data_1NJI
# 
_entry.id   1NJI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NJI         
NDB   RR0061       
RCSB  RCSB017921   
WWPDB D_1000017921 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1K73 'Anisomycin bound to 50S subunit'                       unspecified 
PDB 1KC8 'Blasticidin S bound to 50S subunit'                    unspecified 
PDB 1N8R 'Virginiamycin M bound to 50S subunit'                  unspecified 
PDB 1M90 'Sparsomycin and P-site substrate bound to 50S subunit' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NJI 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hansen, J.L.' 1 
'Moore, P.B.'  2 
'Steitz, T.A.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of 
the Large Ribosomal Subunit
;
J.Mol.Biol. 330 1061 1075 2003 JMOBAK UK 0022-2836 0070 ? 12860128 '10.1016/S0022-2836(03)00668-5' 
1       'The complete atomic structure of the large ribosomal subunit at 2.4 A resolution'                        Science     289 
905  920  2000 SCIEAS US 0036-8075 0038 ? ?        10.1126/science.289.5481.905    
2       'The structural basis of ribosome activity in peptide bond synthesis'                                     Science     289 
920  930  2000 SCIEAS US 0036-8075 0038 ? ?        10.1126/science.289.5481.920    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hansen, J.'   1  
primary 'Moore, P.B.'  2  
primary 'Steitz, T.A.' 3  
1       'Ban, N.'      4  
1       'Nissen, P.'   5  
1       'Hansen, J.'   6  
1       'Moore, P.B.'  7  
1       'Steitz, T.A.' 8  
2       'Nissen, P.'   9  
2       'Hansen, J.'   10 
2       'Ban, N.'      11 
2       'Moore, P.B.'  12 
2       'Steitz, T.A.' 13 
# 
_cell.entry_id           1NJI 
_cell.length_a           211.720 
_cell.length_b           299.750 
_cell.length_c           573.430 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NJI 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S ribosomal RNA'                   946034.375 1    ? ?                       ? ? 
2  polymer     nat '5S ribosomal RNA'                    39318.414  1    ? ?                       ? ? 
3  polymer     nat '50S ribosomal protein L2P'           25237.475  1    ? ?                       ? ? 
4  polymer     nat '50S ribosomal protein L3P'           37265.195  1    ? 'R310P, 311F insertion' ? ? 
5  polymer     nat '50S ribosomal protein L4E'           26442.098  1    ? ?                       ? ? 
6  polymer     nat '50S ribosomal protein L5P'           19420.498  1    ? ?                       ? ? 
7  polymer     nat '50S ribosomal protein L6P'           19830.523  1    ? ?                       ? ? 
8  polymer     nat '50S ribosomal protein L7Ae'          12600.822  1    ? ?                       ? ? 
9  polymer     nat 'Acidic ribosomal protein P0 homolog' 37213.805  1    ? ?                       ? ? 
10 polymer     nat '50S ribosomal protein L10e'          18022.527  1    ? ?                       ? ? 
11 polymer     nat '50S ribosomal protein L13P'          16249.214  1    ? ?                       ? ? 
12 polymer     nat '50S ribosomal protein L14P'          14216.233  1    ? ?                       ? ? 
13 polymer     nat '50S ribosomal protein L15P'          17874.172  1    ? ?                       ? ? 
14 polymer     nat '50S ribosomal protein L15E'          22856.566  1    ? ?                       ? ? 
15 polymer     nat '50S ribosomal protein L18P'          20509.740  1    ? ?                       ? ? 
16 polymer     nat '50S ribosomal protein L18E'          12307.720  1    ? ?                       ? ? 
17 polymer     nat '50S ribosomal protein L19E'          16631.322  1    ? ?                       ? ? 
18 polymer     nat '50S ribosomal protein L21e'          10436.604  1    ? ?                       ? ? 
19 polymer     nat '50S ribosomal protein L22P'          16835.746  1    ? ?                       ? ? 
20 polymer     nat '50S ribosomal protein L23P'          9481.340   1    ? ?                       ? ? 
21 polymer     nat '50S ribosomal protein L24P'          13539.759  1    ? ?                       ? ? 
22 polymer     nat '50S ribosomal protein L24E'          7233.720   1    ? ?                       ? ? 
23 polymer     nat '50S ribosomal protein L29P'          7758.667   1    ? ?                       ? ? 
24 polymer     nat '50S ribosomal protein L30P'          17062.885  1    ? ?                       ? ? 
25 polymer     nat '50S ribosomal protein L31E'          10253.417  1    ? ?                       ? ? 
26 polymer     nat '50S ribosomal protein L32E'          26324.531  1    ? ?                       ? ? 
27 polymer     nat '50S ribosomal protein L37AE'         8097.830   1    ? ?                       ? ? 
28 polymer     nat '50S ribosomal protein L37e'          6199.007   1    ? ?                       ? ? 
29 polymer     nat '50S ribosomal protein L39e'          5844.700   1    ? ?                       ? ? 
30 polymer     nat '50S ribosomal protein L44E'          10815.245  1    ? ?                       ? ? 
31 non-polymer syn 'MAGNESIUM ION'                       24.305     117  ? ?                       ? ? 
32 non-polymer syn 'POTASSIUM ION'                       39.098     2    ? ?                       ? ? 
33 non-polymer syn 'SODIUM ION'                          22.990     85   ? ?                       ? ? 
34 non-polymer syn 'CHLORIDE ION'                        35.453     22   ? ?                       ? ? 
35 non-polymer syn CHLORAMPHENICOL                       323.129    1    ? ?                       ? ? 
36 non-polymer syn 'CADMIUM ION'                         112.411    5    ? ?                       ? ? 
37 water       nat water                                 18.015     7867 ? ?                       ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3  'Hmal2, HL4'         
4  'Hmal3, HL1'         
5  'Hmal4, HL6'         
6  'Hmal5, HL13'        
7  'Hmal6, HL10'        
8  HS6                  
9  'L10E, HMaL10'       
11 Hmal13               
12 'Hmal14, HL27'       
13 'Hmal15, HL9'        
15 'Hmal18, HL12'       
16 'HL29, L19'          
17 'Hmal19, HL24'       
18 HL31                 
19 'Hmal22, HL23'       
20 'Hmal23, HL25, L21'  
21 'Hmal24, HL16, HL15' 
22 HL21/HL22            
23 'Hmal29, HL33'       
24 'Hmal30, HL20, HL16' 
25 'L34, HL30'          
26 HL5                  
28 L35e                 
29 'HL39e, HL46e'       
30 'LA, HLA'            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no no 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
A ? 
2  polyribonucleotide no no 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
B ? 
3  'polypeptide(L)'   no no 
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
C ? 
4  'polypeptide(L)'   no no 
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
D ? 
5  'polypeptide(L)'   no no 
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
E ? 
6  'polypeptide(L)'   no no 
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
F ? 
7  'polypeptide(L)'   no no 
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
G ? 
8  'polypeptide(L)'   no no 
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
H ? 
9  'polypeptide(L)'   no no 
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
I ? 
10 'polypeptide(L)'   no no 
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
J ? 
11 'polypeptide(L)'   no no 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
K ? 
12 'polypeptide(L)'   no no 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
L ? 
13 'polypeptide(L)'   no no 
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
M ? 
14 'polypeptide(L)'   no no 
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
N ? 
15 'polypeptide(L)'   no no 
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
O ? 
16 'polypeptide(L)'   no no 
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
P ? 
17 'polypeptide(L)'   no no 
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
Q ? 
18 'polypeptide(L)'   no no 
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
R ? 
19 'polypeptide(L)'   no no 
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
S ? 
20 'polypeptide(L)'   no no 
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
T ? 
21 'polypeptide(L)'   no no 
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
U ? 
22 'polypeptide(L)'   no no PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA V ? 
23 'polypeptide(L)'   no no TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE W ? 
24 'polypeptide(L)'   no no 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
X ? 
25 'polypeptide(L)'   no no 
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
Y ? 
26 'polypeptide(L)'   no no 
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
Z ? 
27 'polypeptide(L)'   no no RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 1 ? 
28 'polypeptide(L)'   no no TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 2 ? 
29 'polypeptide(L)'   no no GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE 3 ? 
30 'polypeptide(L)'   no no 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
4 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  A   n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 U   n 
1  2587 G   n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 U   n 
1  2619 U   n 
1  2620 U   n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    GLY n 
3  2    ARG n 
3  3    ARG n 
3  4    ILE n 
3  5    GLN n 
3  6    GLY n 
3  7    GLN n 
3  8    ARG n 
3  9    ARG n 
3  10   GLY n 
3  11   ARG n 
3  12   GLY n 
3  13   THR n 
3  14   SER n 
3  15   THR n 
3  16   PHE n 
3  17   ARG n 
3  18   ALA n 
3  19   PRO n 
3  20   SER n 
3  21   HIS n 
3  22   ARG n 
3  23   TYR n 
3  24   LYS n 
3  25   ALA n 
3  26   ASP n 
3  27   LEU n 
3  28   GLU n 
3  29   HIS n 
3  30   ARG n 
3  31   LYS n 
3  32   VAL n 
3  33   GLU n 
3  34   ASP n 
3  35   GLY n 
3  36   ASP n 
3  37   VAL n 
3  38   ILE n 
3  39   ALA n 
3  40   GLY n 
3  41   THR n 
3  42   VAL n 
3  43   VAL n 
3  44   ASP n 
3  45   ILE n 
3  46   GLU n 
3  47   HIS n 
3  48   ASP n 
3  49   PRO n 
3  50   ALA n 
3  51   ARG n 
3  52   SER n 
3  53   ALA n 
3  54   PRO n 
3  55   VAL n 
3  56   ALA n 
3  57   ALA n 
3  58   VAL n 
3  59   GLU n 
3  60   PHE n 
3  61   GLU n 
3  62   ASP n 
3  63   GLY n 
3  64   ASP n 
3  65   ARG n 
3  66   ARG n 
3  67   LEU n 
3  68   ILE n 
3  69   LEU n 
3  70   ALA n 
3  71   PRO n 
3  72   GLU n 
3  73   GLY n 
3  74   VAL n 
3  75   GLY n 
3  76   VAL n 
3  77   GLY n 
3  78   ASP n 
3  79   GLU n 
3  80   LEU n 
3  81   GLN n 
3  82   VAL n 
3  83   GLY n 
3  84   VAL n 
3  85   ASP n 
3  86   ALA n 
3  87   GLU n 
3  88   ILE n 
3  89   ALA n 
3  90   PRO n 
3  91   GLY n 
3  92   ASN n 
3  93   THR n 
3  94   LEU n 
3  95   PRO n 
3  96   LEU n 
3  97   ALA n 
3  98   GLU n 
3  99   ILE n 
3  100  PRO n 
3  101  GLU n 
3  102  GLY n 
3  103  VAL n 
3  104  PRO n 
3  105  VAL n 
3  106  CYS n 
3  107  ASN n 
3  108  VAL n 
3  109  GLU n 
3  110  SER n 
3  111  SER n 
3  112  PRO n 
3  113  GLY n 
3  114  ASP n 
3  115  GLY n 
3  116  GLY n 
3  117  LYS n 
3  118  PHE n 
3  119  ALA n 
3  120  ARG n 
3  121  ALA n 
3  122  SER n 
3  123  GLY n 
3  124  VAL n 
3  125  ASN n 
3  126  ALA n 
3  127  GLN n 
3  128  LEU n 
3  129  LEU n 
3  130  THR n 
3  131  HIS n 
3  132  ASP n 
3  133  ARG n 
3  134  ASN n 
3  135  VAL n 
3  136  ALA n 
3  137  VAL n 
3  138  VAL n 
3  139  LYS n 
3  140  LEU n 
3  141  PRO n 
3  142  SER n 
3  143  GLY n 
3  144  GLU n 
3  145  MET n 
3  146  LYS n 
3  147  ARG n 
3  148  LEU n 
3  149  ASP n 
3  150  PRO n 
3  151  GLN n 
3  152  CYS n 
3  153  ARG n 
3  154  ALA n 
3  155  THR n 
3  156  ILE n 
3  157  GLY n 
3  158  VAL n 
3  159  VAL n 
3  160  GLY n 
3  161  GLY n 
3  162  GLY n 
3  163  GLY n 
3  164  ARG n 
3  165  THR n 
3  166  ASP n 
3  167  LYS n 
3  168  PRO n 
3  169  PHE n 
3  170  VAL n 
3  171  LYS n 
3  172  ALA n 
3  173  GLY n 
3  174  ASN n 
3  175  LYS n 
3  176  HIS n 
3  177  HIS n 
3  178  LYS n 
3  179  MET n 
3  180  LYS n 
3  181  ALA n 
3  182  ARG n 
3  183  GLY n 
3  184  THR n 
3  185  LYS n 
3  186  TRP n 
3  187  PRO n 
3  188  ASN n 
3  189  VAL n 
3  190  ARG n 
3  191  GLY n 
3  192  VAL n 
3  193  ALA n 
3  194  MET n 
3  195  ASN n 
3  196  ALA n 
3  197  VAL n 
3  198  ASP n 
3  199  HIS n 
3  200  PRO n 
3  201  PHE n 
3  202  GLY n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  ARG n 
3  207  GLN n 
3  208  HIS n 
3  209  PRO n 
3  210  GLY n 
3  211  LYS n 
3  212  PRO n 
3  213  LYS n 
3  214  SER n 
3  215  ILE n 
3  216  SER n 
3  217  ARG n 
3  218  ASN n 
3  219  ALA n 
3  220  PRO n 
3  221  PRO n 
3  222  GLY n 
3  223  ARG n 
3  224  LYS n 
3  225  VAL n 
3  226  GLY n 
3  227  ASP n 
3  228  ILE n 
3  229  ALA n 
3  230  SER n 
3  231  LYS n 
3  232  ARG n 
3  233  THR n 
3  234  GLY n 
3  235  ARG n 
3  236  GLY n 
3  237  GLY n 
3  238  ASN n 
3  239  GLU n 
4  1    PRO n 
4  2    GLN n 
4  3    PRO n 
4  4    SER n 
4  5    ARG n 
4  6    PRO n 
4  7    ARG n 
4  8    LYS n 
4  9    GLY n 
4  10   SER n 
4  11   LEU n 
4  12   GLY n 
4  13   PHE n 
4  14   GLY n 
4  15   PRO n 
4  16   ARG n 
4  17   LYS n 
4  18   ARG n 
4  19   SER n 
4  20   THR n 
4  21   SER n 
4  22   GLU n 
4  23   THR n 
4  24   PRO n 
4  25   ARG n 
4  26   PHE n 
4  27   ASN n 
4  28   SER n 
4  29   TRP n 
4  30   PRO n 
4  31   SER n 
4  32   ASP n 
4  33   ASP n 
4  34   GLY n 
4  35   GLN n 
4  36   PRO n 
4  37   GLY n 
4  38   VAL n 
4  39   GLN n 
4  40   GLY n 
4  41   PHE n 
4  42   ALA n 
4  43   GLY n 
4  44   TYR n 
4  45   LYS n 
4  46   ALA n 
4  47   GLY n 
4  48   MET n 
4  49   THR n 
4  50   HIS n 
4  51   VAL n 
4  52   VAL n 
4  53   LEU n 
4  54   VAL n 
4  55   ASN n 
4  56   ASP n 
4  57   GLU n 
4  58   PRO n 
4  59   ASN n 
4  60   SER n 
4  61   PRO n 
4  62   ARG n 
4  63   GLU n 
4  64   GLY n 
4  65   MET n 
4  66   GLU n 
4  67   GLU n 
4  68   THR n 
4  69   VAL n 
4  70   PRO n 
4  71   VAL n 
4  72   THR n 
4  73   VAL n 
4  74   ILE n 
4  75   GLU n 
4  76   THR n 
4  77   PRO n 
4  78   PRO n 
4  79   MET n 
4  80   ARG n 
4  81   ALA n 
4  82   VAL n 
4  83   ALA n 
4  84   LEU n 
4  85   ARG n 
4  86   ALA n 
4  87   TYR n 
4  88   GLU n 
4  89   ASP n 
4  90   THR n 
4  91   PRO n 
4  92   TYR n 
4  93   GLY n 
4  94   GLN n 
4  95   ARG n 
4  96   PRO n 
4  97   LEU n 
4  98   THR n 
4  99   GLU n 
4  100  VAL n 
4  101  TRP n 
4  102  THR n 
4  103  ASP n 
4  104  GLU n 
4  105  PHE n 
4  106  HIS n 
4  107  SER n 
4  108  GLU n 
4  109  LEU n 
4  110  ASP n 
4  111  ARG n 
4  112  THR n 
4  113  LEU n 
4  114  ASP n 
4  115  VAL n 
4  116  PRO n 
4  117  GLU n 
4  118  ASP n 
4  119  HIS n 
4  120  ASP n 
4  121  PRO n 
4  122  ASP n 
4  123  ALA n 
4  124  ALA n 
4  125  GLU n 
4  126  GLU n 
4  127  GLN n 
4  128  ILE n 
4  129  ARG n 
4  130  ASP n 
4  131  ALA n 
4  132  HIS n 
4  133  GLU n 
4  134  ALA n 
4  135  GLY n 
4  136  ASP n 
4  137  LEU n 
4  138  GLY n 
4  139  ASP n 
4  140  LEU n 
4  141  ARG n 
4  142  LEU n 
4  143  ILE n 
4  144  THR n 
4  145  HIS n 
4  146  THR n 
4  147  VAL n 
4  148  PRO n 
4  149  ASP n 
4  150  ALA n 
4  151  VAL n 
4  152  PRO n 
4  153  SER n 
4  154  VAL n 
4  155  PRO n 
4  156  LYS n 
4  157  LYS n 
4  158  LYS n 
4  159  PRO n 
4  160  ASP n 
4  161  VAL n 
4  162  MET n 
4  163  GLU n 
4  164  THR n 
4  165  ARG n 
4  166  VAL n 
4  167  GLY n 
4  168  GLY n 
4  169  GLY n 
4  170  SER n 
4  171  VAL n 
4  172  SER n 
4  173  ASP n 
4  174  ARG n 
4  175  LEU n 
4  176  ASP n 
4  177  HIS n 
4  178  ALA n 
4  179  LEU n 
4  180  ASP n 
4  181  ILE n 
4  182  VAL n 
4  183  GLU n 
4  184  ASP n 
4  185  GLY n 
4  186  GLY n 
4  187  GLU n 
4  188  HIS n 
4  189  ALA n 
4  190  MET n 
4  191  ASN n 
4  192  ASP n 
4  193  ILE n 
4  194  PHE n 
4  195  ARG n 
4  196  ALA n 
4  197  GLY n 
4  198  GLU n 
4  199  TYR n 
4  200  ALA n 
4  201  ASP n 
4  202  VAL n 
4  203  ALA n 
4  204  GLY n 
4  205  VAL n 
4  206  THR n 
4  207  LYS n 
4  208  GLY n 
4  209  LYS n 
4  210  GLY n 
4  211  THR n 
4  212  GLN n 
4  213  GLY n 
4  214  PRO n 
4  215  VAL n 
4  216  LYS n 
4  217  ARG n 
4  218  TRP n 
4  219  GLY n 
4  220  VAL n 
4  221  GLN n 
4  222  LYS n 
4  223  ARG n 
4  224  LYS n 
4  225  GLY n 
4  226  LYS n 
4  227  HIS n 
4  228  ALA n 
4  229  ARG n 
4  230  GLN n 
4  231  GLY n 
4  232  TRP n 
4  233  ARG n 
4  234  ARG n 
4  235  ARG n 
4  236  ILE n 
4  237  GLY n 
4  238  ASN n 
4  239  LEU n 
4  240  GLY n 
4  241  PRO n 
4  242  TRP n 
4  243  ASN n 
4  244  PRO n 
4  245  SER n 
4  246  ARG n 
4  247  VAL n 
4  248  ARG n 
4  249  SER n 
4  250  THR n 
4  251  VAL n 
4  252  PRO n 
4  253  GLN n 
4  254  GLN n 
4  255  GLY n 
4  256  GLN n 
4  257  THR n 
4  258  GLY n 
4  259  TYR n 
4  260  HIS n 
4  261  GLN n 
4  262  ARG n 
4  263  THR n 
4  264  GLU n 
4  265  LEU n 
4  266  ASN n 
4  267  LYS n 
4  268  ARG n 
4  269  LEU n 
4  270  ILE n 
4  271  ASP n 
4  272  ILE n 
4  273  GLY n 
4  274  GLU n 
4  275  GLY n 
4  276  ASP n 
4  277  GLU n 
4  278  PRO n 
4  279  THR n 
4  280  VAL n 
4  281  ASP n 
4  282  GLY n 
4  283  GLY n 
4  284  PHE n 
4  285  VAL n 
4  286  ASN n 
4  287  TYR n 
4  288  GLY n 
4  289  GLU n 
4  290  VAL n 
4  291  ASP n 
4  292  GLY n 
4  293  PRO n 
4  294  TYR n 
4  295  THR n 
4  296  LEU n 
4  297  VAL n 
4  298  LYS n 
4  299  GLY n 
4  300  SER n 
4  301  VAL n 
4  302  PRO n 
4  303  GLY n 
4  304  PRO n 
4  305  ASP n 
4  306  LYS n 
4  307  ARG n 
4  308  LEU n 
4  309  VAL n 
4  310  ARG n 
4  311  PHE n 
4  312  ARG n 
4  313  PRO n 
4  314  ALA n 
4  315  VAL n 
4  316  ARG n 
4  317  PRO n 
4  318  ASN n 
4  319  ASP n 
4  320  GLN n 
4  321  PRO n 
4  322  ARG n 
4  323  LEU n 
4  324  ASP n 
4  325  PRO n 
4  326  GLU n 
4  327  VAL n 
4  328  ARG n 
4  329  TYR n 
4  330  VAL n 
4  331  SER n 
4  332  ASN n 
4  333  GLU n 
4  334  SER n 
4  335  ASN n 
4  336  GLN n 
4  337  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    SER n 
6  2    SER n 
6  3    GLU n 
6  4    SER n 
6  5    GLU n 
6  6    SER n 
6  7    GLY n 
6  8    GLY n 
6  9    ASP n 
6  10   PHE n 
6  11   HIS n 
6  12   GLU n 
6  13   MET n 
6  14   ARG n 
6  15   GLU n 
6  16   PRO n 
6  17   ARG n 
6  18   ILE n 
6  19   GLU n 
6  20   LYS n 
6  21   VAL n 
6  22   VAL n 
6  23   VAL n 
6  24   HIS n 
6  25   MET n 
6  26   GLY n 
6  27   ILE n 
6  28   GLY n 
6  29   HIS n 
6  30   GLY n 
6  31   GLY n 
6  32   ARG n 
6  33   ASP n 
6  34   LEU n 
6  35   ALA n 
6  36   ASN n 
6  37   ALA n 
6  38   GLU n 
6  39   ASP n 
6  40   ILE n 
6  41   LEU n 
6  42   GLY n 
6  43   GLU n 
6  44   ILE n 
6  45   THR n 
6  46   GLY n 
6  47   GLN n 
6  48   MET n 
6  49   PRO n 
6  50   VAL n 
6  51   ARG n 
6  52   THR n 
6  53   LYS n 
6  54   ALA n 
6  55   LYS n 
6  56   ARG n 
6  57   THR n 
6  58   VAL n 
6  59   GLY n 
6  60   GLU n 
6  61   PHE n 
6  62   ASP n 
6  63   ILE n 
6  64   ARG n 
6  65   GLU n 
6  66   GLY n 
6  67   ASP n 
6  68   PRO n 
6  69   ILE n 
6  70   GLY n 
6  71   ALA n 
6  72   LYS n 
6  73   VAL n 
6  74   THR n 
6  75   LEU n 
6  76   ARG n 
6  77   ASP n 
6  78   GLU n 
6  79   MET n 
6  80   ALA n 
6  81   GLU n 
6  82   GLU n 
6  83   PHE n 
6  84   LEU n 
6  85   GLN n 
6  86   THR n 
6  87   ALA n 
6  88   LEU n 
6  89   PRO n 
6  90   LEU n 
6  91   ALA n 
6  92   GLU n 
6  93   LEU n 
6  94   ALA n 
6  95   THR n 
6  96   SER n 
6  97   GLN n 
6  98   PHE n 
6  99   ASP n 
6  100  ASP n 
6  101  THR n 
6  102  GLY n 
6  103  ASN n 
6  104  PHE n 
6  105  SER n 
6  106  PHE n 
6  107  GLY n 
6  108  VAL n 
6  109  GLU n 
6  110  GLU n 
6  111  HIS n 
6  112  THR n 
6  113  GLU n 
6  114  PHE n 
6  115  PRO n 
6  116  SER n 
6  117  GLN n 
6  118  GLU n 
6  119  TYR n 
6  120  ASP n 
6  121  PRO n 
6  122  SER n 
6  123  ILE n 
6  124  GLY n 
6  125  ILE n 
6  126  TYR n 
6  127  GLY n 
6  128  LEU n 
6  129  ASP n 
6  130  VAL n 
6  131  THR n 
6  132  VAL n 
6  133  ASN n 
6  134  LEU n 
6  135  VAL n 
6  136  ARG n 
6  137  PRO n 
6  138  GLY n 
6  139  TYR n 
6  140  ARG n 
6  141  VAL n 
6  142  ALA n 
6  143  LYS n 
6  144  ARG n 
6  145  ASP n 
6  146  LYS n 
6  147  ALA n 
6  148  SER n 
6  149  ARG n 
6  150  SER n 
6  151  ILE n 
6  152  PRO n 
6  153  THR n 
6  154  LYS n 
6  155  HIS n 
6  156  ARG n 
6  157  LEU n 
6  158  ASN n 
6  159  PRO n 
6  160  ALA n 
6  161  ASP n 
6  162  ALA n 
6  163  VAL n 
6  164  ALA n 
6  165  PHE n 
6  166  ILE n 
6  167  GLU n 
6  168  SER n 
6  169  THR n 
6  170  TYR n 
6  171  ASP n 
6  172  VAL n 
6  173  GLU n 
6  174  VAL n 
6  175  SER n 
6  176  GLU n 
7  1    PRO n 
7  2    ARG n 
7  3    VAL n 
7  4    GLU n 
7  5    LEU n 
7  6    GLU n 
7  7    ILE n 
7  8    PRO n 
7  9    GLU n 
7  10   ASP n 
7  11   VAL n 
7  12   ASP n 
7  13   ALA n 
7  14   GLU n 
7  15   GLN n 
7  16   ASP n 
7  17   HIS n 
7  18   LEU n 
7  19   ASP n 
7  20   ILE n 
7  21   THR n 
7  22   VAL n 
7  23   GLU n 
7  24   GLY n 
7  25   ASP n 
7  26   ASN n 
7  27   GLY n 
7  28   SER n 
7  29   VAL n 
7  30   THR n 
7  31   ARG n 
7  32   ARG n 
7  33   LEU n 
7  34   TRP n 
7  35   TYR n 
7  36   PRO n 
7  37   ASP n 
7  38   ILE n 
7  39   ASP n 
7  40   VAL n 
7  41   SER n 
7  42   VAL n 
7  43   ASP n 
7  44   GLY n 
7  45   ASP n 
7  46   THR n 
7  47   VAL n 
7  48   VAL n 
7  49   ILE n 
7  50   GLU n 
7  51   SER n 
7  52   ASP n 
7  53   GLU n 
7  54   ASP n 
7  55   ASN n 
7  56   ALA n 
7  57   LYS n 
7  58   THR n 
7  59   MET n 
7  60   SER n 
7  61   THR n 
7  62   ILE n 
7  63   GLY n 
7  64   THR n 
7  65   PHE n 
7  66   GLN n 
7  67   SER n 
7  68   HIS n 
7  69   ILE n 
7  70   GLU n 
7  71   ASN n 
7  72   MET n 
7  73   PHE n 
7  74   HIS n 
7  75   GLY n 
7  76   VAL n 
7  77   THR n 
7  78   GLU n 
7  79   GLY n 
7  80   TRP n 
7  81   GLU n 
7  82   TYR n 
7  83   GLY n 
7  84   MET n 
7  85   GLU n 
7  86   VAL n 
7  87   PHE n 
7  88   TYR n 
7  89   SER n 
7  90   HIS n 
7  91   PHE n 
7  92   PRO n 
7  93   MET n 
7  94   GLN n 
7  95   VAL n 
7  96   ASN n 
7  97   VAL n 
7  98   GLU n 
7  99   GLY n 
7  100  ASP n 
7  101  GLU n 
7  102  VAL n 
7  103  VAL n 
7  104  ILE n 
7  105  GLU n 
7  106  ASN n 
7  107  PHE n 
7  108  LEU n 
7  109  GLY n 
7  110  GLU n 
7  111  LYS n 
7  112  ALA n 
7  113  PRO n 
7  114  ARG n 
7  115  ARG n 
7  116  THR n 
7  117  THR n 
7  118  ILE n 
7  119  HIS n 
7  120  GLY n 
7  121  ASP n 
7  122  THR n 
7  123  ASP n 
7  124  VAL n 
7  125  GLU n 
7  126  ILE n 
7  127  ASP n 
7  128  GLY n 
7  129  GLU n 
7  130  GLU n 
7  131  LEU n 
7  132  THR n 
7  133  VAL n 
7  134  SER n 
7  135  GLY n 
7  136  PRO n 
7  137  ASP n 
7  138  ILE n 
7  139  GLU n 
7  140  ALA n 
7  141  VAL n 
7  142  GLY n 
7  143  GLN n 
7  144  THR n 
7  145  ALA n 
7  146  ALA n 
7  147  ASP n 
7  148  ILE n 
7  149  GLU n 
7  150  GLN n 
7  151  LEU n 
7  152  THR n 
7  153  ARG n 
7  154  ILE n 
7  155  ASN n 
7  156  ASP n 
7  157  LYS n 
7  158  ASP n 
7  159  VAL n 
7  160  ARG n 
7  161  VAL n 
7  162  PHE n 
7  163  GLN n 
7  164  ASP n 
7  165  GLY n 
7  166  VAL n 
7  167  TYR n 
7  168  ILE n 
7  169  THR n 
7  170  ARG n 
7  171  LYS n 
7  172  PRO n 
7  173  ASN n 
7  174  ARG n 
7  175  GLY n 
7  176  ASP n 
7  177  ALA n 
8  1    PRO n 
8  2    VAL n 
8  3    TYR n 
8  4    VAL n 
8  5    ASP n 
8  6    PHE n 
8  7    ASP n 
8  8    VAL n 
8  9    PRO n 
8  10   ALA n 
8  11   ASP n 
8  12   LEU n 
8  13   GLU n 
8  14   ASP n 
8  15   ASP n 
8  16   ALA n 
8  17   LEU n 
8  18   GLU n 
8  19   ALA n 
8  20   LEU n 
8  21   GLU n 
8  22   VAL n 
8  23   ALA n 
8  24   ARG n 
8  25   ASP n 
8  26   THR n 
8  27   GLY n 
8  28   ALA n 
8  29   VAL n 
8  30   LYS n 
8  31   LYS n 
8  32   GLY n 
8  33   THR n 
8  34   ASN n 
8  35   GLU n 
8  36   THR n 
8  37   THR n 
8  38   LYS n 
8  39   SER n 
8  40   ILE n 
8  41   GLU n 
8  42   ARG n 
8  43   GLY n 
8  44   SER n 
8  45   ALA n 
8  46   GLU n 
8  47   LEU n 
8  48   VAL n 
8  49   PHE n 
8  50   VAL n 
8  51   ALA n 
8  52   GLU n 
8  53   ASP n 
8  54   VAL n 
8  55   GLN n 
8  56   PRO n 
8  57   GLU n 
8  58   GLU n 
8  59   ILE n 
8  60   VAL n 
8  61   MET n 
8  62   HIS n 
8  63   ILE n 
8  64   PRO n 
8  65   GLU n 
8  66   LEU n 
8  67   ALA n 
8  68   ASP n 
8  69   GLU n 
8  70   LYS n 
8  71   GLY n 
8  72   VAL n 
8  73   PRO n 
8  74   PHE n 
8  75   ILE n 
8  76   PHE n 
8  77   VAL n 
8  78   GLU n 
8  79   GLN n 
8  80   GLN n 
8  81   ASP n 
8  82   ASP n 
8  83   LEU n 
8  84   GLY n 
8  85   HIS n 
8  86   ALA n 
8  87   ALA n 
8  88   GLY n 
8  89   LEU n 
8  90   GLU n 
8  91   VAL n 
8  92   GLY n 
8  93   SER n 
8  94   ALA n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   VAL n 
8  99   THR n 
8  100  ASP n 
8  101  ALA n 
8  102  GLY n 
8  103  ALA n 
8  104  ALA n 
8  105  ALA n 
8  106  THR n 
8  107  VAL n 
8  108  LEU n 
8  109  GLU n 
8  110  GLU n 
8  111  ILE n 
8  112  ALA n 
8  113  ASP n 
8  114  LYS n 
8  115  VAL n 
8  116  GLU n 
8  117  GLU n 
8  118  LEU n 
8  119  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    LYS n 
10 2    PRO n 
10 3    GLY n 
10 4    ALA n 
10 5    MET n 
10 6    TYR n 
10 7    ARG n 
10 8    ASN n 
10 9    SER n 
10 10   SER n 
10 11   LYS n 
10 12   PRO n 
10 13   ALA n 
10 14   TYR n 
10 15   THR n 
10 16   ARG n 
10 17   ARG n 
10 18   GLU n 
10 19   TYR n 
10 20   ILE n 
10 21   SER n 
10 22   GLY n 
10 23   ILE n 
10 24   PRO n 
10 25   GLY n 
10 26   LYS n 
10 27   LYS n 
10 28   ILE n 
10 29   ALA n 
10 30   GLN n 
10 31   PHE n 
10 32   ASP n 
10 33   MET n 
10 34   GLY n 
10 35   ASN n 
10 36   ASN n 
10 37   GLY n 
10 38   ALA n 
10 39   GLY n 
10 40   PRO n 
10 41   THR n 
10 42   TYR n 
10 43   PRO n 
10 44   ALA n 
10 45   GLN n 
10 46   VAL n 
10 47   GLU n 
10 48   LEU n 
10 49   VAL n 
10 50   VAL n 
10 51   GLU n 
10 52   LYS n 
10 53   PRO n 
10 54   VAL n 
10 55   GLN n 
10 56   ILE n 
10 57   ARG n 
10 58   HIS n 
10 59   ASN n 
10 60   ALA n 
10 61   LEU n 
10 62   GLU n 
10 63   ALA n 
10 64   ALA n 
10 65   ARG n 
10 66   VAL n 
10 67   ALA n 
10 68   ALA n 
10 69   ASN n 
10 70   ARG n 
10 71   TYR n 
10 72   VAL n 
10 73   GLN n 
10 74   ASN n 
10 75   SER n 
10 76   GLY n 
10 77   ALA n 
10 78   ALA n 
10 79   ALA n 
10 80   ASN n 
10 81   TYR n 
10 82   LYS n 
10 83   PHE n 
10 84   ARG n 
10 85   ILE n 
10 86   ARG n 
10 87   LYS n 
10 88   PHE n 
10 89   PRO n 
10 90   PHE n 
10 91   HIS n 
10 92   VAL n 
10 93   ILE n 
10 94   ARG n 
10 95   GLU n 
10 96   ASN n 
10 97   LYS n 
10 98   ALA n 
10 99   ALA n 
10 100  ALA n 
10 101  ALA n 
10 102  ALA n 
10 103  ALA n 
10 104  ALA n 
10 105  ALA n 
10 106  ALA n 
10 107  ALA n 
10 108  ALA n 
10 109  ASP n 
10 110  GLY n 
10 111  MET n 
10 112  ARG n 
10 113  ALA n 
10 114  PRO n 
10 115  PHE n 
10 116  GLY n 
10 117  LYS n 
10 118  PRO n 
10 119  VAL n 
10 120  GLY n 
10 121  THR n 
10 122  ALA n 
10 123  ALA n 
10 124  ARG n 
10 125  VAL n 
10 126  HIS n 
10 127  GLY n 
10 128  ALA n 
10 129  ASN n 
10 130  HIS n 
10 131  ILE n 
10 132  PHE n 
10 133  ILE n 
10 134  ALA n 
10 135  TRP n 
10 136  VAL n 
10 137  ASN n 
10 138  PRO n 
10 139  ASP n 
10 140  PRO n 
10 141  ASN n 
10 142  VAL n 
10 143  GLU n 
10 144  GLU n 
10 145  ALA n 
10 146  TRP n 
10 147  ARG n 
10 148  ARG n 
10 149  ALA n 
10 150  LYS n 
10 151  MET n 
10 152  LYS n 
10 153  VAL n 
10 154  THR n 
10 155  PRO n 
10 156  THR n 
10 157  ILE n 
10 158  ASN n 
10 159  ILE n 
10 160  ASP n 
10 161  SER n 
10 162  SER n 
10 163  PRO n 
10 164  ALA n 
10 165  GLY n 
10 166  ASN n 
10 167  ALA n 
11 1    MET n 
11 2    SER n 
11 3    VAL n 
11 4    ALA n 
11 5    GLU n 
11 6    PHE n 
11 7    ASP n 
11 8    ALA n 
11 9    ASP n 
11 10   VAL n 
11 11   ILE n 
11 12   VAL n 
11 13   ASP n 
11 14   ALA n 
11 15   ARG n 
11 16   ASP n 
11 17   CYS n 
11 18   ILE n 
11 19   MET n 
11 20   GLY n 
11 21   ARG n 
11 22   VAL n 
11 23   ALA n 
11 24   SER n 
11 25   GLN n 
11 26   VAL n 
11 27   ALA n 
11 28   GLU n 
11 29   GLN n 
11 30   ALA n 
11 31   LEU n 
11 32   ASP n 
11 33   GLY n 
11 34   GLU n 
11 35   THR n 
11 36   VAL n 
11 37   ALA n 
11 38   VAL n 
11 39   VAL n 
11 40   ASN n 
11 41   ALA n 
11 42   GLU n 
11 43   ARG n 
11 44   ALA n 
11 45   VAL n 
11 46   ILE n 
11 47   THR n 
11 48   GLY n 
11 49   ARG n 
11 50   GLU n 
11 51   GLU n 
11 52   GLN n 
11 53   ILE n 
11 54   VAL n 
11 55   GLU n 
11 56   LYS n 
11 57   TYR n 
11 58   GLU n 
11 59   LYS n 
11 60   ARG n 
11 61   VAL n 
11 62   ASP n 
11 63   ILE n 
11 64   GLY n 
11 65   ASN n 
11 66   ASP n 
11 67   ASN n 
11 68   GLY n 
11 69   TYR n 
11 70   PHE n 
11 71   TYR n 
11 72   PRO n 
11 73   LYS n 
11 74   ARG n 
11 75   PRO n 
11 76   ASP n 
11 77   GLY n 
11 78   ILE n 
11 79   PHE n 
11 80   LYS n 
11 81   ARG n 
11 82   THR n 
11 83   ILE n 
11 84   ARG n 
11 85   GLY n 
11 86   MET n 
11 87   LEU n 
11 88   PRO n 
11 89   HIS n 
11 90   LYS n 
11 91   LYS n 
11 92   GLN n 
11 93   ARG n 
11 94   GLY n 
11 95   ARG n 
11 96   GLU n 
11 97   ALA n 
11 98   PHE n 
11 99   GLU n 
11 100  SER n 
11 101  VAL n 
11 102  ARG n 
11 103  VAL n 
11 104  TYR n 
11 105  LEU n 
11 106  GLY n 
11 107  ASN n 
11 108  PRO n 
11 109  TYR n 
11 110  ASP n 
11 111  GLU n 
11 112  ASP n 
11 113  GLY n 
11 114  GLU n 
11 115  VAL n 
11 116  LEU n 
11 117  ASP n 
11 118  GLY n 
11 119  THR n 
11 120  SER n 
11 121  LEU n 
11 122  ASP n 
11 123  ARG n 
11 124  LEU n 
11 125  SER n 
11 126  ASN n 
11 127  ILE n 
11 128  LYS n 
11 129  PHE n 
11 130  VAL n 
11 131  THR n 
11 132  LEU n 
11 133  GLY n 
11 134  GLU n 
11 135  ILE n 
11 136  SER n 
11 137  GLU n 
11 138  THR n 
11 139  LEU n 
11 140  GLY n 
11 141  ALA n 
11 142  ASN n 
11 143  LYS n 
11 144  THR n 
11 145  TRP n 
12 1    MET n 
12 2    GLU n 
12 3    ALA n 
12 4    LEU n 
12 5    GLY n 
12 6    ALA n 
12 7    ASP n 
12 8    VAL n 
12 9    THR n 
12 10   GLN n 
12 11   GLY n 
12 12   LEU n 
12 13   GLU n 
12 14   LYS n 
12 15   GLY n 
12 16   SER n 
12 17   LEU n 
12 18   ILE n 
12 19   THR n 
12 20   CYS n 
12 21   ALA n 
12 22   ASP n 
12 23   ASN n 
12 24   THR n 
12 25   GLY n 
12 26   ALA n 
12 27   ARG n 
12 28   GLU n 
12 29   LEU n 
12 30   LYS n 
12 31   VAL n 
12 32   ILE n 
12 33   SER n 
12 34   VAL n 
12 35   HIS n 
12 36   GLY n 
12 37   TYR n 
12 38   SER n 
12 39   GLY n 
12 40   THR n 
12 41   LYS n 
12 42   ASN n 
12 43   ARG n 
12 44   HIS n 
12 45   PRO n 
12 46   LYS n 
12 47   ALA n 
12 48   GLY n 
12 49   LEU n 
12 50   GLY n 
12 51   ASP n 
12 52   LYS n 
12 53   ILE n 
12 54   THR n 
12 55   VAL n 
12 56   SER n 
12 57   VAL n 
12 58   THR n 
12 59   LYS n 
12 60   GLY n 
12 61   THR n 
12 62   PRO n 
12 63   GLU n 
12 64   MET n 
12 65   ARG n 
12 66   ARG n 
12 67   GLN n 
12 68   VAL n 
12 69   LEU n 
12 70   GLU n 
12 71   ALA n 
12 72   VAL n 
12 73   VAL n 
12 74   VAL n 
12 75   ARG n 
12 76   GLN n 
12 77   ARG n 
12 78   LYS n 
12 79   PRO n 
12 80   ILE n 
12 81   ARG n 
12 82   ARG n 
12 83   PRO n 
12 84   ASP n 
12 85   GLY n 
12 86   THR n 
12 87   ARG n 
12 88   VAL n 
12 89   LYS n 
12 90   PHE n 
12 91   GLU n 
12 92   ASP n 
12 93   ASN n 
12 94   ALA n 
12 95   ALA n 
12 96   VAL n 
12 97   ILE n 
12 98   VAL n 
12 99   ASP n 
12 100  GLU n 
12 101  ASN n 
12 102  GLU n 
12 103  ASP n 
12 104  PRO n 
12 105  ARG n 
12 106  GLY n 
12 107  THR n 
12 108  GLU n 
12 109  LEU n 
12 110  LYS n 
12 111  GLY n 
12 112  PRO n 
12 113  ILE n 
12 114  ALA n 
12 115  ARG n 
12 116  GLU n 
12 117  VAL n 
12 118  ALA n 
12 119  GLN n 
12 120  ARG n 
12 121  PHE n 
12 122  GLY n 
12 123  SER n 
12 124  VAL n 
12 125  ALA n 
12 126  SER n 
12 127  ALA n 
12 128  ALA n 
12 129  THR n 
12 130  MET n 
12 131  ILE n 
12 132  VAL n 
13 1    THR n 
13 2    SER n 
13 3    LYS n 
13 4    LYS n 
13 5    LYS n 
13 6    ARG n 
13 7    GLN n 
13 8    ARG n 
13 9    GLY n 
13 10   SER n 
13 11   ARG n 
13 12   THR n 
13 13   HIS n 
13 14   GLY n 
13 15   GLY n 
13 16   GLY n 
13 17   SER n 
13 18   HIS n 
13 19   LYS n 
13 20   ASN n 
13 21   ARG n 
13 22   ARG n 
13 23   GLY n 
13 24   ALA n 
13 25   GLY n 
13 26   HIS n 
13 27   ARG n 
13 28   GLY n 
13 29   GLY n 
13 30   ARG n 
13 31   GLY n 
13 32   ASP n 
13 33   ALA n 
13 34   GLY n 
13 35   ARG n 
13 36   ASP n 
13 37   LYS n 
13 38   HIS n 
13 39   GLU n 
13 40   PHE n 
13 41   HIS n 
13 42   ASN n 
13 43   HIS n 
13 44   GLU n 
13 45   PRO n 
13 46   LEU n 
13 47   GLY n 
13 48   LYS n 
13 49   SER n 
13 50   GLY n 
13 51   PHE n 
13 52   LYS n 
13 53   ARG n 
13 54   PRO n 
13 55   GLN n 
13 56   LYS n 
13 57   VAL n 
13 58   GLN n 
13 59   GLU n 
13 60   GLU n 
13 61   ALA n 
13 62   ALA n 
13 63   THR n 
13 64   ILE n 
13 65   ASP n 
13 66   VAL n 
13 67   ARG n 
13 68   GLU n 
13 69   ILE n 
13 70   ASP n 
13 71   GLU n 
13 72   ASN n 
13 73   VAL n 
13 74   THR n 
13 75   LEU n 
13 76   LEU n 
13 77   ALA n 
13 78   ALA n 
13 79   ASP n 
13 80   ASP n 
13 81   VAL n 
13 82   ALA n 
13 83   GLU n 
13 84   VAL n 
13 85   GLU n 
13 86   ASP n 
13 87   GLY n 
13 88   GLY n 
13 89   PHE n 
13 90   ARG n 
13 91   VAL n 
13 92   ASP n 
13 93   VAL n 
13 94   ARG n 
13 95   ASP n 
13 96   VAL n 
13 97   VAL n 
13 98   GLU n 
13 99   GLU n 
13 100  ALA n 
13 101  ASP n 
13 102  ASP n 
13 103  ALA n 
13 104  ASP n 
13 105  TYR n 
13 106  VAL n 
13 107  LYS n 
13 108  VAL n 
13 109  LEU n 
13 110  GLY n 
13 111  ALA n 
13 112  GLY n 
13 113  GLN n 
13 114  VAL n 
13 115  ARG n 
13 116  HIS n 
13 117  GLU n 
13 118  LEU n 
13 119  THR n 
13 120  LEU n 
13 121  ILE n 
13 122  ALA n 
13 123  ASP n 
13 124  ASP n 
13 125  PHE n 
13 126  SER n 
13 127  GLU n 
13 128  GLY n 
13 129  ALA n 
13 130  ARG n 
13 131  GLU n 
13 132  LYS n 
13 133  VAL n 
13 134  GLU n 
13 135  GLY n 
13 136  ALA n 
13 137  GLY n 
13 138  GLY n 
13 139  SER n 
13 140  VAL n 
13 141  GLU n 
13 142  LEU n 
13 143  THR n 
13 144  ASP n 
13 145  LEU n 
13 146  GLY n 
13 147  GLU n 
13 148  GLU n 
13 149  ARG n 
13 150  GLN n 
13 151  ALA n 
13 152  GLU n 
13 153  ALA n 
13 154  GLU n 
13 155  GLU n 
13 156  THR n 
13 157  GLU n 
13 158  ASP n 
13 159  ALA n 
13 160  ASP n 
13 161  ALA n 
13 162  ASP n 
13 163  GLU n 
13 164  GLU n 
14 1    ALA n 
14 2    ARG n 
14 3    SER n 
14 4    ALA n 
14 5    TYR n 
14 6    SER n 
14 7    TYR n 
14 8    ILE n 
14 9    ARG n 
14 10   GLU n 
14 11   ALA n 
14 12   TRP n 
14 13   LYS n 
14 14   ARG n 
14 15   PRO n 
14 16   LYS n 
14 17   GLU n 
14 18   GLY n 
14 19   GLN n 
14 20   ILE n 
14 21   ALA n 
14 22   GLU n 
14 23   LEU n 
14 24   MET n 
14 25   TRP n 
14 26   HIS n 
14 27   ARG n 
14 28   MET n 
14 29   GLN n 
14 30   GLU n 
14 31   TRP n 
14 32   ARG n 
14 33   ASN n 
14 34   GLU n 
14 35   PRO n 
14 36   ALA n 
14 37   VAL n 
14 38   VAL n 
14 39   ARG n 
14 40   ILE n 
14 41   GLU n 
14 42   ARG n 
14 43   PRO n 
14 44   THR n 
14 45   ARG n 
14 46   LEU n 
14 47   ASP n 
14 48   ARG n 
14 49   ALA n 
14 50   ARG n 
14 51   SER n 
14 52   LEU n 
14 53   GLY n 
14 54   TYR n 
14 55   LYS n 
14 56   ALA n 
14 57   LYS n 
14 58   GLN n 
14 59   GLY n 
14 60   ILE n 
14 61   ILE n 
14 62   VAL n 
14 63   VAL n 
14 64   ARG n 
14 65   VAL n 
14 66   ALA n 
14 67   ILE n 
14 68   ARG n 
14 69   LYS n 
14 70   GLY n 
14 71   SER n 
14 72   SER n 
14 73   ARG n 
14 74   ARG n 
14 75   THR n 
14 76   ARG n 
14 77   PHE n 
14 78   ASN n 
14 79   LYS n 
14 80   GLY n 
14 81   ARG n 
14 82   ARG n 
14 83   SER n 
14 84   LYS n 
14 85   ARG n 
14 86   MET n 
14 87   MET n 
14 88   VAL n 
14 89   ASN n 
14 90   ARG n 
14 91   ILE n 
14 92   THR n 
14 93   ARG n 
14 94   LYS n 
14 95   LYS n 
14 96   ASN n 
14 97   ILE n 
14 98   GLN n 
14 99   ARG n 
14 100  ILE n 
14 101  ALA n 
14 102  GLU n 
14 103  GLU n 
14 104  ARG n 
14 105  ALA n 
14 106  ASN n 
14 107  ARG n 
14 108  LYS n 
14 109  PHE n 
14 110  PRO n 
14 111  ASN n 
14 112  LEU n 
14 113  ARG n 
14 114  VAL n 
14 115  LEU n 
14 116  ASN n 
14 117  SER n 
14 118  TYR n 
14 119  SER n 
14 120  VAL n 
14 121  GLY n 
14 122  GLU n 
14 123  ASP n 
14 124  GLY n 
14 125  ARG n 
14 126  HIS n 
14 127  LYS n 
14 128  TRP n 
14 129  HIS n 
14 130  GLU n 
14 131  VAL n 
14 132  ILE n 
14 133  LEU n 
14 134  ILE n 
14 135  ASP n 
14 136  PRO n 
14 137  ASP n 
14 138  HIS n 
14 139  PRO n 
14 140  ALA n 
14 141  ILE n 
14 142  LYS n 
14 143  SER n 
14 144  ASP n 
14 145  ASP n 
14 146  GLN n 
14 147  LEU n 
14 148  SER n 
14 149  TRP n 
14 150  ILE n 
14 151  SER n 
14 152  ARG n 
14 153  THR n 
14 154  ARG n 
14 155  HIS n 
14 156  ARG n 
14 157  LEU n 
14 158  ARG n 
14 159  THR n 
14 160  PHE n 
14 161  ARG n 
14 162  GLY n 
14 163  LEU n 
14 164  THR n 
14 165  SER n 
14 166  ALA n 
14 167  GLY n 
14 168  ARG n 
14 169  ARG n 
14 170  CYS n 
14 171  ARG n 
14 172  GLY n 
14 173  LEU n 
14 174  ARG n 
14 175  GLY n 
14 176  GLN n 
14 177  GLY n 
14 178  LYS n 
14 179  GLY n 
14 180  SER n 
14 181  GLU n 
14 182  LYS n 
14 183  VAL n 
14 184  ARG n 
14 185  PRO n 
14 186  SER n 
14 187  LEU n 
14 188  ARG n 
14 189  VAL n 
14 190  ASN n 
14 191  GLY n 
14 192  ALA n 
14 193  LYS n 
14 194  ALA n 
15 1    ALA n 
15 2    THR n 
15 3    GLY n 
15 4    PRO n 
15 5    ARG n 
15 6    TYR n 
15 7    LYS n 
15 8    VAL n 
15 9    PRO n 
15 10   MET n 
15 11   ARG n 
15 12   ARG n 
15 13   ARG n 
15 14   ARG n 
15 15   GLU n 
15 16   ALA n 
15 17   ARG n 
15 18   THR n 
15 19   ASP n 
15 20   TYR n 
15 21   HIS n 
15 22   GLN n 
15 23   ARG n 
15 24   LEU n 
15 25   ARG n 
15 26   LEU n 
15 27   LEU n 
15 28   LYS n 
15 29   SER n 
15 30   GLY n 
15 31   LYS n 
15 32   PRO n 
15 33   ARG n 
15 34   LEU n 
15 35   VAL n 
15 36   ALA n 
15 37   ARG n 
15 38   LYS n 
15 39   SER n 
15 40   ASN n 
15 41   LYS n 
15 42   HIS n 
15 43   VAL n 
15 44   ARG n 
15 45   ALA n 
15 46   GLN n 
15 47   LEU n 
15 48   VAL n 
15 49   THR n 
15 50   LEU n 
15 51   GLY n 
15 52   PRO n 
15 53   ASN n 
15 54   GLY n 
15 55   ASP n 
15 56   ASP n 
15 57   THR n 
15 58   LEU n 
15 59   ALA n 
15 60   SER n 
15 61   ALA n 
15 62   HIS n 
15 63   SER n 
15 64   SER n 
15 65   ASP n 
15 66   LEU n 
15 67   ALA n 
15 68   GLU n 
15 69   TYR n 
15 70   GLY n 
15 71   TRP n 
15 72   GLU n 
15 73   ALA n 
15 74   PRO n 
15 75   THR n 
15 76   GLY n 
15 77   ASN n 
15 78   MET n 
15 79   PRO n 
15 80   SER n 
15 81   ALA n 
15 82   TYR n 
15 83   LEU n 
15 84   THR n 
15 85   GLY n 
15 86   LEU n 
15 87   LEU n 
15 88   ALA n 
15 89   GLY n 
15 90   LEU n 
15 91   ARG n 
15 92   ALA n 
15 93   GLN n 
15 94   GLU n 
15 95   ALA n 
15 96   GLY n 
15 97   VAL n 
15 98   GLU n 
15 99   GLU n 
15 100  ALA n 
15 101  VAL n 
15 102  LEU n 
15 103  ASP n 
15 104  ILE n 
15 105  GLY n 
15 106  LEU n 
15 107  ASN n 
15 108  SER n 
15 109  PRO n 
15 110  THR n 
15 111  PRO n 
15 112  GLY n 
15 113  SER n 
15 114  LYS n 
15 115  VAL n 
15 116  PHE n 
15 117  ALA n 
15 118  ILE n 
15 119  GLN n 
15 120  GLU n 
15 121  GLY n 
15 122  ALA n 
15 123  ILE n 
15 124  ASP n 
15 125  ALA n 
15 126  GLY n 
15 127  LEU n 
15 128  ASP n 
15 129  ILE n 
15 130  PRO n 
15 131  HIS n 
15 132  ASN n 
15 133  ASP n 
15 134  ASP n 
15 135  VAL n 
15 136  LEU n 
15 137  ALA n 
15 138  ASP n 
15 139  TRP n 
15 140  GLN n 
15 141  ARG n 
15 142  THR n 
15 143  ARG n 
15 144  GLY n 
15 145  ALA n 
15 146  HIS n 
15 147  ILE n 
15 148  ALA n 
15 149  GLU n 
15 150  TYR n 
15 151  ASP n 
15 152  GLU n 
15 153  GLN n 
15 154  LEU n 
15 155  GLU n 
15 156  GLU n 
15 157  PRO n 
15 158  LEU n 
15 159  TYR n 
15 160  SER n 
15 161  GLY n 
15 162  ASP n 
15 163  PHE n 
15 164  ASP n 
15 165  ALA n 
15 166  ALA n 
15 167  ASP n 
15 168  LEU n 
15 169  PRO n 
15 170  GLU n 
15 171  HIS n 
15 172  PHE n 
15 173  ASP n 
15 174  GLU n 
15 175  LEU n 
15 176  ARG n 
15 177  GLU n 
15 178  THR n 
15 179  LEU n 
15 180  LEU n 
15 181  ASP n 
15 182  GLY n 
15 183  ASP n 
15 184  ILE n 
15 185  GLU n 
15 186  LEU n 
16 1    SER n 
16 2    LYS n 
16 3    THR n 
16 4    ASN n 
16 5    PRO n 
16 6    ARG n 
16 7    LEU n 
16 8    SER n 
16 9    SER n 
16 10   LEU n 
16 11   ILE n 
16 12   ALA n 
16 13   ASP n 
16 14   LEU n 
16 15   LYS n 
16 16   SER n 
16 17   ALA n 
16 18   ALA n 
16 19   ARG n 
16 20   SER n 
16 21   SER n 
16 22   GLY n 
16 23   GLY n 
16 24   ALA n 
16 25   VAL n 
16 26   TRP n 
16 27   GLY n 
16 28   ASP n 
16 29   VAL n 
16 30   ALA n 
16 31   GLU n 
16 32   ARG n 
16 33   LEU n 
16 34   GLU n 
16 35   LYS n 
16 36   PRO n 
16 37   ARG n 
16 38   ARG n 
16 39   THR n 
16 40   HIS n 
16 41   ALA n 
16 42   GLU n 
16 43   VAL n 
16 44   ASN n 
16 45   LEU n 
16 46   GLY n 
16 47   ARG n 
16 48   ILE n 
16 49   GLU n 
16 50   ARG n 
16 51   TYR n 
16 52   ALA n 
16 53   GLN n 
16 54   GLU n 
16 55   ASP n 
16 56   GLU n 
16 57   THR n 
16 58   VAL n 
16 59   VAL n 
16 60   VAL n 
16 61   PRO n 
16 62   GLY n 
16 63   LYS n 
16 64   VAL n 
16 65   LEU n 
16 66   GLY n 
16 67   SER n 
16 68   GLY n 
16 69   VAL n 
16 70   LEU n 
16 71   GLN n 
16 72   LYS n 
16 73   ASP n 
16 74   VAL n 
16 75   THR n 
16 76   VAL n 
16 77   ALA n 
16 78   ALA n 
16 79   VAL n 
16 80   ASP n 
16 81   PHE n 
16 82   SER n 
16 83   GLY n 
16 84   THR n 
16 85   ALA n 
16 86   GLU n 
16 87   THR n 
16 88   LYS n 
16 89   ILE n 
16 90   ASP n 
16 91   GLN n 
16 92   VAL n 
16 93   GLY n 
16 94   GLU n 
16 95   ALA n 
16 96   VAL n 
16 97   SER n 
16 98   LEU n 
16 99   GLU n 
16 100  GLN n 
16 101  ALA n 
16 102  ILE n 
16 103  GLU n 
16 104  ASN n 
16 105  ASN n 
16 106  PRO n 
16 107  GLU n 
16 108  GLY n 
16 109  SER n 
16 110  HIS n 
16 111  VAL n 
16 112  ARG n 
16 113  VAL n 
16 114  ILE n 
16 115  ARG n 
17 1    THR n 
17 2    ASP n 
17 3    LEU n 
17 4    SER n 
17 5    ALA n 
17 6    GLN n 
17 7    LYS n 
17 8    ARG n 
17 9    LEU n 
17 10   ALA n 
17 11   ALA n 
17 12   ASP n 
17 13   VAL n 
17 14   LEU n 
17 15   ASP n 
17 16   VAL n 
17 17   GLY n 
17 18   LYS n 
17 19   ASN n 
17 20   ARG n 
17 21   VAL n 
17 22   TRP n 
17 23   PHE n 
17 24   ASN n 
17 25   PRO n 
17 26   GLU n 
17 27   ARG n 
17 28   GLN n 
17 29   GLY n 
17 30   ASP n 
17 31   ILE n 
17 32   ALA n 
17 33   ASP n 
17 34   ALA n 
17 35   ILE n 
17 36   THR n 
17 37   ARG n 
17 38   GLU n 
17 39   ASP n 
17 40   VAL n 
17 41   ARG n 
17 42   GLU n 
17 43   LEU n 
17 44   VAL n 
17 45   ASP n 
17 46   GLU n 
17 47   GLY n 
17 48   ALA n 
17 49   ILE n 
17 50   GLN n 
17 51   ALA n 
17 52   LYS n 
17 53   ASP n 
17 54   LYS n 
17 55   LYS n 
17 56   GLY n 
17 57   ASN n 
17 58   SER n 
17 59   ARG n 
17 60   GLY n 
17 61   ARG n 
17 62   ALA n 
17 63   ARG n 
17 64   GLU n 
17 65   ARG n 
17 66   GLN n 
17 67   LYS n 
17 68   LYS n 
17 69   ARG n 
17 70   ALA n 
17 71   LYS n 
17 72   GLY n 
17 73   HIS n 
17 74   GLN n 
17 75   LYS n 
17 76   GLY n 
17 77   ALA n 
17 78   GLY n 
17 79   SER n 
17 80   ARG n 
17 81   LYS n 
17 82   GLY n 
17 83   LYS n 
17 84   ALA n 
17 85   GLY n 
17 86   ALA n 
17 87   ARG n 
17 88   GLN n 
17 89   ASN n 
17 90   SER n 
17 91   LYS n 
17 92   GLU n 
17 93   ASP n 
17 94   TRP n 
17 95   GLU n 
17 96   SER n 
17 97   ARG n 
17 98   ILE n 
17 99   ARG n 
17 100  ALA n 
17 101  GLN n 
17 102  ARG n 
17 103  THR n 
17 104  LYS n 
17 105  LEU n 
17 106  ARG n 
17 107  GLU n 
17 108  LEU n 
17 109  ARG n 
17 110  ASP n 
17 111  GLU n 
17 112  GLY n 
17 113  THR n 
17 114  LEU n 
17 115  SER n 
17 116  SER n 
17 117  SER n 
17 118  GLN n 
17 119  TYR n 
17 120  ARG n 
17 121  ASP n 
17 122  LEU n 
17 123  TYR n 
17 124  ASP n 
17 125  LYS n 
17 126  ALA n 
17 127  GLY n 
17 128  GLY n 
17 129  GLY n 
17 130  GLU n 
17 131  PHE n 
17 132  ASP n 
17 133  SER n 
17 134  VAL n 
17 135  ALA n 
17 136  ASP n 
17 137  LEU n 
17 138  GLU n 
17 139  ARG n 
17 140  TYR n 
17 141  ILE n 
17 142  ASP n 
17 143  ALA n 
17 144  ASN n 
17 145  HIS n 
17 146  GLY n 
17 147  ASP n 
17 148  ALA n 
18 1    PRO n 
18 2    SER n 
18 3    SER n 
18 4    ASN n 
18 5    GLY n 
18 6    PRO n 
18 7    LEU n 
18 8    GLU n 
18 9    GLY n 
18 10   THR n 
18 11   ARG n 
18 12   GLY n 
18 13   LYS n 
18 14   LEU n 
18 15   LYS n 
18 16   ASN n 
18 17   LYS n 
18 18   PRO n 
18 19   ARG n 
18 20   ASP n 
18 21   ARG n 
18 22   GLY n 
18 23   THR n 
18 24   SER n 
18 25   PRO n 
18 26   PRO n 
18 27   GLN n 
18 28   ARG n 
18 29   ALA n 
18 30   VAL n 
18 31   GLU n 
18 32   GLU n 
18 33   PHE n 
18 34   ASP n 
18 35   ASP n 
18 36   GLY n 
18 37   GLU n 
18 38   LYS n 
18 39   VAL n 
18 40   HIS n 
18 41   LEU n 
18 42   LYS n 
18 43   ILE n 
18 44   ASP n 
18 45   PRO n 
18 46   SER n 
18 47   VAL n 
18 48   PRO n 
18 49   ASN n 
18 50   GLY n 
18 51   ARG n 
18 52   PHE n 
18 53   HIS n 
18 54   PRO n 
18 55   ARG n 
18 56   PHE n 
18 57   ASP n 
18 58   GLY n 
18 59   GLN n 
18 60   THR n 
18 61   GLY n 
18 62   THR n 
18 63   VAL n 
18 64   GLU n 
18 65   GLY n 
18 66   LYS n 
18 67   GLN n 
18 68   GLY n 
18 69   ASP n 
18 70   ALA n 
18 71   TYR n 
18 72   LYS n 
18 73   VAL n 
18 74   ASP n 
18 75   ILE n 
18 76   VAL n 
18 77   ASP n 
18 78   GLY n 
18 79   GLY n 
18 80   LYS n 
18 81   GLU n 
18 82   LYS n 
18 83   THR n 
18 84   ILE n 
18 85   ILE n 
18 86   VAL n 
18 87   THR n 
18 88   ALA n 
18 89   ALA n 
18 90   HIS n 
18 91   LEU n 
18 92   ARG n 
18 93   ARG n 
18 94   GLN n 
18 95   GLU n 
19 1    GLY n 
19 2    ILE n 
19 3    SER n 
19 4    TYR n 
19 5    SER n 
19 6    VAL n 
19 7    GLU n 
19 8    ALA n 
19 9    ASP n 
19 10   PRO n 
19 11   ASP n 
19 12   THR n 
19 13   THR n 
19 14   ALA n 
19 15   LYS n 
19 16   ALA n 
19 17   MET n 
19 18   LEU n 
19 19   ARG n 
19 20   GLU n 
19 21   ARG n 
19 22   GLN n 
19 23   MET n 
19 24   SER n 
19 25   PHE n 
19 26   LYS n 
19 27   HIS n 
19 28   SER n 
19 29   LYS n 
19 30   ALA n 
19 31   ILE n 
19 32   ALA n 
19 33   ARG n 
19 34   GLU n 
19 35   ILE n 
19 36   LYS n 
19 37   GLY n 
19 38   LYS n 
19 39   THR n 
19 40   ALA n 
19 41   GLY n 
19 42   GLU n 
19 43   ALA n 
19 44   VAL n 
19 45   ASP n 
19 46   TYR n 
19 47   LEU n 
19 48   GLU n 
19 49   ALA n 
19 50   VAL n 
19 51   ILE n 
19 52   GLU n 
19 53   GLY n 
19 54   ASP n 
19 55   GLN n 
19 56   PRO n 
19 57   VAL n 
19 58   PRO n 
19 59   PHE n 
19 60   LYS n 
19 61   GLN n 
19 62   HIS n 
19 63   ASN n 
19 64   SER n 
19 65   GLY n 
19 66   VAL n 
19 67   GLY n 
19 68   HIS n 
19 69   LYS n 
19 70   SER n 
19 71   LYS n 
19 72   VAL n 
19 73   ASP n 
19 74   GLY n 
19 75   TRP n 
19 76   ASP n 
19 77   ALA n 
19 78   GLY n 
19 79   ARG n 
19 80   TYR n 
19 81   PRO n 
19 82   GLU n 
19 83   LYS n 
19 84   ALA n 
19 85   SER n 
19 86   LYS n 
19 87   ALA n 
19 88   PHE n 
19 89   LEU n 
19 90   ASP n 
19 91   LEU n 
19 92   LEU n 
19 93   GLU n 
19 94   ASN n 
19 95   ALA n 
19 96   VAL n 
19 97   GLY n 
19 98   ASN n 
19 99   ALA n 
19 100  ASP n 
19 101  HIS n 
19 102  GLN n 
19 103  GLY n 
19 104  PHE n 
19 105  ASP n 
19 106  GLY n 
19 107  GLU n 
19 108  ALA n 
19 109  MET n 
19 110  THR n 
19 111  ILE n 
19 112  LYS n 
19 113  HIS n 
19 114  VAL n 
19 115  ALA n 
19 116  ALA n 
19 117  HIS n 
19 118  LYS n 
19 119  VAL n 
19 120  GLY n 
19 121  GLU n 
19 122  GLN n 
19 123  GLN n 
19 124  GLY n 
19 125  ARG n 
19 126  LYS n 
19 127  PRO n 
19 128  ARG n 
19 129  ALA n 
19 130  MET n 
19 131  GLY n 
19 132  ARG n 
19 133  ALA n 
19 134  SER n 
19 135  ALA n 
19 136  TRP n 
19 137  ASN n 
19 138  SER n 
19 139  PRO n 
19 140  GLN n 
19 141  VAL n 
19 142  ASP n 
19 143  VAL n 
19 144  GLU n 
19 145  LEU n 
19 146  ILE n 
19 147  LEU n 
19 148  GLU n 
19 149  GLU n 
19 150  PRO n 
19 151  GLU n 
19 152  VAL n 
19 153  GLU n 
19 154  ASP n 
20 1    SER n 
20 2    TRP n 
20 3    ASP n 
20 4    VAL n 
20 5    ILE n 
20 6    LYS n 
20 7    HIS n 
20 8    PRO n 
20 9    HIS n 
20 10   VAL n 
20 11   THR n 
20 12   GLU n 
20 13   LYS n 
20 14   ALA n 
20 15   MET n 
20 16   ASN n 
20 17   ASP n 
20 18   MET n 
20 19   ASP n 
20 20   PHE n 
20 21   GLN n 
20 22   ASN n 
20 23   LYS n 
20 24   LEU n 
20 25   GLN n 
20 26   PHE n 
20 27   ALA n 
20 28   VAL n 
20 29   ASP n 
20 30   ASP n 
20 31   ARG n 
20 32   ALA n 
20 33   SER n 
20 34   LYS n 
20 35   GLY n 
20 36   GLU n 
20 37   VAL n 
20 38   ALA n 
20 39   ASP n 
20 40   ALA n 
20 41   VAL n 
20 42   GLU n 
20 43   GLU n 
20 44   GLN n 
20 45   TYR n 
20 46   ASP n 
20 47   VAL n 
20 48   THR n 
20 49   VAL n 
20 50   GLU n 
20 51   GLN n 
20 52   VAL n 
20 53   ASN n 
20 54   THR n 
20 55   GLN n 
20 56   ASN n 
20 57   THR n 
20 58   MET n 
20 59   ASP n 
20 60   GLY n 
20 61   GLU n 
20 62   LYS n 
20 63   LYS n 
20 64   ALA n 
20 65   VAL n 
20 66   VAL n 
20 67   ARG n 
20 68   LEU n 
20 69   SER n 
20 70   GLU n 
20 71   ASP n 
20 72   ASP n 
20 73   ASP n 
20 74   ALA n 
20 75   GLN n 
20 76   GLU n 
20 77   VAL n 
20 78   ALA n 
20 79   SER n 
20 80   ARG n 
20 81   ILE n 
20 82   GLY n 
20 83   VAL n 
20 84   PHE n 
21 1    SER n 
21 2    LYS n 
21 3    GLN n 
21 4    PRO n 
21 5    ASP n 
21 6    LYS n 
21 7    GLN n 
21 8    ARG n 
21 9    LYS n 
21 10   SER n 
21 11   GLN n 
21 12   ARG n 
21 13   ARG n 
21 14   ALA n 
21 15   PRO n 
21 16   LEU n 
21 17   HIS n 
21 18   GLU n 
21 19   ARG n 
21 20   HIS n 
21 21   LYS n 
21 22   GLN n 
21 23   VAL n 
21 24   ARG n 
21 25   ALA n 
21 26   THR n 
21 27   LEU n 
21 28   SER n 
21 29   ALA n 
21 30   ASP n 
21 31   LEU n 
21 32   ARG n 
21 33   GLU n 
21 34   GLU n 
21 35   TYR n 
21 36   GLY n 
21 37   GLN n 
21 38   ARG n 
21 39   ASN n 
21 40   VAL n 
21 41   ARG n 
21 42   VAL n 
21 43   ASN n 
21 44   ALA n 
21 45   GLY n 
21 46   ASP n 
21 47   THR n 
21 48   VAL n 
21 49   GLU n 
21 50   VAL n 
21 51   LEU n 
21 52   ARG n 
21 53   GLY n 
21 54   ASP n 
21 55   PHE n 
21 56   ALA n 
21 57   GLY n 
21 58   GLU n 
21 59   GLU n 
21 60   GLY n 
21 61   GLU n 
21 62   VAL n 
21 63   ILE n 
21 64   ASN n 
21 65   VAL n 
21 66   ASP n 
21 67   LEU n 
21 68   ASP n 
21 69   LYS n 
21 70   ALA n 
21 71   VAL n 
21 72   ILE n 
21 73   HIS n 
21 74   VAL n 
21 75   GLU n 
21 76   ASP n 
21 77   VAL n 
21 78   THR n 
21 79   LEU n 
21 80   GLU n 
21 81   LYS n 
21 82   THR n 
21 83   ASP n 
21 84   GLY n 
21 85   GLU n 
21 86   GLU n 
21 87   VAL n 
21 88   PRO n 
21 89   ARG n 
21 90   PRO n 
21 91   LEU n 
21 92   ASP n 
21 93   THR n 
21 94   SER n 
21 95   ASN n 
21 96   VAL n 
21 97   ARG n 
21 98   VAL n 
21 99   THR n 
21 100  ASP n 
21 101  LEU n 
21 102  ASP n 
21 103  LEU n 
21 104  GLU n 
21 105  ASP n 
21 106  GLU n 
21 107  LYS n 
21 108  ARG n 
21 109  GLU n 
21 110  ALA n 
21 111  ARG n 
21 112  LEU n 
21 113  GLU n 
21 114  SER n 
21 115  GLU n 
21 116  ASP n 
21 117  ASP n 
21 118  SER n 
21 119  ALA n 
22 1    PRO n 
22 2    ARG n 
22 3    THR n 
22 4    ARG n 
22 5    GLU n 
22 6    CYS n 
22 7    ASP n 
22 8    TYR n 
22 9    CYS n 
22 10   GLY n 
22 11   THR n 
22 12   ASP n 
22 13   ILE n 
22 14   GLU n 
22 15   PRO n 
22 16   GLY n 
22 17   THR n 
22 18   GLY n 
22 19   THR n 
22 20   MET n 
22 21   PHE n 
22 22   VAL n 
22 23   HIS n 
22 24   LYS n 
22 25   ASP n 
22 26   GLY n 
22 27   ALA n 
22 28   THR n 
22 29   THR n 
22 30   HIS n 
22 31   PHE n 
22 32   CYS n 
22 33   SER n 
22 34   SER n 
22 35   LYS n 
22 36   CYS n 
22 37   GLU n 
22 38   ASN n 
22 39   ASN n 
22 40   ALA n 
22 41   ASP n 
22 42   LEU n 
22 43   GLY n 
22 44   ARG n 
22 45   GLU n 
22 46   ALA n 
22 47   ARG n 
22 48   ASN n 
22 49   LEU n 
22 50   GLU n 
22 51   TRP n 
22 52   THR n 
22 53   ASP n 
22 54   THR n 
22 55   ALA n 
22 56   ARG n 
22 57   GLY n 
22 58   GLU n 
22 59   ALA n 
22 60   GLY n 
22 61   GLU n 
22 62   ALA n 
22 63   GLU n 
22 64   ASP n 
22 65   GLU n 
22 66   ALA n 
23 1    THR n 
23 2    VAL n 
23 3    LEU n 
23 4    HIS n 
23 5    VAL n 
23 6    GLN n 
23 7    GLU n 
23 8    ILE n 
23 9    ARG n 
23 10   ASP n 
23 11   MET n 
23 12   THR n 
23 13   PRO n 
23 14   ALA n 
23 15   GLU n 
23 16   ARG n 
23 17   GLU n 
23 18   ALA n 
23 19   GLU n 
23 20   LEU n 
23 21   ASP n 
23 22   ASP n 
23 23   LEU n 
23 24   LYS n 
23 25   THR n 
23 26   GLU n 
23 27   LEU n 
23 28   LEU n 
23 29   ASN n 
23 30   ALA n 
23 31   ARG n 
23 32   ALA n 
23 33   VAL n 
23 34   GLN n 
23 35   ALA n 
23 36   ALA n 
23 37   GLY n 
23 38   GLY n 
23 39   ALA n 
23 40   PRO n 
23 41   GLU n 
23 42   ASN n 
23 43   PRO n 
23 44   GLY n 
23 45   ARG n 
23 46   ILE n 
23 47   LYS n 
23 48   GLU n 
23 49   LEU n 
23 50   ARG n 
23 51   LYS n 
23 52   ALA n 
23 53   ILE n 
23 54   ALA n 
23 55   ARG n 
23 56   ILE n 
23 57   LYS n 
23 58   THR n 
23 59   ILE n 
23 60   GLN n 
23 61   GLY n 
23 62   GLU n 
23 63   GLU n 
23 64   GLY n 
23 65   ASP n 
23 66   LEU n 
23 67   GLN n 
23 68   GLU n 
23 69   ASN n 
23 70   GLU n 
24 1    MET n 
24 2    HIS n 
24 3    ALA n 
24 4    LEU n 
24 5    VAL n 
24 6    GLN n 
24 7    LEU n 
24 8    ARG n 
24 9    GLY n 
24 10   GLU n 
24 11   VAL n 
24 12   ASN n 
24 13   MET n 
24 14   HIS n 
24 15   THR n 
24 16   ASP n 
24 17   ILE n 
24 18   GLN n 
24 19   ASP n 
24 20   THR n 
24 21   LEU n 
24 22   GLU n 
24 23   MET n 
24 24   LEU n 
24 25   ASN n 
24 26   ILE n 
24 27   HIS n 
24 28   HIS n 
24 29   VAL n 
24 30   ASN n 
24 31   HIS n 
24 32   CYS n 
24 33   THR n 
24 34   LEU n 
24 35   VAL n 
24 36   PRO n 
24 37   GLU n 
24 38   THR n 
24 39   ASP n 
24 40   ALA n 
24 41   TYR n 
24 42   ARG n 
24 43   GLY n 
24 44   MET n 
24 45   VAL n 
24 46   ALA n 
24 47   LYS n 
24 48   VAL n 
24 49   ASN n 
24 50   ASP n 
24 51   PHE n 
24 52   VAL n 
24 53   ALA n 
24 54   PHE n 
24 55   GLY n 
24 56   GLU n 
24 57   PRO n 
24 58   SER n 
24 59   GLN n 
24 60   GLU n 
24 61   THR n 
24 62   LEU n 
24 63   GLU n 
24 64   THR n 
24 65   VAL n 
24 66   LEU n 
24 67   ALA n 
24 68   THR n 
24 69   ARG n 
24 70   ALA n 
24 71   GLU n 
24 72   PRO n 
24 73   LEU n 
24 74   GLU n 
24 75   GLY n 
24 76   ASP n 
24 77   ALA n 
24 78   ASP n 
24 79   VAL n 
24 80   ASP n 
24 81   ASP n 
24 82   GLU n 
24 83   TRP n 
24 84   VAL n 
24 85   ALA n 
24 86   GLU n 
24 87   HIS n 
24 88   THR n 
24 89   ASP n 
24 90   TYR n 
24 91   ASP n 
24 92   ASP n 
24 93   ILE n 
24 94   SER n 
24 95   GLY n 
24 96   LEU n 
24 97   ALA n 
24 98   PHE n 
24 99   ALA n 
24 100  LEU n 
24 101  LEU n 
24 102  SER n 
24 103  GLU n 
24 104  GLU n 
24 105  THR n 
24 106  THR n 
24 107  LEU n 
24 108  ARG n 
24 109  GLU n 
24 110  GLN n 
24 111  GLY n 
24 112  LEU n 
24 113  SER n 
24 114  PRO n 
24 115  THR n 
24 116  LEU n 
24 117  ARG n 
24 118  LEU n 
24 119  HIS n 
24 120  PRO n 
24 121  PRO n 
24 122  ARG n 
24 123  GLY n 
24 124  GLY n 
24 125  HIS n 
24 126  ASP n 
24 127  GLY n 
24 128  VAL n 
24 129  LYS n 
24 130  HIS n 
24 131  PRO n 
24 132  VAL n 
24 133  LYS n 
24 134  GLU n 
24 135  GLY n 
24 136  GLY n 
24 137  GLN n 
24 138  LEU n 
24 139  GLY n 
24 140  LYS n 
24 141  HIS n 
24 142  ASP n 
24 143  THR n 
24 144  GLU n 
24 145  GLY n 
24 146  ILE n 
24 147  ASP n 
24 148  ASP n 
24 149  LEU n 
24 150  LEU n 
24 151  GLU n 
24 152  ALA n 
24 153  MET n 
24 154  ARG n 
25 1    SER n 
25 2    ALA n 
25 3    SER n 
25 4    ASP n 
25 5    PHE n 
25 6    GLU n 
25 7    GLU n 
25 8    ARG n 
25 9    VAL n 
25 10   VAL n 
25 11   THR n 
25 12   ILE n 
25 13   PRO n 
25 14   LEU n 
25 15   ARG n 
25 16   ASP n 
25 17   ALA n 
25 18   ARG n 
25 19   ALA n 
25 20   GLU n 
25 21   PRO n 
25 22   ASN n 
25 23   HIS n 
25 24   LYS n 
25 25   ARG n 
25 26   ALA n 
25 27   ASP n 
25 28   LYS n 
25 29   ALA n 
25 30   MET n 
25 31   ILE n 
25 32   LEU n 
25 33   ILE n 
25 34   ARG n 
25 35   GLU n 
25 36   HIS n 
25 37   LEU n 
25 38   ALA n 
25 39   LYS n 
25 40   HIS n 
25 41   PHE n 
25 42   SER n 
25 43   VAL n 
25 44   ASP n 
25 45   GLU n 
25 46   ASP n 
25 47   ALA n 
25 48   VAL n 
25 49   ARG n 
25 50   LEU n 
25 51   ASP n 
25 52   PRO n 
25 53   SER n 
25 54   ILE n 
25 55   ASN n 
25 56   GLU n 
25 57   ALA n 
25 58   ALA n 
25 59   TRP n 
25 60   ALA n 
25 61   ARG n 
25 62   GLY n 
25 63   ARG n 
25 64   ALA n 
25 65   ASN n 
25 66   THR n 
25 67   PRO n 
25 68   SER n 
25 69   LYS n 
25 70   ILE n 
25 71   ARG n 
25 72   VAL n 
25 73   ARG n 
25 74   ALA n 
25 75   ALA n 
25 76   ARG n 
25 77   PHE n 
25 78   GLU n 
25 79   GLU n 
25 80   GLU n 
25 81   GLY n 
25 82   GLU n 
25 83   ALA n 
25 84   ILE n 
25 85   VAL n 
25 86   GLU n 
25 87   ALA n 
25 88   GLU n 
25 89   THR n 
25 90   ALA n 
25 91   GLU n 
26 1    ALA n 
26 2    ASP n 
26 3    ASN n 
26 4    GLU n 
26 5    GLU n 
26 6    ASP n 
26 7    VAL n 
26 8    GLU n 
26 9    ALA n 
26 10   GLU n 
26 11   GLU n 
26 12   GLU n 
26 13   TYR n 
26 14   THR n 
26 15   GLU n 
26 16   LEU n 
26 17   THR n 
26 18   ASP n 
26 19   ILE n 
26 20   SER n 
26 21   GLY n 
26 22   VAL n 
26 23   GLY n 
26 24   PRO n 
26 25   SER n 
26 26   LYS n 
26 27   ALA n 
26 28   GLU n 
26 29   SER n 
26 30   LEU n 
26 31   ARG n 
26 32   GLU n 
26 33   ALA n 
26 34   GLY n 
26 35   PHE n 
26 36   GLU n 
26 37   SER n 
26 38   VAL n 
26 39   GLU n 
26 40   ASP n 
26 41   VAL n 
26 42   ARG n 
26 43   GLY n 
26 44   ALA n 
26 45   ASP n 
26 46   GLN n 
26 47   SER n 
26 48   ALA n 
26 49   LEU n 
26 50   ALA n 
26 51   ASP n 
26 52   VAL n 
26 53   SER n 
26 54   GLY n 
26 55   ILE n 
26 56   GLY n 
26 57   ASN n 
26 58   ALA n 
26 59   LEU n 
26 60   ALA n 
26 61   ALA n 
26 62   ARG n 
26 63   ILE n 
26 64   LYS n 
26 65   ALA n 
26 66   ASP n 
26 67   VAL n 
26 68   GLY n 
26 69   GLY n 
26 70   LEU n 
26 71   GLU n 
26 72   VAL n 
26 73   GLU n 
26 74   SER n 
26 75   GLU n 
26 76   THR n 
26 77   GLU n 
26 78   ALA n 
26 79   GLU n 
26 80   VAL n 
26 81   GLU n 
26 82   GLU n 
26 83   GLU n 
26 84   GLY n 
26 85   GLY n 
26 86   GLU n 
26 87   GLU n 
26 88   ALA n 
26 89   PRO n 
26 90   ASP n 
26 91   GLU n 
26 92   ASP n 
26 93   VAL n 
26 94   GLU n 
26 95   THR n 
26 96   GLU n 
26 97   LEU n 
26 98   GLN n 
26 99   ALA n 
26 100  ARG n 
26 101  GLY n 
26 102  LEU n 
26 103  THR n 
26 104  GLU n 
26 105  LYS n 
26 106  THR n 
26 107  PRO n 
26 108  ASP n 
26 109  LEU n 
26 110  SER n 
26 111  ASP n 
26 112  GLU n 
26 113  ASP n 
26 114  ALA n 
26 115  ARG n 
26 116  LEU n 
26 117  LEU n 
26 118  THR n 
26 119  GLN n 
26 120  ARG n 
26 121  HIS n 
26 122  ARG n 
26 123  VAL n 
26 124  GLY n 
26 125  LYS n 
26 126  PRO n 
26 127  GLN n 
26 128  PHE n 
26 129  ASN n 
26 130  ARG n 
26 131  GLN n 
26 132  ASP n 
26 133  HIS n 
26 134  HIS n 
26 135  LYS n 
26 136  LYS n 
26 137  LYS n 
26 138  ARG n 
26 139  VAL n 
26 140  SER n 
26 141  THR n 
26 142  SER n 
26 143  TRP n 
26 144  ARG n 
26 145  LYS n 
26 146  PRO n 
26 147  ARG n 
26 148  GLY n 
26 149  GLN n 
26 150  LEU n 
26 151  SER n 
26 152  LYS n 
26 153  GLN n 
26 154  ARG n 
26 155  ARG n 
26 156  GLY n 
26 157  ILE n 
26 158  LYS n 
26 159  GLY n 
26 160  LYS n 
26 161  GLY n 
26 162  ASP n 
26 163  THR n 
26 164  VAL n 
26 165  GLU n 
26 166  ALA n 
26 167  GLY n 
26 168  PHE n 
26 169  ARG n 
26 170  SER n 
26 171  PRO n 
26 172  THR n 
26 173  ALA n 
26 174  VAL n 
26 175  ARG n 
26 176  GLY n 
26 177  LYS n 
26 178  HIS n 
26 179  PRO n 
26 180  SER n 
26 181  GLY n 
26 182  PHE n 
26 183  GLU n 
26 184  GLU n 
26 185  VAL n 
26 186  ARG n 
26 187  VAL n 
26 188  HIS n 
26 189  ASN n 
26 190  VAL n 
26 191  ASP n 
26 192  ASP n 
26 193  LEU n 
26 194  GLU n 
26 195  GLY n 
26 196  VAL n 
26 197  ASP n 
26 198  GLY n 
26 199  ASP n 
26 200  THR n 
26 201  GLU n 
26 202  ALA n 
26 203  VAL n 
26 204  ARG n 
26 205  ILE n 
26 206  ALA n 
26 207  SER n 
26 208  LYS n 
26 209  VAL n 
26 210  GLY n 
26 211  ALA n 
26 212  ARG n 
26 213  LYS n 
26 214  ARG n 
26 215  GLU n 
26 216  ARG n 
26 217  ILE n 
26 218  GLU n 
26 219  GLU n 
26 220  GLU n 
26 221  ALA n 
26 222  GLU n 
26 223  ASP n 
26 224  ALA n 
26 225  GLY n 
26 226  ILE n 
26 227  ARG n 
26 228  VAL n 
26 229  LEU n 
26 230  ASN n 
26 231  PRO n 
26 232  THR n 
26 233  TYR n 
26 234  VAL n 
26 235  GLU n 
26 236  VAL n 
26 237  GLU n 
26 238  VAL n 
26 239  SER n 
26 240  GLU n 
27 1    ARG n 
27 2    THR n 
27 3    GLY n 
27 4    ARG n 
27 5    PHE n 
27 6    GLY n 
27 7    PRO n 
27 8    ARG n 
27 9    TYR n 
27 10   GLY n 
27 11   LEU n 
27 12   LYS n 
27 13   ILE n 
27 14   ARG n 
27 15   VAL n 
27 16   ARG n 
27 17   VAL n 
27 18   ALA n 
27 19   ASP n 
27 20   VAL n 
27 21   GLU n 
27 22   ILE n 
27 23   LYS n 
27 24   HIS n 
27 25   LYS n 
27 26   LYS n 
27 27   LYS n 
27 28   HIS n 
27 29   LYS n 
27 30   CYS n 
27 31   PRO n 
27 32   VAL n 
27 33   CYS n 
27 34   GLY n 
27 35   PHE n 
27 36   LYS n 
27 37   LYS n 
27 38   LEU n 
27 39   LYS n 
27 40   ARG n 
27 41   ALA n 
27 42   GLY n 
27 43   THR n 
27 44   GLY n 
27 45   ILE n 
27 46   TRP n 
27 47   MET n 
27 48   CYS n 
27 49   GLY n 
27 50   HIS n 
27 51   CYS n 
27 52   GLY n 
27 53   TYR n 
27 54   LYS n 
27 55   ILE n 
27 56   ALA n 
27 57   GLY n 
27 58   GLY n 
27 59   CYS n 
27 60   TYR n 
27 61   GLN n 
27 62   PRO n 
27 63   GLU n 
27 64   THR n 
27 65   VAL n 
27 66   ALA n 
27 67   GLY n 
27 68   LYS n 
27 69   ALA n 
27 70   VAL n 
27 71   MET n 
27 72   LYS n 
27 73   ALA n 
28 1    THR n 
28 2    GLY n 
28 3    ALA n 
28 4    GLY n 
28 5    THR n 
28 6    PRO n 
28 7    SER n 
28 8    GLN n 
28 9    GLY n 
28 10   LYS n 
28 11   LYS n 
28 12   ASN n 
28 13   THR n 
28 14   THR n 
28 15   THR n 
28 16   HIS n 
28 17   THR n 
28 18   LYS n 
28 19   CYS n 
28 20   ARG n 
28 21   ARG n 
28 22   CYS n 
28 23   GLY n 
28 24   GLU n 
28 25   LYS n 
28 26   SER n 
28 27   TYR n 
28 28   HIS n 
28 29   THR n 
28 30   LYS n 
28 31   LYS n 
28 32   LYS n 
28 33   VAL n 
28 34   CYS n 
28 35   SER n 
28 36   SER n 
28 37   CYS n 
28 38   GLY n 
28 39   PHE n 
28 40   GLY n 
28 41   LYS n 
28 42   SER n 
28 43   ALA n 
28 44   LYS n 
28 45   ARG n 
28 46   ARG n 
28 47   ASP n 
28 48   TYR n 
28 49   GLU n 
28 50   TRP n 
28 51   GLN n 
28 52   SER n 
28 53   LYS n 
28 54   ALA n 
28 55   GLY n 
28 56   GLU n 
29 1    GLY n 
29 2    LYS n 
29 3    LYS n 
29 4    SER n 
29 5    LYS n 
29 6    ALA n 
29 7    THR n 
29 8    LYS n 
29 9    LYS n 
29 10   ARG n 
29 11   LEU n 
29 12   ALA n 
29 13   LYS n 
29 14   LEU n 
29 15   ASP n 
29 16   ASN n 
29 17   GLN n 
29 18   ASN n 
29 19   SER n 
29 20   ARG n 
29 21   VAL n 
29 22   PRO n 
29 23   ALA n 
29 24   TRP n 
29 25   VAL n 
29 26   MET n 
29 27   LEU n 
29 28   LYS n 
29 29   THR n 
29 30   ASP n 
29 31   GLU n 
29 32   VAL n 
29 33   GLN n 
29 34   ARG n 
29 35   ASN n 
29 36   HIS n 
29 37   LYS n 
29 38   ARG n 
29 39   ARG n 
29 40   HIS n 
29 41   TRP n 
29 42   ARG n 
29 43   ARG n 
29 44   ASN n 
29 45   ASP n 
29 46   THR n 
29 47   ASP n 
29 48   GLU n 
30 1    MET n 
30 2    GLN n 
30 3    MET n 
30 4    PRO n 
30 5    ARG n 
30 6    ARG n 
30 7    PHE n 
30 8    ASN n 
30 9    THR n 
30 10   TYR n 
30 11   CYS n 
30 12   PRO n 
30 13   HIS n 
30 14   CYS n 
30 15   ASN n 
30 16   GLU n 
30 17   HIS n 
30 18   GLN n 
30 19   GLU n 
30 20   HIS n 
30 21   GLU n 
30 22   VAL n 
30 23   GLU n 
30 24   LYS n 
30 25   VAL n 
30 26   ARG n 
30 27   SER n 
30 28   GLY n 
30 29   ARG n 
30 30   GLN n 
30 31   THR n 
30 32   GLY n 
30 33   MET n 
30 34   LYS n 
30 35   TRP n 
30 36   ILE n 
30 37   ASP n 
30 38   ARG n 
30 39   GLN n 
30 40   ARG n 
30 41   GLU n 
30 42   ARG n 
30 43   ASN n 
30 44   SER n 
30 45   GLY n 
30 46   ILE n 
30 47   GLY n 
30 48   ASN n 
30 49   ASP n 
30 50   GLY n 
30 51   LYS n 
30 52   PHE n 
30 53   SER n 
30 54   LYS n 
30 55   VAL n 
30 56   PRO n 
30 57   GLY n 
30 58   GLY n 
30 59   ASP n 
30 60   LYS n 
30 61   PRO n 
30 62   THR n 
30 63   LYS n 
30 64   LYS n 
30 65   THR n 
30 66   ASP n 
30 67   LEU n 
30 68   LYS n 
30 69   TYR n 
30 70   ARG n 
30 71   CYS n 
30 72   GLY n 
30 73   GLU n 
30 74   CYS n 
30 75   GLY n 
30 76   LYS n 
30 77   ALA n 
30 78   HIS n 
30 79   LEU n 
30 80   ARG n 
30 81   GLU n 
30 82   GLY n 
30 83   TRP n 
30 84   ARG n 
30 85   ALA n 
30 86   GLY n 
30 87   ARG n 
30 88   LEU n 
30 89   GLU n 
30 90   PHE n 
30 91   GLN n 
30 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1  1  GB  AF034620   3377779 2597 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
? 
2  2  GB  AF034620   3377779 5658 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
? 
3  3  UNP RL2_HALMA  P20276  1    
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
? 
4  4  UNP RL3_HALMA  P20279  1    
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVPFFRPAVRPND
QPRLDPEVRYVSNESNQG
;
? 
5  5  UNP RL4_HALMA  P12735  1    
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
? 
6  6  UNP RL5_HALMA  P14124  1    
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
? 
7  7  UNP RL6_HALMA  P14135  1    
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
? 
8  8  UNP RL7A_HALMA P12743  1    
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
? 
9  9  UNP RLA0_HALMA P15825  1    
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
? 
10 11 UNP RL13_HALMA P29198  1    
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
? 
11 12 UNP RL14_HALMA P22450  1    
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
? 
12 13 UNP RL15_HALMA P12737  1    
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
? 
13 15 UNP RL18_HALMA P14123  1    
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
? 
14 16 UNP R18E_HALMA P12733  1    
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
? 
15 17 UNP RL19_HALMA P14119  1    
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
? 
16 18 UNP RL21_HALMA P12734  1    
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
? 
17 19 UNP RL22_HALMA P10970  1    
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
? 
18 20 UNP RL23_HALMA P12732  1    
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
? 
19 21 UNP RL24_HALMA P10972  1    
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
? 
20 22 UNP R24E_HALMA P14116  1    PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA ? 
21 23 UNP RL29_HALMA P10971  1    TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE ? 
22 24 UNP RL30_HALMA P14121  1    
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
? 
23 25 UNP RL31_HALMA P18138  1    
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
? 
24 26 UNP RL32_HALMA P12736  1    
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

;
? 
25 28 UNP RL37_HALMA P32410  1    TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE ? 
26 29 UNP RL39_HALMA P22452  1    GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE ? 
27 30 UNP RL44_HALMA P32411  1    
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
? 
28 10 PDB 1NJI       1NJI    ?    ? ? 
29 14 PDB 1NJI       1NJI    ?    ? ? 
30 27 PDB 1NJI       1NJI    ?    ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1NJI A 1 ? 2922 ? 3377779 2597 ? 5518 ? 2    2923 
2  2  1NJI B 1 ? 122  ? 3377779 5658 ? 5779 ? 3001 3122 
3  3  1NJI C 1 ? 239  ? P20276  1    ? 239  ? 1    239  
4  4  1NJI D 1 ? 337  ? P20279  1    ? 338  ? 1    337  
5  5  1NJI E 1 ? 246  ? P12735  1    ? 246  ? 1    246  
6  6  1NJI F 1 ? 176  ? P14124  1    ? 176  ? 1    176  
7  7  1NJI G 1 ? 177  ? P14135  1    ? 177  ? 1    177  
8  8  1NJI H 1 ? 119  ? P12743  1    ? 119  ? 1    119  
9  9  1NJI I 1 ? 348  ? P15825  1    ? 348  ? 1    348  
10 10 1NJI K 1 ? 145  ? P29198  1    ? 145  ? 1    145  
11 11 1NJI L 1 ? 132  ? P22450  1    ? 132  ? 1    132  
12 12 1NJI M 1 ? 164  ? P12737  1    ? 164  ? 1    164  
13 13 1NJI O 1 ? 186  ? P14123  1    ? 186  ? 1    186  
14 14 1NJI P 1 ? 115  ? P12733  1    ? 115  ? 1    115  
15 15 1NJI Q 1 ? 148  ? P14119  1    ? 148  ? 1    148  
16 16 1NJI R 1 ? 95   ? P12734  1    ? 95   ? 1    95   
17 17 1NJI S 1 ? 154  ? P10970  1    ? 154  ? 1    154  
18 18 1NJI T 1 ? 84   ? P12732  1    ? 84   ? 1    84   
19 19 1NJI U 1 ? 119  ? P10972  1    ? 119  ? 1    119  
20 20 1NJI V 1 ? 66   ? P14116  1    ? 66   ? 1    66   
21 21 1NJI W 1 ? 70   ? P10971  1    ? 70   ? 1    70   
22 22 1NJI X 1 ? 154  ? P14121  1    ? 154  ? 1    154  
23 23 1NJI Y 1 ? 91   ? P18138  1    ? 91   ? 1    91   
24 24 1NJI Z 1 ? 240  ? P12736  1    ? 240  ? 1    240  
25 25 1NJI 2 1 ? 56   ? P32410  1    ? 56   ? 1    56   
26 26 1NJI 3 1 ? 47   ? P22452  1    ? 48   ? 1    48   
27 27 1NJI 4 1 ? 92   ? P32411  1    ? 92   ? 1    92   
28 28 1NJI J 1 ? 167  ? 1NJI    1    ? 167  ? 1    167  
29 29 1NJI N 1 ? 194  ? 1NJI    1    ? 194  ? 1    194  
30 30 1NJI 1 1 ? 73   ? 1NJI    10   ? 82   ? 10   82   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
4 1NJI ?   D ?   ? UNP P20279 PRO 310 'SEE REMARK 999' ?   1 
4 1NJI ARG D 310 ? UNP P20279 PHE 311 'SEE REMARK 999' 310 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'    323.197 
CD  non-polymer         . 'CADMIUM ION'                ? 'Cd 2'              112.411 
CL  non-polymer         . 'CHLORIDE ION'               ? 'Cl -1'             35.453  
CLM non-polymer         . CHLORAMPHENICOL              ? 'C11 H12 Cl2 N2 O5' 323.129 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                        ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'              ? 'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'              24.305  
NA  non-polymer         . 'SODIUM ION'                 ? 'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1NJI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.13 
_exptl_crystal.density_percent_sol   60.74 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    
;PEG 6000, KCl, MgCl2, NH4Cl, Na Acetate, pH 5.8, 
VAPOR DIFFUSION, SITTING DROP at 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 KCl              ? ? ? 
1 2  1 NH4Cl            ? ? ? 
1 3  1 MgCl2            ? ? ? 
1 4  1 'sodium acetate' ? ? ? 
1 5  1 'PEG 6000'       ? ? ? 
1 6  2 KCl              ? ? ? 
1 7  2 NH4Cl            ? ? ? 
1 8  2 MgCl2            ? ? ? 
1 9  2 'sodium acetate' ? ? ? 
1 10 2 'PEG 6000'       ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2002-01-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     1NJI 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.92 
_reflns.number_obs                   393074 
_reflns.number_all                   393891 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.246 
_reflns.pdbx_Rsym_value              0.246 
_reflns.pdbx_netI_over_sigmaI        8.88 
_reflns.B_iso_Wilson_estimate        38.5 
_reflns.pdbx_redundancy              7.0 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.92 
_reflns_shell.d_res_low              2.97 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           0.965 
_reflns_shell.pdbx_Rsym_value        0.965 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      19931 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1NJI 
_refine.ls_number_reflns_obs                     347962 
_refine.ls_number_reflns_all                     360866 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               233703.41 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          0.209 
_refine.ls_R_factor_all                          0.209 
_refine.ls_R_factor_R_work                       0.176 
_refine.ls_R_factor_R_free                       0.209 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.0 
_refine.ls_number_reflns_R_free                  3391 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46.0 
_refine.aniso_B[1][1]                            -1.23 
_refine.aniso_B[2][2]                            -4.45 
_refine.aniso_B[3][3]                            5.68 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.3070 
_refine.solvent_model_param_bsol                 24.06 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JJ2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'same test set as 1JJ2' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1NJI 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.43 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28801 
_refine_hist.pdbx_number_atoms_nucleic_acid   61617 
_refine_hist.pdbx_number_atoms_ligand         251 
_refine_hist.number_atoms_solvent             7867 
_refine_hist.number_atoms_total               98536 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 15.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.41  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.15  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.95  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.39  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.18  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.11 
_refine_ls_shell.number_reflns_R_work             31832 
_refine_ls_shell.R_factor_R_work                  0.271 
_refine_ls_shell.percent_reflns_obs               89.7 
_refine_ls_shell.R_factor_R_free                  0.29 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            1.0 
_refine_ls_shell.number_reflns_R_free             318 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 RNA.PARAM           RNA.TOP       'X-RAY DIFFRACTION' 
2 PROT.PARAM          PROT.TOP      'X-RAY DIFFRACTION' 
3 ION.PARAM           ION.TOP       'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM     WATER_REP.TOP 'X-RAY DIFFRACTION' 
5 CHLORAMPHENIC.PARAM CLM.TOP       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1NJI 
_struct.title                     'Structure of chloramphenicol bound to the 50S ribosomal subunit' 
_struct.pdbx_descriptor           'large ribosomal subunit 50S' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NJI 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            '50S, antibiotic, chloramphenicol, LSU, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 31 ? 
GA N N 31 ? 
HA N N 31 ? 
IA N N 31 ? 
JA N N 31 ? 
KA N N 31 ? 
LA N N 31 ? 
MA N N 31 ? 
NA N N 31 ? 
OA N N 31 ? 
PA N N 31 ? 
QA N N 31 ? 
RA N N 31 ? 
SA N N 31 ? 
TA N N 31 ? 
UA N N 31 ? 
VA N N 31 ? 
WA N N 31 ? 
XA N N 31 ? 
YA N N 31 ? 
ZA N N 31 ? 
AB N N 31 ? 
BB N N 31 ? 
CB N N 31 ? 
DB N N 31 ? 
EB N N 31 ? 
FB N N 31 ? 
GB N N 31 ? 
HB N N 31 ? 
IB N N 31 ? 
JB N N 31 ? 
KB N N 31 ? 
LB N N 31 ? 
MB N N 31 ? 
NB N N 31 ? 
OB N N 31 ? 
PB N N 31 ? 
QB N N 31 ? 
RB N N 31 ? 
SB N N 31 ? 
TB N N 31 ? 
UB N N 31 ? 
VB N N 31 ? 
WB N N 31 ? 
XB N N 31 ? 
YB N N 31 ? 
ZB N N 31 ? 
AC N N 31 ? 
BC N N 31 ? 
CC N N 31 ? 
DC N N 31 ? 
EC N N 31 ? 
FC N N 31 ? 
GC N N 31 ? 
HC N N 31 ? 
IC N N 31 ? 
JC N N 31 ? 
KC N N 31 ? 
LC N N 31 ? 
MC N N 31 ? 
NC N N 31 ? 
OC N N 31 ? 
PC N N 31 ? 
QC N N 31 ? 
RC N N 31 ? 
SC N N 31 ? 
TC N N 31 ? 
UC N N 31 ? 
VC N N 31 ? 
WC N N 31 ? 
XC N N 31 ? 
YC N N 31 ? 
ZC N N 31 ? 
AD N N 31 ? 
BD N N 31 ? 
CD N N 31 ? 
DD N N 31 ? 
ED N N 31 ? 
FD N N 31 ? 
GD N N 31 ? 
HD N N 31 ? 
ID N N 31 ? 
JD N N 31 ? 
KD N N 31 ? 
LD N N 31 ? 
MD N N 31 ? 
ND N N 31 ? 
OD N N 31 ? 
PD N N 31 ? 
QD N N 31 ? 
RD N N 31 ? 
SD N N 31 ? 
TD N N 31 ? 
UD N N 31 ? 
VD N N 31 ? 
WD N N 31 ? 
XD N N 31 ? 
YD N N 31 ? 
ZD N N 31 ? 
AE N N 31 ? 
BE N N 31 ? 
CE N N 31 ? 
DE N N 31 ? 
EE N N 31 ? 
FE N N 31 ? 
GE N N 31 ? 
HE N N 31 ? 
IE N N 31 ? 
JE N N 32 ? 
KE N N 32 ? 
LE N N 33 ? 
ME N N 33 ? 
NE N N 33 ? 
OE N N 33 ? 
PE N N 33 ? 
QE N N 33 ? 
RE N N 33 ? 
SE N N 33 ? 
TE N N 33 ? 
UE N N 33 ? 
VE N N 33 ? 
WE N N 33 ? 
XE N N 33 ? 
YE N N 33 ? 
ZE N N 33 ? 
AF N N 33 ? 
BF N N 33 ? 
CF N N 33 ? 
DF N N 33 ? 
EF N N 33 ? 
FF N N 33 ? 
GF N N 33 ? 
HF N N 33 ? 
IF N N 33 ? 
JF N N 33 ? 
KF N N 33 ? 
LF N N 33 ? 
MF N N 33 ? 
NF N N 33 ? 
OF N N 33 ? 
PF N N 33 ? 
QF N N 33 ? 
RF N N 33 ? 
SF N N 33 ? 
TF N N 33 ? 
UF N N 33 ? 
VF N N 33 ? 
WF N N 33 ? 
XF N N 33 ? 
YF N N 33 ? 
ZF N N 33 ? 
AG N N 33 ? 
BG N N 33 ? 
CG N N 33 ? 
DG N N 33 ? 
EG N N 33 ? 
FG N N 33 ? 
GG N N 33 ? 
HG N N 33 ? 
IG N N 33 ? 
JG N N 33 ? 
KG N N 33 ? 
LG N N 33 ? 
MG N N 33 ? 
NG N N 33 ? 
OG N N 33 ? 
PG N N 33 ? 
QG N N 33 ? 
RG N N 33 ? 
SG N N 33 ? 
TG N N 33 ? 
UG N N 33 ? 
VG N N 33 ? 
WG N N 33 ? 
XG N N 33 ? 
YG N N 33 ? 
ZG N N 33 ? 
AH N N 33 ? 
BH N N 33 ? 
CH N N 33 ? 
DH N N 33 ? 
EH N N 34 ? 
FH N N 34 ? 
GH N N 34 ? 
HH N N 34 ? 
IH N N 34 ? 
JH N N 34 ? 
KH N N 34 ? 
LH N N 34 ? 
MH N N 34 ? 
NH N N 35 ? 
OH N N 31 ? 
PH N N 33 ? 
QH N N 33 ? 
RH N N 31 ? 
SH N N 33 ? 
TH N N 34 ? 
UH N N 31 ? 
VH N N 34 ? 
WH N N 33 ? 
XH N N 33 ? 
YH N N 33 ? 
ZH N N 33 ? 
AI N N 34 ? 
BI N N 34 ? 
CI N N 34 ? 
DI N N 31 ? 
EI N N 33 ? 
FI N N 34 ? 
GI N N 33 ? 
HI N N 34 ? 
II N N 34 ? 
JI N N 36 ? 
KI N N 34 ? 
LI N N 33 ? 
MI N N 34 ? 
NI N N 33 ? 
OI N N 33 ? 
PI N N 34 ? 
QI N N 33 ? 
RI N N 31 ? 
SI N N 33 ? 
TI N N 36 ? 
UI N N 31 ? 
VI N N 34 ? 
WI N N 31 ? 
XI N N 36 ? 
YI N N 36 ? 
ZI N N 31 ? 
AJ N N 36 ? 
BJ N N 34 ? 
CJ N N 37 ? 
DJ N N 37 ? 
EJ N N 37 ? 
FJ N N 37 ? 
GJ N N 37 ? 
HJ N N 37 ? 
IJ N N 37 ? 
JJ N N 37 ? 
KJ N N 37 ? 
LJ N N 37 ? 
MJ N N 37 ? 
NJ N N 37 ? 
OJ N N 37 ? 
PJ N N 37 ? 
QJ N N 37 ? 
RJ N N 37 ? 
SJ N N 37 ? 
TJ N N 37 ? 
UJ N N 37 ? 
VJ N N 37 ? 
WJ N N 37 ? 
XJ N N 37 ? 
YJ N N 37 ? 
ZJ N N 37 ? 
AK N N 37 ? 
BK N N 37 ? 
CK N N 37 ? 
DK N N 37 ? 
EK N N 37 ? 
FK N N 37 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  4   ? ARG C  11  ? ILE C 4   ARG C 11  1 ? 8  
HELX_P HELX_P2   2   GLY C  12  ? GLY C  12  ? GLY C 12  GLY C 12  5 ? 1  
HELX_P HELX_P3   3   THR C  13  ? ARG C  17  ? THR C 13  ARG C 17  5 ? 5  
HELX_P HELX_P4   4   PRO C  19  ? TYR C  23  ? PRO C 19  TYR C 23  5 ? 5  
HELX_P HELX_P5   5   GLY C  163 ? LYS C  167 ? GLY C 163 LYS C 167 5 ? 5  
HELX_P HELX_P6   6   LYS C  171 ? LYS C  180 ? LYS C 171 LYS C 180 1 ? 10 
HELX_P HELX_P7   7   ARG C  190 ? MET C  194 ? ARG C 190 MET C 194 5 ? 5  
HELX_P HELX_P8   8   ASN C  195 ? HIS C  199 ? ASN C 195 HIS C 199 5 ? 5  
HELX_P HELX_P9   9   GLU D  108 ? THR D  112 ? GLU D 108 THR D 112 5 ? 5  
HELX_P HELX_P10  10  ASP D  120 ? GLY D  135 ? ASP D 120 GLY D 135 1 ? 16 
HELX_P HELX_P11  11  VAL D  147 ? VAL D  151 ? VAL D 147 VAL D 151 5 ? 5  
HELX_P HELX_P12  12  SER D  170 ? GLY D  185 ? SER D 170 GLY D 185 1 ? 16 
HELX_P HELX_P13  13  ALA D  189 ? PHE D  194 ? ALA D 189 PHE D 194 1 ? 6  
HELX_P HELX_P14  14  GLY D  213 ? GLY D  219 ? GLY D 213 GLY D 219 1 ? 7  
HELX_P HELX_P15  15  LYS D  224 ? GLN D  230 ? LYS D 224 GLN D 230 5 ? 7  
HELX_P HELX_P16  16  PRO E  19  ? THR E  24  ? PRO E 19  THR E 24  5 ? 6  
HELX_P HELX_P17  17  ARG E  27  ? ASN E  41  ? ARG E 27  ASN E 41  1 ? 15 
HELX_P HELX_P18  18  ASN E  103 ? THR E  118 ? ASN E 103 THR E 118 1 ? 16 
HELX_P HELX_P19  19  ASP E  120 ? ARG E  127 ? ASP E 120 ARG E 127 1 ? 8  
HELX_P HELX_P20  20  ASP E  142 ? LEU E  147 ? ASP E 142 LEU E 147 5 ? 6  
HELX_P HELX_P21  21  LYS E  149 ? LEU E  160 ? LYS E 149 LEU E 160 1 ? 12 
HELX_P HELX_P22  22  VAL E  162 ? ASP E  170 ? VAL E 162 ASP E 170 1 ? 9  
HELX_P HELX_P23  23  GLY E  177 ? GLY E  183 ? GLY E 177 GLY E 183 5 ? 7  
HELX_P HELX_P24  24  SER E  201 ? ASN E  206 ? SER E 201 ASN E 206 1 ? 6  
HELX_P HELX_P25  25  ASN E  219 ? ALA E  224 ? ASN E 219 ALA E 224 1 ? 6  
HELX_P HELX_P26  26  PRO E  225 ? ALA E  228 ? PRO E 225 ALA E 228 5 ? 4  
HELX_P HELX_P27  27  GLU E  237 ? ALA E  244 ? GLU E 237 ALA E 244 1 ? 8  
HELX_P HELX_P28  28  ALA F  37  ? GLY F  46  ? ALA F 37  GLY F 46  1 ? 10 
HELX_P HELX_P29  29  ASP F  77  ? LEU F  88  ? ASP F 77  LEU F 88  1 ? 12 
HELX_P HELX_P30  30  PRO F  89  ? ALA F  91  ? PRO F 89  ALA F 91  5 ? 3  
HELX_P HELX_P31  31  GLY F  138 ? LYS F  143 ? GLY F 138 LYS F 143 5 ? 6  
HELX_P HELX_P32  32  PRO F  152 ? ARG F  156 ? PRO F 152 ARG F 156 5 ? 5  
HELX_P HELX_P33  33  ASN F  158 ? SER F  168 ? ASN F 158 SER F 168 1 ? 11 
HELX_P HELX_P34  34  ASN G  55  ? THR G  77  ? ASN G 55  THR G 77  1 ? 23 
HELX_P HELX_P35  35  ASN G  106 ? GLU G  110 ? ASN G 106 GLU G 110 5 ? 5  
HELX_P HELX_P36  36  ASP G  137 ? LEU G  151 ? ASP G 137 LEU G 151 1 ? 15 
HELX_P HELX_P37  37  PRO H  9   ? GLY H  27  ? PRO H 9   GLY H 27  1 ? 19 
HELX_P HELX_P38  38  GLY H  32  ? GLY H  43  ? GLY H 32  GLY H 43  1 ? 12 
HELX_P HELX_P39  39  GLU H  57  ? HIS H  62  ? GLU H 57  HIS H 62  1 ? 6  
HELX_P HELX_P40  40  HIS H  62  ? GLU H  69  ? HIS H 62  GLU H 69  1 ? 8  
HELX_P HELX_P41  41  GLN H  79  ? ALA H  87  ? GLN H 79  ALA H 87  1 ? 9  
HELX_P HELX_P42  42  ALA H  104 ? LEU H  118 ? ALA H 104 LEU H 118 1 ? 15 
HELX_P HELX_P43  43  PRO I  13  ? SER I  29  ? PRO I 13  SER I 29  1 ? 17 
HELX_P HELX_P44  44  ARG I  63  ? ASP I  72  ? ARG I 63  ASP I 72  1 ? 10 
HELX_P HELX_P45  45  PRO J  2   ? TYR J  6   ? PRO J 2   TYR J 6   5 ? 5  
HELX_P HELX_P46  46  HIS J  58  ? ARG J  70  ? HIS J 58  ARG J 70  1 ? 13 
HELX_P HELX_P47  47  ASN J  141 ? LYS J  150 ? ASN J 141 LYS J 150 1 ? 10 
HELX_P HELX_P48  48  ILE K  18  ? LEU K  31  ? ILE K 18  LEU K 31  1 ? 14 
HELX_P HELX_P49  49  ASN K  40  ? ARG K  43  ? ASN K 40  ARG K 43  5 ? 4  
HELX_P HELX_P50  50  ARG K  49  ? ILE K  63  ? ARG K 49  ILE K 63  1 ? 15 
HELX_P HELX_P51  51  ARG K  74  ? GLY K  85  ? ARG K 74  GLY K 85  1 ? 12 
HELX_P HELX_P52  52  LYS K  91  ? SER K  100 ? LYS K 91  SER K 100 1 ? 10 
HELX_P HELX_P53  53  ASP K  122 ? ASN K  126 ? ASP K 122 ASN K 126 5 ? 5  
HELX_P HELX_P54  54  LEU K  132 ? LEU K  139 ? LEU K 132 LEU K 139 1 ? 8  
HELX_P HELX_P55  55  GLU L  116 ? ALA L  118 ? GLU L 116 ALA L 118 5 ? 3  
HELX_P HELX_P56  56  PHE L  121 ? SER L  126 ? PHE L 121 SER L 126 1 ? 6  
HELX_P HELX_P57  57  SER M  2   ? GLN M  7   ? SER M 2   GLN M 7   1 ? 6  
HELX_P HELX_P58  58  GLY M  23  ? GLY M  28  ? GLY M 23  GLY M 28  5 ? 6  
HELX_P HELX_P59  59  PRO M  54  ? GLN M  58  ? PRO M 54  GLN M 58  5 ? 5  
HELX_P HELX_P60  60  VAL M  66  ? ASN M  72  ? VAL M 66  ASN M 72  1 ? 7  
HELX_P HELX_P61  61  VAL M  93  ? VAL M  97  ? VAL M 93  VAL M 97  1 ? 5  
HELX_P HELX_P62  62  SER M  126 ? ALA M  136 ? SER M 126 ALA M 136 1 ? 11 
HELX_P HELX_P63  63  SER N  3   ? ARG N  14  ? SER N 3   ARG N 14  1 ? 12 
HELX_P HELX_P64  64  GLU N  17  ? ARG N  32  ? GLU N 17  ARG N 32  1 ? 16 
HELX_P HELX_P65  65  ARG N  45  ? GLY N  53  ? ARG N 45  GLY N 53  1 ? 9  
HELX_P HELX_P66  66  ARG N  82  ? MET N  86  ? ARG N 82  MET N 86  5 ? 5  
HELX_P HELX_P67  67  ASN N  96  ? PHE N  109 ? ASN N 96  PHE N 109 1 ? 14 
HELX_P HELX_P68  68  LEU N  147 ? ARG N  156 ? LEU N 147 ARG N 156 5 ? 10 
HELX_P HELX_P69  69  LEU N  157 ? GLY N  162 ? LEU N 157 GLY N 162 5 ? 6  
HELX_P HELX_P70  70  THR N  164 ? ARG N  171 ? THR N 164 ARG N 171 1 ? 8  
HELX_P HELX_P71  71  LEU N  187 ? GLY N  191 ? LEU N 187 GLY N 191 5 ? 5  
HELX_P HELX_P72  72  MET O  10  ? GLU O  15  ? MET O 10  GLU O 15  1 ? 6  
HELX_P HELX_P73  73  ASP O  19  ? SER O  29  ? ASP O 19  SER O 29  1 ? 11 
HELX_P HELX_P74  74  SER O  64  ? GLY O  70  ? SER O 64  GLY O 70  5 ? 7  
HELX_P HELX_P75  75  ASN O  77  ? ALA O  95  ? ASN O 77  ALA O 95  1 ? 19 
HELX_P HELX_P76  76  SER O  113 ? ALA O  125 ? SER O 113 ALA O 125 1 ? 13 
HELX_P HELX_P77  77  ASN O  132 ? LEU O  136 ? ASN O 132 LEU O 136 5 ? 5  
HELX_P HELX_P78  78  TRP O  139 ? GLY O  144 ? TRP O 139 GLY O 144 1 ? 6  
HELX_P HELX_P79  79  GLY O  144 ? GLN O  153 ? GLY O 144 GLN O 153 1 ? 10 
HELX_P HELX_P80  80  LEU O  168 ? LEU O  180 ? LEU O 168 LEU O 180 1 ? 13 
HELX_P HELX_P81  81  ASN P  4   ? SER P  21  ? ASN P 4   SER P 21  1 ? 18 
HELX_P HELX_P82  82  ALA P  24  ? LYS P  35  ? ALA P 24  LYS P 35  1 ? 12 
HELX_P HELX_P83  83  PRO P  36  ? HIS P  40  ? PRO P 36  HIS P 40  5 ? 5  
HELX_P HELX_P84  84  LEU P  45  ? ALA P  52  ? LEU P 45  ALA P 52  1 ? 8  
HELX_P HELX_P85  85  SER P  82  ? GLY P  93  ? SER P 82  GLY P 93  1 ? 12 
HELX_P HELX_P86  86  LEU P  98  ? ASN P  105 ? LEU P 98  ASN P 105 1 ? 8  
HELX_P HELX_P87  87  LEU Q  3   ? LEU Q  14  ? LEU Q 3   LEU Q 14  1 ? 12 
HELX_P HELX_P88  88  GLY Q  17  ? ASN Q  19  ? GLY Q 17  ASN Q 19  5 ? 3  
HELX_P HELX_P89  89  ARG Q  27  ? ASP Q  33  ? ARG Q 27  ASP Q 33  1 ? 7  
HELX_P HELX_P90  90  THR Q  36  ? GLU Q  46  ? THR Q 36  GLU Q 46  1 ? 11 
HELX_P HELX_P91  91  ARG Q  59  ? LYS Q  71  ? ARG Q 59  LYS Q 71  1 ? 13 
HELX_P HELX_P92  92  GLY Q  76  ? ARG Q  80  ? GLY Q 76  ARG Q 80  5 ? 5  
HELX_P HELX_P93  93  LYS Q  83  ? GLN Q  88  ? LYS Q 83  GLN Q 88  1 ? 6  
HELX_P HELX_P94  94  ASN Q  89  ? GLU Q  111 ? ASN Q 89  GLU Q 111 1 ? 23 
HELX_P HELX_P95  95  SER Q  115 ? GLY Q  128 ? SER Q 115 GLY Q 128 1 ? 14 
HELX_P HELX_P96  96  SER Q  133 ? ASP Q  142 ? SER Q 133 ASP Q 142 1 ? 10 
HELX_P HELX_P97  97  PRO R  25  ? VAL R  30  ? PRO R 25  VAL R 30  5 ? 6  
HELX_P HELX_P98  98  HIS R  53  ? ASP R  57  ? HIS R 53  ASP R 57  5 ? 5  
HELX_P HELX_P99  99  THR R  87  ? ALA R  89  ? THR R 87  ALA R 89  5 ? 3  
HELX_P HELX_P100 100 ASP S  9   ? ASP S  11  ? ASP S 9   ASP S 11  5 ? 3  
HELX_P HELX_P101 101 SER S  24  ? LYS S  36  ? SER S 24  LYS S 36  1 ? 13 
HELX_P HELX_P102 102 THR S  39  ? GLU S  52  ? THR S 39  GLU S 52  1 ? 14 
HELX_P HELX_P103 103 PRO S  81  ? HIS S  101 ? PRO S 81  HIS S 101 1 ? 21 
HELX_P HELX_P104 104 ALA S  129 ? GLY S  131 ? ALA S 129 GLY S 131 5 ? 3  
HELX_P HELX_P105 105 THR T  11  ? ASN T  22  ? THR T 11  ASN T 22  1 ? 12 
HELX_P HELX_P106 106 SER T  33  ? ASP T  46  ? SER T 33  ASP T 46  1 ? 14 
HELX_P HELX_P107 107 ASP T  73  ? ARG T  80  ? ASP T 73  ARG T 80  1 ? 8  
HELX_P HELX_P108 108 GLN U  3   ? ARG U  13  ? GLN U 3   ARG U 13  1 ? 11 
HELX_P HELX_P109 109 PRO U  15  ? GLN U  22  ? PRO U 15  GLN U 22  5 ? 8  
HELX_P HELX_P110 110 SER U  28  ? GLY U  36  ? SER U 28  GLY U 36  1 ? 9  
HELX_P HELX_P111 111 ASP U  92  ? SER U  94  ? ASP U 92  SER U 94  5 ? 3  
HELX_P HELX_P112 112 ASP U  105 ? SER U  114 ? ASP U 105 SER U 114 1 ? 10 
HELX_P HELX_P113 113 SER V  33  ? LEU V  42  ? SER V 33  LEU V 42  1 ? 10 
HELX_P HELX_P114 114 GLU V  45  ? LEU V  49  ? GLU V 45  LEU V 49  5 ? 5  
HELX_P HELX_P115 115 HIS W  4   ? ASP W  10  ? HIS W 4   ASP W 10  1 ? 7  
HELX_P HELX_P116 116 THR W  12  ? ALA W  36  ? THR W 12  ALA W 36  1 ? 25 
HELX_P HELX_P117 117 PRO W  43  ? GLY W  64  ? PRO W 43  GLY W 64  1 ? 22 
HELX_P HELX_P118 118 HIS X  14  ? LEU X  24  ? HIS X 14  LEU X 24  1 ? 11 
HELX_P HELX_P119 119 THR X  38  ? ASN X  49  ? THR X 38  ASN X 49  1 ? 12 
HELX_P HELX_P120 120 SER X  58  ? ALA X  70  ? SER X 58  ALA X 70  1 ? 13 
HELX_P HELX_P121 121 ASP X  80  ? THR X  88  ? ASP X 80  THR X 88  1 ? 9  
HELX_P HELX_P122 122 ASP X  92  ? SER X  102 ? ASP X 92  SER X 102 1 ? 11 
HELX_P HELX_P123 123 PRO X  131 ? GLY X  135 ? PRO X 131 GLY X 135 5 ? 5  
HELX_P HELX_P124 124 ASP X  142 ? MET X  153 ? ASP X 142 MET X 153 1 ? 12 
HELX_P HELX_P125 125 ARG Y  15  ? GLU Y  20  ? ARG Y 15  GLU Y 20  5 ? 6  
HELX_P HELX_P126 126 PRO Y  21  ? HIS Y  23  ? PRO Y 21  HIS Y 23  5 ? 3  
HELX_P HELX_P127 127 LYS Y  24  ? PHE Y  41  ? LYS Y 24  PHE Y 41  1 ? 18 
HELX_P HELX_P128 128 ASP Y  44  ? ASP Y  46  ? ASP Y 44  ASP Y 46  5 ? 3  
HELX_P HELX_P129 129 ASP Y  51  ? ALA Y  60  ? ASP Y 51  ALA Y 60  1 ? 10 
HELX_P HELX_P130 130 SER Z  110 ? GLY Z  124 ? SER Z 110 GLY Z 124 1 ? 15 
HELX_P HELX_P131 131 GLU Z  165 ? ARG Z  169 ? GLU Z 165 ARG Z 169 5 ? 5  
HELX_P HELX_P132 132 VAL Z  190 ? GLU Z  194 ? VAL Z 190 GLU Z 194 5 ? 5  
HELX_P HELX_P133 133 GLY Z  210 ? ALA Z  224 ? GLY Z 210 ALA Z 224 1 ? 15 
HELX_P HELX_P134 134 ARG AA 1   ? GLY AA 6   ? ARG 1 10  GLY 1 15  5 ? 6  
HELX_P HELX_P135 135 GLY AA 10  ? LYS AA 26  ? GLY 1 19  LYS 1 35  1 ? 17 
HELX_P HELX_P136 136 THR AA 64  ? ALA AA 73  ? THR 1 73  ALA 1 82  1 ? 10 
HELX_P HELX_P137 137 GLY BA 4   ? GLY BA 9   ? GLY 2 4   GLY 2 9   1 ? 6  
HELX_P HELX_P138 138 TYR BA 48  ? SER BA 52  ? TYR 2 48  SER 2 52  5 ? 5  
HELX_P HELX_P139 139 SER CA 4   ? ASN CA 18  ? SER 3 4   ASN 3 18  1 ? 15 
HELX_P HELX_P140 140 PRO CA 22  ? THR CA 29  ? PRO 3 22  THR 3 29  1 ? 8  
HELX_P HELX_P141 141 LYS DA 34  ? SER DA 44  ? LYS 4 34  SER 4 44  1 ? 11 
HELX_P HELX_P142 142 ASP DA 49  ? LYS DA 54  ? ASP 4 49  LYS 4 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1    metalc ? ? WI MG  .    MG    ? ? ? 1_555 AA ARG 4    NH1   ? ? 1 MG  8105 1 ARG 13   1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc2    metalc ? ? XI CD  .    CD    ? ? ? 1_555 AA CYS 51   SG    ? ? 1 CD  8403 1 CYS 60   1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc3    metalc ? ? XI CD  .    CD    ? ? ? 1_555 AA CYS 30   SG    ? ? 1 CD  8403 1 CYS 39   1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc4    metalc ? ? XI CD  .    CD    ? ? ? 1_555 AA CYS 33   SG    ? ? 1 CD  8403 1 CYS 42   1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc5    metalc ? ? XI CD  .    CD    ? ? ? 1_555 AA CYS 48   SG    ? ? 1 CD  8403 1 CYS 57   1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc6    metalc ? ? YI CD  .    CD    ? ? ? 1_555 BA CYS 19   SG    ? ? 2 CD  8402 2 CYS 19   1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc7    metalc ? ? YI CD  .    CD    ? ? ? 1_555 BA CYS 34   SG    ? ? 2 CD  8402 2 CYS 34   1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc8    metalc ? ? YI CD  .    CD    ? ? ? 1_555 BA CYS 37   SG    ? ? 2 CD  8402 2 CYS 37   1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc9    metalc ? ? YI CD  .    CD    ? ? ? 1_555 BA CYS 22   SG    ? ? 2 CD  8402 2 CYS 22   1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc10   metalc ? ? ZI MG  .    MG    ? ? ? 1_555 DA ASP 49   OD2   ? ? 4 MG  8078 4 ASP 49   1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc11   metalc ? ? ZI MG  .    MG    ? ? ? 1_555 DA GLY 45   O     ? ? 4 MG  8078 4 GLY 45   1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc12   metalc ? ? ZI MG  .    MG    ? ? ? 1_555 DA GLY 47   O     ? ? 4 MG  8078 4 GLY 47   1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc13   metalc ? ? ZI MG  .    MG    ? ? ? 1_555 DA ASP 49   OD1   ? ? 4 MG  8078 4 ASP 49   1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc14   metalc ? ? ZI MG  .    MG    ? ? ? 1_555 FK HOH .    O     ? ? 4 MG  8078 4 HOH 8524 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc15   metalc ? ? ZI MG  .    MG    ? ? ? 1_555 FK HOH .    O     ? ? 4 MG  8078 4 HOH 8572 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc16   metalc ? ? AJ CD  .    CD    ? ? ? 1_555 DA CYS 71   SG    ? ? 4 CD  8404 4 CYS 71   1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc17   metalc ? ? AJ CD  .    CD    ? ? ? 1_555 DA CYS 74   SG    ? ? 4 CD  8404 4 CYS 74   1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc18   metalc ? ? AJ CD  .    CD    ? ? ? 1_555 DA CYS 11   SG    ? ? 4 CD  8404 4 CYS 11   1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc19   metalc ? ? AJ CD  .    CD    ? ? ? 1_555 DA CYS 14   SG    ? ? 4 CD  8404 4 CYS 14   1_555 ? ? ? ? ? ? ? 2.703 ? 
metalc20   metalc ? ? EA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8001 A HOH 9174 1_555 ? ? ? ? ? ? ? 1.601 ? 
metalc21   metalc ? ? EA MG  .    MG    ? ? ? 1_555 A  A   2482 OP2   ? ? A MG  8001 A A   2483 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc22   metalc ? ? EA MG  .    MG    ? ? ? 1_555 A  C   2532 OP2   ? ? A MG  8001 A C   2533 1_555 ? ? ? ? ? ? ? 1.962 ? 
metalc23   metalc ? ? EA MG  .    MG    ? ? ? 1_555 A  C   2533 OP2   ? ? A MG  8001 A C   2534 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc24   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  G   626  O6    ? ? A MG  8002 A G   627  1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc25   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  A   2482 OP1   ? ? A MG  8002 A A   2483 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc26   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  C   2533 OP1   ? ? A MG  8002 A C   2534 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc27   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  G   876  OP2   ? ? A MG  8003 A G   877  1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc28   metalc ? ? GA MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8003 C HOH 8511 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc29   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  A   2623 OP1   ? ? A MG  8003 A A   2624 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc30   metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8003 A HOH 9820 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc31   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  A   875  OP2   ? ? A MG  8003 A A   876  1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc32   metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 9048 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc33   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  G   455  O6    ? ? A MG  8004 A G   456  1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc34   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   458  OP1   ? ? A MG  8004 A A   459  1_555 ? ? ? ? ? ? ? 1.809 ? 
metalc35   metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 9772 1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc36   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   1835 OP1   ? ? A MG  8005 A A   1836 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc37   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   1838 OP2   ? ? A MG  8005 A A   1839 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc38   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  U   1837 OP1   ? ? A MG  8005 A U   1838 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc39   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  U   820  OP2   ? ? A MG  8006 A U   821  1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc40   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  G   853  OP1   ? ? A MG  8006 A G   854  1_555 ? ? ? ? ? ? ? 1.875 ? 
metalc41   metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8006 A HOH 9804 1_555 ? ? ? ? ? ? ? 1.933 ? 
metalc42   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  C   821  OP2   ? ? A MG  8006 A C   822  1_555 ? ? ? ? ? ? ? 1.914 ? 
metalc43   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  U   831  OP2   ? ? A MG  8007 A U   832  1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc44   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  A   1838 OP1   ? ? A MG  8007 A A   1839 1_555 ? ? ? ? ? ? ? 1.812 ? 
metalc45   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  A   1839 OP2   ? ? A MG  8007 A A   1840 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc46   metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8007 A HOH 9007 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc47   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  C   2463 OP1   ? ? A MG  8008 A C   2464 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc48   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  U   918  OP1   ? ? A MG  8008 A U   919  1_555 ? ? ? ? ? ? ? 1.790 ? 
metalc49   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   2464 OP1   ? ? A MG  8008 A A   2465 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc50   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  G   2610 OP1   ? ? A MG  8009 A G   2611 1_555 ? ? ? ? ? ? ? 1.912 ? 
metalc51   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  A   2611 OP1   ? ? A MG  8009 A A   2612 1_555 ? ? ? ? ? ? ? 1.818 ? 
metalc52   metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8010 A HOH 9269 1_555 ? ? ? ? ? ? ? 1.722 ? 
metalc53   metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8010 A HOH 9357 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc54   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  G   835  OP1   ? ? A MG  8010 A G   836  1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc55   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  U   2614 OP1   ? ? A MG  8010 A U   2615 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc56   metalc ? ? NA MG  .    MG    ? ? ? 1_555 D  GLN 230  OE1   ? ? A MG  8010 D GLN 230  1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc57   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  G   823  N7    ? ? A MG  8011 A G   824  1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc58   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  G   853  N7    ? ? A MG  8011 A G   854  1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc59   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   27   OP1   ? ? A MG  8012 A G   28   1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc60   metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8012 A HOH 9040 1_555 ? ? ? ? ? ? ? 1.550 ? 
metalc61   metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8012 A HOH 9629 1_555 ? ? ? ? ? ? ? 1.876 ? 
metalc62   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   876  OP1   ? ? A MG  8013 A G   877  1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc63   metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8013 A HOH 9021 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc64   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   2622 OP1   ? ? A MG  8013 A G   2623 1_555 ? ? ? ? ? ? ? 1.825 ? 
metalc65   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   2101 OP2   ? ? A MG  8014 A G   2102 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc66   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   2536 OP2   ? ? A MG  8014 A G   2537 1_555 ? ? ? ? ? ? ? 1.867 ? 
metalc67   metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8014 A HOH 9034 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc68   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  A   843  OP1   ? ? A MG  8015 A A   844  1_555 ? ? ? ? ? ? ? 1.765 ? 
metalc69   metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8015 A HOH 9024 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc70   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  A   1688 OP1   ? ? A MG  8015 A A   1689 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc71   metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8015 A HOH 9005 1_555 ? ? ? ? ? ? ? 1.647 ? 
metalc72   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   1503 OP1   ? ? A MG  8016 A A   1504 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc73   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   1677 OP1   ? ? A MG  8016 A A   1678 1_555 ? ? ? ? ? ? ? 1.940 ? 
metalc74   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  C   1678 OP2   ? ? A MG  8016 A C   1679 1_555 ? ? ? ? ? ? ? 1.892 ? 
metalc75   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  G   455  OP2   ? ? A MG  8017 A G   456  1_555 ? ? ? ? ? ? ? 1.916 ? 
metalc76   metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8017 A HOH 9408 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc77   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  G   1291 OP2   ? ? A MG  8018 A G   1292 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc78   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  A   1290 OP1   ? ? A MG  8018 A A   1291 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc79   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  A   2010 OP2   ? ? A MG  8019 A A   2011 1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc80   metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 9124 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc81   metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 9121 1_555 ? ? ? ? ? ? ? 1.752 ? 
metalc82   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  C   1829 OP1   ? ? A MG  8020 A C   1830 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc83   metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 9194 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc84   metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8021 A HOH 9958 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc85   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  G   2303 OP2   ? ? A MG  8021 A G   2304 1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc86   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8022 A HOH 9450 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc87   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8022 A HOH 9110 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc88   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  G   2096 OP2   ? ? A MG  8022 A G   2097 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc89   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  G   2539 OP1   ? ? A MG  8022 A G   2540 1_555 ? ? ? ? ? ? ? 1.924 ? 
metalc90   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2616 OP2   ? ? A MG  8023 A G   2617 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc91   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2617 OP2   ? ? A MG  8023 A G   2618 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc92   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  A   1380 N7    ? ? A MG  8024 A A   1381 1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc93   metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8024 A HOH 9931 1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc94   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  G   1120 OP2   ? ? A MG  8025 A G   1121 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc95   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  U   1119 OP2   ? ? A MG  8025 A U   1120 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc96   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  G   2608 OP1   ? ? A MG  8026 A G   2609 1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc97   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  C   2607 OP1   ? ? A MG  8026 A C   2608 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc98   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  U   2609 OP2   ? ? A MG  8026 A U   2610 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc99   metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8026 A HOH 9387 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc100  metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  C   239  OP1   ? ? A MG  8027 A C   240  1_555 ? ? ? ? ? ? ? 1.818 ? 
metalc101  metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  G   268  O6    ? ? A MG  8027 A G   269  1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc102  metalc ? ? EB MG  .    MG    ? ? ? 1_555 PJ HOH .    O     ? ? A MG  8027 N HOH 8641 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc103  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 9568 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc104  metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  A   1447 OP2   ? ? A MG  8028 A A   1448 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc105  metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  U   1676 O4    ? ? A MG  8028 A U   1677 1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc106  metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  C   1678 OP1   ? ? A MG  8029 A C   1679 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc107  metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  U   1502 OP1   ? ? A MG  8029 A U   1503 1_555 ? ? ? ? ? ? ? 1.833 ? 
metalc108  metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  U   1748 OP2   ? ? A MG  8030 A U   1749 1_555 ? ? ? ? ? ? ? 2.026 ? 
metalc109  metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  U   1747 OP1   ? ? A MG  8030 A U   1748 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc110  metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   776  OP2   ? ? A MG  8031 A U   777  1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc111  metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  C   777  OP2   ? ? A MG  8031 A C   778  1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc112  metalc ? ? IB MG  .    MG    ? ? ? 1_555 FF NA  .    NA    ? ? A MG  8031 A NA  8325 1_555 ? ? ? ? ? ? ? 3.133 ? 
metalc113  metalc ? ? JB MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8032 C HOH 8629 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc114  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 9984 1_555 ? ? ? ? ? ? ? 1.869 ? 
metalc115  metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  U   2114 OP1   ? ? A MG  8032 A U   2115 1_555 ? ? ? ? ? ? ? 1.852 ? 
metalc116  metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  A   1746 OP2   ? ? A MG  8033 A A   1747 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc117  metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  G   2584 OP1   ? ? A MG  8033 A G   2585 1_555 ? ? ? ? ? ? ? 1.879 ? 
metalc118  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8033 A HOH 9668 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc119  metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  U   1747 OP2   ? ? A MG  8033 A U   1748 1_555 ? ? ? ? ? ? ? 1.909 ? 
metalc120  metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  U   1748 O4    ? ? A MG  8033 A U   1749 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc121  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  A   2302 OP1   ? ? A MG  8034 A A   2303 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc122  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  A   2301 OP1   ? ? A MG  8034 A A   2302 1_555 ? ? ? ? ? ? ? 1.909 ? 
metalc123  metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  G   1483 OP2   ? ? A MG  8035 A G   1484 1_555 ? ? ? ? ? ? ? 1.883 ? 
metalc124  metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  G   955  OP2   ? ? A MG  8036 A G   956  1_555 ? ? ? ? ? ? ? 1.824 ? 
metalc125  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8036 A HOH 9362 1_555 ? ? ? ? ? ? ? 1.770 ? 
metalc126  metalc ? ? OB MG  .    MG    ? ? ? 1_555 A  A   2552 OP2   ? ? A MG  8037 A A   2553 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc127  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 9079 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc128  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 9279 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc129  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8039 A HOH 9904 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc130  metalc ? ? QB MG  .    MG    ? ? ? 1_555 A  U   114  OP2   ? ? A MG  8039 A U   115  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc131  metalc ? ? RB MG  .    MG    ? ? ? 1_555 A  U   391  OP2   ? ? A MG  8040 A U   392  1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc132  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8040 A HOH 9682 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc133  metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  A   226  "O2'" ? ? A MG  8041 A A   227  1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc134  metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  C   227  "O4'" ? ? A MG  8041 A C   228  1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc135  metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  G   195  OP1   ? ? A MG  8041 A G   196  1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc136  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  U   1308 O2    ? ? A MG  8042 A U   1309 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc137  metalc ? ? TB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8042 A HOH 9429 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc138  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  U   1345 O2    ? ? A MG  8042 A U   1346 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc139  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  G   815  O6    ? ? A MG  8043 A G   816  1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc140  metalc ? ? UB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8043 A HOH 9808 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc141  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? A MG  8043 A G   817  1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc142  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  C   2047 OP1   ? ? A MG  8044 A C   2048 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc143  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  A   2088 OP1   ? ? A MG  8044 A A   2089 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc144  metalc ? ? VB MG  .    MG    ? ? ? 1_555 S  GLY 65   O     ? ? A MG  8044 S GLY 65   1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc145  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  G   1978 OP2   ? ? A MG  8045 A G   1979 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc146  metalc ? ? XB MG  .    MG    ? ? ? 1_555 A  G   1793 N7    ? ? A MG  8046 A G   1794 1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc147  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  A   1097 OP2   ? ? A MG  8047 A A   1098 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc148  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 A  A   2745 OP2   ? ? A MG  8048 A A   2746 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc149  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 A  G   2749 OP2   ? ? A MG  8048 A G   2750 1_555 ? ? ? ? ? ? ? 1.773 ? 
metalc150  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  G   2420 OP1   ? ? A MG  8049 A G   2421 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc151  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  C   2422 OP1   ? ? A MG  8049 A C   2423 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc152  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  C   2247 OP2   ? ? A MG  8050 A C   2248 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc153  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  G   640  OP2   ? ? A MG  8051 A G   641  1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc154  metalc ? ? DC MG  .    MG    ? ? ? 1_555 B  G   92   OP1   ? ? A MG  8052 B G   3092 1_555 ? ? ? ? ? ? ? 3.104 ? 
metalc155  metalc ? ? DC MG  .    MG    ? ? ? 1_555 A  U   1124 OP1   ? ? A MG  8052 A U   1125 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc156  metalc ? ? DC MG  .    MG    ? ? ? 1_555 DJ HOH .    O     ? ? A MG  8052 B HOH 8389 1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc157  metalc ? ? DC MG  .    MG    ? ? ? 1_555 DJ HOH .    O     ? ? A MG  8052 B HOH 8418 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc158  metalc ? ? EC MG  .    MG    ? ? ? 1_555 A  G   470  O6    ? ? A MG  8053 A G   471  1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc159  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8053 A HOH 9199 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc160  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8053 A HOH 9239 1_555 ? ? ? ? ? ? ? 2.753 ? 
metalc161  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  U   2275 OP1   ? ? A MG  8054 A U   2276 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc162  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8054 A HOH 9425 1_555 ? ? ? ? ? ? ? 1.630 ? 
metalc163  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  C   161  OP1   ? ? A MG  8054 A C   162  1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc164  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8056 A HOH 9976 1_555 ? ? ? ? ? ? ? 1.915 ? 
metalc165  metalc ? ? GC MG  .    MG    ? ? ? 1_555 D  ASN 335  O     ? ? A MG  8056 D ASN 335  1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc166  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  A   2756 OP1   ? ? A MG  8056 A A   2757 1_555 ? ? ? ? ? ? ? 1.984 ? 
metalc167  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  U   2011 "O3'" ? ? A MG  8057 A U   2012 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc168  metalc ? ? HC MG  .    MG    ? ? ? 1_555 C  GLN 207  O     ? ? A MG  8057 C GLN 207  1_555 ? ? ? ? ? ? ? 2.941 ? 
metalc169  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? A MG  8057 A G   2013 1_555 ? ? ? ? ? ? ? 3.088 ? 
metalc170  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  U   1882 OP1   ? ? A MG  8057 A U   1883 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc171  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  U   2011 "O2'" ? ? A MG  8057 A U   2012 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc172  metalc ? ? IC MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8058 C HOH 8630 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc173  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? A MG  8058 A G   2013 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc174  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 9039 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc175  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 9043 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc176  metalc ? ? JC MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? A MG  8059 A G   2618 1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc177  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8060 A HOH 9167 1_555 ? ? ? ? ? ? ? 1.892 ? 
metalc178  metalc ? ? KC MG  .    MG    ? ? ? 1_555 A  G   174  OP2   ? ? A MG  8060 A G   175  1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc179  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  A   1368 OP2   ? ? A MG  8061 A A   1369 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc180  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  U   2649 OP1   ? ? A MG  8061 A U   2650 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc181  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8061 A HOH 9814 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc182  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  G   1488 OP2   ? ? A MG  8062 A G   1489 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc183  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 9389 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc184  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  G   1490 O6    ? ? A MG  8062 A G   1491 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc185  metalc ? ? OC MG  .    MG    ? ? ? 1_555 A  U   2277 O4    ? ? A MG  8064 A U   2278 1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc186  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8064 A HOH 9914 1_555 ? ? ? ? ? ? ? 3.068 ? 
metalc187  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8064 A HOH 9582 1_555 ? ? ? ? ? ? ? 2.709 ? 
metalc188  metalc ? ? OC MG  .    MG    ? ? ? 1_555 A  U   2276 O4    ? ? A MG  8064 A U   2277 1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc189  metalc ? ? OC MG  .    MG    ? ? ? 1_555 A  G   2470 O6    ? ? A MG  8064 A G   2471 1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc190  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  G   2539 OP2   ? ? A MG  8066 A G   2540 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc191  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  G   1883 O6    ? ? A MG  8067 A G   1884 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc192  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  U   1845 OP2   ? ? A MG  8067 A U   1846 1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc193  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  A   1844 OP1   ? ? A MG  8067 A A   1845 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc194  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASN 188  O     ? ? A MG  8067 C ASN 188  1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc195  metalc ? ? RC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 9728 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc196  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  A   2567 OP2   ? ? A MG  8068 A A   2568 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc197  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  G   218  O6    ? ? A MG  8070 A G   219  1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc198  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  A   165  OP1   ? ? A MG  8070 A A   166  1_555 ? ? ? ? ? ? ? 1.965 ? 
metalc199  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8070 A HOH 9122 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc200  metalc ? ? UC MG  .    MG    ? ? ? 1_555 A  U   953  OP1   ? ? A MG  8072 A U   954  1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc201  metalc ? ? VC MG  .    MG    ? ? ? 1_555 A  A   1286 OP1   ? ? A MG  8074 A A   1287 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc202  metalc ? ? VC MG  .    MG    ? ? ? 1_555 A  A   1285 OP1   ? ? A MG  8074 A A   1286 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc203  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   907  "O4'" ? ? A MG  8075 A A   908  1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc204  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   906  "O2'" ? ? A MG  8075 A A   907  1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc205  metalc ? ? XC MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? A MG  8076 3 HOH 7875 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc206  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8077 A HOH 9238 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc207  metalc ? ? YC MG  .    MG    ? ? ? 1_555 A  U   882  OP2   ? ? A MG  8077 A U   883  1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc208  metalc ? ? YC MG  .    MG    ? ? ? 1_555 A  C   879  OP1   ? ? A MG  8077 A C   880  1_555 ? ? ? ? ? ? ? 1.858 ? 
metalc209  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  C   167  OP2   ? ? A MG  8079 A C   168  1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc210  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  A   166  OP1   ? ? A MG  8079 A A   167  1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc211  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  A   164  N7    ? ? A MG  8079 A A   165  1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc212  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   1683 OP2   ? ? A MG  8080 A A   1684 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc213  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  U   1723 OP2   ? ? A MG  8080 A U   1724 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc214  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  G   1437 OP1   ? ? A MG  8081 A G   1438 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc215  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  C   1420 OP2   ? ? A MG  8081 A C   1421 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc216  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  C   1419 OP1   ? ? A MG  8081 A C   1420 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc217  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8081 A HOH 9603 1_555 ? ? ? ? ? ? ? 2.740 ? 
metalc218  metalc ? ? CD MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? A MG  8082 Q HOH 221  1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc219  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  A   1436 OP2   ? ? A MG  8082 A A   1437 1_555 ? ? ? ? ? ? ? 3.101 ? 
metalc220  metalc ? ? DD MG  .    MG    ? ? ? 1_555 A  A   1753 OP2   ? ? A MG  8083 A A   1754 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc221  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 9746 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc222  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 9368 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc223  metalc ? ? ED MG  .    MG    ? ? ? 1_555 A  A   1741 OP2   ? ? A MG  8084 A A   1742 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc224  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 9247 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc225  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8085 A HOH 9594 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc226  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8085 A HOH 9039 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc227  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? A MG  8085 A G   2618 1_555 ? ? ? ? ? ? ? 2.613 ? 
metalc228  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  G   2616 "O3'" ? ? A MG  8085 A G   2617 1_555 ? ? ? ? ? ? ? 3.138 ? 
metalc229  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  U   532  OP1   ? ? A MG  8086 A U   533  1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc230  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  A   531  OP1   ? ? A MG  8086 A A   532  1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc231  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  G   682  OP2   ? ? A MG  8087 A G   683  1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc232  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  A   681  OP2   ? ? A MG  8087 A A   682  1_555 ? ? ? ? ? ? ? 1.933 ? 
metalc233  metalc ? ? ID MG  .    MG    ? ? ? 1_555 SF NA  .    NA    ? ? A MG  8088 A NA  8339 1_555 ? ? ? ? ? ? ? 3.070 ? 
metalc234  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  G   2610 "O2'" ? ? A MG  8088 A G   2611 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc235  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  G   2539 O6    ? ? A MG  8088 A G   2540 1_555 ? ? ? ? ? ? ? 2.592 ? 
metalc236  metalc ? ? ID MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8088 A HOH 9065 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc237  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  U   516  OP2   ? ? A MG  8089 A U   517  1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc238  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  A   515  OP1   ? ? A MG  8089 A A   516  1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc239  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  G   517  N7    ? ? A MG  8089 A G   518  1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc240  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  A   2102 OP2   ? ? A MG  8090 A A   2103 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc241  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 9539 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc242  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 9093 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc243  metalc ? ? LD MG  .    MG    ? ? ? 1_555 A  G   917  OP1   ? ? A MG  8091 A G   918  1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc244  metalc ? ? MD MG  .    MG    ? ? ? 1_555 A  C   1843 OP2   ? ? A MG  8092 A C   1844 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc245  metalc ? ? ND MG  .    MG    ? ? ? 1_555 A  A   1069 "O2'" ? ? A MG  8093 A A   1070 1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc246  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8093 A HOH 9674 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc247  metalc ? ? ND MG  .    MG    ? ? ? 1_555 A  G   1070 OP1   ? ? A MG  8093 A G   1071 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc248  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  U   1095 OP2   ? ? A MG  8094 A U   1096 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc249  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  C   1256 OP2   ? ? A MG  8094 A C   1257 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc250  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  G   1848 O6    ? ? A MG  8096 A G   1849 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc251  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  G   1847 O6    ? ? A MG  8096 A G   1848 1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc252  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  U   863  O4    ? ? A MG  8097 A U   864  1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc253  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   862  O6    ? ? A MG  8097 A G   863  1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc254  metalc ? ? RD MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? A MG  8098 Z HOH 8570 1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc255  metalc ? ? RD MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? A MG  8098 Z HOH 8542 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc256  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8098 A HOH 9937 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc257  metalc ? ? RD MG  .    MG    ? ? ? 1_555 A  A   906  N7    ? ? A MG  8098 A A   907  1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc258  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8099 A HOH 9106 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc259  metalc ? ? SD MG  .    MG    ? ? ? 1_555 A  A   2611 "O3'" ? ? A MG  8099 A A   2612 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc260  metalc ? ? SD MG  .    MG    ? ? ? 1_555 A  A   2611 "O2'" ? ? A MG  8099 A A   2612 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc261  metalc ? ? TD MG  .    MG    ? ? ? 1_555 A  G   2079 O6    ? ? A MG  8100 A G   2080 1_555 ? ? ? ? ? ? ? 3.040 ? 
metalc262  metalc ? ? UD MG  .    MG    ? ? ? 1_555 A  U   2281 O4    ? ? A MG  8101 A U   2282 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc263  metalc ? ? UD MG  .    MG    ? ? ? 1_555 A  C   2280 OP2   ? ? A MG  8101 A C   2281 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc264  metalc ? ? VD MG  .    MG    ? ? ? 1_555 FK HOH .    O     ? ? A MG  8102 4 HOH 8521 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc265  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8102 A HOH 9887 1_555 ? ? ? ? ? ? ? 3.018 ? 
metalc266  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8102 A HOH 9250 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc267  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  U   2457 O2    ? ? A MG  8102 A U   2458 1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc268  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  A   2433 N3    ? ? A MG  8102 A A   2434 1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc269  metalc ? ? WD MG  .    MG    ? ? ? 1_555 A  G   2578 OP2   ? ? A MG  8103 A G   2579 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc270  metalc ? ? WD MG  .    MG    ? ? ? 1_555 A  G   2577 OP2   ? ? A MG  8103 A G   2578 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc271  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  C   2103 OP1   ? ? A MG  8104 A C   2104 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc272  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  C   2104 OP2   ? ? A MG  8104 A C   2105 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc273  metalc ? ? YD MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? A MG  8106 Q HOH 191  1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc274  metalc ? ? YD MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? A MG  8106 A G   817  1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc275  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 A  A   1105 OP2   ? ? A MG  8107 A A   1106 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc276  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 A  A   1106 OP2   ? ? A MG  8107 A A   1107 1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc277  metalc ? ? BE MG  .    MG    ? ? ? 1_555 A  U   902  OP1   ? ? A MG  8110 A U   903  1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc278  metalc ? ? BE MG  .    MG    ? ? ? 1_555 A  A   1356 N7    ? ? A MG  8110 A A   1357 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc279  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 9501 1_555 ? ? ? ? ? ? ? 2.665 ? 
metalc280  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  G   2608 N7    ? ? A MG  8111 A G   2609 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc281  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 9561 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc282  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 9325 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc283  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 9126 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc284  metalc ? ? DE MG  .    MG    ? ? ? 1_555 A  A   186  N1    ? ? A MG  8112 A A   187  1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc285  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 9582 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc286  metalc ? ? EE MG  .    MG    ? ? ? 1_555 A  A   2111 N7    ? ? A MG  8113 A A   2112 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc287  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8114 A HOH 9443 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc288  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8114 A HOH 9344 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc289  metalc ? ? FE MG  .    MG    ? ? ? 1_555 A  A   2429 N1    ? ? A MG  8114 A A   2430 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc290  metalc ? ? GE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8115 C HOH 8632 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc291  metalc ? ? GE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8115 C HOH 8552 1_555 ? ? ? ? ? ? ? 2.689 ? 
metalc292  metalc ? ? HE MG  .    MG    ? ? ? 1_555 A  U   1849 O4    ? ? A MG  8116 A U   1850 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc293  metalc ? ? HE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8116 C HOH 8552 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc294  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  C   1840 OP2   ? ? A MG  8117 A C   1841 1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc295  metalc ? ? IE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8117 A HOH 9220 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc296  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  A   2021 N7    ? ? A MG  8117 A A   2022 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc297  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  A   1839 "O2'" ? ? A MG  8117 A A   1840 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc298  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  A   1839 "O3'" ? ? A MG  8117 A A   1840 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc299  metalc ? ? JE K   .    K     ? ? ? 1_555 A  G   2481 N7    ? ? A K   8201 A G   2482 1_555 ? ? ? ? ? ? ? 2.793 ? 
metalc300  metalc ? ? JE K   .    K     ? ? ? 1_555 A  C   2535 O2    ? ? A K   8201 A C   2536 1_555 ? ? ? ? ? ? ? 3.051 ? 
metalc301  metalc ? ? JE K   .    K     ? ? ? 1_555 A  G   2481 O6    ? ? A K   8201 A G   2482 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc302  metalc ? ? JE K   .    K     ? ? ? 1_555 A  G   2101 O6    ? ? A K   8201 A G   2102 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc303  metalc ? ? JE K   .    K     ? ? ? 1_555 A  G   2101 N7    ? ? A K   8201 A G   2102 1_555 ? ? ? ? ? ? ? 3.544 ? 
metalc304  metalc ? ? JE K   .    K     ? ? ? 1_555 A  C   2535 "O4'" ? ? A K   8201 A C   2536 1_555 ? ? ? ? ? ? ? 3.143 ? 
metalc305  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 9015 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc306  metalc ? ? KE K   .    K     ? ? ? 1_555 A  C   161  OP2   ? ? A K   8202 A C   162  1_555 ? ? ? ? ? ? ? 3.056 ? 
metalc307  metalc ? ? KE K   .    K     ? ? ? 1_555 A  U   171  O4    ? ? A K   8202 A U   172  1_555 ? ? ? ? ? ? ? 3.118 ? 
metalc308  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 9145 1_555 ? ? ? ? ? ? ? 2.814 ? 
metalc309  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 9111 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc310  metalc ? ? KE K   .    K     ? ? ? 1_555 A  U   162  O4    ? ? A K   8202 A U   163  1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc311  metalc ? ? LE NA  .    NA    ? ? ? 1_555 A  G   1071 N7    ? ? A NA  8301 A G   1072 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc312  metalc ? ? LE NA  .    NA    ? ? ? 1_555 A  C   1068 OP2   ? ? A NA  8301 A C   1069 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc313  metalc ? ? ME NA  .    NA    ? ? ? 1_555 A  G   1118 "O2'" ? ? A NA  8302 A G   1119 1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc314  metalc ? ? OE NA  .    NA    ? ? ? 1_555 A  A   629  N3    ? ? A NA  8305 A A   630  1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc315  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  C   1393 O2    ? ? A NA  8308 A C   1394 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc316  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  U   1723 O2    ? ? A NA  8308 A U   1724 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc317  metalc ? ? TE NA  .    NA    ? ? ? 1_555 A  G   2523 N7    ? ? A NA  8311 A G   2524 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc318  metalc ? ? TE NA  .    NA    ? ? ? 1_555 A  G   2524 O6    ? ? A NA  8311 A G   2525 1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc319  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  G   2398 O6    ? ? A NA  8313 A G   2399 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc320  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8313 A HOH 9947 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc321  metalc ? ? VE NA  .    NA    ? ? ? 1_555 A  U   2606 "O2'" ? ? A NA  8314 A U   2607 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc322  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8314 A HOH 9326 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc323  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  A   165  "O3'" ? ? A NA  8315 A A   166  1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc324  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  A   164  OP2   ? ? A NA  8315 A A   165  1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc325  metalc ? ? YE NA  .    NA    ? ? ? 1_555 CA TRP 41   O     ? ? A NA  8317 3 TRP 42   1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc326  metalc ? ? YE NA  .    NA    ? ? ? 1_555 EK HOH .    O     ? ? A NA  8317 3 HOH 4135 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc327  metalc ? ? YE NA  .    NA    ? ? ? 1_555 A  G   1415 "O3'" ? ? A NA  8317 A G   1416 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc328  metalc ? ? YE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8317 A HOH 9275 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc329  metalc ? ? AF NA  .    NA    ? ? ? 1_555 A  G   2465 OP2   ? ? A NA  8319 A G   2466 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc330  metalc ? ? AF NA  .    NA    ? ? ? 1_555 M  ASP 36   O     ? ? A NA  8319 M ASP 36   1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc331  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8320 A HOH 9737 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc332  metalc ? ? CF NA  .    NA    ? ? ? 1_555 A  G   835  "O3'" ? ? A NA  8321 A G   836  1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc333  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8325 A HOH 9617 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc334  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  U   2011 O4    ? ? A NA  8326 A U   2012 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc335  metalc ? ? HF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8327 A HOH 9038 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc336  metalc ? ? KF NA  .    NA    ? ? ? 1_555 A  C   140  "O4'" ? ? A NA  8330 A C   141  1_555 ? ? ? ? ? ? ? 2.525 ? 
metalc337  metalc ? ? KF NA  .    NA    ? ? ? 1_555 A  C   140  O2    ? ? A NA  8330 A C   141  1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc338  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  G   386  O6    ? ? A NA  8332 A G   387  1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc339  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  U   1896 O4    ? ? A NA  8333 A U   1897 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc340  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  C   1893 O2    ? ? A NA  8333 A C   1894 1_555 ? ? ? ? ? ? ? 2.576 ? 
metalc341  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  G   1705 O6    ? ? A NA  8336 A G   1706 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc342  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  G   1706 O6    ? ? A NA  8336 A G   1707 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc343  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 9919 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc344  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  G   2659 OP1   ? ? A NA  8338 A G   2660 1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc345  metalc ? ? RF NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? A NA  8338 S HOH 8516 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc346  metalc ? ? RF NA  .    NA    ? ? ? 1_555 S  TRP 75   O     ? ? A NA  8338 S TRP 75   1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc347  metalc ? ? RF NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? A NA  8338 S HOH 8527 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc348  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  U   2658 "O3'" ? ? A NA  8338 A U   2659 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc349  metalc ? ? RF NA  .    NA    ? ? ? 1_555 S  VAL 72   O     ? ? A NA  8338 S VAL 72   1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc350  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  G   2539 O6    ? ? A NA  8339 A G   2540 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc351  metalc ? ? UF NA  .    NA    ? ? ? 1_555 A  G   682  O6    ? ? A NA  8341 A G   683  1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc352  metalc ? ? WF NA  .    NA    ? ? ? 1_555 A  U   2662 O2    ? ? A NA  8344 A U   2663 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc353  metalc ? ? XF NA  .    NA    ? ? ? 1_555 A  A   913  "O3'" ? ? A NA  8349 A A   914  1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc354  metalc ? ? XF NA  .    NA    ? ? ? 1_555 A  G   1044 OP2   ? ? A NA  8349 A G   1045 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc355  metalc ? ? AG NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? A NA  8353 M HOH 8512 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc356  metalc ? ? EG NA  .    NA    ? ? ? 1_555 A  U   941  O4    ? ? A NA  8357 A U   942  1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc357  metalc ? ? EG NA  .    NA    ? ? ? 1_555 A  G   1023 O6    ? ? A NA  8357 A G   1024 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc358  metalc ? ? FG NA  .    NA    ? ? ? 1_555 A  U   2108 OP2   ? ? A NA  8359 A U   2109 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc359  metalc ? ? IG NA  .    NA    ? ? ? 1_555 A  G   2109 OP2   ? ? A NA  8362 A G   2110 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc360  metalc ? ? KG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8364 A HOH 9586 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc361  metalc ? ? MG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8366 A HOH 9880 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc362  metalc ? ? MG NA  .    NA    ? ? ? 1_555 A  G   544  O6    ? ? A NA  8366 A G   545  1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc363  metalc ? ? NG NA  .    NA    ? ? ? 1_555 A  G   474  OP2   ? ? A NA  8367 A G   475  1_555 ? ? ? ? ? ? ? 2.598 ? 
metalc364  metalc ? ? NG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8367 A HOH 9823 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc365  metalc ? ? QG NA  .    NA    ? ? ? 1_555 A  G   1831 OP2   ? ? A NA  8370 A G   1832 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc366  metalc ? ? WG NA  .    NA    ? ? ? 1_555 A  C   632  OP1   ? ? A NA  8376 A C   633  1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc367  metalc ? ? YG NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? A NA  8378 M HOH 8528 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc368  metalc ? ? AH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8381 A HOH 9324 1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc369  metalc ? ? AH NA  .    NA    ? ? ? 1_555 A  U   2585 O4    ? ? A NA  8381 A U   2586 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc370  metalc ? ? BH NA  .    NA    ? ? ? 1_555 A  G   2771 O6    ? ? A NA  8382 A G   2772 1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc371  metalc ? ? BH NA  .    NA    ? ? ? 1_555 A  G   2772 O6    ? ? A NA  8382 A G   2773 1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc372  metalc ? ? CH NA  .    NA    ? ? ? 1_555 A  C   196  N3    ? ? A NA  8384 A C   197  1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc373  metalc ? ? DH NA  .    NA    ? ? ? 1_555 A  A   1078 OP1   ? ? A NA  8385 A A   1079 1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc374  metalc ? ? DH NA  .    NA    ? ? ? 1_555 A  G   1076 N7    ? ? A NA  8385 A G   1077 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc375  metalc ? ? OH MG  .    MG    ? ? ? 1_555 B  A   57   OP2   ? ? B MG  8095 B A   3057 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc376  metalc ? ? OH MG  .    MG    ? ? ? 1_555 DJ HOH .    O     ? ? B MG  8095 B HOH 8518 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc377  metalc ? ? OH MG  .    MG    ? ? ? 1_555 B  A   56   OP2   ? ? B MG  8095 B A   3056 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc378  metalc ? ? PH NA  .    NA    ? ? ? 1_555 B  C   40   N3    ? ? B NA  8351 B C   3040 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc379  metalc ? ? RH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8631 1_555 ? ? ? ? ? ? ? 1.803 ? 
metalc380  metalc ? ? RH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8601 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc381  metalc ? ? RH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8523 1_555 ? ? ? ? ? ? ? 1.712 ? 
metalc382  metalc ? ? RH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? C MG  8065 A HOH 9920 1_555 ? ? ? ? ? ? ? 1.981 ? 
metalc383  metalc ? ? RH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8549 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc384  metalc ? ? SH NA  .    NA    ? ? ? 1_555 C  HIS 208  O     ? ? C NA  8345 C HIS 208  1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc385  metalc ? ? SH NA  .    NA    ? ? ? 1_555 EJ HOH .    O     ? ? C NA  8345 C HOH 8600 1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc386  metalc ? ? SH NA  .    NA    ? ? ? 1_555 EJ HOH .    O     ? ? C NA  8345 C HOH 8555 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc387  metalc ? ? SH NA  .    NA    ? ? ? 1_555 C  PHE 201  O     ? ? C NA  8345 C PHE 201  1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc388  metalc ? ? UH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? D MG  8055 D HOH 8665 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc389  metalc ? ? WH NA  .    NA    ? ? ? 1_555 E  ASP 45   OD1   ? ? E NA  8304 E ASP 45   1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc390  metalc ? ? WH NA  .    NA    ? ? ? 1_555 E  LYS 96   O     ? ? E NA  8304 E LYS 96   1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc391  metalc ? ? ZH NA  .    NA    ? ? ? 1_555 K  TYR 69   O     ? ? K NA  8346 K TYR 69   1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc392  metalc ? ? DI MG  .    MG    ? ? ? 1_555 NJ HOH .    O     ? ? L MG  8069 L HOH 7871 1_555 ? ? ? ? ? ? ? 1.894 ? 
metalc393  metalc ? ? DI MG  .    MG    ? ? ? 1_555 NJ HOH .    O     ? ? L MG  8069 L HOH 2121 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc394  metalc ? ? DI MG  .    MG    ? ? ? 1_555 L  ASN 42   OD1   ? ? L MG  8069 L ASN 42   1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc395  metalc ? ? EI NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? M NA  8380 M HOH 8587 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc396  metalc ? ? GI NA  .    NA    ? ? ? 1_555 N  ASN 106  OD1   ? ? N NA  8347 N ASN 106  1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc397  metalc ? ? GI NA  .    NA    ? ? ? 1_555 PJ HOH .    O     ? ? N NA  8347 N HOH 8626 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc398  metalc ? ? JI CD  .    CD    ? ? ? 1_555 RJ HOH .    O     ? ? P CD  8405 P HOH 5322 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc399  metalc ? ? JI CD  .    CD    ? ? ? 1_555 P  HIS 40   ND1   ? ? P CD  8405 P HIS 40   1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc400  metalc ? ? LI NA  .    NA    ? ? ? 1_555 R  GLY 22   O     ? ? R NA  8348 R GLY 22   1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc401  metalc ? ? LI NA  .    NA    ? ? ? 1_555 R  SER 46   OG    ? ? R NA  8348 R SER 46   1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc402  metalc ? ? NI NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? S NA  8337 S HOH 8525 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc403  metalc ? ? QI NA  .    NA    ? ? ? 1_555 T  GLU 61   OE2   ? ? T NA  8312 T GLU 61   1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc404  metalc ? ? QI NA  .    NA    ? ? ? 1_555 T  HIS 7    NE2   ? ? T NA  8312 T HIS 7    1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc405  metalc ? ? RI MG  .    MG    ? ? ? 1_555 WJ HOH .    O     ? ? U MG  8073 U HOH 2868 1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc406  metalc ? ? RI MG  .    MG    ? ? ? 1_555 U  ASP 117  O     ? ? U MG  8073 U ASP 117  1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc407  metalc ? ? RI MG  .    MG    ? ? ? 1_555 U  SER 114  O     ? ? U MG  8073 U SER 114  1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc408  metalc ? ? RI MG  .    MG    ? ? ? 1_555 U  LEU 112  O     ? ? U MG  8073 U LEU 112  1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc409  metalc ? ? RI MG  .    MG    ? ? ? 1_555 U  ARG 111  O     ? ? U MG  8073 U ARG 111  1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc410  metalc ? ? RI MG  .    MG    ? ? ? 1_555 U  GLN 37   OE1   ? ? U MG  8073 U GLN 37   1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc411  metalc ? ? SI NA  .    NA    ? ? ? 1_555 U  SER 94   OG    ? ? U NA  8343 U SER 94   1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc412  metalc ? ? SI NA  .    NA    ? ? ? 1_555 U  ASN 95   OD1   ? ? U NA  8343 U ASN 95   1_555 ? ? ? ? ? ? ? 2.597 ? 
metalc413  metalc ? ? SI NA  .    NA    ? ? ? 1_555 WJ HOH .    O     ? ? U NA  8343 U HOH 1124 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc414  metalc ? ? TI CD  .    CD    ? ? ? 1_555 V  CYS 9    SG    ? ? V CD  8401 V CYS 9    1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc415  metalc ? ? TI CD  .    CD    ? ? ? 1_555 V  CYS 6    SG    ? ? V CD  8401 V CYS 6    1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc416  metalc ? ? TI CD  .    CD    ? ? ? 1_555 V  CYS 36   SG    ? ? V CD  8401 V CYS 36   1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc417  metalc ? ? TI CD  .    CD    ? ? ? 1_555 V  CYS 32   SG    ? ? V CD  8401 V CYS 32   1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc418  metalc ? ? UI MG  .    MG    ? ? ? 1_555 Z  LYS 136  O     ? ? Z MG  8109 Z LYS 136  1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc419  metalc ? ? UI MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? Z MG  8109 Z HOH 8561 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc420  metalc ? ? UI MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? Z MG  8109 Z HOH 8618 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc421  metalc ? ? UI MG  .    MG    ? ? ? 1_555 Z  HIS 133  O     ? ? Z MG  8109 Z HIS 133  1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc422  metalc ? ? UI MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? Z MG  8109 Z HOH 8584 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc423  metalc ? ? UI MG  .    MG    ? ? ? 1_555 Z  VAL 139  O     ? ? Z MG  8109 Z VAL 139  1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc424  metalc ? ? A  C   39   "O2'" ? ? ? 1_555 QE NA  .    NA    ? ? A C   40   A NA  8307 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc425  metalc ? ? A  C   39   O2    ? ? ? 1_555 QE NA  .    NA    ? ? A C   40   A NA  8307 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc426  metalc ? ? A  G   55   O6    ? ? ? 1_555 IF NA  .    NA    ? ? A G   56   A NA  8328 1_555 ? ? ? ? ? ? ? 2.810 ? 
metalc427  metalc ? ? A  A   58   N3    ? ? ? 1_555 IF NA  .    NA    ? ? A A   59   A NA  8328 1_555 ? ? ? ? ? ? ? 2.933 ? 
metalc428  metalc ? ? A  G   60   N7    ? ? ? 1_555 IF NA  .    NA    ? ? A G   61   A NA  8328 1_555 ? ? ? ? ? ? ? 2.779 ? 
metalc429  metalc ? ? A  U   107  O2    ? ? ? 1_555 JF NA  .    NA    ? ? A U   108  A NA  8329 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc430  metalc ? ? A  G   141  N7    ? ? ? 1_555 KF NA  .    NA    ? ? A G   142  A NA  8330 1_555 ? ? ? ? ? ? ? 2.786 ? 
metalc431  metalc ? ? A  G   141  O6    ? ? ? 1_555 KF NA  .    NA    ? ? A G   142  A NA  8330 1_555 ? ? ? ? ? ? ? 2.932 ? 
metalc432  metalc ? ? A  U   145  O4    ? ? ? 1_555 EF NA  .    NA    ? ? A U   146  A NA  8324 1_555 ? ? ? ? ? ? ? 2.897 ? 
metalc433  metalc ? ? A  A   165  "O2'" ? ? ? 1_555 WE NA  .    NA    ? ? A A   166  A NA  8315 1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc434  metalc ? ? A  A   166  OP1   ? ? ? 1_555 WE NA  .    NA    ? ? A A   167  A NA  8315 1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc435  metalc ? ? A  U   169  O2    ? ? ? 1_555 LF NA  .    NA    ? ? A U   170  A NA  8331 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc436  metalc ? ? A  C   217  "O2'" ? ? ? 1_555 LF NA  .    NA    ? ? A C   218  A NA  8331 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc437  metalc ? ? A  G   220  O6    ? ? ? 1_555 LF NA  .    NA    ? ? A G   221  A NA  8331 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc438  metalc ? ? A  U   307  O4    ? ? ? 1_555 SI NA  .    NA    ? ? A U   308  U NA  8343 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc439  metalc ? ? A  U   334  O2    ? ? ? 1_555 SI NA  .    NA    ? ? A U   335  U NA  8343 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc440  metalc ? ? A  C   341  O2    ? ? ? 1_555 SI NA  .    NA    ? ? A C   342  U NA  8343 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc441  metalc ? ? A  G   385  O6    ? ? ? 1_555 MF NA  .    NA    ? ? A G   386  A NA  8332 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc442  metalc ? ? A  U   390  "O2'" ? ? ? 1_555 LG NA  .    NA    ? ? A U   391  A NA  8365 1_555 ? ? ? ? ? ? ? 2.718 ? 
metalc443  metalc ? ? A  C   398  O2    ? ? ? 1_555 LG NA  .    NA    ? ? A C   399  A NA  8365 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc444  metalc ? ? A  U   401  O4    ? ? ? 1_555 MF NA  .    NA    ? ? A U   402  A NA  8332 1_555 ? ? ? ? ? ? ? 2.805 ? 
metalc445  metalc ? ? A  C   442  O2    ? ? ? 1_555 QE NA  .    NA    ? ? A C   443  A NA  8307 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc446  metalc ? ? A  A   452  "O2'" ? ? ? 1_555 GG NA  .    NA    ? ? A A   453  A NA  8360 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc447  metalc ? ? A  G   463  O6    ? ? ? 1_555 NG NA  .    NA    ? ? A G   464  A NA  8367 1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc448  metalc ? ? A  G   478  OP2   ? ? ? 1_555 GG NA  .    NA    ? ? A G   479  A NA  8360 1_555 ? ? ? ? ? ? ? 2.894 ? 
metalc449  metalc ? ? A  G   543  O6    ? ? ? 1_555 MG NA  .    NA    ? ? A G   544  A NA  8366 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc450  metalc ? ? A  G   621  O6    ? ? ? 1_555 PF NA  .    NA    ? ? A G   622  A NA  8335 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc451  metalc ? ? A  U   622  "O2'" ? ? ? 1_555 YF NA  .    NA    ? ? A U   623  A NA  8350 1_555 ? ? ? ? ? ? ? 2.921 ? 
metalc452  metalc ? ? A  U   622  O4    ? ? ? 1_555 PF NA  .    NA    ? ? A U   623  A NA  8335 1_555 ? ? ? ? ? ? ? 2.822 ? 
metalc453  metalc ? ? A  A   629  "O2'" ? ? ? 1_555 OE NA  .    NA    ? ? A A   630  A NA  8305 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc454  metalc ? ? A  A   630  "O2'" ? ? ? 1_555 OE NA  .    NA    ? ? A A   631  A NA  8305 1_555 ? ? ? ? ? ? ? 2.964 ? 
metalc455  metalc ? ? A  G   680  "O3'" ? ? ? 1_555 UF NA  .    NA    ? ? A G   681  A NA  8341 1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc456  metalc ? ? A  G   680  "O2'" ? ? ? 1_555 UF NA  .    NA    ? ? A G   681  A NA  8341 1_555 ? ? ? ? ? ? ? 2.884 ? 
metalc457  metalc ? ? A  G   682  N7    ? ? ? 1_555 UF NA  .    NA    ? ? A G   683  A NA  8341 1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc458  metalc ? ? A  U   767  "O2'" ? ? ? 1_555 BG NA  .    NA    ? ? A U   768  A NA  8354 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc459  metalc ? ? A  A   775  "O3'" ? ? ? 1_555 FF NA  .    NA    ? ? A A   776  A NA  8325 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc460  metalc ? ? A  A   775  "O2'" ? ? ? 1_555 FF NA  .    NA    ? ? A A   776  A NA  8325 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc461  metalc ? ? A  U   776  OP2   ? ? ? 1_555 FF NA  .    NA    ? ? A U   777  A NA  8325 1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc462  metalc ? ? A  U   778  O4    ? ? ? 1_555 FF NA  .    NA    ? ? A U   779  A NA  8325 1_555 ? ? ? ? ? ? ? 2.920 ? 
metalc463  metalc ? ? A  G   797  O6    ? ? ? 1_555 OG NA  .    NA    ? ? A G   798  A NA  8368 1_555 ? ? ? ? ? ? ? 2.850 ? 
metalc464  metalc ? ? A  G   813  O6    ? ? ? 1_555 OG NA  .    NA    ? ? A G   814  A NA  8368 1_555 ? ? ? ? ? ? ? 2.820 ? 
metalc465  metalc ? ? A  U   814  O4    ? ? ? 1_555 OG NA  .    NA    ? ? A U   815  A NA  8368 1_555 ? ? ? ? ? ? ? 2.616 ? 
metalc466  metalc ? ? A  U   836  OP1   ? ? ? 1_555 CF NA  .    NA    ? ? A U   837  A NA  8321 1_555 ? ? ? ? ? ? ? 2.786 ? 
metalc467  metalc ? ? A  C   852  "O3'" ? ? ? 1_555 HF NA  .    NA    ? ? A C   853  A NA  8327 1_555 ? ? ? ? ? ? ? 2.868 ? 
metalc468  metalc ? ? A  G   853  OP1   ? ? ? 1_555 HF NA  .    NA    ? ? A G   854  A NA  8327 1_555 ? ? ? ? ? ? ? 2.829 ? 
metalc469  metalc ? ? A  G   884  "O2'" ? ? ? 1_555 DF NA  .    NA    ? ? A G   885  A NA  8323 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc470  metalc ? ? A  G   886  OP2   ? ? ? 1_555 VG NA  .    NA    ? ? A G   887  A NA  8375 1_555 ? ? ? ? ? ? ? 2.927 ? 
metalc471  metalc ? ? A  G   891  N7    ? ? ? 1_555 VF NA  .    NA    ? ? A G   892  A NA  8342 1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc472  metalc ? ? A  C   892  "O2'" ? ? ? 1_555 VF NA  .    NA    ? ? A C   893  A NA  8342 1_555 ? ? ? ? ? ? ? 2.886 ? 
metalc473  metalc ? ? A  C   892  O2    ? ? ? 1_555 VF NA  .    NA    ? ? A C   893  A NA  8342 1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc474  metalc ? ? A  C   895  "O2'" ? ? ? 1_555 XE NA  .    NA    ? ? A C   896  A NA  8316 1_555 ? ? ? ? ? ? ? 2.845 ? 
metalc475  metalc ? ? A  C   895  O2    ? ? ? 1_555 XE NA  .    NA    ? ? A C   896  A NA  8316 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc476  metalc ? ? A  A   896  "O4'" ? ? ? 1_555 XE NA  .    NA    ? ? A A   897  A NA  8316 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc477  metalc ? ? A  G   900  OP1   ? ? ? 1_555 YF NA  .    NA    ? ? A G   901  A NA  8350 1_555 ? ? ? ? ? ? ? 2.897 ? 
metalc478  metalc ? ? A  G   901  O6    ? ? ? 1_555 YG NA  .    NA    ? ? A G   902  A NA  8378 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc479  metalc ? ? A  U   902  O4    ? ? ? 1_555 YG NA  .    NA    ? ? A U   903  A NA  8378 1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc480  metalc ? ? A  A   913  "O2'" ? ? ? 1_555 XF NA  .    NA    ? ? A A   914  A NA  8349 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc481  metalc ? ? A  C   914  OP2   ? ? ? 1_555 XF NA  .    NA    ? ? A C   915  A NA  8349 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc482  metalc ? ? A  C   919  O2    ? ? ? 1_555 DG NA  .    NA    ? ? A C   920  A NA  8356 1_555 ? ? ? ? ? ? ? 2.882 ? 
metalc483  metalc ? ? A  C   919  N3    ? ? ? 1_555 DG NA  .    NA    ? ? A C   920  A NA  8356 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc484  metalc ? ? A  A   921  OP1   ? ? ? 1_555 FG NA  .    NA    ? ? A A   922  A NA  8359 1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc485  metalc ? ? A  G   923  O6    ? ? ? 1_555 SG NA  .    NA    ? ? A G   924  A NA  8372 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc486  metalc ? ? A  G   940  O6    ? ? ? 1_555 EG NA  .    NA    ? ? A G   941  A NA  8357 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc487  metalc ? ? A  A   1039 "O2'" ? ? ? 1_555 AG NA  .    NA    ? ? A A   1040 A NA  8353 1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc488  metalc ? ? A  G   1118 "O3'" ? ? ? 1_555 ME NA  .    NA    ? ? A G   1119 A NA  8302 1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc489  metalc ? ? A  G   1118 O6    ? ? ? 1_555 CG NA  .    NA    ? ? A G   1119 A NA  8355 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc490  metalc ? ? A  A   1132 "O3'" ? ? ? 1_555 XH NA  .    NA    ? ? A A   1133 J NA  8309 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc491  metalc ? ? A  G   1133 OP1   ? ? ? 1_555 XH NA  .    NA    ? ? A G   1134 J NA  8309 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc492  metalc ? ? A  C   1242 OP2   ? ? ? 1_555 CG NA  .    NA    ? ? A C   1243 A NA  8355 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc493  metalc ? ? A  U   1292 OP2   ? ? ? 1_555 XG NA  .    NA    ? ? A U   1293 A NA  8377 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc494  metalc ? ? A  G   1294 O6    ? ? ? 1_555 XG NA  .    NA    ? ? A G   1295 A NA  8377 1_555 ? ? ? ? ? ? ? 2.901 ? 
metalc495  metalc ? ? A  A   1295 OP1   ? ? ? 1_555 AG NA  .    NA    ? ? A A   1296 A NA  8353 1_555 ? ? ? ? ? ? ? 2.809 ? 
metalc496  metalc ? ? A  C   1359 OP1   ? ? ? 1_555 JG NA  .    NA    ? ? A C   1360 A NA  8363 1_555 ? ? ? ? ? ? ? 2.625 ? 
metalc497  metalc ? ? A  G   1416 OP1   ? ? ? 1_555 YE NA  .    NA    ? ? A G   1417 A NA  8317 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc498  metalc ? ? A  U   1431 O4    ? ? ? 1_555 RE NA  .    NA    ? ? A U   1432 A NA  8308 1_555 ? ? ? ? ? ? ? 2.645 ? 
metalc499  metalc ? ? A  G   1575 O6    ? ? ? 1_555 TG NA  .    NA    ? ? A G   1576 A NA  8373 1_555 ? ? ? ? ? ? ? 2.703 ? 
metalc500  metalc ? ? A  U   1576 O4    ? ? ? 1_555 TG NA  .    NA    ? ? A U   1577 A NA  8373 1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc501  metalc ? ? A  G   1618 O6    ? ? ? 1_555 TG NA  .    NA    ? ? A G   1619 A NA  8373 1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc502  metalc ? ? A  A   1735 OP1   ? ? ? 1_555 CF NA  .    NA    ? ? A A   1736 A NA  8321 1_555 ? ? ? ? ? ? ? 2.916 ? 
metalc503  metalc ? ? A  U   1739 O4    ? ? ? 1_555 TF NA  .    NA    ? ? A U   1740 A NA  8340 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc504  metalc ? ? A  U   1740 O4    ? ? ? 1_555 TF NA  .    NA    ? ? A U   1741 A NA  8340 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc505  metalc ? ? A  U   1830 "O2'" ? ? ? 1_555 HF NA  .    NA    ? ? A U   1831 A NA  8327 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc506  metalc ? ? A  C   1893 O2    ? ? ? 1_555 OF NA  .    NA    ? ? A C   1894 A NA  8334 1_555 ? ? ? ? ? ? ? 2.814 ? 
metalc507  metalc ? ? A  G   1895 N7    ? ? ? 1_555 OF NA  .    NA    ? ? A G   1896 A NA  8334 1_555 ? ? ? ? ? ? ? 2.664 ? 
metalc508  metalc ? ? A  G   1895 O6    ? ? ? 1_555 OF NA  .    NA    ? ? A G   1896 A NA  8334 1_555 ? ? ? ? ? ? ? 2.706 ? 
metalc509  metalc ? ? A  G   1897 O6    ? ? ? 1_555 NF NA  .    NA    ? ? A G   1898 A NA  8333 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc510  metalc ? ? A  U   1938 O4    ? ? ? 1_555 NF NA  .    NA    ? ? A U   1939 A NA  8333 1_555 ? ? ? ? ? ? ? 2.961 ? 
metalc511  metalc ? ? A  A   2009 OP2   ? ? ? 1_555 GF NA  .    NA    ? ? A A   2010 A NA  8326 1_555 ? ? ? ? ? ? ? 2.892 ? 
metalc512  metalc ? ? A  U   2056 O4    ? ? ? 1_555 KG NA  .    NA    ? ? A U   2057 A NA  8364 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc513  metalc ? ? A  G   2057 O6    ? ? ? 1_555 KG NA  .    NA    ? ? A G   2058 A NA  8364 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc514  metalc ? ? A  G   2093 N7    ? ? ? 1_555 PE NA  .    NA    ? ? A G   2094 A NA  8306 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc515  metalc ? ? A  A   2111 OP1   ? ? ? 1_555 BG NA  .    NA    ? ? A A   2112 A NA  8354 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc516  metalc ? ? A  A   2111 N3    ? ? ? 1_555 DF NA  .    NA    ? ? A A   2112 A NA  8323 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc517  metalc ? ? A  U   2277 OP1   ? ? ? 1_555 DG NA  .    NA    ? ? A U   2278 A NA  8356 1_555 ? ? ? ? ? ? ? 2.798 ? 
metalc518  metalc ? ? A  C   2474 N4    ? ? ? 1_555 DF NA  .    NA    ? ? A C   2475 A NA  8323 1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc519  metalc ? ? A  G   2528 O6    ? ? ? 1_555 RG NA  .    NA    ? ? A G   2529 A NA  8371 1_555 ? ? ? ? ? ? ? 2.875 ? 
metalc520  metalc ? ? A  G   2542 O6    ? ? ? 1_555 BF NA  .    NA    ? ? A G   2543 A NA  8320 1_555 ? ? ? ? ? ? ? 2.891 ? 
metalc521  metalc ? ? A  G   2543 O6    ? ? ? 1_555 ZE NA  .    NA    ? ? A G   2544 A NA  8318 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc522  metalc ? ? A  G   2578 N7    ? ? ? 1_555 SE NA  .    NA    ? ? A G   2579 A NA  8310 1_555 ? ? ? ? ? ? ? 2.893 ? 
metalc523  metalc ? ? A  G   2578 O6    ? ? ? 1_555 SE NA  .    NA    ? ? A G   2579 A NA  8310 1_555 ? ? ? ? ? ? ? 2.964 ? 
metalc524  metalc ? ? A  G   2584 O6    ? ? ? 1_555 AH NA  .    NA    ? ? A G   2585 A NA  8381 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc525  metalc ? ? A  G   2591 O6    ? ? ? 1_555 AH NA  .    NA    ? ? A G   2592 A NA  8381 1_555 ? ? ? ? ? ? ? 2.783 ? 
metalc526  metalc ? ? A  U   2606 O2    ? ? ? 1_555 VE NA  .    NA    ? ? A U   2607 A NA  8314 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc527  metalc ? ? A  U   2614 O4    ? ? ? 1_555 BF NA  .    NA    ? ? A U   2615 A NA  8320 1_555 ? ? ? ? ? ? ? 2.836 ? 
metalc528  metalc ? ? A  U   2644 O2    ? ? ? 1_555 SF NA  .    NA    ? ? A U   2645 A NA  8339 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc529  metalc ? ? A  A   2810 "O3'" ? ? ? 1_555 WF NA  .    NA    ? ? A A   2811 A NA  8344 1_555 ? ? ? ? ? ? ? 2.799 ? 
metalc530  metalc ? ? A  A   2810 "O2'" ? ? ? 1_555 WF NA  .    NA    ? ? A A   2811 A NA  8344 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc531  metalc ? ? A  A   2815 "O2'" ? ? ? 1_555 WF NA  .    NA    ? ? A A   2816 A NA  8344 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc532  metalc ? ? A  G   2816 OP2   ? ? ? 1_555 WF NA  .    NA    ? ? A G   2817 A NA  8344 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc533  metalc ? ? B  C   40   O2    ? ? ? 1_555 PH NA  .    NA    ? ? B C   3040 B NA  8351 1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc534  metalc ? ? C  GLY 203  O     ? ? ? 1_555 SH NA  .    NA    ? ? C GLY 203  C NA  8345 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc535  metalc ? ? D  ARG 229  O     ? ? ? 1_555 CF NA  .    NA    ? ? D ARG 229  A NA  8321 1_555 ? ? ? ? ? ? ? 2.800 ? 
metalc536  metalc ? ? D  GLN 230  O     ? ? ? 1_555 HG NA  .    NA    ? ? D GLN 230  A NA  8361 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc537  metalc ? ? J  LYS 150  O     ? ? ? 1_555 XH NA  .    NA    ? ? J LYS 150  J NA  8309 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc538  metalc ? ? J  VAL 153  O     ? ? ? 1_555 XH NA  .    NA    ? ? J VAL 153  J NA  8309 1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc539  metalc ? ? J  PRO 155  O     ? ? ? 1_555 XH NA  .    NA    ? ? J PRO 155  J NA  8309 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc540  metalc ? ? K  ARG 60   O     ? ? ? 1_555 ZH NA  .    NA    ? ? K ARG 60   K NA  8346 1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc541  metalc ? ? K  VAL 61   O     ? ? ? 1_555 ZH NA  .    NA    ? ? K VAL 61   K NA  8346 1_555 ? ? ? ? ? ? ? 2.664 ? 
metalc542  metalc ? ? K  ILE 63   O     ? ? ? 1_555 ZH NA  .    NA    ? ? K ILE 63   K NA  8346 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc543  metalc ? ? M  GLY 14   O     ? ? ? 1_555 AG NA  .    NA    ? ? M GLY 14   A NA  8353 1_555 ? ? ? ? ? ? ? 2.724 ? 
metalc544  metalc ? ? M  HIS 18   O     ? ? ? 1_555 YG NA  .    NA    ? ? M HIS 18   A NA  8378 1_555 ? ? ? ? ? ? ? 2.998 ? 
metalc545  metalc ? ? M  GLY 29   O     ? ? ? 1_555 EI NA  .    NA    ? ? M GLY 29   M NA  8380 1_555 ? ? ? ? ? ? ? 2.853 ? 
metalc546  metalc ? ? M  ALA 33   O     ? ? ? 1_555 EI NA  .    NA    ? ? M ALA 33   M NA  8380 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc547  metalc ? ? M  GLU 39   OE1   ? ? ? 1_555 EI NA  .    NA    ? ? M GLU 39   M NA  8380 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc548  metalc ? ? N  ASN 106  O     ? ? ? 1_555 GI NA  .    NA    ? ? N ASN 106  N NA  8347 1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc549  metalc ? ? N  PHE 109  O     ? ? ? 1_555 GI NA  .    NA    ? ? N PHE 109  N NA  8347 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc550  metalc ? ? N  LEU 112  O     ? ? ? 1_555 GI NA  .    NA    ? ? N LEU 112  N NA  8347 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc551  metalc ? ? N  LYS 193  O     ? ? ? 1_555 LG NA  .    NA    ? ? N LYS 193  A NA  8365 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc552  metalc ? ? R  ASP 20   O     ? ? ? 1_555 LI NA  .    NA    ? ? R ASP 20   R NA  8348 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc553  metalc ? ? R  SER 24   OG    ? ? ? 1_555 LI NA  .    NA    ? ? R SER 24   R NA  8348 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc554  metalc ? ? S  ASN 63   OD1   ? ? ? 1_555 OI NA  .    NA    ? ? S ASN 63   S NA  8386 1_555 ? ? ? ? ? ? ? 2.703 ? 
metalc555  metalc ? ? S  SER 70   O     ? ? ? 1_555 NI NA  .    NA    ? ? S SER 70   S NA  8337 1_555 ? ? ? ? ? ? ? 2.687 ? 
metalc556  metalc ? ? S  VAL 72   O     ? ? ? 1_555 NI NA  .    NA    ? ? S VAL 72   S NA  8337 1_555 ? ? ? ? ? ? ? 2.807 ? 
metalc557  metalc ? ? T  GLU 61   OE1   ? ? ? 1_555 QI NA  .    NA    ? ? T GLU 61   T NA  8312 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc558  metalc ? ? CA ASN 44   O     ? ? ? 1_555 YE NA  .    NA    ? ? 3 ASN 45   A NA  8317 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc559  metalc ? ? WH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? E NA  8304 E HOH 8311 1_555 ? ? ? ? ? ? ? 2.868 ? 
metalc560  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8311 A HOH 9180 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc561  metalc ? ? QI NA  .    NA    ? ? ? 1_555 VJ HOH .    O     ? ? T NA  8312 T HOH 8324 1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc562  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8318 A HOH 9208 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc563  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8319 A HOH 9061 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc564  metalc ? ? AF NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? A NA  8319 M HOH 8533 1_555 ? ? ? ? ? ? ? 2.998 ? 
metalc565  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8320 A HOH 9058 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc566  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8320 A HOH 9089 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc567  metalc ? ? HF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8327 A HOH 9724 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc568  metalc ? ? KF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8330 A HOH 9231 1_555 ? ? ? ? ? ? ? 2.884 ? 
metalc569  metalc ? ? LF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8331 A HOH 9297 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc570  metalc ? ? PF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8335 A HOH 9867 1_555 ? ? ? ? ? ? ? 2.662 ? 
metalc571  metalc ? ? NI NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? S NA  8337 S HOH 8527 1_555 ? ? ? ? ? ? ? 2.693 ? 
metalc572  metalc ? ? WF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8344 A HOH 9219 1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc573  metalc ? ? ZH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? K NA  8346 A HOH 9477 1_555 ? ? ? ? ? ? ? 2.673 ? 
metalc574  metalc ? ? LI NA  .    NA    ? ? ? 1_555 TJ HOH .    O     ? ? R NA  8348 R HOH 5427 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc575  metalc ? ? LI NA  .    NA    ? ? ? 1_555 TJ HOH .    O     ? ? R NA  8348 R HOH 1795 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc576  metalc ? ? PH NA  .    NA    ? ? ? 1_555 DJ HOH .    O     ? ? B NA  8351 B HOH 8407 1_555 ? ? ? ? ? ? ? 2.683 ? 
metalc577  metalc ? ? DG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8356 A HOH 9447 1_555 ? ? ? ? ? ? ? 2.890 ? 
metalc578  metalc ? ? KG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8364 A HOH 9811 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc579  metalc ? ? MG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8366 A HOH 9861 1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc580  metalc ? ? PG NA  .    NA    ? ? ? 1_555 FK HOH .    O     ? ? A NA  8369 4 HOH 8543 1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc581  metalc ? ? QG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8370 A HOH 9104 1_555 ? ? ? ? ? ? ? 2.833 ? 
metalc582  metalc ? ? RG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8371 A HOH 9618 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc583  metalc ? ? YG NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? A NA  8378 M HOH 8547 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc584  metalc ? ? EA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8001 A HOH 7769 1_555 ? ? ? ? ? ? ? 1.818 ? 
metalc585  metalc ? ? EA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8001 A HOH 3608 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc586  metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8002 A HOH 4314 1_555 ? ? ? ? ? ? ? 1.858 ? 
metalc587  metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8002 A HOH 7747 1_555 ? ? ? ? ? ? ? 1.816 ? 
metalc588  metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8002 A HOH 7748 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc589  metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8003 A HOH 3659 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc590  metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 7754 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc591  metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 3773 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc592  metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8005 A HOH 3604 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc593  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8006 A HOH 3610 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc594  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8006 A HOH 3745 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc595  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8007 A HOH 3353 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc596  metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8008 A HOH 3623 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc597  metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8008 A HOH 7763 1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc598  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8009 A HOH 3731 1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc599  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8009 A HOH 7424 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc600  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8009 A HOH 7764 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc601  metalc ? ? OA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8011 A HOH 3950 1_555 ? ? ? ? ? ? ? 1.908 ? 
metalc602  metalc ? ? OA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8011 A HOH 4413 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc603  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8012 A HOH 7850 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc604  metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8013 A HOH 3647 1_555 ? ? ? ? ? ? ? 1.757 ? 
metalc605  metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8013 A HOH 7778 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc606  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8014 A HOH 3652 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc607  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8014 A HOH 7745 1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc608  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8015 A HOH 7780 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc609  metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8016 A HOH 7772 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc610  metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8016 A HOH 3738 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc611  metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8016 A HOH 7773 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc612  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8017 A HOH 3615 1_555 ? ? ? ? ? ? ? 1.836 ? 
metalc613  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8017 A HOH 3935 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc614  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8017 A HOH 7755 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc615  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8018 A HOH 3216 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc616  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8018 A HOH 3606 1_555 ? ? ? ? ? ? ? 1.895 ? 
metalc617  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8018 A HOH 7851 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc618  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8019 A HOH 4141 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc619  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8019 A HOH 7233 1_555 ? ? ? ? ? ? ? 1.972 ? 
metalc620  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8019 A HOH 7774 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc621  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8019 A HOH 7776 1_555 ? ? ? ? ? ? ? 1.763 ? 
metalc622  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 7758 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc623  metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8021 A HOH 3631 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc624  metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8021 A HOH 7761 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc625  metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8021 A HOH 3632 1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc626  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8022 A HOH 7766 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc627  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8022 A HOH 3862 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc628  metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8023 A HOH 3621 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc629  metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8023 A HOH 7783 1_555 ? ? ? ? ? ? ? 1.875 ? 
metalc630  metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8023 A HOH 3811 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc631  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8024 A HOH 7853 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc632  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8024 A HOH 5115 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc633  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8024 A HOH 7852 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc634  metalc ? ? CB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8025 A HOH 7785 1_555 ? ? ? ? ? ? ? 1.831 ? 
metalc635  metalc ? ? CB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8025 A HOH 4159 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc636  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8026 A HOH 7786 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc637  metalc ? ? EB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8027 A HOH 4005 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc638  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 3702 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc639  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 7790 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc640  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 3670 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc641  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 3690 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc642  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8029 A HOH 7793 1_555 ? ? ? ? ? ? ? 1.850 ? 
metalc643  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8029 A HOH 7794 1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc644  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8029 A HOH 7792 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc645  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8030 A HOH 7756 1_555 ? ? ? ? ? ? ? 1.799 ? 
metalc646  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8030 A HOH 3633 1_555 ? ? ? ? ? ? ? 1.852 ? 
metalc647  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8030 A HOH 7757 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc648  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8031 A HOH 3273 1_555 ? ? ? ? ? ? ? 1.764 ? 
metalc649  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8031 A HOH 7796 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc650  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8031 A HOH 7797 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc651  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8031 A HOH 7798 1_555 ? ? ? ? ? ? ? 1.777 ? 
metalc652  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 4181 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc653  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 3779 1_555 ? ? ? ? ? ? ? 1.908 ? 
metalc654  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 3716 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc655  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8033 A HOH 3807 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc656  metalc ? ? LB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8034 A HOH 3636 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc657  metalc ? ? LB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8034 A HOH 7799 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc658  metalc ? ? LB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8034 A HOH 3761 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc659  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 3707 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc660  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 7801 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc661  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 7800 1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc662  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 7856 1_555 ? ? ? ? ? ? ? 1.830 ? 
metalc663  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 7857 1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc664  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8036 A HOH 3662 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc665  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8036 A HOH 7803 1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc666  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8036 A HOH 7804 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc667  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 3132 1_555 ? ? ? ? ? ? ? 1.880 ? 
metalc668  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 3206 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc669  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 7858 1_555 ? ? ? ? ? ? ? 1.882 ? 
metalc670  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 3641 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc671  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 7806 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc672  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 3663 1_555 ? ? ? ? ? ? ? 1.753 ? 
metalc673  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 3665 1_555 ? ? ? ? ? ? ? 1.813 ? 
metalc674  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 3642 1_555 ? ? ? ? ? ? ? 1.955 ? 
metalc675  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8039 A HOH 3956 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc676  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8039 A HOH 5094 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc677  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8040 A HOH 3780 1_555 ? ? ? ? ? ? ? 1.877 ? 
metalc678  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8040 A HOH 4637 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc679  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8040 A HOH 7861 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc680  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8040 A HOH 7860 1_555 ? ? ? ? ? ? ? 1.963 ? 
metalc681  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8041 A HOH 4099 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc682  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8041 A HOH 4192 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc683  metalc ? ? TB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8042 A HOH 3650 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc684  metalc ? ? UB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8043 A HOH 7413 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc685  metalc ? ? WB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8045 A HOH 7865 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc686  metalc ? ? WB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8045 A HOH 7811 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc687  metalc ? ? XB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8046 A HOH 7866 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc688  metalc ? ? XB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8046 A HOH 7867 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc689  metalc ? ? YB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8047 A HOH 6271 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc690  metalc ? ? YB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8047 A HOH 7881 1_555 ? ? ? ? ? ? ? 1.851 ? 
metalc691  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8048 A HOH 7906 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc692  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8048 A HOH 5876 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc693  metalc ? ? AC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8049 A HOH 7869 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc694  metalc ? ? CC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8051 A HOH 4094 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc695  metalc ? ? CC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8051 A HOH 7812 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc696  metalc ? ? CC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8051 A HOH 7813 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc697  metalc ? ? DC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8052 A HOH 3617 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc698  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8053 A HOH 3038 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc699  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8053 A HOH 5614 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc700  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8054 A HOH 7814 1_555 ? ? ? ? ? ? ? 1.795 ? 
metalc701  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8054 A HOH 7815 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc702  metalc ? ? UH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? D MG  8055 A HOH 6418 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc703  metalc ? ? UH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? D MG  8055 A HOH 3749 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc704  metalc ? ? UH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? D MG  8055 A HOH 3785 1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc705  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8056 A HOH 3660 1_555 ? ? ? ? ? ? ? 1.783 ? 
metalc706  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8056 A HOH 7833 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc707  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8056 A HOH 3965 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc708  metalc ? ? HC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8057 A HOH 5004 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc709  metalc ? ? IC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8058 A HOH 7885 1_555 ? ? ? ? ? ? ? 1.843 ? 
metalc710  metalc ? ? IC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8058 A HOH 7816 1_555 ? ? ? ? ? ? ? 1.896 ? 
metalc711  metalc ? ? IC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8058 A HOH 7817 1_555 ? ? ? ? ? ? ? 1.924 ? 
metalc712  metalc ? ? IC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8058 A HOH 3755 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc713  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 4041 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc714  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 7768 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc715  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 3713 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc716  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8060 A HOH 7820 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc717  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8060 A HOH 7819 1_555 ? ? ? ? ? ? ? 1.809 ? 
metalc718  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8061 A HOH 7821 1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc719  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8061 A HOH 7822 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc720  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8061 A HOH 7823 1_555 ? ? ? ? ? ? ? 1.870 ? 
metalc721  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 3949 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc722  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 3626 1_555 ? ? ? ? ? ? ? 1.979 ? 
metalc723  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 6173 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc724  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 7001 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc725  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 7832 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc726  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 7431 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc727  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 7753 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc728  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 4171 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc729  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 7886 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc730  metalc ? ? RH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? C MG  8065 A HOH 3960 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc731  metalc ? ? QC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8067 A HOH 7825 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc732  metalc ? ? RC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 3743 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc733  metalc ? ? RC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 4815 1_555 ? ? ? ? ? ? ? 1.837 ? 
metalc734  metalc ? ? RC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 7887 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc735  metalc ? ? DI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? L MG  8069 A HOH 3415 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc736  metalc ? ? DI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? L MG  8069 A HOH 4232 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc737  metalc ? ? DI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? L MG  8069 A HOH 6044 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc738  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 7553 1_555 ? ? ? ? ? ? ? 1.925 ? 
metalc739  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 7830 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc740  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 7417 1_555 ? ? ? ? ? ? ? 1.867 ? 
metalc741  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 7831 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc742  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 4103 1_555 ? ? ? ? ? ? ? 1.867 ? 
metalc743  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 6053 1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc744  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8072 A HOH 7888 1_555 ? ? ? ? ? ? ? 1.863 ? 
metalc745  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8072 A HOH 7829 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc746  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8072 A HOH 3987 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc747  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8072 A HOH 7412 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc748  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8074 A HOH 7890 1_555 ? ? ? ? ? ? ? 1.956 ? 
metalc749  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8074 A HOH 7827 1_555 ? ? ? ? ? ? ? 1.819 ? 
metalc750  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8074 A HOH 7889 1_555 ? ? ? ? ? ? ? 1.868 ? 
metalc751  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8074 A HOH 7826 1_555 ? ? ? ? ? ? ? 1.871 ? 
metalc752  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8075 A HOH 7828 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc753  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8075 A HOH 3630 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc754  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8075 A HOH 3907 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc755  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8075 A HOH 4930 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc756  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8076 A HOH 7835 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc757  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8076 A HOH 6848 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc758  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8076 A HOH 7892 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc759  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8077 A HOH 3616 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc760  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8077 A HOH 7836 1_555 ? ? ? ? ? ? ? 1.791 ? 
metalc761  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8077 A HOH 7837 1_555 ? ? ? ? ? ? ? 1.882 ? 
metalc762  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8079 A HOH 3622 1_555 ? ? ? ? ? ? ? 1.895 ? 
metalc763  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8079 A HOH 3603 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc764  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8079 A HOH 3609 1_555 ? ? ? ? ? ? ? 1.837 ? 
metalc765  metalc ? ? AD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8080 A HOH 7838 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc766  metalc ? ? AD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8080 A HOH 4483 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc767  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8081 A HOH 4089 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc768  metalc ? ? CD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8082 A HOH 5151 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc769  metalc ? ? CD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8082 A HOH 7902 1_555 ? ? ? ? ? ? ? 1.851 ? 
metalc770  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 3698 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc771  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 4142 1_555 ? ? ? ? ? ? ? 1.951 ? 
metalc772  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 6356 1_555 ? ? ? ? ? ? ? 1.912 ? 
metalc773  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 7839 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc774  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 7895 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc775  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 7840 1_555 ? ? ? ? ? ? ? 1.804 ? 
metalc776  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8085 A HOH 3778 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc777  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 3724 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc778  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 3966 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc779  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 7842 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc780  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 7841 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc781  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8087 A HOH 3669 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc782  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8087 A HOH 7903 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc783  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8089 A HOH 7896 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc784  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8089 A HOH 7897 1_555 ? ? ? ? ? ? ? 1.804 ? 
metalc785  metalc ? ? KD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8090 A HOH 3607 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc786  metalc ? ? KD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8090 A HOH 3788 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc787  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 7844 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc788  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 6484 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc789  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 3321 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc790  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8092 A HOH 3638 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc791  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8092 A HOH 7898 1_555 ? ? ? ? ? ? ? 1.867 ? 
metalc792  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8092 A HOH 3653 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc793  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8093 A HOH 3674 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc794  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8093 A HOH 3643 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc795  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8094 A HOH 7899 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc796  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8094 A HOH 7845 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc797  metalc ? ? PD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8096 A HOH 3656 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc798  metalc ? ? PD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8096 A HOH 3825 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc799  metalc ? ? PD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8096 A HOH 3691 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc800  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8097 A HOH 3668 1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc801  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8097 A HOH 3336 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc802  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8097 A HOH 3664 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc803  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8098 A HOH 3740 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc804  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8098 A HOH 3365 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc805  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8099 A HOH 3671 1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc806  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8100 A HOH 4240 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc807  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8100 A HOH 3758 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc808  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8100 A HOH 5504 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc809  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8100 A HOH 7846 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc810  metalc ? ? UD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8101 A HOH 3739 1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc811  metalc ? ? UD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8101 A HOH 4615 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc812  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8102 A HOH 7907 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc813  metalc ? ? WD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8103 A HOH 7900 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc814  metalc ? ? XD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8104 A HOH 7750 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc815  metalc ? ? YD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8106 A HOH 3592 1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc816  metalc ? ? YD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8106 A HOH 7862 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc817  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8107 A HOH 7874 1_555 ? ? ? ? ? ? ? 1.787 ? 
metalc818  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8107 A HOH 7873 1_555 ? ? ? ? ? ? ? 1.781 ? 
metalc819  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8107 A HOH 7872 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc820  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8107 A HOH 7871 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc821  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 7877 1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc822  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 7878 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc823  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 7489 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc824  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 7876 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc825  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 5399 1_555 ? ? ? ? ? ? ? 1.889 ? 
metalc826  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 6031 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc827  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 3917 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc828  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8111 A HOH 3688 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc829  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8111 A HOH 5748 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc830  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8111 A HOH 3712 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc831  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8111 A HOH 3297 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc832  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8111 A HOH 5600 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc833  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 3759 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc834  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 3744 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc835  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 6130 1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc836  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8114 A HOH 4811 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc837  metalc ? ? GE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8115 A HOH 4275 1_555 ? ? ? ? ? ? ? 1.787 ? 
metalc838  metalc ? ? GE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8115 A HOH 6601 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc839  metalc ? ? HE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8116 A HOH 3656 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc840  metalc ? ? HE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8116 A HOH 3857 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc841  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 4918 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc842  metalc ? ? LE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8301 A HOH 3166 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc843  metalc ? ? LE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8301 A HOH 4964 1_555 ? ? ? ? ? ? ? 2.659 ? 
metalc844  metalc ? ? LE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8301 A HOH 3196 1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc845  metalc ? ? OE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8305 A HOH 4080 1_555 ? ? ? ? ? ? ? 2.733 ? 
metalc846  metalc ? ? OE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8305 A HOH 4693 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc847  metalc ? ? OE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8305 A HOH 5786 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc848  metalc ? ? RE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8308 A HOH 3405 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc849  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8311 A HOH 4647 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc850  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8311 A HOH 3567 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc851  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8313 A HOH 5112 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc852  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8313 A HOH 3826 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc853  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8314 A HOH 3127 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc854  metalc ? ? XE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8316 A HOH 6315 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc855  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8318 A HOH 3921 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc856  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8319 A HOH 4250 1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc857  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8319 A HOH 6046 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc858  metalc ? ? DF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8323 A HOH 4470 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc859  metalc ? ? EF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8324 A HOH 4119 1_555 ? ? ? ? ? ? ? 2.882 ? 
metalc860  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8325 A HOH 7660 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc861  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8325 A HOH 3273 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc862  metalc ? ? IF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8328 A HOH 5211 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc863  metalc ? ? IF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8328 A HOH 6479 1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc864  metalc ? ? JF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8329 A HOH 6580 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc865  metalc ? ? MF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8332 A HOH 7070 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc866  metalc ? ? OF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8334 A HOH 5245 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc867  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 7345 1_555 ? ? ? ? ? ? ? 2.648 ? 
metalc868  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 7687 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc869  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 5335 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc870  metalc ? ? NI NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? S NA  8337 A HOH 5918 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc871  metalc ? ? VF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8342 A HOH 3300 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc872  metalc ? ? VF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8342 A HOH 6268 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc873  metalc ? ? VF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8342 A HOH 5624 1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc874  metalc ? ? ZH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? K NA  8346 A HOH 5757 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc875  metalc ? ? YF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8350 A HOH 6953 1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc876  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8352 A HOH 6605 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc877  metalc ? ? AG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8353 A HOH 4870 1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc878  metalc ? ? BG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8354 A HOH 4812 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc879  metalc ? ? CG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8355 A HOH 4804 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc880  metalc ? ? EG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8357 A HOH 6275 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc881  metalc ? ? GG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8360 A HOH 5957 1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc882  metalc ? ? HG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8361 A HOH 5093 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc883  metalc ? ? HG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8361 A HOH 7334 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc884  metalc ? ? HG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8361 A HOH 4898 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc885  metalc ? ? MG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8366 A HOH 3873 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc886  metalc ? ? MG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8366 A HOH 3812 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc887  metalc ? ? NG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8367 A HOH 4469 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc888  metalc ? ? OG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8368 A HOH 3877 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc889  metalc ? ? PG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8369 A HOH 6575 1_555 ? ? ? ? ? ? ? 2.833 ? 
metalc890  metalc ? ? QG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8370 A HOH 4093 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc891  metalc ? ? TG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8373 A HOH 3672 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc892  metalc ? ? WG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8376 A HOH 4851 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc893  metalc ? ? XG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8377 A HOH 6343 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc894  metalc ? ? YG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8378 A HOH 3204 1_555 ? ? ? ? ? ? ? 2.996 ? 
metalc895  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8379 A HOH 4417 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc896  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8379 A HOH 3705 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc897  metalc ? ? AH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8381 A HOH 3682 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc898  metalc ? ? AH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8381 A HOH 7072 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc899  metalc ? ? CH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8384 A HOH 5012 1_555 ? ? ? ? ? ? ? 2.786 ? 
metalc900  metalc ? ? DH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8385 A HOH 7680 1_555 ? ? ? ? ? ? ? 2.915 ? 
hydrog1    hydrog ? ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2    ? ? A U   12   A G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ? ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ? ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ? ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ? ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ? ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ? ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ? ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3    ? ? A A   16   A U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ? ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4    ? ? A A   16   A U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ? ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2    ? ? A G   17   A U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ? ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3    ? ? A G   17   A U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ? ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ? ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ? ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ? ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1    ? ? A U   19   A A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ? ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6    ? ? A U   19   A A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ? ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ? ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ? ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2    ? ? A G   21   A U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3    ? ? A G   21   A U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ? ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6    ? ? A U   22   A A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ? ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7    ? ? A G   23   A A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ? ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6    ? ? A G   23   A A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7    ? ? A G   24   A A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6    ? ? A G   24   A A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ? ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3    ? ? A A   25   A G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ? ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2    ? ? A A   25   A G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ? ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2    ? ? A U   26   A U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ? ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3    ? ? A U   26   A U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1    ? ? A U   27   A A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6    ? ? A U   27   A A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ? ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ? ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ? ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ? ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ? ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ? ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ? ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7    ? ? A U   30   A A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ? ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6    ? ? A U   30   A A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ? ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ? ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1    ? ? A G   32   A A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3    ? ? A G   32   A G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ? ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2    ? ? A G   32   A G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ? ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ? ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ? ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ? ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1    ? ? A U   35   A A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ? ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6    ? ? A U   35   A A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ? ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ? ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6    ? ? A C   36   A A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ? ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3    ? ? A A   37   A U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ? ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4    ? ? A A   37   A U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ? ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ? ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ? ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ? ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1    ? ? A C   40   A A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ? ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6    ? ? A C   40   A A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1    ? ? A G   41   A A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ? ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ? ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ? ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ? ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ? ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ? ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1    ? ? A U   43   A A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ? ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6    ? ? A U   43   A A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ? ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1    ? ? A G   44   A A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ? ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4    ? ? A A   45   A U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ? ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3    ? ? A A   45   A U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ? ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7    ? ? A G   47   A A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ? ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6    ? ? A G   47   A A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ? ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6    ? ? A A   48   A A   114  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog87   hydrog ? ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3    ? ? A A   49   A G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog88   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2    ? ? A A   49   A G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ? ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90   hydrog ? ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ? ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2    ? ? A G   51   A U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog96   hydrog ? ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3    ? ? A A   52   A U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97   hydrog ? ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4    ? ? A A   52   A U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ? ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ? ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ? ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ? ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ? ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3    ? ? A G   54   A A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog105  hydrog ? ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6    ? ? A U   55   A G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog106  hydrog ? ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1    ? ? A U   55   A G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ? ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4    ? ? A G   56   A C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog108  hydrog ? ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6    ? ? A G   56   A G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog109  hydrog ? ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7    ? ? A G   56   A G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ? ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111  hydrog ? ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ? ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ? ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6    ? ? A A   59   A A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog117  hydrog ? ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4    ? ? A A   59   A C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog118  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6    ? ? A A   60   A A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog119  hydrog ? ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1    ? ? A A   60   A A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ? ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121  hydrog ? ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ? ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ? ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ? ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ? ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ? ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7    ? ? A U   63   A A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog127  hydrog ? ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6    ? ? A U   63   A A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog128  hydrog ? ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1    ? ? A G   66   A A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog129  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1    ? ? A G   71   A A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog130  hydrog ? ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6    ? ? A G   71   A A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  U   106  O2    ? ? A G   71   A U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog132  hydrog ? ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133  hydrog ? ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ? ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ? ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3    ? ? A A   74   A U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ? ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4    ? ? A A   74   A U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ? ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1    ? ? A U   75   A A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ? ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6    ? ? A U   75   A A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ? ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143  hydrog ? ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ? ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7    ? ? A G   78   A A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog149  hydrog ? ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6    ? ? A G   78   A A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog150  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7    ? ? A G   79   A A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog151  hydrog ? ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2    ? ? A A   80   A G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog152  hydrog ? ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3    ? ? A A   80   A G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog153  hydrog ? ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2    ? ? A A   80   A G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog154  hydrog ? ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156  hydrog ? ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3    ? ? A G   81   A A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog158  hydrog ? ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159  hydrog ? ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ? ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ? ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ? ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ? ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ? ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3    ? ? A A   117  A U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ? ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4    ? ? A A   117  A U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ? ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ? ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ? ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ? ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1    ? ? A U   125  A A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173  hydrog ? ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6    ? ? A U   125  A A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174  hydrog ? ? A  C   129  O2    ? ? ? 1_555 A  A   131  N6    ? ? A C   130  A A   132  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog175  hydrog ? ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7    ? ? A C   130  A A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog176  hydrog ? ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7    ? ? A A   131  A G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog177  hydrog ? ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3    ? ? A A   132  A U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4    ? ? A A   132  A U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ? ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1    ? ? A U   133  A A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180  hydrog ? ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6    ? ? A U   133  A A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1    ? ? A U   134  A A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6    ? ? A U   134  A A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ? ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ? ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ? ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ? ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187  hydrog ? ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188  hydrog ? ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189  hydrog ? ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1    ? ? A U   137  A G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog190  hydrog ? ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4    ? ? A C   141  A C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog191  hydrog ? ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6    ? ? A C   141  A A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog192  hydrog ? ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1    ? ? A A   152  A G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog193  hydrog ? ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6    ? ? A A   152  A G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog194  hydrog ? ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195  hydrog ? ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ? ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ? ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ? ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1    ? ? A G   157  A A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog210  hydrog ? ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3    ? ? A A   158  A U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211  hydrog ? ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4    ? ? A A   158  A U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7    ? ? A G   159  A A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog213  hydrog ? ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6    ? ? A G   159  A A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog214  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  U   177  O4    ? ? A G   159  A U   178  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog215  hydrog ? ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2    ? ? A A   160  A U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog216  hydrog ? ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3    ? ? A A   160  A U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog217  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7    ? ? A A   161  A A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog218  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6    ? ? A A   161  A A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog219  hydrog ? ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2    ? ? A A   161  A G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog220  hydrog ? ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2    ? ? A C   162  A C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog221  hydrog ? ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4    ? ? A C   162  A C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog222  hydrog ? ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2    ? ? A U   163  A U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog223  hydrog ? ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3    ? ? A U   163  A U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog224  hydrog ? ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226  hydrog ? ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3    ? ? A G   164  A A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog228  hydrog ? ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2    ? ? A A   165  A G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog229  hydrog ? ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2    ? ? A A   166  A G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog230  hydrog ? ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3    ? ? A A   166  A G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog231  hydrog ? ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232  hydrog ? ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233  hydrog ? ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234  hydrog ? ? A  U   169  N3    ? ? ? 1_555 A  G   220  O6    ? ? A U   170  A G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog235  hydrog ? ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1    ? ? A U   170  A G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog236  hydrog ? ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1    ? ? A C   171  A G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog237  hydrog ? ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4    ? ? A G   175  A U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog238  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1    ? ? A G   185  A A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog239  hydrog ? ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7    ? ? A G   190  A A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog240  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  A   235  N3    ? ? A A   191  A A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog241  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2    ? ? A A   191  A U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog242  hydrog ? ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3    ? ? A A   191  A U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog243  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3    ? ? A A   192  A G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog244  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2    ? ? A A   192  A G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog245  hydrog ? ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2    ? ? A A   193  A G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog246  hydrog ? ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3    ? ? A A   194  A U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247  hydrog ? ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4    ? ? A A   194  A U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248  hydrog ? ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249  hydrog ? ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251  hydrog ? ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7    ? ? A G   196  A A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog252  hydrog ? ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6    ? ? A G   196  A A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog253  hydrog ? ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2    ? ? A G   196  A U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog254  hydrog ? ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2    ? ? A A   198  A G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog255  hydrog ? ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3    ? ? A A   198  A G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog256  hydrog ? ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6    ? ? A A   204  A A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog257  hydrog ? ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1    ? ? A A   204  A A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog258  hydrog ? ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1    ? ? A U   205  A A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog259  hydrog ? ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6    ? ? A U   205  A A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog260  hydrog ? ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2    ? ? A G   206  A U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog261  hydrog ? ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3    ? ? A G   206  A U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog262  hydrog ? ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1    ? ? A U   207  A A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263  hydrog ? ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6    ? ? A U   207  A A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264  hydrog ? ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265  hydrog ? ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266  hydrog ? ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267  hydrog ? ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268  hydrog ? ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269  hydrog ? ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270  hydrog ? ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6    ? ? A U   210  A G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog271  hydrog ? ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1    ? ? A U   210  A G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog272  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4    ? ? A U   211  A C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog273  hydrog ? ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7    ? ? A A   212  A A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog274  hydrog ? ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6    ? ? A A   212  A A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog275  hydrog ? ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4    ? ? A G   213  A U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog276  hydrog ? ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7    ? ? A U   214  A A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog277  hydrog ? ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6    ? ? A U   214  A A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog278  hydrog ? ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3    ? ? A A   215  A G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog279  hydrog ? ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2    ? ? A A   215  A G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog280  hydrog ? ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3    ? ? A A   216  A U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4    ? ? A A   216  A U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282  hydrog ? ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283  hydrog ? ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284  hydrog ? ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285  hydrog ? ? A  C   217  O2    ? ? ? 1_555 A  A   221  N6    ? ? A C   218  A A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog286  hydrog ? ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3    ? ? A G   231  A A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog287  hydrog ? ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ? ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289  hydrog ? ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290  hydrog ? ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ? ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ? ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299  hydrog ? ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2    ? ? A A   241  A U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog300  hydrog ? ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3    ? ? A A   241  A U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog301  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3    ? ? A A   242  A G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog302  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2    ? ? A A   242  A G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog303  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2    ? ? A A   243  A U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog304  hydrog ? ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2    ? ? A A   243  A G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog305  hydrog ? ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306  hydrog ? ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307  hydrog ? ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311  hydrog ? ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4    ? ? A G   246  A U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog312  hydrog ? ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3    ? ? A A   247  A G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog313  hydrog ? ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2    ? ? A A   247  A G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog314  hydrog ? ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3    ? ? A A   248  A U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4    ? ? A A   248  A U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316  hydrog ? ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317  hydrog ? ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ? ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ? ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ? ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ? ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4    ? ? A U   253  A C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog329  hydrog ? ? A  U   252  N3    ? ? ? 1_555 A  G   256  O6    ? ? A U   253  A G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog330  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  G   256  N1    ? ? A U   253  A G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog331  hydrog ? ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1    ? ? A C   271  A A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog332  hydrog ? ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333  hydrog ? ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334  hydrog ? ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2    ? ? A G   275  A U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog339  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3    ? ? A G   275  A U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog340  hydrog ? ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341  hydrog ? ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342  hydrog ? ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343  hydrog ? ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1    ? ? A U   277  A A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ? ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6    ? ? A U   277  A A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ? ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3    ? ? A A   278  A U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346  hydrog ? ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4    ? ? A A   278  A U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347  hydrog ? ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348  hydrog ? ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  C   367  N4    ? ? A U   281  A C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog354  hydrog ? ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4    ? ? A C   282  A C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog355  hydrog ? ? A  A   284  N6    ? ? ? 1_555 A  G   366  N3    ? ? A A   285  A G   367  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog356  hydrog ? ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2    ? ? A U   286  A U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog357  hydrog ? ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3    ? ? A U   286  A U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog358  hydrog ? ? A  C   286  N3    ? ? ? 1_555 A  G   364  N1    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog359  hydrog ? ? A  C   286  N4    ? ? ? 1_555 A  G   364  O6    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog360  hydrog ? ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361  hydrog ? ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1    ? ? A G   289  A A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog362  hydrog ? ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363  hydrog ? ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog364  hydrog ? ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4    ? ? A C   291  A C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog366  hydrog ? ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7    ? ? A G   292  A A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog367  hydrog ? ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6    ? ? A G   292  A A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog368  hydrog ? ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2    ? ? A A   293  A U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog369  hydrog ? ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3    ? ? A A   293  A U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog370  hydrog ? ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2    ? ? A C   295  A C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog371  hydrog ? ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372  hydrog ? ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373  hydrog ? ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ? ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1    ? ? A U   297  A A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ? ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6    ? ? A U   297  A A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376  hydrog ? ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377  hydrog ? ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378  hydrog ? ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379  hydrog ? ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1    ? ? A U   299  A A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380  hydrog ? ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6    ? ? A U   299  A A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381  hydrog ? ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ? ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383  hydrog ? ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384  hydrog ? ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385  hydrog ? ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386  hydrog ? ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387  hydrog ? ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3    ? ? A A   302  A U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388  hydrog ? ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4    ? ? A A   302  A U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389  hydrog ? ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4    ? ? A C   303  A C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog390  hydrog ? ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7    ? ? A G   304  A A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog391  hydrog ? ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6    ? ? A G   304  A A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog392  hydrog ? ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6    ? ? A A   305  A G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog393  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6    ? ? A A   306  A G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog394  hydrog ? ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395  hydrog ? ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396  hydrog ? ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ? ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1    ? ? A U   308  A A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ? ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6    ? ? A U   308  A A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399  hydrog ? ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400  hydrog ? ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401  hydrog ? ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402  hydrog ? ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1    ? ? A U   310  A A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403  hydrog ? ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6    ? ? A U   310  A A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404  hydrog ? ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405  hydrog ? ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406  hydrog ? ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407  hydrog ? ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1    ? ? A U   312  A A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog408  hydrog ? ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6    ? ? A U   312  A A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog409  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7    ? ? A U   313  A A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog410  hydrog ? ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6    ? ? A U   313  A A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog411  hydrog ? ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1    ? ? A G   314  A A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog412  hydrog ? ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6    ? ? A G   314  A A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog413  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3    ? ? A G   315  A G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog414  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2    ? ? A G   315  A G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog415  hydrog ? ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2    ? ? A A   316  A U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog416  hydrog ? ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3    ? ? A G   324  A C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog417  hydrog ? ? A  G   323  N2    ? ? ? 1_555 A  C   340  O2    ? ? A G   324  A C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog418  hydrog ? ? A  G   323  O6    ? ? ? 1_555 A  C   340  N4    ? ? A G   324  A C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419  hydrog ? ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1    ? ? A U   325  A A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420  hydrog ? ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6    ? ? A U   325  A A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421  hydrog ? ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog422  hydrog ? ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog423  hydrog ? ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog424  hydrog ? ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3    ? ? A A   329  A U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog425  hydrog ? ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3    ? ? A A   331  A G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog426  hydrog ? ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2    ? ? A A   331  A G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog427  hydrog ? ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog428  hydrog ? ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog429  hydrog ? ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog434  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog435  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog436  hydrog ? ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7    ? ? A U   335  A A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog437  hydrog ? ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6    ? ? A U   335  A A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog438  hydrog ? ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4    ? ? A G   358  A U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog439  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7    ? ? A A   380  A A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog440  hydrog ? ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6    ? ? A A   380  A A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog441  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  U   408  O4    ? ? A A   380  A U   409  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog442  hydrog ? ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4    ? ? A G   381  A U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog443  hydrog ? ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7    ? ? A U   382  A A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog444  hydrog ? ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6    ? ? A U   382  A A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog445  hydrog ? ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3    ? ? A A   383  A G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog446  hydrog ? ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2    ? ? A A   383  A G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog447  hydrog ? ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog448  hydrog ? ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449  hydrog ? ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450  hydrog ? ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451  hydrog ? ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452  hydrog ? ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453  hydrog ? ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog454  hydrog ? ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog455  hydrog ? ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog456  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2    ? ? A G   387  A U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog457  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3    ? ? A G   387  A U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog458  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog459  hydrog ? ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog465  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog466  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog467  hydrog ? ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4    ? ? A U   391  A U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog468  hydrog ? ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3    ? ? A U   391  A U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog469  hydrog ? ? A  G   393  N3    ? ? ? 1_555 A  G   416  N2    ? ? A G   394  A G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog470  hydrog ? ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4    ? ? A A   395  A C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog471  hydrog ? ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2    ? ? A U   396  A G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog472  hydrog ? ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1    ? ? A A   407  A A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog473  hydrog ? ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6    ? ? A A   408  A A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog474  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? A A   408  A A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog475  hydrog ? ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476  hydrog ? ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477  hydrog ? ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478  hydrog ? ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479  hydrog ? ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480  hydrog ? ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481  hydrog ? ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog482  hydrog ? ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ? ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ? ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3    ? ? A A   415  A U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ? ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4    ? ? A A   415  A U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ? ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ? ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ? ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ? ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog490  hydrog ? ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491  hydrog ? ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog492  hydrog ? ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4    ? ? A A   419  A C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog493  hydrog ? ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3    ? ? A A   419  A U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog494  hydrog ? ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4    ? ? A A   419  A U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495  hydrog ? ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1    ? ? A U   420  A A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496  hydrog ? ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6    ? ? A U   420  A A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497  hydrog ? ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog498  hydrog ? ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog499  hydrog ? ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog500  hydrog ? ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2    ? ? A G   422  A U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog501  hydrog ? ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3    ? ? A G   422  A U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog502  hydrog ? ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3    ? ? A A   423  A U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog503  hydrog ? ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4    ? ? A A   423  A U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog504  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6    ? ? A A   441  A A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog505  hydrog ? ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2    ? ? A A   449  A G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog506  hydrog ? ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1    ? ? A G   452  A A   460  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog507  hydrog ? ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2    ? ? A U   454  A U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog508  hydrog ? ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6    ? ? A A   455  A A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog509  hydrog ? ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7    ? ? A A   455  A A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog510  hydrog ? ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3    ? ? A G   458  A A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog511  hydrog ? ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7    ? ? A A   463  A A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog512  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6    ? ? A A   463  A A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog513  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  C   477  N4    ? ? A A   463  A C   478  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog514  hydrog ? ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4    ? ? A G   464  A U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog515  hydrog ? ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7    ? ? A U   465  A A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog516  hydrog ? ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6    ? ? A U   465  A A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog517  hydrog ? ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3    ? ? A A   466  A G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog518  hydrog ? ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2    ? ? A A   466  A G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog519  hydrog ? ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog520  hydrog ? ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog521  hydrog ? ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog522  hydrog ? ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1    ? ? A U   468  A A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog523  hydrog ? ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6    ? ? A U   468  A A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog524  hydrog ? ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7    ? ? A G   469  A A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog525  hydrog ? ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2    ? ? A G   471  A C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog526  hydrog ? ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7    ? ? A U   481  A A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog527  hydrog ? ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6    ? ? A U   481  A A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog528  hydrog ? ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7    ? ? A G   482  A A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog529  hydrog ? ? A  C   482  N4    ? ? ? 1_555 A  A   506  N7    ? ? A C   483  A A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog530  hydrog ? ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6    ? ? A A   485  A A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog531  hydrog ? ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1    ? ? A A   485  A A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog532  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6    ? ? A A   486  A A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog533  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1    ? ? A A   486  A A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog534  hydrog ? ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2    ? ? A G   487  A G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog535  hydrog ? ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog536  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog537  hydrog ? ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog538  hydrog ? ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1    ? ? A U   488  A G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog539  hydrog ? ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3    ? ? A A   489  A G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog540  hydrog ? ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2    ? ? A A   489  A G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog541  hydrog ? ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1    ? ? A C   490  A A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog542  hydrog ? ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog543  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog544  hydrog ? ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog545  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog546  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog547  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog548  hydrog ? ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6    ? ? A U   493  A G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog549  hydrog ? ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1    ? ? A U   493  A G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog550  hydrog ? ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6    ? ? A C   494  A A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog551  hydrog ? ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6    ? ? A G   504  A G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog552  hydrog ? ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6    ? ? A C   505  A A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog553  hydrog ? ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7    ? ? A G   506  A A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog554  hydrog ? ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6    ? ? A G   506  A A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog555  hydrog ? ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2    ? ? A A   521  A G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog556  hydrog ? ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2    ? ? A A   532  A G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog557  hydrog ? ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1    ? ? A G   535  A G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog558  hydrog ? ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2    ? ? A G   535  A G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog559  hydrog ? ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2    ? ? A A   536  A G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog560  hydrog ? ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2    ? ? A G   537  A U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog561  hydrog ? ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3    ? ? A G   537  A U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog562  hydrog ? ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3    ? ? A C   538  A A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog563  hydrog ? ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog564  hydrog ? ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog565  hydrog ? ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566  hydrog ? ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3    ? ? A A   540  A U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog567  hydrog ? ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4    ? ? A A   540  A U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog568  hydrog ? ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog569  hydrog ? ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog570  hydrog ? ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ? ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3    ? ? A A   542  A U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572  hydrog ? ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4    ? ? A A   542  A U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573  hydrog ? ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574  hydrog ? ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog575  hydrog ? ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog576  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2    ? ? A G   544  A U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog577  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3    ? ? A G   544  A U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog578  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2    ? ? A G   545  A U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog579  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3    ? ? A G   545  A U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog580  hydrog ? ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog581  hydrog ? ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582  hydrog ? ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583  hydrog ? ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3    ? ? A A   547  A U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584  hydrog ? ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4    ? ? A A   547  A U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585  hydrog ? ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1    ? ? A U   548  A A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog586  hydrog ? ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6    ? ? A U   548  A A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587  hydrog ? ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2    ? ? A A   552  A G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog588  hydrog ? ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589  hydrog ? ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590  hydrog ? ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594  hydrog ? ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1    ? ? A U   555  A A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog595  hydrog ? ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6    ? ? A U   555  A A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ? ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ? ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ? ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6    ? ? A C   558  A G   599  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog603  hydrog ? ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4    ? ? A U   559  A C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog604  hydrog ? ? A  C   559  N4    ? ? ? 1_555 A  A   596  N1    ? ? A C   560  A A   597  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog605  hydrog ? ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606  hydrog ? ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog607  hydrog ? ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog608  hydrog ? ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3    ? ? A A   562  A U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog609  hydrog ? ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4    ? ? A A   562  A U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog610  hydrog ? ? A  C   562  O2    ? ? ? 1_555 A  C   593  N4    ? ? A C   563  A C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog611  hydrog ? ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3    ? ? A A   566  A G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog612  hydrog ? ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2    ? ? A A   566  A G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog613  hydrog ? ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2    ? ? A A   566  A G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog614  hydrog ? ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1    ? ? A U   567  A A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog615  hydrog ? ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6    ? ? A U   567  A A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog616  hydrog ? ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7    ? ? A G   568  A A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog617  hydrog ? ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6    ? ? A G   568  A A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog618  hydrog ? ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2    ? ? A A   569  A U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog619  hydrog ? ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3    ? ? A A   569  A U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog620  hydrog ? ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2    ? ? A C   571  A C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog621  hydrog ? ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog622  hydrog ? ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog623  hydrog ? ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog624  hydrog ? ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3    ? ? A A   573  A U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625  hydrog ? ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4    ? ? A A   573  A U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626  hydrog ? ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627  hydrog ? ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628  hydrog ? ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog629  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog630  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog631  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog632  hydrog ? ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog633  hydrog ? ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634  hydrog ? ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog635  hydrog ? ? A  G   576  N2    ? ? ? 1_555 A  A   579  N7    ? ? A G   577  A A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog636  hydrog ? ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2    ? ? A G   579  A U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog637  hydrog ? ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2    ? ? A A   580  A G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog638  hydrog ? ? A  G   587  N2    ? ? ? 1_555 A  U   588  O4    ? ? A G   588  A U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog639  hydrog ? ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6    ? ? A G   604  A G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog640  hydrog ? ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7    ? ? A G   604  A G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog641  hydrog ? ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1    ? ? A U   619  A A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog642  hydrog ? ? A  U   618  O4    ? ? ? 1_555 A  A   2073 N6    ? ? A U   619  A A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog643  hydrog ? ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1    ? ? A A   620  A A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog644  hydrog ? ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog645  hydrog ? ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646  hydrog ? ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog647  hydrog ? ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648  hydrog ? ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog649  hydrog ? ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog650  hydrog ? ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1    ? ? A U   623  A A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog651  hydrog ? ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6    ? ? A U   623  A A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog652  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  A   627  N7    ? ? A U   624  A A   628  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog653  hydrog ? ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4    ? ? A U   625  A C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog654  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6    ? ? A U   626  A A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog655  hydrog ? ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2    ? ? A A   629  A G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog656  hydrog ? ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3    ? ? A A   629  A G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog657  hydrog ? ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog658  hydrog ? ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659  hydrog ? ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660  hydrog ? ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ? ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ? ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog665  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog666  hydrog ? ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3    ? ? A A   639  A U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog667  hydrog ? ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4    ? ? A A   639  A U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog668  hydrog ? ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669  hydrog ? ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670  hydrog ? ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog671  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog673  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog674  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7    ? ? A G   642  A A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog675  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6    ? ? A G   642  A A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog676  hydrog ? ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2    ? ? A A   643  A G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog677  hydrog ? ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7    ? ? A A   643  A A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog678  hydrog ? ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6    ? ? A A   643  A A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog679  hydrog ? ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2    ? ? A G   644  A U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog680  hydrog ? ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3    ? ? A U   645  A A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog681  hydrog ? ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog682  hydrog ? ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683  hydrog ? ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684  hydrog ? ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1    ? ? A U   647  A A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685  hydrog ? ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6    ? ? A U   647  A A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog686  hydrog ? ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog687  hydrog ? ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog688  hydrog ? ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog689  hydrog ? ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1    ? ? A U   649  A A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog690  hydrog ? ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6    ? ? A U   649  A A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog691  hydrog ? ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog692  hydrog ? ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog693  hydrog ? ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog694  hydrog ? ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6    ? ? A U   651  A G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog695  hydrog ? ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1    ? ? A U   651  A G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog696  hydrog ? ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2    ? ? A G   652  A U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog697  hydrog ? ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3    ? ? A G   652  A U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog698  hydrog ? ? A  C   652  N3    ? ? ? 1_555 A  G   751  N1    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog699  hydrog ? ? A  C   652  N4    ? ? ? 1_555 A  G   751  O6    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog700  hydrog ? ? A  C   652  O2    ? ? ? 1_555 A  G   751  N2    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog701  hydrog ? ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3    ? ? A A   654  A U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ? ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4    ? ? A A   654  A U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ? ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1    ? ? A U   655  A A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ? ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6    ? ? A U   655  A A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ? ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog706  hydrog ? ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog707  hydrog ? ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog708  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog709  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog710  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog711  hydrog ? ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog712  hydrog ? ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog713  hydrog ? ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog714  hydrog ? ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog715  hydrog ? ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog716  hydrog ? ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog717  hydrog ? ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6    ? ? A U   662  A G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog718  hydrog ? ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1    ? ? A U   662  A G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog719  hydrog ? ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog720  hydrog ? ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog721  hydrog ? ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog722  hydrog ? ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7    ? ? A U   664  A A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog723  hydrog ? ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6    ? ? A U   664  A A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog724  hydrog ? ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3    ? ? A A   666  A G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog725  hydrog ? ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2    ? ? A A   666  A G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog726  hydrog ? ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog727  hydrog ? ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog728  hydrog ? ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog729  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ? ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog733  hydrog ? ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog734  hydrog ? ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog735  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog736  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ? ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ? ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ? ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog741  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog742  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog743  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog744  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7    ? ? A G   691  A A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog745  hydrog ? ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2    ? ? A A   692  A G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog746  hydrog ? ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2    ? ? A A   698  A G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog747  hydrog ? ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog748  hydrog ? ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog749  hydrog ? ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog750  hydrog ? ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog751  hydrog ? ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog752  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog753  hydrog ? ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2    ? ? A G   702  A G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog754  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1    ? ? A G   702  A G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog755  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog756  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog757  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog758  hydrog ? ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ? ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ? ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog761  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog762  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog763  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog764  hydrog ? ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6    ? ? A G   706  A G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog765  hydrog ? ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6    ? ? A C   707  A A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog766  hydrog ? ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7    ? ? A C   707  A A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog767  hydrog ? ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3    ? ? A A   708  A G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog768  hydrog ? ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2    ? ? A A   708  A G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog769  hydrog ? ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog770  hydrog ? ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog771  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog772  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog775  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog776  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog777  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog778  hydrog ? ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog779  hydrog ? ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog780  hydrog ? ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog781  hydrog ? ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6    ? ? A C   726  A G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog782  hydrog ? ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog783  hydrog ? ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ? ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog785  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog786  hydrog ? ? A  C   728  N4    ? ? ? 1_555 A  G   741  O6    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog787  hydrog ? ? A  C   728  O2    ? ? ? 1_555 A  G   741  N2    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ? ? A  G   729  N1    ? ? ? 1_555 A  C   740  N3    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog789  hydrog ? ? A  G   729  N2    ? ? ? 1_555 A  C   740  O2    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog790  hydrog ? ? A  G   729  O6    ? ? ? 1_555 A  C   740  N4    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog791  hydrog ? ? A  U   730  N3    ? ? ? 1_555 A  G   739  O6    ? ? A U   731  A G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog792  hydrog ? ? A  U   730  O2    ? ? ? 1_555 A  G   739  N1    ? ? A U   731  A G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog793  hydrog ? ? A  C   731  N3    ? ? ? 1_555 A  G   738  N1    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog794  hydrog ? ? A  C   731  N4    ? ? ? 1_555 A  G   738  O6    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog795  hydrog ? ? A  C   731  O2    ? ? ? 1_555 A  G   738  N2    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog796  hydrog ? ? A  U   732  N3    ? ? ? 1_555 A  G   737  O6    ? ? A U   733  A G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog797  hydrog ? ? A  U   732  O2    ? ? ? 1_555 A  G   737  N1    ? ? A U   733  A G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog798  hydrog ? ? A  C   761  N3    ? ? ? 1_555 A  G   901  N1    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog799  hydrog ? ? A  C   761  N4    ? ? ? 1_555 A  G   901  O6    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog800  hydrog ? ? A  C   761  O2    ? ? ? 1_555 A  G   901  N2    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog801  hydrog ? ? A  C   762  N3    ? ? ? 1_555 A  G   900  N1    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog802  hydrog ? ? A  C   762  N4    ? ? ? 1_555 A  G   900  O6    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog803  hydrog ? ? A  C   762  O2    ? ? ? 1_555 A  G   900  N2    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ? ? A  C   763  N4    ? ? ? 1_555 A  U   899  O4    ? ? A C   764  A U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog805  hydrog ? ? A  G   764  N1    ? ? ? 1_555 A  C   898  N3    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog806  hydrog ? ? A  G   764  N2    ? ? ? 1_555 A  C   898  O2    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog807  hydrog ? ? A  G   764  O6    ? ? ? 1_555 A  C   898  N4    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog808  hydrog ? ? A  A   765  N6    ? ? ? 1_555 A  C   895  N3    ? ? A A   766  A C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog809  hydrog ? ? A  A   765  N7    ? ? ? 1_555 A  C   895  N4    ? ? A A   766  A C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog810  hydrog ? ? A  A   766  N6    ? ? ? 1_555 A  A   894  N1    ? ? A A   767  A A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog811  hydrog ? ? A  A   766  N7    ? ? ? 1_555 A  A   894  N6    ? ? A A   767  A A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog812  hydrog ? ? A  A   766  N3    ? ? ? 1_555 A  G   2109 N2    ? ? A A   767  A G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog813  hydrog ? ? A  U   767  O4    ? ? ? 1_555 A  C   892  N4    ? ? A U   768  A C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog814  hydrog ? ? A  C   768  N3    ? ? ? 1_555 A  G   891  N1    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog815  hydrog ? ? A  C   768  N4    ? ? ? 1_555 A  G   891  O6    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog816  hydrog ? ? A  C   768  O2    ? ? ? 1_555 A  G   891  N2    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog817  hydrog ? ? A  C   769  N3    ? ? ? 1_555 A  G   890  N1    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ? ? A  C   769  N4    ? ? ? 1_555 A  G   890  O6    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog819  hydrog ? ? A  C   769  O2    ? ? ? 1_555 A  G   890  N2    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog820  hydrog ? ? A  G   770  N1    ? ? ? 1_555 A  C   889  N3    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog821  hydrog ? ? A  G   770  N2    ? ? ? 1_555 A  C   889  O2    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog822  hydrog ? ? A  G   770  O6    ? ? ? 1_555 A  C   889  N4    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog823  hydrog ? ? A  G   771  N1    ? ? ? 1_555 A  C   888  N3    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog824  hydrog ? ? A  G   771  N2    ? ? ? 1_555 A  C   888  O2    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog825  hydrog ? ? A  G   771  O6    ? ? ? 1_555 A  C   888  N4    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ? ? A  A   772  N1    ? ? ? 1_555 A  U   887  N3    ? ? A A   773  A U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ? ? A  A   772  N6    ? ? ? 1_555 A  U   887  O4    ? ? A A   773  A U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ? ? A  C   773  N3    ? ? ? 1_555 A  G   886  N1    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog829  hydrog ? ? A  C   773  N4    ? ? ? 1_555 A  G   886  O6    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog830  hydrog ? ? A  C   773  O2    ? ? ? 1_555 A  G   886  N2    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog831  hydrog ? ? A  G   774  N1    ? ? ? 1_555 A  G   867  N7    ? ? A G   775  A G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog832  hydrog ? ? A  G   774  N2    ? ? ? 1_555 A  G   867  O6    ? ? A G   775  A G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog833  hydrog ? ? A  A   775  N3    ? ? ? 1_555 A  U   778  N3    ? ? A A   776  A U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog834  hydrog ? ? A  A   775  N1    ? ? ? 1_555 A  G   870  N2    ? ? A A   776  A G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog835  hydrog ? ? A  A   775  N6    ? ? ? 1_555 A  G   870  N3    ? ? A A   776  A G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog836  hydrog ? ? A  C   777  O2    ? ? ? 1_555 A  A   1835 N6    ? ? A C   778  A A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog837  hydrog ? ? A  A   779  N1    ? ? ? 1_555 A  U   865  N3    ? ? A A   780  A U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog838  hydrog ? ? A  A   779  N6    ? ? ? 1_555 A  U   865  O4    ? ? A A   780  A U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog839  hydrog ? ? A  C   780  N3    ? ? ? 1_555 A  G   864  N1    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog840  hydrog ? ? A  C   780  N4    ? ? ? 1_555 A  G   864  O6    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog841  hydrog ? ? A  C   780  O2    ? ? ? 1_555 A  G   864  N2    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog842  hydrog ? ? A  G   781  N1    ? ? ? 1_555 A  U   863  O2    ? ? A G   782  A U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog843  hydrog ? ? A  G   781  O6    ? ? ? 1_555 A  U   863  N3    ? ? A G   782  A U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog844  hydrog ? ? A  C   782  N3    ? ? ? 1_555 A  G   862  N1    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog845  hydrog ? ? A  C   782  N4    ? ? ? 1_555 A  G   862  O6    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog846  hydrog ? ? A  C   782  O2    ? ? ? 1_555 A  G   862  N2    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog847  hydrog ? ? A  A   783  N1    ? ? ? 1_555 A  U   861  N3    ? ? A A   784  A U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ? ? A  A   783  N6    ? ? ? 1_555 A  U   861  O4    ? ? A A   784  A U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog849  hydrog ? ? A  U   784  N3    ? ? ? 1_555 A  A   860  N1    ? ? A U   785  A A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog850  hydrog ? ? A  U   784  O4    ? ? ? 1_555 A  A   860  N6    ? ? A U   785  A A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog851  hydrog ? ? A  G   785  N1    ? ? ? 1_555 A  U   859  O2    ? ? A G   786  A U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog852  hydrog ? ? A  G   785  O6    ? ? ? 1_555 A  U   859  N3    ? ? A G   786  A U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog853  hydrog ? ? A  G   786  N1    ? ? ? 1_555 A  C   858  N3    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog854  hydrog ? ? A  G   786  N2    ? ? ? 1_555 A  C   858  O2    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog855  hydrog ? ? A  G   786  O6    ? ? ? 1_555 A  C   858  N4    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog856  hydrog ? ? A  A   787  N1    ? ? ? 1_555 A  U   857  N3    ? ? A A   788  A U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ? ? A  A   787  N6    ? ? ? 1_555 A  U   857  O4    ? ? A A   788  A U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ? ? A  C   788  N3    ? ? ? 1_555 A  G   855  N1    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog859  hydrog ? ? A  C   788  N4    ? ? ? 1_555 A  G   855  O6    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog860  hydrog ? ? A  C   788  O2    ? ? ? 1_555 A  G   855  N2    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog861  hydrog ? ? A  A   789  N6    ? ? ? 1_555 A  G   823  N3    ? ? A A   790  A G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog862  hydrog ? ? A  A   789  N7    ? ? ? 1_555 A  G   823  N2    ? ? A A   790  A G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog863  hydrog ? ? A  A   789  N1    ? ? ? 1_555 A  G   1708 N2    ? ? A A   790  A G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog864  hydrog ? ? A  A   790  N1    ? ? ? 1_555 A  U   822  N3    ? ? A A   791  A U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog865  hydrog ? ? A  A   790  N6    ? ? ? 1_555 A  U   822  O4    ? ? A A   791  A U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog866  hydrog ? ? A  G   791  N1    ? ? ? 1_555 A  C   821  N3    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog867  hydrog ? ? A  G   791  N2    ? ? ? 1_555 A  C   821  O2    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog868  hydrog ? ? A  G   791  O6    ? ? ? 1_555 A  C   821  N4    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog869  hydrog ? ? A  A   792  N1    ? ? ? 1_555 A  U   820  N3    ? ? A A   793  A U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog870  hydrog ? ? A  A   792  N6    ? ? ? 1_555 A  U   820  O4    ? ? A A   793  A U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog871  hydrog ? ? A  U   793  O2    ? ? ? 1_555 A  A   817  N6    ? ? A U   794  A A   818  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog872  hydrog ? ? A  U   793  N3    ? ? ? 1_555 A  A   818  N1    ? ? A U   794  A A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog873  hydrog ? ? A  U   793  O4    ? ? ? 1_555 A  A   818  N6    ? ? A U   794  A A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog874  hydrog ? ? A  G   794  N2    ? ? ? 1_555 A  A   817  N7    ? ? A G   795  A A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog875  hydrog ? ? A  G   794  N3    ? ? ? 1_555 A  A   817  N6    ? ? A G   795  A A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog876  hydrog ? ? A  A   795  N6    ? ? ? 1_555 A  G   816  N3    ? ? A A   796  A G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog877  hydrog ? ? A  A   795  N7    ? ? ? 1_555 A  G   816  N2    ? ? A A   796  A G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog878  hydrog ? ? A  A   796  N6    ? ? ? 1_555 A  G   815  N3    ? ? A A   797  A G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog879  hydrog ? ? A  A   796  N7    ? ? ? 1_555 A  G   815  N2    ? ? A A   797  A G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog880  hydrog ? ? A  G   797  N1    ? ? ? 1_555 A  U   814  O2    ? ? A G   798  A U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog881  hydrog ? ? A  G   797  O6    ? ? ? 1_555 A  U   814  N3    ? ? A G   798  A U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog882  hydrog ? ? A  C   798  N3    ? ? ? 1_555 A  G   813  N1    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog883  hydrog ? ? A  C   798  N4    ? ? ? 1_555 A  G   813  O6    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog884  hydrog ? ? A  C   798  O2    ? ? ? 1_555 A  G   813  N2    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog885  hydrog ? ? A  G   799  N1    ? ? ? 1_555 A  C   812  N3    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog886  hydrog ? ? A  G   799  N2    ? ? ? 1_555 A  C   812  O2    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog887  hydrog ? ? A  G   799  O6    ? ? ? 1_555 A  C   812  N4    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog888  hydrog ? ? A  U   800  N3    ? ? ? 1_555 A  A   811  N1    ? ? A U   801  A A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog889  hydrog ? ? A  U   800  O4    ? ? ? 1_555 A  A   811  N6    ? ? A U   801  A A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog890  hydrog ? ? A  G   801  N1    ? ? ? 1_555 A  C   810  N3    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog891  hydrog ? ? A  G   801  N2    ? ? ? 1_555 A  C   810  O2    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog892  hydrog ? ? A  G   801  O6    ? ? ? 1_555 A  C   810  N4    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog893  hydrog ? ? A  C   802  N3    ? ? ? 1_555 A  G   809  N1    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ? ? A  C   802  N4    ? ? ? 1_555 A  G   809  O6    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ? ? A  C   802  O2    ? ? ? 1_555 A  G   809  N2    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog896  hydrog ? ? A  C   803  N3    ? ? ? 1_555 A  G   808  N1    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog897  hydrog ? ? A  C   803  N4    ? ? ? 1_555 A  G   808  O6    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog898  hydrog ? ? A  C   803  O2    ? ? ? 1_555 A  G   808  N2    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ? ? A  G   804  N2    ? ? ? 1_555 A  A   807  N7    ? ? A G   805  A A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog900  hydrog ? ? A  G   819  N1    ? ? ? 1_555 A  C   1829 N3    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog901  hydrog ? ? A  G   819  N2    ? ? ? 1_555 A  C   1829 O2    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog902  hydrog ? ? A  G   819  O6    ? ? ? 1_555 A  C   1829 N4    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog903  hydrog ? ? A  A   826  N6    ? ? ? 1_555 A  G   853  N3    ? ? A A   827  A G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog904  hydrog ? ? A  A   826  N7    ? ? ? 1_555 A  G   853  N2    ? ? A A   827  A G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog905  hydrog ? ? A  G   827  N1    ? ? ? 1_555 A  C   852  N3    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog906  hydrog ? ? A  G   827  N2    ? ? ? 1_555 A  C   852  O2    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog907  hydrog ? ? A  G   827  O6    ? ? ? 1_555 A  C   852  N4    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog908  hydrog ? ? A  A   828  N1    ? ? ? 1_555 A  U   851  N3    ? ? A A   829  A U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog909  hydrog ? ? A  A   828  N6    ? ? ? 1_555 A  U   851  O4    ? ? A A   829  A U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog910  hydrog ? ? A  G   829  N1    ? ? ? 1_555 A  C   850  N3    ? ? A G   830  A C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog911  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  C   850  O2    ? ? A G   830  A C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog912  hydrog ? ? A  G   829  O6    ? ? ? 1_555 A  C   850  N4    ? ? A G   830  A C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog913  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  A   2021 N1    ? ? A G   830  A A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog914  hydrog ? ? A  U   831  N3    ? ? ? 1_555 A  U   849  O2    ? ? A U   832  A U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog915  hydrog ? ? A  U   831  O4    ? ? ? 1_555 A  U   849  N3    ? ? A U   832  A U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog916  hydrog ? ? A  G   832  N1    ? ? ? 1_555 A  C   848  N3    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog917  hydrog ? ? A  G   832  N2    ? ? ? 1_555 A  C   848  O2    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog918  hydrog ? ? A  G   832  O6    ? ? ? 1_555 A  C   848  N4    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog919  hydrog ? ? A  G   833  N1    ? ? ? 1_555 A  C   847  N3    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog920  hydrog ? ? A  G   833  N2    ? ? ? 1_555 A  C   847  O2    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog921  hydrog ? ? A  G   833  O6    ? ? ? 1_555 A  C   847  N4    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog922  hydrog ? ? A  G   835  N1    ? ? ? 1_555 A  C   846  N3    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog923  hydrog ? ? A  G   835  N2    ? ? ? 1_555 A  C   846  O2    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog924  hydrog ? ? A  G   835  O6    ? ? ? 1_555 A  C   846  N4    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog925  hydrog ? ? A  U   836  N3    ? ? ? 1_555 A  A   845  N1    ? ? A U   837  A A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog926  hydrog ? ? A  U   836  O4    ? ? ? 1_555 A  A   845  N6    ? ? A U   837  A A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog927  hydrog ? ? A  C   837  O2    ? ? ? 1_555 A  A   842  N6    ? ? A C   838  A A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog928  hydrog ? ? A  U   839  N3    ? ? ? 1_555 A  A   2054 N3    ? ? A U   840  A A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog929  hydrog ? ? A  C   841  N4    ? ? ? 1_555 A  A   845  N3    ? ? A C   842  A A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog930  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  U   1830 O4    ? ? A A   857  A U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog931  hydrog ? ? A  A   856  N7    ? ? ? 1_555 A  U   1830 N3    ? ? A A   857  A U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog932  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  A   1844 N3    ? ? A A   857  A A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog933  hydrog ? ? A  A   860  N3    ? ? ? 1_555 A  U   1487 N3    ? ? A A   861  A U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog934  hydrog ? ? A  G   862  N2    ? ? ? 1_555 A  A   1458 N3    ? ? A G   863  A A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog935  hydrog ? ? A  A   866  N3    ? ? ? 1_555 A  G   869  N2    ? ? A A   867  A G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog936  hydrog ? ? A  G   867  N1    ? ? ? 1_555 A  C   883  N3    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog937  hydrog ? ? A  G   867  N2    ? ? ? 1_555 A  C   883  O2    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog938  hydrog ? ? A  G   867  O6    ? ? ? 1_555 A  C   883  N4    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog939  hydrog ? ? A  G   869  N1    ? ? ? 1_555 A  C   879  N3    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog940  hydrog ? ? A  G   869  N2    ? ? ? 1_555 A  C   879  O2    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog941  hydrog ? ? A  G   869  O6    ? ? ? 1_555 A  C   879  N4    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog942  hydrog ? ? A  G   870  N1    ? ? ? 1_555 A  C   878  N3    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog943  hydrog ? ? A  G   870  N2    ? ? ? 1_555 A  C   878  O2    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog944  hydrog ? ? A  G   870  O6    ? ? ? 1_555 A  C   878  N4    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog945  hydrog ? ? A  U   871  N3    ? ? ? 1_555 A  G   877  O6    ? ? A U   872  A G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog946  hydrog ? ? A  U   871  O2    ? ? ? 1_555 A  G   877  N1    ? ? A U   872  A G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog947  hydrog ? ? A  G   872  N2    ? ? ? 1_555 A  A   875  N1    ? ? A G   873  A A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog948  hydrog ? ? A  G   872  N3    ? ? ? 1_555 A  A   875  N6    ? ? A G   873  A A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog949  hydrog ? ? A  A   873  N3    ? ? ? 1_555 A  G   1831 N2    ? ? A A   874  A G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog950  hydrog ? ? A  C   879  N4    ? ? ? 1_555 A  C   883  O2    ? ? A C   880  A C   884  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog951  hydrog ? ? A  G   884  N2    ? ? ? 1_555 A  G   2112 N3    ? ? A G   885  A G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog952  hydrog ? ? A  U   899  O2    ? ? ? 1_555 A  A   2100 N6    ? ? A U   900  A A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog953  hydrog ? ? A  G   900  N2    ? ? ? 1_555 A  A   1357 N3    ? ? A G   901  A A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog954  hydrog ? ? A  C   904  N3    ? ? ? 1_555 A  G   1299 N1    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog955  hydrog ? ? A  C   904  N4    ? ? ? 1_555 A  G   1299 O6    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog956  hydrog ? ? A  C   904  O2    ? ? ? 1_555 A  G   1299 N2    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog957  hydrog ? ? A  C   905  N3    ? ? ? 1_555 A  G   1298 N1    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog958  hydrog ? ? A  C   905  N4    ? ? ? 1_555 A  G   1298 O6    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog959  hydrog ? ? A  C   905  O2    ? ? ? 1_555 A  G   1298 N2    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog960  hydrog ? ? A  A   906  N1    ? ? ? 1_555 A  U   1297 N3    ? ? A A   907  A U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog961  hydrog ? ? A  A   906  N6    ? ? ? 1_555 A  U   1297 O4    ? ? A A   907  A U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog962  hydrog ? ? A  A   907  N1    ? ? ? 1_555 A  U   1296 N3    ? ? A A   908  A U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog963  hydrog ? ? A  A   907  N6    ? ? ? 1_555 A  U   1296 O4    ? ? A A   908  A U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ? ? A  U   908  N3    ? ? ? 1_555 A  A   1295 N1    ? ? A U   909  A A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog965  hydrog ? ? A  U   908  O4    ? ? ? 1_555 A  A   1295 N6    ? ? A U   909  A A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog966  hydrog ? ? A  C   909  N3    ? ? ? 1_555 A  G   1294 N1    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog967  hydrog ? ? A  C   909  N4    ? ? ? 1_555 A  G   1294 O6    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog968  hydrog ? ? A  C   909  O2    ? ? ? 1_555 A  G   1294 N2    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog969  hydrog ? ? A  G   910  N2    ? ? ? 1_555 A  A   1293 N7    ? ? A G   911  A A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog970  hydrog ? ? A  G   910  N3    ? ? ? 1_555 A  A   1293 N6    ? ? A G   911  A A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog971  hydrog ? ? A  A   911  N6    ? ? ? 1_555 A  U   1292 O2    ? ? A A   912  A U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog972  hydrog ? ? A  A   911  N7    ? ? ? 1_555 A  U   1292 N3    ? ? A A   912  A U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog973  hydrog ? ? A  A   912  N6    ? ? ? 1_555 A  G   1070 O6    ? ? A A   913  A G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog974  hydrog ? ? A  A   913  N6    ? ? ? 1_555 A  A   1069 N3    ? ? A A   914  A A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog975  hydrog ? ? A  C   914  N3    ? ? ? 1_555 A  G   927  N1    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog976  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  G   927  O6    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog977  hydrog ? ? A  C   914  O2    ? ? ? 1_555 A  G   927  N2    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog978  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  U   1041 O2    ? ? A C   915  A U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog979  hydrog ? ? A  A   915  N1    ? ? ? 1_555 A  U   926  N3    ? ? A A   916  A U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog980  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  U   926  O4    ? ? A A   916  A U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog981  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  C   1042 O2    ? ? A A   916  A C   1043 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog982  hydrog ? ? A  U   916  N3    ? ? ? 1_555 A  A   925  N1    ? ? A U   917  A A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog983  hydrog ? ? A  U   916  O4    ? ? ? 1_555 A  A   925  N6    ? ? A U   917  A A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog984  hydrog ? ? A  G   917  N1    ? ? ? 1_555 A  C   924  N3    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog985  hydrog ? ? A  G   917  N2    ? ? ? 1_555 A  C   924  O2    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog986  hydrog ? ? A  G   917  O6    ? ? ? 1_555 A  C   924  N4    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog987  hydrog ? ? A  U   918  N3    ? ? ? 1_555 A  G   923  O6    ? ? A U   919  A G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog988  hydrog ? ? A  U   918  O2    ? ? ? 1_555 A  G   923  N1    ? ? A U   919  A G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog989  hydrog ? ? A  G   920  O6    ? ? ? 1_555 A  G   2278 N2    ? ? A G   921  A G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog990  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  U   2106 O2    ? ? A A   923  A U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog991  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  G   2479 N3    ? ? A A   923  A G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog992  hydrog ? ? A  A   925  N6    ? ? ? 1_555 A  C   1042 N3    ? ? A A   926  A C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog993  hydrog ? ? A  A   925  N7    ? ? ? 1_555 A  C   1042 N4    ? ? A A   926  A C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog994  hydrog ? ? A  G   927  N2    ? ? ? 1_555 A  A   2393 N1    ? ? A G   928  A A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog995  hydrog ? ? A  A   928  N6    ? ? ? 1_555 A  U   1040 O4    ? ? A A   929  A U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog996  hydrog ? ? A  C   929  O2    ? ? ? 1_555 A  A   1039 N6    ? ? A C   930  A A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog997  hydrog ? ? A  C   930  N3    ? ? ? 1_555 A  G   1038 N1    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog998  hydrog ? ? A  C   930  N4    ? ? ? 1_555 A  G   1038 O6    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog999  hydrog ? ? A  C   930  O2    ? ? ? 1_555 A  G   1038 N2    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1000 hydrog ? ? A  U   931  N3    ? ? ? 1_555 A  G   1037 O6    ? ? A U   932  A G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1001 hydrog ? ? A  U   931  O2    ? ? ? 1_555 A  G   1037 N1    ? ? A U   932  A G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1002 hydrog ? ? A  C   932  N3    ? ? ? 1_555 A  G   1036 N1    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1003 hydrog ? ? A  C   932  N4    ? ? ? 1_555 A  G   1036 O6    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1004 hydrog ? ? A  C   932  O2    ? ? ? 1_555 A  G   1036 N2    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1005 hydrog ? ? A  C   933  N3    ? ? ? 1_555 A  G   1035 N1    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1006 hydrog ? ? A  C   933  N4    ? ? ? 1_555 A  G   1035 O6    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1007 hydrog ? ? A  C   933  O2    ? ? ? 1_555 A  G   1035 N2    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1008 hydrog ? ? A  G   934  N1    ? ? ? 1_555 A  C   1034 N3    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1009 hydrog ? ? A  G   934  N2    ? ? ? 1_555 A  C   1034 O2    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1010 hydrog ? ? A  G   934  O6    ? ? ? 1_555 A  C   1034 N4    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1011 hydrog ? ? A  C   935  N3    ? ? ? 1_555 A  G   1033 N1    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1012 hydrog ? ? A  C   935  N4    ? ? ? 1_555 A  G   1033 O6    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1013 hydrog ? ? A  C   935  O2    ? ? ? 1_555 A  G   1033 N2    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1014 hydrog ? ? A  C   936  O2    ? ? ? 1_555 A  C   1032 N4    ? ? A C   937  A C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1015 hydrog ? ? A  G   937  N2    ? ? ? 1_555 A  A   1031 N7    ? ? A G   938  A A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1016 hydrog ? ? A  A   938  N3    ? ? ? 1_555 A  G   1026 N2    ? ? A A   939  A G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1017 hydrog ? ? A  A   938  N6    ? ? ? 1_555 A  G   1030 N3    ? ? A A   939  A G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1018 hydrog ? ? A  A   938  N7    ? ? ? 1_555 A  G   1030 N2    ? ? A A   939  A G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1019 hydrog ? ? A  G   939  N1    ? ? ? 1_555 A  C   1025 O2    ? ? A G   940  A C   1026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1020 hydrog ? ? A  G   939  N2    ? ? ? 1_555 A  A   1031 N3    ? ? A G   940  A A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1021 hydrog ? ? A  G   940  N1    ? ? ? 1_555 A  C   1024 N3    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1022 hydrog ? ? A  G   940  N2    ? ? ? 1_555 A  C   1024 O2    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ? ? A  G   940  O6    ? ? ? 1_555 A  C   1024 N4    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1024 hydrog ? ? A  U   941  N3    ? ? ? 1_555 A  G   1023 O6    ? ? A U   942  A G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1025 hydrog ? ? A  U   941  O2    ? ? ? 1_555 A  G   1023 N1    ? ? A U   942  A G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1026 hydrog ? ? A  A   942  N6    ? ? ? 1_555 A  C   1024 O2    ? ? A A   943  A C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1027 hydrog ? ? A  G   943  N1    ? ? ? 1_555 A  C   1022 N3    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1028 hydrog ? ? A  G   943  N2    ? ? ? 1_555 A  C   1022 O2    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1029 hydrog ? ? A  G   943  O6    ? ? ? 1_555 A  C   1022 N4    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1030 hydrog ? ? A  U   944  N3    ? ? ? 1_555 A  A   1021 N1    ? ? A U   945  A A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1031 hydrog ? ? A  U   944  O4    ? ? ? 1_555 A  A   1021 N6    ? ? A U   945  A A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ? ? A  C   945  N3    ? ? ? 1_555 A  G   1020 N1    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ? ? A  C   945  N4    ? ? ? 1_555 A  G   1020 O6    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ? ? A  C   945  O2    ? ? ? 1_555 A  G   1020 N2    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1035 hydrog ? ? A  U   946  N3    ? ? ? 1_555 A  A   1019 N1    ? ? A U   947  A A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1036 hydrog ? ? A  U   946  O4    ? ? ? 1_555 A  A   1019 N6    ? ? A U   947  A A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1037 hydrog ? ? A  G   947  N1    ? ? ? 1_555 A  C   1018 N3    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1038 hydrog ? ? A  G   947  N2    ? ? ? 1_555 A  C   1018 O2    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1039 hydrog ? ? A  G   947  O6    ? ? ? 1_555 A  C   1018 N4    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1040 hydrog ? ? A  U   948  N3    ? ? ? 1_555 A  A   1017 N1    ? ? A U   949  A A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ? ? A  U   948  O4    ? ? ? 1_555 A  A   1017 N6    ? ? A U   949  A A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1042 hydrog ? ? A  G   949  N1    ? ? ? 1_555 A  U   1016 O2    ? ? A G   950  A U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1043 hydrog ? ? A  G   949  O6    ? ? ? 1_555 A  U   1016 N3    ? ? A G   950  A U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1044 hydrog ? ? A  A   950  N1    ? ? ? 1_555 A  U   1015 N3    ? ? A A   951  A U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1045 hydrog ? ? A  A   950  N6    ? ? ? 1_555 A  U   1015 O4    ? ? A A   951  A U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1046 hydrog ? ? A  G   951  N1    ? ? ? 1_555 A  C   1014 N3    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1047 hydrog ? ? A  G   951  N2    ? ? ? 1_555 A  C   1014 O2    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1048 hydrog ? ? A  G   951  O6    ? ? ? 1_555 A  C   1014 N4    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1049 hydrog ? ? A  G   952  N2    ? ? ? 1_555 A  U   953  O4    ? ? A G   953  A U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1050 hydrog ? ? A  U   953  N3    ? ? ? 1_555 A  A   1012 N7    ? ? A U   954  A A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1051 hydrog ? ? A  U   953  O2    ? ? ? 1_555 A  A   1012 N6    ? ? A U   954  A A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1052 hydrog ? ? A  A   954  N6    ? ? ? 1_555 A  A   1011 N3    ? ? A A   955  A A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1053 hydrog ? ? A  G   955  N1    ? ? ? 1_555 A  C   1010 N3    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1054 hydrog ? ? A  G   955  N2    ? ? ? 1_555 A  C   1010 O2    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1055 hydrog ? ? A  G   955  O6    ? ? ? 1_555 A  C   1010 N4    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1056 hydrog ? ? A  A   956  N1    ? ? ? 1_555 A  U   1008 N3    ? ? A A   957  A U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ? ? A  A   956  N6    ? ? ? 1_555 A  U   1008 O4    ? ? A A   957  A U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1058 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  A   960  N1    ? ? A G   958  A A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1059 hydrog ? ? A  G   957  N3    ? ? ? 1_555 A  A   960  N6    ? ? A G   958  A A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1060 hydrog ? ? A  G   957  N1    ? ? ? 1_555 A  C   1007 N3    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1061 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  C   1007 O2    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1062 hydrog ? ? A  G   957  O6    ? ? ? 1_555 A  C   1007 N4    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1063 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   961  N4    ? ? A C   959  A C   962  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1064 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   962  N4    ? ? A C   959  A C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1065 hydrog ? ? A  C   958  N3    ? ? ? 1_555 A  A   1004 N6    ? ? A C   959  A A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1066 hydrog ? ? A  C   958  N4    ? ? ? 1_555 A  A   1004 N7    ? ? A C   959  A A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1067 hydrog ? ? A  C   961  N4    ? ? ? 1_555 A  C   1007 O2    ? ? A C   962  A C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1068 hydrog ? ? A  C   962  N3    ? ? ? 1_555 A  A   1004 N6    ? ? A C   963  A A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1069 hydrog ? ? A  G   963  N1    ? ? ? 1_555 A  C   1003 N3    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1070 hydrog ? ? A  G   963  N2    ? ? ? 1_555 A  C   1003 O2    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1071 hydrog ? ? A  G   963  O6    ? ? ? 1_555 A  C   1003 N4    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1072 hydrog ? ? A  A   964  N1    ? ? ? 1_555 A  U   1002 N3    ? ? A A   965  A U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1073 hydrog ? ? A  A   964  N6    ? ? ? 1_555 A  U   1002 O4    ? ? A A   965  A U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1074 hydrog ? ? A  U   965  O2    ? ? ? 1_555 A  G   1001 N1    ? ? A U   966  A G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1075 hydrog ? ? A  U   966  N3    ? ? ? 1_555 A  U   1000 O2    ? ? A U   967  A U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1076 hydrog ? ? A  U   966  O4    ? ? ? 1_555 A  U   1000 N3    ? ? A U   967  A U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1077 hydrog ? ? A  G   967  N1    ? ? ? 1_555 A  C   999  N3    ? ? A G   968  A C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1078 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   998  N3    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1079 hydrog ? ? A  G   968  N2    ? ? ? 1_555 A  C   998  O2    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1080 hydrog ? ? A  G   968  O6    ? ? ? 1_555 A  C   998  N4    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1081 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   999  N3    ? ? A G   969  A C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1082 hydrog ? ? A  U   1008 O2    ? ? ? 1_555 A  C   1009 N4    ? ? A U   1009 A C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1083 hydrog ? ? A  A   1013 N6    ? ? ? 1_555 A  A   2301 N7    ? ? A A   1014 A A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1084 hydrog ? ? A  A   1013 N7    ? ? ? 1_555 A  A   2301 N6    ? ? A A   1014 A A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1085 hydrog ? ? A  G   1044 N1    ? ? ? 1_555 A  C   1068 N3    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1086 hydrog ? ? A  G   1044 N2    ? ? ? 1_555 A  C   1068 O2    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1087 hydrog ? ? A  G   1044 O6    ? ? ? 1_555 A  C   1068 N4    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1088 hydrog ? ? A  G   1045 N1    ? ? ? 1_555 A  C   1067 N3    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1089 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  C   1067 O2    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1090 hydrog ? ? A  G   1045 O6    ? ? ? 1_555 A  C   1067 N4    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1091 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  A   1081 N3    ? ? A G   1046 A A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1092 hydrog ? ? A  U   1046 N3    ? ? ? 1_555 A  A   1066 N1    ? ? A U   1047 A A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1093 hydrog ? ? A  U   1046 O4    ? ? ? 1_555 A  A   1066 N6    ? ? A U   1047 A A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1094 hydrog ? ? A  G   1047 N1    ? ? ? 1_555 A  U   1065 O2    ? ? A G   1048 A U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1095 hydrog ? ? A  G   1047 O6    ? ? ? 1_555 A  U   1065 N3    ? ? A G   1048 A U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1096 hydrog ? ? A  C   1048 N3    ? ? ? 1_555 A  G   1064 N1    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1097 hydrog ? ? A  C   1048 N4    ? ? ? 1_555 A  G   1064 O6    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1098 hydrog ? ? A  C   1048 O2    ? ? ? 1_555 A  G   1064 N2    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1099 hydrog ? ? A  G   1049 N1    ? ? ? 1_555 A  U   1063 O2    ? ? A G   1050 A U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1100 hydrog ? ? A  G   1049 O6    ? ? ? 1_555 A  U   1063 N3    ? ? A G   1050 A U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1101 hydrog ? ? A  C   1050 N3    ? ? ? 1_555 A  G   1062 N1    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1102 hydrog ? ? A  C   1050 N4    ? ? ? 1_555 A  G   1062 O6    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1103 hydrog ? ? A  C   1050 O2    ? ? ? 1_555 A  G   1062 N2    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1104 hydrog ? ? A  G   1051 N1    ? ? ? 1_555 A  U   1061 O2    ? ? A G   1052 A U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1105 hydrog ? ? A  G   1051 O6    ? ? ? 1_555 A  U   1061 N3    ? ? A G   1052 A U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1106 hydrog ? ? A  G   1052 N1    ? ? ? 1_555 A  C   1060 N3    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1107 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  C   1060 O2    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1108 hydrog ? ? A  G   1052 O6    ? ? ? 1_555 A  C   1060 N4    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1109 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  U   2307 O2    ? ? A G   1053 A U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1110 hydrog ? ? A  G   1053 N1    ? ? ? 1_555 A  C   1059 N3    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1111 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  C   1059 O2    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1112 hydrog ? ? A  G   1053 O6    ? ? ? 1_555 A  C   1059 N4    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1113 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  G   2282 O6    ? ? A G   1054 A G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1114 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  A   1057 N7    ? ? A G   1055 A A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1115 hydrog ? ? A  U   1055 O4    ? ? ? 1_555 A  G   2528 N2    ? ? A U   1056 A G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1116 hydrog ? ? A  A   1057 N3    ? ? ? 1_555 A  G   2490 N2    ? ? A A   1058 A G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1117 hydrog ? ? A  G   1062 N2    ? ? ? 1_555 A  A   2300 N7    ? ? A G   1063 A A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1118 hydrog ? ? A  G   1071 N2    ? ? ? 1_555 A  A   1087 N7    ? ? A G   1072 A A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1119 hydrog ? ? A  G   1071 N3    ? ? ? 1_555 A  A   1087 N6    ? ? A G   1072 A A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1120 hydrog ? ? A  A   1072 N6    ? ? ? 1_555 A  A   1085 N3    ? ? A A   1073 A A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1121 hydrog ? ? A  A   1072 N7    ? ? ? 1_555 A  G   1086 N2    ? ? A A   1073 A G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1122 hydrog ? ? A  G   1073 N1    ? ? ? 1_555 A  C   1084 N3    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1123 hydrog ? ? A  G   1073 N2    ? ? ? 1_555 A  C   1084 O2    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1124 hydrog ? ? A  G   1073 O6    ? ? ? 1_555 A  C   1084 N4    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1125 hydrog ? ? A  G   1074 N1    ? ? ? 1_555 A  C   1083 N3    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1126 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  C   1083 O2    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1127 hydrog ? ? A  G   1074 O6    ? ? ? 1_555 A  C   1083 N4    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1128 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  A   1097 N3    ? ? A G   1075 A A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1129 hydrog ? ? A  G   1075 N1    ? ? ? 1_555 A  C   1082 N3    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1130 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  C   1082 O2    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1131 hydrog ? ? A  G   1075 O6    ? ? ? 1_555 A  C   1082 N4    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1132 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 B  U   87   O4    ? ? A G   1076 B U   3087 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1133 hydrog ? ? A  A   1078 N3    ? ? ? 1_555 A  G   2067 N2    ? ? A A   1079 A G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1134 hydrog ? ? A  C   1082 O2    ? ? ? 1_555 A  A   1123 N6    ? ? A C   1083 A A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1135 hydrog ? ? A  G   1088 N1    ? ? ? 1_555 A  C   1266 N3    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1136 hydrog ? ? A  G   1088 N2    ? ? ? 1_555 A  C   1266 O2    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1137 hydrog ? ? A  G   1088 O6    ? ? ? 1_555 A  C   1266 N4    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1138 hydrog ? ? A  A   1089 N1    ? ? ? 1_555 A  U   1265 N3    ? ? A A   1090 A U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1139 hydrog ? ? A  A   1089 N6    ? ? ? 1_555 A  U   1265 O4    ? ? A A   1090 A U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1140 hydrog ? ? A  U   1090 N3    ? ? ? 1_555 A  G   1264 O6    ? ? A U   1091 A G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1141 hydrog ? ? A  U   1090 O2    ? ? ? 1_555 A  G   1264 N1    ? ? A U   1091 A G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1142 hydrog ? ? A  A   1091 N1    ? ? ? 1_555 A  U   1263 N3    ? ? A A   1092 A U   1264 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1143 hydrog ? ? A  G   1092 N1    ? ? ? 1_555 A  C   1262 N3    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ? ? A  G   1092 N2    ? ? ? 1_555 A  C   1262 O2    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ? ? A  G   1092 O6    ? ? ? 1_555 A  C   1262 N4    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1146 hydrog ? ? A  G   1093 N1    ? ? ? 1_555 A  C   1261 N3    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1147 hydrog ? ? A  G   1093 N2    ? ? ? 1_555 A  C   1261 O2    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1148 hydrog ? ? A  G   1093 O6    ? ? ? 1_555 A  C   1261 N4    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1149 hydrog ? ? A  U   1094 N3    ? ? ? 1_555 A  A   1260 N1    ? ? A U   1095 A A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1150 hydrog ? ? A  U   1094 O4    ? ? ? 1_555 A  A   1260 N6    ? ? A U   1095 A A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1151 hydrog ? ? A  U   1095 N3    ? ? ? 1_555 A  A   1258 N7    ? ? A U   1096 A A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1152 hydrog ? ? A  U   1095 O2    ? ? ? 1_555 A  A   1258 N6    ? ? A U   1096 A A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1153 hydrog ? ? A  A   1097 N6    ? ? ? 1_555 A  G   1257 N3    ? ? A A   1098 A G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1154 hydrog ? ? A  A   1097 N7    ? ? ? 1_555 A  G   1257 N2    ? ? A A   1098 A G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1155 hydrog ? ? A  G   1098 N1    ? ? ? 1_555 A  C   1256 N3    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1156 hydrog ? ? A  G   1098 N2    ? ? ? 1_555 A  C   1256 O2    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ? ? A  G   1098 O6    ? ? ? 1_555 A  C   1256 N4    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  A   1106 N3    ? ? A G   1100 A A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1159 hydrog ? ? A  G   1099 N1    ? ? ? 1_555 A  C   1255 N3    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1160 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  C   1255 O2    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1161 hydrog ? ? A  G   1099 O6    ? ? ? 1_555 A  C   1255 N4    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1162 hydrog ? ? A  U   1100 N3    ? ? ? 1_555 A  A   1254 N1    ? ? A U   1101 A A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1163 hydrog ? ? A  U   1100 O4    ? ? ? 1_555 A  A   1254 N6    ? ? A U   1101 A A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ? ? A  C   1101 N3    ? ? ? 1_555 A  G   1240 N1    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1165 hydrog ? ? A  C   1101 N4    ? ? ? 1_555 A  G   1240 O6    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1166 hydrog ? ? A  C   1101 O2    ? ? ? 1_555 A  G   1240 N2    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1167 hydrog ? ? A  C   1102 N3    ? ? ? 1_555 A  G   1239 N1    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1168 hydrog ? ? A  C   1102 N4    ? ? ? 1_555 A  G   1239 O6    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1169 hydrog ? ? A  C   1102 O2    ? ? ? 1_555 A  G   1239 N2    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1170 hydrog ? ? A  C   1103 N3    ? ? ? 1_555 A  G   1238 N1    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1171 hydrog ? ? A  C   1103 N4    ? ? ? 1_555 A  G   1238 O6    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ? ? A  C   1103 O2    ? ? ? 1_555 A  G   1238 N2    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1173 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1105 N6    ? ? A C   1105 A A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1174 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1106 N6    ? ? A C   1105 A A   1107 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1175 hydrog ? ? A  G   1107 N1    ? ? ? 1_555 A  C   1253 N3    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1176 hydrog ? ? A  G   1107 N2    ? ? ? 1_555 A  C   1253 O2    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ? ? A  G   1107 O6    ? ? ? 1_555 A  C   1253 N4    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ? ? A  U   1108 N3    ? ? ? 1_555 A  A   1246 N7    ? ? A U   1109 A A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1179 hydrog ? ? A  U   1108 O4    ? ? ? 1_555 A  A   1246 N6    ? ? A U   1109 A A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1180 hydrog ? ? A  G   1109 N1    ? ? ? 1_555 A  C   1252 N3    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ? ? A  G   1109 N2    ? ? ? 1_555 A  C   1252 O2    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1182 hydrog ? ? A  G   1109 O6    ? ? ? 1_555 A  C   1252 N4    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1183 hydrog ? ? A  U   1110 N3    ? ? ? 1_555 A  A   1251 N1    ? ? A U   1111 A A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1184 hydrog ? ? A  U   1110 O4    ? ? ? 1_555 A  A   1251 N6    ? ? A U   1111 A A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ? ? A  G   1111 N1    ? ? ? 1_555 A  C   1250 N3    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1186 hydrog ? ? A  G   1111 N2    ? ? ? 1_555 A  C   1250 O2    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ? ? A  G   1111 O6    ? ? ? 1_555 A  C   1250 N4    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ? ? A  G   1112 N1    ? ? ? 1_555 A  C   1249 N3    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ? ? A  G   1112 N2    ? ? ? 1_555 A  C   1249 O2    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1190 hydrog ? ? A  G   1112 O6    ? ? ? 1_555 A  C   1249 N4    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1191 hydrog ? ? A  A   1113 N1    ? ? ? 1_555 A  U   1248 N3    ? ? A A   1114 A U   1249 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1192 hydrog ? ? A  U   1114 N3    ? ? ? 1_555 A  A   1247 N1    ? ? A U   1115 A A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1193 hydrog ? ? A  U   1114 O4    ? ? ? 1_555 A  A   1247 N6    ? ? A U   1115 A A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1194 hydrog ? ? A  U   1115 O2    ? ? ? 1_555 A  A   1245 N6    ? ? A U   1116 A A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1195 hydrog ? ? A  A   1117 N6    ? ? ? 1_555 A  U   1243 O2    ? ? A A   1118 A U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1196 hydrog ? ? A  G   1118 N2    ? ? ? 1_555 A  U   1119 O4    ? ? A G   1119 A U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1197 hydrog ? ? A  G   1120 N1    ? ? ? 1_555 A  C   1242 N3    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1198 hydrog ? ? A  G   1120 N2    ? ? ? 1_555 A  C   1242 O2    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1199 hydrog ? ? A  G   1120 O6    ? ? ? 1_555 A  C   1242 N4    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1200 hydrog ? ? A  U   1121 N3    ? ? ? 1_555 A  A   1241 N1    ? ? A U   1122 A A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1201 hydrog ? ? A  U   1121 O4    ? ? ? 1_555 A  A   1241 N6    ? ? A U   1122 A A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1202 hydrog ? ? A  A   1131 N6    ? ? ? 1_555 A  A   1229 N7    ? ? A A   1132 A A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1203 hydrog ? ? A  A   1131 N7    ? ? ? 1_555 A  A   1229 N6    ? ? A A   1132 A A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1204 hydrog ? ? A  A   1132 N6    ? ? ? 1_555 A  C   1228 O2    ? ? A A   1133 A C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1205 hydrog ? ? A  A   1132 N3    ? ? ? 1_555 A  G   2519 N2    ? ? A A   1133 A G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1206 hydrog ? ? A  G   1133 N1    ? ? ? 1_555 A  C   1227 N3    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1207 hydrog ? ? A  G   1133 N2    ? ? ? 1_555 A  C   1227 O2    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1208 hydrog ? ? A  G   1133 O6    ? ? ? 1_555 A  C   1227 N4    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1209 hydrog ? ? A  G   1134 N1    ? ? ? 1_555 A  C   1226 N3    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1210 hydrog ? ? A  G   1134 N2    ? ? ? 1_555 A  C   1226 O2    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1211 hydrog ? ? A  G   1134 O6    ? ? ? 1_555 A  C   1226 N4    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1212 hydrog ? ? A  U   1135 N3    ? ? ? 1_555 A  G   1225 O6    ? ? A U   1136 A G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1213 hydrog ? ? A  U   1135 O2    ? ? ? 1_555 A  G   1225 N1    ? ? A U   1136 A G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1214 hydrog ? ? A  G   1137 N1    ? ? ? 1_555 A  C   1224 N3    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1215 hydrog ? ? A  G   1137 N2    ? ? ? 1_555 A  C   1224 O2    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1216 hydrog ? ? A  G   1137 O6    ? ? ? 1_555 A  C   1224 N4    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ? ? A  U   1138 N3    ? ? ? 1_555 A  G   1223 O6    ? ? A U   1139 A G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1218 hydrog ? ? A  U   1138 O2    ? ? ? 1_555 A  G   1223 N1    ? ? A U   1139 A G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1219 hydrog ? ? A  C   1139 N3    ? ? ? 1_555 A  G   1222 N1    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1220 hydrog ? ? A  C   1139 N4    ? ? ? 1_555 A  G   1222 O6    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ? ? A  C   1139 O2    ? ? ? 1_555 A  G   1222 N2    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ? ? A  U   1140 N3    ? ? ? 1_555 A  A   1221 N1    ? ? A U   1141 A A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1223 hydrog ? ? A  U   1140 O4    ? ? ? 1_555 A  A   1221 N6    ? ? A U   1141 A A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1224 hydrog ? ? A  C   1141 N3    ? ? ? 1_555 A  G   1220 N1    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1225 hydrog ? ? A  C   1141 N4    ? ? ? 1_555 A  G   1220 O6    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1226 hydrog ? ? A  C   1141 O2    ? ? ? 1_555 A  G   1220 N2    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1227 hydrog ? ? A  G   1142 N1    ? ? ? 1_555 A  U   1219 O2    ? ? A G   1143 A U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1228 hydrog ? ? A  G   1142 O6    ? ? ? 1_555 A  U   1219 N3    ? ? A G   1143 A U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1229 hydrog ? ? A  A   1143 N1    ? ? ? 1_555 A  U   1218 N3    ? ? A A   1144 A U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1230 hydrog ? ? A  A   1143 N6    ? ? ? 1_555 A  U   1218 O4    ? ? A A   1144 A U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1231 hydrog ? ? A  G   1144 N1    ? ? ? 1_555 A  U   1217 O2    ? ? A G   1145 A U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1232 hydrog ? ? A  G   1144 O6    ? ? ? 1_555 A  U   1217 N3    ? ? A G   1145 A U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1233 hydrog ? ? A  C   1145 N3    ? ? ? 1_555 A  G   1216 N1    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1234 hydrog ? ? A  C   1145 N4    ? ? ? 1_555 A  G   1216 O6    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1235 hydrog ? ? A  C   1145 O2    ? ? ? 1_555 A  G   1216 N2    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1236 hydrog ? ? A  C   1146 N3    ? ? ? 1_555 A  G   1215 N1    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1237 hydrog ? ? A  C   1146 N4    ? ? ? 1_555 A  G   1215 O6    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1238 hydrog ? ? A  C   1146 O2    ? ? ? 1_555 A  G   1215 N2    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1239 hydrog ? ? A  G   1150 N2    ? ? ? 1_555 A  A   1214 N7    ? ? A G   1151 A A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1240 hydrog ? ? A  G   1150 N3    ? ? ? 1_555 A  A   1214 N6    ? ? A G   1151 A A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1241 hydrog ? ? A  A   1151 N7    ? ? ? 1_555 A  G   1213 N2    ? ? A A   1152 A G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1242 hydrog ? ? A  A   1151 N3    ? ? ? 1_555 A  G   1215 N2    ? ? A A   1152 A G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1243 hydrog ? ? A  A   1151 N6    ? ? ? 1_555 A  G   2785 O6    ? ? A A   1152 A G   2786 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1244 hydrog ? ? A  C   1152 N4    ? ? ? 1_555 A  G   2785 O6    ? ? A C   1153 A G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1245 hydrog ? ? A  A   1153 N6    ? ? ? 1_555 A  C   1212 O2    ? ? A A   1154 A C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1246 hydrog ? ? A  G   1154 N1    ? ? ? 1_555 A  C   1211 N3    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1247 hydrog ? ? A  G   1154 N2    ? ? ? 1_555 A  C   1211 O2    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1248 hydrog ? ? A  G   1154 O6    ? ? ? 1_555 A  C   1211 N4    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1249 hydrog ? ? A  C   1155 N3    ? ? ? 1_555 A  G   1210 N1    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1250 hydrog ? ? A  C   1155 N4    ? ? ? 1_555 A  G   1210 O6    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1251 hydrog ? ? A  C   1155 O2    ? ? ? 1_555 A  G   1210 N2    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1252 hydrog ? ? A  C   1156 N3    ? ? ? 1_555 A  G   1209 N1    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1253 hydrog ? ? A  C   1156 N4    ? ? ? 1_555 A  G   1209 O6    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ? ? A  C   1156 O2    ? ? ? 1_555 A  G   1209 N2    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ? ? A  G   1157 N1    ? ? ? 1_555 A  C   1208 N3    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1256 hydrog ? ? A  G   1157 N2    ? ? ? 1_555 A  C   1208 O2    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1257 hydrog ? ? A  G   1157 O6    ? ? ? 1_555 A  C   1208 N4    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1258 hydrog ? ? A  G   1158 N1    ? ? ? 1_555 A  C   1207 N3    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1259 hydrog ? ? A  G   1158 N2    ? ? ? 1_555 A  C   1207 O2    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1260 hydrog ? ? A  G   1158 O6    ? ? ? 1_555 A  C   1207 N4    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1261 hydrog ? ? A  A   1160 N1    ? ? ? 1_555 A  U   1184 N3    ? ? A A   1161 A U   1185 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1262 hydrog ? ? A  G   1161 N1    ? ? ? 1_555 A  C   1183 N3    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1263 hydrog ? ? A  G   1161 N2    ? ? ? 1_555 A  C   1183 O2    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1264 hydrog ? ? A  G   1161 O6    ? ? ? 1_555 A  C   1183 N4    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1265 hydrog ? ? A  G   1162 N2    ? ? ? 1_555 A  C   1182 O2    ? ? A G   1163 A C   1183 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1266 hydrog ? ? A  A   1165 N6    ? ? ? 1_555 A  U   1179 O4    ? ? A A   1166 A U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1267 hydrog ? ? A  G   1166 N1    ? ? ? 1_555 A  C   1178 N3    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1268 hydrog ? ? A  G   1166 N2    ? ? ? 1_555 A  C   1178 O2    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1269 hydrog ? ? A  G   1166 O6    ? ? ? 1_555 A  C   1178 N4    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1270 hydrog ? ? A  C   1167 O2    ? ? ? 1_555 A  G   1177 N1    ? ? A C   1168 A G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1271 hydrog ? ? A  A   1173 N6    ? ? ? 1_555 A  A   1199 N3    ? ? A A   1174 A A   1200 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1272 hydrog ? ? A  G   1174 O6    ? ? ? 1_555 A  C   1203 N4    ? ? A G   1175 A C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1273 hydrog ? ? A  C   1175 N3    ? ? ? 1_555 A  C   1195 N4    ? ? A C   1176 A C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1274 hydrog ? ? A  C   1175 N4    ? ? ? 1_555 A  G   1202 O6    ? ? A C   1176 A G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1275 hydrog ? ? A  C   1185 N3    ? ? ? 1_555 A  G   1189 N2    ? ? A C   1186 A G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1276 hydrog ? ? A  C   1185 O2    ? ? ? 1_555 A  G   1189 N1    ? ? A C   1186 A G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1277 hydrog ? ? A  A   1192 N3    ? ? ? 1_555 A  A   1193 N6    ? ? A A   1193 A A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1278 hydrog ? ? A  G   1194 N2    ? ? ? 1_555 A  C   1203 O2    ? ? A G   1195 A C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1279 hydrog ? ? A  C   1195 N3    ? ? ? 1_555 A  G   1202 N1    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1280 hydrog ? ? A  C   1195 N4    ? ? ? 1_555 A  G   1202 O6    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1281 hydrog ? ? A  C   1195 O2    ? ? ? 1_555 A  G   1202 N2    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1282 hydrog ? ? A  G   1196 N2    ? ? ? 1_555 A  A   1201 N7    ? ? A G   1197 A A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1283 hydrog ? ? A  G   1196 N3    ? ? ? 1_555 A  A   1201 N6    ? ? A G   1197 A A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1284 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  C   2497 O2    ? ? A A   1231 A C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1285 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  U   2522 O2    ? ? A A   1231 A U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1286 hydrog ? ? A  G   1234 N2    ? ? ? 1_555 A  A   1235 N7    ? ? A G   1235 A A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1287 hydrog ? ? A  G   1234 O6    ? ? ? 1_555 A  G   2079 N2    ? ? A G   1235 A G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1288 hydrog ? ? A  C   1237 N4    ? ? ? 1_555 A  G   1240 N7    ? ? A C   1238 A G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1289 hydrog ? ? A  C   1267 N3    ? ? ? 1_555 A  G   1289 N1    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1290 hydrog ? ? A  C   1267 N4    ? ? ? 1_555 A  G   1289 O6    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1291 hydrog ? ? A  C   1267 O2    ? ? ? 1_555 A  G   1289 N2    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1292 hydrog ? ? A  G   1268 N1    ? ? ? 1_555 A  C   1288 N3    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ? ? A  G   1268 N2    ? ? ? 1_555 A  C   1288 O2    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ? ? A  G   1268 O6    ? ? ? 1_555 A  C   1288 N4    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ? ? A  U   1269 N3    ? ? ? 1_555 A  A   1285 N1    ? ? A U   1270 A A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1296 hydrog ? ? A  U   1269 O4    ? ? ? 1_555 A  A   1285 N6    ? ? A U   1270 A A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1297 hydrog ? ? A  A   1270 N1    ? ? ? 1_555 A  U   1284 N3    ? ? A A   1271 A U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1298 hydrog ? ? A  A   1270 N6    ? ? ? 1_555 A  U   1284 O4    ? ? A A   1271 A U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1299 hydrog ? ? A  C   1271 N3    ? ? ? 1_555 A  G   1283 N1    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1300 hydrog ? ? A  C   1271 N4    ? ? ? 1_555 A  G   1283 O6    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1301 hydrog ? ? A  C   1271 O2    ? ? ? 1_555 A  G   1283 N2    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1302 hydrog ? ? A  C   1272 N3    ? ? ? 1_555 A  G   1282 N1    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1303 hydrog ? ? A  C   1272 N4    ? ? ? 1_555 A  G   1282 O6    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1304 hydrog ? ? A  C   1272 O2    ? ? ? 1_555 A  G   1282 N2    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1305 hydrog ? ? A  A   1273 N1    ? ? ? 1_555 A  U   1281 N3    ? ? A A   1274 A U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1306 hydrog ? ? A  A   1273 N6    ? ? ? 1_555 A  U   1281 O4    ? ? A A   1274 A U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1307 hydrog ? ? A  C   1274 O2    ? ? ? 1_555 A  C   1280 N4    ? ? A C   1275 A C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1308 hydrog ? ? A  U   1275 O2    ? ? ? 1_555 A  A   1279 N6    ? ? A U   1276 A A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1309 hydrog ? ? A  G   1291 N2    ? ? ? 1_555 A  U   1292 O4    ? ? A G   1292 A U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1310 hydrog ? ? A  G   1299 N2    ? ? ? 1_555 A  A   1329 N3    ? ? A G   1300 A A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1311 hydrog ? ? A  C   1300 N3    ? ? ? 1_555 A  G   1353 N1    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1312 hydrog ? ? A  C   1300 N4    ? ? ? 1_555 A  G   1353 O6    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1313 hydrog ? ? A  C   1300 O2    ? ? ? 1_555 A  G   1353 N2    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1314 hydrog ? ? A  G   1301 N1    ? ? ? 1_555 A  C   1352 O2    ? ? A G   1302 A C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1315 hydrog ? ? A  C   1302 N3    ? ? ? 1_555 A  G   1350 N1    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1316 hydrog ? ? A  C   1302 N4    ? ? ? 1_555 A  G   1350 O6    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1317 hydrog ? ? A  C   1302 O2    ? ? ? 1_555 A  G   1350 N2    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ? ? A  U   1303 N3    ? ? ? 1_555 A  U   1349 O2    ? ? A U   1304 A U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1319 hydrog ? ? A  U   1303 O4    ? ? ? 1_555 A  U   1349 N3    ? ? A U   1304 A U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1320 hydrog ? ? A  C   1304 N3    ? ? ? 1_555 A  G   1348 N1    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1321 hydrog ? ? A  C   1304 N4    ? ? ? 1_555 A  G   1348 O6    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1322 hydrog ? ? A  C   1304 O2    ? ? ? 1_555 A  G   1348 N2    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1323 hydrog ? ? A  U   1305 N3    ? ? ? 1_555 A  A   1347 N1    ? ? A U   1306 A A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1324 hydrog ? ? A  U   1305 O4    ? ? ? 1_555 A  A   1347 N6    ? ? A U   1306 A A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1325 hydrog ? ? A  A   1306 N1    ? ? ? 1_555 A  U   1346 N3    ? ? A A   1307 A U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1326 hydrog ? ? A  A   1306 N6    ? ? ? 1_555 A  U   1346 O4    ? ? A A   1307 A U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1327 hydrog ? ? A  A   1307 N1    ? ? ? 1_555 A  U   1345 N3    ? ? A A   1308 A U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1328 hydrog ? ? A  A   1307 N6    ? ? ? 1_555 A  U   1345 O4    ? ? A A   1308 A U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1329 hydrog ? ? A  U   1308 N3    ? ? ? 1_555 A  A   1344 N1    ? ? A U   1309 A A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1330 hydrog ? ? A  U   1308 O4    ? ? ? 1_555 A  A   1344 N6    ? ? A U   1309 A A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1331 hydrog ? ? A  U   1309 N3    ? ? ? 1_555 A  G   1343 O6    ? ? A U   1310 A G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1332 hydrog ? ? A  U   1309 O2    ? ? ? 1_555 A  G   1343 N1    ? ? A U   1310 A G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1333 hydrog ? ? A  G   1310 N1    ? ? ? 1_555 A  C   1342 N3    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1334 hydrog ? ? A  G   1310 N2    ? ? ? 1_555 A  C   1342 O2    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1335 hydrog ? ? A  G   1310 O6    ? ? ? 1_555 A  C   1342 N4    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1336 hydrog ? ? A  G   1311 N1    ? ? ? 1_555 A  C   1341 N3    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1337 hydrog ? ? A  G   1311 N2    ? ? ? 1_555 A  C   1341 O2    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1338 hydrog ? ? A  G   1311 O6    ? ? ? 1_555 A  C   1341 N4    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1339 hydrog ? ? A  G   1315 N2    ? ? ? 1_555 A  A   1340 N7    ? ? A G   1316 A A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1340 hydrog ? ? A  G   1315 N3    ? ? ? 1_555 A  A   1340 N6    ? ? A G   1316 A A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1341 hydrog ? ? A  A   1316 N6    ? ? ? 1_555 A  G   1339 N3    ? ? A A   1317 A G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1342 hydrog ? ? A  A   1316 N7    ? ? ? 1_555 A  G   1339 N2    ? ? A A   1317 A G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1343 hydrog ? ? A  A   1317 N6    ? ? ? 1_555 A  G   1338 N3    ? ? A A   1318 A G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1344 hydrog ? ? A  A   1317 N7    ? ? ? 1_555 A  G   1338 N2    ? ? A A   1318 A G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1345 hydrog ? ? A  G   1318 N1    ? ? ? 1_555 A  U   1337 O2    ? ? A G   1319 A U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1346 hydrog ? ? A  G   1318 O6    ? ? ? 1_555 A  U   1337 N3    ? ? A G   1319 A U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1347 hydrog ? ? A  U   1319 N3    ? ? ? 1_555 A  A   1336 N1    ? ? A U   1320 A A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1348 hydrog ? ? A  U   1319 O4    ? ? ? 1_555 A  A   1336 N6    ? ? A U   1320 A A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1349 hydrog ? ? A  A   1320 N1    ? ? ? 1_555 A  U   1335 N3    ? ? A A   1321 A U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1350 hydrog ? ? A  A   1320 N6    ? ? ? 1_555 A  U   1335 O4    ? ? A A   1321 A U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ? ? A  G   1321 N1    ? ? ? 1_555 A  C   1334 N3    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1352 hydrog ? ? A  G   1321 N2    ? ? ? 1_555 A  C   1334 O2    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1353 hydrog ? ? A  G   1321 O6    ? ? ? 1_555 A  C   1334 N4    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1354 hydrog ? ? A  G   1322 N1    ? ? ? 1_555 A  C   1333 N3    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1355 hydrog ? ? A  G   1322 N2    ? ? ? 1_555 A  C   1333 O2    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1356 hydrog ? ? A  G   1322 O6    ? ? ? 1_555 A  C   1333 N4    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1357 hydrog ? ? A  G   1323 N1    ? ? ? 1_555 A  U   1332 O2    ? ? A G   1324 A U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1358 hydrog ? ? A  G   1323 O6    ? ? ? 1_555 A  U   1332 N3    ? ? A G   1324 A U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1359 hydrog ? ? A  G   1324 N1    ? ? ? 1_555 A  C   1331 N3    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1360 hydrog ? ? A  G   1324 N2    ? ? ? 1_555 A  C   1331 O2    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1361 hydrog ? ? A  G   1324 O6    ? ? ? 1_555 A  C   1331 N4    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ? ? A  U   1325 N3    ? ? ? 1_555 A  A   1330 N1    ? ? A U   1326 A A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1363 hydrog ? ? A  U   1325 O4    ? ? ? 1_555 A  A   1330 N6    ? ? A U   1326 A A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1364 hydrog ? ? A  G   1326 N2    ? ? ? 1_555 A  A   1329 N7    ? ? A G   1327 A A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1365 hydrog ? ? A  C   1365 N3    ? ? ? 1_555 A  G   2057 N1    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1366 hydrog ? ? A  C   1365 N4    ? ? ? 1_555 A  G   2057 O6    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1367 hydrog ? ? A  C   1365 O2    ? ? ? 1_555 A  G   2057 N2    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1368 hydrog ? ? A  A   1366 N1    ? ? ? 1_555 A  U   2056 N3    ? ? A A   1367 A U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1369 hydrog ? ? A  A   1366 N6    ? ? ? 1_555 A  U   2056 O4    ? ? A A   1367 A U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1370 hydrog ? ? A  U   1367 O2    ? ? ? 1_555 A  C   2055 N4    ? ? A U   1368 A C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1371 hydrog ? ? A  A   1368 N6    ? ? ? 1_555 A  A   2054 N7    ? ? A A   1369 A A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1372 hydrog ? ? A  A   1368 N7    ? ? ? 1_555 A  A   2054 N6    ? ? A A   1369 A A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1373 hydrog ? ? A  G   1369 N2    ? ? ? 1_555 A  U   1370 O4    ? ? A G   1370 A U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1374 hydrog ? ? A  U   1370 N3    ? ? ? 1_555 A  A   2053 N7    ? ? A U   1371 A A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1375 hydrog ? ? A  U   1370 O2    ? ? ? 1_555 A  A   2053 N6    ? ? A U   1371 A A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1376 hydrog ? ? A  A   1371 N6    ? ? ? 1_555 A  G   2052 N3    ? ? A A   1372 A G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1377 hydrog ? ? A  A   1371 N7    ? ? ? 1_555 A  G   2052 N2    ? ? A A   1372 A G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1378 hydrog ? ? A  G   1372 N2    ? ? ? 1_555 A  C   1430 O2    ? ? A G   1373 A C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1379 hydrog ? ? A  G   1372 N1    ? ? ? 1_555 A  U   2051 O2    ? ? A G   1373 A U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1380 hydrog ? ? A  G   1372 O6    ? ? ? 1_555 A  U   2051 N3    ? ? A G   1373 A U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1381 hydrog ? ? A  C   1373 N3    ? ? ? 1_555 A  G   2050 N1    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1382 hydrog ? ? A  C   1373 N4    ? ? ? 1_555 A  G   2050 O6    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1383 hydrog ? ? A  C   1373 O2    ? ? ? 1_555 A  G   2050 N2    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ? ? A  C   1376 N3    ? ? ? 1_555 A  G   1682 N2    ? ? A C   1377 A G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1385 hydrog ? ? A  C   1376 O2    ? ? ? 1_555 A  G   1682 N1    ? ? A C   1377 A G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1386 hydrog ? ? A  A   1380 N3    ? ? ? 1_555 A  G   1400 N2    ? ? A A   1381 A G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1387 hydrog ? ? A  G   1381 N1    ? ? ? 1_555 A  C   1399 N3    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1388 hydrog ? ? A  G   1381 N2    ? ? ? 1_555 A  C   1399 O2    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1389 hydrog ? ? A  G   1381 O6    ? ? ? 1_555 A  C   1399 N4    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1390 hydrog ? ? A  U   1382 N3    ? ? ? 1_555 A  A   1398 N1    ? ? A U   1383 A A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1391 hydrog ? ? A  U   1382 O4    ? ? ? 1_555 A  A   1398 N6    ? ? A U   1383 A A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1392 hydrog ? ? A  C   1383 N3    ? ? ? 1_555 A  G   1397 N1    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1393 hydrog ? ? A  C   1383 N4    ? ? ? 1_555 A  G   1397 O6    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1394 hydrog ? ? A  C   1383 O2    ? ? ? 1_555 A  G   1397 N2    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1395 hydrog ? ? A  G   1384 N1    ? ? ? 1_555 A  C   1396 N3    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1396 hydrog ? ? A  G   1384 N2    ? ? ? 1_555 A  C   1396 O2    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1397 hydrog ? ? A  G   1384 O6    ? ? ? 1_555 A  C   1396 N4    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1398 hydrog ? ? A  G   1385 N1    ? ? ? 1_555 A  C   1395 N3    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1399 hydrog ? ? A  G   1385 N2    ? ? ? 1_555 A  C   1395 O2    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1400 hydrog ? ? A  G   1385 O6    ? ? ? 1_555 A  C   1395 N4    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1401 hydrog ? ? A  G   1386 N1    ? ? ? 1_555 A  C   1394 N3    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1402 hydrog ? ? A  G   1386 N2    ? ? ? 1_555 A  C   1394 O2    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1403 hydrog ? ? A  G   1386 O6    ? ? ? 1_555 A  C   1394 N4    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1404 hydrog ? ? A  U   1387 N3    ? ? ? 1_555 A  A   1391 N7    ? ? A U   1388 A A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1405 hydrog ? ? A  U   1387 O2    ? ? ? 1_555 A  A   1391 N6    ? ? A U   1388 A A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1406 hydrog ? ? A  G   1388 N2    ? ? ? 1_555 A  U   1434 O4    ? ? A G   1389 A U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1407 hydrog ? ? A  A   1392 N6    ? ? ? 1_555 A  C   1724 O2    ? ? A A   1393 A C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1408 hydrog ? ? A  C   1393 N3    ? ? ? 1_555 A  U   1431 N3    ? ? A C   1394 A U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1409 hydrog ? ? A  C   1393 N4    ? ? ? 1_555 A  U   1431 O2    ? ? A C   1394 A U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1410 hydrog ? ? A  G   1400 N1    ? ? ? 1_555 A  C   1720 N3    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1411 hydrog ? ? A  G   1400 N2    ? ? ? 1_555 A  C   1720 O2    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1412 hydrog ? ? A  G   1400 O6    ? ? ? 1_555 A  C   1720 N4    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ? ? A  G   1401 N1    ? ? ? 1_555 A  C   1719 N3    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1414 hydrog ? ? A  G   1401 N2    ? ? ? 1_555 A  C   1719 O2    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1415 hydrog ? ? A  G   1401 O6    ? ? ? 1_555 A  C   1719 N4    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1416 hydrog ? ? A  C   1402 N3    ? ? ? 1_555 A  G   1718 N1    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1417 hydrog ? ? A  C   1402 N4    ? ? ? 1_555 A  G   1718 O6    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1418 hydrog ? ? A  C   1402 O2    ? ? ? 1_555 A  G   1718 N2    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1419 hydrog ? ? A  C   1403 N3    ? ? ? 1_555 A  G   1717 N1    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1420 hydrog ? ? A  C   1403 N4    ? ? ? 1_555 A  G   1717 O6    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1421 hydrog ? ? A  C   1403 O2    ? ? ? 1_555 A  G   1717 N2    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1422 hydrog ? ? A  U   1404 N3    ? ? ? 1_555 A  A   1715 N7    ? ? A U   1405 A A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1423 hydrog ? ? A  U   1404 O2    ? ? ? 1_555 A  A   1715 N6    ? ? A U   1405 A A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1424 hydrog ? ? A  A   1406 N1    ? ? ? 1_555 A  A   1716 N6    ? ? A A   1407 A A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1425 hydrog ? ? A  A   1406 N6    ? ? ? 1_555 A  A   1716 N1    ? ? A A   1407 A A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1426 hydrog ? ? A  G   1408 N1    ? ? ? 1_555 A  C   1699 N3    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1427 hydrog ? ? A  G   1408 N2    ? ? ? 1_555 A  C   1699 O2    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1428 hydrog ? ? A  G   1408 O6    ? ? ? 1_555 A  C   1699 N4    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1429 hydrog ? ? A  G   1409 N1    ? ? ? 1_555 A  C   1698 N3    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1430 hydrog ? ? A  G   1409 N2    ? ? ? 1_555 A  C   1698 O2    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1431 hydrog ? ? A  G   1409 O6    ? ? ? 1_555 A  C   1698 N4    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1432 hydrog ? ? A  A   1410 N1    ? ? ? 1_555 A  U   1697 N3    ? ? A A   1411 A U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1433 hydrog ? ? A  A   1410 N6    ? ? ? 1_555 A  U   1697 O4    ? ? A A   1411 A U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1434 hydrog ? ? A  U   1411 N3    ? ? ? 1_555 A  G   1696 O6    ? ? A U   1412 A G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1435 hydrog ? ? A  U   1411 O2    ? ? ? 1_555 A  G   1696 N1    ? ? A U   1412 A G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1436 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  G   1680 N3    ? ? A A   1414 A G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1437 hydrog ? ? A  A   1413 N7    ? ? ? 1_555 A  G   1680 N2    ? ? A A   1414 A G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1438 hydrog ? ? A  A   1413 N1    ? ? ? 1_555 A  A   1681 N6    ? ? A A   1414 A A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1439 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  A   1681 N1    ? ? A A   1414 A A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1440 hydrog ? ? A  G   1414 N1    ? ? ? 1_555 A  C   1679 N3    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1441 hydrog ? ? A  G   1414 N2    ? ? ? 1_555 A  C   1679 O2    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1442 hydrog ? ? A  G   1414 O6    ? ? ? 1_555 A  C   1679 N4    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1443 hydrog ? ? A  G   1415 N1    ? ? ? 1_555 A  C   1678 N3    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  C   1678 O2    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ? ? A  G   1415 O6    ? ? ? 1_555 A  C   1678 N4    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  A   1684 N3    ? ? A G   1416 A A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1447 hydrog ? ? A  U   1417 N3    ? ? ? 1_555 A  U   1445 O4    ? ? A U   1418 A U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1448 hydrog ? ? A  U   1418 N3    ? ? ? 1_555 A  A   1677 N1    ? ? A U   1419 A A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1449 hydrog ? ? A  U   1418 O4    ? ? ? 1_555 A  A   1677 N6    ? ? A U   1419 A A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1450 hydrog ? ? A  C   1419 N3    ? ? ? 1_555 A  G   1443 N1    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1451 hydrog ? ? A  C   1419 N4    ? ? ? 1_555 A  G   1443 O6    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1452 hydrog ? ? A  C   1419 O2    ? ? ? 1_555 A  G   1443 N2    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1453 hydrog ? ? A  C   1420 N3    ? ? ? 1_555 A  G   1442 N1    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1454 hydrog ? ? A  C   1420 N4    ? ? ? 1_555 A  G   1442 O6    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1455 hydrog ? ? A  C   1420 O2    ? ? ? 1_555 A  G   1442 N2    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ? ? A  U   1421 N3    ? ? ? 1_555 A  A   1441 N1    ? ? A U   1422 A A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ? ? A  U   1421 O4    ? ? ? 1_555 A  A   1441 N6    ? ? A U   1422 A A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ? ? A  C   1422 N3    ? ? ? 1_555 A  G   1440 N1    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1459 hydrog ? ? A  C   1422 N4    ? ? ? 1_555 A  G   1440 O6    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1460 hydrog ? ? A  C   1422 O2    ? ? ? 1_555 A  G   1440 N2    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1461 hydrog ? ? A  A   1423 N1    ? ? ? 1_555 A  U   1439 N3    ? ? A A   1424 A U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1462 hydrog ? ? A  A   1423 N6    ? ? ? 1_555 A  U   1439 O4    ? ? A A   1424 A U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1463 hydrog ? ? A  G   1424 N1    ? ? ? 1_555 A  C   1438 N3    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1464 hydrog ? ? A  G   1424 N2    ? ? ? 1_555 A  C   1438 O2    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ? ? A  G   1424 O6    ? ? ? 1_555 A  C   1438 N4    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ? ? A  C   1425 N3    ? ? ? 1_555 A  A   1436 N6    ? ? A C   1426 A A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1467 hydrog ? ? A  C   1425 N4    ? ? ? 1_555 A  A   1436 N7    ? ? A C   1426 A A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1468 hydrog ? ? A  C   1427 N4    ? ? ? 1_555 A  C   1438 O2    ? ? A C   1428 A C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1469 hydrog ? ? A  U   1428 N3    ? ? ? 1_555 A  A   1436 N1    ? ? A U   1429 A A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1470 hydrog ? ? A  U   1428 O4    ? ? ? 1_555 A  A   1436 N6    ? ? A U   1429 A A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1471 hydrog ? ? A  G   1429 N1    ? ? ? 1_555 A  C   1435 N3    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1472 hydrog ? ? A  G   1429 N2    ? ? ? 1_555 A  C   1435 O2    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1473 hydrog ? ? A  G   1429 O6    ? ? ? 1_555 A  C   1435 N4    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1474 hydrog ? ? A  G   1429 N3    ? ? ? 1_555 A  A   1690 N6    ? ? A G   1430 A A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1475 hydrog ? ? A  A   1447 N6    ? ? ? 1_555 A  U   1676 O2    ? ? A A   1448 A U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1476 hydrog ? ? A  A   1447 N7    ? ? ? 1_555 A  U   1676 N3    ? ? A A   1448 A U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1477 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  A   1492 N3    ? ? A G   1449 A A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1478 hydrog ? ? A  G   1448 N1    ? ? ? 1_555 A  C   1512 N3    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1479 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  C   1512 O2    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1480 hydrog ? ? A  G   1448 O6    ? ? ? 1_555 A  C   1512 N4    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1481 hydrog ? ? A  C   1449 N3    ? ? ? 1_555 A  G   1511 N1    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1482 hydrog ? ? A  C   1449 N4    ? ? ? 1_555 A  G   1511 O6    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1483 hydrog ? ? A  C   1449 O2    ? ? ? 1_555 A  G   1511 N2    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1484 hydrog ? ? A  C   1450 N3    ? ? ? 1_555 A  G   1675 N1    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ? ? A  C   1450 N4    ? ? ? 1_555 A  G   1675 O6    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ? ? A  C   1450 O2    ? ? ? 1_555 A  G   1675 N2    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  A   1485 N1    ? ? A G   1452 A A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1488 hydrog ? ? A  G   1451 N1    ? ? ? 1_555 A  C   1674 N3    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1489 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  C   1674 O2    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1490 hydrog ? ? A  G   1451 O6    ? ? ? 1_555 A  C   1674 N4    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1491 hydrog ? ? A  G   1452 N1    ? ? ? 1_555 A  C   1673 N3    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1492 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  C   1673 O2    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1493 hydrog ? ? A  G   1452 O6    ? ? ? 1_555 A  C   1673 N4    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ? ? A  U   1453 O4    ? ? ? 1_555 A  G   1490 N2    ? ? A U   1454 A G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1495 hydrog ? ? A  C   1454 N3    ? ? ? 1_555 A  G   1489 N1    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1496 hydrog ? ? A  C   1454 N4    ? ? ? 1_555 A  G   1489 O6    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1497 hydrog ? ? A  C   1454 O2    ? ? ? 1_555 A  G   1489 N2    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1498 hydrog ? ? A  C   1455 N3    ? ? ? 1_555 A  G   1488 N1    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1499 hydrog ? ? A  C   1455 N4    ? ? ? 1_555 A  G   1488 O6    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1500 hydrog ? ? A  C   1455 O2    ? ? ? 1_555 A  G   1488 N2    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1501 hydrog ? ? A  U   1456 N3    ? ? ? 1_555 A  A   1484 N7    ? ? A U   1457 A A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1502 hydrog ? ? A  U   1456 O2    ? ? ? 1_555 A  A   1484 N6    ? ? A U   1457 A A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1503 hydrog ? ? A  A   1458 N6    ? ? ? 1_555 A  G   1483 N3    ? ? A A   1459 A G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1504 hydrog ? ? A  A   1458 N7    ? ? ? 1_555 A  G   1483 N2    ? ? A A   1459 A G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1505 hydrog ? ? A  G   1459 N1    ? ? ? 1_555 A  C   1482 N3    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1506 hydrog ? ? A  G   1459 N2    ? ? ? 1_555 A  C   1482 O2    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1507 hydrog ? ? A  G   1459 O6    ? ? ? 1_555 A  C   1482 N4    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1508 hydrog ? ? A  U   1460 N3    ? ? ? 1_555 A  A   1481 N1    ? ? A U   1461 A A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ? ? A  U   1460 O4    ? ? ? 1_555 A  A   1481 N6    ? ? A U   1461 A A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1510 hydrog ? ? A  C   1461 N3    ? ? ? 1_555 A  G   1480 N1    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ? ? A  C   1461 N4    ? ? ? 1_555 A  G   1480 O6    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ? ? A  C   1461 O2    ? ? ? 1_555 A  G   1480 N2    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ? ? A  A   1462 N1    ? ? ? 1_555 A  U   1479 N3    ? ? A A   1463 A U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1514 hydrog ? ? A  A   1462 N6    ? ? ? 1_555 A  U   1479 O4    ? ? A A   1463 A U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ? ? A  U   1463 N3    ? ? ? 1_555 A  A   1478 N1    ? ? A U   1464 A A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1516 hydrog ? ? A  U   1463 O4    ? ? ? 1_555 A  A   1478 N6    ? ? A U   1464 A A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1517 hydrog ? ? A  A   1464 N1    ? ? ? 1_555 A  U   1477 N3    ? ? A A   1465 A U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1518 hydrog ? ? A  A   1464 N6    ? ? ? 1_555 A  U   1477 O4    ? ? A A   1465 A U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1519 hydrog ? ? A  C   1465 O2    ? ? ? 1_555 A  C   1476 N4    ? ? A C   1466 A C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1520 hydrog ? ? A  C   1466 N3    ? ? ? 1_555 A  G   1474 N1    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1521 hydrog ? ? A  C   1466 N4    ? ? ? 1_555 A  G   1474 O6    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1522 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  G   1474 N2    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1523 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  A   1475 N6    ? ? A C   1467 A A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1524 hydrog ? ? A  G   1467 N1    ? ? ? 1_555 A  C   1473 N3    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1525 hydrog ? ? A  G   1467 N2    ? ? ? 1_555 A  C   1473 O2    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1526 hydrog ? ? A  G   1467 O6    ? ? ? 1_555 A  C   1473 N4    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1527 hydrog ? ? A  G   1474 N2    ? ? ? 1_555 A  A   1865 N3    ? ? A G   1475 A A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1528 hydrog ? ? A  A   1484 N6    ? ? ? 1_555 A  A   1655 N1    ? ? A A   1485 A A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1529 hydrog ? ? A  A   1486 N3    ? ? ? 1_555 A  G   1696 N2    ? ? A A   1487 A G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1530 hydrog ? ? A  G   1488 N3    ? ? ? 1_555 A  A   1655 N6    ? ? A G   1489 A A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1531 hydrog ? ? A  G   1488 N2    ? ? ? 1_555 A  A   1656 N1    ? ? A G   1489 A A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1532 hydrog ? ? A  A   1493 N1    ? ? ? 1_555 A  U   1510 N3    ? ? A A   1494 A U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1533 hydrog ? ? A  A   1493 N6    ? ? ? 1_555 A  U   1510 O4    ? ? A A   1494 A U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1534 hydrog ? ? A  C   1494 N3    ? ? ? 1_555 A  G   1509 N1    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1535 hydrog ? ? A  C   1494 N4    ? ? ? 1_555 A  G   1509 O6    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1536 hydrog ? ? A  C   1494 O2    ? ? ? 1_555 A  G   1509 N2    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ? ? A  G   1495 N1    ? ? ? 1_555 A  C   1508 N3    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ? ? A  G   1495 N2    ? ? ? 1_555 A  C   1508 O2    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ? ? A  G   1495 O6    ? ? ? 1_555 A  C   1508 N4    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1540 hydrog ? ? A  G   1496 N1    ? ? ? 1_555 A  C   1507 N3    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1541 hydrog ? ? A  G   1496 N2    ? ? ? 1_555 A  C   1507 O2    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1542 hydrog ? ? A  G   1496 O6    ? ? ? 1_555 A  C   1507 N4    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1543 hydrog ? ? A  G   1497 N1    ? ? ? 1_555 A  C   1506 N3    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1544 hydrog ? ? A  G   1497 N2    ? ? ? 1_555 A  C   1506 O2    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1545 hydrog ? ? A  G   1497 O6    ? ? ? 1_555 A  C   1506 N4    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1546 hydrog ? ? A  U   1498 N3    ? ? ? 1_555 A  A   1503 N7    ? ? A U   1499 A A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1547 hydrog ? ? A  U   1498 O2    ? ? ? 1_555 A  A   1503 N6    ? ? A U   1499 A A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1548 hydrog ? ? A  C   1513 N3    ? ? ? 1_555 A  G   1671 N1    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1549 hydrog ? ? A  C   1513 N4    ? ? ? 1_555 A  G   1671 O6    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1550 hydrog ? ? A  C   1513 O2    ? ? ? 1_555 A  G   1671 N2    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1551 hydrog ? ? A  A   1514 N1    ? ? ? 1_555 A  U   1670 N3    ? ? A A   1515 A U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ? ? A  A   1514 N6    ? ? ? 1_555 A  U   1670 O4    ? ? A A   1515 A U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ? ? A  C   1515 N3    ? ? ? 1_555 A  G   1669 N1    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ? ? A  C   1515 N4    ? ? ? 1_555 A  G   1669 O6    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ? ? A  C   1515 O2    ? ? ? 1_555 A  G   1669 N2    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ? ? A  U   1516 N3    ? ? ? 1_555 A  A   1668 N1    ? ? A U   1517 A A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ? ? A  U   1516 O4    ? ? ? 1_555 A  A   1668 N6    ? ? A U   1517 A A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ? ? A  A   1517 N1    ? ? ? 1_555 A  U   1667 N3    ? ? A A   1518 A U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ? ? A  A   1517 N6    ? ? ? 1_555 A  U   1667 O4    ? ? A A   1518 A U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ? ? A  U   1518 N3    ? ? ? 1_555 A  A   1666 N1    ? ? A U   1519 A A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ? ? A  U   1518 O4    ? ? ? 1_555 A  A   1666 N6    ? ? A U   1519 A A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1562 hydrog ? ? A  G   1519 N1    ? ? ? 1_555 A  C   1665 N3    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1563 hydrog ? ? A  G   1519 N2    ? ? ? 1_555 A  C   1665 O2    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1564 hydrog ? ? A  G   1519 O6    ? ? ? 1_555 A  C   1665 N4    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1565 hydrog ? ? A  C   1520 N3    ? ? ? 1_555 A  G   1664 N1    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1566 hydrog ? ? A  C   1520 N4    ? ? ? 1_555 A  G   1664 O6    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1567 hydrog ? ? A  C   1520 O2    ? ? ? 1_555 A  G   1664 N2    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1568 hydrog ? ? A  A   1526 N6    ? ? ? 1_555 A  A   1663 N7    ? ? A A   1527 A A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1569 hydrog ? ? A  A   1526 N7    ? ? ? 1_555 A  A   1663 N6    ? ? A A   1527 A A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1570 hydrog ? ? A  A   1527 N6    ? ? ? 1_555 A  G   1662 N3    ? ? A A   1528 A G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1571 hydrog ? ? A  A   1527 N7    ? ? ? 1_555 A  G   1662 N2    ? ? A A   1528 A G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1572 hydrog ? ? A  G   1528 N1    ? ? ? 1_555 A  C   1661 N3    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1573 hydrog ? ? A  G   1528 N2    ? ? ? 1_555 A  C   1661 O2    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1574 hydrog ? ? A  G   1528 O6    ? ? ? 1_555 A  C   1661 N4    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1575 hydrog ? ? A  U   1529 N3    ? ? ? 1_555 A  A   1660 N1    ? ? A U   1530 A A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1576 hydrog ? ? A  U   1529 O4    ? ? ? 1_555 A  A   1660 N6    ? ? A U   1530 A A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1577 hydrog ? ? A  U   1530 N3    ? ? ? 1_555 A  G   1659 O6    ? ? A U   1531 A G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1578 hydrog ? ? A  U   1530 O2    ? ? ? 1_555 A  G   1659 N1    ? ? A U   1531 A G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1579 hydrog ? ? A  G   1531 N2    ? ? ? 1_555 A  A   1658 N7    ? ? A G   1532 A A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1580 hydrog ? ? A  G   1531 N3    ? ? ? 1_555 A  A   1658 N6    ? ? A G   1532 A A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1581 hydrog ? ? A  A   1532 N6    ? ? ? 1_555 A  A   1657 N7    ? ? A A   1533 A A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1582 hydrog ? ? A  A   1532 N7    ? ? ? 1_555 A  A   1657 N6    ? ? A A   1533 A A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1583 hydrog ? ? A  C   1533 N4    ? ? ? 1_555 A  A   1656 N7    ? ? A C   1534 A A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1584 hydrog ? ? A  G   1534 N1    ? ? ? 1_555 A  C   1649 N3    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1585 hydrog ? ? A  G   1534 N2    ? ? ? 1_555 A  C   1649 O2    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1586 hydrog ? ? A  G   1534 O6    ? ? ? 1_555 A  C   1649 N4    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1587 hydrog ? ? A  C   1535 N3    ? ? ? 1_555 A  G   1648 N1    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ? ? A  C   1535 N4    ? ? ? 1_555 A  G   1648 O6    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ? ? A  C   1535 O2    ? ? ? 1_555 A  G   1648 N2    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1590 hydrog ? ? A  C   1536 N3    ? ? ? 1_555 A  G   1647 N1    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1591 hydrog ? ? A  C   1536 N4    ? ? ? 1_555 A  G   1647 O6    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1592 hydrog ? ? A  C   1536 O2    ? ? ? 1_555 A  G   1647 N2    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1593 hydrog ? ? A  C   1537 N3    ? ? ? 1_555 A  G   1646 N1    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1594 hydrog ? ? A  C   1537 N4    ? ? ? 1_555 A  G   1646 O6    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1595 hydrog ? ? A  C   1537 O2    ? ? ? 1_555 A  G   1646 N2    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1596 hydrog ? ? A  U   1538 N3    ? ? ? 1_555 A  G   1645 O6    ? ? A U   1539 A G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1597 hydrog ? ? A  U   1538 O2    ? ? ? 1_555 A  G   1645 N1    ? ? A U   1539 A G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1598 hydrog ? ? A  G   1539 N1    ? ? ? 1_555 A  U   1644 O2    ? ? A G   1540 A U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1599 hydrog ? ? A  G   1539 O6    ? ? ? 1_555 A  U   1644 N3    ? ? A G   1540 A U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1600 hydrog ? ? A  G   1540 N1    ? ? ? 1_555 A  C   1643 N3    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1601 hydrog ? ? A  G   1540 N2    ? ? ? 1_555 A  C   1643 O2    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1602 hydrog ? ? A  G   1540 O6    ? ? ? 1_555 A  C   1643 N4    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1603 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  A   1615 N3    ? ? A G   1542 A A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1604 hydrog ? ? A  G   1541 N1    ? ? ? 1_555 A  C   1642 N3    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1605 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  C   1642 O2    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1606 hydrog ? ? A  G   1541 O6    ? ? ? 1_555 A  C   1642 N4    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1607 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  A   1641 N7    ? ? A G   1543 A A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1608 hydrog ? ? A  G   1542 N3    ? ? ? 1_555 A  A   1641 N6    ? ? A G   1543 A A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1609 hydrog ? ? A  U   1543 N3    ? ? ? 1_555 A  A   1640 N7    ? ? A U   1544 A A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1610 hydrog ? ? A  U   1543 O2    ? ? ? 1_555 A  A   1640 N6    ? ? A U   1544 A A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1611 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  C   1639 O2    ? ? A C   1545 A C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1612 hydrog ? ? A  C   1544 N3    ? ? ? 1_555 A  U   1701 N3    ? ? A C   1545 A U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1613 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  U   1701 O4    ? ? A C   1545 A U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1614 hydrog ? ? A  G   1545 N1    ? ? ? 1_555 A  U   1638 O2    ? ? A G   1546 A U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1615 hydrog ? ? A  G   1545 O6    ? ? ? 1_555 A  U   1638 N3    ? ? A G   1546 A U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1616 hydrog ? ? A  A   1546 N1    ? ? ? 1_555 A  U   1637 N3    ? ? A A   1547 A U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1617 hydrog ? ? A  A   1546 N6    ? ? ? 1_555 A  U   1637 O4    ? ? A A   1547 A U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ? ? A  U   1547 N3    ? ? ? 1_555 A  A   1636 N1    ? ? A U   1548 A A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ? ? A  U   1547 O4    ? ? ? 1_555 A  A   1636 N6    ? ? A U   1548 A A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ? ? A  C   1548 N3    ? ? ? 1_555 A  G   1635 N1    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1621 hydrog ? ? A  C   1548 N4    ? ? ? 1_555 A  G   1635 O6    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1622 hydrog ? ? A  C   1548 O2    ? ? ? 1_555 A  G   1635 N2    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1623 hydrog ? ? A  A   1549 N1    ? ? ? 1_555 A  U   1634 N3    ? ? A A   1550 A U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1624 hydrog ? ? A  A   1549 N6    ? ? ? 1_555 A  U   1634 O4    ? ? A A   1550 A U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1625 hydrog ? ? A  C   1550 N3    ? ? ? 1_555 A  G   1633 N1    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1626 hydrog ? ? A  C   1550 N4    ? ? ? 1_555 A  G   1633 O6    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1627 hydrog ? ? A  C   1550 O2    ? ? ? 1_555 A  G   1633 N2    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1628 hydrog ? ? A  G   1551 N1    ? ? ? 1_555 A  U   1568 O2    ? ? A G   1552 A U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1629 hydrog ? ? A  G   1551 O6    ? ? ? 1_555 A  U   1568 N3    ? ? A G   1552 A U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1630 hydrog ? ? A  C   1552 N3    ? ? ? 1_555 A  G   1567 N1    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1631 hydrog ? ? A  C   1552 N4    ? ? ? 1_555 A  G   1567 O6    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1632 hydrog ? ? A  C   1552 O2    ? ? ? 1_555 A  G   1567 N2    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1633 hydrog ? ? A  U   1553 N3    ? ? ? 1_555 A  A   1566 N1    ? ? A U   1554 A A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ? ? A  U   1553 O4    ? ? ? 1_555 A  A   1566 N6    ? ? A U   1554 A A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ? ? A  G   1554 N1    ? ? ? 1_555 A  C   1565 N3    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ? ? A  G   1554 N2    ? ? ? 1_555 A  C   1565 O2    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ? ? A  G   1554 O6    ? ? ? 1_555 A  C   1565 N4    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ? ? A  G   1555 N1    ? ? ? 1_555 A  C   1564 N3    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ? ? A  G   1555 N2    ? ? ? 1_555 A  C   1564 O2    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ? ? A  G   1555 O6    ? ? ? 1_555 A  C   1564 N4    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ? ? A  G   1556 N1    ? ? ? 1_555 A  C   1563 N3    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ? ? A  G   1556 N2    ? ? ? 1_555 A  C   1563 O2    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ? ? A  G   1556 O6    ? ? ? 1_555 A  C   1563 N4    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1644 hydrog ? ? A  U   1560 N3    ? ? ? 1_555 A  A   2738 N1    ? ? A U   1561 A A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1645 hydrog ? ? A  U   1560 O4    ? ? ? 1_555 A  A   2738 N6    ? ? A U   1561 A A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1646 hydrog ? ? A  C   1561 N3    ? ? ? 1_555 A  G   2737 N1    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1647 hydrog ? ? A  C   1561 N4    ? ? ? 1_555 A  G   2737 O6    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1648 hydrog ? ? A  C   1561 O2    ? ? ? 1_555 A  G   2737 N2    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1649 hydrog ? ? A  G   1567 N2    ? ? ? 1_555 A  A   1631 N3    ? ? A G   1568 A A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1650 hydrog ? ? A  C   1569 N3    ? ? ? 1_555 A  G   1626 N1    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1651 hydrog ? ? A  C   1569 N4    ? ? ? 1_555 A  G   1626 O6    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1652 hydrog ? ? A  C   1569 O2    ? ? ? 1_555 A  G   1626 N2    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1653 hydrog ? ? A  G   1570 N2    ? ? ? 1_555 A  A   1625 N7    ? ? A G   1571 A A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1654 hydrog ? ? A  G   1570 N3    ? ? ? 1_555 A  A   1625 N6    ? ? A G   1571 A A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1655 hydrog ? ? A  A   1571 N6    ? ? ? 1_555 A  A   1623 N7    ? ? A A   1572 A A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1656 hydrog ? ? A  A   1571 N7    ? ? ? 1_555 A  A   1623 N6    ? ? A A   1572 A A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1657 hydrog ? ? A  A   1572 N6    ? ? ? 1_555 A  C   1622 O2    ? ? A A   1573 A C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1658 hydrog ? ? A  C   1573 N3    ? ? ? 1_555 A  G   1621 N1    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1659 hydrog ? ? A  C   1573 N4    ? ? ? 1_555 A  G   1621 O6    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ? ? A  C   1573 O2    ? ? ? 1_555 A  G   1621 N2    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1661 hydrog ? ? A  C   1574 N3    ? ? ? 1_555 A  G   1620 N1    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1662 hydrog ? ? A  C   1574 N4    ? ? ? 1_555 A  G   1620 O6    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1663 hydrog ? ? A  C   1574 O2    ? ? ? 1_555 A  G   1620 N2    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1664 hydrog ? ? A  G   1575 N1    ? ? ? 1_555 A  C   1619 N3    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ? ? A  G   1575 N2    ? ? ? 1_555 A  C   1619 O2    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1666 hydrog ? ? A  G   1575 O6    ? ? ? 1_555 A  C   1619 N4    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1667 hydrog ? ? A  U   1576 N3    ? ? ? 1_555 A  G   1618 O6    ? ? A U   1577 A G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1668 hydrog ? ? A  U   1576 O2    ? ? ? 1_555 A  G   1618 N1    ? ? A U   1577 A G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1669 hydrog ? ? A  C   1577 N3    ? ? ? 1_555 A  G   1617 N1    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1670 hydrog ? ? A  C   1577 N4    ? ? ? 1_555 A  G   1617 O6    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1671 hydrog ? ? A  C   1577 O2    ? ? ? 1_555 A  G   1617 N2    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1672 hydrog ? ? A  C   1578 N3    ? ? ? 1_555 A  A   1615 N6    ? ? A C   1579 A A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1673 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  A   1615 N7    ? ? A C   1579 A A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1674 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  G   1617 O6    ? ? A C   1579 A G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1675 hydrog ? ? A  A   1580 N6    ? ? ? 1_555 A  G   1613 N3    ? ? A A   1581 A G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1676 hydrog ? ? A  A   1580 N7    ? ? ? 1_555 A  G   1613 N2    ? ? A A   1581 A G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1677 hydrog ? ? A  C   1581 N4    ? ? ? 1_555 A  C   1612 N3    ? ? A C   1582 A C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1678 hydrog ? ? A  U   1582 N3    ? ? ? 1_555 A  A   1611 N1    ? ? A U   1583 A A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1679 hydrog ? ? A  U   1582 O4    ? ? ? 1_555 A  A   1611 N6    ? ? A U   1583 A A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ? ? A  C   1583 N3    ? ? ? 1_555 A  G   1610 N1    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ? ? A  C   1583 N4    ? ? ? 1_555 A  G   1610 O6    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ? ? A  C   1583 O2    ? ? ? 1_555 A  G   1610 N2    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1683 hydrog ? ? A  C   1584 N3    ? ? ? 1_555 A  G   1609 N1    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1684 hydrog ? ? A  C   1584 N4    ? ? ? 1_555 A  G   1609 O6    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1685 hydrog ? ? A  C   1584 O2    ? ? ? 1_555 A  G   1609 N2    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1686 hydrog ? ? A  G   1585 N1    ? ? ? 1_555 A  C   1608 N3    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1687 hydrog ? ? A  G   1585 N2    ? ? ? 1_555 A  C   1608 O2    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1688 hydrog ? ? A  G   1585 O6    ? ? ? 1_555 A  C   1608 N4    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1689 hydrog ? ? A  U   1586 N3    ? ? ? 1_555 A  G   1607 O6    ? ? A U   1587 A G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1690 hydrog ? ? A  U   1586 O2    ? ? ? 1_555 A  G   1607 N1    ? ? A U   1587 A G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1691 hydrog ? ? A  G   1587 N2    ? ? ? 1_555 A  A   1606 N7    ? ? A G   1588 A A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1692 hydrog ? ? A  G   1587 N3    ? ? ? 1_555 A  A   1606 N6    ? ? A G   1588 A A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1693 hydrog ? ? A  G   1588 N2    ? ? ? 1_555 A  A   1605 N7    ? ? A G   1589 A A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1694 hydrog ? ? A  A   1589 N6    ? ? ? 1_555 A  G   1604 N3    ? ? A A   1590 A G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1695 hydrog ? ? A  A   1589 N7    ? ? ? 1_555 A  G   1604 N2    ? ? A A   1590 A G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1696 hydrog ? ? A  G   1591 N1    ? ? ? 1_555 A  C   1601 N3    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1697 hydrog ? ? A  G   1591 N2    ? ? ? 1_555 A  C   1601 O2    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1698 hydrog ? ? A  G   1591 O6    ? ? ? 1_555 A  C   1601 N4    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1699 hydrog ? ? A  C   1592 N3    ? ? ? 1_555 A  G   1600 N1    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1700 hydrog ? ? A  C   1592 N4    ? ? ? 1_555 A  G   1600 O6    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1701 hydrog ? ? A  C   1592 O2    ? ? ? 1_555 A  G   1600 N2    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ? ? A  C   1593 N3    ? ? ? 1_555 A  G   1599 N1    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1703 hydrog ? ? A  C   1593 N4    ? ? ? 1_555 A  G   1599 O6    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1704 hydrog ? ? A  C   1593 O2    ? ? ? 1_555 A  G   1599 N2    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1705 hydrog ? ? A  A   1596 N6    ? ? ? 1_555 A  G   1646 N3    ? ? A A   1597 A G   1647 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1706 hydrog ? ? A  G   1627 N1    ? ? ? 1_555 A  C   1632 N3    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1707 hydrog ? ? A  G   1627 N2    ? ? ? 1_555 A  C   1632 O2    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1708 hydrog ? ? A  G   1627 O6    ? ? ? 1_555 A  C   1632 N4    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1709 hydrog ? ? A  G   1628 N2    ? ? ? 1_555 A  A   1631 N7    ? ? A G   1629 A A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1710 hydrog ? ? A  G   1628 N1    ? ? ? 1_555 A  C   1632 N3    ? ? A G   1629 A C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1711 hydrog ? ? A  C   1650 N3    ? ? ? 1_555 A  G   1654 N1    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1712 hydrog ? ? A  C   1650 N4    ? ? ? 1_555 A  G   1654 O6    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1713 hydrog ? ? A  C   1650 O2    ? ? ? 1_555 A  G   1654 N2    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1714 hydrog ? ? A  A   1681 N6    ? ? ? 1_555 A  U   1695 O2    ? ? A A   1682 A U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1715 hydrog ? ? A  A   1681 N7    ? ? ? 1_555 A  U   1695 N3    ? ? A A   1682 A U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1716 hydrog ? ? A  A   1683 N6    ? ? ? 1_555 A  U   1721 O4    ? ? A A   1684 A U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1717 hydrog ? ? A  A   1683 N7    ? ? ? 1_555 A  U   1721 N3    ? ? A A   1684 A U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1718 hydrog ? ? A  C   1685 N3    ? ? ? 1_555 A  G   1694 N1    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1719 hydrog ? ? A  C   1685 N4    ? ? ? 1_555 A  G   1694 O6    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ? ? A  C   1685 O2    ? ? ? 1_555 A  G   1694 N2    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ? ? A  C   1686 N3    ? ? ? 1_555 A  G   1693 N1    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ? ? A  C   1686 N4    ? ? ? 1_555 A  G   1693 O6    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ? ? A  C   1686 O2    ? ? ? 1_555 A  G   1693 N2    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1724 hydrog ? ? A  G   1702 N1    ? ? ? 1_555 A  C   1714 N3    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1725 hydrog ? ? A  G   1702 N2    ? ? ? 1_555 A  C   1714 O2    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1726 hydrog ? ? A  G   1702 O6    ? ? ? 1_555 A  C   1714 N4    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1727 hydrog ? ? A  G   1703 N1    ? ? ? 1_555 A  C   1713 N3    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1728 hydrog ? ? A  G   1703 N2    ? ? ? 1_555 A  C   1713 O2    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1729 hydrog ? ? A  G   1703 O6    ? ? ? 1_555 A  C   1713 N4    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1730 hydrog ? ? A  C   1704 N3    ? ? ? 1_555 A  G   1712 N1    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1731 hydrog ? ? A  C   1704 N4    ? ? ? 1_555 A  G   1712 O6    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1732 hydrog ? ? A  C   1704 O2    ? ? ? 1_555 A  G   1712 N2    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1733 hydrog ? ? A  G   1705 N2    ? ? ? 1_555 A  A   1711 N7    ? ? A G   1706 A A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1734 hydrog ? ? A  G   1705 N3    ? ? ? 1_555 A  A   1711 N6    ? ? A G   1706 A A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1735 hydrog ? ? A  G   1706 N2    ? ? ? 1_555 A  A   1710 N7    ? ? A G   1707 A A   1711 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1736 hydrog ? ? A  C   1724 N3    ? ? ? 1_555 A  G   2049 N1    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1737 hydrog ? ? A  C   1724 N4    ? ? ? 1_555 A  G   2049 O6    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ? ? A  C   1724 O2    ? ? ? 1_555 A  G   2049 N2    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ? ? A  G   1725 N1    ? ? ? 1_555 A  C   2048 N3    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ? ? A  G   1725 N2    ? ? ? 1_555 A  C   2048 O2    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ? ? A  G   1725 O6    ? ? ? 1_555 A  C   2048 N4    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ? ? A  G   1726 N1    ? ? ? 1_555 A  C   2047 N3    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1743 hydrog ? ? A  G   1726 N2    ? ? ? 1_555 A  C   2047 O2    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1744 hydrog ? ? A  G   1726 O6    ? ? ? 1_555 A  C   2047 N4    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1745 hydrog ? ? A  G   1727 N1    ? ? ? 1_555 A  C   2046 N3    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ? ? A  G   1727 N2    ? ? ? 1_555 A  C   2046 O2    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ? ? A  G   1727 O6    ? ? ? 1_555 A  C   2046 N4    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ? ? A  A   1732 N6    ? ? ? 1_555 A  G   2045 N3    ? ? A A   1733 A G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1749 hydrog ? ? A  A   1732 N7    ? ? ? 1_555 A  G   2045 N2    ? ? A A   1733 A G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1750 hydrog ? ? A  C   1733 N3    ? ? ? 1_555 A  G   2044 N1    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1751 hydrog ? ? A  C   1733 N4    ? ? ? 1_555 A  G   2044 O6    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ? ? A  C   1733 O2    ? ? ? 1_555 A  G   2044 N2    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ? ? A  C   1734 N3    ? ? ? 1_555 A  G   2043 N1    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ? ? A  C   1734 N4    ? ? ? 1_555 A  G   2043 O6    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ? ? A  C   1734 O2    ? ? ? 1_555 A  G   2043 N2    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ? ? A  A   1735 N1    ? ? ? 1_555 A  U   2042 N3    ? ? A A   1736 A U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ? ? A  A   1735 N6    ? ? ? 1_555 A  U   2042 O4    ? ? A A   1736 A U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ? ? A  A   1736 N1    ? ? ? 1_555 A  U   2041 N3    ? ? A A   1737 A U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ? ? A  A   1736 N6    ? ? ? 1_555 A  U   2041 O4    ? ? A A   1737 A U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ? ? A  C   1737 N3    ? ? ? 1_555 A  G   2040 N1    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ? ? A  C   1737 N4    ? ? ? 1_555 A  G   2040 O6    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ? ? A  C   1737 O2    ? ? ? 1_555 A  G   2040 N2    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ? ? A  G   1738 N1    ? ? ? 1_555 A  C   2039 N3    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1764 hydrog ? ? A  G   1738 N2    ? ? ? 1_555 A  C   2039 O2    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1765 hydrog ? ? A  G   1738 O6    ? ? ? 1_555 A  C   2039 N4    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1766 hydrog ? ? A  U   1739 N3    ? ? ? 1_555 A  A   2038 N1    ? ? A U   1740 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1767 hydrog ? ? A  U   1739 O4    ? ? ? 1_555 A  A   2038 N6    ? ? A U   1740 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1768 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2037 N1    ? ? A U   1741 A A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2037 N6    ? ? A U   1741 A A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ? ? A  A   1741 N1    ? ? ? 1_555 A  C   2036 N4    ? ? A A   1742 A C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1771 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  C   2036 N3    ? ? A A   1742 A C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1772 hydrog ? ? A  G   1742 N1    ? ? ? 1_555 A  C   2035 N3    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1773 hydrog ? ? A  G   1742 N2    ? ? ? 1_555 A  C   2035 O2    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1774 hydrog ? ? A  G   1742 O6    ? ? ? 1_555 A  C   2035 N4    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1775 hydrog ? ? A  G   1743 N1    ? ? ? 1_555 A  C   2034 N3    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1776 hydrog ? ? A  G   1743 N2    ? ? ? 1_555 A  C   2034 O2    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1777 hydrog ? ? A  G   1743 O6    ? ? ? 1_555 A  C   2034 N4    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ? ? A  G   1744 N2    ? ? ? 1_555 A  U   2033 O4    ? ? A G   1745 A U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1779 hydrog ? ? A  A   1745 N6    ? ? ? 1_555 A  U   2031 O2    ? ? A A   1746 A U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1780 hydrog ? ? A  A   1745 N7    ? ? ? 1_555 A  U   2031 N3    ? ? A A   1746 A U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1781 hydrog ? ? A  A   1746 N1    ? ? ? 1_555 A  U   2033 N3    ? ? A A   1747 A U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1782 hydrog ? ? A  A   1746 N6    ? ? ? 1_555 A  U   2033 O4    ? ? A A   1747 A U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1783 hydrog ? ? A  G   1751 N1    ? ? ? 1_555 A  C   2030 N3    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1784 hydrog ? ? A  G   1751 N2    ? ? ? 1_555 A  C   2030 O2    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ? ? A  G   1751 O6    ? ? ? 1_555 A  C   2030 N4    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1786 hydrog ? ? A  G   1759 N1    ? ? ? 1_555 A  U   1783 O2    ? ? A G   1760 A U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1787 hydrog ? ? A  G   1759 O6    ? ? ? 1_555 A  U   1783 N3    ? ? A G   1760 A U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1788 hydrog ? ? A  U   1760 N3    ? ? ? 1_555 A  A   1782 N1    ? ? A U   1761 A A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1789 hydrog ? ? A  U   1760 O4    ? ? ? 1_555 A  A   1782 N6    ? ? A U   1761 A A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1790 hydrog ? ? A  C   1761 N3    ? ? ? 1_555 A  G   1781 N1    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1791 hydrog ? ? A  C   1761 N4    ? ? ? 1_555 A  G   1781 O6    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ? ? A  C   1761 O2    ? ? ? 1_555 A  G   1781 N2    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ? ? A  C   1762 N3    ? ? ? 1_555 A  G   1780 N1    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ? ? A  C   1762 N4    ? ? ? 1_555 A  G   1780 O6    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1795 hydrog ? ? A  C   1762 O2    ? ? ? 1_555 A  G   1780 N2    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1796 hydrog ? ? A  C   1763 N3    ? ? ? 1_555 A  G   1779 N1    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1797 hydrog ? ? A  C   1763 N4    ? ? ? 1_555 A  G   1779 O6    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1798 hydrog ? ? A  C   1763 O2    ? ? ? 1_555 A  G   1779 N2    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1799 hydrog ? ? A  G   1764 N2    ? ? ? 1_555 A  A   1778 N7    ? ? A G   1765 A A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1800 hydrog ? ? A  G   1764 N3    ? ? ? 1_555 A  A   1778 N6    ? ? A G   1765 A A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1801 hydrog ? ? A  A   1766 N6    ? ? ? 1_555 A  A   1775 N7    ? ? A A   1767 A A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1802 hydrog ? ? A  A   1766 N7    ? ? ? 1_555 A  A   1775 N6    ? ? A A   1767 A A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1803 hydrog ? ? A  C   1767 N4    ? ? ? 1_555 A  A   1774 N3    ? ? A C   1768 A A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1804 hydrog ? ? A  C   1768 N3    ? ? ? 1_555 A  G   1773 N1    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1805 hydrog ? ? A  C   1768 N4    ? ? ? 1_555 A  G   1773 O6    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1806 hydrog ? ? A  C   1768 O2    ? ? ? 1_555 A  G   1773 N2    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1807 hydrog ? ? A  U   1769 O2    ? ? ? 1_555 A  G   1772 N1    ? ? A U   1770 A G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1808 hydrog ? ? A  U   1770 N3    ? ? ? 1_555 A  A   1884 N1    ? ? A U   1771 A A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ? ? A  U   1770 O4    ? ? ? 1_555 A  A   1884 N6    ? ? A U   1771 A A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1810 hydrog ? ? A  G   1784 N1    ? ? ? 1_555 A  U   1806 O2    ? ? A G   1785 A U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1811 hydrog ? ? A  G   1784 O6    ? ? ? 1_555 A  U   1806 N3    ? ? A G   1785 A U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1812 hydrog ? ? A  C   1785 N3    ? ? ? 1_555 A  G   1805 N1    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1813 hydrog ? ? A  C   1785 N4    ? ? ? 1_555 A  G   1805 O6    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1814 hydrog ? ? A  C   1785 O2    ? ? ? 1_555 A  G   1805 N2    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1815 hydrog ? ? A  C   1786 N3    ? ? ? 1_555 A  G   1804 N1    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1816 hydrog ? ? A  C   1786 N4    ? ? ? 1_555 A  G   1804 O6    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1817 hydrog ? ? A  C   1786 O2    ? ? ? 1_555 A  G   1804 N2    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1818 hydrog ? ? A  U   1787 N3    ? ? ? 1_555 A  A   1803 N1    ? ? A U   1788 A A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1819 hydrog ? ? A  U   1787 O4    ? ? ? 1_555 A  A   1803 N6    ? ? A U   1788 A A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1820 hydrog ? ? A  G   1788 N1    ? ? ? 1_555 A  C   1802 N3    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ? ? A  G   1788 N2    ? ? ? 1_555 A  C   1802 O2    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ? ? A  G   1788 O6    ? ? ? 1_555 A  C   1802 N4    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ? ? A  C   1789 N3    ? ? ? 1_555 A  G   1801 N1    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1824 hydrog ? ? A  C   1789 N4    ? ? ? 1_555 A  G   1801 O6    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ? ? A  C   1789 O2    ? ? ? 1_555 A  G   1801 N2    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ? ? A  U   1790 N3    ? ? ? 1_555 A  A   1800 N1    ? ? A U   1791 A A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1827 hydrog ? ? A  U   1790 O4    ? ? ? 1_555 A  A   1800 N6    ? ? A U   1791 A A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1828 hydrog ? ? A  C   1791 N3    ? ? ? 1_555 A  G   1799 N1    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ? ? A  C   1791 N4    ? ? ? 1_555 A  G   1799 O6    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1830 hydrog ? ? A  C   1791 O2    ? ? ? 1_555 A  G   1799 N2    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1831 hydrog ? ? A  C   1792 N3    ? ? ? 1_555 A  G   1798 N1    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1832 hydrog ? ? A  C   1792 N4    ? ? ? 1_555 A  G   1798 O6    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1833 hydrog ? ? A  C   1792 O2    ? ? ? 1_555 A  G   1798 N2    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ? ? A  G   1793 N2    ? ? ? 1_555 A  A   1796 N7    ? ? A G   1794 A A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1835 hydrog ? ? A  G   1804 N2    ? ? ? 1_555 A  A   2874 N3    ? ? A G   1805 A A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1836 hydrog ? ? A  G   1805 N2    ? ? ? 1_555 A  A   2882 N3    ? ? A G   1806 A A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1837 hydrog ? ? A  C   1807 N3    ? ? ? 1_555 A  G   1811 N1    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1838 hydrog ? ? A  C   1807 N4    ? ? ? 1_555 A  G   1811 O6    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1839 hydrog ? ? A  C   1807 O2    ? ? ? 1_555 A  G   1811 N2    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1840 hydrog ? ? A  C   1809 N4    ? ? ? 1_555 A  C   2751 O2    ? ? A C   1810 A C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1841 hydrog ? ? A  A   1810 N1    ? ? ? 1_555 A  G   2730 N2    ? ? A A   1811 A G   2731 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1842 hydrog ? ? A  U   1812 O2    ? ? ? 1_555 A  U   1816 N3    ? ? A U   1813 A U   1817 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1843 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  C   1817 O2    ? ? A U   1813 A C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1844 hydrog ? ? A  G   1819 N1    ? ? ? 1_555 A  C   2028 N3    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1845 hydrog ? ? A  G   1819 N2    ? ? ? 1_555 A  C   2028 O2    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1846 hydrog ? ? A  G   1819 O6    ? ? ? 1_555 A  C   2028 N4    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1847 hydrog ? ? A  A   1820 N1    ? ? ? 1_555 A  U   2027 N3    ? ? A A   1821 A U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1848 hydrog ? ? A  A   1820 N6    ? ? ? 1_555 A  U   2027 O4    ? ? A A   1821 A U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ? ? A  A   1821 N1    ? ? ? 1_555 A  U   2026 N3    ? ? A A   1822 A U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ? ? A  A   1821 N6    ? ? ? 1_555 A  U   2026 O4    ? ? A A   1822 A U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1851 hydrog ? ? A  G   1822 N1    ? ? ? 1_555 A  C   2025 N3    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1852 hydrog ? ? A  G   1822 N2    ? ? ? 1_555 A  C   2025 O2    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1853 hydrog ? ? A  G   1822 O6    ? ? ? 1_555 A  C   2025 N4    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1854 hydrog ? ? A  C   1823 N3    ? ? ? 1_555 A  G   2024 N1    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ? ? A  C   1823 N4    ? ? ? 1_555 A  G   2024 O6    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ? ? A  C   1823 O2    ? ? ? 1_555 A  G   2024 N2    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1857 hydrog ? ? A  U   1824 N3    ? ? ? 1_555 A  A   2023 N1    ? ? A U   1825 A A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1858 hydrog ? ? A  U   1824 O4    ? ? ? 1_555 A  A   2023 N6    ? ? A U   1825 A A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1859 hydrog ? ? A  C   1825 N3    ? ? ? 1_555 A  G   2022 N1    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1860 hydrog ? ? A  C   1825 N4    ? ? ? 1_555 A  G   2022 O6    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1861 hydrog ? ? A  C   1825 O2    ? ? ? 1_555 A  G   2022 N2    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ? ? A  G   1826 N1    ? ? ? 1_555 A  C   2020 N3    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ? ? A  G   1826 N2    ? ? ? 1_555 A  C   2020 O2    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1864 hydrog ? ? A  G   1826 O6    ? ? ? 1_555 A  C   2020 N4    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1865 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2019 N3    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1866 hydrog ? ? A  G   1827 N2    ? ? ? 1_555 A  C   2019 O2    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1867 hydrog ? ? A  G   1827 O6    ? ? ? 1_555 A  C   2019 N4    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1868 hydrog ? ? A  A   1828 N3    ? ? ? 1_555 A  A   2017 N6    ? ? A A   1829 A A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1869 hydrog ? ? A  C   1829 N4    ? ? ? 1_555 A  U   1845 O2    ? ? A C   1830 A U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1870 hydrog ? ? A  G   1831 N1    ? ? ? 1_555 A  C   1843 N3    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1871 hydrog ? ? A  G   1831 N2    ? ? ? 1_555 A  C   1843 O2    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1872 hydrog ? ? A  G   1831 O6    ? ? ? 1_555 A  C   1843 N4    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1873 hydrog ? ? A  U   1832 N3    ? ? ? 1_555 A  A   1842 N1    ? ? A U   1833 A A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1874 hydrog ? ? A  U   1832 O4    ? ? ? 1_555 A  A   1842 N6    ? ? A U   1833 A A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1875 hydrog ? ? A  C   1833 O2    ? ? ? 1_555 A  C   1840 N4    ? ? A C   1834 A C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1876 hydrog ? ? A  U   1834 O4    ? ? ? 1_555 A  C   1840 N4    ? ? A U   1835 A C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1877 hydrog ? ? A  U   1837 N3    ? ? ? 1_555 A  U   2620 O4    ? ? A U   1838 A U   2621 1_555 ? ? ? ? ? ? TYPE_12_PAIR ? ? 
hydrog1878 hydrog ? ? A  U   1837 O4    ? ? ? 1_555 A  U   2620 N3    ? ? A U   1838 A U   2621 1_555 ? ? ? ? ? ? TYPE_12_PAIR ? ? 
hydrog1879 hydrog ? ? A  A   1838 N3    ? ? ? 1_555 A  G   2641 N2    ? ? A A   1839 A G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1880 hydrog ? ? A  C   1840 O2    ? ? ? 1_555 A  G   2622 N2    ? ? A C   1841 A G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1881 hydrog ? ? A  A   1846 N6    ? ? ? 1_555 A  G   1883 N3    ? ? A A   1847 A G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1882 hydrog ? ? A  A   1846 N7    ? ? ? 1_555 A  G   1883 N2    ? ? A A   1847 A G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1883 hydrog ? ? A  G   1847 N1    ? ? ? 1_555 A  U   1882 O2    ? ? A G   1848 A U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1884 hydrog ? ? A  G   1847 O6    ? ? ? 1_555 A  U   1882 N3    ? ? A G   1848 A U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1885 hydrog ? ? A  G   1848 N1    ? ? ? 1_555 A  C   1881 N3    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1886 hydrog ? ? A  G   1848 N2    ? ? ? 1_555 A  C   1881 O2    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1887 hydrog ? ? A  G   1848 O6    ? ? ? 1_555 A  C   1881 N4    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1888 hydrog ? ? A  U   1849 N3    ? ? ? 1_555 A  A   1880 N1    ? ? A U   1850 A A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1889 hydrog ? ? A  U   1849 O4    ? ? ? 1_555 A  A   1880 N6    ? ? A U   1850 A A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1890 hydrog ? ? A  G   1850 N1    ? ? ? 1_555 A  C   1879 N3    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1891 hydrog ? ? A  G   1850 N2    ? ? ? 1_555 A  C   1879 O2    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1892 hydrog ? ? A  G   1850 O6    ? ? ? 1_555 A  C   1879 N4    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1893 hydrog ? ? A  A   1851 N1    ? ? ? 1_555 A  U   1878 N3    ? ? A A   1852 A U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1894 hydrog ? ? A  A   1851 N6    ? ? ? 1_555 A  U   1878 O4    ? ? A A   1852 A U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1895 hydrog ? ? A  C   1852 N3    ? ? ? 1_555 A  G   1877 N1    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1896 hydrog ? ? A  C   1852 N4    ? ? ? 1_555 A  G   1877 O6    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1897 hydrog ? ? A  C   1852 O2    ? ? ? 1_555 A  G   1877 N2    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1898 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1876 N1    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1899 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1876 O6    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1900 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1876 N2    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1901 hydrog ? ? A  G   1854 N2    ? ? ? 1_555 A  U   1873 O2    ? ? A G   1855 A U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1902 hydrog ? ? A  C   1855 N3    ? ? ? 1_555 A  G   1872 N2    ? ? A C   1856 A G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1903 hydrog ? ? A  C   1855 O2    ? ? ? 1_555 A  G   1872 N1    ? ? A C   1856 A G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1904 hydrog ? ? A  C   1855 N4    ? ? ? 1_555 A  A   1874 N7    ? ? A C   1856 A A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1905 hydrog ? ? A  A   1856 N6    ? ? ? 1_555 A  U   2245 O2    ? ? A A   1857 A U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1906 hydrog ? ? A  A   1857 N6    ? ? ? 1_555 A  U   1870 O4    ? ? A A   1858 A U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1907 hydrog ? ? A  A   1858 N6    ? ? ? 1_555 A  C   1869 O2    ? ? A A   1859 A C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1908 hydrog ? ? A  A   1858 N3    ? ? ? 1_555 A  G   1877 N2    ? ? A A   1859 A G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1909 hydrog ? ? A  U   1859 N3    ? ? ? 1_555 A  A   1868 N1    ? ? A U   1860 A A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1910 hydrog ? ? A  U   1859 O4    ? ? ? 1_555 A  A   1868 N6    ? ? A U   1860 A A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1911 hydrog ? ? A  C   1860 N3    ? ? ? 1_555 A  G   1867 N1    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1912 hydrog ? ? A  C   1860 N4    ? ? ? 1_555 A  G   1867 O6    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1913 hydrog ? ? A  C   1860 O2    ? ? ? 1_555 A  G   1867 N2    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1914 hydrog ? ? A  C   1861 N3    ? ? ? 1_555 A  G   1866 N1    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1915 hydrog ? ? A  C   1861 N4    ? ? ? 1_555 A  G   1866 O6    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1916 hydrog ? ? A  C   1861 O2    ? ? ? 1_555 A  G   1866 N2    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1917 hydrog ? ? A  G   1862 N2    ? ? ? 1_555 A  A   1865 N7    ? ? A G   1863 A A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1918 hydrog ? ? A  A   1884 N6    ? ? ? 1_555 A  U   2016 O2    ? ? A A   1885 A U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1919 hydrog ? ? A  A   1885 N6    ? ? ? 1_555 A  U   2015 O2    ? ? A A   1886 A U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1920 hydrog ? ? A  U   1886 N3    ? ? ? 1_555 A  A   2014 N1    ? ? A U   1887 A A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1921 hydrog ? ? A  U   1886 O4    ? ? ? 1_555 A  A   2014 N6    ? ? A U   1887 A A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1922 hydrog ? ? A  C   1887 N3    ? ? ? 1_555 A  G   2013 N1    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1923 hydrog ? ? A  C   1887 N4    ? ? ? 1_555 A  G   2013 O6    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1924 hydrog ? ? A  C   1887 O2    ? ? ? 1_555 A  G   2013 N2    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1925 hydrog ? ? A  C   1888 N3    ? ? ? 1_555 A  G   2012 N1    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1926 hydrog ? ? A  C   1888 N4    ? ? ? 1_555 A  G   2012 O6    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1927 hydrog ? ? A  C   1888 O2    ? ? ? 1_555 A  G   2012 N2    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1928 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   1940 N6    ? ? A U   1890 A A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1929 hydrog ? ? A  U   1889 N3    ? ? ? 1_555 A  A   2010 N7    ? ? A U   1890 A A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1930 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   2010 N6    ? ? A U   1890 A A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1931 hydrog ? ? A  G   1890 N1    ? ? ? 1_555 A  C   1945 N3    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1932 hydrog ? ? A  G   1890 N2    ? ? ? 1_555 A  C   1945 O2    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ? ? A  G   1890 O6    ? ? ? 1_555 A  C   1945 N4    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ? ? A  C   1891 N3    ? ? ? 1_555 A  G   1944 N1    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1935 hydrog ? ? A  C   1891 N4    ? ? ? 1_555 A  G   1944 O6    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1936 hydrog ? ? A  C   1891 O2    ? ? ? 1_555 A  G   1944 N2    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1937 hydrog ? ? A  C   1892 N3    ? ? ? 1_555 A  G   1943 N1    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1938 hydrog ? ? A  C   1892 N4    ? ? ? 1_555 A  G   1943 O6    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1939 hydrog ? ? A  C   1892 O2    ? ? ? 1_555 A  G   1943 N2    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1940 hydrog ? ? A  C   1893 N3    ? ? ? 1_555 A  A   1941 N6    ? ? A C   1894 A A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1941 hydrog ? ? A  C   1893 N4    ? ? ? 1_555 A  A   1941 N7    ? ? A C   1894 A A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1942 hydrog ? ? A  G   1895 N1    ? ? ? 1_555 A  C   1942 N3    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1943 hydrog ? ? A  G   1895 N2    ? ? ? 1_555 A  C   1942 O2    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ? ? A  G   1895 O6    ? ? ? 1_555 A  C   1942 N4    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1945 hydrog ? ? A  U   1896 N3    ? ? ? 1_555 A  A   1941 N1    ? ? A U   1897 A A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1946 hydrog ? ? A  U   1896 O4    ? ? ? 1_555 A  A   1941 N6    ? ? A U   1897 A A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1947 hydrog ? ? A  G   1897 N1    ? ? ? 1_555 A  U   1938 O2    ? ? A G   1898 A U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1948 hydrog ? ? A  G   1897 O6    ? ? ? 1_555 A  U   1938 N3    ? ? A G   1898 A U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1949 hydrog ? ? A  C   1898 N3    ? ? ? 1_555 A  G   1937 N1    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1950 hydrog ? ? A  C   1898 N4    ? ? ? 1_555 A  G   1937 O6    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1951 hydrog ? ? A  C   1898 O2    ? ? ? 1_555 A  G   1937 N2    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1952 hydrog ? ? A  A   1899 N1    ? ? ? 1_555 A  U   1936 N3    ? ? A A   1900 A U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ? ? A  A   1899 N6    ? ? ? 1_555 A  U   1936 O4    ? ? A A   1900 A U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ? ? A  G   1900 N1    ? ? ? 1_555 A  C   1935 N3    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1955 hydrog ? ? A  G   1900 N2    ? ? ? 1_555 A  C   1935 O2    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ? ? A  G   1900 O6    ? ? ? 1_555 A  C   1935 N4    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1957 hydrog ? ? A  G   1901 N1    ? ? ? 1_555 A  C   1934 N3    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1958 hydrog ? ? A  G   1901 N2    ? ? ? 1_555 A  C   1934 O2    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1959 hydrog ? ? A  G   1901 O6    ? ? ? 1_555 A  C   1934 N4    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1960 hydrog ? ? A  U   1902 O2    ? ? ? 1_555 A  A   1933 N6    ? ? A U   1903 A A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1961 hydrog ? ? A  U   1904 N3    ? ? ? 1_555 A  A   1933 N1    ? ? A U   1905 A A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1962 hydrog ? ? A  U   1904 O4    ? ? ? 1_555 A  A   1933 N6    ? ? A U   1905 A A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1963 hydrog ? ? A  C   1905 N3    ? ? ? 1_555 A  G   1932 N1    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1964 hydrog ? ? A  C   1905 N4    ? ? ? 1_555 A  G   1932 O6    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1965 hydrog ? ? A  C   1905 O2    ? ? ? 1_555 A  G   1932 N2    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1966 hydrog ? ? A  U   1906 N3    ? ? ? 1_555 A  G   1931 O6    ? ? A U   1907 A G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1967 hydrog ? ? A  U   1906 O2    ? ? ? 1_555 A  G   1931 N1    ? ? A U   1907 A G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1968 hydrog ? ? A  G   1907 N2    ? ? ? 1_555 A  A   1930 N7    ? ? A G   1908 A A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1969 hydrog ? ? A  G   1907 N3    ? ? ? 1_555 A  A   1930 N6    ? ? A G   1908 A A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1970 hydrog ? ? A  A   1909 N3    ? ? ? 1_555 A  G   2127 N2    ? ? A A   1910 A G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1971 hydrog ? ? A  A   1911 N6    ? ? ? 1_555 A  A   1926 N1    ? ? A A   1912 A A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1972 hydrog ? ? A  C   1912 N3    ? ? ? 1_555 A  G   1925 N1    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1973 hydrog ? ? A  C   1912 N4    ? ? ? 1_555 A  G   1925 O6    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ? ? A  C   1912 O2    ? ? ? 1_555 A  G   1925 N2    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1975 hydrog ? ? A  C   1913 N3    ? ? ? 1_555 A  G   1924 N1    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ? ? A  C   1913 N4    ? ? ? 1_555 A  G   1924 O6    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1977 hydrog ? ? A  C   1913 O2    ? ? ? 1_555 A  G   1924 N2    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1978 hydrog ? ? A  U   1914 N3    ? ? ? 1_555 A  A   1923 N1    ? ? A U   1915 A A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1979 hydrog ? ? A  U   1914 O4    ? ? ? 1_555 A  A   1923 N6    ? ? A U   1915 A A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1980 hydrog ? ? A  C   1915 N3    ? ? ? 1_555 A  G   1922 N1    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1981 hydrog ? ? A  C   1915 N4    ? ? ? 1_555 A  G   1922 O6    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1982 hydrog ? ? A  C   1915 O2    ? ? ? 1_555 A  G   1922 N2    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1983 hydrog ? ? A  G   1916 N2    ? ? ? 1_555 A  A   1921 N7    ? ? A G   1917 A A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1984 hydrog ? ? A  A   1920 N1    ? ? ? 1_555 A  G   2448 N2    ? ? A A   1921 A G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1985 hydrog ? ? A  A   1920 N6    ? ? ? 1_555 A  G   2448 N3    ? ? A A   1921 A G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1986 hydrog ? ? A  A   1930 N3    ? ? ? 1_555 A  G   2266 N2    ? ? A A   1931 A G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1987 hydrog ? ? A  C   1939 O2    ? ? ? 1_555 A  C   1942 N4    ? ? A C   1940 A C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1988 hydrog ? ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N3    ? ? A G   1945 A A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1989 hydrog ? ? A  G   1946 N1    ? ? ? 1_555 A  C   1964 N3    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1990 hydrog ? ? A  G   1946 N2    ? ? ? 1_555 A  C   1964 O2    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1991 hydrog ? ? A  G   1946 O6    ? ? ? 1_555 A  C   1964 N4    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1992 hydrog ? ? A  G   1947 N1    ? ? ? 1_555 A  U   1963 O2    ? ? A G   1948 A U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1993 hydrog ? ? A  G   1947 O6    ? ? ? 1_555 A  U   1963 N3    ? ? A G   1948 A U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1994 hydrog ? ? A  U   1965 N3    ? ? ? 1_555 A  G   1969 O6    ? ? A U   1966 A G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1995 hydrog ? ? A  U   1965 O4    ? ? ? 1_555 A  G   1969 N1    ? ? A U   1966 A G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1996 hydrog ? ? A  G   1970 N2    ? ? ? 1_555 A  U   1971 O4    ? ? A G   1971 A U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1997 hydrog ? ? A  U   1971 N3    ? ? ? 1_555 A  A   2009 N7    ? ? A U   1972 A A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1998 hydrog ? ? A  A   1972 N6    ? ? ? 1_555 A  G   2008 N3    ? ? A A   1973 A G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1999 hydrog ? ? A  A   1972 N7    ? ? ? 1_555 A  G   2008 N2    ? ? A A   1973 A G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2000 hydrog ? ? A  G   1973 N1    ? ? ? 1_555 A  U   2007 O2    ? ? A G   1974 A U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2001 hydrog ? ? A  G   1973 O6    ? ? ? 1_555 A  U   2007 N3    ? ? A G   1974 A U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2002 hydrog ? ? A  C   1974 N3    ? ? ? 1_555 A  G   2004 N1    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2003 hydrog ? ? A  C   1974 N4    ? ? ? 1_555 A  G   2004 O6    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2004 hydrog ? ? A  C   1974 O2    ? ? ? 1_555 A  G   2004 N2    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2005 hydrog ? ? A  U   1976 N3    ? ? ? 1_555 A  U   1983 O4    ? ? A U   1977 A U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2006 hydrog ? ? A  U   1976 O2    ? ? ? 1_555 A  U   1983 N3    ? ? A U   1977 A U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2007 hydrog ? ? A  A   1977 N1    ? ? ? 1_555 A  G   2004 N2    ? ? A A   1978 A G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2008 hydrog ? ? A  G   1978 N2    ? ? ? 1_555 A  U   2639 O2    ? ? A G   1979 A U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2009 hydrog ? ? A  A   1980 N3    ? ? ? 1_555 A  C   1982 N4    ? ? A A   1981 A C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2010 hydrog ? ? A  G   1985 N1    ? ? ? 1_555 A  C   2001 N3    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2011 hydrog ? ? A  G   1985 N2    ? ? ? 1_555 A  C   2001 O2    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2012 hydrog ? ? A  G   1985 O6    ? ? ? 1_555 A  C   2001 N4    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2013 hydrog ? ? A  C   1986 N3    ? ? ? 1_555 A  G   2000 N1    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2014 hydrog ? ? A  C   1986 N4    ? ? ? 1_555 A  G   2000 O6    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2015 hydrog ? ? A  C   1986 O2    ? ? ? 1_555 A  G   2000 N2    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2016 hydrog ? ? A  C   1987 N3    ? ? ? 1_555 A  G   1999 N1    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2017 hydrog ? ? A  C   1987 N4    ? ? ? 1_555 A  G   1999 O6    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2018 hydrog ? ? A  C   1987 O2    ? ? ? 1_555 A  G   1999 N2    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2019 hydrog ? ? A  G   1988 N1    ? ? ? 1_555 A  C   1998 N3    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2020 hydrog ? ? A  G   1988 N2    ? ? ? 1_555 A  C   1998 O2    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2021 hydrog ? ? A  G   1988 O6    ? ? ? 1_555 A  C   1998 N4    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2022 hydrog ? ? A  C   1989 N3    ? ? ? 1_555 A  G   1997 N1    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2023 hydrog ? ? A  C   1989 N4    ? ? ? 1_555 A  G   1997 O6    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2024 hydrog ? ? A  C   1989 O2    ? ? ? 1_555 A  G   1997 N2    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2025 hydrog ? ? A  A   1993 N3    ? ? ? 1_555 A  G   2583 N2    ? ? A A   1994 A G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2026 hydrog ? ? A  U   1995 O4    ? ? ? 1_555 A  C   2590 N4    ? ? A U   1996 A C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2027 hydrog ? ? A  A   2009 N3    ? ? ? 1_555 A  G   2012 N2    ? ? A A   2010 A G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2028 hydrog ? ? A  G   2032 N1    ? ? ? 1_555 A  C   2036 O2    ? ? A G   2033 A C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2029 hydrog ? ? A  G   2040 N2    ? ? ? 1_555 A  U   2725 O4    ? ? A G   2041 A U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2030 hydrog ? ? A  A   2053 N1    ? ? ? 1_555 A  U   2647 N3    ? ? A A   2054 A U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2031 hydrog ? ? A  A   2053 N6    ? ? ? 1_555 A  U   2647 O2    ? ? A A   2054 A U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2032 hydrog ? ? A  A   2059 N1    ? ? ? 1_555 A  U   2075 N3    ? ? A A   2060 A U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2033 hydrog ? ? A  A   2059 N6    ? ? ? 1_555 A  U   2075 O4    ? ? A A   2060 A U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2034 hydrog ? ? A  C   2060 N3    ? ? ? 1_555 A  G   2074 N1    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2035 hydrog ? ? A  C   2060 N4    ? ? ? 1_555 A  G   2074 O6    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2036 hydrog ? ? A  C   2060 O2    ? ? ? 1_555 A  G   2074 N2    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2037 hydrog ? ? A  U   2062 N3    ? ? ? 1_555 A  A   2082 N3    ? ? A U   2063 A A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2038 hydrog ? ? A  U   2063 N3    ? ? ? 1_555 A  A   2080 N1    ? ? A U   2064 A A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2039 hydrog ? ? A  U   2063 O4    ? ? ? 1_555 A  A   2080 N6    ? ? A U   2064 A A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2040 hydrog ? ? A  C   2064 N3    ? ? ? 1_555 A  G   2079 N1    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2041 hydrog ? ? A  C   2064 N4    ? ? ? 1_555 A  G   2079 O6    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2042 hydrog ? ? A  C   2064 O2    ? ? ? 1_555 A  G   2079 N2    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2043 hydrog ? ? A  C   2065 N3    ? ? ? 1_555 A  G   2078 N1    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2044 hydrog ? ? A  C   2065 N4    ? ? ? 1_555 A  G   2078 O6    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2045 hydrog ? ? A  C   2065 O2    ? ? ? 1_555 A  G   2078 N2    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2046 hydrog ? ? A  A   2066 N1    ? ? ? 1_555 A  U   2077 N3    ? ? A A   2067 A U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2047 hydrog ? ? A  A   2066 N6    ? ? ? 1_555 A  U   2077 O4    ? ? A A   2067 A U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2048 hydrog ? ? A  G   2067 N1    ? ? ? 1_555 A  C   2076 N3    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2049 hydrog ? ? A  G   2067 N2    ? ? ? 1_555 A  C   2076 O2    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2050 hydrog ? ? A  G   2067 O6    ? ? ? 1_555 A  C   2076 N4    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2051 hydrog ? ? A  U   2068 N3    ? ? ? 1_555 A  A   2073 N7    ? ? A U   2069 A A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2052 hydrog ? ? A  U   2068 O2    ? ? ? 1_555 A  A   2073 N6    ? ? A U   2069 A A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2053 hydrog ? ? A  G   2071 N2    ? ? ? 1_555 A  A   2489 N3    ? ? A G   2072 A A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2054 hydrog ? ? A  C   2083 N3    ? ? ? 1_555 A  G   2659 N1    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2055 hydrog ? ? A  C   2083 N4    ? ? ? 1_555 A  G   2659 O6    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2056 hydrog ? ? A  C   2083 O2    ? ? ? 1_555 A  G   2659 N2    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ? ? A  A   2084 N1    ? ? ? 1_555 A  U   2658 N3    ? ? A A   2085 A U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ? ? A  A   2084 N6    ? ? ? 1_555 A  U   2658 O4    ? ? A A   2085 A U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ? ? A  C   2085 N3    ? ? ? 1_555 A  G   2657 N1    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ? ? A  C   2085 N4    ? ? ? 1_555 A  G   2657 O6    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ? ? A  C   2085 O2    ? ? ? 1_555 A  G   2657 N2    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2062 hydrog ? ? A  C   2086 N3    ? ? ? 1_555 A  G   2656 N1    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2063 hydrog ? ? A  C   2086 N4    ? ? ? 1_555 A  G   2656 O6    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2064 hydrog ? ? A  C   2086 O2    ? ? ? 1_555 A  G   2656 N2    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ? ? A  C   2087 N3    ? ? ? 1_555 A  G   2655 N1    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2066 hydrog ? ? A  C   2087 N4    ? ? ? 1_555 A  G   2655 O6    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  G   2655 N2    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2068 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  A   2839 N6    ? ? A C   2088 A A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2069 hydrog ? ? A  A   2088 N1    ? ? ? 1_555 A  U   2654 N3    ? ? A A   2089 A U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2070 hydrog ? ? A  A   2088 N6    ? ? ? 1_555 A  U   2654 O4    ? ? A A   2089 A U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2071 hydrog ? ? A  G   2089 N1    ? ? ? 1_555 A  C   2653 N3    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2072 hydrog ? ? A  G   2089 N2    ? ? ? 1_555 A  C   2653 O2    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2073 hydrog ? ? A  G   2089 O6    ? ? ? 1_555 A  C   2653 N4    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2074 hydrog ? ? A  G   2090 N1    ? ? ? 1_555 A  A   2652 N1    ? ? A G   2091 A A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2075 hydrog ? ? A  G   2090 O6    ? ? ? 1_555 A  A   2652 N6    ? ? A G   2091 A A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2076 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  G   2092 O6    ? ? A G   2092 A G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2077 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  U   2651 O4    ? ? A G   2092 A U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2078 hydrog ? ? A  G   2092 N1    ? ? ? 1_555 A  U   2651 O2    ? ? A G   2093 A U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2079 hydrog ? ? A  G   2092 O6    ? ? ? 1_555 A  U   2651 N3    ? ? A G   2093 A U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2080 hydrog ? ? A  G   2093 N1    ? ? ? 1_555 A  C   2650 N3    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2081 hydrog ? ? A  G   2093 N2    ? ? ? 1_555 A  C   2650 O2    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2082 hydrog ? ? A  G   2093 O6    ? ? ? 1_555 A  C   2650 N4    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2083 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  A   2611 N1    ? ? A A   2095 A A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2084 hydrog ? ? A  A   2094 N7    ? ? ? 1_555 A  A   2611 N6    ? ? A A   2095 A A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2085 hydrog ? ? A  A   2094 N1    ? ? ? 1_555 A  U   2649 N3    ? ? A A   2095 A U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2086 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  U   2649 O4    ? ? A A   2095 A U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2087 hydrog ? ? A  G   2096 N1    ? ? ? 1_555 A  C   2646 N3    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2088 hydrog ? ? A  G   2096 N2    ? ? ? 1_555 A  C   2646 O2    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2089 hydrog ? ? A  G   2096 O6    ? ? ? 1_555 A  C   2646 N4    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2090 hydrog ? ? A  C   2097 N3    ? ? ? 1_555 A  G   2645 N1    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2091 hydrog ? ? A  C   2097 N4    ? ? ? 1_555 A  G   2645 O6    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2092 hydrog ? ? A  C   2097 O2    ? ? ? 1_555 A  G   2645 N2    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2093 hydrog ? ? A  G   2101 N1    ? ? ? 1_555 A  A   2485 N1    ? ? A G   2102 A A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2094 hydrog ? ? A  G   2101 O6    ? ? ? 1_555 A  A   2485 N6    ? ? A G   2102 A A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2095 hydrog ? ? A  A   2102 N6    ? ? ? 1_555 A  A   2537 N7    ? ? A A   2103 A A   2538 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2096 hydrog ? ? A  A   2102 N7    ? ? ? 1_555 A  A   2537 N6    ? ? A A   2103 A A   2538 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2097 hydrog ? ? A  C   2103 N3    ? ? ? 1_555 A  A   2484 N6    ? ? A C   2104 A A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2098 hydrog ? ? A  C   2103 N4    ? ? ? 1_555 A  C   2535 O2    ? ? A C   2104 A C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2099 hydrog ? ? A  C   2104 N3    ? ? ? 1_555 A  G   2480 N1    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2100 hydrog ? ? A  C   2104 N4    ? ? ? 1_555 A  G   2480 O6    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2101 hydrog ? ? A  C   2104 O2    ? ? ? 1_555 A  G   2480 N2    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2102 hydrog ? ? A  C   2105 N3    ? ? ? 1_555 A  G   2479 N1    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ? ? A  C   2105 N4    ? ? ? 1_555 A  G   2479 O6    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2104 hydrog ? ? A  C   2105 O2    ? ? ? 1_555 A  G   2479 N2    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2105 hydrog ? ? A  U   2106 N3    ? ? ? 1_555 A  A   2478 N1    ? ? A U   2107 A A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2106 hydrog ? ? A  U   2106 O4    ? ? ? 1_555 A  A   2478 N6    ? ? A U   2107 A A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2107 hydrog ? ? A  A   2107 N1    ? ? ? 1_555 A  U   2477 N3    ? ? A A   2108 A U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ? ? A  A   2107 N6    ? ? ? 1_555 A  U   2477 O4    ? ? A A   2108 A U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ? ? A  U   2108 N3    ? ? ? 1_555 A  A   2466 N1    ? ? A U   2109 A A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2110 hydrog ? ? A  U   2108 O2    ? ? ? 1_555 A  A   2466 N6    ? ? A U   2109 A A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2111 hydrog ? ? A  G   2109 N1    ? ? ? 1_555 A  C   2476 N3    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2112 hydrog ? ? A  G   2109 N2    ? ? ? 1_555 A  C   2476 O2    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2113 hydrog ? ? A  G   2109 O6    ? ? ? 1_555 A  C   2476 N4    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2114 hydrog ? ? A  G   2110 N1    ? ? ? 1_555 A  C   2475 N3    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ? ? A  G   2110 N2    ? ? ? 1_555 A  C   2475 O2    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ? ? A  G   2110 O6    ? ? ? 1_555 A  C   2475 N4    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2117 hydrog ? ? A  A   2111 N1    ? ? ? 1_555 A  U   2472 N3    ? ? A A   2112 A U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2118 hydrog ? ? A  A   2111 N6    ? ? ? 1_555 A  U   2472 O4    ? ? A A   2112 A U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2119 hydrog ? ? A  G   2112 N1    ? ? ? 1_555 A  C   2471 N3    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ? ? A  G   2112 N2    ? ? ? 1_555 A  C   2471 O2    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ? ? A  G   2112 O6    ? ? ? 1_555 A  C   2471 N4    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ? ? A  G   2112 N3    ? ? ? 1_555 A  C   2474 N4    ? ? A G   2113 A C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2123 hydrog ? ? A  C   2113 N3    ? ? ? 1_555 A  G   2470 N1    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2124 hydrog ? ? A  C   2113 N4    ? ? ? 1_555 A  G   2470 O6    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2125 hydrog ? ? A  C   2113 O2    ? ? ? 1_555 A  G   2470 N2    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2126 hydrog ? ? A  U   2114 N3    ? ? ? 1_555 A  A   2469 N1    ? ? A U   2115 A A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2127 hydrog ? ? A  U   2114 O4    ? ? ? 1_555 A  A   2469 N6    ? ? A U   2115 A A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2128 hydrog ? ? A  U   2114 O2    ? ? ? 1_555 A  G   2631 N2    ? ? A U   2115 A G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2129 hydrog ? ? A  U   2115 N3    ? ? ? 1_555 A  A   2117 N7    ? ? A U   2116 A A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2130 hydrog ? ? A  U   2115 O4    ? ? ? 1_555 A  A   2117 N6    ? ? A U   2116 A A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2131 hydrog ? ? A  A   2117 N1    ? ? ? 1_555 A  U   2275 N3    ? ? A A   2118 A U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2132 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  U   2275 O4    ? ? A A   2118 A U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2133 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2270 O6    ? ? A C   2119 A G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2134 hydrog ? ? A  C   2118 N3    ? ? ? 1_555 A  G   2274 N1    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2274 O6    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2136 hydrog ? ? A  C   2118 O2    ? ? ? 1_555 A  G   2274 N2    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2137 hydrog ? ? A  U   2119 N3    ? ? ? 1_555 A  A   2273 N1    ? ? A U   2120 A A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2138 hydrog ? ? A  U   2119 O4    ? ? ? 1_555 A  A   2273 N6    ? ? A U   2120 A A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2139 hydrog ? ? A  G   2120 N1    ? ? ? 1_555 A  C   2272 N3    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2140 hydrog ? ? A  G   2120 N2    ? ? ? 1_555 A  C   2272 O2    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2141 hydrog ? ? A  G   2120 O6    ? ? ? 1_555 A  C   2272 N4    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2142 hydrog ? ? A  C   2121 N3    ? ? ? 1_555 A  G   2271 N1    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2143 hydrog ? ? A  C   2121 N4    ? ? ? 1_555 A  G   2271 O6    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2144 hydrog ? ? A  C   2121 O2    ? ? ? 1_555 A  G   2271 N2    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2145 hydrog ? ? A  A   2122 N6    ? ? ? 1_555 A  G   2269 N3    ? ? A A   2123 A G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2146 hydrog ? ? A  A   2122 N7    ? ? ? 1_555 A  G   2269 N2    ? ? A A   2123 A G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2147 hydrog ? ? A  G   2123 N1    ? ? ? 1_555 A  C   2268 N3    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2148 hydrog ? ? A  G   2123 N2    ? ? ? 1_555 A  C   2268 O2    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2149 hydrog ? ? A  G   2123 O6    ? ? ? 1_555 A  C   2268 N4    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2150 hydrog ? ? A  G   2124 N1    ? ? ? 1_555 A  C   2267 N3    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ? ? A  G   2124 N2    ? ? ? 1_555 A  C   2267 O2    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ? ? A  G   2124 O6    ? ? ? 1_555 A  C   2267 N4    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2153 hydrog ? ? A  C   2125 N3    ? ? ? 1_555 A  G   2266 N1    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2154 hydrog ? ? A  C   2125 N4    ? ? ? 1_555 A  G   2266 O6    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2155 hydrog ? ? A  C   2125 O2    ? ? ? 1_555 A  G   2266 N2    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2156 hydrog ? ? A  U   2126 N3    ? ? ? 1_555 A  A   2265 N1    ? ? A U   2127 A A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2157 hydrog ? ? A  U   2126 O4    ? ? ? 1_555 A  A   2265 N6    ? ? A U   2127 A A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ? ? A  G   2127 N1    ? ? ? 1_555 A  U   2264 O2    ? ? A G   2128 A U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2159 hydrog ? ? A  G   2127 O6    ? ? ? 1_555 A  U   2264 N3    ? ? A G   2128 A U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2160 hydrog ? ? A  U   2128 N3    ? ? ? 1_555 A  A   2263 N1    ? ? A U   2129 A A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2161 hydrog ? ? A  U   2128 O4    ? ? ? 1_555 A  A   2263 N6    ? ? A U   2129 A A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2162 hydrog ? ? A  C   2129 N3    ? ? ? 1_555 A  G   2262 N1    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2163 hydrog ? ? A  C   2129 N4    ? ? ? 1_555 A  G   2262 O6    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2164 hydrog ? ? A  C   2129 O2    ? ? ? 1_555 A  G   2262 N2    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2165 hydrog ? ? A  G   2130 N1    ? ? ? 1_555 A  C   2261 N3    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2166 hydrog ? ? A  G   2130 N2    ? ? ? 1_555 A  C   2261 O2    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2167 hydrog ? ? A  G   2130 O6    ? ? ? 1_555 A  C   2261 N4    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2168 hydrog ? ? A  C   2131 O2    ? ? ? 1_555 A  C   2260 N4    ? ? A C   2132 A C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2169 hydrog ? ? A  U   2132 O4    ? ? ? 1_555 A  A   2259 N6    ? ? A U   2133 A A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2170 hydrog ? ? A  G   2133 N1    ? ? ? 1_555 A  C   2240 N3    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2171 hydrog ? ? A  G   2133 N2    ? ? ? 1_555 A  C   2240 O2    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2172 hydrog ? ? A  G   2133 O6    ? ? ? 1_555 A  C   2240 N4    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2173 hydrog ? ? A  A   2134 N1    ? ? ? 1_555 A  U   2239 N3    ? ? A A   2135 A U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2174 hydrog ? ? A  A   2134 N6    ? ? ? 1_555 A  U   2239 O4    ? ? A A   2135 A U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2175 hydrog ? ? A  G   2135 N1    ? ? ? 1_555 A  C   2238 N3    ? ? A G   2136 A C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2176 hydrog ? ? A  G   2135 N2    ? ? ? 1_555 A  C   2238 O2    ? ? A G   2136 A C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2177 hydrog ? ? A  G   2135 O6    ? ? ? 1_555 A  C   2238 N4    ? ? A G   2136 A C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2178 hydrog ? ? A  U   2241 N3    ? ? ? 1_555 A  A   2257 N7    ? ? A U   2242 A A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2179 hydrog ? ? A  U   2241 O2    ? ? ? 1_555 A  A   2257 N6    ? ? A U   2242 A A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2180 hydrog ? ? A  A   2243 N6    ? ? ? 1_555 A  G   2256 N3    ? ? A A   2244 A G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2181 hydrog ? ? A  A   2243 N7    ? ? ? 1_555 A  G   2256 N2    ? ? A A   2244 A G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2182 hydrog ? ? A  C   2244 N3    ? ? ? 1_555 A  G   2255 N1    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2183 hydrog ? ? A  C   2244 N4    ? ? ? 1_555 A  G   2255 O6    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2184 hydrog ? ? A  C   2244 O2    ? ? ? 1_555 A  G   2255 N2    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2185 hydrog ? ? A  U   2245 N3    ? ? ? 1_555 A  A   2254 N1    ? ? A U   2246 A A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2186 hydrog ? ? A  U   2245 O4    ? ? ? 1_555 A  A   2254 N6    ? ? A U   2246 A A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2187 hydrog ? ? A  C   2246 N3    ? ? ? 1_555 A  G   2253 N1    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2188 hydrog ? ? A  C   2246 N4    ? ? ? 1_555 A  G   2253 O6    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2189 hydrog ? ? A  C   2246 O2    ? ? ? 1_555 A  G   2253 N2    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2190 hydrog ? ? A  C   2247 N3    ? ? ? 1_555 A  G   2252 N1    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2191 hydrog ? ? A  C   2247 N4    ? ? ? 1_555 A  G   2252 O6    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2192 hydrog ? ? A  C   2247 O2    ? ? ? 1_555 A  G   2252 N2    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2193 hydrog ? ? A  G   2248 N2    ? ? ? 1_555 A  A   2251 N7    ? ? A G   2249 A A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2194 hydrog ? ? A  G   2270 N7    ? ? ? 1_555 A  A   2273 N6    ? ? A G   2271 A A   2274 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2195 hydrog ? ? A  U   2276 N3    ? ? ? 1_555 A  A   2469 N7    ? ? A U   2277 A A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2196 hydrog ? ? A  U   2276 O4    ? ? ? 1_555 A  A   2469 N6    ? ? A U   2277 A A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2197 hydrog ? ? A  U   2277 N3    ? ? ? 1_555 A  G   2470 N7    ? ? A U   2278 A G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2198 hydrog ? ? A  G   2278 N1    ? ? ? 1_555 A  C   2291 N3    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2199 hydrog ? ? A  G   2278 N2    ? ? ? 1_555 A  C   2291 O2    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ? ? A  G   2278 O6    ? ? ? 1_555 A  C   2291 N4    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2201 hydrog ? ? A  A   2279 N1    ? ? ? 1_555 A  U   2289 N3    ? ? A A   2280 A U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2202 hydrog ? ? A  A   2279 N6    ? ? ? 1_555 A  U   2289 O4    ? ? A A   2280 A U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2203 hydrog ? ? A  C   2280 N3    ? ? ? 1_555 A  G   2288 N1    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2204 hydrog ? ? A  C   2280 N4    ? ? ? 1_555 A  G   2288 O6    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2205 hydrog ? ? A  C   2280 O2    ? ? ? 1_555 A  G   2288 N2    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2206 hydrog ? ? A  G   2287 N1    ? ? ? 1_555 A  C   2308 N3    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2207 hydrog ? ? A  G   2287 N2    ? ? ? 1_555 A  C   2308 O2    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2208 hydrog ? ? A  G   2287 O6    ? ? ? 1_555 A  C   2308 N4    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2209 hydrog ? ? A  G   2288 N2    ? ? ? 1_555 A  A   2290 N1    ? ? A G   2289 A A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2210 hydrog ? ? A  G   2292 N1    ? ? ? 1_555 A  C   2314 N3    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2211 hydrog ? ? A  G   2292 N2    ? ? ? 1_555 A  C   2314 O2    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ? ? A  G   2292 O6    ? ? ? 1_555 A  C   2314 N4    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ? ? A  C   2293 N3    ? ? ? 1_555 A  G   2313 N1    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2214 hydrog ? ? A  C   2293 N4    ? ? ? 1_555 A  G   2313 O6    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ? ? A  C   2293 O2    ? ? ? 1_555 A  G   2313 N2    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2216 hydrog ? ? A  G   2294 N1    ? ? ? 1_555 A  C   2312 N3    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2217 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  C   2312 O2    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ? ? A  G   2294 O6    ? ? ? 1_555 A  C   2312 N4    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2219 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  A   2360 N3    ? ? A G   2295 A A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2220 hydrog ? ? A  C   2295 N3    ? ? ? 1_555 A  G   2311 N1    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2221 hydrog ? ? A  C   2295 N4    ? ? ? 1_555 A  G   2311 O6    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2222 hydrog ? ? A  C   2295 O2    ? ? ? 1_555 A  G   2311 N2    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ? ? A  U   2296 N3    ? ? ? 1_555 A  A   2310 N1    ? ? A U   2297 A A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2224 hydrog ? ? A  U   2296 O4    ? ? ? 1_555 A  A   2310 N6    ? ? A U   2297 A A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2225 hydrog ? ? A  C   2297 N3    ? ? ? 1_555 A  G   2309 N1    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2226 hydrog ? ? A  C   2297 N4    ? ? ? 1_555 A  G   2309 O6    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2227 hydrog ? ? A  C   2297 O2    ? ? ? 1_555 A  G   2309 N2    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2228 hydrog ? ? A  G   2298 N2    ? ? ? 1_555 A  U   2307 O4    ? ? A G   2299 A U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2229 hydrog ? ? A  A   2299 N6    ? ? ? 1_555 A  A   2306 N7    ? ? A A   2300 A A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2230 hydrog ? ? A  A   2299 N7    ? ? ? 1_555 A  A   2306 N6    ? ? A A   2300 A A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2231 hydrog ? ? A  A   2300 N1    ? ? ? 1_555 A  U   2305 N3    ? ? A A   2301 A U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2232 hydrog ? ? A  A   2300 N6    ? ? ? 1_555 A  U   2305 O2    ? ? A A   2301 A U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2233 hydrog ? ? A  G   2313 N2    ? ? ? 1_555 A  A   2424 N3    ? ? A G   2314 A A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2234 hydrog ? ? A  G   2315 N1    ? ? ? 1_555 A  C   2463 N3    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2235 hydrog ? ? A  G   2315 N2    ? ? ? 1_555 A  C   2463 O2    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2236 hydrog ? ? A  G   2315 O6    ? ? ? 1_555 A  C   2463 N4    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2237 hydrog ? ? A  C   2316 N3    ? ? ? 1_555 A  G   2358 N1    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2238 hydrog ? ? A  C   2316 N4    ? ? ? 1_555 A  G   2358 O6    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2239 hydrog ? ? A  C   2316 O2    ? ? ? 1_555 A  G   2358 N2    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2240 hydrog ? ? A  C   2317 N3    ? ? ? 1_555 A  G   2420 N1    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2241 hydrog ? ? A  C   2317 N4    ? ? ? 1_555 A  G   2420 O6    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2242 hydrog ? ? A  C   2317 O2    ? ? ? 1_555 A  G   2420 N2    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2243 hydrog ? ? A  C   2318 N3    ? ? ? 1_555 A  G   2419 N1    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2244 hydrog ? ? A  C   2318 N4    ? ? ? 1_555 A  G   2419 O6    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2245 hydrog ? ? A  C   2318 O2    ? ? ? 1_555 A  G   2419 N2    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2246 hydrog ? ? A  A   2320 N1    ? ? ? 1_555 A  U   2377 N3    ? ? A A   2321 A U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2247 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  U   2377 O2    ? ? A A   2321 A U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2248 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  A   2379 N7    ? ? A A   2321 A A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2249 hydrog ? ? A  A   2320 N7    ? ? ? 1_555 A  A   2379 N6    ? ? A A   2321 A A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2250 hydrog ? ? A  U   2321 O2    ? ? ? 1_555 A  G   2420 N2    ? ? A U   2322 A G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2251 hydrog ? ? A  G   2322 N1    ? ? ? 1_555 A  U   2376 O2    ? ? A G   2323 A U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2252 hydrog ? ? A  G   2322 O6    ? ? ? 1_555 A  U   2376 N3    ? ? A G   2323 A U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2253 hydrog ? ? A  G   2323 N1    ? ? ? 1_555 A  C   2375 N3    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2254 hydrog ? ? A  G   2323 N2    ? ? ? 1_555 A  C   2375 O2    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2255 hydrog ? ? A  G   2323 O6    ? ? ? 1_555 A  C   2375 N4    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2256 hydrog ? ? A  C   2324 N3    ? ? ? 1_555 A  G   2374 N1    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2257 hydrog ? ? A  C   2324 N4    ? ? ? 1_555 A  G   2374 O6    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2258 hydrog ? ? A  C   2324 O2    ? ? ? 1_555 A  G   2374 N2    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2259 hydrog ? ? A  U   2325 N3    ? ? ? 1_555 A  A   2373 N1    ? ? A U   2326 A A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2260 hydrog ? ? A  U   2325 O4    ? ? ? 1_555 A  A   2373 N6    ? ? A U   2326 A A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2261 hydrog ? ? A  A   2326 N1    ? ? ? 1_555 A  U   2372 N3    ? ? A A   2327 A U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2262 hydrog ? ? A  A   2326 N6    ? ? ? 1_555 A  U   2372 O4    ? ? A A   2327 A U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2263 hydrog ? ? A  U   2327 N3    ? ? ? 1_555 A  A   2371 N1    ? ? A U   2328 A A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2264 hydrog ? ? A  U   2327 O4    ? ? ? 1_555 A  A   2371 N6    ? ? A U   2328 A A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2265 hydrog ? ? A  C   2328 N3    ? ? ? 1_555 A  G   2370 N1    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2266 hydrog ? ? A  C   2328 N4    ? ? ? 1_555 A  G   2370 O6    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2267 hydrog ? ? A  C   2328 O2    ? ? ? 1_555 A  G   2370 N2    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2268 hydrog ? ? A  U   2329 N3    ? ? ? 1_555 A  A   2368 N7    ? ? A U   2330 A A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2269 hydrog ? ? A  U   2329 O2    ? ? ? 1_555 A  A   2368 N6    ? ? A U   2330 A A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2270 hydrog ? ? A  C   2330 N3    ? ? ? 1_555 A  G   2354 N1    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2271 hydrog ? ? A  C   2330 N4    ? ? ? 1_555 A  G   2354 O6    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2272 hydrog ? ? A  C   2330 O2    ? ? ? 1_555 A  G   2354 N2    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2273 hydrog ? ? A  A   2331 N6    ? ? ? 1_555 A  G   2351 N3    ? ? A A   2332 A G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2274 hydrog ? ? A  A   2331 N7    ? ? ? 1_555 A  G   2351 N2    ? ? A A   2332 A G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2275 hydrog ? ? A  G   2332 N1    ? ? ? 1_555 A  C   2350 N3    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2276 hydrog ? ? A  G   2332 N2    ? ? ? 1_555 A  C   2350 O2    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ? ? A  G   2332 O6    ? ? ? 1_555 A  C   2350 N4    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ? ? A  C   2333 N3    ? ? ? 1_555 A  G   2349 N1    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2279 hydrog ? ? A  C   2333 N4    ? ? ? 1_555 A  G   2349 O6    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2280 hydrog ? ? A  C   2333 O2    ? ? ? 1_555 A  G   2349 N2    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2281 hydrog ? ? A  C   2334 N3    ? ? ? 1_555 A  G   2348 N1    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2282 hydrog ? ? A  C   2334 N4    ? ? ? 1_555 A  G   2348 O6    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ? ? A  C   2334 O2    ? ? ? 1_555 A  G   2348 N2    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ? ? A  G   2335 N1    ? ? ? 1_555 A  C   2347 N3    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ? ? A  G   2335 N2    ? ? ? 1_555 A  C   2347 O2    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2286 hydrog ? ? A  G   2335 O6    ? ? ? 1_555 A  C   2347 N4    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2287 hydrog ? ? A  G   2336 N1    ? ? ? 1_555 A  C   2346 N3    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2288 hydrog ? ? A  G   2336 N2    ? ? ? 1_555 A  C   2346 O2    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ? ? A  G   2336 O6    ? ? ? 1_555 A  C   2346 N4    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ? ? A  G   2337 N1    ? ? ? 1_555 A  C   2345 N3    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2291 hydrog ? ? A  G   2337 N2    ? ? ? 1_555 A  C   2345 O2    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2292 hydrog ? ? A  G   2337 O6    ? ? ? 1_555 A  C   2345 N4    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2293 hydrog ? ? A  A   2355 N1    ? ? ? 1_555 A  A   2368 N6    ? ? A A   2356 A A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2294 hydrog ? ? A  A   2355 N6    ? ? ? 1_555 A  A   2368 N1    ? ? A A   2356 A A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2295 hydrog ? ? A  G   2356 N1    ? ? ? 1_555 A  C   2365 N3    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2296 hydrog ? ? A  G   2356 N2    ? ? ? 1_555 A  C   2365 O2    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2297 hydrog ? ? A  G   2356 O6    ? ? ? 1_555 A  C   2365 N4    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2298 hydrog ? ? A  U   2357 N3    ? ? ? 1_555 A  G   2364 O6    ? ? A U   2358 A G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2299 hydrog ? ? A  U   2357 O2    ? ? ? 1_555 A  G   2364 N1    ? ? A U   2358 A G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2300 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  A   2424 N6    ? ? A C   2360 A A   2425 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2301 hydrog ? ? A  C   2359 N3    ? ? ? 1_555 A  G   2425 N1    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2302 hydrog ? ? A  C   2359 N4    ? ? ? 1_555 A  G   2425 O6    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  G   2425 N2    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2304 hydrog ? ? A  A   2361 N1    ? ? ? 1_555 A  U   2423 N3    ? ? A A   2362 A U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2305 hydrog ? ? A  A   2361 N6    ? ? ? 1_555 A  U   2423 O4    ? ? A A   2362 A U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2306 hydrog ? ? A  G   2362 N1    ? ? ? 1_555 A  C   2422 N3    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2307 hydrog ? ? A  G   2362 N2    ? ? ? 1_555 A  C   2422 O2    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2308 hydrog ? ? A  G   2362 O6    ? ? ? 1_555 A  C   2422 N4    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2309 hydrog ? ? A  A   2363 N1    ? ? ? 1_555 A  U   2421 N3    ? ? A A   2364 A U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2310 hydrog ? ? A  A   2363 N6    ? ? ? 1_555 A  U   2421 O4    ? ? A A   2364 A U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2311 hydrog ? ? A  G   2364 N2    ? ? ? 1_555 A  A   2369 N3    ? ? A G   2365 A A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2312 hydrog ? ? A  G   2378 O6    ? ? ? 1_555 A  A   2407 N6    ? ? A G   2379 A A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2313 hydrog ? ? A  C   2380 N3    ? ? ? 1_555 A  G   2406 N1    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2314 hydrog ? ? A  C   2380 N4    ? ? ? 1_555 A  G   2406 O6    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2315 hydrog ? ? A  C   2380 O2    ? ? ? 1_555 A  G   2406 N2    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2316 hydrog ? ? A  A   2381 N1    ? ? ? 1_555 A  U   2405 N3    ? ? A A   2382 A U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2317 hydrog ? ? A  A   2381 N6    ? ? ? 1_555 A  U   2405 O4    ? ? A A   2382 A U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2318 hydrog ? ? A  G   2382 N1    ? ? ? 1_555 A  C   2404 N3    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2319 hydrog ? ? A  G   2382 N2    ? ? ? 1_555 A  C   2404 O2    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2320 hydrog ? ? A  G   2382 O6    ? ? ? 1_555 A  C   2404 N4    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2321 hydrog ? ? A  U   2383 N3    ? ? ? 1_555 A  G   2403 O6    ? ? A U   2384 A G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2322 hydrog ? ? A  U   2383 O2    ? ? ? 1_555 A  G   2403 N1    ? ? A U   2384 A G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2323 hydrog ? ? A  G   2384 N1    ? ? ? 1_555 A  C   2402 N3    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2324 hydrog ? ? A  G   2384 N2    ? ? ? 1_555 A  C   2402 O2    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ? ? A  G   2384 O6    ? ? ? 1_555 A  C   2402 N4    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2326 hydrog ? ? A  U   2385 N3    ? ? ? 1_555 A  A   2401 N1    ? ? A U   2386 A A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2327 hydrog ? ? A  U   2385 O4    ? ? ? 1_555 A  A   2401 N6    ? ? A U   2386 A A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2328 hydrog ? ? A  U   2386 N3    ? ? ? 1_555 A  A   2400 N1    ? ? A U   2387 A A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2329 hydrog ? ? A  U   2386 O4    ? ? ? 1_555 A  A   2400 N6    ? ? A U   2387 A A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2330 hydrog ? ? A  C   2387 N3    ? ? ? 1_555 A  G   2399 N1    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2331 hydrog ? ? A  C   2387 N4    ? ? ? 1_555 A  G   2399 O6    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2332 hydrog ? ? A  C   2387 O2    ? ? ? 1_555 A  G   2399 N2    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2333 hydrog ? ? A  U   2388 N3    ? ? ? 1_555 A  G   2398 O6    ? ? A U   2389 A G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2334 hydrog ? ? A  U   2388 O2    ? ? ? 1_555 A  G   2398 N1    ? ? A U   2389 A G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2335 hydrog ? ? A  U   2389 O2    ? ? ? 1_555 A  A   2397 N6    ? ? A U   2390 A A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2336 hydrog ? ? A  C   2390 N4    ? ? ? 1_555 A  G   2396 N7    ? ? A C   2391 A G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2337 hydrog ? ? A  C   2408 N3    ? ? ? 1_555 A  G   2417 N1    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2338 hydrog ? ? A  C   2408 N4    ? ? ? 1_555 A  G   2417 O6    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2339 hydrog ? ? A  C   2408 O2    ? ? ? 1_555 A  G   2417 N2    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2340 hydrog ? ? A  G   2409 N1    ? ? ? 1_555 A  C   2416 N3    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2341 hydrog ? ? A  G   2409 N2    ? ? ? 1_555 A  C   2416 O2    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2342 hydrog ? ? A  G   2409 O6    ? ? ? 1_555 A  C   2416 N4    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2343 hydrog ? ? A  C   2410 N3    ? ? ? 1_555 A  G   2415 N1    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2344 hydrog ? ? A  C   2410 N4    ? ? ? 1_555 A  G   2415 O6    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2345 hydrog ? ? A  C   2410 O2    ? ? ? 1_555 A  G   2415 N2    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2346 hydrog ? ? A  G   2411 N2    ? ? ? 1_555 A  A   2414 N7    ? ? A G   2412 A A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2347 hydrog ? ? A  C   2426 N4    ? ? ? 1_555 A  G   2461 O6    ? ? A C   2427 A G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2348 hydrog ? ? A  G   2427 N2    ? ? ? 1_555 A  G   2465 N3    ? ? A G   2428 A G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2349 hydrog ? ? A  G   2427 N3    ? ? ? 1_555 A  G   2465 N2    ? ? A G   2428 A G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2350 hydrog ? ? A  A   2428 N6    ? ? ? 1_555 A  U   2460 O2    ? ? A A   2429 A U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2351 hydrog ? ? A  A   2428 N7    ? ? ? 1_555 A  U   2460 N3    ? ? A A   2429 A U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2352 hydrog ? ? A  A   2429 N6    ? ? ? 1_555 A  A   2459 N1    ? ? A A   2430 A A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2353 hydrog ? ? A  C   2431 N3    ? ? ? 1_555 A  G   2458 N1    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2354 hydrog ? ? A  C   2431 N4    ? ? ? 1_555 A  G   2458 O6    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2355 hydrog ? ? A  C   2431 O2    ? ? ? 1_555 A  G   2458 N2    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2356 hydrog ? ? A  A   2432 N1    ? ? ? 1_555 A  U   2457 N3    ? ? A A   2433 A U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2357 hydrog ? ? A  A   2432 N6    ? ? ? 1_555 A  U   2457 O4    ? ? A A   2433 A U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2358 hydrog ? ? A  A   2433 N1    ? ? ? 1_555 A  U   2456 N3    ? ? A A   2434 A U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2359 hydrog ? ? A  A   2433 N6    ? ? ? 1_555 A  U   2456 O4    ? ? A A   2434 A U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2360 hydrog ? ? A  U   2434 N3    ? ? ? 1_555 A  A   2455 N1    ? ? A U   2435 A A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2361 hydrog ? ? A  U   2434 O4    ? ? ? 1_555 A  A   2455 N6    ? ? A U   2435 A A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2362 hydrog ? ? A  U   2435 N3    ? ? ? 1_555 A  A   2454 N1    ? ? A U   2436 A A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2363 hydrog ? ? A  U   2435 O4    ? ? ? 1_555 A  A   2454 N6    ? ? A U   2436 A A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2364 hydrog ? ? A  G   2437 N1    ? ? ? 1_555 A  C   2453 N3    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ? ? A  G   2437 N2    ? ? ? 1_555 A  C   2453 O2    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2366 hydrog ? ? A  G   2437 O6    ? ? ? 1_555 A  C   2453 N4    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2367 hydrog ? ? A  C   2438 N3    ? ? ? 1_555 A  G   2452 N1    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ? ? A  C   2438 N4    ? ? ? 1_555 A  G   2452 O6    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ? ? A  C   2438 O2    ? ? ? 1_555 A  G   2452 N2    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2370 hydrog ? ? A  C   2439 N3    ? ? ? 1_555 A  G   2451 N1    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2371 hydrog ? ? A  C   2439 N4    ? ? ? 1_555 A  G   2451 O6    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2372 hydrog ? ? A  C   2439 O2    ? ? ? 1_555 A  G   2451 N2    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2373 hydrog ? ? A  U   2440 N3    ? ? ? 1_555 A  G   2450 O6    ? ? A U   2441 A G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2374 hydrog ? ? A  U   2440 O2    ? ? ? 1_555 A  G   2450 N1    ? ? A U   2441 A G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2375 hydrog ? ? A  G   2441 N1    ? ? ? 1_555 A  C   2449 N3    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2376 hydrog ? ? A  G   2441 N2    ? ? ? 1_555 A  C   2449 O2    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2377 hydrog ? ? A  G   2441 O6    ? ? ? 1_555 A  C   2449 N4    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2378 hydrog ? ? A  G   2470 N2    ? ? ? 1_555 A  A   2632 N3    ? ? A G   2471 A A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2379 hydrog ? ? A  U   2472 O2    ? ? ? 1_555 A  C   2474 N4    ? ? A U   2473 A C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2380 hydrog ? ? A  G   2481 O6    ? ? ? 1_555 A  A   2485 N6    ? ? A G   2482 A A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2381 hydrog ? ? A  A   2484 N6    ? ? ? 1_555 A  C   2535 N3    ? ? A A   2485 A C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2382 hydrog ? ? A  A   2484 N7    ? ? ? 1_555 A  C   2535 N4    ? ? A A   2485 A C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2383 hydrog ? ? A  A   2487 N6    ? ? ? 1_555 A  C   2533 N3    ? ? A A   2488 A C   2534 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2384 hydrog ? ? A  G   2488 N1    ? ? ? 1_555 A  C   2532 N3    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2385 hydrog ? ? A  G   2488 N2    ? ? ? 1_555 A  C   2532 O2    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2386 hydrog ? ? A  G   2488 O6    ? ? ? 1_555 A  C   2532 N4    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2387 hydrog ? ? A  A   2489 N1    ? ? ? 1_555 A  U   2530 N3    ? ? A A   2490 A U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2388 hydrog ? ? A  A   2489 N6    ? ? ? 1_555 A  U   2530 O4    ? ? A A   2490 A U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2389 hydrog ? ? A  G   2490 N1    ? ? ? 1_555 A  C   2529 N3    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2390 hydrog ? ? A  G   2490 N2    ? ? ? 1_555 A  C   2529 O2    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2391 hydrog ? ? A  G   2490 O6    ? ? ? 1_555 A  C   2529 N4    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2392 hydrog ? ? A  U   2491 N3    ? ? ? 1_555 A  G   2528 O6    ? ? A U   2492 A G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2393 hydrog ? ? A  U   2491 O2    ? ? ? 1_555 A  G   2528 N1    ? ? A U   2492 A G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2394 hydrog ? ? A  G   2493 N1    ? ? ? 1_555 A  U   2527 O2    ? ? A G   2494 A U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2395 hydrog ? ? A  G   2493 O6    ? ? ? 1_555 A  U   2527 N3    ? ? A G   2494 A U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2396 hydrog ? ? A  U   2494 O4    ? ? ? 1_555 A  G   2524 N2    ? ? A U   2495 A G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2397 hydrog ? ? A  U   2494 N3    ? ? ? 1_555 A  U   2526 O4    ? ? A U   2495 A U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2398 hydrog ? ? A  U   2494 O2    ? ? ? 1_555 A  U   2526 N3    ? ? A U   2495 A U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2399 hydrog ? ? A  C   2495 N3    ? ? ? 1_555 A  G   2523 N1    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2400 hydrog ? ? A  C   2495 N4    ? ? ? 1_555 A  G   2523 O6    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2401 hydrog ? ? A  C   2495 O2    ? ? ? 1_555 A  G   2523 N2    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2402 hydrog ? ? A  A   2496 N1    ? ? ? 1_555 A  U   2522 N3    ? ? A A   2497 A U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2403 hydrog ? ? A  A   2496 N6    ? ? ? 1_555 A  U   2522 O4    ? ? A A   2497 A U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2404 hydrog ? ? A  C   2497 N3    ? ? ? 1_555 A  G   2521 N1    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2405 hydrog ? ? A  C   2497 N4    ? ? ? 1_555 A  G   2521 O6    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2406 hydrog ? ? A  C   2497 O2    ? ? ? 1_555 A  G   2521 N2    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2407 hydrog ? ? A  U   2498 N3    ? ? ? 1_555 A  A   2520 N1    ? ? A U   2499 A A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2408 hydrog ? ? A  U   2498 O4    ? ? ? 1_555 A  A   2520 N6    ? ? A U   2499 A A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2409 hydrog ? ? A  C   2499 N3    ? ? ? 1_555 A  G   2519 N1    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2410 hydrog ? ? A  C   2499 N4    ? ? ? 1_555 A  G   2519 O6    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2411 hydrog ? ? A  C   2499 O2    ? ? ? 1_555 A  G   2519 N2    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2412 hydrog ? ? A  G   2500 N1    ? ? ? 1_555 A  C   2518 N3    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2413 hydrog ? ? A  G   2500 N2    ? ? ? 1_555 A  C   2518 O2    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2414 hydrog ? ? A  G   2500 O6    ? ? ? 1_555 A  C   2518 N4    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2415 hydrog ? ? A  C   2501 O2    ? ? ? 1_555 A  C   2517 N4    ? ? A C   2502 A C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2416 hydrog ? ? A  A   2502 N3    ? ? ? 1_555 A  A   2516 N6    ? ? A A   2503 A A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2417 hydrog ? ? A  A   2503 N6    ? ? ? 1_555 A  G   2515 N3    ? ? A A   2504 A G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2418 hydrog ? ? A  A   2503 N7    ? ? ? 1_555 A  G   2515 N2    ? ? A A   2504 A G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2419 hydrog ? ? A  G   2504 N1    ? ? ? 1_555 A  C   2514 N3    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2420 hydrog ? ? A  G   2504 N2    ? ? ? 1_555 A  C   2514 O2    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2421 hydrog ? ? A  G   2504 O6    ? ? ? 1_555 A  C   2514 N4    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2422 hydrog ? ? A  A   2505 N1    ? ? ? 1_555 A  U   2513 N3    ? ? A A   2506 A U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2423 hydrog ? ? A  A   2505 N6    ? ? ? 1_555 A  U   2513 O4    ? ? A A   2506 A U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2424 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  A   2512 N7    ? ? A G   2507 A A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2425 hydrog ? ? A  G   2506 N3    ? ? ? 1_555 A  A   2512 N6    ? ? A G   2507 A A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2426 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  G   2563 O6    ? ? A G   2507 A G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2427 hydrog ? ? A  C   2509 N3    ? ? ? 1_555 A  G   2563 N2    ? ? A C   2510 A G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2428 hydrog ? ? A  C   2509 O2    ? ? ? 1_555 A  G   2563 N1    ? ? A C   2510 A G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2429 hydrog ? ? A  G   2524 N2    ? ? ? 1_555 A  U   2526 O4    ? ? A G   2525 A U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2430 hydrog ? ? A  A   2531 N3    ? ? ? 1_555 A  C   2532 N4    ? ? A A   2532 A C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2431 hydrog ? ? A  G   2539 N1    ? ? ? 1_555 A  U   2644 O2    ? ? A G   2540 A U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2432 hydrog ? ? A  U   2540 N3    ? ? ? 1_555 A  G   2617 O6    ? ? A U   2541 A G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2433 hydrog ? ? A  U   2540 O2    ? ? ? 1_555 A  G   2617 N1    ? ? A U   2541 A G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2434 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2587 N2    ? ? A C   2542 A G   2588 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2435 hydrog ? ? A  C   2541 N3    ? ? ? 1_555 A  G   2616 N1    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2436 hydrog ? ? A  C   2541 N4    ? ? ? 1_555 A  G   2616 O6    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2437 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2616 N2    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2438 hydrog ? ? A  G   2542 N1    ? ? ? 1_555 A  U   2614 O2    ? ? A G   2543 A U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2439 hydrog ? ? A  G   2542 O6    ? ? ? 1_555 A  U   2614 N3    ? ? A G   2543 A U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2440 hydrog ? ? A  G   2543 N1    ? ? ? 1_555 A  C   2613 N3    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2441 hydrog ? ? A  G   2543 N2    ? ? ? 1_555 A  C   2613 O2    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2442 hydrog ? ? A  G   2543 O6    ? ? ? 1_555 A  C   2613 N4    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2443 hydrog ? ? A  U   2544 N3    ? ? ? 1_555 A  G   2612 O6    ? ? A U   2545 A G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2444 hydrog ? ? A  U   2544 O2    ? ? ? 1_555 A  G   2612 N1    ? ? A U   2545 A G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2445 hydrog ? ? A  U   2545 N3    ? ? ? 1_555 A  U   2609 O2    ? ? A U   2546 A U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2446 hydrog ? ? A  U   2545 O4    ? ? ? 1_555 A  U   2609 N3    ? ? A U   2546 A U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2447 hydrog ? ? A  C   2546 N3    ? ? ? 1_555 A  G   2608 N1    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2448 hydrog ? ? A  C   2546 N4    ? ? ? 1_555 A  G   2608 O6    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2449 hydrog ? ? A  C   2546 O2    ? ? ? 1_555 A  G   2608 N2    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2450 hydrog ? ? A  C   2547 N3    ? ? ? 1_555 A  G   2605 N1    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2451 hydrog ? ? A  C   2547 N4    ? ? ? 1_555 A  G   2605 O6    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2452 hydrog ? ? A  C   2547 O2    ? ? ? 1_555 A  G   2605 N2    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2453 hydrog ? ? A  C   2548 N3    ? ? ? 1_555 A  G   2604 N1    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2454 hydrog ? ? A  C   2548 N4    ? ? ? 1_555 A  G   2604 O6    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2455 hydrog ? ? A  C   2548 O2    ? ? ? 1_555 A  G   2604 N2    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2456 hydrog ? ? A  U   2549 N3    ? ? ? 1_555 A  A   2603 N1    ? ? A U   2550 A A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ? ? A  U   2549 O4    ? ? ? 1_555 A  A   2603 N6    ? ? A U   2550 A A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ? ? A  C   2550 N3    ? ? ? 1_555 A  G   2602 N1    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2459 hydrog ? ? A  C   2550 N4    ? ? ? 1_555 A  G   2602 O6    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2460 hydrog ? ? A  C   2550 O2    ? ? ? 1_555 A  G   2602 N2    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2461 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2601 N1    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ? ? A  C   2551 N4    ? ? ? 1_555 A  G   2601 O6    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2463 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2601 N2    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2464 hydrog ? ? A  U   2553 O2    ? ? ? 1_555 A  C   2555 N4    ? ? A U   2554 A C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2465 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  A   2576 N1    ? ? A C   2555 A A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2466 hydrog ? ? A  C   2554 N3    ? ? ? 1_555 A  G   2579 N1    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2467 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  G   2579 O6    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2468 hydrog ? ? A  C   2554 O2    ? ? ? 1_555 A  G   2579 N2    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2469 hydrog ? ? A  C   2555 N3    ? ? ? 1_555 A  G   2578 N1    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  G   2578 O6    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2471 hydrog ? ? A  C   2555 O2    ? ? ? 1_555 A  G   2578 N2    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2472 hydrog ? ? A  U   2556 N3    ? ? ? 1_555 A  G   2577 O6    ? ? A U   2557 A G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2473 hydrog ? ? A  U   2556 O2    ? ? ? 1_555 A  G   2577 N1    ? ? A U   2557 A G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2474 hydrog ? ? A  G   2557 N1    ? ? ? 1_555 A  C   2574 N3    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2475 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  C   2574 O2    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2476 hydrog ? ? A  G   2557 O6    ? ? ? 1_555 A  C   2574 N4    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2477 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  A   2798 N3    ? ? A G   2558 A A   2799 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2478 hydrog ? ? A  C   2558 N3    ? ? ? 1_555 A  G   2573 N1    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ? ? A  C   2558 N4    ? ? ? 1_555 A  G   2573 O6    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2480 hydrog ? ? A  C   2558 O2    ? ? ? 1_555 A  G   2573 N2    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2481 hydrog ? ? A  C   2559 N3    ? ? ? 1_555 A  G   2572 N1    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2482 hydrog ? ? A  C   2559 N4    ? ? ? 1_555 A  G   2572 O6    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2483 hydrog ? ? A  C   2559 O2    ? ? ? 1_555 A  G   2572 N2    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ? ? A  C   2560 N3    ? ? ? 1_555 A  G   2571 N1    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2485 hydrog ? ? A  C   2560 N4    ? ? ? 1_555 A  G   2571 O6    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2486 hydrog ? ? A  C   2560 O2    ? ? ? 1_555 A  G   2571 N2    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2487 hydrog ? ? A  G   2561 N1    ? ? ? 1_555 A  C   2570 N3    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2488 hydrog ? ? A  G   2561 N2    ? ? ? 1_555 A  C   2570 O2    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2489 hydrog ? ? A  G   2561 O6    ? ? ? 1_555 A  C   2570 N4    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2490 hydrog ? ? A  U   2562 N3    ? ? ? 1_555 A  G   2569 O6    ? ? A U   2563 A G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2491 hydrog ? ? A  U   2562 O2    ? ? ? 1_555 A  G   2569 N1    ? ? A U   2563 A G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2492 hydrog ? ? A  A   2565 N1    ? ? ? 1_555 A  A   2698 N6    ? ? A A   2566 A A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2493 hydrog ? ? A  A   2565 N6    ? ? ? 1_555 A  A   2698 N1    ? ? A A   2566 A A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2494 hydrog ? ? A  G   2566 N2    ? ? ? 1_555 A  G   2699 N3    ? ? A G   2567 A G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2495 hydrog ? ? A  G   2566 N3    ? ? ? 1_555 A  G   2699 N2    ? ? A G   2567 A G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2496 hydrog ? ? A  G   2573 N2    ? ? ? 1_555 A  A   2775 N3    ? ? A G   2574 A A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2497 hydrog ? ? A  A   2575 N3    ? ? ? 1_555 A  A   2799 N6    ? ? A A   2576 A A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2498 hydrog ? ? A  G   2579 N2    ? ? ? 1_555 A  A   2599 N3    ? ? A G   2580 A A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2499 hydrog ? ? A  U   2580 N3    ? ? ? 1_555 A  G   2601 N7    ? ? A U   2581 A G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2500 hydrog ? ? A  G   2581 N1    ? ? ? 1_555 A  A   2595 N1    ? ? A G   2582 A A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2501 hydrog ? ? A  G   2581 O6    ? ? ? 1_555 A  A   2595 N6    ? ? A G   2582 A A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2502 hydrog ? ? A  A   2582 N1    ? ? ? 1_555 A  U   2594 N3    ? ? A A   2583 A U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2503 hydrog ? ? A  A   2582 N6    ? ? ? 1_555 A  U   2594 O4    ? ? A A   2583 A U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2504 hydrog ? ? A  G   2583 N1    ? ? ? 1_555 A  C   2593 N3    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2505 hydrog ? ? A  G   2583 N2    ? ? ? 1_555 A  C   2593 O2    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2506 hydrog ? ? A  G   2583 O6    ? ? ? 1_555 A  C   2593 N4    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2507 hydrog ? ? A  G   2584 N1    ? ? ? 1_555 A  C   2592 N3    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2508 hydrog ? ? A  G   2584 N2    ? ? ? 1_555 A  C   2592 O2    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2509 hydrog ? ? A  G   2584 O6    ? ? ? 1_555 A  C   2592 N4    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2510 hydrog ? ? A  U   2585 O4    ? ? ? 1_555 A  G   2591 N1    ? ? A U   2586 A G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2511 hydrog ? ? A  U   2586 O2    ? ? ? 1_555 A  C   2590 N4    ? ? A U   2587 A C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2512 hydrog ? ? A  U   2596 N3    ? ? ? 1_555 A  A   2600 N7    ? ? A U   2597 A A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2513 hydrog ? ? A  U   2596 O2    ? ? ? 1_555 A  A   2600 N6    ? ? A U   2597 A A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2514 hydrog ? ? A  A   2621 N6    ? ? ? 1_555 A  G   2642 N3    ? ? A A   2622 A G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2515 hydrog ? ? A  A   2621 N7    ? ? ? 1_555 A  G   2642 N2    ? ? A A   2622 A G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2516 hydrog ? ? A  G   2622 N1    ? ? ? 1_555 A  C   2640 N3    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2517 hydrog ? ? A  G   2622 N2    ? ? ? 1_555 A  C   2640 O2    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2518 hydrog ? ? A  G   2622 O6    ? ? ? 1_555 A  C   2640 N4    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2519 hydrog ? ? A  A   2623 N1    ? ? ? 1_555 A  U   2639 N3    ? ? A A   2624 A U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2520 hydrog ? ? A  C   2624 N3    ? ? ? 1_555 A  G   2638 N1    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2521 hydrog ? ? A  C   2624 N4    ? ? ? 1_555 A  G   2638 O6    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2522 hydrog ? ? A  C   2624 O2    ? ? ? 1_555 A  G   2638 N2    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2523 hydrog ? ? A  C   2625 N3    ? ? ? 1_555 A  G   2637 N1    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2524 hydrog ? ? A  C   2625 N4    ? ? ? 1_555 A  G   2637 O6    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2525 hydrog ? ? A  C   2625 O2    ? ? ? 1_555 A  G   2637 N2    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2526 hydrog ? ? A  G   2626 N1    ? ? ? 1_555 A  C   2635 N3    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ? ? A  G   2626 N2    ? ? ? 1_555 A  C   2635 O2    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ? ? A  G   2626 O6    ? ? ? 1_555 A  C   2635 N4    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2529 hydrog ? ? A  U   2627 N3    ? ? ? 1_555 A  A   2634 N1    ? ? A U   2628 A A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ? ? A  U   2627 O4    ? ? ? 1_555 A  A   2634 N6    ? ? A U   2628 A A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ? ? A  C   2628 N3    ? ? ? 1_555 A  G   2633 N1    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ? ? A  C   2628 N4    ? ? ? 1_555 A  G   2633 O6    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ? ? A  C   2628 O2    ? ? ? 1_555 A  G   2633 N2    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2534 hydrog ? ? A  G   2629 N2    ? ? ? 1_555 A  A   2632 N7    ? ? A G   2630 A A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2535 hydrog ? ? A  A   2648 N3    ? ? ? 1_555 A  C   2650 N4    ? ? A A   2649 A C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2536 hydrog ? ? A  G   2656 N2    ? ? ? 1_555 A  A   2840 N1    ? ? A G   2657 A A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2537 hydrog ? ? A  G   2656 N3    ? ? ? 1_555 A  A   2840 N6    ? ? A G   2657 A A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2538 hydrog ? ? A  U   2660 O2    ? ? ? 1_555 A  A   2811 N6    ? ? A U   2661 A A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2539 hydrog ? ? A  G   2661 N2    ? ? ? 1_555 A  A   2815 N3    ? ? A G   2662 A A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2540 hydrog ? ? A  G   2666 N1    ? ? ? 1_555 A  C   2821 N3    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2541 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  C   2821 O2    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2542 hydrog ? ? A  G   2666 O6    ? ? ? 1_555 A  C   2821 N4    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2543 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  A   2826 N3    ? ? A G   2667 A A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2544 hydrog ? ? A  G   2667 N1    ? ? ? 1_555 A  C   2820 N3    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2545 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  C   2820 O2    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2546 hydrog ? ? A  G   2667 O6    ? ? ? 1_555 A  C   2820 N4    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2547 hydrog ? ? A  U   2668 N3    ? ? ? 1_555 A  A   2819 N1    ? ? A U   2669 A A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2548 hydrog ? ? A  U   2668 O4    ? ? ? 1_555 A  A   2819 N6    ? ? A U   2669 A A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2549 hydrog ? ? A  G   2669 N1    ? ? ? 1_555 A  C   2818 N3    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2550 hydrog ? ? A  G   2669 N2    ? ? ? 1_555 A  C   2818 O2    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ? ? A  G   2669 O6    ? ? ? 1_555 A  C   2818 N4    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ? ? A  U   2670 N3    ? ? ? 1_555 A  A   2817 N1    ? ? A U   2671 A A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2553 hydrog ? ? A  U   2670 O4    ? ? ? 1_555 A  A   2817 N6    ? ? A U   2671 A A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2554 hydrog ? ? A  C   2671 N3    ? ? ? 1_555 A  G   2816 N1    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ? ? A  C   2671 N4    ? ? ? 1_555 A  G   2816 O6    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ? ? A  C   2671 O2    ? ? ? 1_555 A  G   2816 N2    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2557 hydrog ? ? A  U   2672 N3    ? ? ? 1_555 A  A   2810 N7    ? ? A U   2673 A A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2558 hydrog ? ? A  U   2672 O2    ? ? ? 1_555 A  A   2810 N6    ? ? A U   2673 A A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2559 hydrog ? ? A  G   2673 N2    ? ? ? 1_555 A  A   2812 N7    ? ? A G   2674 A A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2560 hydrog ? ? A  G   2673 N3    ? ? ? 1_555 A  A   2812 N6    ? ? A G   2674 A A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2561 hydrog ? ? A  A   2674 N6    ? ? ? 1_555 A  G   2809 N3    ? ? A A   2675 A G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2562 hydrog ? ? A  A   2674 N7    ? ? ? 1_555 A  G   2809 N2    ? ? A A   2675 A G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2563 hydrog ? ? A  C   2675 N3    ? ? ? 1_555 A  G   2808 N1    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2564 hydrog ? ? A  C   2675 N4    ? ? ? 1_555 A  G   2808 O6    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2565 hydrog ? ? A  C   2675 O2    ? ? ? 1_555 A  G   2808 N2    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2566 hydrog ? ? A  A   2676 N1    ? ? ? 1_555 A  U   2807 N3    ? ? A A   2677 A U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2567 hydrog ? ? A  A   2676 N6    ? ? ? 1_555 A  U   2807 O4    ? ? A A   2677 A U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2568 hydrog ? ? A  A   2677 N1    ? ? ? 1_555 A  U   2806 N3    ? ? A A   2678 A U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2569 hydrog ? ? A  A   2677 N6    ? ? ? 1_555 A  U   2806 O4    ? ? A A   2678 A U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2570 hydrog ? ? A  G   2678 N1    ? ? ? 1_555 A  C   2805 N3    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2571 hydrog ? ? A  G   2678 N2    ? ? ? 1_555 A  C   2805 O2    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2572 hydrog ? ? A  G   2678 O6    ? ? ? 1_555 A  C   2805 N4    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2573 hydrog ? ? A  A   2679 N1    ? ? ? 1_555 A  G   2711 N2    ? ? A A   2680 A G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2574 hydrog ? ? A  A   2680 N3    ? ? ? 1_555 A  G   2712 N2    ? ? A A   2681 A G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2575 hydrog ? ? A  C   2681 N3    ? ? ? 1_555 A  G   2711 N1    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2576 hydrog ? ? A  C   2681 N4    ? ? ? 1_555 A  G   2711 O6    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2577 hydrog ? ? A  C   2681 O2    ? ? ? 1_555 A  G   2711 N2    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2578 hydrog ? ? A  G   2682 N1    ? ? ? 1_555 A  U   2710 O2    ? ? A G   2683 A U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2579 hydrog ? ? A  G   2682 O6    ? ? ? 1_555 A  U   2710 N3    ? ? A G   2683 A U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2580 hydrog ? ? A  A   2683 N1    ? ? ? 1_555 A  U   2709 N3    ? ? A A   2684 A U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2581 hydrog ? ? A  A   2683 N6    ? ? ? 1_555 A  U   2709 O4    ? ? A A   2684 A U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2582 hydrog ? ? A  C   2684 N3    ? ? ? 1_555 A  G   2708 N1    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ? ? A  C   2684 N4    ? ? ? 1_555 A  G   2708 O6    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2584 hydrog ? ? A  C   2684 O2    ? ? ? 1_555 A  G   2708 N2    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2585 hydrog ? ? A  C   2685 N3    ? ? ? 1_555 A  G   2707 N1    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2586 hydrog ? ? A  C   2685 N4    ? ? ? 1_555 A  G   2707 O6    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ? ? A  C   2685 O2    ? ? ? 1_555 A  G   2707 N2    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ? ? A  G   2686 N1    ? ? ? 1_555 A  C   2706 N3    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2589 hydrog ? ? A  G   2686 N2    ? ? ? 1_555 A  C   2706 O2    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2590 hydrog ? ? A  G   2686 O6    ? ? ? 1_555 A  C   2706 N4    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ? ? A  U   2687 N3    ? ? ? 1_555 A  A   2705 N1    ? ? A U   2688 A A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ? ? A  U   2687 O4    ? ? ? 1_555 A  A   2705 N6    ? ? A U   2688 A A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ? ? A  A   2688 N1    ? ? ? 1_555 A  U   2704 N3    ? ? A A   2689 A U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ? ? A  A   2688 N6    ? ? ? 1_555 A  U   2704 O4    ? ? A A   2689 A U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2595 hydrog ? ? A  U   2689 O2    ? ? ? 1_555 A  C   2703 N4    ? ? A U   2690 A C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2596 hydrog ? ? A  A   2690 N6    ? ? ? 1_555 A  A   2702 N7    ? ? A A   2691 A A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2597 hydrog ? ? A  A   2690 N7    ? ? ? 1_555 A  A   2702 N6    ? ? A A   2691 A A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2598 hydrog ? ? A  G   2691 N2    ? ? ? 1_555 A  U   2692 O4    ? ? A G   2692 A U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2599 hydrog ? ? A  U   2692 N3    ? ? ? 1_555 A  A   2701 N7    ? ? A U   2693 A A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2600 hydrog ? ? A  U   2692 O2    ? ? ? 1_555 A  A   2701 N6    ? ? A U   2693 A A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2601 hydrog ? ? A  A   2693 N6    ? ? ? 1_555 A  G   2700 N3    ? ? A A   2694 A G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2602 hydrog ? ? A  A   2693 N7    ? ? ? 1_555 A  G   2700 N2    ? ? A A   2694 A G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2603 hydrog ? ? A  C   2694 N3    ? ? ? 1_555 A  G   2699 N1    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2604 hydrog ? ? A  C   2694 N4    ? ? ? 1_555 A  G   2699 O6    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2605 hydrog ? ? A  C   2694 O2    ? ? ? 1_555 A  G   2699 N2    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2606 hydrog ? ? A  G   2695 N2    ? ? ? 1_555 A  A   2698 N7    ? ? A G   2696 A A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2607 hydrog ? ? A  G   2712 N1    ? ? ? 1_555 A  C   2766 N3    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2608 hydrog ? ? A  G   2712 N2    ? ? ? 1_555 A  C   2766 O2    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2609 hydrog ? ? A  G   2712 O6    ? ? ? 1_555 A  C   2766 N4    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2610 hydrog ? ? A  U   2713 N3    ? ? ? 1_555 A  A   2765 N1    ? ? A U   2714 A A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2611 hydrog ? ? A  U   2713 O4    ? ? ? 1_555 A  A   2765 N6    ? ? A U   2714 A A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2612 hydrog ? ? A  G   2714 N1    ? ? ? 1_555 A  C   2764 N3    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2613 hydrog ? ? A  G   2714 N2    ? ? ? 1_555 A  C   2764 O2    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ? ? A  G   2714 O6    ? ? ? 1_555 A  C   2764 N4    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ? ? A  G   2715 N1    ? ? ? 1_555 A  C   2763 N3    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ? ? A  G   2715 N2    ? ? ? 1_555 A  C   2763 O2    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2617 hydrog ? ? A  G   2715 O6    ? ? ? 1_555 A  C   2763 N4    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ? ? A  C   2716 N3    ? ? ? 1_555 A  G   2762 N1    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ? ? A  C   2716 N4    ? ? ? 1_555 A  G   2762 O6    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ? ? A  C   2716 O2    ? ? ? 1_555 A  G   2762 N2    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2621 hydrog ? ? A  C   2717 O2    ? ? ? 1_555 A  C   2719 N4    ? ? A C   2718 A C   2720 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2622 hydrog ? ? A  C   2717 N3    ? ? ? 1_555 A  A   2760 N6    ? ? A C   2718 A A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2623 hydrog ? ? A  C   2717 N4    ? ? ? 1_555 A  A   2760 N7    ? ? A C   2718 A A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2624 hydrog ? ? A  C   2719 N4    ? ? ? 1_555 A  G   2762 N3    ? ? A C   2720 A G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2625 hydrog ? ? A  U   2720 N3    ? ? ? 1_555 A  A   2760 N1    ? ? A U   2721 A A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2626 hydrog ? ? A  U   2720 O4    ? ? ? 1_555 A  A   2760 N6    ? ? A U   2721 A A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2627 hydrog ? ? A  G   2721 N1    ? ? ? 1_555 A  C   2759 N3    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2628 hydrog ? ? A  G   2721 N2    ? ? ? 1_555 A  C   2759 O2    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2629 hydrog ? ? A  G   2721 O6    ? ? ? 1_555 A  C   2759 N4    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2630 hydrog ? ? A  G   2722 N1    ? ? ? 1_555 A  C   2758 N3    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2631 hydrog ? ? A  G   2722 N2    ? ? ? 1_555 A  C   2758 O2    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2632 hydrog ? ? A  G   2722 O6    ? ? ? 1_555 A  C   2758 N4    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2633 hydrog ? ? A  U   2723 N3    ? ? ? 1_555 A  G   2757 O6    ? ? A U   2724 A G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2634 hydrog ? ? A  U   2723 O2    ? ? ? 1_555 A  G   2757 N1    ? ? A U   2724 A G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2635 hydrog ? ? A  G   2724 N2    ? ? ? 1_555 A  A   2756 N7    ? ? A G   2725 A A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2636 hydrog ? ? A  G   2724 N3    ? ? ? 1_555 A  A   2756 N6    ? ? A G   2725 A A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2637 hydrog ? ? A  A   2726 N7    ? ? ? 1_555 A  G   2754 N2    ? ? A A   2727 A G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2638 hydrog ? ? A  C   2727 N3    ? ? ? 1_555 A  G   2753 N1    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2639 hydrog ? ? A  C   2727 N4    ? ? ? 1_555 A  G   2753 O6    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2640 hydrog ? ? A  C   2727 O2    ? ? ? 1_555 A  G   2753 N2    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2641 hydrog ? ? A  C   2728 N3    ? ? ? 1_555 A  G   2752 N1    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2642 hydrog ? ? A  C   2728 N4    ? ? ? 1_555 A  G   2752 O6    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2643 hydrog ? ? A  C   2728 O2    ? ? ? 1_555 A  G   2752 N2    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2644 hydrog ? ? A  G   2729 N1    ? ? ? 1_555 A  C   2751 N3    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2645 hydrog ? ? A  G   2729 N2    ? ? ? 1_555 A  C   2751 O2    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2646 hydrog ? ? A  G   2729 O6    ? ? ? 1_555 A  C   2751 N4    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2647 hydrog ? ? A  G   2730 N1    ? ? ? 1_555 A  C   2750 N3    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ? ? A  G   2730 N2    ? ? ? 1_555 A  C   2750 O2    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2649 hydrog ? ? A  G   2730 O6    ? ? ? 1_555 A  C   2750 N4    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2650 hydrog ? ? A  U   2731 N3    ? ? ? 1_555 A  G   2749 O6    ? ? A U   2732 A G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2651 hydrog ? ? A  U   2731 O2    ? ? ? 1_555 A  G   2749 N1    ? ? A U   2732 A G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2652 hydrog ? ? A  U   2732 N3    ? ? ? 1_555 A  A   2745 N1    ? ? A U   2733 A A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2653 hydrog ? ? A  U   2732 O4    ? ? ? 1_555 A  A   2745 N6    ? ? A U   2733 A A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2654 hydrog ? ? A  G   2733 N1    ? ? ? 1_555 A  C   2744 N3    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ? ? A  G   2733 N2    ? ? ? 1_555 A  C   2744 O2    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2656 hydrog ? ? A  G   2733 O6    ? ? ? 1_555 A  C   2744 N4    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2657 hydrog ? ? A  U   2734 N3    ? ? ? 1_555 A  G   2743 O6    ? ? A U   2735 A G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2658 hydrog ? ? A  U   2734 O2    ? ? ? 1_555 A  G   2743 N1    ? ? A U   2735 A G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2659 hydrog ? ? A  U   2735 N3    ? ? ? 1_555 A  A   2742 N1    ? ? A U   2736 A A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2660 hydrog ? ? A  U   2735 O4    ? ? ? 1_555 A  A   2742 N6    ? ? A U   2736 A A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2661 hydrog ? ? A  C   2736 N3    ? ? ? 1_555 A  G   2741 N1    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ? ? A  C   2736 N4    ? ? ? 1_555 A  G   2741 O6    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2663 hydrog ? ? A  C   2736 O2    ? ? ? 1_555 A  G   2741 N2    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2664 hydrog ? ? A  U   2755 N3    ? ? ? 1_555 A  A   2895 N1    ? ? A U   2756 A A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2665 hydrog ? ? A  C   2768 N4    ? ? ? 1_555 A  A   2804 N3    ? ? A C   2769 A A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2666 hydrog ? ? A  G   2769 N1    ? ? ? 1_555 A  C   2803 N3    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2667 hydrog ? ? A  G   2769 N2    ? ? ? 1_555 A  C   2803 O2    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2668 hydrog ? ? A  G   2769 O6    ? ? ? 1_555 A  C   2803 N4    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2669 hydrog ? ? A  G   2770 N1    ? ? ? 1_555 A  C   2802 N3    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ? ? A  G   2770 N2    ? ? ? 1_555 A  C   2802 O2    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2671 hydrog ? ? A  G   2770 O6    ? ? ? 1_555 A  C   2802 N4    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2672 hydrog ? ? A  G   2771 N1    ? ? ? 1_555 A  C   2801 N3    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2673 hydrog ? ? A  G   2771 N2    ? ? ? 1_555 A  C   2801 O2    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2674 hydrog ? ? A  G   2771 O6    ? ? ? 1_555 A  C   2801 N4    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2675 hydrog ? ? A  G   2772 N1    ? ? ? 1_555 A  A   2800 N1    ? ? A G   2773 A A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2676 hydrog ? ? A  G   2772 O6    ? ? ? 1_555 A  A   2800 N6    ? ? A G   2773 A A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2677 hydrog ? ? A  U   2773 N3    ? ? ? 1_555 A  A   2798 N7    ? ? A U   2774 A A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2678 hydrog ? ? A  U   2773 O2    ? ? ? 1_555 A  A   2798 N6    ? ? A U   2774 A A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2679 hydrog ? ? A  A   2775 N6    ? ? ? 1_555 A  G   2797 N3    ? ? A A   2776 A G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2680 hydrog ? ? A  A   2775 N7    ? ? ? 1_555 A  G   2797 N2    ? ? A A   2776 A G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2681 hydrog ? ? A  G   2776 N1    ? ? ? 1_555 A  C   2796 N3    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2682 hydrog ? ? A  G   2776 N2    ? ? ? 1_555 A  C   2796 O2    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2683 hydrog ? ? A  G   2776 O6    ? ? ? 1_555 A  C   2796 N4    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2684 hydrog ? ? A  A   2777 N1    ? ? ? 1_555 A  U   2795 N3    ? ? A A   2778 A U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2685 hydrog ? ? A  A   2777 N6    ? ? ? 1_555 A  U   2795 O4    ? ? A A   2778 A U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2686 hydrog ? ? A  G   2778 N1    ? ? ? 1_555 A  C   2794 N3    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2687 hydrog ? ? A  G   2778 N2    ? ? ? 1_555 A  C   2794 O2    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2688 hydrog ? ? A  G   2778 O6    ? ? ? 1_555 A  C   2794 N4    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2689 hydrog ? ? A  C   2779 N3    ? ? ? 1_555 A  G   2793 N1    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2690 hydrog ? ? A  C   2779 N4    ? ? ? 1_555 A  G   2793 O6    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2691 hydrog ? ? A  C   2779 O2    ? ? ? 1_555 A  G   2793 N2    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2692 hydrog ? ? A  U   2780 N3    ? ? ? 1_555 A  U   2790 O4    ? ? A U   2781 A U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2693 hydrog ? ? A  U   2780 O2    ? ? ? 1_555 A  A   2792 N6    ? ? A U   2781 A A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2694 hydrog ? ? A  G   2781 N2    ? ? ? 1_555 A  A   2791 N7    ? ? A G   2782 A A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2695 hydrog ? ? A  G   2781 N3    ? ? ? 1_555 A  A   2791 N6    ? ? A G   2782 A A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2696 hydrog ? ? A  A   2782 N6    ? ? ? 1_555 A  U   2788 O2    ? ? A A   2783 A U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2697 hydrog ? ? A  A   2782 N7    ? ? ? 1_555 A  U   2788 N3    ? ? A A   2783 A U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2698 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  A   2787 N1    ? ? A A   2784 A A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2699 hydrog ? ? A  A   2783 N7    ? ? ? 1_555 A  A   2787 N6    ? ? A A   2784 A A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2700 hydrog ? ? A  C   2784 O2    ? ? ? 1_555 A  C   2786 N4    ? ? A C   2785 A C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2701 hydrog ? ? A  U   2790 N3    ? ? ? 1_555 A  A   2792 N7    ? ? A U   2791 A A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2702 hydrog ? ? A  U   2790 O4    ? ? ? 1_555 A  A   2792 N6    ? ? A U   2791 A A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2703 hydrog ? ? A  A   2811 N1    ? ? ? 1_555 A  A   2813 N6    ? ? A A   2812 A A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2704 hydrog ? ? A  G   2822 N2    ? ? ? 1_555 A  A   2913 N3    ? ? A G   2823 A A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2705 hydrog ? ? A  G   2825 N2    ? ? ? 1_555 A  A   2913 N7    ? ? A G   2826 A A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2706 hydrog ? ? A  G   2825 N3    ? ? ? 1_555 A  A   2913 N6    ? ? A G   2826 A A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2707 hydrog ? ? A  A   2826 N6    ? ? ? 1_555 A  A   2912 N3    ? ? A A   2827 A A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2708 hydrog ? ? A  G   2827 N1    ? ? ? 1_555 A  C   2911 N3    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2709 hydrog ? ? A  G   2827 N2    ? ? ? 1_555 A  C   2911 O2    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2710 hydrog ? ? A  G   2827 O6    ? ? ? 1_555 A  C   2911 N4    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2711 hydrog ? ? A  G   2828 N1    ? ? ? 1_555 A  C   2910 N3    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2712 hydrog ? ? A  G   2828 N2    ? ? ? 1_555 A  C   2910 O2    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2713 hydrog ? ? A  G   2828 O6    ? ? ? 1_555 A  C   2910 N4    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2714 hydrog ? ? A  U   2829 N3    ? ? ? 1_555 A  A   2909 N1    ? ? A U   2830 A A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2715 hydrog ? ? A  U   2829 O4    ? ? ? 1_555 A  A   2909 N6    ? ? A U   2830 A A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2716 hydrog ? ? A  C   2830 O2    ? ? ? 1_555 A  G   2908 N2    ? ? A C   2831 A G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2717 hydrog ? ? A  C   2831 N3    ? ? ? 1_555 A  G   2847 N1    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2718 hydrog ? ? A  C   2831 N4    ? ? ? 1_555 A  G   2847 O6    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2719 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  G   2847 N2    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2720 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  A   2907 N6    ? ? A C   2832 A A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2721 hydrog ? ? A  C   2832 N3    ? ? ? 1_555 A  G   2846 N1    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ? ? A  C   2832 N4    ? ? ? 1_555 A  G   2846 O6    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2723 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  G   2846 N2    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2724 hydrog ? ? A  G   2833 N1    ? ? ? 1_555 A  C   2845 N3    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2725 hydrog ? ? A  G   2833 N2    ? ? ? 1_555 A  C   2845 O2    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2726 hydrog ? ? A  G   2833 O6    ? ? ? 1_555 A  C   2845 N4    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2727 hydrog ? ? A  C   2834 N3    ? ? ? 1_555 A  G   2844 N1    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2728 hydrog ? ? A  C   2834 N4    ? ? ? 1_555 A  G   2844 O6    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2729 hydrog ? ? A  C   2834 O2    ? ? ? 1_555 A  G   2844 N2    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ? ? A  G   2835 N1    ? ? ? 1_555 A  C   2843 N3    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ? ? A  G   2835 N2    ? ? ? 1_555 A  C   2843 O2    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ? ? A  G   2835 O6    ? ? ? 1_555 A  C   2843 N4    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2733 hydrog ? ? A  A   2837 N3    ? ? ? 1_555 A  A   2842 N6    ? ? A A   2838 A A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2734 hydrog ? ? A  G   2846 N2    ? ? ? 1_555 A  A   2905 N3    ? ? A G   2847 A A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2735 hydrog ? ? A  G   2850 N2    ? ? ? 1_555 A  A   2905 N7    ? ? A G   2851 A A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2736 hydrog ? ? A  G   2850 N3    ? ? ? 1_555 A  A   2905 N6    ? ? A G   2851 A A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2737 hydrog ? ? A  A   2851 N1    ? ? ? 1_555 A  C   2902 N4    ? ? A A   2852 A C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2738 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2901 N6    ? ? A U   2853 A A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2739 hydrog ? ? A  U   2852 N3    ? ? ? 1_555 A  A   2904 N1    ? ? A U   2853 A A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2740 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2904 N6    ? ? A U   2853 A A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2741 hydrog ? ? A  A   2853 N1    ? ? ? 1_555 A  U   2903 N3    ? ? A A   2854 A U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2742 hydrog ? ? A  A   2853 N6    ? ? ? 1_555 A  U   2903 O4    ? ? A A   2854 A U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2743 hydrog ? ? A  G   2854 N1    ? ? ? 1_555 A  C   2902 N3    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2744 hydrog ? ? A  G   2854 N2    ? ? ? 1_555 A  C   2902 O2    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2745 hydrog ? ? A  G   2854 O6    ? ? ? 1_555 A  C   2902 N4    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2746 hydrog ? ? A  A   2855 N6    ? ? ? 1_555 A  C   2900 O2    ? ? A A   2856 A C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2747 hydrog ? ? A  C   2856 N3    ? ? ? 1_555 A  G   2899 N1    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ? ? A  C   2856 N4    ? ? ? 1_555 A  G   2899 O6    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2749 hydrog ? ? A  C   2856 O2    ? ? ? 1_555 A  G   2899 N2    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2750 hydrog ? ? A  U   2857 N3    ? ? ? 1_555 A  A   2898 N1    ? ? A U   2858 A A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ? ? A  U   2857 O4    ? ? ? 1_555 A  A   2898 N6    ? ? A U   2858 A A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ? ? A  C   2858 N3    ? ? ? 1_555 A  G   2897 N1    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ? ? A  C   2858 N4    ? ? ? 1_555 A  G   2897 O6    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2754 hydrog ? ? A  C   2858 O2    ? ? ? 1_555 A  G   2897 N2    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2755 hydrog ? ? A  G   2859 N1    ? ? ? 1_555 A  C   2896 N3    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ? ? A  G   2859 N2    ? ? ? 1_555 A  C   2896 O2    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2757 hydrog ? ? A  G   2859 O6    ? ? ? 1_555 A  C   2896 N4    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2758 hydrog ? ? A  G   2860 N1    ? ? ? 1_555 A  C   2894 N3    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2759 hydrog ? ? A  G   2860 N2    ? ? ? 1_555 A  C   2894 O2    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2760 hydrog ? ? A  G   2860 O6    ? ? ? 1_555 A  C   2894 N4    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2761 hydrog ? ? A  G   2861 N1    ? ? ? 1_555 A  C   2893 N3    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2762 hydrog ? ? A  G   2861 N2    ? ? ? 1_555 A  C   2893 O2    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2763 hydrog ? ? A  G   2861 O6    ? ? ? 1_555 A  C   2893 N4    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ? ? A  G   2862 N1    ? ? ? 1_555 A  C   2892 N3    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ? ? A  G   2862 N2    ? ? ? 1_555 A  C   2892 O2    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ? ? A  G   2862 O6    ? ? ? 1_555 A  C   2892 N4    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2767 hydrog ? ? A  U   2863 N3    ? ? ? 1_555 A  G   2891 O6    ? ? A U   2864 A G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2768 hydrog ? ? A  U   2863 O2    ? ? ? 1_555 A  G   2891 N1    ? ? A U   2864 A G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2769 hydrog ? ? A  G   2864 N2    ? ? ? 1_555 A  A   2890 N7    ? ? A G   2865 A A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2770 hydrog ? ? A  G   2864 N3    ? ? ? 1_555 A  A   2890 N6    ? ? A G   2865 A A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2771 hydrog ? ? A  C   2867 N4    ? ? ? 1_555 A  U   2888 O4    ? ? A C   2868 A U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2772 hydrog ? ? A  G   2868 N1    ? ? ? 1_555 A  U   2887 O2    ? ? A G   2869 A U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2773 hydrog ? ? A  G   2868 O6    ? ? ? 1_555 A  U   2887 N3    ? ? A G   2869 A U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2774 hydrog ? ? A  C   2869 N3    ? ? ? 1_555 A  G   2886 N1    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2775 hydrog ? ? A  C   2869 N4    ? ? ? 1_555 A  G   2886 O6    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2776 hydrog ? ? A  C   2869 O2    ? ? ? 1_555 A  G   2886 N2    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2777 hydrog ? ? A  G   2870 N1    ? ? ? 1_555 A  C   2885 N3    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2778 hydrog ? ? A  G   2870 N2    ? ? ? 1_555 A  C   2885 O2    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2779 hydrog ? ? A  G   2870 O6    ? ? ? 1_555 A  C   2885 N4    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2780 hydrog ? ? A  U   2871 N3    ? ? ? 1_555 A  A   2884 N1    ? ? A U   2872 A A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2781 hydrog ? ? A  U   2871 O4    ? ? ? 1_555 A  A   2884 N6    ? ? A U   2872 A A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2782 hydrog ? ? A  C   2872 O2    ? ? ? 1_555 A  G   2883 N2    ? ? A C   2873 A G   2884 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2783 hydrog ? ? A  G   2873 N2    ? ? ? 1_555 A  A   2882 N7    ? ? A G   2874 A A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2784 hydrog ? ? A  G   2873 N3    ? ? ? 1_555 A  A   2882 N6    ? ? A G   2874 A A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2785 hydrog ? ? A  A   2874 N6    ? ? ? 1_555 A  G   2881 N3    ? ? A A   2875 A G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2786 hydrog ? ? A  A   2874 N7    ? ? ? 1_555 A  G   2881 N2    ? ? A A   2875 A G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2787 hydrog ? ? A  G   2875 N1    ? ? ? 1_555 A  C   2880 N3    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2788 hydrog ? ? A  G   2875 N2    ? ? ? 1_555 A  C   2880 O2    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2789 hydrog ? ? A  G   2875 O6    ? ? ? 1_555 A  C   2880 N4    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2790 hydrog ? ? A  G   2876 N2    ? ? ? 1_555 A  A   2879 N7    ? ? A G   2877 A A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2791 hydrog ? ? A  A   2901 N7    ? ? ? 1_555 A  A   2904 N6    ? ? A A   2902 A A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2792 hydrog ? ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2    ? ? B A   3003 B G   3021 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2793 hydrog ? ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2794 hydrog ? ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2795 hydrog ? ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2796 hydrog ? ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2797 hydrog ? ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2798 hydrog ? ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2799 hydrog ? ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2800 hydrog ? ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2801 hydrog ? ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2802 hydrog ? ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2803 hydrog ? ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ? ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2805 hydrog ? ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ? ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ? ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ? ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ? ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ? ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ? ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2    ? ? B A   3011 B G   3068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2812 hydrog ? ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ? ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2814 hydrog ? ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2815 hydrog ? ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2816 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ? ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2818 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2    ? ? B C   3015 B C   3113 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2819 hydrog ? ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2820 hydrog ? ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2821 hydrog ? ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2822 hydrog ? ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ? ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ? ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2825 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1    ? ? B U   3018 B A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ? ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6    ? ? B U   3018 B A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2827 hydrog ? ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2828 hydrog ? ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2829 hydrog ? ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2830 hydrog ? ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2831 hydrog ? ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ? ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ? ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2834 hydrog ? ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ? ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ? ? B  G   22   N2    ? ? ? 1_555 B  C   26   N3    ? ? B G   3022 B C   3026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2837 hydrog ? ? B  G   22   N1    ? ? ? 1_555 B  G   58   O6    ? ? B G   3022 B G   3058 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2838 hydrog ? ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4    ? ? B C   3027 B U   3055 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2839 hydrog ? ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1    ? ? B C   3027 B G   3058 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2840 hydrog ? ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1    ? ? B U   3028 B A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2841 hydrog ? ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6    ? ? B U   3028 B A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2842 hydrog ? ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6    ? ? B U   3028 B A   3057 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2843 hydrog ? ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2844 hydrog ? ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2845 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2846 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6    ? ? B C   3029 B A   3056 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2847 hydrog ? ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2848 hydrog ? ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2849 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2850 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6    ? ? B C   3030 B A   3052 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2851 hydrog ? ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2852 hydrog ? ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2853 hydrog ? ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2854 hydrog ? ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2855 hydrog ? ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2856 hydrog ? ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2857 hydrog ? ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4    ? ? B U   3033 B C   3035 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2858 hydrog ? ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1    ? ? B U   3033 B A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2859 hydrog ? ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6    ? ? B U   3033 B A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2860 hydrog ? ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2    ? ? B C   3035 B C   3048 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2861 hydrog ? ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3    ? ? B C   3036 B A   3047 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2862 hydrog ? ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2863 hydrog ? ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2864 hydrog ? ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2865 hydrog ? ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6    ? ? B A   3038 B A   3045 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2866 hydrog ? ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6    ? ? B U   3039 B A   3044 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2867 hydrog ? ? B  G   43   N2    ? ? ? 1_555 B  C   46   O2    ? ? B G   3043 B C   3046 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2868 hydrog ? ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6    ? ? B A   3051 B A   3052 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2869 hydrog ? ? B  A   54   N3    ? ? ? 1_555 B  A   56   N6    ? ? B A   3054 B A   3056 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2870 hydrog ? ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4    ? ? B A   3065 B C   3067 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2871 hydrog ? ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4    ? ? B G   3066 B C   3113 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2872 hydrog ? ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2    ? ? B U   3069 B U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2873 hydrog ? ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3    ? ? B U   3069 B U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2874 hydrog ? ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2    ? ? B U   3070 B U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2875 hydrog ? ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3    ? ? B U   3070 B U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2876 hydrog ? ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2877 hydrog ? ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2878 hydrog ? ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2879 hydrog ? ? B  C   72   N3    ? ? ? 1_555 B  G   109  N1    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2880 hydrog ? ? B  C   72   N4    ? ? ? 1_555 B  G   109  O6    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2881 hydrog ? ? B  C   72   O2    ? ? ? 1_555 B  G   109  N2    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2882 hydrog ? ? B  G   73   N1    ? ? ? 1_555 B  C   108  N3    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2883 hydrog ? ? B  G   73   N2    ? ? ? 1_555 B  C   108  O2    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2884 hydrog ? ? B  G   73   O6    ? ? ? 1_555 B  C   108  N4    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2885 hydrog ? ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2886 hydrog ? ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2887 hydrog ? ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2888 hydrog ? ? B  G   75   N1    ? ? ? 1_555 B  C   106  N3    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ? ? B  G   75   N2    ? ? ? 1_555 B  C   106  O2    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2890 hydrog ? ? B  G   75   O6    ? ? ? 1_555 B  C   106  N4    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2891 hydrog ? ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7    ? ? B G   3076 B A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2892 hydrog ? ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6    ? ? B G   3076 B A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2893 hydrog ? ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7    ? ? B A   3077 B A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2894 hydrog ? ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6    ? ? B A   3077 B A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2895 hydrog ? ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4    ? ? B G   3078 B U   3079 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2896 hydrog ? ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7    ? ? B U   3079 B A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2897 hydrog ? ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6    ? ? B U   3079 B A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2898 hydrog ? ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3    ? ? B A   3080 B G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2899 hydrog ? ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2    ? ? B A   3080 B G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2900 hydrog ? ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2901 hydrog ? ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2902 hydrog ? ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2903 hydrog ? ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6    ? ? B U   3082 B G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2904 hydrog ? ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1    ? ? B U   3082 B G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2905 hydrog ? ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2    ? ? B G   3083 B U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2906 hydrog ? ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3    ? ? B G   3083 B U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2907 hydrog ? ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2908 hydrog ? ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2909 hydrog ? ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2910 hydrog ? ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3    ? ? B A   3085 B U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2911 hydrog ? ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4    ? ? B A   3085 B U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2912 hydrog ? ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2913 hydrog ? ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2914 hydrog ? ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2915 hydrog ? ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2916 hydrog ? ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2917 hydrog ? ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2918 hydrog ? ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2919 hydrog ? ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2920 hydrog ? ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2921 hydrog ? ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7    ? ? B G   3090 B A   3093 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 186 C . ? TRP 186 C PRO 187 C ? PRO 187 C 1 2.78  
2 GLY 14  D . ? GLY 14  D PRO 15  D ? PRO 15  D 1 -0.29 
3 ASN 243 D . ? ASN 243 D PRO 244 D ? PRO 244 D 1 -0.16 
4 VAL 136 E . ? VAL 136 E PRO 137 E ? PRO 137 E 1 0.14  
5 GLN 55  H . ? GLN 55  H PRO 56  H ? PRO 56  H 1 1.01  
6 ARG 184 N . ? ARG 184 N PRO 185 N ? PRO 185 N 1 -3.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
3   ? 3 ? 
5   ? 5 ? 
13  ? 6 ? 
14  ? 7 ? 
29  ? 5 ? 
30  ? 2 ? 
40  ? 4 ? 
44  ? 2 ? 
45  ? 2 ? 
56  ? 3 ? 
51  ? 2 ? 
57  ? 3 ? 
61  ? 4 ? 
63  ? 2 ? 
69  ? 2 ? 
71  ? 1 ? 
74  ? 4 ? 
83  ? 5 ? 
86  ? 2 ? 
87  ? 2 ? 
92  ? 3 ? 
98  ? 3 ? 
100 ? 5 ? 
110 ? 4 ? 
112 ? 2 ? 
116 ? 1 ? 
119 ? 3 ? 
124 ? 5 ? 
128 ? 1 ? 
136 ? 4 ? 
138 ? 3 ? 
142 ? 1 ? 
143 ? 1 ? 
146 ? 2 ? 
149 ? 2 ? 
152 ? 1 ? 
153 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
3   1 2 ? anti-parallel 
3   2 3 ? anti-parallel 
5   1 2 ? anti-parallel 
5   2 3 ? anti-parallel 
5   3 4 ? anti-parallel 
5   4 5 ? anti-parallel 
13  1 2 ? anti-parallel 
13  2 3 ? anti-parallel 
13  3 4 ? anti-parallel 
13  4 5 ? anti-parallel 
13  5 6 ? anti-parallel 
14  1 2 ? anti-parallel 
14  2 3 ? anti-parallel 
14  3 4 ? anti-parallel 
14  4 5 ? anti-parallel 
14  5 6 ? anti-parallel 
14  6 7 ? anti-parallel 
29  1 2 ? parallel      
29  2 3 ? parallel      
29  3 4 ? parallel      
29  4 5 ? parallel      
30  1 2 ? anti-parallel 
40  1 2 ? anti-parallel 
40  2 3 ? anti-parallel 
40  3 4 ? anti-parallel 
44  1 2 ? anti-parallel 
45  1 2 ? anti-parallel 
56  1 2 ? anti-parallel 
56  2 3 ? anti-parallel 
51  1 2 ? anti-parallel 
57  1 2 ? anti-parallel 
57  2 3 ? parallel      
61  1 2 ? anti-parallel 
61  2 3 ? anti-parallel 
61  3 4 ? anti-parallel 
63  1 2 ? anti-parallel 
69  1 2 ? parallel      
74  1 2 ? anti-parallel 
74  2 3 ? parallel      
74  3 4 ? anti-parallel 
83  1 2 ? anti-parallel 
83  2 3 ? anti-parallel 
83  3 4 ? anti-parallel 
83  4 5 ? anti-parallel 
86  1 2 ? parallel      
87  1 2 ? parallel      
92  1 2 ? anti-parallel 
92  2 3 ? anti-parallel 
98  1 2 ? anti-parallel 
98  2 3 ? parallel      
100 1 2 ? parallel      
100 2 3 ? parallel      
100 3 4 ? parallel      
100 4 5 ? parallel      
110 1 2 ? anti-parallel 
110 2 3 ? anti-parallel 
110 3 4 ? anti-parallel 
112 1 2 ? anti-parallel 
119 1 2 ? anti-parallel 
119 2 3 ? anti-parallel 
124 1 2 ? parallel      
124 2 3 ? anti-parallel 
124 3 4 ? anti-parallel 
124 4 5 ? anti-parallel 
136 1 2 ? anti-parallel 
136 2 3 ? anti-parallel 
136 3 4 ? parallel      
138 1 2 ? anti-parallel 
138 2 3 ? parallel      
146 1 2 ? anti-parallel 
149 1 2 ? anti-parallel 
153 1 2 ? anti-parallel 
153 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
3   1 PRO C  54  ? PHE C  60  ? PRO C 54  PHE C 60  
3   2 ALA C  39  ? HIS C  47  ? ALA C 39  HIS C 47  
3   3 GLU C  79  ? GLN C  81  ? GLU C 79  GLN C 81  
5   1 ARG C  153 ? ILE C  156 ? ARG C 153 ILE C 156 
5   2 PRO C  104 ? CYS C  106 ? PRO C 104 CYS C 106 
5   3 ALA C  126 ? THR C  130 ? ALA C 126 THR C 130 
5   4 ALA C  136 ? LYS C  139 ? ALA C 136 LYS C 139 
5   5 MET C  145 ? LEU C  148 ? MET C 145 LEU C 148 
13  1 VAL D  161 ? GLY D  167 ? VAL D 161 GLY D 167 
13  2 LEU D  137 ? HIS D  145 ? LEU D 137 HIS D 145 
13  3 MET D  79  ? THR D  90  ? MET D 79  THR D 90  
13  4 GLY D  93  ? TRP D  101 ? GLY D 93  TRP D 101 
13  5 MET D  79  ? THR D  90  ? MET D 79  THR D 90  
13  6 GLU D  187 ? HIS D  188 ? GLU D 187 HIS D 188 
14  1 VAL D  327 ? VAL D  330 ? VAL D 327 VAL D 330 
14  2 PHE D  41  ? LEU D  53  ? PHE D 41  LEU D 53  
14  3 THR D  68  ? GLU D  75  ? THR D 68  GLU D 75  
14  4 GLY D  292 ? LYS D  298 ? GLY D 292 LYS D 298 
14  5 GLN D  261 ? GLY D  275 ? GLN D 261 GLY D 275 
14  6 TYR D  199 ? VAL D  205 ? TYR D 199 VAL D 205 
14  7 LEU D  308 ? PRO D  313 ? LEU D 308 PRO D 313 
29  1 GLN E  2   ? TYR E  6   ? GLN E 2   TYR E 6   
29  2 VAL E  138 ? VAL E  140 ? VAL E 138 VAL E 140 
29  3 THR E  233 ? THR E  236 ? THR E 233 THR E 236 
29  4 LEU E  193 ? THR E  196 ? LEU E 193 THR E 196 
29  5 ASP E  211 ? THR E  214 ? ASP E 211 THR E 214 
30  1 PRO E  71  ? LEU E  73  ? PRO E 71  LEU E 73  
30  2 ARG E  76  ? ALA E  77  ? ARG E 76  ALA E 77  
40  1 ALA F  71  ? LEU F  75  ? ALA F 71  LEU F 75  
40  2 ARG F  17  ? MET F  25  ? ARG F 17  MET F 25  
40  3 ASP F  129 ? VAL F  135 ? ASP F 129 VAL F 135 
40  4 PHE F  104 ? PHE F  106 ? PHE F 104 PHE F 106 
44  1 THR G  46  ? SER G  51  ? THR G 46  SER G 51  
44  2 ILE G  38  ? ASP G  43  ? ILE G 38  ASP G 43  
45  1 ASP G  19  ? GLY G  24  ? ASP G 19  GLY G 24  
45  2 GLY G  27  ? ARG G  32  ? GLY G 27  ARG G 32  
56  1 TRP G  80  ? PHE G  87  ? TRP G 80  PHE G 87  
56  2 GLU G  130 ? GLY G  135 ? GLU G 130 GLY G 135 
56  3 ASP G  123 ? ASP G  127 ? ASP G 123 ASP G 127 
51  1 GLU G  101 ? GLU G  105 ? GLU G 101 GLU G 105 
51  2 ARG G  114 ? THR G  117 ? ARG G 114 THR G 117 
57  1 ALA H  95  ? VAL H  98  ? ALA H 95  VAL H 98  
57  2 VAL H  48  ? ALA H  51  ? VAL H 48  ALA H 51  
57  3 PHE H  74  ? VAL H  77  ? PHE H 74  VAL H 77  
61  1 LYS J  82  ? ILE J  85  ? LYS J 82  ILE J 85  
61  2 HIS J  130 ? VAL J  136 ? HIS J 130 VAL J 136 
61  3 ALA J  44  ? VAL J  50  ? ALA J 44  VAL J 50  
61  4 ILE J  157 ? SER J  161 ? ILE J 157 SER J 161 
63  1 LYS J  117 ? VAL J  125 ? LYS J 117 VAL J 125 
63  2 HIS J  91  ? GLU J  95  ? HIS J 91  GLU J 95  
69  1 VAL K  36  ? VAL K  39  ? VAL K 36  VAL K 39  
69  2 VAL K  101 ? VAL K  103 ? VAL K 101 VAL K 103 
71  1 PHE K  129 ? THR K  131 ? PHE K 129 THR K 131 
74  1 ILE L  80  ? ARG L  81  ? ILE L 80  ARG L 81  
74  2 ARG L  87  ? PHE L  90  ? ARG L 87  PHE L 90  
74  3 THR V  19  ? VAL V  22  ? THR V 19  VAL V 22  
74  4 THR V  28  ? PHE V  31  ? THR V 28  PHE V 31  
83  1 LEU L  17  ? CYS L  20  ? LEU L 17  CYS L 20  
83  2 ALA L  26  ? VAL L  34  ? ALA L 26  VAL L 34  
83  3 LYS L  52  ? GLY L  60  ? LYS L 52  GLY L 60  
83  4 VAL L  68  ? ARG L  75  ? VAL L 68  ARG L 75  
83  5 ALA L  94  ? VAL L  98  ? ALA L 94  VAL L 98  
86  1 TYR M  105 ? LEU M  109 ? TYR M 105 LEU M 109 
86  2 ASP M  124 ? PHE M  125 ? ASP M 124 PHE M 125 
87  1 THR M  119 ? ALA M  122 ? THR M 119 ALA M 122 
87  2 SER M  139 ? LEU M  142 ? SER M 139 LEU M 142 
92  1 ILE N  60  ? ARG N  68  ? ILE N 60  ARG N 68  
92  2 HIS N  126 ? ILE N  134 ? HIS N 126 ILE N 134 
92  3 ARG N  113 ? GLU N  122 ? ARG N 113 GLU N 122 
98  1 VAL O  43  ? THR O  49  ? VAL O 43  THR O 49  
98  2 ARG O  33  ? LYS O  38  ? ARG O 33  LYS O 38  
98  3 VAL O  101 ? ASP O  103 ? VAL O 101 ASP O 103 
100 1 THR P  57  ? LEU P  65  ? THR P 57  LEU P 65  
100 2 VAL P  111 ? VAL P  113 ? VAL P 111 VAL P 113 
100 3 THR P  57  ? LEU P  65  ? THR P 57  LEU P 65  
100 4 THR P  75  ? PHE P  81  ? THR P 75  PHE P 81  
100 5 GLU P  94  ? SER P  97  ? GLU P 94  SER P 97  
110 1 ALA R  70  ? ASP R  77  ? ALA R 70  ASP R 77  
110 2 THR R  60  ? GLN R  67  ? THR R 60  GLN R 67  
110 3 LYS R  38  ? LEU R  41  ? LYS R 38  LEU R 41  
110 4 LEU R  91  ? ARG R  93  ? LEU R 91  ARG R 93  
112 1 SER S  138 ? GLU S  148 ? SER S 138 GLU S 148 
112 2 THR S  110 ? GLN S  122 ? THR S 110 GLN S 122 
116 1 ARG S  132 ? ALA S  135 ? ARG S 132 ALA S 135 
119 1 LYS T  23  ? VAL T  28  ? LYS T 23  VAL T 28  
119 2 LYS T  62  ? LEU T  68  ? LYS T 62  LEU T 68  
119 3 VAL T  49  ? ASN T  56  ? VAL T 49  ASN T 56  
124 1 ARG U  24  ? LEU U  27  ? ARG U 24  LEU U 27  
124 2 VAL U  96  ? ASP U  100 ? VAL U 96  ASP U 100 
124 3 THR U  47  ? VAL U  50  ? THR U 47  VAL U 50  
124 4 GLU U  59  ? ASP U  66  ? GLU U 59  ASP U 66  
124 5 VAL U  71  ? VAL U  74  ? VAL U 71  VAL U 74  
128 1 GLU U  86  ? PRO U  88  ? GLU U 86  PRO U 88  
136 1 HIS X  31  ? VAL X  35  ? HIS X 31  VAL X 35  
136 2 HIS X  2   ? GLN X  6   ? HIS X 2   GLN X 6   
136 3 VAL X  52  ? GLY X  55  ? VAL X 52  GLY X 55  
136 4 GLY X  139 ? LYS X  140 ? GLY X 139 LYS X 140 
138 1 LYS Y  69  ? PHE Y  77  ? LYS Y 69  PHE Y 77  
138 2 GLU Y  82  ? GLU Y  86  ? GLU Y 82  GLU Y 86  
138 3 VAL Y  48  ? LEU Y  50  ? VAL Y 48  LEU Y 50  
142 1 TYR Z  233 ? VAL Z  236 ? TYR Z 233 VAL Z 236 
143 1 GLU Z  201 ? ILE Z  205 ? GLU Z 201 ILE Z 205 
146 1 ILE AA 45  ? CYS AA 48  ? ILE 1 54  CYS 1 57  
146 2 LYS AA 54  ? ALA AA 56  ? LYS 1 63  ALA 1 65  
149 1 LYS BA 25  ? HIS BA 28  ? LYS 2 25  HIS 2 28  
149 2 VAL BA 33  ? CYS BA 34  ? VAL 2 33  CYS 2 34  
152 1 GLU DA 89  ? GLN DA 91  ? GLU 4 89  GLN 4 91  
153 1 GLN DA 18  ? LYS DA 24  ? GLN 4 18  LYS 4 24  
153 2 LEU DA 67  ? CYS DA 71  ? LEU 4 67  CYS 4 71  
153 3 ALA DA 77  ? HIS DA 78  ? ALA 4 77  HIS 4 78  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
3   1 2 O GLU C  59  ? O GLU C 59  N THR C  41  ? N THR C 41  
3   2 3 N GLY C  40  ? N GLY C 40  O LEU C  80  ? O LEU C 80  
5   1 2 O THR C  155 ? O THR C 155 N CYS C  106 ? N CYS C 106 
5   2 3 O VAL C  105 ? O VAL C 105 N ALA C  126 ? N ALA C 126 
5   3 4 N LEU C  129 ? N LEU C 129 O VAL C  137 ? O VAL C 137 
5   4 5 O VAL C  138 ? O VAL C 138 N LYS C  146 ? N LYS C 146 
13  1 2 N VAL D  166 ? N VAL D 166 O LEU D  140 ? O LEU D 140 
13  2 3 O HIS D  145 ? O HIS D 145 N ARG D  80  ? N ARG D 80  
13  3 4 O THR D  90  ? O THR D 90  N GLY D  93  ? N GLY D 93  
13  4 5 O VAL D  100 ? O VAL D 100 N LEU D  84  ? N LEU D 84  
13  5 6 N MET D  79  ? N MET D 79  O HIS D  188 ? O HIS D 188 
14  1 2 O TYR D  329 ? O TYR D 329 N VAL D  52  ? N VAL D 52  
14  2 3 O VAL D  51  ? O VAL D 51  N VAL D  69  ? N VAL D 69  
14  3 4 N ILE D  74  ? N ILE D 74  O THR D  295 ? O THR D 295 
14  4 5 N LYS D  298 ? N LYS D 298 O ARG D  268 ? O ARG D 268 
14  5 6 N LYS D  267 ? N LYS D 267 O ALA D  200 ? O ALA D 200 
14  6 7 N ALA D  203 ? N ALA D 203 O ARG D  310 ? O ARG D 310 
29  1 2 N TYR E  6   ? N TYR E 6   O VAL E  139 ? O VAL E 139 
29  2 3 N VAL E  138 ? N VAL E 138 O THR E  233 ? O THR E 233 
29  3 4 N VAL E  234 ? N VAL E 234 O LEU E  193 ? O LEU E 193 
29  4 5 N PHE E  194 ? N PHE E 194 O ASP E  211 ? O ASP E 211 
30  1 2 N LEU E  73  ? N LEU E 73  O ARG E  76  ? O ARG E 76  
40  1 2 N LEU F  75  ? N LEU F 75  O VAL F  21  ? O VAL F 21  
40  2 3 O HIS F  24  ? O HIS F 24  N ASP F  129 ? N ASP F 129 
40  3 4 N VAL F  132 ? N VAL F 132 O PHE F  104 ? O PHE F 104 
44  1 2 O GLU G  50  ? O GLU G 50  N ASP G  39  ? N ASP G 39  
45  1 2 N GLY G  24  ? N GLY G 24  O GLY G  27  ? O GLY G 27  
56  1 2 O MET G  84  ? O MET G 84  N LEU G  131 ? N LEU G 131 
56  2 3 O SER G  134 ? O SER G 134 N ASP G  123 ? N ASP G 123 
51  1 2 N ILE G  104 ? N ILE G 104 O ARG G  114 ? O ARG G 114 
57  1 2 O ALA H  96  ? O ALA H 96  N PHE H  49  ? N PHE H 49  
57  2 3 O VAL H  48  ? O VAL H 48  N ILE H  75  ? N ILE H 75  
61  1 2 N ARG J  84  ? N ARG J 84  O ILE J  133 ? O ILE J 133 
61  2 3 O VAL J  136 ? O VAL J 136 N ALA J  44  ? N ALA J 44  
61  3 4 N VAL J  49  ? N VAL J 49  O ASN J  158 ? O ASN J 158 
63  1 2 N ALA J  122 ? N ALA J 122 O HIS J  91  ? O HIS J 91  
69  1 2 N VAL K  38  ? N VAL K 38  O ARG K  102 ? O ARG K 102 
74  1 2 O ILE L  80  ? O ILE L 80  N VAL L  88  ? N VAL L 88  
74  2 3 O ARG L  87  ? O ARG L 87  N MET V  20  ? N MET V 20  
74  3 4 N PHE V  21  ? N PHE V 21  O THR V  29  ? O THR V 29  
83  1 2 N CYS L  20  ? N CYS L 20  O ARG L  27  ? O ARG L 27  
83  2 3 N ILE L  32  ? N ILE L 32  O THR L  54  ? O THR L 54  
83  3 4 N VAL L  55  ? N VAL L 55  O LEU L  69  ? O LEU L 69  
83  4 5 O ARG L  75  ? O ARG L 75  N ALA L  94  ? N ALA L 94  
86  1 2 N VAL M  108 ? N VAL M 108 O ASP M  124 ? O ASP M 124 
87  1 2 N LEU M  120 ? N LEU M 120 O SER M  139 ? O SER M 139 
92  1 2 N ILE N  67  ? N ILE N 67  O LYS N  127 ? O LYS N 127 
92  2 3 N ILE N  134 ? N ILE N 134 O ARG N  113 ? O ARG N 113 
98  1 2 O VAL O  48  ? O VAL O 48  N ARG O  33  ? N ARG O 33  
98  2 3 N LEU O  34  ? N LEU O 34  O VAL O  101 ? O VAL O 101 
100 1 2 N VAL P  59  ? N VAL P 59  O ARG P  112 ? O ARG P 112 
100 2 3 N ARG P  112 ? N ARG P 112 O THR P  57  ? O THR P 57  
100 3 4 N VAL P  58  ? N VAL P 58  O THR P  75  ? O THR P 75  
100 4 5 N VAL P  76  ? N VAL P 76  O GLU P  94  ? O GLU P 94  
110 1 2 N ASP R  74  ? N ASP R 74  O THR R  62  ? O THR R 62  
110 2 3 O GLY R  61  ? O GLY R 61  N VAL R  39  ? N VAL R 39  
110 3 4 N HIS R  40  ? N HIS R 40  O ARG R  92  ? O ARG R 92  
112 1 2 O GLU S  148 ? O GLU S 148 N THR S  110 ? N THR S 110 
119 1 2 N VAL T  28  ? N VAL T 28  O LYS T  62  ? O LYS T 62  
119 2 3 O ARG T  67  ? O ARG T 67  N GLU T  50  ? N GLU T 50  
124 1 2 N THR U  26  ? N THR U 26  O VAL U  96  ? O VAL U 96  
124 2 3 O ASP U  100 ? O ASP U 100 N THR U  47  ? N THR U 47  
124 3 4 N VAL U  48  ? N VAL U 48  O GLY U  60  ? O GLY U 60  
124 4 5 N ASP U  66  ? N ASP U 66  O VAL U  71  ? O VAL U 71  
136 1 2 N VAL X  35  ? N VAL X 35  O HIS X  2   ? O HIS X 2   
136 2 3 N VAL X  5   ? N VAL X 5   O ALA X  53  ? O ALA X 53  
136 3 4 O VAL X  52  ? O VAL X 52  N GLY X  139 ? N GLY X 139 
138 1 2 N PHE Y  77  ? N PHE Y 77  O GLU Y  82  ? O GLU Y 82  
138 2 3 O ALA Y  83  ? O ALA Y 83  N ARG Y  49  ? N ARG Y 49  
146 1 2 N TRP AA 46  ? N TRP 1 55  O ILE AA 55  ? O ILE 1 64  
149 1 2 N HIS BA 28  ? N HIS 2 28  O VAL BA 33  ? O VAL 2 33  
153 1 2 O GLU DA 23  ? O GLU 4 23  N LYS DA 68  ? N LYS 4 68  
153 2 3 O TYR DA 69  ? O TYR 4 69  N HIS DA 78  ? N HIS 4 78  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8001'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8002'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8003'  
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8004'  
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8005'  
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8006'  
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8007'  
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8008'  
AC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8009'  
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8010'  
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8011'  
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8012'  
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8013'  
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8014'  
BC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8015'  
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8016'  
BC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8017'  
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8018'  
CC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8019'  
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8020'  
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8021'  
CC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8022'  
CC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8023'  
CC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8024'  
CC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8025'  
CC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8026'  
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8027'  
DC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8028'  
DC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG A 8029'  
DC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8030'  
DC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8031'  
DC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8032'  
DC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8033'  
DC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8034'  
DC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8035'  
DC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8036'  
EC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8037'  
EC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8038'  
EC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8039'  
EC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8040'  
EC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8041'  
EC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8042'  
EC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8043'  
EC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8044'  
EC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8045'  
FC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8046'  
FC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8047'  
FC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8048'  
FC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8049'  
FC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 8050'  
FC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8051'  
FC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8052'  
FC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8053'  
FC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8054'  
GC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8056'  
GC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8057'  
GC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8058'  
GC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8059'  
GC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8060'  
GC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8061'  
GC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8062'  
GC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8063'  
GC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8064'  
HC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG A 8066'  
HC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8067'  
HC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8068'  
HC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8070'  
HC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8071'  
HC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8072'  
HC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8074'  
HC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8075'  
HC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8076'  
IC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8077'  
IC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8079'  
IC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8080'  
IC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8081'  
IC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8082'  
IC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8083'  
IC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8084'  
IC8 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE MG A 8085'  
IC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8086'  
JC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8087'  
JC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8088'  
JC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8089'  
JC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8090'  
JC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8091'  
JC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8092'  
JC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8093'  
JC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8094'  
JC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8096'  
KC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8097'  
KC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8098'  
KC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8099'  
KC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8100'  
KC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8101'  
KC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8102'  
KC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 8103'  
KC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8104'  
KC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8106'  
LC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8107'  
LC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8108'  
LC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8110'  
LC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8111'  
LC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8112'  
LC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8113'  
LC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8114'  
LC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8115'  
LC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8116'  
MC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8117'  
MC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K A 8201'   
MC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE K A 8202'   
MC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8301'  
MC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8302'  
MC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8303'  
MC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8305'  
MC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8306'  
MC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8307'  
NC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8308'  
NC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8310'  
NC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8311'  
NC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8313'  
NC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8314'  
NC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8315'  
NC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8316'  
NC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8317'  
NC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8318'  
OC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8319'  
OC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA A 8320'  
OC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8321'  
OC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8323'  
OC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8324'  
OC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8325'  
OC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8326'  
OC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8327'  
OC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8328'  
PC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8329'  
PC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8330'  
PC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8331'  
PC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8332'  
PC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8333'  
PC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8334'  
PC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8335'  
PC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8336'  
PC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8338'  
QC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8339'  
QC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8340'  
QC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8341'  
QC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8342'  
QC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8344'  
QC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8349'  
QC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8350'  
QC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8352'  
QC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8353'  
RC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8354'  
RC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8355'  
RC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8356'  
RC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8357'  
RC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8359'  
RC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8360'  
RC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8361'  
RC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8362'  
RC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA A 8363'  
SC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8364'  
SC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8365'  
SC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA A 8366'  
SC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8367'  
SC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8368'  
SC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8369'  
SC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8370'  
SC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8371'  
SC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8372'  
TC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8373'  
TC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8374'  
TC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8375'  
TC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8376'  
TC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8377'  
TC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8378'  
TC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8379'  
TC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8381'  
TC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8382'  
UC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA A 8384'  
UC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8385'  
UC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 8503'  
UC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 8505'  
UC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 8512'  
UC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 8513'  
UC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 8514'  
UC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 8515'  
UC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 8516'  
VC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 8517'  
VC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 8522'  
VC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLM A 9001' 
VC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG B 8095'  
VC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA B 8351'  
VC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA B 8383'  
VC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG C 8065'  
VC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA C 8345'  
VC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL C 8509'  
WC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG D 8055'  
WC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL D 8519'  
WC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA E 8304'  
WC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA J 8309'  
WC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA J 8322'  
WC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA K 8346'  
WC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL K 8501'  
WC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL K 8502'  
WC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL K 8521'  
XC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG L 8069'  
XC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA M 8380'  
XC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL M 8510'  
XC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA N 8347'  
XC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL N 8518'  
XC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL O 8507'  
XC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CD P 8405'  
XC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL P 8508'  
XC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA R 8348'  
YC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL R 8511'  
YC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA S 8337'  
YC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA S 8386'  
YC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL S 8506'  
YC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA T 8312'  
YC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG U 8073'  
YC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA U 8343'  
YC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD V 8401'  
YC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG Z 8109'  
ZC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL Z 8520'  
ZC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 1 8105'  
ZC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 1 8403'  
ZC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 2 8402'  
ZC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 4 8078'  
ZC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 4 8404'  
ZC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL 4 8504'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 7 G   A  2481 ? G   A 2482 . ? 1_555 ? 
2    AC1 7 A   A  2482 ? A   A 2483 . ? 1_555 ? 
3    AC1 7 C   A  2532 ? C   A 2533 . ? 1_555 ? 
4    AC1 7 C   A  2533 ? C   A 2534 . ? 1_555 ? 
5    AC1 7 HOH CJ .    ? HOH A 3608 . ? 1_555 ? 
6    AC1 7 HOH CJ .    ? HOH A 7769 . ? 1_555 ? 
7    AC1 7 HOH CJ .    ? HOH A 9174 . ? 1_555 ? 
8    AC2 6 G   A  626  ? G   A 627  . ? 1_555 ? 
9    AC2 6 A   A  2482 ? A   A 2483 . ? 1_555 ? 
10   AC2 6 C   A  2533 ? C   A 2534 . ? 1_555 ? 
11   AC2 6 HOH CJ .    ? HOH A 4314 . ? 1_555 ? 
12   AC2 6 HOH CJ .    ? HOH A 7747 . ? 1_555 ? 
13   AC2 6 HOH CJ .    ? HOH A 7748 . ? 1_555 ? 
14   AC3 6 A   A  875  ? A   A 876  . ? 1_555 ? 
15   AC3 6 G   A  876  ? G   A 877  . ? 1_555 ? 
16   AC3 6 A   A  2623 ? A   A 2624 . ? 1_555 ? 
17   AC3 6 HOH CJ .    ? HOH A 3659 . ? 1_555 ? 
18   AC3 6 HOH CJ .    ? HOH A 9820 . ? 1_555 ? 
19   AC3 6 HOH EJ .    ? HOH C 8511 . ? 1_555 ? 
20   AC4 6 G   A  455  ? G   A 456  . ? 1_555 ? 
21   AC4 6 A   A  458  ? A   A 459  . ? 1_555 ? 
22   AC4 6 HOH CJ .    ? HOH A 3773 . ? 1_555 ? 
23   AC4 6 HOH CJ .    ? HOH A 7754 . ? 1_555 ? 
24   AC4 6 HOH CJ .    ? HOH A 9048 . ? 1_555 ? 
25   AC4 6 HOH CJ .    ? HOH A 9772 . ? 1_555 ? 
26   AC5 6 A   A  1835 ? A   A 1836 . ? 1_555 ? 
27   AC5 6 U   A  1837 ? U   A 1838 . ? 1_555 ? 
28   AC5 6 A   A  1838 ? A   A 1839 . ? 1_555 ? 
29   AC5 6 HOH CJ .    ? HOH A 3604 . ? 1_555 ? 
30   AC5 6 HOH CJ .    ? HOH A 7770 . ? 1_555 ? 
31   AC5 6 HOH CJ .    ? HOH A 7771 . ? 1_555 ? 
32   AC6 6 U   A  820  ? U   A 821  . ? 1_555 ? 
33   AC6 6 C   A  821  ? C   A 822  . ? 1_555 ? 
34   AC6 6 G   A  853  ? G   A 854  . ? 1_555 ? 
35   AC6 6 HOH CJ .    ? HOH A 3610 . ? 1_555 ? 
36   AC6 6 HOH CJ .    ? HOH A 3745 . ? 1_555 ? 
37   AC6 6 HOH CJ .    ? HOH A 9804 . ? 1_555 ? 
38   AC7 6 U   A  831  ? U   A 832  . ? 1_555 ? 
39   AC7 6 A   A  1838 ? A   A 1839 . ? 1_555 ? 
40   AC7 6 A   A  1839 ? A   A 1840 . ? 1_555 ? 
41   AC7 6 HOH CJ .    ? HOH A 3353 . ? 1_555 ? 
42   AC7 6 HOH CJ .    ? HOH A 7759 . ? 1_555 ? 
43   AC7 6 HOH CJ .    ? HOH A 9007 . ? 1_555 ? 
44   AC8 6 U   A  918  ? U   A 919  . ? 1_555 ? 
45   AC8 6 C   A  2463 ? C   A 2464 . ? 1_555 ? 
46   AC8 6 A   A  2464 ? A   A 2465 . ? 1_555 ? 
47   AC8 6 HOH CJ .    ? HOH A 3623 . ? 1_555 ? 
48   AC8 6 HOH CJ .    ? HOH A 7763 . ? 1_555 ? 
49   AC8 6 HOH CJ .    ? HOH A 7849 . ? 1_555 ? 
50   AC9 7 U   A  2609 ? U   A 2610 . ? 1_555 ? 
51   AC9 7 G   A  2610 ? G   A 2611 . ? 1_555 ? 
52   AC9 7 A   A  2611 ? A   A 2612 . ? 1_555 ? 
53   AC9 7 HOH CJ .    ? HOH A 3731 . ? 1_555 ? 
54   AC9 7 HOH CJ .    ? HOH A 7424 . ? 1_555 ? 
55   AC9 7 HOH CJ .    ? HOH A 7764 . ? 1_555 ? 
56   AC9 7 HOH CJ .    ? HOH A 7765 . ? 1_555 ? 
57   BC1 6 G   A  835  ? G   A 836  . ? 1_555 ? 
58   BC1 6 U   A  2614 ? U   A 2615 . ? 1_555 ? 
59   BC1 6 HOH CJ .    ? HOH A 3831 . ? 1_555 ? 
60   BC1 6 HOH CJ .    ? HOH A 9269 . ? 1_555 ? 
61   BC1 6 HOH CJ .    ? HOH A 9357 . ? 1_555 ? 
62   BC1 6 GLN D  230  ? GLN D 230  . ? 1_555 ? 
63   BC2 6 G   A  823  ? G   A 824  . ? 1_555 ? 
64   BC2 6 G   A  853  ? G   A 854  . ? 1_555 ? 
65   BC2 6 HOH CJ .    ? HOH A 3950 . ? 1_555 ? 
66   BC2 6 HOH CJ .    ? HOH A 4280 . ? 1_555 ? 
67   BC2 6 HOH CJ .    ? HOH A 4413 . ? 1_555 ? 
68   BC2 6 HOH CJ .    ? HOH A 4519 . ? 1_555 ? 
69   BC3 6 G   A  27   ? G   A 28   . ? 1_555 ? 
70   BC3 6 HOH CJ .    ? HOH A 3223 . ? 1_555 ? 
71   BC3 6 HOH CJ .    ? HOH A 3640 . ? 1_555 ? 
72   BC3 6 HOH CJ .    ? HOH A 7850 . ? 1_555 ? 
73   BC3 6 HOH CJ .    ? HOH A 9040 . ? 1_555 ? 
74   BC3 6 HOH CJ .    ? HOH A 9629 . ? 1_555 ? 
75   BC4 6 G   A  876  ? G   A 877  . ? 1_555 ? 
76   BC4 6 G   A  2622 ? G   A 2623 . ? 1_555 ? 
77   BC4 6 HOH CJ .    ? HOH A 3635 . ? 1_555 ? 
78   BC4 6 HOH CJ .    ? HOH A 3647 . ? 1_555 ? 
79   BC4 6 HOH CJ .    ? HOH A 7778 . ? 1_555 ? 
80   BC4 6 HOH CJ .    ? HOH A 9021 . ? 1_555 ? 
81   BC5 6 G   A  2101 ? G   A 2102 . ? 1_555 ? 
82   BC5 6 G   A  2536 ? G   A 2537 . ? 1_555 ? 
83   BC5 6 HOH CJ .    ? HOH A 3652 . ? 1_555 ? 
84   BC5 6 HOH CJ .    ? HOH A 4154 . ? 1_555 ? 
85   BC5 6 HOH CJ .    ? HOH A 7745 . ? 1_555 ? 
86   BC5 6 HOH CJ .    ? HOH A 9034 . ? 1_555 ? 
87   BC6 7 A   A  842  ? A   A 843  . ? 1_555 ? 
88   BC6 7 A   A  843  ? A   A 844  . ? 1_555 ? 
89   BC6 7 A   A  1688 ? A   A 1689 . ? 1_555 ? 
90   BC6 7 HOH CJ .    ? HOH A 3614 . ? 1_555 ? 
91   BC6 7 HOH CJ .    ? HOH A 7780 . ? 1_555 ? 
92   BC6 7 HOH CJ .    ? HOH A 9005 . ? 1_555 ? 
93   BC6 7 HOH CJ .    ? HOH A 9024 . ? 1_555 ? 
94   BC7 6 A   A  1503 ? A   A 1504 . ? 1_555 ? 
95   BC7 6 A   A  1677 ? A   A 1678 . ? 1_555 ? 
96   BC7 6 C   A  1678 ? C   A 1679 . ? 1_555 ? 
97   BC7 6 HOH CJ .    ? HOH A 3738 . ? 1_555 ? 
98   BC7 6 HOH CJ .    ? HOH A 7772 . ? 1_555 ? 
99   BC7 6 HOH CJ .    ? HOH A 7773 . ? 1_555 ? 
100  BC8 7 G   A  455  ? G   A 456  . ? 1_555 ? 
101  BC8 7 HOH CJ .    ? HOH A 3615 . ? 1_555 ? 
102  BC8 7 HOH CJ .    ? HOH A 3935 . ? 1_555 ? 
103  BC8 7 HOH CJ .    ? HOH A 7387 . ? 1_555 ? 
104  BC8 7 HOH CJ .    ? HOH A 7755 . ? 1_555 ? 
105  BC8 7 HOH CJ .    ? HOH A 9408 . ? 1_555 ? 
106  BC8 7 GLY E  86   ? GLY E 86   . ? 1_555 ? 
107  BC9 6 A   A  1290 ? A   A 1291 . ? 1_555 ? 
108  BC9 6 G   A  1291 ? G   A 1292 . ? 1_555 ? 
109  BC9 6 HOH CJ .    ? HOH A 3216 . ? 1_555 ? 
110  BC9 6 HOH CJ .    ? HOH A 3606 . ? 1_555 ? 
111  BC9 6 HOH CJ .    ? HOH A 7462 . ? 1_555 ? 
112  BC9 6 HOH CJ .    ? HOH A 7851 . ? 1_555 ? 
113  CC1 6 A   A  2010 ? A   A 2011 . ? 1_555 ? 
114  CC1 6 HOH CJ .    ? HOH A 4141 . ? 1_555 ? 
115  CC1 6 HOH CJ .    ? HOH A 7233 . ? 1_555 ? 
116  CC1 6 HOH CJ .    ? HOH A 7774 . ? 1_555 ? 
117  CC1 6 HOH CJ .    ? HOH A 7775 . ? 1_555 ? 
118  CC1 6 HOH CJ .    ? HOH A 7776 . ? 1_555 ? 
119  CC2 6 C   A  1829 ? C   A 1830 . ? 1_555 ? 
120  CC2 6 HOH CJ .    ? HOH A 7758 . ? 1_555 ? 
121  CC2 6 HOH CJ .    ? HOH A 7777 . ? 1_555 ? 
122  CC2 6 HOH CJ .    ? HOH A 9121 . ? 1_555 ? 
123  CC2 6 HOH CJ .    ? HOH A 9124 . ? 1_555 ? 
124  CC2 6 HOH CJ .    ? HOH A 9194 . ? 1_555 ? 
125  CC3 6 G   A  2303 ? G   A 2304 . ? 1_555 ? 
126  CC3 6 HOH CJ .    ? HOH A 3631 . ? 1_555 ? 
127  CC3 6 HOH CJ .    ? HOH A 3632 . ? 1_555 ? 
128  CC3 6 HOH CJ .    ? HOH A 7761 . ? 1_555 ? 
129  CC3 6 HOH CJ .    ? HOH A 7762 . ? 1_555 ? 
130  CC3 6 HOH CJ .    ? HOH A 9958 . ? 1_555 ? 
131  CC4 7 G   A  2096 ? G   A 2097 . ? 1_555 ? 
132  CC4 7 U   A  2538 ? U   A 2539 . ? 1_555 ? 
133  CC4 7 G   A  2539 ? G   A 2540 . ? 1_555 ? 
134  CC4 7 HOH CJ .    ? HOH A 3862 . ? 1_555 ? 
135  CC4 7 HOH CJ .    ? HOH A 7766 . ? 1_555 ? 
136  CC4 7 HOH CJ .    ? HOH A 9110 . ? 1_555 ? 
137  CC4 7 HOH CJ .    ? HOH A 9450 . ? 1_555 ? 
138  CC5 7 G   A  2615 ? G   A 2616 . ? 1_555 ? 
139  CC5 7 G   A  2616 ? G   A 2617 . ? 1_555 ? 
140  CC5 7 G   A  2617 ? G   A 2618 . ? 1_555 ? 
141  CC5 7 HOH CJ .    ? HOH A 3621 . ? 1_555 ? 
142  CC5 7 HOH CJ .    ? HOH A 3811 . ? 1_555 ? 
143  CC5 7 HOH CJ .    ? HOH A 7782 . ? 1_555 ? 
144  CC5 7 HOH CJ .    ? HOH A 7783 . ? 1_555 ? 
145  CC6 5 A   A  1380 ? A   A 1381 . ? 1_555 ? 
146  CC6 5 HOH CJ .    ? HOH A 5115 . ? 1_555 ? 
147  CC6 5 HOH CJ .    ? HOH A 7852 . ? 1_555 ? 
148  CC6 5 HOH CJ .    ? HOH A 7853 . ? 1_555 ? 
149  CC6 5 HOH CJ .    ? HOH A 9931 . ? 1_555 ? 
150  CC7 6 U   A  1119 ? U   A 1120 . ? 1_555 ? 
151  CC7 6 G   A  1120 ? G   A 1121 . ? 1_555 ? 
152  CC7 6 HOH CJ .    ? HOH A 4159 . ? 1_555 ? 
153  CC7 6 HOH CJ .    ? HOH A 7784 . ? 1_555 ? 
154  CC7 6 HOH CJ .    ? HOH A 7785 . ? 1_555 ? 
155  CC7 6 HOH CJ .    ? HOH A 7854 . ? 1_555 ? 
156  CC8 6 C   A  2607 ? C   A 2608 . ? 1_555 ? 
157  CC8 6 G   A  2608 ? G   A 2609 . ? 1_555 ? 
158  CC8 6 U   A  2609 ? U   A 2610 . ? 1_555 ? 
159  CC8 6 HOH CJ .    ? HOH A 7786 . ? 1_555 ? 
160  CC8 6 HOH CJ .    ? HOH A 7787 . ? 1_555 ? 
161  CC8 6 HOH CJ .    ? HOH A 9387 . ? 1_555 ? 
162  CC9 6 C   A  239  ? C   A 240  . ? 1_555 ? 
163  CC9 6 G   A  268  ? G   A 269  . ? 1_555 ? 
164  CC9 6 HOH CJ .    ? HOH A 3865 . ? 1_555 ? 
165  CC9 6 HOH CJ .    ? HOH A 4005 . ? 1_555 ? 
166  CC9 6 HOH CJ .    ? HOH A 4146 . ? 1_555 ? 
167  CC9 6 HOH PJ .    ? HOH N 8641 . ? 1_555 ? 
168  DC1 7 A   A  1447 ? A   A 1448 . ? 1_555 ? 
169  DC1 7 U   A  1676 ? U   A 1677 . ? 1_555 ? 
170  DC1 7 HOH CJ .    ? HOH A 3670 . ? 1_555 ? 
171  DC1 7 HOH CJ .    ? HOH A 3690 . ? 1_555 ? 
172  DC1 7 HOH CJ .    ? HOH A 3702 . ? 1_555 ? 
173  DC1 7 HOH CJ .    ? HOH A 7790 . ? 1_555 ? 
174  DC1 7 HOH CJ .    ? HOH A 9568 . ? 1_555 ? 
175  DC2 8 A   A  1501 ? A   A 1502 . ? 1_555 ? 
176  DC2 8 U   A  1502 ? U   A 1503 . ? 1_555 ? 
177  DC2 8 A   A  1503 ? A   A 1504 . ? 1_555 ? 
178  DC2 8 C   A  1678 ? C   A 1679 . ? 1_555 ? 
179  DC2 8 HOH CJ .    ? HOH A 7791 . ? 1_555 ? 
180  DC2 8 HOH CJ .    ? HOH A 7792 . ? 1_555 ? 
181  DC2 8 HOH CJ .    ? HOH A 7793 . ? 1_555 ? 
182  DC2 8 HOH CJ .    ? HOH A 7794 . ? 1_555 ? 
183  DC3 6 U   A  1747 ? U   A 1748 . ? 1_555 ? 
184  DC3 6 U   A  1748 ? U   A 1749 . ? 1_555 ? 
185  DC3 6 HOH CJ .    ? HOH A 3633 . ? 1_555 ? 
186  DC3 6 HOH CJ .    ? HOH A 7756 . ? 1_555 ? 
187  DC3 6 HOH CJ .    ? HOH A 7757 . ? 1_555 ? 
188  DC3 6 HOH CJ .    ? HOH A 7767 . ? 1_555 ? 
189  DC4 7 U   A  776  ? U   A 777  . ? 1_555 ? 
190  DC4 7 C   A  777  ? C   A 778  . ? 1_555 ? 
191  DC4 7 HOH CJ .    ? HOH A 3273 . ? 1_555 ? 
192  DC4 7 HOH CJ .    ? HOH A 7796 . ? 1_555 ? 
193  DC4 7 HOH CJ .    ? HOH A 7797 . ? 1_555 ? 
194  DC4 7 HOH CJ .    ? HOH A 7798 . ? 1_555 ? 
195  DC4 7 NA  FF .    ? NA  A 8325 . ? 1_555 ? 
196  DC5 6 U   A  2114 ? U   A 2115 . ? 1_555 ? 
197  DC5 6 HOH CJ .    ? HOH A 3716 . ? 1_555 ? 
198  DC5 6 HOH CJ .    ? HOH A 3779 . ? 1_555 ? 
199  DC5 6 HOH CJ .    ? HOH A 4181 . ? 1_555 ? 
200  DC5 6 HOH CJ .    ? HOH A 9984 . ? 1_555 ? 
201  DC5 6 HOH EJ .    ? HOH C 8629 . ? 1_555 ? 
202  DC6 6 A   A  1746 ? A   A 1747 . ? 1_555 ? 
203  DC6 6 U   A  1747 ? U   A 1748 . ? 1_555 ? 
204  DC6 6 U   A  1748 ? U   A 1749 . ? 1_555 ? 
205  DC6 6 G   A  2584 ? G   A 2585 . ? 1_555 ? 
206  DC6 6 HOH CJ .    ? HOH A 3807 . ? 1_555 ? 
207  DC6 6 HOH CJ .    ? HOH A 9668 . ? 1_555 ? 
208  DC7 6 A   A  2301 ? A   A 2302 . ? 1_555 ? 
209  DC7 6 A   A  2302 ? A   A 2303 . ? 1_555 ? 
210  DC7 6 HOH CJ .    ? HOH A 3636 . ? 1_555 ? 
211  DC7 6 HOH CJ .    ? HOH A 3761 . ? 1_555 ? 
212  DC7 6 HOH CJ .    ? HOH A 4862 . ? 1_555 ? 
213  DC7 6 HOH CJ .    ? HOH A 7799 . ? 1_555 ? 
214  DC8 6 G   A  1483 ? G   A 1484 . ? 1_555 ? 
215  DC8 6 HOH CJ .    ? HOH A 3707 . ? 1_555 ? 
216  DC8 6 HOH CJ .    ? HOH A 7800 . ? 1_555 ? 
217  DC8 6 HOH CJ .    ? HOH A 7801 . ? 1_555 ? 
218  DC8 6 HOH CJ .    ? HOH A 7856 . ? 1_555 ? 
219  DC8 6 HOH CJ .    ? HOH A 7857 . ? 1_555 ? 
220  DC9 6 G   A  955  ? G   A 956  . ? 1_555 ? 
221  DC9 6 HOH CJ .    ? HOH A 3662 . ? 1_555 ? 
222  DC9 6 HOH CJ .    ? HOH A 7802 . ? 1_555 ? 
223  DC9 6 HOH CJ .    ? HOH A 7803 . ? 1_555 ? 
224  DC9 6 HOH CJ .    ? HOH A 7804 . ? 1_555 ? 
225  DC9 6 HOH CJ .    ? HOH A 9362 . ? 1_555 ? 
226  EC1 7 A   A  2552 ? A   A 2553 . ? 1_555 ? 
227  EC1 7 A   A  2575 ? A   A 2576 . ? 1_555 ? 
228  EC1 7 HOH CJ .    ? HOH A 3132 . ? 1_555 ? 
229  EC1 7 HOH CJ .    ? HOH A 3206 . ? 1_555 ? 
230  EC1 7 HOH CJ .    ? HOH A 3641 . ? 1_555 ? 
231  EC1 7 HOH CJ .    ? HOH A 7858 . ? 1_555 ? 
232  EC1 7 HOH CJ .    ? HOH A 9079 . ? 1_555 ? 
233  EC2 6 HOH CJ .    ? HOH A 3619 . ? 1_555 ? 
234  EC2 6 HOH CJ .    ? HOH A 3642 . ? 1_555 ? 
235  EC2 6 HOH CJ .    ? HOH A 3663 . ? 1_555 ? 
236  EC2 6 HOH CJ .    ? HOH A 3665 . ? 1_555 ? 
237  EC2 6 HOH CJ .    ? HOH A 7806 . ? 1_555 ? 
238  EC2 6 HOH CJ .    ? HOH A 9279 . ? 1_555 ? 
239  EC3 6 U   A  114  ? U   A 115  . ? 1_555 ? 
240  EC3 6 HOH CJ .    ? HOH A 3956 . ? 1_555 ? 
241  EC3 6 HOH CJ .    ? HOH A 5094 . ? 1_555 ? 
242  EC3 6 HOH CJ .    ? HOH A 7807 . ? 1_555 ? 
243  EC3 6 HOH CJ .    ? HOH A 7808 . ? 1_555 ? 
244  EC3 6 HOH CJ .    ? HOH A 9904 . ? 1_555 ? 
245  EC4 6 U   A  391  ? U   A 392  . ? 1_555 ? 
246  EC4 6 HOH CJ .    ? HOH A 3780 . ? 1_555 ? 
247  EC4 6 HOH CJ .    ? HOH A 4637 . ? 1_555 ? 
248  EC4 6 HOH CJ .    ? HOH A 7860 . ? 1_555 ? 
249  EC4 6 HOH CJ .    ? HOH A 7861 . ? 1_555 ? 
250  EC4 6 HOH CJ .    ? HOH A 9682 . ? 1_555 ? 
251  EC5 7 C   A  194  ? C   A 195  . ? 1_555 ? 
252  EC5 7 G   A  195  ? G   A 196  . ? 1_555 ? 
253  EC5 7 A   A  226  ? A   A 227  . ? 1_555 ? 
254  EC5 7 C   A  227  ? C   A 228  . ? 1_555 ? 
255  EC5 7 HOH CJ .    ? HOH A 4099 . ? 1_555 ? 
256  EC5 7 HOH CJ .    ? HOH A 4192 . ? 1_555 ? 
257  EC5 7 HOH CJ .    ? HOH A 5375 . ? 1_555 ? 
258  EC6 6 U   A  1308 ? U   A 1309 . ? 1_555 ? 
259  EC6 6 U   A  1345 ? U   A 1346 . ? 1_555 ? 
260  EC6 6 HOH CJ .    ? HOH A 3650 . ? 1_555 ? 
261  EC6 6 HOH CJ .    ? HOH A 4409 . ? 1_555 ? 
262  EC6 6 HOH CJ .    ? HOH A 7809 . ? 1_555 ? 
263  EC6 6 HOH CJ .    ? HOH A 9429 . ? 1_555 ? 
264  EC7 6 G   A  815  ? G   A 816  . ? 1_555 ? 
265  EC7 6 G   A  816  ? G   A 817  . ? 1_555 ? 
266  EC7 6 HOH CJ .    ? HOH A 7413 . ? 1_555 ? 
267  EC7 6 HOH CJ .    ? HOH A 7862 . ? 1_555 ? 
268  EC7 6 MG  YD .    ? MG  A 8106 . ? 1_555 ? 
269  EC7 6 HOH CJ .    ? HOH A 9808 . ? 1_555 ? 
270  EC8 6 C   A  2047 ? C   A 2048 . ? 1_555 ? 
271  EC8 6 C   A  2087 ? C   A 2088 . ? 1_555 ? 
272  EC8 6 A   A  2088 ? A   A 2089 . ? 1_555 ? 
273  EC8 6 HOH CJ .    ? HOH A 3293 . ? 1_555 ? 
274  EC8 6 HOH CJ .    ? HOH A 7810 . ? 1_555 ? 
275  EC8 6 GLY S  65   ? GLY S 65   . ? 1_555 ? 
276  EC9 5 G   A  1978 ? G   A 1979 . ? 1_555 ? 
277  EC9 5 HOH CJ .    ? HOH A 7811 . ? 1_555 ? 
278  EC9 5 HOH CJ .    ? HOH A 7863 . ? 1_555 ? 
279  EC9 5 HOH CJ .    ? HOH A 7864 . ? 1_555 ? 
280  EC9 5 HOH CJ .    ? HOH A 7865 . ? 1_555 ? 
281  FC1 4 G   A  1793 ? G   A 1794 . ? 1_555 ? 
282  FC1 4 HOH CJ .    ? HOH A 7294 . ? 1_555 ? 
283  FC1 4 HOH CJ .    ? HOH A 7866 . ? 1_555 ? 
284  FC1 4 HOH CJ .    ? HOH A 7867 . ? 1_555 ? 
285  FC2 4 A   A  1097 ? A   A 1098 . ? 1_555 ? 
286  FC2 4 HOH CJ .    ? HOH A 3126 . ? 1_555 ? 
287  FC2 4 HOH CJ .    ? HOH A 6271 . ? 1_555 ? 
288  FC2 4 HOH CJ .    ? HOH A 7881 . ? 1_555 ? 
289  FC3 6 A   A  2745 ? A   A 2746 . ? 1_555 ? 
290  FC3 6 G   A  2749 ? G   A 2750 . ? 1_555 ? 
291  FC3 6 HOH CJ .    ? HOH A 5876 . ? 1_555 ? 
292  FC3 6 HOH CJ .    ? HOH A 6262 . ? 1_555 ? 
293  FC3 6 HOH CJ .    ? HOH A 7868 . ? 1_555 ? 
294  FC3 6 HOH CJ .    ? HOH A 7906 . ? 1_555 ? 
295  FC4 5 G   A  2420 ? G   A 2421 . ? 1_555 ? 
296  FC4 5 U   A  2421 ? U   A 2422 . ? 1_555 ? 
297  FC4 5 C   A  2422 ? C   A 2423 . ? 1_555 ? 
298  FC4 5 HOH CJ .    ? HOH A 7869 . ? 1_555 ? 
299  FC4 5 HOH CJ .    ? HOH A 7870 . ? 1_555 ? 
300  FC5 2 C   A  2247 ? C   A 2248 . ? 1_555 ? 
301  FC5 2 HOH CJ .    ? HOH A 7317 . ? 1_555 ? 
302  FC6 4 G   A  640  ? G   A 641  . ? 1_555 ? 
303  FC6 4 HOH CJ .    ? HOH A 4094 . ? 1_555 ? 
304  FC6 4 HOH CJ .    ? HOH A 7812 . ? 1_555 ? 
305  FC6 4 HOH CJ .    ? HOH A 7813 . ? 1_555 ? 
306  FC7 7 U   A  1124 ? U   A 1125 . ? 1_555 ? 
307  FC7 7 C   A  1128 ? C   A 1129 . ? 1_555 ? 
308  FC7 7 HOH CJ .    ? HOH A 3617 . ? 1_555 ? 
309  FC7 7 HOH CJ .    ? HOH A 7883 . ? 1_555 ? 
310  FC7 7 G   B  92   ? G   B 3092 . ? 1_555 ? 
311  FC7 7 HOH DJ .    ? HOH B 8389 . ? 1_555 ? 
312  FC7 7 HOH DJ .    ? HOH B 8418 . ? 1_555 ? 
313  FC8 6 G   A  470  ? G   A 471  . ? 1_555 ? 
314  FC8 6 HOH CJ .    ? HOH A 3038 . ? 1_555 ? 
315  FC8 6 HOH CJ .    ? HOH A 4388 . ? 1_555 ? 
316  FC8 6 HOH CJ .    ? HOH A 5614 . ? 1_555 ? 
317  FC8 6 HOH CJ .    ? HOH A 9199 . ? 1_555 ? 
318  FC8 6 HOH CJ .    ? HOH A 9239 . ? 1_555 ? 
319  FC9 6 C   A  161  ? C   A 162  . ? 1_555 ? 
320  FC9 6 U   A  2275 ? U   A 2276 . ? 1_555 ? 
321  FC9 6 HOH CJ .    ? HOH A 7760 . ? 1_555 ? 
322  FC9 6 HOH CJ .    ? HOH A 7814 . ? 1_555 ? 
323  FC9 6 HOH CJ .    ? HOH A 7815 . ? 1_555 ? 
324  FC9 6 HOH CJ .    ? HOH A 9425 . ? 1_555 ? 
325  GC1 6 A   A  2756 ? A   A 2757 . ? 1_555 ? 
326  GC1 6 HOH CJ .    ? HOH A 3660 . ? 1_555 ? 
327  GC1 6 HOH CJ .    ? HOH A 3965 . ? 1_555 ? 
328  GC1 6 HOH CJ .    ? HOH A 7833 . ? 1_555 ? 
329  GC1 6 HOH CJ .    ? HOH A 9976 . ? 1_555 ? 
330  GC1 6 ASN D  335  ? ASN D 335  . ? 1_555 ? 
331  GC2 6 U   A  1882 ? U   A 1883 . ? 1_555 ? 
332  GC2 6 U   A  2011 ? U   A 2012 . ? 1_555 ? 
333  GC2 6 G   A  2012 ? G   A 2013 . ? 1_555 ? 
334  GC2 6 HOH CJ .    ? HOH A 5004 . ? 1_555 ? 
335  GC2 6 HOH CJ .    ? HOH A 7885 . ? 1_555 ? 
336  GC2 6 GLN C  207  ? GLN C 207  . ? 1_555 ? 
337  GC3 6 G   A  2012 ? G   A 2013 . ? 1_555 ? 
338  GC3 6 HOH CJ .    ? HOH A 3755 . ? 1_555 ? 
339  GC3 6 HOH CJ .    ? HOH A 7816 . ? 1_555 ? 
340  GC3 6 HOH CJ .    ? HOH A 7817 . ? 1_555 ? 
341  GC3 6 HOH CJ .    ? HOH A 7885 . ? 1_555 ? 
342  GC3 6 HOH EJ .    ? HOH C 8630 . ? 1_555 ? 
343  GC4 7 G   A  2617 ? G   A 2618 . ? 1_555 ? 
344  GC4 7 HOH CJ .    ? HOH A 3713 . ? 1_555 ? 
345  GC4 7 HOH CJ .    ? HOH A 4041 . ? 1_555 ? 
346  GC4 7 HOH CJ .    ? HOH A 7768 . ? 1_555 ? 
347  GC4 7 MG  FD .    ? MG  A 8085 . ? 1_555 ? 
348  GC4 7 HOH CJ .    ? HOH A 9039 . ? 1_555 ? 
349  GC4 7 HOH CJ .    ? HOH A 9043 . ? 1_555 ? 
350  GC5 5 G   A  174  ? G   A 175  . ? 1_555 ? 
351  GC5 5 HOH CJ .    ? HOH A 7818 . ? 1_555 ? 
352  GC5 5 HOH CJ .    ? HOH A 7819 . ? 1_555 ? 
353  GC5 5 HOH CJ .    ? HOH A 7820 . ? 1_555 ? 
354  GC5 5 HOH CJ .    ? HOH A 9167 . ? 1_555 ? 
355  GC6 6 A   A  1368 ? A   A 1369 . ? 1_555 ? 
356  GC6 6 U   A  2649 ? U   A 2650 . ? 1_555 ? 
357  GC6 6 HOH CJ .    ? HOH A 7821 . ? 1_555 ? 
358  GC6 6 HOH CJ .    ? HOH A 7822 . ? 1_555 ? 
359  GC6 6 HOH CJ .    ? HOH A 7823 . ? 1_555 ? 
360  GC6 6 HOH CJ .    ? HOH A 9814 . ? 1_555 ? 
361  GC7 6 G   A  1488 ? G   A 1489 . ? 1_555 ? 
362  GC7 6 G   A  1490 ? G   A 1491 . ? 1_555 ? 
363  GC7 6 HOH CJ .    ? HOH A 3626 . ? 1_555 ? 
364  GC7 6 HOH CJ .    ? HOH A 3949 . ? 1_555 ? 
365  GC7 6 HOH CJ .    ? HOH A 6173 . ? 1_555 ? 
366  GC7 6 HOH CJ .    ? HOH A 9389 . ? 1_555 ? 
367  GC8 6 HOH CJ .    ? HOH A 4171 . ? 1_555 ? 
368  GC8 6 HOH CJ .    ? HOH A 7001 . ? 1_555 ? 
369  GC8 6 HOH CJ .    ? HOH A 7431 . ? 1_555 ? 
370  GC8 6 HOH CJ .    ? HOH A 7753 . ? 1_555 ? 
371  GC8 6 HOH CJ .    ? HOH A 7832 . ? 1_555 ? 
372  GC8 6 HOH CJ .    ? HOH A 7886 . ? 1_555 ? 
373  GC9 7 U   A  2276 ? U   A 2277 . ? 1_555 ? 
374  GC9 7 U   A  2277 ? U   A 2278 . ? 1_555 ? 
375  GC9 7 G   A  2470 ? G   A 2471 . ? 1_555 ? 
376  GC9 7 HOH CJ .    ? HOH A 3744 . ? 1_555 ? 
377  GC9 7 HOH CJ .    ? HOH A 3752 . ? 1_555 ? 
378  GC9 7 HOH CJ .    ? HOH A 9582 . ? 1_555 ? 
379  GC9 7 HOH CJ .    ? HOH A 9914 . ? 1_555 ? 
380  HC1 1 G   A  2539 ? G   A 2540 . ? 1_555 ? 
381  HC2 6 A   A  1844 ? A   A 1845 . ? 1_555 ? 
382  HC2 6 U   A  1845 ? U   A 1846 . ? 1_555 ? 
383  HC2 6 G   A  1883 ? G   A 1884 . ? 1_555 ? 
384  HC2 6 HOH CJ .    ? HOH A 7825 . ? 1_555 ? 
385  HC2 6 ASN C  188  ? ASN C 188  . ? 1_555 ? 
386  HC2 6 ARG C  190  ? ARG C 190  . ? 1_555 ? 
387  HC3 6 A   A  2567 ? A   A 2568 . ? 1_555 ? 
388  HC3 6 HOH CJ .    ? HOH A 3743 . ? 1_555 ? 
389  HC3 6 HOH CJ .    ? HOH A 4815 . ? 1_555 ? 
390  HC3 6 HOH CJ .    ? HOH A 6222 . ? 1_555 ? 
391  HC3 6 HOH CJ .    ? HOH A 7887 . ? 1_555 ? 
392  HC3 6 HOH CJ .    ? HOH A 9728 . ? 1_555 ? 
393  HC4 5 A   A  165  ? A   A 166  . ? 1_555 ? 
394  HC4 5 G   A  218  ? G   A 219  . ? 1_555 ? 
395  HC4 5 HOH CJ .    ? HOH A 3808 . ? 1_555 ? 
396  HC4 5 HOH CJ .    ? HOH A 5589 . ? 1_555 ? 
397  HC4 5 HOH CJ .    ? HOH A 9122 . ? 1_555 ? 
398  HC5 6 HOH CJ .    ? HOH A 4103 . ? 1_555 ? 
399  HC5 6 HOH CJ .    ? HOH A 6053 . ? 1_555 ? 
400  HC5 6 HOH CJ .    ? HOH A 7417 . ? 1_555 ? 
401  HC5 6 HOH CJ .    ? HOH A 7553 . ? 1_555 ? 
402  HC5 6 HOH CJ .    ? HOH A 7830 . ? 1_555 ? 
403  HC5 6 HOH CJ .    ? HOH A 7831 . ? 1_555 ? 
404  HC6 6 U   A  953  ? U   A 954  . ? 1_555 ? 
405  HC6 6 HOH CJ .    ? HOH A 3228 . ? 1_555 ? 
406  HC6 6 HOH CJ .    ? HOH A 3987 . ? 1_555 ? 
407  HC6 6 HOH CJ .    ? HOH A 7412 . ? 1_555 ? 
408  HC6 6 HOH CJ .    ? HOH A 7829 . ? 1_555 ? 
409  HC6 6 HOH CJ .    ? HOH A 7888 . ? 1_555 ? 
410  HC7 6 A   A  1285 ? A   A 1286 . ? 1_555 ? 
411  HC7 6 A   A  1286 ? A   A 1287 . ? 1_555 ? 
412  HC7 6 HOH CJ .    ? HOH A 7826 . ? 1_555 ? 
413  HC7 6 HOH CJ .    ? HOH A 7827 . ? 1_555 ? 
414  HC7 6 HOH CJ .    ? HOH A 7889 . ? 1_555 ? 
415  HC7 6 HOH CJ .    ? HOH A 7890 . ? 1_555 ? 
416  HC8 6 A   A  906  ? A   A 907  . ? 1_555 ? 
417  HC8 6 A   A  907  ? A   A 908  . ? 1_555 ? 
418  HC8 6 HOH CJ .    ? HOH A 3630 . ? 1_555 ? 
419  HC8 6 HOH CJ .    ? HOH A 3907 . ? 1_555 ? 
420  HC8 6 HOH CJ .    ? HOH A 4930 . ? 1_555 ? 
421  HC8 6 HOH CJ .    ? HOH A 7828 . ? 1_555 ? 
422  HC9 6 HOH EK .    ? HOH 3 7875 . ? 1_555 ? 
423  HC9 6 HOH CJ .    ? HOH A 6848 . ? 1_555 ? 
424  HC9 6 HOH CJ .    ? HOH A 7834 . ? 1_555 ? 
425  HC9 6 HOH CJ .    ? HOH A 7835 . ? 1_555 ? 
426  HC9 6 HOH CJ .    ? HOH A 7891 . ? 1_555 ? 
427  HC9 6 HOH CJ .    ? HOH A 7892 . ? 1_555 ? 
428  IC1 6 C   A  879  ? C   A 880  . ? 1_555 ? 
429  IC1 6 U   A  882  ? U   A 883  . ? 1_555 ? 
430  IC1 6 HOH CJ .    ? HOH A 3616 . ? 1_555 ? 
431  IC1 6 HOH CJ .    ? HOH A 7836 . ? 1_555 ? 
432  IC1 6 HOH CJ .    ? HOH A 7837 . ? 1_555 ? 
433  IC1 6 HOH CJ .    ? HOH A 9238 . ? 1_555 ? 
434  IC2 6 A   A  164  ? A   A 165  . ? 1_555 ? 
435  IC2 6 A   A  166  ? A   A 167  . ? 1_555 ? 
436  IC2 6 C   A  167  ? C   A 168  . ? 1_555 ? 
437  IC2 6 HOH CJ .    ? HOH A 3603 . ? 1_555 ? 
438  IC2 6 HOH CJ .    ? HOH A 3609 . ? 1_555 ? 
439  IC2 6 HOH CJ .    ? HOH A 3622 . ? 1_555 ? 
440  IC3 6 A   A  1683 ? A   A 1684 . ? 1_555 ? 
441  IC3 6 U   A  1723 ? U   A 1724 . ? 1_555 ? 
442  IC3 6 HOH CJ .    ? HOH A 4197 . ? 1_555 ? 
443  IC3 6 HOH CJ .    ? HOH A 4483 . ? 1_555 ? 
444  IC3 6 HOH CJ .    ? HOH A 7838 . ? 1_555 ? 
445  IC3 6 HOH CJ .    ? HOH A 7894 . ? 1_555 ? 
446  IC4 5 C   A  1419 ? C   A 1420 . ? 1_555 ? 
447  IC4 5 C   A  1420 ? C   A 1421 . ? 1_555 ? 
448  IC4 5 G   A  1437 ? G   A 1438 . ? 1_555 ? 
449  IC4 5 HOH CJ .    ? HOH A 4089 . ? 1_555 ? 
450  IC4 5 HOH CJ .    ? HOH A 9603 . ? 1_555 ? 
451  IC5 6 C   A  1435 ? C   A 1436 . ? 1_555 ? 
452  IC5 6 A   A  1436 ? A   A 1437 . ? 1_555 ? 
453  IC5 6 HOH CJ .    ? HOH A 5151 . ? 1_555 ? 
454  IC5 6 HOH CJ .    ? HOH A 5239 . ? 1_555 ? 
455  IC5 6 HOH CJ .    ? HOH A 7902 . ? 1_555 ? 
456  IC5 6 HOH SJ .    ? HOH Q 221  . ? 1_555 ? 
457  IC6 6 A   A  1753 ? A   A 1754 . ? 1_555 ? 
458  IC6 6 HOH CJ .    ? HOH A 3698 . ? 1_555 ? 
459  IC6 6 HOH CJ .    ? HOH A 4142 . ? 1_555 ? 
460  IC6 6 HOH CJ .    ? HOH A 6356 . ? 1_555 ? 
461  IC6 6 HOH CJ .    ? HOH A 7839 . ? 1_555 ? 
462  IC6 6 HOH CJ .    ? HOH A 7895 . ? 1_555 ? 
463  IC7 7 A   A  1741 ? A   A 1742 . ? 1_555 ? 
464  IC7 7 G   A  1744 ? G   A 1745 . ? 1_555 ? 
465  IC7 7 HOH CJ .    ? HOH A 3628 . ? 1_555 ? 
466  IC7 7 HOH CJ .    ? HOH A 7840 . ? 1_555 ? 
467  IC7 7 HOH CJ .    ? HOH A 9247 . ? 1_555 ? 
468  IC7 7 HOH CJ .    ? HOH A 9368 . ? 1_555 ? 
469  IC7 7 HOH CJ .    ? HOH A 9746 . ? 1_555 ? 
470  IC8 9 G   A  2616 ? G   A 2617 . ? 1_555 ? 
471  IC8 9 G   A  2617 ? G   A 2618 . ? 1_555 ? 
472  IC8 9 G   A  2641 ? G   A 2642 . ? 1_555 ? 
473  IC8 9 HOH CJ .    ? HOH A 3778 . ? 1_555 ? 
474  IC8 9 HOH CJ .    ? HOH A 4346 . ? 1_555 ? 
475  IC8 9 HOH CJ .    ? HOH A 4476 . ? 1_555 ? 
476  IC8 9 MG  JC .    ? MG  A 8059 . ? 1_555 ? 
477  IC8 9 HOH CJ .    ? HOH A 9039 . ? 1_555 ? 
478  IC8 9 HOH CJ .    ? HOH A 9594 . ? 1_555 ? 
479  IC9 6 A   A  531  ? A   A 532  . ? 1_555 ? 
480  IC9 6 U   A  532  ? U   A 533  . ? 1_555 ? 
481  IC9 6 HOH CJ .    ? HOH A 3724 . ? 1_555 ? 
482  IC9 6 HOH CJ .    ? HOH A 3966 . ? 1_555 ? 
483  IC9 6 HOH CJ .    ? HOH A 7841 . ? 1_555 ? 
484  IC9 6 HOH CJ .    ? HOH A 7842 . ? 1_555 ? 
485  JC1 4 A   A  681  ? A   A 682  . ? 1_555 ? 
486  JC1 4 G   A  682  ? G   A 683  . ? 1_555 ? 
487  JC1 4 HOH CJ .    ? HOH A 3669 . ? 1_555 ? 
488  JC1 4 HOH CJ .    ? HOH A 7903 . ? 1_555 ? 
489  JC2 7 G   A  2539 ? G   A 2540 . ? 1_555 ? 
490  JC2 7 G   A  2610 ? G   A 2611 . ? 1_555 ? 
491  JC2 7 HOH CJ .    ? HOH A 3042 . ? 1_555 ? 
492  JC2 7 HOH CJ .    ? HOH A 4283 . ? 1_555 ? 
493  JC2 7 HOH CJ .    ? HOH A 7652 . ? 1_555 ? 
494  JC2 7 NA  SF .    ? NA  A 8339 . ? 1_555 ? 
495  JC2 7 HOH CJ .    ? HOH A 9065 . ? 1_555 ? 
496  JC3 7 C   A  514  ? C   A 515  . ? 1_555 ? 
497  JC3 7 A   A  515  ? A   A 516  . ? 1_555 ? 
498  JC3 7 U   A  516  ? U   A 517  . ? 1_555 ? 
499  JC3 7 G   A  517  ? G   A 518  . ? 1_555 ? 
500  JC3 7 HOH CJ .    ? HOH A 7843 . ? 1_555 ? 
501  JC3 7 HOH CJ .    ? HOH A 7896 . ? 1_555 ? 
502  JC3 7 HOH CJ .    ? HOH A 7897 . ? 1_555 ? 
503  JC4 4 A   A  2102 ? A   A 2103 . ? 1_555 ? 
504  JC4 4 U   A  2477 ? U   A 2478 . ? 1_555 ? 
505  JC4 4 HOH CJ .    ? HOH A 3607 . ? 1_555 ? 
506  JC4 4 HOH CJ .    ? HOH A 3788 . ? 1_555 ? 
507  JC5 6 G   A  917  ? G   A 918  . ? 1_555 ? 
508  JC5 6 HOH CJ .    ? HOH A 3321 . ? 1_555 ? 
509  JC5 6 HOH CJ .    ? HOH A 6484 . ? 1_555 ? 
510  JC5 6 HOH CJ .    ? HOH A 7844 . ? 1_555 ? 
511  JC5 6 HOH CJ .    ? HOH A 9093 . ? 1_555 ? 
512  JC5 6 HOH CJ .    ? HOH A 9539 . ? 1_555 ? 
513  JC6 4 C   A  1843 ? C   A 1844 . ? 1_555 ? 
514  JC6 4 HOH CJ .    ? HOH A 3638 . ? 1_555 ? 
515  JC6 4 HOH CJ .    ? HOH A 3653 . ? 1_555 ? 
516  JC6 4 HOH CJ .    ? HOH A 7898 . ? 1_555 ? 
517  JC7 6 A   A  1069 ? A   A 1070 . ? 1_555 ? 
518  JC7 6 G   A  1070 ? G   A 1071 . ? 1_555 ? 
519  JC7 6 HOH CJ .    ? HOH A 3643 . ? 1_555 ? 
520  JC7 6 HOH CJ .    ? HOH A 3674 . ? 1_555 ? 
521  JC7 6 HOH CJ .    ? HOH A 3714 . ? 1_555 ? 
522  JC7 6 HOH CJ .    ? HOH A 9674 . ? 1_555 ? 
523  JC8 4 U   A  1095 ? U   A 1096 . ? 1_555 ? 
524  JC8 4 C   A  1256 ? C   A 1257 . ? 1_555 ? 
525  JC8 4 HOH CJ .    ? HOH A 7845 . ? 1_555 ? 
526  JC8 4 HOH CJ .    ? HOH A 7899 . ? 1_555 ? 
527  JC9 7 G   A  1847 ? G   A 1848 . ? 1_555 ? 
528  JC9 7 G   A  1848 ? G   A 1849 . ? 1_555 ? 
529  JC9 7 HOH CJ .    ? HOH A 3656 . ? 1_555 ? 
530  JC9 7 HOH CJ .    ? HOH A 3691 . ? 1_555 ? 
531  JC9 7 HOH CJ .    ? HOH A 3825 . ? 1_555 ? 
532  JC9 7 HOH CJ .    ? HOH A 3857 . ? 1_555 ? 
533  JC9 7 MG  HE .    ? MG  A 8116 . ? 1_555 ? 
534  KC1 6 G   A  862  ? G   A 863  . ? 1_555 ? 
535  KC1 6 U   A  863  ? U   A 864  . ? 1_555 ? 
536  KC1 6 HOH CJ .    ? HOH A 3336 . ? 1_555 ? 
537  KC1 6 HOH CJ .    ? HOH A 3664 . ? 1_555 ? 
538  KC1 6 HOH CJ .    ? HOH A 3668 . ? 1_555 ? 
539  KC1 6 HOH CJ .    ? HOH A 5551 . ? 1_555 ? 
540  KC2 6 A   A  906  ? A   A 907  . ? 1_555 ? 
541  KC2 6 HOH CJ .    ? HOH A 3365 . ? 1_555 ? 
542  KC2 6 HOH CJ .    ? HOH A 3740 . ? 1_555 ? 
543  KC2 6 HOH CJ .    ? HOH A 9937 . ? 1_555 ? 
544  KC2 6 HOH BK .    ? HOH Z 8542 . ? 1_555 ? 
545  KC2 6 HOH BK .    ? HOH Z 8570 . ? 1_555 ? 
546  KC3 4 A   A  2611 ? A   A 2612 . ? 1_555 ? 
547  KC3 4 HOH CJ .    ? HOH A 3011 . ? 1_555 ? 
548  KC3 4 HOH CJ .    ? HOH A 3671 . ? 1_555 ? 
549  KC3 4 HOH CJ .    ? HOH A 9106 . ? 1_555 ? 
550  KC4 5 G   A  2079 ? G   A 2080 . ? 1_555 ? 
551  KC4 5 HOH CJ .    ? HOH A 3758 . ? 1_555 ? 
552  KC4 5 HOH CJ .    ? HOH A 4240 . ? 1_555 ? 
553  KC4 5 HOH CJ .    ? HOH A 5504 . ? 1_555 ? 
554  KC4 5 HOH CJ .    ? HOH A 7846 . ? 1_555 ? 
555  KC5 6 U   A  2106 ? U   A 2107 . ? 1_555 ? 
556  KC5 6 C   A  2280 ? C   A 2281 . ? 1_555 ? 
557  KC5 6 U   A  2281 ? U   A 2282 . ? 1_555 ? 
558  KC5 6 HOH CJ .    ? HOH A 3739 . ? 1_555 ? 
559  KC5 6 HOH CJ .    ? HOH A 4615 . ? 1_555 ? 
560  KC5 6 HOH CJ .    ? HOH A 6903 . ? 1_555 ? 
561  KC6 6 HOH FK .    ? HOH 4 8521 . ? 1_555 ? 
562  KC6 6 A   A  2433 ? A   A 2434 . ? 1_555 ? 
563  KC6 6 U   A  2457 ? U   A 2458 . ? 1_555 ? 
564  KC6 6 HOH CJ .    ? HOH A 7907 . ? 1_555 ? 
565  KC6 6 HOH CJ .    ? HOH A 9250 . ? 1_555 ? 
566  KC6 6 HOH CJ .    ? HOH A 9887 . ? 1_555 ? 
567  KC7 3 G   A  2577 ? G   A 2578 . ? 1_555 ? 
568  KC7 3 G   A  2578 ? G   A 2579 . ? 1_555 ? 
569  KC7 3 HOH CJ .    ? HOH A 7900 . ? 1_555 ? 
570  KC8 6 C   A  2103 ? C   A 2104 . ? 1_555 ? 
571  KC8 6 C   A  2104 ? C   A 2105 . ? 1_555 ? 
572  KC8 6 HOH CJ .    ? HOH A 7749 . ? 1_555 ? 
573  KC8 6 HOH CJ .    ? HOH A 7750 . ? 1_555 ? 
574  KC8 6 HOH CJ .    ? HOH A 7751 . ? 1_555 ? 
575  KC8 6 HOH CJ .    ? HOH A 7752 . ? 1_555 ? 
576  KC9 7 G   A  816  ? G   A 817  . ? 1_555 ? 
577  KC9 7 HOH CJ .    ? HOH A 3592 . ? 1_555 ? 
578  KC9 7 HOH CJ .    ? HOH A 7408 . ? 1_555 ? 
579  KC9 7 HOH CJ .    ? HOH A 7413 . ? 1_555 ? 
580  KC9 7 HOH CJ .    ? HOH A 7862 . ? 1_555 ? 
581  KC9 7 MG  UB .    ? MG  A 8043 . ? 1_555 ? 
582  KC9 7 HOH SJ .    ? HOH Q 191  . ? 1_555 ? 
583  LC1 6 A   A  1105 ? A   A 1106 . ? 1_555 ? 
584  LC1 6 A   A  1106 ? A   A 1107 . ? 1_555 ? 
585  LC1 6 HOH CJ .    ? HOH A 7871 . ? 1_555 ? 
586  LC1 6 HOH CJ .    ? HOH A 7872 . ? 1_555 ? 
587  LC1 6 HOH CJ .    ? HOH A 7873 . ? 1_555 ? 
588  LC1 6 HOH CJ .    ? HOH A 7874 . ? 1_555 ? 
589  LC2 6 G   A  1999 ? G   A 2000 . ? 1_555 ? 
590  LC2 6 HOH CJ .    ? HOH A 6098 . ? 1_555 ? 
591  LC2 6 HOH CJ .    ? HOH A 7489 . ? 1_555 ? 
592  LC2 6 HOH CJ .    ? HOH A 7876 . ? 1_555 ? 
593  LC2 6 HOH CJ .    ? HOH A 7877 . ? 1_555 ? 
594  LC2 6 HOH CJ .    ? HOH A 7878 . ? 1_555 ? 
595  LC3 6 U   A  902  ? U   A 903  . ? 1_555 ? 
596  LC3 6 A   A  1356 ? A   A 1357 . ? 1_555 ? 
597  LC3 6 HOH CJ .    ? HOH A 3917 . ? 1_555 ? 
598  LC3 6 HOH CJ .    ? HOH A 5399 . ? 1_555 ? 
599  LC3 6 HOH CJ .    ? HOH A 6031 . ? 1_555 ? 
600  LC3 6 HOH CJ .    ? HOH A 9501 . ? 1_555 ? 
601  LC4 6 G   A  2608 ? G   A 2609 . ? 1_555 ? 
602  LC4 6 HOH CJ .    ? HOH A 3297 . ? 1_555 ? 
603  LC4 6 HOH CJ .    ? HOH A 3688 . ? 1_555 ? 
604  LC4 6 HOH CJ .    ? HOH A 3712 . ? 1_555 ? 
605  LC4 6 HOH CJ .    ? HOH A 5600 . ? 1_555 ? 
606  LC4 6 HOH CJ .    ? HOH A 5748 . ? 1_555 ? 
607  LC5 6 A   A  186  ? A   A 187  . ? 1_555 ? 
608  LC5 6 HOH CJ .    ? HOH A 3718 . ? 1_555 ? 
609  LC5 6 HOH CJ .    ? HOH A 3759 . ? 1_555 ? 
610  LC5 6 HOH CJ .    ? HOH A 9126 . ? 1_555 ? 
611  LC5 6 HOH CJ .    ? HOH A 9325 . ? 1_555 ? 
612  LC5 6 HOH CJ .    ? HOH A 9561 . ? 1_555 ? 
613  LC6 6 A   A  2111 ? A   A 2112 . ? 1_555 ? 
614  LC6 6 HOH CJ .    ? HOH A 3744 . ? 1_555 ? 
615  LC6 6 HOH CJ .    ? HOH A 3915 . ? 1_555 ? 
616  LC6 6 HOH CJ .    ? HOH A 6130 . ? 1_555 ? 
617  LC6 6 HOH CJ .    ? HOH A 6400 . ? 1_555 ? 
618  LC6 6 HOH CJ .    ? HOH A 9582 . ? 1_555 ? 
619  LC7 6 A   A  2429 ? A   A 2430 . ? 1_555 ? 
620  LC7 6 HOH CJ .    ? HOH A 3661 . ? 1_555 ? 
621  LC7 6 HOH CJ .    ? HOH A 3955 . ? 1_555 ? 
622  LC7 6 HOH CJ .    ? HOH A 4811 . ? 1_555 ? 
623  LC7 6 HOH CJ .    ? HOH A 9344 . ? 1_555 ? 
624  LC7 6 HOH CJ .    ? HOH A 9443 . ? 1_555 ? 
625  LC8 7 HOH CJ .    ? HOH A 4275 . ? 1_555 ? 
626  LC8 7 HOH CJ .    ? HOH A 4292 . ? 1_555 ? 
627  LC8 7 HOH CJ .    ? HOH A 6410 . ? 1_555 ? 
628  LC8 7 HOH CJ .    ? HOH A 6601 . ? 1_555 ? 
629  LC8 7 HOH CJ .    ? HOH A 6731 . ? 1_555 ? 
630  LC8 7 HOH EJ .    ? HOH C 8552 . ? 1_555 ? 
631  LC8 7 HOH EJ .    ? HOH C 8632 . ? 1_555 ? 
632  LC9 7 U   A  1849 ? U   A 1850 . ? 1_555 ? 
633  LC9 7 HOH CJ .    ? HOH A 3656 . ? 1_555 ? 
634  LC9 7 HOH CJ .    ? HOH A 3680 . ? 1_555 ? 
635  LC9 7 HOH CJ .    ? HOH A 3857 . ? 1_555 ? 
636  LC9 7 HOH CJ .    ? HOH A 6731 . ? 1_555 ? 
637  LC9 7 MG  PD .    ? MG  A 8096 . ? 1_555 ? 
638  LC9 7 HOH EJ .    ? HOH C 8552 . ? 1_555 ? 
639  MC1 6 A   A  1839 ? A   A 1840 . ? 1_555 ? 
640  MC1 6 C   A  1840 ? C   A 1841 . ? 1_555 ? 
641  MC1 6 A   A  2021 ? A   A 2022 . ? 1_555 ? 
642  MC1 6 HOH CJ .    ? HOH A 4630 . ? 1_555 ? 
643  MC1 6 HOH CJ .    ? HOH A 6562 . ? 1_555 ? 
644  MC1 6 HOH CJ .    ? HOH A 9220 . ? 1_555 ? 
645  MC2 3 G   A  2101 ? G   A 2102 . ? 1_555 ? 
646  MC2 3 G   A  2481 ? G   A 2482 . ? 1_555 ? 
647  MC2 3 C   A  2535 ? C   A 2536 . ? 1_555 ? 
648  MC3 8 C   A  161  ? C   A 162  . ? 1_555 ? 
649  MC3 8 U   A  162  ? U   A 163  . ? 1_555 ? 
650  MC3 8 U   A  171  ? U   A 172  . ? 1_555 ? 
651  MC3 8 HOH CJ .    ? HOH A 4918 . ? 1_555 ? 
652  MC3 8 HOH CJ .    ? HOH A 9015 . ? 1_555 ? 
653  MC3 8 HOH CJ .    ? HOH A 9111 . ? 1_555 ? 
654  MC3 8 HOH CJ .    ? HOH A 9145 . ? 1_555 ? 
655  MC3 8 ARG N  82   ? ARG N 82   . ? 1_555 ? 
656  MC4 6 C   A  1068 ? C   A 1069 . ? 1_555 ? 
657  MC4 6 G   A  1071 ? G   A 1072 . ? 1_555 ? 
658  MC4 6 G   A  1086 ? G   A 1087 . ? 1_555 ? 
659  MC4 6 HOH CJ .    ? HOH A 3166 . ? 1_555 ? 
660  MC4 6 HOH CJ .    ? HOH A 3196 . ? 1_555 ? 
661  MC4 6 HOH CJ .    ? HOH A 4964 . ? 1_555 ? 
662  MC5 4 G   A  1118 ? G   A 1119 . ? 1_555 ? 
663  MC5 4 U   A  1119 ? U   A 1120 . ? 1_555 ? 
664  MC5 4 G   A  1120 ? G   A 1121 . ? 1_555 ? 
665  MC5 4 HOH CJ .    ? HOH A 5684 . ? 1_555 ? 
666  MC6 6 A   A  642  ? A   A 643  . ? 1_555 ? 
667  MC6 6 G   A  643  ? G   A 644  . ? 1_555 ? 
668  MC6 6 U   A  903  ? U   A 904  . ? 1_555 ? 
669  MC6 6 C   A  1352 ? C   A 1353 . ? 1_555 ? 
670  MC6 6 G   A  1353 ? G   A 1354 . ? 1_555 ? 
671  MC6 6 ARG M  8    ? ARG M 8    . ? 1_555 ? 
672  MC7 6 A   A  629  ? A   A 630  . ? 1_555 ? 
673  MC7 6 A   A  630  ? A   A 631  . ? 1_555 ? 
674  MC7 6 A   A  2073 ? A   A 2074 . ? 1_555 ? 
675  MC7 6 HOH CJ .    ? HOH A 4080 . ? 1_555 ? 
676  MC7 6 HOH CJ .    ? HOH A 4693 . ? 1_555 ? 
677  MC7 6 HOH CJ .    ? HOH A 5786 . ? 1_555 ? 
678  MC8 5 G   A  2091 ? G   A 2092 . ? 1_555 ? 
679  MC8 5 G   A  2092 ? G   A 2093 . ? 1_555 ? 
680  MC8 5 G   A  2093 ? G   A 2094 . ? 1_555 ? 
681  MC8 5 A   A  2611 ? A   A 2612 . ? 1_555 ? 
682  MC8 5 A   A  2648 ? A   A 2649 . ? 1_555 ? 
683  MC9 4 C   A  39   ? C   A 40   . ? 1_555 ? 
684  MC9 4 G   A  40   ? G   A 41   . ? 1_555 ? 
685  MC9 4 A   A  441  ? A   A 442  . ? 1_555 ? 
686  MC9 4 C   A  442  ? C   A 443  . ? 1_555 ? 
687  NC1 5 C   A  1393 ? C   A 1394 . ? 1_555 ? 
688  NC1 5 U   A  1431 ? U   A 1432 . ? 1_555 ? 
689  NC1 5 G   A  1432 ? G   A 1433 . ? 1_555 ? 
690  NC1 5 U   A  1723 ? U   A 1724 . ? 1_555 ? 
691  NC1 5 HOH CJ .    ? HOH A 3405 . ? 1_555 ? 
692  NC2 3 A   A  2576 ? A   A 2577 . ? 1_555 ? 
693  NC2 3 G   A  2577 ? G   A 2578 . ? 1_555 ? 
694  NC2 3 G   A  2578 ? G   A 2579 . ? 1_555 ? 
695  NC3 5 G   A  2523 ? G   A 2524 . ? 1_555 ? 
696  NC3 5 G   A  2524 ? G   A 2525 . ? 1_555 ? 
697  NC3 5 HOH CJ .    ? HOH A 3567 . ? 1_555 ? 
698  NC3 5 HOH CJ .    ? HOH A 4647 . ? 1_555 ? 
699  NC3 5 HOH CJ .    ? HOH A 9180 . ? 1_555 ? 
700  NC4 6 G   A  2398 ? G   A 2399 . ? 1_555 ? 
701  NC4 6 HOH CJ .    ? HOH A 3826 . ? 1_555 ? 
702  NC4 6 HOH CJ .    ? HOH A 5064 . ? 1_555 ? 
703  NC4 6 HOH CJ .    ? HOH A 5112 . ? 1_555 ? 
704  NC4 6 HOH CJ .    ? HOH A 6060 . ? 1_555 ? 
705  NC4 6 HOH CJ .    ? HOH A 9947 . ? 1_555 ? 
706  NC5 5 U   A  2540 ? U   A 2541 . ? 1_555 ? 
707  NC5 5 U   A  2606 ? U   A 2607 . ? 1_555 ? 
708  NC5 5 HOH CJ .    ? HOH A 3127 . ? 1_555 ? 
709  NC5 5 HOH CJ .    ? HOH A 9326 . ? 1_555 ? 
710  NC5 5 TRP D  242  ? TRP D 242  . ? 1_555 ? 
711  NC6 3 A   A  164  ? A   A 165  . ? 1_555 ? 
712  NC6 3 A   A  165  ? A   A 166  . ? 1_555 ? 
713  NC6 3 A   A  166  ? A   A 167  . ? 1_555 ? 
714  NC7 3 C   A  895  ? C   A 896  . ? 1_555 ? 
715  NC7 3 A   A  896  ? A   A 897  . ? 1_555 ? 
716  NC7 3 HOH CJ .    ? HOH A 6315 . ? 1_555 ? 
717  NC8 6 TRP CA 41   ? TRP 3 42   . ? 1_555 ? 
718  NC8 6 ASN CA 44   ? ASN 3 45   . ? 1_555 ? 
719  NC8 6 HOH EK .    ? HOH 3 4135 . ? 1_555 ? 
720  NC8 6 G   A  1415 ? G   A 1416 . ? 1_555 ? 
721  NC8 6 G   A  1416 ? G   A 1417 . ? 1_555 ? 
722  NC8 6 HOH CJ .    ? HOH A 9275 . ? 1_555 ? 
723  NC9 5 G   A  2542 ? G   A 2543 . ? 1_555 ? 
724  NC9 5 G   A  2543 ? G   A 2544 . ? 1_555 ? 
725  NC9 5 HOH CJ .    ? HOH A 3921 . ? 1_555 ? 
726  NC9 5 NA  BF .    ? NA  A 8320 . ? 1_555 ? 
727  NC9 5 HOH CJ .    ? HOH A 9208 . ? 1_555 ? 
728  OC1 7 A   A  2464 ? A   A 2465 . ? 1_555 ? 
729  OC1 7 G   A  2465 ? G   A 2466 . ? 1_555 ? 
730  OC1 7 HOH CJ .    ? HOH A 4250 . ? 1_555 ? 
731  OC1 7 HOH CJ .    ? HOH A 6046 . ? 1_555 ? 
732  OC1 7 HOH CJ .    ? HOH A 9061 . ? 1_555 ? 
733  OC1 7 ASP M  36   ? ASP M 36   . ? 1_555 ? 
734  OC1 7 HOH OJ .    ? HOH M 8533 . ? 1_555 ? 
735  OC2 8 G   A  2542 ? G   A 2543 . ? 1_555 ? 
736  OC2 8 G   A  2543 ? G   A 2544 . ? 1_555 ? 
737  OC2 8 G   A  2610 ? G   A 2611 . ? 1_555 ? 
738  OC2 8 U   A  2614 ? U   A 2615 . ? 1_555 ? 
739  OC2 8 NA  ZE .    ? NA  A 8318 . ? 1_555 ? 
740  OC2 8 HOH CJ .    ? HOH A 9058 . ? 1_555 ? 
741  OC2 8 HOH CJ .    ? HOH A 9089 . ? 1_555 ? 
742  OC2 8 HOH CJ .    ? HOH A 9737 . ? 1_555 ? 
743  OC3 5 G   A  835  ? G   A 836  . ? 1_555 ? 
744  OC3 5 U   A  836  ? U   A 837  . ? 1_555 ? 
745  OC3 5 A   A  1735 ? A   A 1736 . ? 1_555 ? 
746  OC3 5 A   A  1736 ? A   A 1737 . ? 1_555 ? 
747  OC3 5 ARG D  229  ? ARG D 229  . ? 1_555 ? 
748  OC4 5 G   A  884  ? G   A 885  . ? 1_555 ? 
749  OC4 5 A   A  2111 ? A   A 2112 . ? 1_555 ? 
750  OC4 5 G   A  2112 ? G   A 2113 . ? 1_555 ? 
751  OC4 5 C   A  2474 ? C   A 2475 . ? 1_555 ? 
752  OC4 5 HOH CJ .    ? HOH A 4470 . ? 1_555 ? 
753  OC5 6 A   A  44   ? A   A 45   . ? 1_555 ? 
754  OC5 6 C   A  129  ? C   A 130  . ? 1_555 ? 
755  OC5 6 U   A  145  ? U   A 146  . ? 1_555 ? 
756  OC5 6 G   A  146  ? G   A 147  . ? 1_555 ? 
757  OC5 6 HOH CJ .    ? HOH A 4119 . ? 1_555 ? 
758  OC5 6 HOH CJ .    ? HOH A 9486 . ? 1_555 ? 
759  OC6 7 A   A  775  ? A   A 776  . ? 1_555 ? 
760  OC6 7 U   A  776  ? U   A 777  . ? 1_555 ? 
761  OC6 7 U   A  778  ? U   A 779  . ? 1_555 ? 
762  OC6 7 HOH CJ .    ? HOH A 3273 . ? 1_555 ? 
763  OC6 7 HOH CJ .    ? HOH A 7660 . ? 1_555 ? 
764  OC6 7 MG  IB .    ? MG  A 8031 . ? 1_555 ? 
765  OC6 7 HOH CJ .    ? HOH A 9617 . ? 1_555 ? 
766  OC7 4 G   A  1970 ? G   A 1971 . ? 1_555 ? 
767  OC7 4 G   A  2008 ? G   A 2009 . ? 1_555 ? 
768  OC7 4 A   A  2009 ? A   A 2010 . ? 1_555 ? 
769  OC7 4 U   A  2011 ? U   A 2012 . ? 1_555 ? 
770  OC8 7 U   A  820  ? U   A 821  . ? 1_555 ? 
771  OC8 7 C   A  852  ? C   A 853  . ? 1_555 ? 
772  OC8 7 G   A  853  ? G   A 854  . ? 1_555 ? 
773  OC8 7 U   A  1830 ? U   A 1831 . ? 1_555 ? 
774  OC8 7 HOH CJ .    ? HOH A 3200 . ? 1_555 ? 
775  OC8 7 HOH CJ .    ? HOH A 9038 . ? 1_555 ? 
776  OC8 7 HOH CJ .    ? HOH A 9724 . ? 1_555 ? 
777  OC9 6 G   A  55   ? G   A 56   . ? 1_555 ? 
778  OC9 6 A   A  58   ? A   A 59   . ? 1_555 ? 
779  OC9 6 A   A  59   ? A   A 60   . ? 1_555 ? 
780  OC9 6 G   A  60   ? G   A 61   . ? 1_555 ? 
781  OC9 6 HOH CJ .    ? HOH A 5211 . ? 1_555 ? 
782  OC9 6 HOH CJ .    ? HOH A 6479 . ? 1_555 ? 
783  PC1 4 G   A  65   ? G   A 66   . ? 1_555 ? 
784  PC1 4 U   A  106  ? U   A 107  . ? 1_555 ? 
785  PC1 4 U   A  107  ? U   A 108  . ? 1_555 ? 
786  PC1 4 HOH CJ .    ? HOH A 6580 . ? 1_555 ? 
787  PC2 3 C   A  140  ? C   A 141  . ? 1_555 ? 
788  PC2 3 G   A  141  ? G   A 142  . ? 1_555 ? 
789  PC2 3 HOH CJ .    ? HOH A 9231 . ? 1_555 ? 
790  PC3 5 U   A  169  ? U   A 170  . ? 1_555 ? 
791  PC3 5 C   A  170  ? C   A 171  . ? 1_555 ? 
792  PC3 5 C   A  217  ? C   A 218  . ? 1_555 ? 
793  PC3 5 G   A  220  ? G   A 221  . ? 1_555 ? 
794  PC3 5 HOH CJ .    ? HOH A 9297 . ? 1_555 ? 
795  PC4 5 G   A  385  ? G   A 386  . ? 1_555 ? 
796  PC4 5 G   A  386  ? G   A 387  . ? 1_555 ? 
797  PC4 5 G   A  387  ? G   A 388  . ? 1_555 ? 
798  PC4 5 U   A  401  ? U   A 402  . ? 1_555 ? 
799  PC4 5 HOH CJ .    ? HOH A 7070 . ? 1_555 ? 
800  PC5 4 C   A  1893 ? C   A 1894 . ? 1_555 ? 
801  PC5 4 U   A  1896 ? U   A 1897 . ? 1_555 ? 
802  PC5 4 G   A  1897 ? G   A 1898 . ? 1_555 ? 
803  PC5 4 U   A  1938 ? U   A 1939 . ? 1_555 ? 
804  PC6 5 C   A  1893 ? C   A 1894 . ? 1_555 ? 
805  PC6 5 A   A  1894 ? A   A 1895 . ? 1_555 ? 
806  PC6 5 G   A  1895 ? G   A 1896 . ? 1_555 ? 
807  PC6 5 U   A  1896 ? U   A 1897 . ? 1_555 ? 
808  PC6 5 HOH CJ .    ? HOH A 5245 . ? 1_555 ? 
809  PC7 6 C   A  620  ? C   A 621  . ? 1_555 ? 
810  PC7 6 G   A  621  ? G   A 622  . ? 1_555 ? 
811  PC7 6 U   A  622  ? U   A 623  . ? 1_555 ? 
812  PC7 6 A   A  627  ? A   A 628  . ? 1_555 ? 
813  PC7 6 A   A  629  ? A   A 630  . ? 1_555 ? 
814  PC7 6 HOH CJ .    ? HOH A 9867 . ? 1_555 ? 
815  PC8 6 G   A  1705 ? G   A 1706 . ? 1_555 ? 
816  PC8 6 G   A  1706 ? G   A 1707 . ? 1_555 ? 
817  PC8 6 HOH CJ .    ? HOH A 5335 . ? 1_555 ? 
818  PC8 6 HOH CJ .    ? HOH A 7345 . ? 1_555 ? 
819  PC8 6 HOH CJ .    ? HOH A 7687 . ? 1_555 ? 
820  PC8 6 HOH CJ .    ? HOH A 9919 . ? 1_555 ? 
821  PC9 6 U   A  2658 ? U   A 2659 . ? 1_555 ? 
822  PC9 6 G   A  2659 ? G   A 2660 . ? 1_555 ? 
823  PC9 6 VAL S  72   ? VAL S 72   . ? 1_555 ? 
824  PC9 6 TRP S  75   ? TRP S 75   . ? 1_555 ? 
825  PC9 6 HOH UJ .    ? HOH S 8516 . ? 1_555 ? 
826  PC9 6 HOH UJ .    ? HOH S 8527 . ? 1_555 ? 
827  QC1 5 G   A  2539 ? G   A 2540 . ? 1_555 ? 
828  QC1 5 G   A  2610 ? G   A 2611 . ? 1_555 ? 
829  QC1 5 G   A  2615 ? G   A 2616 . ? 1_555 ? 
830  QC1 5 U   A  2644 ? U   A 2645 . ? 1_555 ? 
831  QC1 5 MG  ID .    ? MG  A 8088 . ? 1_555 ? 
832  QC2 3 U   A  1739 ? U   A 1740 . ? 1_555 ? 
833  QC2 3 U   A  1740 ? U   A 1741 . ? 1_555 ? 
834  QC2 3 G   A  2032 ? G   A 2033 . ? 1_555 ? 
835  QC3 3 G   A  680  ? G   A 681  . ? 1_555 ? 
836  QC3 3 A   A  681  ? A   A 682  . ? 1_555 ? 
837  QC3 3 G   A  682  ? G   A 683  . ? 1_555 ? 
838  QC4 5 G   A  891  ? G   A 892  . ? 1_555 ? 
839  QC4 5 C   A  892  ? C   A 893  . ? 1_555 ? 
840  QC4 5 HOH CJ .    ? HOH A 3300 . ? 1_555 ? 
841  QC4 5 HOH CJ .    ? HOH A 5624 . ? 1_555 ? 
842  QC4 5 HOH CJ .    ? HOH A 6268 . ? 1_555 ? 
843  QC5 6 U   A  2662 ? U   A 2663 . ? 1_555 ? 
844  QC5 6 A   A  2810 ? A   A 2811 . ? 1_555 ? 
845  QC5 6 A   A  2811 ? A   A 2812 . ? 1_555 ? 
846  QC5 6 A   A  2815 ? A   A 2816 . ? 1_555 ? 
847  QC5 6 G   A  2816 ? G   A 2817 . ? 1_555 ? 
848  QC5 6 HOH CJ .    ? HOH A 9219 . ? 1_555 ? 
849  QC6 4 A   A  913  ? A   A 914  . ? 1_555 ? 
850  QC6 4 C   A  914  ? C   A 915  . ? 1_555 ? 
851  QC6 4 C   A  1042 ? C   A 1043 . ? 1_555 ? 
852  QC6 4 G   A  1044 ? G   A 1045 . ? 1_555 ? 
853  QC7 4 U   A  622  ? U   A 623  . ? 1_555 ? 
854  QC7 4 U   A  623  ? U   A 624  . ? 1_555 ? 
855  QC7 4 G   A  900  ? G   A 901  . ? 1_555 ? 
856  QC7 4 HOH CJ .    ? HOH A 6953 . ? 1_555 ? 
857  QC8 4 A   A  954  ? A   A 955  . ? 1_555 ? 
858  QC8 4 HOH CJ .    ? HOH A 6605 . ? 1_555 ? 
859  QC8 4 C   B  81   ? C   B 3081 . ? 1_555 ? 
860  QC8 4 U   B  82   ? U   B 3082 . ? 1_555 ? 
861  QC9 6 A   A  1039 ? A   A 1040 . ? 1_555 ? 
862  QC9 6 G   A  1294 ? G   A 1295 . ? 1_555 ? 
863  QC9 6 A   A  1295 ? A   A 1296 . ? 1_555 ? 
864  QC9 6 HOH CJ .    ? HOH A 4870 . ? 1_555 ? 
865  QC9 6 GLY M  14   ? GLY M 14   . ? 1_555 ? 
866  QC9 6 HOH OJ .    ? HOH M 8512 . ? 1_555 ? 
867  RC1 5 U   A  767  ? U   A 768  . ? 1_555 ? 
868  RC1 5 C   A  768  ? C   A 769  . ? 1_555 ? 
869  RC1 5 G   A  2110 ? G   A 2111 . ? 1_555 ? 
870  RC1 5 A   A  2111 ? A   A 2112 . ? 1_555 ? 
871  RC1 5 HOH CJ .    ? HOH A 4812 . ? 1_555 ? 
872  RC2 4 G   A  1118 ? G   A 1119 . ? 1_555 ? 
873  RC2 4 C   A  1242 ? C   A 1243 . ? 1_555 ? 
874  RC2 4 HOH CJ .    ? HOH A 4804 . ? 1_555 ? 
875  RC2 4 THR K  47   ? THR K 47   . ? 1_555 ? 
876  RC3 5 C   A  919  ? C   A 920  . ? 1_555 ? 
877  RC3 5 U   A  2277 ? U   A 2278 . ? 1_555 ? 
878  RC3 5 G   A  2278 ? G   A 2279 . ? 1_555 ? 
879  RC3 5 A   A  2462 ? A   A 2463 . ? 1_555 ? 
880  RC3 5 HOH CJ .    ? HOH A 9447 . ? 1_555 ? 
881  RC4 4 G   A  940  ? G   A 941  . ? 1_555 ? 
882  RC4 4 U   A  941  ? U   A 942  . ? 1_555 ? 
883  RC4 4 G   A  1023 ? G   A 1024 . ? 1_555 ? 
884  RC4 4 HOH CJ .    ? HOH A 6275 . ? 1_555 ? 
885  RC5 5 G   A  897  ? G   A 898  . ? 1_555 ? 
886  RC5 5 A   A  921  ? A   A 922  . ? 1_555 ? 
887  RC5 5 A   A  922  ? A   A 923  . ? 1_555 ? 
888  RC5 5 G   A  923  ? G   A 924  . ? 1_555 ? 
889  RC5 5 U   A  2108 ? U   A 2109 . ? 1_555 ? 
890  RC6 5 A   A  452  ? A   A 453  . ? 1_555 ? 
891  RC6 5 U   A  453  ? U   A 454  . ? 1_555 ? 
892  RC6 5 C   A  477  ? C   A 478  . ? 1_555 ? 
893  RC6 5 G   A  478  ? G   A 479  . ? 1_555 ? 
894  RC6 5 HOH CJ .    ? HOH A 5957 . ? 1_555 ? 
895  RC7 6 U   A  836  ? U   A 837  . ? 1_555 ? 
896  RC7 6 HOH CJ .    ? HOH A 4898 . ? 1_555 ? 
897  RC7 6 HOH CJ .    ? HOH A 5093 . ? 1_555 ? 
898  RC7 6 HOH CJ .    ? HOH A 6820 . ? 1_555 ? 
899  RC7 6 HOH CJ .    ? HOH A 7334 . ? 1_555 ? 
900  RC7 6 GLN D  230  ? GLN D 230  . ? 1_555 ? 
901  RC8 6 A   A  166  ? A   A 167  . ? 1_555 ? 
902  RC8 6 C   A  167  ? C   A 168  . ? 1_555 ? 
903  RC8 6 G   A  2109 ? G   A 2110 . ? 1_555 ? 
904  RC8 6 G   A  2110 ? G   A 2111 . ? 1_555 ? 
905  RC8 6 U   A  2276 ? U   A 2277 . ? 1_555 ? 
906  RC8 6 HOH CJ .    ? HOH A 5305 . ? 1_555 ? 
907  RC9 2 U   A  1358 ? U   A 1359 . ? 1_555 ? 
908  RC9 2 C   A  1359 ? C   A 1360 . ? 1_555 ? 
909  SC1 5 G   A  635  ? G   A 636  . ? 1_555 ? 
910  SC1 5 U   A  2056 ? U   A 2057 . ? 1_555 ? 
911  SC1 5 G   A  2057 ? G   A 2058 . ? 1_555 ? 
912  SC1 5 HOH CJ .    ? HOH A 9586 . ? 1_555 ? 
913  SC1 5 HOH CJ .    ? HOH A 9811 . ? 1_555 ? 
914  SC2 6 U   A  390  ? U   A 391  . ? 1_555 ? 
915  SC2 6 U   A  391  ? U   A 392  . ? 1_555 ? 
916  SC2 6 U   A  397  ? U   A 398  . ? 1_555 ? 
917  SC2 6 C   A  398  ? C   A 399  . ? 1_555 ? 
918  SC2 6 LYS N  193  ? LYS N 193  . ? 1_555 ? 
919  SC2 6 ALA N  194  ? ALA N 194  . ? 1_555 ? 
920  SC3 8 G   A  543  ? G   A 544  . ? 1_555 ? 
921  SC3 8 G   A  544  ? G   A 545  . ? 1_555 ? 
922  SC3 8 G   A  609  ? G   A 610  . ? 1_555 ? 
923  SC3 8 U   A  610  ? U   A 611  . ? 1_555 ? 
924  SC3 8 HOH CJ .    ? HOH A 3812 . ? 1_555 ? 
925  SC3 8 HOH CJ .    ? HOH A 3873 . ? 1_555 ? 
926  SC3 8 HOH CJ .    ? HOH A 9861 . ? 1_555 ? 
927  SC3 8 HOH CJ .    ? HOH A 9880 . ? 1_555 ? 
928  SC4 6 G   A  463  ? G   A 464  . ? 1_555 ? 
929  SC4 6 G   A  474  ? G   A 475  . ? 1_555 ? 
930  SC4 6 HOH CJ .    ? HOH A 4469 . ? 1_555 ? 
931  SC4 6 HOH CJ .    ? HOH A 4594 . ? 1_555 ? 
932  SC4 6 HOH CJ .    ? HOH A 9823 . ? 1_555 ? 
933  SC4 6 ARG E  55   ? ARG E 55   . ? 1_555 ? 
934  SC5 5 G   A  797  ? G   A 798  . ? 1_555 ? 
935  SC5 5 C   A  798  ? C   A 799  . ? 1_555 ? 
936  SC5 5 G   A  813  ? G   A 814  . ? 1_555 ? 
937  SC5 5 U   A  814  ? U   A 815  . ? 1_555 ? 
938  SC5 5 HOH CJ .    ? HOH A 3877 . ? 1_555 ? 
939  SC6 6 HOH FK .    ? HOH 4 8543 . ? 1_555 ? 
940  SC6 6 U   A  390  ? U   A 391  . ? 1_555 ? 
941  SC6 6 U   A  391  ? U   A 392  . ? 1_555 ? 
942  SC6 6 A   A  394  ? A   A 395  . ? 1_555 ? 
943  SC6 6 U   A  397  ? U   A 398  . ? 1_555 ? 
944  SC6 6 HOH CJ .    ? HOH A 6575 . ? 1_555 ? 
945  SC7 4 G   A  1831 ? G   A 1832 . ? 1_555 ? 
946  SC7 4 A   A  2021 ? A   A 2022 . ? 1_555 ? 
947  SC7 4 HOH CJ .    ? HOH A 4093 . ? 1_555 ? 
948  SC7 4 HOH CJ .    ? HOH A 9104 . ? 1_555 ? 
949  SC8 5 G   A  2490 ? G   A 2491 . ? 1_555 ? 
950  SC8 5 U   A  2491 ? U   A 2492 . ? 1_555 ? 
951  SC8 5 U   A  2527 ? U   A 2528 . ? 1_555 ? 
952  SC8 5 G   A  2528 ? G   A 2529 . ? 1_555 ? 
953  SC8 5 HOH CJ .    ? HOH A 9618 . ? 1_555 ? 
954  SC9 3 U   A  918  ? U   A 919  . ? 1_555 ? 
955  SC9 3 G   A  920  ? G   A 921  . ? 1_555 ? 
956  SC9 3 G   A  923  ? G   A 924  . ? 1_555 ? 
957  TC1 6 G   A  1575 ? G   A 1576 . ? 1_555 ? 
958  TC1 6 U   A  1576 ? U   A 1577 . ? 1_555 ? 
959  TC1 6 G   A  1617 ? G   A 1618 . ? 1_555 ? 
960  TC1 6 G   A  1618 ? G   A 1619 . ? 1_555 ? 
961  TC1 6 C   A  1619 ? C   A 1620 . ? 1_555 ? 
962  TC1 6 HOH CJ .    ? HOH A 3672 . ? 1_555 ? 
963  TC2 5 C   A  194  ? C   A 195  . ? 1_555 ? 
964  TC2 5 G   A  195  ? G   A 196  . ? 1_555 ? 
965  TC2 5 A   A  414  ? A   A 415  . ? 1_555 ? 
966  TC2 5 G   A  415  ? G   A 416  . ? 1_555 ? 
967  TC2 5 HOH CJ .    ? HOH A 9892 . ? 1_555 ? 
968  TC3 5 G   A  867  ? G   A 868  . ? 1_555 ? 
969  TC3 5 G   A  868  ? G   A 869  . ? 1_555 ? 
970  TC3 5 A   A  885  ? A   A 886  . ? 1_555 ? 
971  TC3 5 G   A  886  ? G   A 887  . ? 1_555 ? 
972  TC3 5 HOH CJ .    ? HOH A 9260 . ? 1_555 ? 
973  TC4 7 A   A  631  ? A   A 632  . ? 1_555 ? 
974  TC4 7 C   A  632  ? C   A 633  . ? 1_555 ? 
975  TC4 7 U   A  2534 ? U   A 2535 . ? 1_555 ? 
976  TC4 7 C   A  2535 ? C   A 2536 . ? 1_555 ? 
977  TC4 7 A   A  2537 ? A   A 2538 . ? 1_555 ? 
978  TC4 7 U   A  2538 ? U   A 2539 . ? 1_555 ? 
979  TC4 7 HOH CJ .    ? HOH A 4851 . ? 1_555 ? 
980  TC5 4 G   A  910  ? G   A 911  . ? 1_555 ? 
981  TC5 4 U   A  1292 ? U   A 1293 . ? 1_555 ? 
982  TC5 4 G   A  1294 ? G   A 1295 . ? 1_555 ? 
983  TC5 4 HOH CJ .    ? HOH A 6343 . ? 1_555 ? 
984  TC6 7 C   A  761  ? C   A 762  . ? 1_555 ? 
985  TC6 7 G   A  901  ? G   A 902  . ? 1_555 ? 
986  TC6 7 U   A  902  ? U   A 903  . ? 1_555 ? 
987  TC6 7 HOH CJ .    ? HOH A 3204 . ? 1_555 ? 
988  TC6 7 HIS M  18   ? HIS M 18   . ? 1_555 ? 
989  TC6 7 HOH OJ .    ? HOH M 8528 . ? 1_555 ? 
990  TC6 7 HOH OJ .    ? HOH M 8547 . ? 1_555 ? 
991  TC7 5 U   A  830  ? U   A 831  . ? 1_555 ? 
992  TC7 5 U   A  831  ? U   A 832  . ? 1_555 ? 
993  TC7 5 G   A  832  ? G   A 833  . ? 1_555 ? 
994  TC7 5 HOH CJ .    ? HOH A 3705 . ? 1_555 ? 
995  TC7 5 HOH CJ .    ? HOH A 4417 . ? 1_555 ? 
996  TC8 7 G   A  2584 ? G   A 2585 . ? 1_555 ? 
997  TC8 7 U   A  2585 ? U   A 2586 . ? 1_555 ? 
998  TC8 7 U   A  2586 ? U   A 2587 . ? 1_555 ? 
999  TC8 7 G   A  2591 ? G   A 2592 . ? 1_555 ? 
1000 TC8 7 HOH CJ .    ? HOH A 3682 . ? 1_555 ? 
1001 TC8 7 HOH CJ .    ? HOH A 7072 . ? 1_555 ? 
1002 TC8 7 HOH CJ .    ? HOH A 9324 . ? 1_555 ? 
1003 TC9 3 G   A  2771 ? G   A 2772 . ? 1_555 ? 
1004 TC9 3 G   A  2772 ? G   A 2773 . ? 1_555 ? 
1005 TC9 3 HOH CJ .    ? HOH A 4359 . ? 1_555 ? 
1006 UC1 2 C   A  196  ? C   A 197  . ? 1_555 ? 
1007 UC1 2 HOH CJ .    ? HOH A 5012 . ? 1_555 ? 
1008 UC2 3 G   A  1076 ? G   A 1077 . ? 1_555 ? 
1009 UC2 3 A   A  1078 ? A   A 1079 . ? 1_555 ? 
1010 UC2 3 HOH CJ .    ? HOH A 7680 . ? 1_555 ? 
1011 UC3 2 G   A  1451 ? G   A 1452 . ? 1_555 ? 
1012 UC3 2 G   A  1675 ? G   A 1676 . ? 1_555 ? 
1013 UC4 2 G   A  200  ? G   A 201  . ? 1_555 ? 
1014 UC4 2 U   A  201  ? U   A 202  . ? 1_555 ? 
1015 UC5 5 G   A  2581 ? G   A 2582 . ? 1_555 ? 
1016 UC5 5 A   A  2595 ? A   A 2596 . ? 1_555 ? 
1017 UC5 5 LYS L  14   ? LYS L 14   . ? 1_555 ? 
1018 UC5 5 SER L  33   ? SER L 33   . ? 1_555 ? 
1019 UC5 5 HOH NJ .    ? HOH L 4058 . ? 1_555 ? 
1020 UC6 5 G   A  1298 ? G   A 1299 . ? 1_555 ? 
1021 UC6 5 G   A  1299 ? G   A 1300 . ? 1_555 ? 
1022 UC6 5 A   A  1327 ? A   A 1328 . ? 1_555 ? 
1023 UC6 5 A   A  1328 ? A   A 1329 . ? 1_555 ? 
1024 UC6 5 HOH CJ .    ? HOH A 4652 . ? 1_555 ? 
1025 UC7 4 G   A  643  ? G   A 644  . ? 1_555 ? 
1026 UC7 4 HOH CJ .    ? HOH A 7716 . ? 1_555 ? 
1027 UC7 4 GLN M  7    ? GLN M 7    . ? 1_555 ? 
1028 UC7 4 HIS M  13   ? HIS M 13   . ? 1_555 ? 
1029 UC8 3 A   A  1596 ? A   A 1597 . ? 1_555 ? 
1030 UC8 3 A   A  1597 ? A   A 1598 . ? 1_555 ? 
1031 UC8 3 G   A  1645 ? G   A 1646 . ? 1_555 ? 
1032 UC9 3 G   A  1118 ? G   A 1119 . ? 1_555 ? 
1033 UC9 3 C   A  1242 ? C   A 1243 . ? 1_555 ? 
1034 UC9 3 LYS K  56   ? LYS K 56   . ? 1_555 ? 
1035 VC1 4 C   A  593  ? C   A 594  . ? 1_555 ? 
1036 VC1 4 U   A  594  ? U   A 595  . ? 1_555 ? 
1037 VC1 4 ARG Z  115  ? ARG Z 115  . ? 1_555 ? 
1038 VC1 4 HOH BK .    ? HOH Z 8556 . ? 1_555 ? 
1039 VC2 3 G   A  1071 ? G   A 1072 . ? 1_555 ? 
1040 VC2 3 G   A  1086 ? G   A 1087 . ? 1_555 ? 
1041 VC2 3 A   A  1290 ? A   A 1291 . ? 1_555 ? 
1042 VC3 4 G   A  2098 ? G   A 2099 . ? 1_555 ? 
1043 VC3 4 A   A  2099 ? A   A 2100 . ? 1_555 ? 
1044 VC3 4 G   A  2539 ? G   A 2540 . ? 1_555 ? 
1045 VC3 4 G   A  2645 ? G   A 2646 . ? 1_555 ? 
1046 VC4 4 G   B  21   ? G   B 3021 . ? 1_555 ? 
1047 VC4 4 A   B  56   ? A   B 3056 . ? 1_555 ? 
1048 VC4 4 A   B  57   ? A   B 3057 . ? 1_555 ? 
1049 VC4 4 HOH DJ .    ? HOH B 8518 . ? 1_555 ? 
1050 VC5 2 C   B  40   ? C   B 3040 . ? 1_555 ? 
1051 VC5 2 HOH DJ .    ? HOH B 8407 . ? 1_555 ? 
1052 VC6 5 G   B  21   ? G   B 3021 . ? 1_555 ? 
1053 VC6 5 G   B  22   ? G   B 3022 . ? 1_555 ? 
1054 VC6 5 U   B  55   ? U   B 3055 . ? 1_555 ? 
1055 VC6 5 A   B  57   ? A   B 3057 . ? 1_555 ? 
1056 VC6 5 G   B  58   ? G   B 3058 . ? 1_555 ? 
1057 VC7 6 HOH CJ .    ? HOH A 3960 . ? 1_555 ? 
1058 VC7 6 HOH CJ .    ? HOH A 9920 . ? 1_555 ? 
1059 VC7 6 HOH EJ .    ? HOH C 8523 . ? 1_555 ? 
1060 VC7 6 HOH EJ .    ? HOH C 8549 . ? 1_555 ? 
1061 VC7 6 HOH EJ .    ? HOH C 8601 . ? 1_555 ? 
1062 VC7 6 HOH EJ .    ? HOH C 8631 . ? 1_555 ? 
1063 VC8 7 A   A  2632 ? A   A 2633 . ? 1_555 ? 
1064 VC8 7 PHE C  201  ? PHE C 201  . ? 1_555 ? 
1065 VC8 7 GLY C  202  ? GLY C 202  . ? 1_555 ? 
1066 VC8 7 GLY C  203  ? GLY C 203  . ? 1_555 ? 
1067 VC8 7 HIS C  208  ? HIS C 208  . ? 1_555 ? 
1068 VC8 7 HOH EJ .    ? HOH C 8555 . ? 1_555 ? 
1069 VC8 7 HOH EJ .    ? HOH C 8600 . ? 1_555 ? 
1070 VC9 1 LYS C  178  ? LYS C 178  . ? 1_555 ? 
1071 WC1 6 HOH CJ .    ? HOH A 3749 . ? 1_555 ? 
1072 WC1 6 HOH CJ .    ? HOH A 3785 . ? 1_555 ? 
1073 WC1 6 HOH CJ .    ? HOH A 6418 . ? 1_555 ? 
1074 WC1 6 HOH CJ .    ? HOH A 7711 . ? 1_555 ? 
1075 WC1 6 HOH CJ .    ? HOH A 7884 . ? 1_555 ? 
1076 WC1 6 HOH FJ .    ? HOH D 8665 . ? 1_555 ? 
1077 WC2 4 HOH CJ .    ? HOH A 9575 . ? 1_555 ? 
1078 WC2 4 HOH CJ .    ? HOH A 9639 . ? 1_555 ? 
1079 WC2 4 LYS D  224  ? LYS D 224  . ? 1_555 ? 
1080 WC2 4 HIS D  227  ? HIS D 227  . ? 1_555 ? 
1081 WC3 4 ASP E  45   ? ASP E 45   . ? 1_555 ? 
1082 WC3 4 THR E  94   ? THR E 94   . ? 1_555 ? 
1083 WC3 4 LYS E  96   ? LYS E 96   . ? 1_555 ? 
1084 WC3 4 HOH GJ .    ? HOH E 8311 . ? 1_555 ? 
1085 WC4 6 A   A  1132 ? A   A 1133 . ? 1_555 ? 
1086 WC4 6 G   A  1133 ? G   A 1134 . ? 1_555 ? 
1087 WC4 6 LYS J  150  ? LYS J 150  . ? 1_555 ? 
1088 WC4 6 VAL J  153  ? VAL J 153  . ? 1_555 ? 
1089 WC4 6 THR J  154  ? THR J 154  . ? 1_555 ? 
1090 WC4 6 PRO J  155  ? PRO J 155  . ? 1_555 ? 
1091 WC5 3 C   A  2286 ? C   A 2287 . ? 1_555 ? 
1092 WC5 3 ASP J  109  ? ASP J 109  . ? 1_555 ? 
1093 WC5 3 ARG J  112  ? ARG J 112  . ? 1_555 ? 
1094 WC6 6 HOH CJ .    ? HOH A 5757 . ? 1_555 ? 
1095 WC6 6 HOH CJ .    ? HOH A 9477 . ? 1_555 ? 
1096 WC6 6 ARG K  60   ? ARG K 60   . ? 1_555 ? 
1097 WC6 6 VAL K  61   ? VAL K 61   . ? 1_555 ? 
1098 WC6 6 ILE K  63   ? ILE K 63   . ? 1_555 ? 
1099 WC6 6 TYR K  69   ? TYR K 69   . ? 1_555 ? 
1100 WC7 6 PRO G  36   ? PRO G 36   . ? 1_555 ? 
1101 WC7 6 ASN K  126  ? ASN K 126  . ? 1_555 ? 
1102 WC7 6 ILE K  127  ? ILE K 127  . ? 1_555 ? 
1103 WC7 6 LYS K  128  ? LYS K 128  . ? 1_555 ? 
1104 WC7 6 HOH MJ .    ? HOH K 4038 . ? 1_555 ? 
1105 WC7 6 HOH MJ .    ? HOH K 4193 . ? 1_555 ? 
1106 WC8 3 PRO K  88   ? PRO K 88   . ? 1_555 ? 
1107 WC8 3 HIS K  89   ? HIS K 89   . ? 1_555 ? 
1108 WC8 3 LYS K  90   ? LYS K 90   . ? 1_555 ? 
1109 WC9 4 GLY K  64   ? GLY K 64   . ? 1_555 ? 
1110 WC9 4 ASN K  65   ? ASN K 65   . ? 1_555 ? 
1111 WC9 4 GLY K  68   ? GLY K 68   . ? 1_555 ? 
1112 WC9 4 TYR K  69   ? TYR K 69   . ? 1_555 ? 
1113 XC1 6 HOH CJ .    ? HOH A 3415 . ? 1_555 ? 
1114 XC1 6 HOH CJ .    ? HOH A 4232 . ? 1_555 ? 
1115 XC1 6 HOH CJ .    ? HOH A 6044 . ? 1_555 ? 
1116 XC1 6 ASN L  42   ? ASN L 42   . ? 1_555 ? 
1117 XC1 6 HOH NJ .    ? HOH L 2121 . ? 1_555 ? 
1118 XC1 6 HOH NJ .    ? HOH L 7871 . ? 1_555 ? 
1119 XC2 7 ARG M  27   ? ARG M 27   . ? 1_555 ? 
1120 XC2 7 GLY M  28   ? GLY M 28   . ? 1_555 ? 
1121 XC2 7 GLY M  29   ? GLY M 29   . ? 1_555 ? 
1122 XC2 7 GLY M  31   ? GLY M 31   . ? 1_555 ? 
1123 XC2 7 ALA M  33   ? ALA M 33   . ? 1_555 ? 
1124 XC2 7 GLU M  39   ? GLU M 39   . ? 1_555 ? 
1125 XC2 7 HOH OJ .    ? HOH M 8587 . ? 1_555 ? 
1126 XC3 2 A   A  692  ? A   A 693  . ? 1_555 ? 
1127 XC3 2 ARG M  53   ? ARG M 53   . ? 1_555 ? 
1128 XC4 5 ASN N  106  ? ASN N 106  . ? 1_555 ? 
1129 XC4 5 PHE N  109  ? PHE N 109  . ? 1_555 ? 
1130 XC4 5 PRO N  110  ? PRO N 110  . ? 1_555 ? 
1131 XC4 5 LEU N  112  ? LEU N 112  . ? 1_555 ? 
1132 XC4 5 HOH PJ .    ? HOH N 8626 . ? 1_555 ? 
1133 XC5 5 ASN N  106  ? ASN N 106  . ? 1_555 ? 
1134 XC5 5 VAL N  114  ? VAL N 114  . ? 1_555 ? 
1135 XC5 5 LEU N  157  ? LEU N 157  . ? 1_555 ? 
1136 XC5 5 ARG N  158  ? ARG N 158  . ? 1_555 ? 
1137 XC5 5 THR N  159  ? THR N 159  . ? 1_555 ? 
1138 XC6 4 LYS F  146  ? LYS F 146  . ? 1_555 ? 
1139 XC6 4 ARG O  37   ? ARG O 37   . ? 1_555 ? 
1140 XC6 4 LYS O  38   ? LYS O 38   . ? 1_555 ? 
1141 XC6 4 ASN O  107  ? ASN O 107  . ? 1_555 ? 
1142 XC7 3 HOH CJ .    ? HOH A 6249 . ? 1_555 ? 
1143 XC7 3 HIS P  40   ? HIS P 40   . ? 1_555 ? 
1144 XC7 3 HOH RJ .    ? HOH P 5322 . ? 1_555 ? 
1145 XC8 3 HOH CJ .    ? HOH A 7026 . ? 1_555 ? 
1146 XC8 3 ASN P  44   ? ASN P 44   . ? 1_555 ? 
1147 XC8 3 ARG P  47   ? ARG P 47   . ? 1_555 ? 
1148 XC9 6 ASP R  20   ? ASP R 20   . ? 1_555 ? 
1149 XC9 6 GLY R  22   ? GLY R 22   . ? 1_555 ? 
1150 XC9 6 SER R  24   ? SER R 24   . ? 1_555 ? 
1151 XC9 6 SER R  46   ? SER R 46   . ? 1_555 ? 
1152 XC9 6 HOH TJ .    ? HOH R 1795 . ? 1_555 ? 
1153 XC9 6 HOH TJ .    ? HOH R 5427 . ? 1_555 ? 
1154 YC1 2 C   A  2387 ? C   A 2388 . ? 1_555 ? 
1155 YC1 2 HIS R  53   ? HIS R 53   . ? 1_555 ? 
1156 YC2 5 HOH CJ .    ? HOH A 5918 . ? 1_555 ? 
1157 YC2 5 SER S  70   ? SER S 70   . ? 1_555 ? 
1158 YC2 5 VAL S  72   ? VAL S 72   . ? 1_555 ? 
1159 YC2 5 HOH UJ .    ? HOH S 8525 . ? 1_555 ? 
1160 YC2 5 HOH UJ .    ? HOH S 8527 . ? 1_555 ? 
1161 YC3 3 LYS S  60   ? LYS S 60   . ? 1_555 ? 
1162 YC3 3 GLN S  61   ? GLN S 61   . ? 1_555 ? 
1163 YC3 3 ASN S  63   ? ASN S 63   . ? 1_555 ? 
1164 YC4 1 LYS S  118  ? LYS S 118  . ? 1_555 ? 
1165 YC5 3 HIS T  7    ? HIS T 7    . ? 1_555 ? 
1166 YC5 3 GLU T  61   ? GLU T 61   . ? 1_555 ? 
1167 YC5 3 HOH VJ .    ? HOH T 8324 . ? 1_555 ? 
1168 YC6 6 GLN U  37   ? GLN U 37   . ? 1_555 ? 
1169 YC6 6 ARG U  111  ? ARG U 111  . ? 1_555 ? 
1170 YC6 6 LEU U  112  ? LEU U 112  . ? 1_555 ? 
1171 YC6 6 SER U  114  ? SER U 114  . ? 1_555 ? 
1172 YC6 6 ASP U  117  ? ASP U 117  . ? 1_555 ? 
1173 YC6 6 HOH WJ .    ? HOH U 2868 . ? 1_555 ? 
1174 YC7 7 U   A  307  ? U   A 308  . ? 1_555 ? 
1175 YC7 7 U   A  334  ? U   A 335  . ? 1_555 ? 
1176 YC7 7 A   A  338  ? A   A 339  . ? 1_555 ? 
1177 YC7 7 C   A  341  ? C   A 342  . ? 1_555 ? 
1178 YC7 7 SER U  94   ? SER U 94   . ? 1_555 ? 
1179 YC7 7 ASN U  95   ? ASN U 95   . ? 1_555 ? 
1180 YC7 7 HOH WJ .    ? HOH U 1124 . ? 1_555 ? 
1181 YC8 4 CYS V  6    ? CYS V 6    . ? 1_555 ? 
1182 YC8 4 CYS V  9    ? CYS V 9    . ? 1_555 ? 
1183 YC8 4 CYS V  32   ? CYS V 32   . ? 1_555 ? 
1184 YC8 4 CYS V  36   ? CYS V 36   . ? 1_555 ? 
1185 YC9 7 HIS Z  133  ? HIS Z 133  . ? 1_555 ? 
1186 YC9 7 LYS Z  136  ? LYS Z 136  . ? 1_555 ? 
1187 YC9 7 LYS Z  137  ? LYS Z 137  . ? 1_555 ? 
1188 YC9 7 VAL Z  139  ? VAL Z 139  . ? 1_555 ? 
1189 YC9 7 HOH BK .    ? HOH Z 8561 . ? 1_555 ? 
1190 YC9 7 HOH BK .    ? HOH Z 8584 . ? 1_555 ? 
1191 YC9 7 HOH BK .    ? HOH Z 8618 . ? 1_555 ? 
1192 ZC1 3 G   A  1268 ? G   A 1269 . ? 1_555 ? 
1193 ZC1 3 HOH CJ .    ? HOH A 4930 . ? 1_555 ? 
1194 ZC1 3 ARG Z  169  ? ARG Z 169  . ? 1_555 ? 
1195 ZC2 4 ARG AA 4    ? ARG 1 13   . ? 1_555 ? 
1196 ZC2 4 PHE AA 5    ? PHE 1 14   . ? 1_555 ? 
1197 ZC2 4 HOH CJ .    ? HOH A 5349 . ? 1_555 ? 
1198 ZC2 4 ASN C  174  ? ASN C 174  . ? 1_555 ? 
1199 ZC3 4 CYS AA 30   ? CYS 1 39   . ? 1_555 ? 
1200 ZC3 4 CYS AA 33   ? CYS 1 42   . ? 1_555 ? 
1201 ZC3 4 CYS AA 48   ? CYS 1 57   . ? 1_555 ? 
1202 ZC3 4 CYS AA 51   ? CYS 1 60   . ? 1_555 ? 
1203 ZC4 4 CYS BA 19   ? CYS 2 19   . ? 1_555 ? 
1204 ZC4 4 CYS BA 22   ? CYS 2 22   . ? 1_555 ? 
1205 ZC4 4 CYS BA 34   ? CYS 2 34   . ? 1_555 ? 
1206 ZC4 4 CYS BA 37   ? CYS 2 37   . ? 1_555 ? 
1207 ZC5 6 GLY DA 45   ? GLY 4 45   . ? 1_555 ? 
1208 ZC5 6 GLY DA 47   ? GLY 4 47   . ? 1_555 ? 
1209 ZC5 6 ASP DA 49   ? ASP 4 49   . ? 1_555 ? 
1210 ZC5 6 HOH FK .    ? HOH 4 8524 . ? 1_555 ? 
1211 ZC5 6 HOH FK .    ? HOH 4 8572 . ? 1_555 ? 
1212 ZC5 6 HOH CJ .    ? HOH A 7893 . ? 1_555 ? 
1213 ZC6 4 CYS DA 11   ? CYS 4 11   . ? 1_555 ? 
1214 ZC6 4 CYS DA 14   ? CYS 4 14   . ? 1_555 ? 
1215 ZC6 4 CYS DA 71   ? CYS 4 71   . ? 1_555 ? 
1216 ZC6 4 CYS DA 74   ? CYS 4 74   . ? 1_555 ? 
1217 ZC7 1 ASP DA 66   ? ASP 4 66   . ? 1_555 ? 
# 
_atom_sites.entry_id                    1NJI 
_atom_sites.fract_transf_matrix[1][1]   0.004723 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003336 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  9    ? 16.099  148.953 104.420 1.00 82.94  ? 10   U   A "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  9    ? 17.084  149.965 104.246 1.00 81.79  ? 10   U   A "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  9    ? 18.529  149.514 104.362 1.00 81.07  ? 10   U   A "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  9    ? 18.756  148.908 105.659 1.00 82.05  ? 10   U   A "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  9    ? 19.028  148.433 103.408 1.00 79.28  ? 10   U   A "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  9    ? 19.224  148.987 102.081 1.00 73.96  ? 10   U   A "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  9    ? 20.305  147.967 104.113 1.00 80.71  ? 10   U   A "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  9    ? 21.393  148.832 103.890 1.00 81.79  ? 10   U   A "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  9    ? 19.934  148.121 105.592 1.00 82.50  ? 10   U   A "C1'" 1 
ATOM   10    N  N1    . U   A  1  9    ? 19.776  146.888 106.391 1.00 84.56  ? 10   U   A N1    1 
ATOM   11    C  C2    . U   A  1  9    ? 19.580  147.018 107.773 1.00 85.99  ? 10   U   A C2    1 
ATOM   12    O  O2    . U   A  1  9    ? 19.496  148.097 108.347 1.00 88.04  ? 10   U   A O2    1 
ATOM   13    N  N3    . U   A  1  9    ? 19.483  145.834 108.461 1.00 85.35  ? 10   U   A N3    1 
ATOM   14    C  C4    . U   A  1  9    ? 19.549  144.565 107.940 1.00 85.02  ? 10   U   A C4    1 
ATOM   15    O  O4    . U   A  1  9    ? 19.462  143.602 108.700 1.00 86.00  ? 10   U   A O4    1 
ATOM   16    C  C5    . U   A  1  9    ? 19.734  144.506 106.517 1.00 84.70  ? 10   U   A C5    1 
ATOM   17    C  C6    . U   A  1  9    ? 19.837  145.637 105.811 1.00 84.22  ? 10   U   A C6    1 
ATOM   18    P  P     . A   A  1  10   ? 20.464  148.518 101.144 1.00 67.24  ? 11   A   A P     1 
ATOM   19    O  OP1   . A   A  1  10   ? 20.108  148.817 99.733  1.00 67.66  ? 11   A   A OP1   1 
ATOM   20    O  OP2   . A   A  1  10   ? 20.881  147.141 101.501 1.00 66.88  ? 11   A   A OP2   1 
ATOM   21    O  "O5'" . A   A  1  10   ? 21.618  149.538 101.550 1.00 61.84  ? 11   A   A "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  10   ? 22.950  149.379 101.053 1.00 55.18  ? 11   A   A "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  10   ? 23.930  150.131 101.922 1.00 50.53  ? 11   A   A "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  10   ? 23.725  149.800 103.321 1.00 48.49  ? 11   A   A "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  10   ? 25.379  149.782 101.644 1.00 48.01  ? 11   A   A "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  10   ? 25.870  150.573 100.583 1.00 46.40  ? 11   A   A "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  10   ? 26.048  150.074 102.978 1.00 47.00  ? 11   A   A "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  10   ? 26.248  151.458 103.171 1.00 46.60  ? 11   A   A "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  10   ? 24.976  149.579 103.954 1.00 46.27  ? 11   A   A "C1'" 1 
ATOM   30    N  N9    . A   A  1  10   ? 25.062  148.149 104.263 1.00 45.45  ? 11   A   A N9    1 
ATOM   31    C  C8    . A   A  1  10   ? 24.035  147.241 104.192 1.00 45.04  ? 11   A   A C8    1 
ATOM   32    N  N7    . A   A  1  10   ? 24.378  146.019 104.524 1.00 44.11  ? 11   A   A N7    1 
ATOM   33    C  C5    . A   A  1  10   ? 25.722  146.126 104.839 1.00 43.50  ? 11   A   A C5    1 
ATOM   34    C  C6    . A   A  1  10   ? 26.658  145.185 105.271 1.00 43.11  ? 11   A   A C6    1 
ATOM   35    N  N6    . A   A  1  10   ? 26.366  143.901 105.475 1.00 44.37  ? 11   A   A N6    1 
ATOM   36    N  N1    . A   A  1  10   ? 27.919  145.610 105.494 1.00 42.15  ? 11   A   A N1    1 
ATOM   37    C  C2    . A   A  1  10   ? 28.206  146.903 105.294 1.00 42.75  ? 11   A   A C2    1 
ATOM   38    N  N3    . A   A  1  10   ? 27.407  147.893 104.894 1.00 44.88  ? 11   A   A N3    1 
ATOM   39    C  C4    . A   A  1  10   ? 26.162  147.432 104.680 1.00 44.49  ? 11   A   A C4    1 
ATOM   40    P  P     . U   A  1  11   ? 26.091  149.913 99.143  1.00 47.63  ? 12   U   A P     1 
ATOM   41    O  OP1   . U   A  1  11   ? 26.497  151.015 98.237  1.00 48.17  ? 12   U   A OP1   1 
ATOM   42    O  OP2   . U   A  1  11   ? 24.901  149.090 98.814  1.00 48.05  ? 12   U   A OP2   1 
ATOM   43    O  "O5'" . U   A  1  11   ? 27.342  148.949 99.351  1.00 46.52  ? 12   U   A "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  11   ? 28.630  149.495 99.687  1.00 44.71  ? 12   U   A "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  11   ? 29.529  148.438 100.277 1.00 43.44  ? 12   U   A "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  11   ? 28.999  147.972 101.544 1.00 42.97  ? 12   U   A "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  11   ? 29.672  147.159 99.479  1.00 43.64  ? 12   U   A "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  11   ? 30.531  147.268 98.372  1.00 41.85  ? 12   U   A "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  11   ? 30.207  146.204 100.526 1.00 44.21  ? 12   U   A "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  11   ? 31.583  146.414 100.805 1.00 46.98  ? 12   U   A "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  11   ? 29.355  146.606 101.729 1.00 43.01  ? 12   U   A "C1'" 1 
ATOM   52    N  N1    . U   A  1  11   ? 28.126  145.796 101.789 1.00 42.24  ? 12   U   A N1    1 
ATOM   53    C  C2    . U   A  1  11   ? 28.246  144.462 102.171 1.00 42.22  ? 12   U   A C2    1 
ATOM   54    O  O2    . U   A  1  11   ? 29.321  143.926 102.420 1.00 43.68  ? 12   U   A O2    1 
ATOM   55    N  N3    . U   A  1  11   ? 27.059  143.771 102.229 1.00 41.49  ? 12   U   A N3    1 
ATOM   56    C  C4    . U   A  1  11   ? 25.802  144.249 101.926 1.00 41.10  ? 12   U   A C4    1 
ATOM   57    O  O4    . U   A  1  11   ? 24.840  143.484 101.956 1.00 41.19  ? 12   U   A O4    1 
ATOM   58    C  C5    . U   A  1  11   ? 25.765  145.620 101.526 1.00 41.88  ? 12   U   A C5    1 
ATOM   59    C  C6    . U   A  1  11   ? 26.895  146.330 101.477 1.00 41.53  ? 12   U   A C6    1 
ATOM   60    P  P     . G   A  1  12   ? 30.020  146.768 96.945  1.00 41.87  ? 13   G   A P     1 
ATOM   61    O  OP1   . G   A  1  12   ? 31.233  146.490 96.144  1.00 42.08  ? 13   G   A OP1   1 
ATOM   62    O  OP2   . G   A  1  12   ? 29.039  147.789 96.484  1.00 43.55  ? 13   G   A OP2   1 
ATOM   63    O  "O5'" . G   A  1  12   ? 29.286  145.381 97.246  1.00 38.87  ? 13   G   A "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  12   ? 30.060  144.265 97.712  1.00 38.83  ? 13   G   A "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  12   ? 29.200  143.069 98.082  1.00 38.09  ? 13   G   A "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  12   ? 28.071  143.468 98.885  1.00 37.63  ? 13   G   A "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  12   ? 28.500  142.255 97.008  1.00 36.82  ? 13   G   A "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  12   ? 29.381  141.407 96.281  1.00 38.28  ? 13   G   A "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  12   ? 27.608  141.380 97.873  1.00 36.01  ? 13   G   A "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  12   ? 28.350  140.337 98.475  1.00 34.60  ? 13   G   A "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  12   ? 27.180  142.371 98.960  1.00 35.67  ? 13   G   A "C1'" 1 
ATOM   72    N  N9    . G   A  1  12   ? 25.816  142.845 98.762  1.00 35.36  ? 13   G   A N9    1 
ATOM   73    C  C8    . G   A  1  12   ? 25.406  144.098 98.373  1.00 35.40  ? 13   G   A C8    1 
ATOM   74    N  N7    . G   A  1  12   ? 24.109  144.200 98.264  1.00 36.03  ? 13   G   A N7    1 
ATOM   75    C  C5    . G   A  1  12   ? 23.637  142.941 98.607  1.00 35.19  ? 13   G   A C5    1 
ATOM   76    C  C6    . G   A  1  12   ? 22.317  142.446 98.675  1.00 34.63  ? 13   G   A C6    1 
ATOM   77    O  O6    . G   A  1  12   ? 21.265  143.043 98.458  1.00 34.95  ? 13   G   A O6    1 
ATOM   78    N  N1    . G   A  1  12   ? 22.288  141.110 99.045  1.00 33.75  ? 13   G   A N1    1 
ATOM   79    C  C2    . G   A  1  12   ? 23.391  140.345 99.318  1.00 34.43  ? 13   G   A C2    1 
ATOM   80    N  N2    . G   A  1  12   ? 23.167  139.057 99.611  1.00 35.70  ? 13   G   A N2    1 
ATOM   81    N  N3    . G   A  1  12   ? 24.628  140.801 99.288  1.00 34.28  ? 13   G   A N3    1 
ATOM   82    C  C4    . G   A  1  12   ? 24.677  142.096 98.920  1.00 35.21  ? 13   G   A C4    1 
ATOM   83    P  P     . C   A  1  13   ? 28.905  140.785 94.876  1.00 37.78  ? 14   C   A P     1 
ATOM   84    O  OP1   . C   A  1  13   ? 30.104  140.240 94.179  1.00 36.38  ? 14   C   A OP1   1 
ATOM   85    O  OP2   . C   A  1  13   ? 28.065  141.811 94.205  1.00 35.72  ? 14   C   A OP2   1 
ATOM   86    O  "O5'" . C   A  1  13   ? 27.998  139.549 95.300  1.00 34.84  ? 14   C   A "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  13   ? 28.606  138.358 95.827  1.00 35.07  ? 14   C   A "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  13   ? 27.583  137.268 95.997  1.00 35.38  ? 14   C   A "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  13   ? 26.607  137.685 96.979  1.00 36.14  ? 14   C   A "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  13   ? 26.768  136.926 94.763  1.00 35.44  ? 14   C   A "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  13   ? 27.473  135.999 93.945  1.00 37.82  ? 14   C   A "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  13   ? 25.537  136.295 95.388  1.00 35.81  ? 14   C   A "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  13   ? 25.839  134.987 95.830  1.00 37.47  ? 14   C   A "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  13   ? 25.329  137.198 96.611  1.00 35.23  ? 14   C   A "C1'" 1 
ATOM   95    N  N1    . C   A  1  13   ? 24.450  138.357 96.337  1.00 34.63  ? 14   C   A N1    1 
ATOM   96    C  C2    . C   A  1  13   ? 23.075  138.146 96.224  1.00 34.33  ? 14   C   A C2    1 
ATOM   97    O  O2    . C   A  1  13   ? 22.631  137.002 96.387  1.00 36.18  ? 14   C   A O2    1 
ATOM   98    N  N3    . C   A  1  13   ? 22.265  139.191 95.935  1.00 32.95  ? 14   C   A N3    1 
ATOM   99    C  C4    . C   A  1  13   ? 22.781  140.410 95.766  1.00 32.11  ? 14   C   A C4    1 
ATOM   100   N  N4    . C   A  1  13   ? 21.951  141.406 95.463  1.00 32.64  ? 14   C   A N4    1 
ATOM   101   C  C5    . C   A  1  13   ? 24.174  140.659 95.893  1.00 33.31  ? 14   C   A C5    1 
ATOM   102   C  C6    . C   A  1  13   ? 24.965  139.615 96.178  1.00 33.90  ? 14   C   A C6    1 
ATOM   103   P  P     . C   A  1  14   ? 27.378  136.103 92.346  1.00 39.78  ? 15   C   A P     1 
ATOM   104   O  OP1   . C   A  1  14   ? 28.416  135.211 91.758  1.00 38.41  ? 15   C   A OP1   1 
ATOM   105   O  OP2   . C   A  1  14   ? 27.340  137.535 91.974  1.00 38.20  ? 15   C   A OP2   1 
ATOM   106   O  "O5'" . C   A  1  14   ? 25.957  135.475 92.033  1.00 40.68  ? 15   C   A "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  14   ? 25.676  134.113 92.378  1.00 41.62  ? 15   C   A "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  14   ? 24.224  133.808 92.146  1.00 42.41  ? 15   C   A "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  14   ? 23.417  134.514 93.119  1.00 42.94  ? 15   C   A "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  14   ? 23.654  134.262 90.816  1.00 42.88  ? 15   C   A "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  14   ? 23.969  133.383 89.744  1.00 45.08  ? 15   C   A "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  14   ? 22.168  134.273 91.117  1.00 43.11  ? 15   C   A "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  14   ? 21.651  132.960 91.164  1.00 44.32  ? 15   C   A "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  14   ? 22.161  134.838 92.537  1.00 42.92  ? 15   C   A "C1'" 1 
ATOM   115   N  N1    . C   A  1  14   ? 21.981  136.304 92.551  1.00 42.09  ? 15   C   A N1    1 
ATOM   116   C  C2    . C   A  1  14   ? 20.677  136.833 92.469  1.00 41.55  ? 15   C   A C2    1 
ATOM   117   O  O2    . C   A  1  14   ? 19.712  136.058 92.414  1.00 42.24  ? 15   C   A O2    1 
ATOM   118   N  N3    . C   A  1  14   ? 20.512  138.177 92.456  1.00 39.60  ? 15   C   A N3    1 
ATOM   119   C  C4    . C   A  1  14   ? 21.579  138.979 92.526  1.00 39.35  ? 15   C   A C4    1 
ATOM   120   N  N4    . C   A  1  14   ? 21.379  140.293 92.500  1.00 39.77  ? 15   C   A N4    1 
ATOM   121   C  C5    . C   A  1  14   ? 22.903  138.467 92.623  1.00 40.43  ? 15   C   A C5    1 
ATOM   122   C  C6    . C   A  1  14   ? 23.057  137.141 92.631  1.00 40.83  ? 15   C   A C6    1 
ATOM   123   P  P     . A   A  1  15   ? 24.084  133.967 88.245  1.00 47.53  ? 16   A   A P     1 
ATOM   124   O  OP1   . A   A  1  15   ? 24.609  132.863 87.400  1.00 46.94  ? 16   A   A OP1   1 
ATOM   125   O  OP2   . A   A  1  15   ? 24.799  135.273 88.278  1.00 46.88  ? 16   A   A OP2   1 
ATOM   126   O  "O5'" . A   A  1  15   ? 22.576  134.262 87.814  1.00 46.47  ? 16   A   A "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  15   ? 21.668  133.182 87.473  1.00 46.23  ? 16   A   A "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  15   ? 20.271  133.712 87.240  1.00 44.08  ? 16   A   A "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  15   ? 19.823  134.375 88.446  1.00 42.81  ? 16   A   A "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  15   ? 20.117  134.771 86.157  1.00 45.25  ? 16   A   A "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  15   ? 20.007  134.201 84.843  1.00 47.93  ? 16   A   A "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  15   ? 18.830  135.461 86.584  1.00 44.35  ? 16   A   A "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  15   ? 17.674  134.727 86.239  1.00 46.57  ? 16   A   A "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  15   ? 18.977  135.461 88.107  1.00 42.94  ? 16   A   A "C1'" 1 
ATOM   135   N  N9    . A   A  1  15   ? 19.588  136.705 88.575  1.00 41.24  ? 16   A   A N9    1 
ATOM   136   C  C8    . A   A  1  15   ? 20.910  136.969 88.836  1.00 40.81  ? 16   A   A C8    1 
ATOM   137   N  N7    . A   A  1  15   ? 21.142  138.216 89.166  1.00 39.18  ? 16   A   A N7    1 
ATOM   138   C  C5    . A   A  1  15   ? 19.887  138.807 89.138  1.00 36.76  ? 16   A   A C5    1 
ATOM   139   C  C6    . A   A  1  15   ? 19.455  140.114 89.389  1.00 34.90  ? 16   A   A C6    1 
ATOM   140   N  N6    . A   A  1  15   ? 20.272  141.119 89.717  1.00 33.92  ? 16   A   A N6    1 
ATOM   141   N  N1    . A   A  1  15   ? 18.136  140.364 89.288  1.00 33.50  ? 16   A   A N1    1 
ATOM   142   C  C2    . A   A  1  15   ? 17.318  139.364 88.949  1.00 34.30  ? 16   A   A C2    1 
ATOM   143   N  N3    . A   A  1  15   ? 17.604  138.098 88.679  1.00 34.88  ? 16   A   A N3    1 
ATOM   144   C  C4    . A   A  1  15   ? 18.921  137.883 88.794  1.00 38.11  ? 16   A   A C4    1 
ATOM   145   P  P     . G   A  1  16   ? 20.449  135.057 83.539  1.00 51.22  ? 17   G   A P     1 
ATOM   146   O  OP1   . G   A  1  16   ? 20.315  134.157 82.350  1.00 50.64  ? 17   G   A OP1   1 
ATOM   147   O  OP2   . G   A  1  16   ? 21.752  135.712 83.813  1.00 52.08  ? 17   G   A OP2   1 
ATOM   148   O  "O5'" . G   A  1  16   ? 19.337  136.197 83.413  1.00 46.65  ? 17   G   A "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  16   ? 17.980  135.848 83.080  1.00 43.44  ? 17   G   A "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  16   ? 17.039  136.994 83.354  1.00 41.18  ? 17   G   A "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  16   ? 17.283  137.531 84.674  1.00 41.48  ? 17   G   A "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  16   ? 17.167  138.231 82.489  1.00 40.83  ? 17   G   A "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  16   ? 16.544  138.029 81.225  1.00 40.81  ? 17   G   A "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  16   ? 16.378  139.248 83.307  1.00 40.93  ? 17   G   A "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  16   ? 14.983  139.086 83.164  1.00 41.29  ? 17   G   A "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  16   ? 16.765  138.858 84.737  1.00 40.34  ? 17   G   A "C1'" 1 
ATOM   157   N  N9    . G   A  1  16   ? 17.773  139.747 85.320  1.00 39.33  ? 17   G   A N9    1 
ATOM   158   C  C8    . G   A  1  16   ? 19.084  139.451 85.600  1.00 39.05  ? 17   G   A C8    1 
ATOM   159   N  N7    . G   A  1  16   ? 19.744  140.465 86.087  1.00 37.55  ? 17   G   A N7    1 
ATOM   160   C  C5    . G   A  1  16   ? 18.818  141.493 86.132  1.00 36.67  ? 17   G   A C5    1 
ATOM   161   C  C6    . G   A  1  16   ? 18.964  142.829 86.558  1.00 37.11  ? 17   G   A C6    1 
ATOM   162   O  O6    . G   A  1  16   ? 19.980  143.401 86.964  1.00 38.32  ? 17   G   A O6    1 
ATOM   163   N  N1    . G   A  1  16   ? 17.767  143.527 86.470  1.00 38.26  ? 17   G   A N1    1 
ATOM   164   C  C2    . G   A  1  16   ? 16.579  143.008 86.019  1.00 38.80  ? 17   G   A C2    1 
ATOM   165   N  N2    . G   A  1  16   ? 15.521  143.839 86.032  1.00 37.51  ? 17   G   A N2    1 
ATOM   166   N  N3    . G   A  1  16   ? 16.438  141.762 85.593  1.00 39.27  ? 17   G   A N3    1 
ATOM   167   C  C4    . G   A  1  16   ? 17.592  141.065 85.681  1.00 37.82  ? 17   G   A C4    1 
ATOM   168   P  P     . C   A  1  17   ? 16.867  139.020 80.001  1.00 39.61  ? 18   C   A P     1 
ATOM   169   O  OP1   . C   A  1  17   ? 16.101  138.531 78.830  1.00 39.37  ? 18   C   A OP1   1 
ATOM   170   O  OP2   . C   A  1  17   ? 18.327  139.194 79.901  1.00 39.41  ? 18   C   A OP2   1 
ATOM   171   O  "O5'" . C   A  1  17   ? 16.281  140.417 80.467  1.00 36.39  ? 18   C   A "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  17   ? 14.875  140.673 80.455  1.00 35.21  ? 18   C   A "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  17   ? 14.621  142.109 80.834  1.00 35.59  ? 18   C   A "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  17   ? 15.070  142.317 82.200  1.00 35.89  ? 18   C   A "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  17   ? 15.377  143.159 80.031  1.00 34.89  ? 18   C   A "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  17   ? 14.706  143.458 78.804  1.00 34.72  ? 18   C   A "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  17   ? 15.354  144.339 80.994  1.00 35.30  ? 18   C   A "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  17   ? 14.074  144.938 81.039  1.00 36.98  ? 18   C   A "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  17   ? 15.573  143.636 82.337  1.00 35.37  ? 18   C   A "C1'" 1 
ATOM   180   N  N1    . C   A  1  17   ? 16.994  143.567 82.735  1.00 35.13  ? 18   C   A N1    1 
ATOM   181   C  C2    . C   A  1  17   ? 17.585  144.690 83.314  1.00 36.06  ? 18   C   A C2    1 
ATOM   182   O  O2    . C   A  1  17   ? 16.902  145.714 83.472  1.00 38.77  ? 18   C   A O2    1 
ATOM   183   N  N3    . C   A  1  17   ? 18.884  144.634 83.683  1.00 34.55  ? 18   C   A N3    1 
ATOM   184   C  C4    . C   A  1  17   ? 19.585  143.514 83.493  1.00 32.52  ? 18   C   A C4    1 
ATOM   185   N  N4    . C   A  1  17   ? 20.856  143.498 83.882  1.00 32.06  ? 18   C   A N4    1 
ATOM   186   C  C5    . C   A  1  17   ? 19.012  142.361 82.902  1.00 33.09  ? 18   C   A C5    1 
ATOM   187   C  C6    . C   A  1  17   ? 17.727  142.428 82.542  1.00 34.41  ? 18   C   A C6    1 
ATOM   188   P  P     . U   A  1  18   ? 15.554  143.853 77.487  1.00 34.32  ? 19   U   A P     1 
ATOM   189   O  OP1   . U   A  1  18   ? 14.635  143.916 76.334  1.00 35.71  ? 19   U   A OP1   1 
ATOM   190   O  OP2   . U   A  1  18   ? 16.744  142.967 77.409  1.00 36.35  ? 19   U   A OP2   1 
ATOM   191   O  "O5'" . U   A  1  18   ? 16.030  145.343 77.772  1.00 35.37  ? 19   U   A "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  18   ? 15.095  146.431 77.724  1.00 34.34  ? 19   U   A "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  18   ? 15.777  147.730 78.088  1.00 34.80  ? 19   U   A "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  18   ? 16.156  147.709 79.492  1.00 34.70  ? 19   U   A "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  18   ? 17.089  148.029 77.383  1.00 34.31  ? 19   U   A "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  18   ? 16.909  148.549 76.078  1.00 33.61  ? 19   U   A "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  18   ? 17.686  149.068 78.312  1.00 34.48  ? 19   U   A "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  18   ? 17.027  150.314 78.176  1.00 35.47  ? 19   U   A "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  18   ? 17.343  148.464 79.672  1.00 34.77  ? 19   U   A "C1'" 1 
ATOM   200   N  N1    . U   A  1  18   ? 18.418  147.561 80.110  1.00 35.58  ? 19   U   A N1    1 
ATOM   201   C  C2    . U   A  1  18   ? 19.528  148.129 80.728  1.00 36.68  ? 19   U   A C2    1 
ATOM   202   O  O2    . U   A  1  18   ? 19.629  149.327 80.963  1.00 37.06  ? 19   U   A O2    1 
ATOM   203   N  N3    . U   A  1  18   ? 20.519  147.239 81.062  1.00 36.54  ? 19   U   A N3    1 
ATOM   204   C  C4    . U   A  1  18   ? 20.521  145.881 80.851  1.00 36.40  ? 19   U   A C4    1 
ATOM   205   O  O4    . U   A  1  18   ? 21.523  145.230 81.143  1.00 35.85  ? 19   U   A O4    1 
ATOM   206   C  C5    . U   A  1  18   ? 19.336  145.367 80.236  1.00 36.12  ? 19   U   A C5    1 
ATOM   207   C  C6    . U   A  1  18   ? 18.349  146.199 79.899  1.00 35.58  ? 19   U   A C6    1 
ATOM   208   P  P     . G   A  1  19   ? 18.001  148.243 74.938  1.00 34.56  ? 20   G   A P     1 
ATOM   209   O  OP1   . G   A  1  19   ? 17.481  148.867 73.697  1.00 35.35  ? 20   G   A OP1   1 
ATOM   210   O  OP2   . G   A  1  19   ? 18.312  146.791 74.950  1.00 35.17  ? 20   G   A OP2   1 
ATOM   211   O  "O5'" . G   A  1  19   ? 19.295  149.051 75.399  1.00 31.87  ? 20   G   A "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  19   ? 19.342  150.481 75.298  1.00 31.52  ? 20   G   A "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  19   ? 20.561  151.021 76.003  1.00 31.50  ? 20   G   A "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  19   ? 20.565  150.601 77.395  1.00 31.71  ? 20   G   A "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  19   ? 21.917  150.569 75.493  1.00 30.06  ? 20   G   A "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  19   ? 22.319  151.323 74.373  1.00 30.20  ? 20   G   A "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  19   ? 22.796  150.919 76.674  1.00 30.59  ? 20   G   A "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  19   ? 23.022  152.312 76.695  1.00 29.96  ? 20   G   A "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  19   ? 21.906  150.476 77.841  1.00 31.43  ? 20   G   A "C1'" 1 
ATOM   220   N  N9    . G   A  1  19   ? 22.153  149.071 78.156  1.00 32.59  ? 20   G   A N9    1 
ATOM   221   C  C8    . G   A  1  19   ? 21.379  147.991 77.812  1.00 33.19  ? 20   G   A C8    1 
ATOM   222   N  N7    . G   A  1  19   ? 21.894  146.850 78.185  1.00 32.49  ? 20   G   A N7    1 
ATOM   223   C  C5    . G   A  1  19   ? 23.070  147.199 78.826  1.00 33.06  ? 20   G   A C5    1 
ATOM   224   C  C6    . G   A  1  19   ? 24.056  146.389 79.440  1.00 33.80  ? 20   G   A C6    1 
ATOM   225   O  O6    . G   A  1  19   ? 24.089  145.153 79.535  1.00 35.77  ? 20   G   A O6    1 
ATOM   226   N  N1    . G   A  1  19   ? 25.090  147.160 79.980  1.00 33.28  ? 20   G   A N1    1 
ATOM   227   C  C2    . G   A  1  19   ? 25.165  148.535 79.925  1.00 33.02  ? 20   G   A C2    1 
ATOM   228   N  N2    . G   A  1  19   ? 26.232  149.107 80.487  1.00 31.66  ? 20   G   A N2    1 
ATOM   229   N  N3    . G   A  1  19   ? 24.251  149.297 79.354  1.00 33.75  ? 20   G   A N3    1 
ATOM   230   C  C4    . G   A  1  19   ? 23.239  148.568 78.828  1.00 33.37  ? 20   G   A C4    1 
ATOM   231   P  P     . G   A  1  20   ? 23.141  150.614 73.198  1.00 33.57  ? 21   G   A P     1 
ATOM   232   O  OP1   . G   A  1  20   ? 23.305  151.673 72.185  1.00 32.64  ? 21   G   A OP1   1 
ATOM   233   O  OP2   . G   A  1  20   ? 22.412  149.377 72.855  1.00 34.34  ? 21   G   A OP2   1 
ATOM   234   O  "O5'" . G   A  1  20   ? 24.568  150.258 73.832  1.00 34.96  ? 21   G   A "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  20   ? 25.473  151.331 74.152  1.00 34.97  ? 21   G   A "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  20   ? 26.541  150.928 75.156  1.00 34.11  ? 21   G   A "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  20   ? 26.037  150.054 76.202  1.00 33.17  ? 21   G   A "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  20   ? 27.740  150.144 74.670  1.00 31.81  ? 21   G   A "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  20   ? 28.610  150.981 73.909  1.00 30.92  ? 21   G   A "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  20   ? 28.377  149.755 76.007  1.00 32.34  ? 21   G   A "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  20   ? 29.096  150.816 76.602  1.00 31.44  ? 21   G   A "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  20   ? 27.145  149.498 76.884  1.00 31.35  ? 21   G   A "C1'" 1 
ATOM   243   N  N9    . G   A  1  20   ? 26.924  148.073 77.098  1.00 31.41  ? 21   G   A N9    1 
ATOM   244   C  C8    . G   A  1  20   ? 25.880  147.307 76.645  1.00 30.71  ? 21   G   A C8    1 
ATOM   245   N  N7    . G   A  1  20   ? 25.983  146.048 76.980  1.00 31.42  ? 21   G   A N7    1 
ATOM   246   C  C5    . G   A  1  20   ? 27.167  145.980 77.701  1.00 31.22  ? 21   G   A C5    1 
ATOM   247   C  C6    . G   A  1  20   ? 27.810  144.873 78.319  1.00 31.08  ? 21   G   A C6    1 
ATOM   248   O  O6    . G   A  1  20   ? 27.453  143.693 78.341  1.00 31.33  ? 21   G   A O6    1 
ATOM   249   N  N1    . G   A  1  20   ? 28.986  145.254 78.956  1.00 30.21  ? 21   G   A N1    1 
ATOM   250   C  C2    . G   A  1  20   ? 29.483  146.528 78.994  1.00 31.38  ? 21   G   A C2    1 
ATOM   251   N  N2    . G   A  1  20   ? 30.627  146.691 79.683  1.00 33.80  ? 21   G   A N2    1 
ATOM   252   N  N3    . G   A  1  20   ? 28.902  147.566 78.412  1.00 31.10  ? 21   G   A N3    1 
ATOM   253   C  C4    . G   A  1  20   ? 27.756  147.222 77.791  1.00 31.61  ? 21   G   A C4    1 
ATOM   254   P  P     . U   A  1  21   ? 29.542  150.337 72.769  1.00 30.35  ? 22   U   A P     1 
ATOM   255   O  OP1   . U   A  1  21   ? 30.363  151.399 72.133  1.00 31.92  ? 22   U   A OP1   1 
ATOM   256   O  OP2   . U   A  1  21   ? 28.724  149.443 71.922  1.00 32.08  ? 22   U   A OP2   1 
ATOM   257   O  "O5'" . U   A  1  21   ? 30.534  149.405 73.586  1.00 33.07  ? 22   U   A "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  21   ? 31.566  149.973 74.414  1.00 33.43  ? 22   U   A "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  21   ? 32.320  148.877 75.121  1.00 31.96  ? 22   U   A "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  21   ? 31.401  148.146 75.972  1.00 32.66  ? 22   U   A "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  21   ? 32.909  147.809 74.217  1.00 31.74  ? 22   U   A "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  21   ? 34.191  148.200 73.739  1.00 31.21  ? 22   U   A "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  21   ? 33.040  146.632 75.168  1.00 33.82  ? 22   U   A "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  21   ? 34.158  146.836 76.017  1.00 36.02  ? 22   U   A "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  21   ? 31.765  146.774 76.000  1.00 34.07  ? 22   U   A "C1'" 1 
ATOM   266   N  N1    . U   A  1  21   ? 30.614  145.966 75.552  1.00 34.55  ? 22   U   A N1    1 
ATOM   267   C  C2    . U   A  1  21   ? 30.545  144.636 75.952  1.00 34.68  ? 22   U   A C2    1 
ATOM   268   O  O2    . U   A  1  21   ? 31.436  144.074 76.562  1.00 34.41  ? 22   U   A O2    1 
ATOM   269   N  N3    . U   A  1  21   ? 29.392  143.986 75.596  1.00 33.74  ? 22   U   A N3    1 
ATOM   270   C  C4    . U   A  1  21   ? 28.334  144.501 74.884  1.00 32.82  ? 22   U   A C4    1 
ATOM   271   O  O4    . U   A  1  21   ? 27.289  143.852 74.806  1.00 33.67  ? 22   U   A O4    1 
ATOM   272   C  C5    . U   A  1  21   ? 28.510  145.848 74.449  1.00 33.61  ? 22   U   A C5    1 
ATOM   273   C  C6    . U   A  1  21   ? 29.612  146.518 74.788  1.00 33.73  ? 22   U   A C6    1 
ATOM   274   P  P     . G   A  1  22   ? 34.638  147.824 72.242  1.00 33.01  ? 23   G   A P     1 
ATOM   275   O  OP1   . G   A  1  22   ? 35.996  148.391 72.058  1.00 32.87  ? 23   G   A OP1   1 
ATOM   276   O  OP2   . G   A  1  22   ? 33.527  148.249 71.337  1.00 33.81  ? 23   G   A OP2   1 
ATOM   277   O  "O5'" . G   A  1  22   ? 34.724  146.227 72.217  1.00 31.07  ? 23   G   A "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  22   ? 35.673  145.491 73.027  1.00 29.76  ? 23   G   A "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  22   ? 35.330  144.019 73.003  1.00 29.00  ? 23   G   A "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  22   ? 34.022  143.830 73.608  1.00 30.70  ? 23   G   A "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  22   ? 35.178  143.451 71.606  1.00 27.93  ? 23   G   A "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  22   ? 36.430  143.070 71.062  1.00 25.98  ? 23   G   A "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  22   ? 34.213  142.290 71.807  1.00 28.82  ? 23   G   A "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  22   ? 34.823  141.131 72.319  1.00 28.84  ? 23   G   A "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  22   ? 33.280  142.856 72.879  1.00 28.52  ? 23   G   A "C1'" 1 
ATOM   286   N  N9    . G   A  1  22   ? 32.079  143.515 72.370  1.00 28.07  ? 23   G   A N9    1 
ATOM   287   C  C8    . G   A  1  22   ? 31.999  144.787 71.864  1.00 27.16  ? 23   G   A C8    1 
ATOM   288   N  N7    . G   A  1  22   ? 30.780  145.151 71.582  1.00 26.53  ? 23   G   A N7    1 
ATOM   289   C  C5    . G   A  1  22   ? 30.009  144.042 71.896  1.00 24.44  ? 23   G   A C5    1 
ATOM   290   C  C6    . G   A  1  22   ? 28.614  143.845 71.816  1.00 22.84  ? 23   G   A C6    1 
ATOM   291   O  O6    . G   A  1  22   ? 27.744  144.639 71.460  1.00 24.93  ? 23   G   A O6    1 
ATOM   292   N  N1    . G   A  1  22   ? 28.255  142.569 72.221  1.00 21.48  ? 23   G   A N1    1 
ATOM   293   C  C2    . G   A  1  22   ? 29.120  141.606 72.657  1.00 22.72  ? 23   G   A C2    1 
ATOM   294   N  N2    . G   A  1  22   ? 28.573  140.437 73.005  1.00 21.74  ? 23   G   A N2    1 
ATOM   295   N  N3    . G   A  1  22   ? 30.424  141.777 72.747  1.00 25.71  ? 23   G   A N3    1 
ATOM   296   C  C4    . G   A  1  22   ? 30.797  143.013 72.355  1.00 26.31  ? 23   G   A C4    1 
ATOM   297   P  P     . G   A  1  23   ? 36.714  143.302 69.498  1.00 25.81  ? 24   G   A P     1 
ATOM   298   O  OP1   . G   A  1  23   ? 38.175  143.208 69.262  1.00 24.26  ? 24   G   A OP1   1 
ATOM   299   O  OP2   . G   A  1  23   ? 35.996  144.540 69.114  1.00 26.69  ? 24   G   A OP2   1 
ATOM   300   O  "O5'" . G   A  1  23   ? 35.993  142.070 68.794  1.00 24.44  ? 24   G   A "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  23   ? 36.159  140.728 69.286  1.00 21.43  ? 24   G   A "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  23   ? 35.064  139.857 68.744  1.00 22.56  ? 24   G   A "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  23   ? 33.791  140.476 69.085  1.00 24.00  ? 24   G   A "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  23   ? 35.053  139.720 67.228  1.00 22.26  ? 24   G   A "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  23   ? 34.412  138.499 66.918  1.00 24.74  ? 24   G   A "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  23   ? 34.165  140.878 66.810  1.00 22.74  ? 24   G   A "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  23   ? 33.574  140.721 65.545  1.00 23.14  ? 24   G   A "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  23   ? 33.107  140.835 67.905  1.00 24.92  ? 24   G   A "C1'" 1 
ATOM   309   N  N9    . G   A  1  23   ? 32.419  142.107 68.112  1.00 27.67  ? 24   G   A N9    1 
ATOM   310   C  C8    . G   A  1  23   ? 32.929  143.373 67.923  1.00 28.23  ? 24   G   A C8    1 
ATOM   311   N  N7    . G   A  1  23   ? 32.033  144.314 68.062  1.00 28.75  ? 24   G   A N7    1 
ATOM   312   C  C5    . G   A  1  23   ? 30.867  143.627 68.391  1.00 26.97  ? 24   G   A C5    1 
ATOM   313   C  C6    . G   A  1  23   ? 29.560  144.101 68.628  1.00 26.14  ? 24   G   A C6    1 
ATOM   314   O  O6    . G   A  1  23   ? 29.142  145.254 68.574  1.00 29.08  ? 24   G   A O6    1 
ATOM   315   N  N1    . G   A  1  23   ? 28.690  143.066 68.944  1.00 24.76  ? 24   G   A N1    1 
ATOM   316   C  C2    . G   A  1  23   ? 29.029  141.740 69.014  1.00 26.76  ? 24   G   A C2    1 
ATOM   317   N  N2    . G   A  1  23   ? 28.032  140.900 69.345  1.00 28.13  ? 24   G   A N2    1 
ATOM   318   N  N3    . G   A  1  23   ? 30.241  141.277 68.779  1.00 26.12  ? 24   G   A N3    1 
ATOM   319   C  C4    . G   A  1  23   ? 31.103  142.269 68.470  1.00 27.15  ? 24   G   A C4    1 
ATOM   320   P  P     . A   A  1  24   ? 34.839  137.674 65.612  1.00 25.38  ? 25   A   A P     1 
ATOM   321   O  OP1   . A   A  1  24   ? 36.298  137.408 65.683  1.00 26.03  ? 25   A   A OP1   1 
ATOM   322   O  OP2   . A   A  1  24   ? 34.279  138.322 64.423  1.00 25.26  ? 25   A   A OP2   1 
ATOM   323   O  "O5'" . A   A  1  24   ? 34.100  136.288 65.833  1.00 23.20  ? 25   A   A "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  24   ? 34.553  135.399 66.866  1.00 22.07  ? 25   A   A "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  24   ? 33.384  134.716 67.529  1.00 23.01  ? 25   A   A "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  24   ? 32.605  135.675 68.294  1.00 24.08  ? 25   A   A "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  24   ? 32.361  134.056 66.623  1.00 23.72  ? 25   A   A "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  24   ? 32.804  132.783 66.160  1.00 24.42  ? 25   A   A "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  24   ? 31.172  133.930 67.566  1.00 24.83  ? 25   A   A "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  24   ? 31.373  132.884 68.497  1.00 26.72  ? 25   A   A "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  24   ? 31.245  135.259 68.328  1.00 26.16  ? 25   A   A "C1'" 1 
ATOM   332   N  N9    . A   A  1  24   ? 30.410  136.334 67.768  1.00 29.08  ? 25   A   A N9    1 
ATOM   333   C  C8    . A   A  1  24   ? 30.858  137.507 67.201  1.00 31.37  ? 25   A   A C8    1 
ATOM   334   N  N7    . A   A  1  24   ? 29.898  138.280 66.753  1.00 31.83  ? 25   A   A N7    1 
ATOM   335   C  C5    . A   A  1  24   ? 28.736  137.578 67.044  1.00 29.67  ? 25   A   A C5    1 
ATOM   336   C  C6    . A   A  1  24   ? 27.388  137.858 66.797  1.00 29.77  ? 25   A   A C6    1 
ATOM   337   N  N6    . A   A  1  24   ? 26.960  138.960 66.171  1.00 30.91  ? 25   A   A N6    1 
ATOM   338   N  N1    . A   A  1  24   ? 26.478  136.958 67.209  1.00 30.20  ? 25   A   A N1    1 
ATOM   339   C  C2    . A   A  1  24   ? 26.903  135.850 67.825  1.00 29.98  ? 25   A   A C2    1 
ATOM   340   N  N3    . A   A  1  24   ? 28.147  135.468 68.110  1.00 30.49  ? 25   A   A N3    1 
ATOM   341   C  C4    . A   A  1  24   ? 29.031  136.386 67.684  1.00 29.24  ? 25   A   A C4    1 
ATOM   342   P  P     . U   A  1  25   ? 32.387  132.279 64.686  1.00 26.32  ? 26   U   A P     1 
ATOM   343   O  OP1   . U   A  1  25   ? 32.791  130.853 64.496  1.00 23.73  ? 26   U   A OP1   1 
ATOM   344   O  OP2   . U   A  1  25   ? 32.863  133.307 63.743  1.00 24.25  ? 26   U   A OP2   1 
ATOM   345   O  "O5'" . U   A  1  25   ? 30.798  132.321 64.719  1.00 23.61  ? 26   U   A "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  25   ? 30.073  131.482 65.634  1.00 22.87  ? 26   U   A "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  25   ? 28.592  131.731 65.536  1.00 23.52  ? 26   U   A "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  25   ? 28.274  133.019 66.098  1.00 24.76  ? 26   U   A "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  25   ? 28.000  131.748 64.142  1.00 22.92  ? 26   U   A "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  25   ? 27.686  130.428 63.742  1.00 23.35  ? 26   U   A "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  25   ? 26.745  132.578 64.343  1.00 24.57  ? 26   U   A "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  25   ? 25.732  131.843 64.997  1.00 29.35  ? 26   U   A "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  25   ? 27.243  133.622 65.336  1.00 24.83  ? 26   U   A "C1'" 1 
ATOM   354   N  N1    . U   A  1  25   ? 27.784  134.835 64.701  1.00 25.14  ? 26   U   A N1    1 
ATOM   355   C  C2    . U   A  1  25   ? 26.895  135.740 64.178  1.00 24.64  ? 26   U   A C2    1 
ATOM   356   O  O2    . U   A  1  25   ? 25.698  135.541 64.134  1.00 25.53  ? 26   U   A O2    1 
ATOM   357   N  N3    . U   A  1  25   ? 27.461  136.890 63.690  1.00 26.02  ? 26   U   A N3    1 
ATOM   358   C  C4    . U   A  1  25   ? 28.797  137.212 63.647  1.00 26.21  ? 26   U   A C4    1 
ATOM   359   O  O4    . U   A  1  25   ? 29.132  138.344 63.290  1.00 29.23  ? 26   U   A O4    1 
ATOM   360   C  C5    . U   A  1  25   ? 29.662  136.202 64.153  1.00 24.64  ? 26   U   A C5    1 
ATOM   361   C  C6    . U   A  1  25   ? 29.141  135.078 64.650  1.00 25.34  ? 26   U   A C6    1 
ATOM   362   P  P     . U   A  1  26   ? 27.966  129.967 62.237  1.00 27.19  ? 27   U   A P     1 
ATOM   363   O  OP1   . U   A  1  26   ? 27.859  128.491 62.212  1.00 27.00  ? 27   U   A OP1   1 
ATOM   364   O  OP2   . U   A  1  26   ? 29.207  130.624 61.764  1.00 28.00  ? 27   U   A OP2   1 
ATOM   365   O  "O5'" . U   A  1  26   ? 26.757  130.603 61.421  1.00 27.54  ? 27   U   A "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  26   ? 25.395  130.216 61.681  1.00 26.82  ? 27   U   A "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  26   ? 24.454  131.171 61.003  1.00 26.12  ? 27   U   A "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  26   ? 24.465  132.450 61.679  1.00 25.06  ? 27   U   A "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  26   ? 24.835  131.506 59.577  1.00 26.37  ? 27   U   A "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  26   ? 24.402  130.493 58.676  1.00 27.31  ? 27   U   A "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  26   ? 24.101  132.814 59.361  1.00 26.11  ? 27   U   A "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  26   ? 22.733  132.551 59.138  1.00 28.37  ? 27   U   A "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  26   ? 24.284  133.488 60.726  1.00 26.68  ? 27   U   A "C1'" 1 
ATOM   374   N  N1    . U   A  1  26   ? 25.470  134.361 60.741  1.00 27.99  ? 27   U   A N1    1 
ATOM   375   C  C2    . U   A  1  26   ? 25.300  135.678 60.346  1.00 27.73  ? 27   U   A C2    1 
ATOM   376   O  O2    . U   A  1  26   ? 24.213  136.149 60.041  1.00 29.89  ? 27   U   A O2    1 
ATOM   377   N  N3    . U   A  1  26   ? 26.446  136.427 60.320  1.00 26.75  ? 27   U   A N3    1 
ATOM   378   C  C4    . U   A  1  26   ? 27.717  136.012 60.649  1.00 26.80  ? 27   U   A C4    1 
ATOM   379   O  O4    . U   A  1  26   ? 28.655  136.798 60.550  1.00 26.24  ? 27   U   A O4    1 
ATOM   380   C  C5    . U   A  1  26   ? 27.809  134.650 61.074  1.00 27.11  ? 27   U   A C5    1 
ATOM   381   C  C6    . U   A  1  26   ? 26.713  133.891 61.107  1.00 27.32  ? 27   U   A C6    1 
ATOM   382   P  P     . G   A  1  27   ? 25.272  130.184 57.365  1.00 31.46  ? 28   G   A P     1 
ATOM   383   O  OP1   . G   A  1  27   ? 24.803  128.913 56.768  1.00 28.28  ? 28   G   A OP1   1 
ATOM   384   O  OP2   . G   A  1  27   ? 26.713  130.318 57.753  1.00 32.64  ? 28   G   A OP2   1 
ATOM   385   O  "O5'" . G   A  1  27   ? 24.903  131.408 56.414  1.00 31.20  ? 28   G   A "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  27   ? 23.537  131.700 56.099  1.00 30.21  ? 28   G   A "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  27   ? 23.405  133.099 55.527  1.00 30.88  ? 28   G   A "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  27   ? 23.639  134.088 56.562  1.00 32.94  ? 28   G   A "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  27   ? 24.391  133.494 54.440  1.00 30.80  ? 28   G   A "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  27   ? 23.993  132.971 53.190  1.00 30.20  ? 28   G   A "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  27   ? 24.277  135.008 54.472  1.00 30.96  ? 28   G   A "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  27   ? 23.059  135.433 53.893  1.00 34.88  ? 28   G   A "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  27   ? 24.193  135.258 55.977  1.00 32.49  ? 28   G   A "C1'" 1 
ATOM   394   N  N9    . G   A  1  27   ? 25.531  135.454 56.511  1.00 33.29  ? 28   G   A N9    1 
ATOM   395   C  C8    . G   A  1  27   ? 26.322  134.517 57.122  1.00 33.47  ? 28   G   A C8    1 
ATOM   396   N  N7    . G   A  1  27   ? 27.498  134.972 57.443  1.00 34.18  ? 28   G   A N7    1 
ATOM   397   C  C5    . G   A  1  27   ? 27.474  136.298 57.031  1.00 34.15  ? 28   G   A C5    1 
ATOM   398   C  C6    . G   A  1  27   ? 28.464  137.302 57.118  1.00 32.98  ? 28   G   A C6    1 
ATOM   399   O  O6    . G   A  1  27   ? 29.604  137.214 57.573  1.00 33.08  ? 28   G   A O6    1 
ATOM   400   N  N1    . G   A  1  27   ? 28.014  138.514 56.597  1.00 33.88  ? 28   G   A N1    1 
ATOM   401   C  C2    . G   A  1  27   ? 26.768  138.728 56.056  1.00 34.62  ? 28   G   A C2    1 
ATOM   402   N  N2    . G   A  1  27   ? 26.509  139.974 55.622  1.00 33.63  ? 28   G   A N2    1 
ATOM   403   N  N3    . G   A  1  27   ? 25.841  137.789 55.955  1.00 35.72  ? 28   G   A N3    1 
ATOM   404   C  C4    . G   A  1  27   ? 26.260  136.610 56.464  1.00 34.10  ? 28   G   A C4    1 
ATOM   405   P  P     . C   A  1  28   ? 25.103  132.463 52.161  1.00 31.33  ? 29   C   A P     1 
ATOM   406   O  OP1   . C   A  1  28   ? 24.393  131.984 50.953  1.00 33.70  ? 29   C   A OP1   1 
ATOM   407   O  OP2   . C   A  1  28   ? 26.027  131.545 52.884  1.00 31.54  ? 29   C   A OP2   1 
ATOM   408   O  "O5'" . C   A  1  28   ? 25.831  133.812 51.744  1.00 31.89  ? 29   C   A "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  28   ? 25.074  134.836 51.096  1.00 29.70  ? 29   C   A "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  28   ? 25.892  136.077 50.908  1.00 29.75  ? 29   C   A "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  28   ? 26.236  136.655 52.186  1.00 30.16  ? 29   C   A "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  28   ? 27.215  135.889 50.200  1.00 30.63  ? 29   C   A "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  28   ? 27.008  135.841 48.793  1.00 33.04  ? 29   C   A "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  28   ? 27.955  137.152 50.612  1.00 31.65  ? 29   C   A "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  28   ? 27.563  138.258 49.827  1.00 30.86  ? 29   C   A "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  28   ? 27.469  137.338 52.059  1.00 31.86  ? 29   C   A "C1'" 1 
ATOM   417   N  N1    . C   A  1  28   ? 28.434  136.779 53.023  1.00 33.89  ? 29   C   A N1    1 
ATOM   418   C  C2    . C   A  1  28   ? 29.551  137.538 53.352  1.00 35.39  ? 29   C   A C2    1 
ATOM   419   O  O2    . C   A  1  28   ? 29.630  138.693 52.925  1.00 36.67  ? 29   C   A O2    1 
ATOM   420   N  N3    . C   A  1  28   ? 30.511  136.999 54.132  1.00 34.93  ? 29   C   A N3    1 
ATOM   421   C  C4    . C   A  1  28   ? 30.369  135.758 54.601  1.00 35.10  ? 29   C   A C4    1 
ATOM   422   N  N4    . C   A  1  28   ? 31.364  135.251 55.323  1.00 36.12  ? 29   C   A N4    1 
ATOM   423   C  C5    . C   A  1  28   ? 29.204  134.980 54.337  1.00 36.29  ? 29   C   A C5    1 
ATOM   424   C  C6    . C   A  1  28   ? 28.270  135.527 53.551  1.00 35.62  ? 29   C   A C6    1 
ATOM   425   P  P     . U   A  1  29   ? 27.923  134.891 47.880  1.00 35.67  ? 30   U   A P     1 
ATOM   426   O  OP1   . U   A  1  29   ? 27.354  134.865 46.516  1.00 35.98  ? 30   U   A OP1   1 
ATOM   427   O  OP2   . U   A  1  29   ? 28.135  133.622 48.611  1.00 34.40  ? 30   U   A OP2   1 
ATOM   428   O  "O5'" . U   A  1  29   ? 29.301  135.675 47.793  1.00 33.93  ? 30   U   A "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  29   ? 29.342  137.036 47.356  1.00 33.93  ? 30   U   A "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  29   ? 30.764  137.536 47.381  1.00 33.75  ? 30   U   A "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  29   ? 31.266  137.467 48.737  1.00 33.21  ? 30   U   A "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  29   ? 31.765  136.773 46.520  1.00 33.04  ? 30   U   A "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  29   ? 32.694  137.686 45.981  1.00 34.52  ? 30   U   A "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  29   ? 32.515  135.924 47.524  1.00 32.50  ? 30   U   A "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  29   ? 33.824  135.665 47.054  1.00 33.27  ? 30   U   A "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  29   ? 32.529  136.853 48.736  1.00 33.11  ? 30   U   A "C1'" 1 
ATOM   437   N  N1    . U   A  1  29   ? 32.708  136.182 50.034  1.00 35.57  ? 30   U   A N1    1 
ATOM   438   C  C2    . U   A  1  29   ? 33.593  136.737 50.940  1.00 36.08  ? 30   U   A C2    1 
ATOM   439   O  O2    . U   A  1  29   ? 34.171  137.801 50.764  1.00 37.62  ? 30   U   A O2    1 
ATOM   440   N  N3    . U   A  1  29   ? 33.775  136.002 52.079  1.00 38.04  ? 30   U   A N3    1 
ATOM   441   C  C4    . U   A  1  29   ? 33.171  134.814 52.416  1.00 36.68  ? 30   U   A C4    1 
ATOM   442   O  O4    . U   A  1  29   ? 33.543  134.212 53.423  1.00 36.97  ? 30   U   A O4    1 
ATOM   443   C  C5    . U   A  1  29   ? 32.232  134.341 51.466  1.00 37.52  ? 30   U   A C5    1 
ATOM   444   C  C6    . U   A  1  29   ? 32.036  135.020 50.336  1.00 36.81  ? 30   U   A C6    1 
ATOM   445   P  P     . C   A  1  30   ? 32.427  138.303 44.532  1.00 37.82  ? 31   C   A P     1 
ATOM   446   O  OP1   . C   A  1  30   ? 31.949  139.686 44.754  1.00 36.75  ? 31   C   A OP1   1 
ATOM   447   O  OP2   . C   A  1  30   ? 31.584  137.350 43.766  1.00 37.58  ? 31   C   A OP2   1 
ATOM   448   O  "O5'" . C   A  1  30   ? 33.858  138.327 43.841  1.00 39.44  ? 31   C   A "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  30   ? 35.066  138.234 44.621  1.00 44.52  ? 31   C   A "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  30   ? 36.141  139.128 44.040  1.00 47.04  ? 31   C   A "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  30   ? 35.690  140.509 44.094  1.00 51.42  ? 31   C   A "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  30   ? 37.472  139.110 44.781  1.00 46.04  ? 31   C   A "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  30   ? 38.511  139.428 43.855  1.00 39.02  ? 31   C   A "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  30   ? 37.297  140.240 45.781  1.00 49.82  ? 31   C   A "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  30   ? 38.523  140.740 46.258  1.00 51.23  ? 31   C   A "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  30   ? 36.564  141.264 44.919  1.00 55.14  ? 31   C   A "C1'" 1 
ATOM   457   N  N1    . C   A  1  30   ? 35.769  142.253 45.678  1.00 62.24  ? 31   C   A N1    1 
ATOM   458   C  C2    . C   A  1  30   ? 36.413  143.404 46.186  1.00 65.95  ? 31   C   A C2    1 
ATOM   459   O  O2    . C   A  1  30   ? 37.638  143.565 45.981  1.00 67.80  ? 31   C   A O2    1 
ATOM   460   N  N3    . C   A  1  30   ? 35.686  144.310 46.884  1.00 68.42  ? 31   C   A N3    1 
ATOM   461   C  C4    . C   A  1  30   ? 34.379  144.108 47.087  1.00 69.17  ? 31   C   A C4    1 
ATOM   462   N  N4    . C   A  1  30   ? 33.705  145.024 47.797  1.00 71.26  ? 31   C   A N4    1 
ATOM   463   C  C5    . C   A  1  30   ? 33.702  142.958 46.579  1.00 67.24  ? 31   C   A C5    1 
ATOM   464   C  C6    . C   A  1  30   ? 34.427  142.065 45.890  1.00 64.91  ? 31   C   A C6    1 
ATOM   465   P  P     . G   A  1  31   ? 39.500  138.275 43.357  1.00 33.83  ? 32   G   A P     1 
ATOM   466   O  OP1   . G   A  1  31   ? 40.549  138.864 42.489  1.00 34.97  ? 32   G   A OP1   1 
ATOM   467   O  OP2   . G   A  1  31   ? 38.680  137.147 42.858  1.00 34.07  ? 32   G   A OP2   1 
ATOM   468   O  "O5'" . G   A  1  31   ? 40.203  137.790 44.690  1.00 31.29  ? 32   G   A "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  31   ? 41.023  138.669 45.461  1.00 29.99  ? 32   G   A "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  31   ? 41.568  137.927 46.646  1.00 28.52  ? 32   G   A "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  31   ? 40.459  137.493 47.476  1.00 30.25  ? 32   G   A "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  31   ? 42.288  136.641 46.286  1.00 28.22  ? 32   G   A "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  31   ? 43.636  136.930 45.882  1.00 26.74  ? 32   G   A "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  31   ? 42.157  135.846 47.581  1.00 29.49  ? 32   G   A "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  31   ? 43.038  136.348 48.562  1.00 30.38  ? 32   G   A "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  31   ? 40.729  136.203 48.014  1.00 31.01  ? 32   G   A "C1'" 1 
ATOM   477   N  N9    . G   A  1  31   ? 39.712  135.265 47.529  1.00 34.34  ? 32   G   A N9    1 
ATOM   478   C  C8    . G   A  1  31   ? 38.942  135.380 46.397  1.00 34.60  ? 32   G   A C8    1 
ATOM   479   N  N7    . G   A  1  31   ? 38.196  134.332 46.172  1.00 34.57  ? 32   G   A N7    1 
ATOM   480   C  C5    . G   A  1  31   ? 38.469  133.481 47.233  1.00 35.97  ? 32   G   A C5    1 
ATOM   481   C  C6    . G   A  1  31   ? 37.988  132.171 47.522  1.00 35.88  ? 32   G   A C6    1 
ATOM   482   O  O6    . G   A  1  31   ? 37.213  131.461 46.870  1.00 37.51  ? 32   G   A O6    1 
ATOM   483   N  N1    . G   A  1  31   ? 38.522  131.685 48.707  1.00 37.22  ? 32   G   A N1    1 
ATOM   484   C  C2    . G   A  1  31   ? 39.411  132.351 49.511  1.00 37.74  ? 32   G   A C2    1 
ATOM   485   N  N2    . G   A  1  31   ? 39.818  131.715 50.617  1.00 38.14  ? 32   G   A N2    1 
ATOM   486   N  N3    . G   A  1  31   ? 39.875  133.558 49.250  1.00 38.75  ? 32   G   A N3    1 
ATOM   487   C  C4    . G   A  1  31   ? 39.374  134.058 48.100  1.00 36.44  ? 32   G   A C4    1 
ATOM   488   P  P     . G   A  1  32   ? 44.577  135.760 45.309  1.00 28.67  ? 33   G   A P     1 
ATOM   489   O  OP1   . G   A  1  32   ? 45.943  136.289 45.079  1.00 26.95  ? 33   G   A OP1   1 
ATOM   490   O  OP2   . G   A  1  32   ? 43.862  135.077 44.206  1.00 26.59  ? 33   G   A OP2   1 
ATOM   491   O  "O5'" . G   A  1  32   ? 44.679  134.777 46.555  1.00 30.58  ? 33   G   A "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  32   ? 45.104  133.420 46.415  1.00 29.15  ? 33   G   A "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  32   ? 44.704  132.638 47.636  1.00 28.47  ? 33   G   A "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  32   ? 43.282  132.785 47.892  1.00 29.95  ? 33   G   A "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  32   ? 44.920  131.148 47.514  1.00 27.66  ? 33   G   A "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  32   ? 46.266  130.863 47.839  1.00 27.20  ? 33   G   A "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  32   ? 43.964  130.615 48.568  1.00 29.60  ? 33   G   A "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  32   ? 44.503  130.822 49.860  1.00 31.75  ? 33   G   A "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  32   ? 42.766  131.558 48.392  1.00 32.03  ? 33   G   A "C1'" 1 
ATOM   500   N  N9    . G   A  1  32   ? 41.763  131.063 47.448  1.00 35.38  ? 33   G   A N9    1 
ATOM   501   C  C8    . G   A  1  32   ? 41.320  131.694 46.307  1.00 36.79  ? 33   G   A C8    1 
ATOM   502   N  N7    . G   A  1  32   ? 40.431  131.003 45.653  1.00 37.20  ? 33   G   A N7    1 
ATOM   503   C  C5    . G   A  1  32   ? 40.273  129.847 46.407  1.00 36.19  ? 33   G   A C5    1 
ATOM   504   C  C6    . G   A  1  32   ? 39.447  128.719 46.190  1.00 37.32  ? 33   G   A C6    1 
ATOM   505   O  O6    . G   A  1  32   ? 38.672  128.503 45.249  1.00 38.05  ? 33   G   A O6    1 
ATOM   506   N  N1    . G   A  1  32   ? 39.590  127.775 47.206  1.00 36.38  ? 33   G   A N1    1 
ATOM   507   C  C2    . G   A  1  32   ? 40.431  127.898 48.285  1.00 35.75  ? 33   G   A C2    1 
ATOM   508   N  N2    . G   A  1  32   ? 40.424  126.880 49.159  1.00 36.67  ? 33   G   A N2    1 
ATOM   509   N  N3    . G   A  1  32   ? 41.215  128.940 48.490  1.00 36.11  ? 33   G   A N3    1 
ATOM   510   C  C4    . G   A  1  32   ? 41.083  129.872 47.520  1.00 35.57  ? 33   G   A C4    1 
ATOM   511   P  P     . C   A  1  33   ? 47.125  129.900 46.903  1.00 28.32  ? 34   C   A P     1 
ATOM   512   O  OP1   . C   A  1  33   ? 48.516  129.875 47.414  1.00 28.26  ? 34   C   A OP1   1 
ATOM   513   O  OP2   . C   A  1  33   ? 46.865  130.318 45.509  1.00 29.62  ? 34   C   A OP2   1 
ATOM   514   O  "O5'" . C   A  1  33   ? 46.472  128.465 47.130  1.00 29.68  ? 34   C   A "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  33   ? 46.506  127.812 48.406  1.00 28.47  ? 34   C   A "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  33   ? 45.620  126.593 48.392  1.00 26.73  ? 34   C   A "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  33   ? 44.230  126.998 48.284  1.00 28.42  ? 34   C   A "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  33   ? 45.816  125.654 47.216  1.00 25.10  ? 34   C   A "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  33   ? 46.897  124.755 47.413  1.00 23.63  ? 34   C   A "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  33   ? 44.493  124.916 47.209  1.00 27.70  ? 34   C   A "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  33   ? 44.428  124.010 48.294  1.00 29.97  ? 34   C   A "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  33   ? 43.519  126.053 47.506  1.00 28.74  ? 34   C   A "C1'" 1 
ATOM   523   N  N1    . C   A  1  33   ? 43.005  126.715 46.282  1.00 31.95  ? 34   C   A N1    1 
ATOM   524   C  C2    . C   A  1  33   ? 41.929  126.126 45.594  1.00 32.25  ? 34   C   A C2    1 
ATOM   525   O  O2    . C   A  1  33   ? 41.488  125.032 45.975  1.00 32.40  ? 34   C   A O2    1 
ATOM   526   N  N3    . C   A  1  33   ? 41.403  126.763 44.523  1.00 31.49  ? 34   C   A N3    1 
ATOM   527   C  C4    . C   A  1  33   ? 41.912  127.925 44.119  1.00 31.99  ? 34   C   A C4    1 
ATOM   528   N  N4    . C   A  1  33   ? 41.331  128.528 43.078  1.00 31.93  ? 34   C   A N4    1 
ATOM   529   C  C5    . C   A  1  33   ? 43.033  128.525 44.769  1.00 33.07  ? 34   C   A C5    1 
ATOM   530   C  C6    . C   A  1  33   ? 43.543  127.891 45.831  1.00 32.57  ? 34   C   A C6    1 
ATOM   531   P  P     . U   A  1  34   ? 47.779  124.268 46.162  1.00 22.96  ? 35   U   A P     1 
ATOM   532   O  OP1   . U   A  1  34   ? 48.984  123.597 46.707  1.00 24.70  ? 35   U   A OP1   1 
ATOM   533   O  OP2   . U   A  1  34   ? 47.923  125.419 45.277  1.00 24.66  ? 35   U   A OP2   1 
ATOM   534   O  "O5'" . U   A  1  34   ? 46.882  123.198 45.405  1.00 25.65  ? 35   U   A "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  34   ? 46.437  121.984 46.040  1.00 25.78  ? 35   U   A "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  34   ? 45.331  121.360 45.220  1.00 25.95  ? 35   U   A "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  34   ? 44.187  122.261 45.195  1.00 26.60  ? 35   U   A "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  34   ? 45.653  121.196 43.745  1.00 26.16  ? 35   U   A "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  34   ? 46.479  120.078 43.453  1.00 26.14  ? 35   U   A "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  34   ? 44.269  121.089 43.128  1.00 25.92  ? 35   U   A "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  34   ? 43.694  119.812 43.304  1.00 27.16  ? 35   U   A "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  34   ? 43.501  122.112 43.961  1.00 26.51  ? 35   U   A "C1'" 1 
ATOM   543   N  N1    . U   A  1  34   ? 43.427  123.408 43.270  1.00 27.72  ? 35   U   A N1    1 
ATOM   544   C  C2    . U   A  1  34   ? 42.425  123.559 42.326  1.00 28.62  ? 35   U   A C2    1 
ATOM   545   O  O2    . U   A  1  34   ? 41.606  122.689 42.080  1.00 29.82  ? 35   U   A O2    1 
ATOM   546   N  N3    . U   A  1  34   ? 42.416  124.769 41.678  1.00 29.28  ? 35   U   A N3    1 
ATOM   547   C  C4    . U   A  1  34   ? 43.279  125.827 41.874  1.00 28.45  ? 35   U   A C4    1 
ATOM   548   O  O4    . U   A  1  34   ? 43.093  126.877 41.254  1.00 29.03  ? 35   U   A O4    1 
ATOM   549   C  C5    . U   A  1  34   ? 44.281  125.602 42.874  1.00 28.48  ? 35   U   A C5    1 
ATOM   550   C  C6    . U   A  1  34   ? 44.317  124.432 43.523  1.00 27.96  ? 35   U   A C6    1 
ATOM   551   P  P     . C   A  1  35   ? 47.169  119.983 42.011  1.00 26.02  ? 36   C   A P     1 
ATOM   552   O  OP1   . C   A  1  35   ? 48.155  118.868 42.016  1.00 24.79  ? 36   C   A OP1   1 
ATOM   553   O  OP2   . C   A  1  35   ? 47.607  121.346 41.648  1.00 25.24  ? 36   C   A OP2   1 
ATOM   554   O  "O5'" . C   A  1  35   ? 45.964  119.616 41.041  1.00 25.53  ? 36   C   A "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  35   ? 45.298  118.362 41.139  1.00 25.91  ? 36   C   A "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  35   ? 44.146  118.317 40.177  1.00 27.54  ? 36   C   A "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  35   ? 43.258  119.432 40.464  1.00 27.98  ? 36   C   A "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  35   ? 44.495  118.535 38.716  1.00 28.72  ? 36   C   A "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  35   ? 44.980  117.368 38.080  1.00 30.29  ? 36   C   A "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  35   ? 43.156  118.962 38.147  1.00 29.37  ? 36   C   A "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  35   ? 42.255  117.877 38.059  1.00 30.32  ? 36   C   A "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  35   ? 42.662  119.883 39.255  1.00 29.22  ? 36   C   A "C1'" 1 
ATOM   563   N  N1    . C   A  1  35   ? 43.042  121.287 39.013  1.00 29.71  ? 36   C   A N1    1 
ATOM   564   C  C2    . C   A  1  35   ? 42.237  122.060 38.162  1.00 30.04  ? 36   C   A C2    1 
ATOM   565   O  O2    . C   A  1  35   ? 41.272  121.524 37.593  1.00 29.11  ? 36   C   A O2    1 
ATOM   566   N  N3    . C   A  1  35   ? 42.534  123.368 37.977  1.00 31.27  ? 36   C   A N3    1 
ATOM   567   C  C4    . C   A  1  35   ? 43.592  123.907 38.589  1.00 30.22  ? 36   C   A C4    1 
ATOM   568   N  N4    . C   A  1  35   ? 43.820  125.209 38.405  1.00 29.18  ? 36   C   A N4    1 
ATOM   569   C  C5    . C   A  1  35   ? 44.456  123.133 39.425  1.00 31.14  ? 36   C   A C5    1 
ATOM   570   C  C6    . C   A  1  35   ? 44.143  121.840 39.609  1.00 29.66  ? 36   C   A C6    1 
ATOM   571   P  P     . A   A  1  36   ? 45.998  117.512 36.844  1.00 32.91  ? 37   A   A P     1 
ATOM   572   O  OP1   . A   A  1  36   ? 46.385  116.139 36.467  1.00 33.13  ? 37   A   A OP1   1 
ATOM   573   O  OP2   . A   A  1  36   ? 47.048  118.499 37.200  1.00 32.29  ? 37   A   A OP2   1 
ATOM   574   O  "O5'" . A   A  1  36   ? 45.104  118.126 35.680  1.00 31.04  ? 37   A   A "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  36   ? 44.004  117.376 35.156  1.00 34.34  ? 37   A   A "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  36   ? 43.268  118.161 34.099  1.00 36.74  ? 37   A   A "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  36   ? 42.655  119.337 34.684  1.00 37.26  ? 37   A   A "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  36   ? 44.088  118.699 32.939  1.00 37.82  ? 37   A   A "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  36   ? 44.310  117.714 31.936  1.00 39.89  ? 37   A   A "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  36   ? 43.189  119.802 32.412  1.00 37.42  ? 37   A   A "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  36   ? 42.143  119.262 31.629  1.00 36.95  ? 37   A   A "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  36   ? 42.609  120.365 33.715  1.00 37.93  ? 37   A   A "C1'" 1 
ATOM   583   N  N9    . A   A  1  36   ? 43.372  121.498 34.225  1.00 38.75  ? 37   A   A N9    1 
ATOM   584   C  C8    . A   A  1  36   ? 44.347  121.512 35.186  1.00 39.50  ? 37   A   A C8    1 
ATOM   585   N  N7    . A   A  1  36   ? 44.852  122.702 35.406  1.00 40.47  ? 37   A   A N7    1 
ATOM   586   C  C5    . A   A  1  36   ? 44.158  123.525 34.534  1.00 40.22  ? 37   A   A C5    1 
ATOM   587   C  C6    . A   A  1  36   ? 44.224  124.905 34.284  1.00 41.02  ? 37   A   A C6    1 
ATOM   588   N  N6    . A   A  1  36   ? 45.066  125.730 34.909  1.00 41.43  ? 37   A   A N6    1 
ATOM   589   N  N1    . A   A  1  36   ? 43.386  125.416 33.354  1.00 41.87  ? 37   A   A N1    1 
ATOM   590   C  C2    . A   A  1  36   ? 42.550  124.585 32.722  1.00 42.42  ? 37   A   A C2    1 
ATOM   591   N  N3    . A   A  1  36   ? 42.397  123.269 32.872  1.00 41.45  ? 37   A   A N3    1 
ATOM   592   C  C4    . A   A  1  36   ? 43.241  122.797 33.804  1.00 39.75  ? 37   A   A C4    1 
ATOM   593   P  P     . G   A  1  37   ? 45.565  117.868 30.948  1.00 40.36  ? 38   G   A P     1 
ATOM   594   O  OP1   . G   A  1  37   ? 45.817  116.574 30.262  1.00 39.94  ? 38   G   A OP1   1 
ATOM   595   O  OP2   . G   A  1  37   ? 46.646  118.485 31.756  1.00 42.46  ? 38   G   A OP2   1 
ATOM   596   O  "O5'" . G   A  1  37   ? 45.082  118.946 29.875  1.00 40.65  ? 38   G   A "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  37   ? 44.095  118.608 28.882  1.00 39.24  ? 38   G   A "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  37   ? 43.666  119.839 28.114  1.00 38.99  ? 38   G   A "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  37   ? 43.069  120.804 29.020  1.00 39.00  ? 38   G   A "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  37   ? 44.767  120.641 27.445  1.00 39.49  ? 38   G   A "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  37   ? 45.197  120.078 26.221  1.00 40.16  ? 38   G   A "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  37   ? 44.081  121.978 27.233  1.00 39.37  ? 38   G   A "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  37   ? 43.154  121.935 26.165  1.00 38.94  ? 38   G   A "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  37   ? 43.342  122.124 28.562  1.00 39.22  ? 38   G   A "C1'" 1 
ATOM   605   N  N9    . G   A  1  37   ? 44.202  122.779 29.541  1.00 38.57  ? 38   G   A N9    1 
ATOM   606   C  C8    . G   A  1  37   ? 44.904  122.187 30.561  1.00 39.68  ? 38   G   A C8    1 
ATOM   607   N  N7    . G   A  1  37   ? 45.612  123.037 31.254  1.00 40.07  ? 38   G   A N7    1 
ATOM   608   C  C5    . G   A  1  37   ? 45.363  124.260 30.657  1.00 38.38  ? 38   G   A C5    1 
ATOM   609   C  C6    . G   A  1  37   ? 45.865  125.540 30.972  1.00 38.67  ? 38   G   A C6    1 
ATOM   610   O  O6    . G   A  1  37   ? 46.666  125.850 31.860  1.00 37.48  ? 38   G   A O6    1 
ATOM   611   N  N1    . G   A  1  37   ? 45.351  126.514 30.126  1.00 38.81  ? 38   G   A N1    1 
ATOM   612   C  C2    . G   A  1  37   ? 44.470  126.276 29.098  1.00 40.10  ? 38   G   A C2    1 
ATOM   613   N  N2    . G   A  1  37   ? 44.084  127.342 28.393  1.00 41.03  ? 38   G   A N2    1 
ATOM   614   N  N3    . G   A  1  37   ? 44.001  125.078 28.787  1.00 39.05  ? 38   G   A N3    1 
ATOM   615   C  C4    . G   A  1  37   ? 44.487  124.123 29.605  1.00 38.87  ? 38   G   A C4    1 
ATOM   616   P  P     . G   A  1  38   ? 46.678  120.394 25.687  1.00 41.27  ? 39   G   A P     1 
ATOM   617   O  OP1   . G   A  1  38   ? 46.816  119.723 24.370  1.00 41.49  ? 39   G   A OP1   1 
ATOM   618   O  OP2   . G   A  1  38   ? 47.663  120.105 26.767  1.00 41.45  ? 39   G   A OP2   1 
ATOM   619   O  "O5'" . G   A  1  38   ? 46.660  121.962 25.424  1.00 40.22  ? 39   G   A "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  38   ? 45.925  122.497 24.312  1.00 42.16  ? 39   G   A "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  38   ? 46.049  123.993 24.282  1.00 43.21  ? 39   G   A "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  38   ? 45.626  124.520 25.570  1.00 44.39  ? 39   G   A "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  38   ? 47.462  124.529 24.110  1.00 43.66  ? 39   G   A "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  38   ? 47.829  124.544 22.732  1.00 43.30  ? 39   G   A "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  38   ? 47.323  125.931 24.688  1.00 43.87  ? 39   G   A "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  38   ? 46.682  126.815 23.786  1.00 43.57  ? 39   G   A "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  38   ? 46.410  125.662 25.894  1.00 43.84  ? 39   G   A "C1'" 1 
ATOM   628   N  N9    . G   A  1  38   ? 47.193  125.361 27.091  1.00 43.59  ? 39   G   A N9    1 
ATOM   629   C  C8    . G   A  1  38   ? 47.437  124.125 27.650  1.00 43.80  ? 39   G   A C8    1 
ATOM   630   N  N7    . G   A  1  38   ? 48.243  124.181 28.675  1.00 43.30  ? 39   G   A N7    1 
ATOM   631   C  C5    . G   A  1  38   ? 48.533  125.533 28.811  1.00 42.67  ? 39   G   A C5    1 
ATOM   632   C  C6    . G   A  1  38   ? 49.366  126.201 29.740  1.00 42.61  ? 39   G   A C6    1 
ATOM   633   O  O6    . G   A  1  38   ? 50.052  125.715 30.646  1.00 41.70  ? 39   G   A O6    1 
ATOM   634   N  N1    . G   A  1  38   ? 49.364  127.577 29.530  1.00 43.44  ? 39   G   A N1    1 
ATOM   635   C  C2    . G   A  1  38   ? 48.656  128.226 28.546  1.00 42.67  ? 39   G   A C2    1 
ATOM   636   N  N2    . G   A  1  38   ? 48.775  129.561 28.514  1.00 42.22  ? 39   G   A N2    1 
ATOM   637   N  N3    . G   A  1  38   ? 47.887  127.610 27.665  1.00 42.21  ? 39   G   A N3    1 
ATOM   638   C  C4    . G   A  1  38   ? 47.873  126.274 27.855  1.00 42.43  ? 39   G   A C4    1 
ATOM   639   P  P     . C   A  1  39   ? 49.377  124.400 22.301  1.00 44.29  ? 40   C   A P     1 
ATOM   640   O  OP1   . C   A  1  39   ? 49.381  124.593 20.839  1.00 46.26  ? 40   C   A OP1   1 
ATOM   641   O  OP2   . C   A  1  39   ? 49.986  123.168 22.874  1.00 42.31  ? 40   C   A OP2   1 
ATOM   642   O  "O5'" . C   A  1  39   ? 50.085  125.687 22.921  1.00 43.95  ? 40   C   A "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  39   ? 49.781  127.006 22.430  1.00 43.96  ? 40   C   A "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  39   ? 50.429  128.043 23.308  1.00 43.89  ? 40   C   A "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  39   ? 49.964  127.843 24.667  1.00 44.77  ? 40   C   A "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  39   ? 51.945  127.942 23.394  1.00 44.19  ? 40   C   A "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  39   ? 52.556  128.693 22.337  1.00 44.33  ? 40   C   A "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  39   ? 52.233  128.537 24.766  1.00 44.17  ? 40   C   A "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  39   ? 52.195  129.952 24.729  1.00 43.99  ? 40   C   A "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  39   ? 51.037  128.020 25.578  1.00 44.03  ? 40   C   A "C1'" 1 
ATOM   651   N  N1    . C   A  1  39   ? 51.274  126.736 26.286  1.00 43.95  ? 40   C   A N1    1 
ATOM   652   C  C2    . C   A  1  39   ? 51.963  126.752 27.511  1.00 44.26  ? 40   C   A C2    1 
ATOM   653   O  O2    . C   A  1  39   ? 52.268  127.845 28.013  1.00 44.07  ? 40   C   A O2    1 
ATOM   654   N  N3    . C   A  1  39   ? 52.264  125.573 28.115  1.00 43.19  ? 40   C   A N3    1 
ATOM   655   C  C4    . C   A  1  39   ? 51.879  124.419 27.559  1.00 42.80  ? 40   C   A C4    1 
ATOM   656   N  N4    . C   A  1  39   ? 52.234  123.285 28.167  1.00 43.06  ? 40   C   A N4    1 
ATOM   657   C  C5    . C   A  1  39   ? 51.125  124.379 26.346  1.00 43.03  ? 40   C   A C5    1 
ATOM   658   C  C6    . C   A  1  39   ? 50.851  125.547 25.751  1.00 42.70  ? 40   C   A C6    1 
ATOM   659   P  P     . G   A  1  40   ? 54.111  128.464 21.976  1.00 43.67  ? 41   G   A P     1 
ATOM   660   O  OP1   . G   A  1  40   ? 54.460  129.478 20.943  1.00 45.40  ? 41   G   A OP1   1 
ATOM   661   O  OP2   . G   A  1  40   ? 54.344  127.017 21.696  1.00 42.00  ? 41   G   A OP2   1 
ATOM   662   O  "O5'" . G   A  1  40   ? 54.870  128.847 23.320  1.00 41.71  ? 41   G   A "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  40   ? 55.130  130.220 23.669  1.00 39.52  ? 41   G   A "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  40   ? 56.107  130.261 24.818  1.00 38.44  ? 41   G   A "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  40   ? 55.478  129.678 25.992  1.00 38.82  ? 41   G   A "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  40   ? 57.370  129.435 24.600  1.00 36.38  ? 41   G   A "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  40   ? 58.358  130.208 23.926  1.00 35.01  ? 41   G   A "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  40   ? 57.786  129.099 26.023  1.00 36.92  ? 41   G   A "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  40   ? 58.451  130.174 26.652  1.00 36.33  ? 41   G   A "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  40   ? 56.422  128.888 26.687  1.00 37.68  ? 41   G   A "C1'" 1 
ATOM   671   N  N9    . G   A  1  40   ? 55.954  127.506 26.666  1.00 38.55  ? 41   G   A N9    1 
ATOM   672   C  C8    . G   A  1  40   ? 55.367  126.832 25.618  1.00 38.63  ? 41   G   A C8    1 
ATOM   673   N  N7    . G   A  1  40   ? 55.048  125.602 25.916  1.00 39.77  ? 41   G   A N7    1 
ATOM   674   C  C5    . G   A  1  40   ? 55.457  125.457 27.238  1.00 40.02  ? 41   G   A C5    1 
ATOM   675   C  C6    . G   A  1  40   ? 55.381  124.340 28.112  1.00 39.93  ? 41   G   A C6    1 
ATOM   676   O  O6    . G   A  1  40   ? 54.921  123.214 27.889  1.00 39.41  ? 41   G   A O6    1 
ATOM   677   N  N1    . G   A  1  40   ? 55.915  124.636 29.364  1.00 39.57  ? 41   G   A N1    1 
ATOM   678   C  C2    . G   A  1  40   ? 56.448  125.849 29.731  1.00 39.51  ? 41   G   A C2    1 
ATOM   679   N  N2    . G   A  1  40   ? 56.911  125.944 30.986  1.00 39.15  ? 41   G   A N2    1 
ATOM   680   N  N3    . G   A  1  40   ? 56.523  126.891 28.928  1.00 39.69  ? 41   G   A N3    1 
ATOM   681   C  C4    . G   A  1  40   ? 56.015  126.627 27.709  1.00 39.42  ? 41   G   A C4    1 
ATOM   682   P  P     . C   A  1  41   ? 59.148  129.598 22.666  1.00 35.61  ? 42   C   A P     1 
ATOM   683   O  OP1   . C   A  1  41   ? 59.152  130.684 21.658  1.00 35.70  ? 42   C   A OP1   1 
ATOM   684   O  OP2   . C   A  1  41   ? 58.611  128.263 22.302  1.00 36.84  ? 42   C   A OP2   1 
ATOM   685   O  "O5'" . C   A  1  41   ? 60.651  129.432 23.175  1.00 34.72  ? 42   C   A "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  41   ? 61.568  130.553 23.156  1.00 32.55  ? 42   C   A "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  41   ? 61.312  131.457 24.341  1.00 31.29  ? 42   C   A "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  41   ? 61.520  130.725 25.572  1.00 29.41  ? 42   C   A "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  41   ? 62.224  132.660 24.473  1.00 31.00  ? 42   C   A "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  41   ? 61.753  133.716 23.646  1.00 34.31  ? 42   C   A "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  41   ? 62.092  132.995 25.950  1.00 29.05  ? 42   C   A "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  41   ? 60.899  133.682 26.253  1.00 30.57  ? 42   C   A "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  41   ? 62.023  131.598 26.561  1.00 28.77  ? 42   C   A "C1'" 1 
ATOM   694   N  N1    . C   A  1  41   ? 63.352  131.137 26.961  1.00 28.89  ? 42   C   A N1    1 
ATOM   695   C  C2    . C   A  1  41   ? 63.883  131.619 28.151  1.00 30.06  ? 42   C   A C2    1 
ATOM   696   O  O2    . C   A  1  41   ? 63.184  132.378 28.849  1.00 30.57  ? 42   C   A O2    1 
ATOM   697   N  N3    . C   A  1  41   ? 65.137  131.254 28.509  1.00 29.33  ? 42   C   A N3    1 
ATOM   698   C  C4    . C   A  1  41   ? 65.839  130.426 27.731  1.00 29.82  ? 42   C   A C4    1 
ATOM   699   N  N4    . C   A  1  41   ? 67.072  130.096 28.119  1.00 31.11  ? 42   C   A N4    1 
ATOM   700   C  C5    . C   A  1  41   ? 65.307  129.900 26.521  1.00 30.29  ? 42   C   A C5    1 
ATOM   701   C  C6    . C   A  1  41   ? 64.071  130.278 26.179  1.00 29.99  ? 42   C   A C6    1 
ATOM   702   P  P     . U   A  1  42   ? 62.792  134.758 23.016  1.00 35.07  ? 43   U   A P     1 
ATOM   703   O  OP1   . U   A  1  42   ? 62.020  135.581 22.056  1.00 32.79  ? 43   U   A OP1   1 
ATOM   704   O  OP2   . U   A  1  42   ? 64.006  134.008 22.559  1.00 33.42  ? 43   U   A OP2   1 
ATOM   705   O  "O5'" . U   A  1  42   ? 63.168  135.687 24.247  1.00 31.90  ? 43   U   A "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  42   ? 62.222  136.635 24.740  1.00 32.90  ? 43   U   A "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  42   ? 62.827  137.408 25.873  1.00 33.66  ? 43   U   A "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  42   ? 63.181  136.482 26.937  1.00 34.06  ? 43   U   A "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  42   ? 64.153  138.078 25.565  1.00 34.16  ? 43   U   A "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  42   ? 63.999  139.282 24.825  1.00 34.27  ? 43   U   A "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  42   ? 64.701  138.299 26.966  1.00 33.77  ? 43   U   A "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  42   ? 64.002  139.346 27.615  1.00 35.00  ? 43   U   A "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  42   ? 64.314  136.977 27.640  1.00 32.08  ? 43   U   A "C1'" 1 
ATOM   714   N  N1    . U   A  1  42   ? 65.373  135.950 27.623  1.00 29.84  ? 43   U   A N1    1 
ATOM   715   C  C2    . U   A  1  42   ? 66.378  136.042 28.570  1.00 28.55  ? 43   U   A C2    1 
ATOM   716   O  O2    . U   A  1  42   ? 66.419  136.926 29.408  1.00 29.75  ? 43   U   A O2    1 
ATOM   717   N  N3    . U   A  1  42   ? 67.342  135.063 28.497  1.00 26.84  ? 43   U   A N3    1 
ATOM   718   C  C4    . U   A  1  42   ? 67.411  134.027 27.584  1.00 27.92  ? 43   U   A C4    1 
ATOM   719   O  O4    . U   A  1  42   ? 68.393  133.282 27.579  1.00 26.11  ? 43   U   A O4    1 
ATOM   720   C  C5    . U   A  1  42   ? 66.331  133.993 26.646  1.00 28.64  ? 43   U   A C5    1 
ATOM   721   C  C6    . U   A  1  42   ? 65.375  134.929 26.696  1.00 29.22  ? 43   U   A C6    1 
ATOM   722   P  P     . G   A  1  43   ? 65.169  139.745 23.825  1.00 35.96  ? 44   G   A P     1 
ATOM   723   O  OP1   . G   A  1  43   ? 64.746  141.056 23.243  1.00 35.23  ? 44   G   A OP1   1 
ATOM   724   O  OP2   . G   A  1  43   ? 65.501  138.608 22.928  1.00 34.54  ? 44   G   A OP2   1 
ATOM   725   O  "O5'" . G   A  1  43   ? 66.419  139.981 24.787  1.00 34.62  ? 44   G   A "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  43   ? 66.447  141.115 25.683  1.00 34.29  ? 44   G   A "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  43   ? 67.786  141.220 26.367  1.00 33.00  ? 44   G   A "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  43   ? 67.934  140.152 27.337  1.00 35.30  ? 44   G   A "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  43   ? 69.035  141.114 25.506  1.00 33.09  ? 44   G   A "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  43   ? 69.295  142.339 24.800  1.00 33.82  ? 44   G   A "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  43   ? 70.078  140.804 26.575  1.00 32.53  ? 44   G   A "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  43   ? 70.339  141.950 27.359  1.00 32.22  ? 44   G   A "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  43   ? 69.309  139.814 27.459  1.00 32.58  ? 44   G   A "C1'" 1 
ATOM   734   N  N9    . G   A  1  43   ? 69.491  138.417 27.059  1.00 31.26  ? 44   G   A N9    1 
ATOM   735   C  C8    . G   A  1  43   ? 68.605  137.628 26.357  1.00 31.43  ? 44   G   A C8    1 
ATOM   736   N  N7    . G   A  1  43   ? 69.087  136.448 26.066  1.00 31.13  ? 44   G   A N7    1 
ATOM   737   C  C5    . G   A  1  43   ? 70.361  136.450 26.623  1.00 28.90  ? 44   G   A C5    1 
ATOM   738   C  C6    . G   A  1  43   ? 71.380  135.461 26.596  1.00 28.92  ? 44   G   A C6    1 
ATOM   739   O  O6    . G   A  1  43   ? 71.379  134.365 26.016  1.00 29.97  ? 44   G   A O6    1 
ATOM   740   N  N1    . G   A  1  43   ? 72.502  135.862 27.317  1.00 27.88  ? 44   G   A N1    1 
ATOM   741   C  C2    . G   A  1  43   ? 72.638  137.060 27.964  1.00 27.38  ? 44   G   A C2    1 
ATOM   742   N  N2    . G   A  1  43   ? 73.798  137.236 28.629  1.00 28.19  ? 44   G   A N2    1 
ATOM   743   N  N3    . G   A  1  43   ? 71.712  138.007 27.966  1.00 27.24  ? 44   G   A N3    1 
ATOM   744   C  C4    . G   A  1  43   ? 70.609  137.639 27.277  1.00 28.60  ? 44   G   A C4    1 
ATOM   745   P  P     . A   A  1  44   ? 69.982  142.301 23.335  1.00 34.54  ? 45   A   A P     1 
ATOM   746   O  OP1   . A   A  1  44   ? 68.949  142.703 22.345  1.00 34.51  ? 45   A   A OP1   1 
ATOM   747   O  OP2   . A   A  1  44   ? 70.745  141.042 23.115  1.00 33.03  ? 45   A   A OP2   1 
ATOM   748   O  "O5'" . A   A  1  44   ? 71.050  143.477 23.400  1.00 33.74  ? 45   A   A "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  44   ? 72.016  143.532 24.454  1.00 31.74  ? 45   A   A "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  44   ? 73.133  144.461 24.068  1.00 31.76  ? 45   A   A "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  44   ? 74.040  144.619 25.182  1.00 31.66  ? 45   A   A "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  44   ? 73.995  143.990 22.907  1.00 32.47  ? 45   A   A "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  44   ? 74.552  145.148 22.317  1.00 36.86  ? 45   A   A "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  44   ? 75.091  143.212 23.616  1.00 32.12  ? 45   A   A "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  44   ? 76.292  143.084 22.885  1.00 29.16  ? 45   A   A "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  44   ? 75.301  144.089 24.844  1.00 33.20  ? 45   A   A "C1'" 1 
ATOM   757   N  N9    . A   A  1  44   ? 75.796  143.356 26.002  1.00 35.72  ? 45   A   A N9    1 
ATOM   758   C  C8    . A   A  1  44   ? 76.895  143.677 26.741  1.00 35.37  ? 45   A   A C8    1 
ATOM   759   N  N7    . A   A  1  44   ? 77.117  142.865 27.735  1.00 36.12  ? 45   A   A N7    1 
ATOM   760   C  C5    . A   A  1  44   ? 76.091  141.940 27.649  1.00 37.24  ? 45   A   A C5    1 
ATOM   761   C  C6    . A   A  1  44   ? 75.763  140.817 28.428  1.00 37.58  ? 45   A   A C6    1 
ATOM   762   N  N6    . A   A  1  44   ? 76.469  140.422 29.489  1.00 35.90  ? 45   A   A N6    1 
ATOM   763   N  N1    . A   A  1  44   ? 74.669  140.104 28.074  1.00 38.31  ? 45   A   A N1    1 
ATOM   764   C  C2    . A   A  1  44   ? 73.962  140.505 27.005  1.00 38.15  ? 45   A   A C2    1 
ATOM   765   N  N3    . A   A  1  44   ? 74.175  141.539 26.196  1.00 38.60  ? 45   A   A N3    1 
ATOM   766   C  C4    . A   A  1  44   ? 75.269  142.226 26.580  1.00 37.23  ? 45   A   A C4    1 
ATOM   767   P  P     . U   A  1  45   ? 74.302  145.456 20.775  1.00 39.13  ? 46   U   A P     1 
ATOM   768   O  OP1   . U   A  1  45   ? 74.369  144.162 20.056  1.00 39.35  ? 46   U   A OP1   1 
ATOM   769   O  OP2   . U   A  1  45   ? 75.245  146.539 20.442  1.00 37.62  ? 46   U   A OP2   1 
ATOM   770   O  "O5'" . U   A  1  45   ? 72.807  145.999 20.696  1.00 39.19  ? 46   U   A "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  45   ? 72.475  147.342 21.089  1.00 43.38  ? 46   U   A "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  45   ? 70.982  147.557 20.993  1.00 46.34  ? 46   U   A "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  45   ? 70.562  147.497 19.599  1.00 51.08  ? 46   U   A "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  45   ? 70.108  146.553 21.735  1.00 47.30  ? 46   U   A "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  45   ? 68.970  147.236 22.217  1.00 43.07  ? 46   U   A "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  45   ? 69.693  145.584 20.635  1.00 50.68  ? 46   U   A "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  45   ? 68.463  144.944 20.909  1.00 53.02  ? 46   U   A "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  45   ? 69.538  146.535 19.452  1.00 51.92  ? 46   U   A "C1'" 1 
ATOM   779   N  N1    . U   A  1  45   ? 69.686  145.881 18.144  1.00 54.35  ? 46   U   A N1    1 
ATOM   780   C  C2    . U   A  1  45   ? 68.554  145.788 17.347  1.00 55.36  ? 46   U   A C2    1 
ATOM   781   O  O2    . U   A  1  45   ? 67.467  146.237 17.679  1.00 54.49  ? 46   U   A O2    1 
ATOM   782   N  N3    . U   A  1  45   ? 68.742  145.149 16.148  1.00 57.59  ? 46   U   A N3    1 
ATOM   783   C  C4    . U   A  1  45   ? 69.921  144.602 15.672  1.00 59.45  ? 46   U   A C4    1 
ATOM   784   O  O4    . U   A  1  45   ? 69.921  144.021 14.583  1.00 61.67  ? 46   U   A O4    1 
ATOM   785   C  C5    . U   A  1  45   ? 71.051  144.748 16.551  1.00 58.08  ? 46   U   A C5    1 
ATOM   786   C  C6    . U   A  1  45   ? 70.899  145.369 17.726  1.00 55.19  ? 46   U   A C6    1 
ATOM   787   P  P     . G   A  1  46   ? 69.061  148.004 23.612  1.00 40.84  ? 47   G   A P     1 
ATOM   788   O  OP1   . G   A  1  46   ? 67.667  148.127 24.106  1.00 39.67  ? 47   G   A OP1   1 
ATOM   789   O  OP2   . G   A  1  46   ? 69.894  149.226 23.426  1.00 42.04  ? 47   G   A OP2   1 
ATOM   790   O  "O5'" . G   A  1  46   ? 69.915  147.015 24.519  1.00 39.98  ? 47   G   A "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  46   ? 69.330  145.871 25.130  1.00 36.87  ? 47   G   A "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  46   ? 69.696  145.839 26.593  1.00 36.23  ? 47   G   A "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  46   ? 71.134  145.693 26.717  1.00 34.57  ? 47   G   A "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  46   ? 69.333  147.078 27.403  1.00 35.48  ? 47   G   A "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  46   ? 68.989  146.719 28.727  1.00 36.68  ? 47   G   A "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  46   ? 70.625  147.879 27.432  1.00 35.12  ? 47   G   A "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  46   ? 70.717  148.683 28.597  1.00 34.16  ? 47   G   A "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  46   ? 71.675  146.772 27.449  1.00 34.39  ? 47   G   A "C1'" 1 
ATOM   799   N  N9    . G   A  1  46   ? 72.884  147.184 26.752  1.00 35.69  ? 47   G   A N9    1 
ATOM   800   C  C8    . G   A  1  46   ? 72.936  147.790 25.518  1.00 36.36  ? 47   G   A C8    1 
ATOM   801   N  N7    . G   A  1  46   ? 74.151  148.039 25.122  1.00 37.14  ? 47   G   A N7    1 
ATOM   802   C  C5    . G   A  1  46   ? 74.955  147.573 26.155  1.00 36.61  ? 47   G   A C5    1 
ATOM   803   C  C6    . G   A  1  46   ? 76.361  147.583 26.288  1.00 36.94  ? 47   G   A C6    1 
ATOM   804   O  O6    . G   A  1  46   ? 77.203  148.029 25.501  1.00 38.13  ? 47   G   A O6    1 
ATOM   805   N  N1    . G   A  1  46   ? 76.766  147.007 27.489  1.00 37.65  ? 47   G   A N1    1 
ATOM   806   C  C2    . G   A  1  46   ? 75.919  146.497 28.447  1.00 36.77  ? 47   G   A C2    1 
ATOM   807   N  N2    . G   A  1  46   ? 76.502  145.980 29.536  1.00 35.33  ? 47   G   A N2    1 
ATOM   808   N  N3    . G   A  1  46   ? 74.600  146.493 28.339  1.00 36.18  ? 47   G   A N3    1 
ATOM   809   C  C4    . G   A  1  46   ? 74.189  147.043 27.173  1.00 36.36  ? 47   G   A C4    1 
ATOM   810   P  P     . A   A  1  47   ? 67.612  147.251 29.342  1.00 36.99  ? 48   A   A P     1 
ATOM   811   O  OP1   . A   A  1  47   ? 66.979  148.083 28.299  1.00 37.04  ? 48   A   A OP1   1 
ATOM   812   O  OP2   . A   A  1  47   ? 67.881  147.842 30.670  1.00 37.53  ? 48   A   A OP2   1 
ATOM   813   O  "O5'" . A   A  1  47   ? 66.746  145.927 29.543  1.00 37.37  ? 48   A   A "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  47   ? 66.134  145.245 28.424  1.00 36.41  ? 48   A   A "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  47   ? 65.922  143.784 28.750  1.00 36.66  ? 48   A   A "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  47   ? 67.194  143.096 28.782  1.00 37.49  ? 48   A   A "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  47   ? 65.291  143.510 30.104  1.00 36.54  ? 48   A   A "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  47   ? 63.882  143.526 29.994  1.00 35.03  ? 48   A   A "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  47   ? 65.793  142.115 30.441  1.00 37.59  ? 48   A   A "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  47   ? 65.042  141.092 29.821  1.00 39.07  ? 48   A   A "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  47   ? 67.197  142.156 29.841  1.00 38.21  ? 48   A   A "C1'" 1 
ATOM   822   N  N9    . A   A  1  47   ? 68.227  142.563 30.790  1.00 39.85  ? 48   A   A N9    1 
ATOM   823   C  C8    . A   A  1  47   ? 68.873  143.770 30.899  1.00 39.53  ? 48   A   A C8    1 
ATOM   824   N  N7    . A   A  1  47   ? 69.825  143.774 31.796  1.00 39.94  ? 48   A   A N7    1 
ATOM   825   C  C5    . A   A  1  47   ? 69.790  142.492 32.326  1.00 40.04  ? 48   A   A C5    1 
ATOM   826   C  C6    . A   A  1  47   ? 70.573  141.846 33.298  1.00 39.63  ? 48   A   A C6    1 
ATOM   827   N  N6    . A   A  1  47   ? 71.617  142.419 33.912  1.00 39.42  ? 48   A   A N6    1 
ATOM   828   N  N1    . A   A  1  47   ? 70.258  140.567 33.611  1.00 39.51  ? 48   A   A N1    1 
ATOM   829   C  C2    . A   A  1  47   ? 69.242  139.983 32.971  1.00 40.59  ? 48   A   A C2    1 
ATOM   830   N  N3    . A   A  1  47   ? 68.451  140.479 32.021  1.00 43.45  ? 48   A   A N3    1 
ATOM   831   C  C4    . A   A  1  47   ? 68.787  141.751 31.741  1.00 41.01  ? 48   A   A C4    1 
ATOM   832   P  P     . A   A  1  48   ? 63.006  144.255 31.113  1.00 35.90  ? 49   A   A P     1 
ATOM   833   O  OP1   . A   A  1  48   ? 61.598  144.258 30.657  1.00 33.69  ? 49   A   A OP1   1 
ATOM   834   O  OP2   . A   A  1  48   ? 63.685  145.534 31.447  1.00 35.95  ? 49   A   A OP2   1 
ATOM   835   O  "O5'" . A   A  1  48   ? 63.097  143.275 32.355  1.00 33.38  ? 49   A   A "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  48   ? 62.485  141.988 32.302  1.00 33.52  ? 49   A   A "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  48   ? 63.012  141.147 33.414  1.00 31.81  ? 49   A   A "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  48   ? 64.425  140.910 33.210  1.00 32.89  ? 49   A   A "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  48   ? 62.945  141.788 34.789  1.00 31.58  ? 49   A   A "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  48   ? 61.660  141.637 35.365  1.00 30.88  ? 49   A   A "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  48   ? 63.952  140.944 35.533  1.00 33.22  ? 49   A   A "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  48   ? 63.375  139.689 35.821  1.00 33.68  ? 49   A   A "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  48   ? 65.052  140.797 34.472  1.00 35.11  ? 49   A   A "C1'" 1 
ATOM   844   N  N9    . A   A  1  48   ? 66.015  141.886 34.609  1.00 37.32  ? 49   A   A N9    1 
ATOM   845   C  C8    . A   A  1  48   ? 66.035  143.109 33.990  1.00 37.74  ? 49   A   A C8    1 
ATOM   846   N  N7    . A   A  1  48   ? 67.014  143.885 34.389  1.00 39.83  ? 49   A   A N7    1 
ATOM   847   C  C5    . A   A  1  48   ? 67.691  143.114 35.321  1.00 39.42  ? 49   A   A C5    1 
ATOM   848   C  C6    . A   A  1  48   ? 68.818  143.366 36.123  1.00 39.90  ? 49   A   A C6    1 
ATOM   849   N  N6    . A   A  1  48   ? 69.498  144.515 36.103  1.00 41.13  ? 49   A   A N6    1 
ATOM   850   N  N1    . A   A  1  48   ? 69.225  142.386 36.960  1.00 40.73  ? 49   A   A N1    1 
ATOM   851   C  C2    . A   A  1  48   ? 68.539  141.239 36.981  1.00 42.07  ? 49   A   A C2    1 
ATOM   852   N  N3    . A   A  1  48   ? 67.468  140.884 36.275  1.00 41.22  ? 49   A   A N3    1 
ATOM   853   C  C4    . A   A  1  48   ? 67.091  141.879 35.457  1.00 39.03  ? 49   A   A C4    1 
ATOM   854   P  P     . G   A  1  49   ? 60.986  142.854 36.169  1.00 32.00  ? 50   G   A P     1 
ATOM   855   O  OP1   . G   A  1  49   ? 59.765  142.296 36.793  1.00 34.08  ? 50   G   A OP1   1 
ATOM   856   O  OP2   . G   A  1  49   ? 60.875  144.031 35.270  1.00 34.48  ? 50   G   A OP2   1 
ATOM   857   O  "O5'" . G   A  1  49   ? 62.008  143.161 37.347  1.00 33.21  ? 50   G   A "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  49   ? 62.242  142.185 38.375  1.00 32.77  ? 50   G   A "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  49   ? 63.399  142.610 39.241  1.00 34.12  ? 50   G   A "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  49   ? 64.617  142.676 38.443  1.00 34.61  ? 50   G   A "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  49   ? 63.300  143.996 39.849  1.00 33.84  ? 50   G   A "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  49   ? 62.463  144.042 40.989  1.00 34.53  ? 50   G   A "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  49   ? 64.750  144.273 40.176  1.00 33.68  ? 50   G   A "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  49   ? 65.163  143.524 41.301  1.00 33.16  ? 50   G   A "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  49   ? 65.439  143.728 38.920  1.00 34.04  ? 50   G   A "C1'" 1 
ATOM   866   N  N9    . G   A  1  49   ? 65.555  144.735 37.864  1.00 35.20  ? 50   G   A N9    1 
ATOM   867   C  C8    . G   A  1  49   ? 64.803  144.820 36.718  1.00 36.05  ? 50   G   A C8    1 
ATOM   868   N  N7    . G   A  1  49   ? 65.084  145.870 35.995  1.00 37.93  ? 50   G   A N7    1 
ATOM   869   C  C5    . G   A  1  49   ? 66.092  146.515 36.699  1.00 36.88  ? 50   G   A C5    1 
ATOM   870   C  C6    . G   A  1  49   ? 66.778  147.726 36.423  1.00 37.54  ? 50   G   A C6    1 
ATOM   871   O  O6    . G   A  1  49   ? 66.610  148.509 35.482  1.00 38.65  ? 50   G   A O6    1 
ATOM   872   N  N1    . G   A  1  49   ? 67.736  148.001 37.389  1.00 37.90  ? 50   G   A N1    1 
ATOM   873   C  C2    . G   A  1  49   ? 67.996  147.220 38.485  1.00 37.27  ? 50   G   A C2    1 
ATOM   874   N  N2    . G   A  1  49   ? 68.977  147.639 39.288  1.00 39.38  ? 50   G   A N2    1 
ATOM   875   N  N3    . G   A  1  49   ? 67.348  146.106 38.769  1.00 37.30  ? 50   G   A N3    1 
ATOM   876   C  C4    . G   A  1  49   ? 66.416  145.814 37.840  1.00 35.92  ? 50   G   A C4    1 
ATOM   877   P  P     . G   A  1  50   ? 61.670  145.399 41.335  1.00 36.69  ? 51   G   A P     1 
ATOM   878   O  OP1   . G   A  1  50   ? 60.806  145.130 42.526  1.00 36.49  ? 51   G   A OP1   1 
ATOM   879   O  OP2   . G   A  1  50   ? 61.055  145.885 40.088  1.00 36.70  ? 51   G   A OP2   1 
ATOM   880   O  "O5'" . G   A  1  50   ? 62.821  146.433 41.730  1.00 35.43  ? 51   G   A "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  50   ? 63.616  146.240 42.930  1.00 33.53  ? 51   G   A "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  50   ? 64.772  147.219 42.974  1.00 30.50  ? 51   G   A "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  50   ? 65.572  147.060 41.777  1.00 32.08  ? 51   G   A "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  50   ? 64.464  148.712 43.003  1.00 30.22  ? 51   G   A "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  50   ? 64.166  149.159 44.316  1.00 30.11  ? 51   G   A "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  50   ? 65.788  149.292 42.546  1.00 29.97  ? 51   G   A "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  50   ? 66.777  149.261 43.552  1.00 32.22  ? 51   G   A "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  50   ? 66.185  148.293 41.459  1.00 31.45  ? 51   G   A "C1'" 1 
ATOM   889   N  N9    . G   A  1  50   ? 65.670  148.762 40.182  1.00 34.41  ? 51   G   A N9    1 
ATOM   890   C  C8    . G   A  1  50   ? 64.673  148.229 39.404  1.00 35.56  ? 51   G   A C8    1 
ATOM   891   N  N7    . G   A  1  50   ? 64.422  148.945 38.342  1.00 35.94  ? 51   G   A N7    1 
ATOM   892   C  C5    . G   A  1  50   ? 65.312  150.002 38.429  1.00 35.34  ? 51   G   A C5    1 
ATOM   893   C  C6    . G   A  1  50   ? 65.511  151.103 37.577  1.00 35.40  ? 51   G   A C6    1 
ATOM   894   O  O6    . G   A  1  50   ? 64.918  151.386 36.536  1.00 35.92  ? 51   G   A O6    1 
ATOM   895   N  N1    . G   A  1  50   ? 66.526  151.933 38.043  1.00 36.73  ? 51   G   A N1    1 
ATOM   896   C  C2    . G   A  1  50   ? 67.258  151.721 39.183  1.00 36.55  ? 51   G   A C2    1 
ATOM   897   N  N2    . G   A  1  50   ? 68.211  152.621 39.469  1.00 37.07  ? 51   G   A N2    1 
ATOM   898   N  N3    . G   A  1  50   ? 67.075  150.701 39.984  1.00 36.33  ? 51   G   A N3    1 
ATOM   899   C  C4    . G   A  1  50   ? 66.095  149.888 39.550  1.00 35.37  ? 51   G   A C4    1 
ATOM   900   P  P     . A   A  1  51   ? 63.362  150.541 44.547  1.00 32.54  ? 52   A   A P     1 
ATOM   901   O  OP1   . A   A  1  51   ? 63.140  150.622 46.012  1.00 31.48  ? 52   A   A OP1   1 
ATOM   902   O  OP2   . A   A  1  51   ? 62.206  150.667 43.610  1.00 30.44  ? 52   A   A OP2   1 
ATOM   903   O  "O5'" . A   A  1  51   ? 64.390  151.678 44.138  1.00 29.95  ? 52   A   A "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  51   ? 65.615  151.862 44.844  1.00 30.87  ? 52   A   A "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  51   ? 66.352  153.022 44.249  1.00 32.57  ? 52   A   A "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  51   ? 66.673  152.710 42.867  1.00 33.69  ? 52   A   A "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  51   ? 65.560  154.314 44.173  1.00 33.37  ? 52   A   A "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  51   ? 65.599  154.999 45.432  1.00 33.63  ? 52   A   A "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  51   ? 66.275  155.037 43.037  1.00 34.88  ? 52   A   A "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  51   ? 67.527  155.555 43.435  1.00 35.75  ? 52   A   A "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  51   ? 66.580  153.881 42.080  1.00 34.69  ? 52   A   A "C1'" 1 
ATOM   912   N  N9    . A   A  1  51   ? 65.586  153.661 41.025  1.00 36.73  ? 52   A   A N9    1 
ATOM   913   C  C8    . A   A  1  51   ? 64.610  152.701 41.013  1.00 38.05  ? 52   A   A C8    1 
ATOM   914   N  N7    . A   A  1  51   ? 63.849  152.730 39.946  1.00 39.85  ? 52   A   A N7    1 
ATOM   915   C  C5    . A   A  1  51   ? 64.357  153.785 39.203  1.00 38.61  ? 52   A   A C5    1 
ATOM   916   C  C6    . A   A  1  51   ? 63.979  154.334 37.968  1.00 39.95  ? 52   A   A C6    1 
ATOM   917   N  N6    . A   A  1  51   ? 62.948  153.887 37.248  1.00 41.40  ? 52   A   A N6    1 
ATOM   918   N  N1    . A   A  1  51   ? 64.695  155.370 37.499  1.00 39.47  ? 52   A   A N1    1 
ATOM   919   C  C2    . A   A  1  51   ? 65.713  155.821 38.234  1.00 39.03  ? 52   A   A C2    1 
ATOM   920   N  N3    . A   A  1  51   ? 66.161  155.397 39.414  1.00 37.75  ? 52   A   A N3    1 
ATOM   921   C  C4    . A   A  1  51   ? 65.431  154.363 39.850  1.00 37.40  ? 52   A   A C4    1 
ATOM   922   P  P     . C   A  1  52   ? 64.359  155.926 45.897  1.00 34.27  ? 53   C   A P     1 
ATOM   923   O  OP1   . C   A  1  52   ? 64.758  156.557 47.185  1.00 33.17  ? 53   C   A OP1   1 
ATOM   924   O  OP2   . C   A  1  52   ? 63.066  155.206 45.815  1.00 35.04  ? 53   C   A OP2   1 
ATOM   925   O  "O5'" . C   A  1  52   ? 64.326  157.057 44.782  1.00 35.03  ? 53   C   A "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  52   ? 65.397  158.000 44.681  1.00 33.68  ? 53   C   A "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  52   ? 65.264  158.822 43.422  1.00 33.89  ? 53   C   A "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  52   ? 65.452  157.986 42.248  1.00 34.99  ? 53   C   A "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  52   ? 63.933  159.491 43.150  1.00 33.59  ? 53   C   A "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  52   ? 63.726  160.658 43.932  1.00 32.82  ? 53   C   A "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  52   ? 64.083  159.822 41.674  1.00 34.57  ? 53   C   A "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  52   ? 64.994  160.885 41.488  1.00 37.12  ? 53   C   A "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  52   ? 64.735  158.543 41.151  1.00 35.24  ? 53   C   A "C1'" 1 
ATOM   934   N  N1    . C   A  1  52   ? 63.702  157.584 40.700  1.00 37.08  ? 53   C   A N1    1 
ATOM   935   C  C2    . C   A  1  52   ? 63.192  157.691 39.395  1.00 36.94  ? 53   C   A C2    1 
ATOM   936   O  O2    . C   A  1  52   ? 63.673  158.531 38.620  1.00 37.32  ? 53   C   A O2    1 
ATOM   937   N  N3    . C   A  1  52   ? 62.187  156.874 39.012  1.00 37.63  ? 53   C   A N3    1 
ATOM   938   C  C4    . C   A  1  52   ? 61.697  155.970 39.862  1.00 36.72  ? 53   C   A C4    1 
ATOM   939   N  N4    . C   A  1  52   ? 60.674  155.217 39.450  1.00 37.92  ? 53   C   A N4    1 
ATOM   940   C  C5    . C   A  1  52   ? 62.225  155.805 41.173  1.00 38.50  ? 53   C   A C5    1 
ATOM   941   C  C6    . C   A  1  52   ? 63.218  156.625 41.548  1.00 38.43  ? 53   C   A C6    1 
ATOM   942   P  P     . G   A  1  53   ? 62.311  161.418 43.856  1.00 33.45  ? 54   G   A P     1 
ATOM   943   O  OP1   . G   A  1  53   ? 62.256  162.372 44.977  1.00 31.81  ? 54   G   A OP1   1 
ATOM   944   O  OP2   . G   A  1  53   ? 61.245  160.387 43.721  1.00 32.81  ? 54   G   A OP2   1 
ATOM   945   O  "O5'" . G   A  1  53   ? 62.422  162.229 42.490  1.00 31.70  ? 54   G   A "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  53   ? 61.255  162.678 41.792  1.00 33.92  ? 54   G   A "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  53   ? 61.523  162.700 40.310  1.00 35.98  ? 54   G   A "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  53   ? 62.005  161.404 39.881  1.00 36.81  ? 54   G   A "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  53   ? 60.317  163.005 39.440  1.00 37.64  ? 54   G   A "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  53   ? 60.201  164.409 39.256  1.00 37.58  ? 54   G   A "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  53   ? 60.637  162.258 38.151  1.00 39.16  ? 54   G   A "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  53   ? 61.563  162.943 37.337  1.00 42.50  ? 54   G   A "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  53   ? 61.332  161.010 38.697  1.00 39.05  ? 54   G   A "C1'" 1 
ATOM   954   N  N9    . G   A  1  53   ? 60.430  159.923 39.058  1.00 40.52  ? 54   G   A N9    1 
ATOM   955   C  C8    . G   A  1  53   ? 60.294  159.384 40.312  1.00 40.95  ? 54   G   A C8    1 
ATOM   956   N  N7    . G   A  1  53   ? 59.442  158.402 40.358  1.00 43.05  ? 54   G   A N7    1 
ATOM   957   C  C5    . G   A  1  53   ? 58.981  158.280 39.056  1.00 41.63  ? 54   G   A C5    1 
ATOM   958   C  C6    . G   A  1  53   ? 58.052  157.373 38.505  1.00 40.98  ? 54   G   A C6    1 
ATOM   959   O  O6    . G   A  1  53   ? 57.449  156.458 39.070  1.00 40.35  ? 54   G   A O6    1 
ATOM   960   N  N1    . G   A  1  53   ? 57.853  157.605 37.152  1.00 39.86  ? 54   G   A N1    1 
ATOM   961   C  C2    . G   A  1  53   ? 58.478  158.581 36.420  1.00 40.98  ? 54   G   A C2    1 
ATOM   962   N  N2    . G   A  1  53   ? 58.133  158.654 35.129  1.00 41.88  ? 54   G   A N2    1 
ATOM   963   N  N3    . G   A  1  53   ? 59.369  159.426 36.918  1.00 41.09  ? 54   G   A N3    1 
ATOM   964   C  C4    . G   A  1  53   ? 59.569  159.220 38.238  1.00 41.09  ? 54   G   A C4    1 
ATOM   965   P  P     . U   A  1  54   ? 58.827  165.148 39.619  1.00 39.83  ? 55   U   A P     1 
ATOM   966   O  OP1   . U   A  1  54   ? 58.989  166.620 39.473  1.00 39.02  ? 55   U   A OP1   1 
ATOM   967   O  OP2   . U   A  1  54   ? 58.346  164.592 40.914  1.00 40.53  ? 55   U   A OP2   1 
ATOM   968   O  "O5'" . U   A  1  54   ? 57.845  164.666 38.468  1.00 39.26  ? 55   U   A "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  54   ? 58.178  164.875 37.089  1.00 39.99  ? 55   U   A "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  54   ? 57.261  164.065 36.210  1.00 40.69  ? 55   U   A "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  54   ? 57.561  162.650 36.340  1.00 42.14  ? 55   U   A "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  54   ? 55.790  164.192 36.568  1.00 39.80  ? 55   U   A "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  54   ? 55.233  165.360 35.957  1.00 39.80  ? 55   U   A "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  54   ? 55.210  162.898 36.016  1.00 40.45  ? 55   U   A "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  54   ? 55.013  162.977 34.625  1.00 41.75  ? 55   U   A "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  54   ? 56.354  161.905 36.278  1.00 42.52  ? 55   U   A "C1'" 1 
ATOM   977   N  N1    . U   A  1  54   ? 56.219  161.117 37.518  1.00 44.06  ? 55   U   A N1    1 
ATOM   978   C  C2    . U   A  1  54   ? 55.504  159.927 37.459  1.00 43.89  ? 55   U   A C2    1 
ATOM   979   O  O2    . U   A  1  54   ? 55.048  159.474 36.420  1.00 44.51  ? 55   U   A O2    1 
ATOM   980   N  N3    . U   A  1  54   ? 55.354  159.281 38.661  1.00 45.60  ? 55   U   A N3    1 
ATOM   981   C  C4    . U   A  1  54   ? 55.859  159.672 39.890  1.00 46.34  ? 55   U   A C4    1 
ATOM   982   O  O4    . U   A  1  54   ? 55.596  159.007 40.901  1.00 46.60  ? 55   U   A O4    1 
ATOM   983   C  C5    . U   A  1  54   ? 56.621  160.881 39.860  1.00 46.01  ? 55   U   A C5    1 
ATOM   984   C  C6    . U   A  1  54   ? 56.769  161.548 38.708  1.00 44.72  ? 55   U   A C6    1 
ATOM   985   P  P     . G   A  1  55   ? 54.263  166.328 36.803  1.00 40.37  ? 56   G   A P     1 
ATOM   986   O  OP1   . G   A  1  55   ? 53.935  167.519 35.970  1.00 39.96  ? 56   G   A OP1   1 
ATOM   987   O  OP2   . G   A  1  55   ? 54.845  166.521 38.149  1.00 39.30  ? 56   G   A OP2   1 
ATOM   988   O  "O5'" . G   A  1  55   ? 52.925  165.479 36.944  1.00 40.73  ? 56   G   A "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  55   ? 52.200  165.082 35.775  1.00 41.23  ? 56   G   A "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  55   ? 50.725  165.196 36.011  1.00 41.55  ? 56   G   A "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  55   ? 50.295  164.095 36.845  1.00 43.21  ? 56   G   A "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  55   ? 50.230  166.462 36.693  1.00 42.37  ? 56   G   A "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  55   ? 48.963  166.754 36.139  1.00 44.60  ? 56   G   A "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  55   ? 50.046  166.012 38.138  1.00 41.57  ? 56   G   A "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  55   ? 49.072  166.755 38.844  1.00 41.56  ? 56   G   A "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  55   ? 49.535  164.595 37.920  1.00 43.43  ? 56   G   A "C1'" 1 
ATOM   997   N  N9    . G   A  1  55   ? 49.690  163.681 39.043  1.00 45.46  ? 56   G   A N9    1 
ATOM   998   C  C8    . G   A  1  55   ? 50.414  163.868 40.194  1.00 45.37  ? 56   G   A C8    1 
ATOM   999   N  N7    . G   A  1  55   ? 50.346  162.853 41.010  1.00 45.89  ? 56   G   A N7    1 
ATOM   1000  C  C5    . G   A  1  55   ? 49.532  161.943 40.356  1.00 45.46  ? 56   G   A C5    1 
ATOM   1001  C  C6    . G   A  1  55   ? 49.099  160.665 40.744  1.00 45.67  ? 56   G   A C6    1 
ATOM   1002  O  O6    . G   A  1  55   ? 49.354  160.055 41.782  1.00 46.26  ? 56   G   A O6    1 
ATOM   1003  N  N1    . G   A  1  55   ? 48.283  160.084 39.778  1.00 45.69  ? 56   G   A N1    1 
ATOM   1004  C  C2    . G   A  1  55   ? 47.928  160.664 38.589  1.00 44.53  ? 56   G   A C2    1 
ATOM   1005  N  N2    . G   A  1  55   ? 47.134  159.943 37.795  1.00 44.47  ? 56   G   A N2    1 
ATOM   1006  N  N3    . G   A  1  55   ? 48.324  161.860 38.214  1.00 44.64  ? 56   G   A N3    1 
ATOM   1007  C  C4    . G   A  1  55   ? 49.119  162.439 39.141  1.00 45.32  ? 56   G   A C4    1 
ATOM   1008  P  P     . C   A  1  56   ? 48.749  168.135 35.378  1.00 45.95  ? 57   C   A P     1 
ATOM   1009  O  OP1   . C   A  1  56   ? 47.406  168.072 34.759  1.00 47.72  ? 57   C   A OP1   1 
ATOM   1010  O  OP2   . C   A  1  56   ? 49.949  168.382 34.520  1.00 45.79  ? 57   C   A OP2   1 
ATOM   1011  O  "O5'" . C   A  1  56   ? 48.706  169.178 36.578  1.00 45.25  ? 57   C   A "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  56   ? 49.073  170.548 36.395  1.00 44.96  ? 57   C   A "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  56   ? 48.418  171.390 37.462  1.00 44.95  ? 57   C   A "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  56   ? 46.995  171.480 37.219  1.00 43.37  ? 57   C   A "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  56   ? 48.507  170.844 38.874  1.00 45.78  ? 57   C   A "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  56   ? 49.769  171.143 39.431  1.00 48.98  ? 57   C   A "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  56   ? 47.353  171.547 39.572  1.00 43.79  ? 57   C   A "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  56   ? 47.643  172.884 39.943  1.00 44.63  ? 57   C   A "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  56   ? 46.309  171.551 38.456  1.00 42.22  ? 57   C   A "C1'" 1 
ATOM   1020  N  N1    . C   A  1  56   ? 45.343  170.443 38.530  1.00 40.44  ? 57   C   A N1    1 
ATOM   1021  C  C2    . C   A  1  56   ? 44.338  170.506 39.507  1.00 40.34  ? 57   C   A C2    1 
ATOM   1022  O  O2    . C   A  1  56   ? 44.350  171.445 40.310  1.00 41.46  ? 57   C   A O2    1 
ATOM   1023  N  N3    . C   A  1  56   ? 43.392  169.541 39.554  1.00 38.90  ? 57   C   A N3    1 
ATOM   1024  C  C4    . C   A  1  56   ? 43.433  168.530 38.684  1.00 38.80  ? 57   C   A C4    1 
ATOM   1025  N  N4    . C   A  1  56   ? 42.463  167.615 38.753  1.00 37.68  ? 57   C   A N4    1 
ATOM   1026  C  C5    . C   A  1  56   ? 44.470  168.416 37.700  1.00 39.17  ? 57   C   A C5    1 
ATOM   1027  C  C6    . C   A  1  56   ? 45.396  169.384 37.662  1.00 39.43  ? 57   C   A C6    1 
ATOM   1028  P  P     . C   A  1  57   ? 50.456  170.093 40.419  1.00 50.89  ? 58   C   A P     1 
ATOM   1029  O  OP1   . C   A  1  57   ? 51.765  170.669 40.822  1.00 50.01  ? 58   C   A OP1   1 
ATOM   1030  O  OP2   . C   A  1  57   ? 50.395  168.747 39.806  1.00 49.32  ? 58   C   A OP2   1 
ATOM   1031  O  "O5'" . C   A  1  57   ? 49.505  170.125 41.685  1.00 49.80  ? 58   C   A "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  57   ? 49.375  171.328 42.433  1.00 52.75  ? 58   C   A "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  57   ? 48.302  171.177 43.460  1.00 54.70  ? 58   C   A "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  57   ? 47.023  171.063 42.804  1.00 55.49  ? 58   C   A "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  57   ? 48.371  169.903 44.274  1.00 56.67  ? 58   C   A "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  57   ? 49.335  169.984 45.301  1.00 60.16  ? 58   C   A "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  57   ? 46.970  169.841 44.845  1.00 56.70  ? 58   C   A "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  57   ? 46.818  170.735 45.929  1.00 57.77  ? 58   C   A "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  57   ? 46.151  170.329 43.645  1.00 56.32  ? 58   C   A "C1'" 1 
ATOM   1040  N  N1    . C   A  1  57   ? 45.553  169.222 42.881  1.00 55.66  ? 58   C   A N1    1 
ATOM   1041  C  C2    . C   A  1  57   ? 44.274  168.819 43.229  1.00 55.45  ? 58   C   A C2    1 
ATOM   1042  O  O2    . C   A  1  57   ? 43.698  169.420 44.145  1.00 55.74  ? 58   C   A O2    1 
ATOM   1043  N  N3    . C   A  1  57   ? 43.696  167.787 42.569  1.00 55.38  ? 58   C   A N3    1 
ATOM   1044  C  C4    . C   A  1  57   ? 44.362  167.166 41.592  1.00 55.67  ? 58   C   A C4    1 
ATOM   1045  N  N4    . C   A  1  57   ? 43.762  166.141 40.977  1.00 55.67  ? 58   C   A N4    1 
ATOM   1046  C  C5    . C   A  1  57   ? 45.677  167.565 41.205  1.00 55.46  ? 58   C   A C5    1 
ATOM   1047  C  C6    . C   A  1  57   ? 46.228  168.590 41.869  1.00 55.68  ? 58   C   A C6    1 
ATOM   1048  P  P     . A   A  1  58   ? 50.647  169.069 45.218  1.00 63.57  ? 59   A   A P     1 
ATOM   1049  O  OP1   . A   A  1  58   ? 51.388  169.285 46.499  1.00 64.09  ? 59   A   A OP1   1 
ATOM   1050  O  OP2   . A   A  1  58   ? 51.311  169.367 43.914  1.00 63.23  ? 59   A   A OP2   1 
ATOM   1051  O  "O5'" . A   A  1  58   ? 50.086  167.575 45.152  1.00 59.67  ? 59   A   A "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  58   ? 49.525  166.934 46.316  1.00 53.60  ? 59   A   A "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  58   ? 49.682  165.431 46.220  1.00 49.55  ? 59   A   A "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  58   ? 48.579  164.859 45.454  1.00 48.32  ? 59   A   A "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  58   ? 50.981  164.908 45.594  1.00 47.27  ? 59   A   A "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  58   ? 51.502  163.816 46.348  1.00 45.93  ? 59   A   A "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  58   ? 50.514  164.407 44.225  1.00 46.93  ? 59   A   A "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  58   ? 51.274  163.323 43.743  1.00 45.28  ? 59   A   A "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  58   ? 49.096  163.930 44.529  1.00 47.43  ? 59   A   A "C1'" 1 
ATOM   1060  N  N9    . A   A  1  58   ? 48.214  163.854 43.356  1.00 47.82  ? 59   A   A N9    1 
ATOM   1061  C  C8    . A   A  1  58   ? 48.092  164.738 42.308  1.00 47.74  ? 59   A   A C8    1 
ATOM   1062  N  N7    . A   A  1  58   ? 47.264  164.338 41.368  1.00 47.89  ? 59   A   A N7    1 
ATOM   1063  C  C5    . A   A  1  58   ? 46.791  163.118 41.837  1.00 48.39  ? 59   A   A C5    1 
ATOM   1064  C  C6    . A   A  1  58   ? 45.890  162.172 41.301  1.00 48.36  ? 59   A   A C6    1 
ATOM   1065  N  N6    . A   A  1  58   ? 45.281  162.301 40.120  1.00 48.28  ? 59   A   A N6    1 
ATOM   1066  N  N1    . A   A  1  58   ? 45.637  161.063 42.033  1.00 47.90  ? 59   A   A N1    1 
ATOM   1067  C  C2    . A   A  1  58   ? 46.251  160.915 43.212  1.00 46.16  ? 59   A   A C2    1 
ATOM   1068  N  N3    . A   A  1  58   ? 47.117  161.721 43.814  1.00 47.69  ? 59   A   A N3    1 
ATOM   1069  C  C4    . A   A  1  58   ? 47.352  162.817 43.068  1.00 48.32  ? 59   A   A C4    1 
ATOM   1070  P  P     . A   A  1  59   ? 52.994  163.885 46.970  1.00 45.62  ? 60   A   A P     1 
ATOM   1071  O  OP1   . A   A  1  59   ? 53.440  165.284 47.134  1.00 44.85  ? 60   A   A OP1   1 
ATOM   1072  O  OP2   . A   A  1  59   ? 53.864  162.921 46.244  1.00 45.98  ? 60   A   A OP2   1 
ATOM   1073  O  "O5'" . A   A  1  59   ? 52.746  163.334 48.436  1.00 43.84  ? 60   A   A "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  59   ? 53.789  162.744 49.213  1.00 42.35  ? 60   A   A "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  59   ? 53.225  161.576 49.982  1.00 41.24  ? 60   A   A "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  59   ? 51.877  161.924 50.418  1.00 40.79  ? 60   A   A "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  59   ? 53.019  160.310 49.168  1.00 40.72  ? 60   A   A "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  59   ? 54.203  159.540 49.154  1.00 41.21  ? 60   A   A "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  59   ? 51.932  159.604 49.951  1.00 40.19  ? 60   A   A "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  59   ? 52.449  158.985 51.106  1.00 41.18  ? 60   A   A "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  59   ? 51.040  160.784 50.337  1.00 40.55  ? 60   A   A "C1'" 1 
ATOM   1082  N  N9    . A   A  1  59   ? 50.037  161.025 49.302  1.00 42.24  ? 60   A   A N9    1 
ATOM   1083  C  C8    . A   A  1  59   ? 49.987  162.053 48.399  1.00 42.30  ? 60   A   A C8    1 
ATOM   1084  N  N7    . A   A  1  59   ? 48.984  161.972 47.560  1.00 43.87  ? 60   A   A N7    1 
ATOM   1085  C  C5    . A   A  1  59   ? 48.322  160.814 47.943  1.00 45.12  ? 60   A   A C5    1 
ATOM   1086  C  C6    . A   A  1  59   ? 47.176  160.169 47.448  1.00 46.14  ? 60   A   A C6    1 
ATOM   1087  N  N6    . A   A  1  59   ? 46.451  160.631 46.432  1.00 46.75  ? 60   A   A N6    1 
ATOM   1088  N  N1    . A   A  1  59   ? 46.792  159.019 48.049  1.00 46.10  ? 60   A   A N1    1 
ATOM   1089  C  C2    . A   A  1  59   ? 47.506  158.568 49.090  1.00 44.57  ? 60   A   A C2    1 
ATOM   1090  N  N3    . A   A  1  59   ? 48.591  159.092 49.653  1.00 45.61  ? 60   A   A N3    1 
ATOM   1091  C  C4    . A   A  1  59   ? 48.954  160.225 49.021  1.00 44.23  ? 60   A   A C4    1 
ATOM   1092  P  P     . G   A  1  60   ? 54.409  158.415 48.037  1.00 42.36  ? 61   G   A P     1 
ATOM   1093  O  OP1   . G   A  1  60   ? 55.754  157.837 48.268  1.00 44.00  ? 61   G   A OP1   1 
ATOM   1094  O  OP2   . G   A  1  60   ? 54.099  159.064 46.733  1.00 43.42  ? 61   G   A OP2   1 
ATOM   1095  O  "O5'" . G   A  1  60   ? 53.300  157.315 48.359  1.00 41.86  ? 61   G   A "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  60   ? 53.390  156.476 49.530  1.00 39.91  ? 61   G   A "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  60   ? 52.309  155.417 49.497  1.00 38.58  ? 61   G   A "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  60   ? 51.012  156.073 49.532  1.00 37.66  ? 61   G   A "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  60   ? 52.260  154.540 48.254  1.00 37.47  ? 61   G   A "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  60   ? 53.206  153.475 48.297  1.00 36.89  ? 61   G   A "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  60   ? 50.805  154.086 48.232  1.00 37.32  ? 61   G   A "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  60   ? 50.517  153.014 49.096  1.00 35.98  ? 61   G   A "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  60   ? 50.087  155.339 48.751  1.00 37.78  ? 61   G   A "C1'" 1 
ATOM   1104  N  N9    . G   A  1  60   ? 49.562  156.210 47.698  1.00 38.29  ? 61   G   A N9    1 
ATOM   1105  C  C8    . G   A  1  60   ? 49.972  157.482 47.372  1.00 38.20  ? 61   G   A C8    1 
ATOM   1106  N  N7    . G   A  1  60   ? 49.316  157.990 46.363  1.00 37.21  ? 61   G   A N7    1 
ATOM   1107  C  C5    . G   A  1  60   ? 48.424  156.994 45.998  1.00 36.99  ? 61   G   A C5    1 
ATOM   1108  C  C6    . G   A  1  60   ? 47.473  156.950 44.952  1.00 36.11  ? 61   G   A C6    1 
ATOM   1109  O  O6    . G   A  1  60   ? 47.239  157.792 44.088  1.00 36.81  ? 61   G   A O6    1 
ATOM   1110  N  N1    . G   A  1  60   ? 46.766  155.755 44.958  1.00 37.49  ? 61   G   A N1    1 
ATOM   1111  C  C2    . G   A  1  60   ? 46.962  154.722 45.842  1.00 38.65  ? 61   G   A C2    1 
ATOM   1112  N  N2    . G   A  1  60   ? 46.169  153.648 45.696  1.00 40.28  ? 61   G   A N2    1 
ATOM   1113  N  N3    . G   A  1  60   ? 47.864  154.739 46.799  1.00 37.85  ? 61   G   A N3    1 
ATOM   1114  C  C4    . G   A  1  60   ? 48.551  155.897 46.823  1.00 37.36  ? 61   G   A C4    1 
ATOM   1115  P  P     . C   A  1  61   ? 53.907  152.979 46.935  1.00 38.80  ? 62   C   A P     1 
ATOM   1116  O  OP1   . C   A  1  61   ? 54.899  151.922 47.260  1.00 37.06  ? 62   C   A OP1   1 
ATOM   1117  O  OP2   . C   A  1  61   ? 54.332  154.169 46.151  1.00 38.74  ? 62   C   A OP2   1 
ATOM   1118  O  "O5'" . C   A  1  61   ? 52.716  152.304 46.128  1.00 40.08  ? 62   C   A "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  61   ? 52.019  151.167 46.669  1.00 39.22  ? 62   C   A "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  61   ? 50.840  150.816 45.800  1.00 40.44  ? 62   C   A "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  61   ? 49.847  151.875 45.878  1.00 41.83  ? 62   C   A "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  61   ? 51.088  150.657 44.306  1.00 40.59  ? 62   C   A "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  61   ? 51.606  149.380 43.964  1.00 41.67  ? 62   C   A "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  61   ? 49.686  150.834 43.744  1.00 42.31  ? 62   C   A "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  61   ? 48.887  149.683 43.859  1.00 43.00  ? 62   C   A "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  61   ? 49.125  151.930 44.655  1.00 42.71  ? 62   C   A "C1'" 1 
ATOM   1127  N  N1    . C   A  1  61   ? 49.283  153.271 44.054  1.00 43.44  ? 62   C   A N1    1 
ATOM   1128  C  C2    . C   A  1  61   ? 48.300  153.727 43.155  1.00 43.62  ? 62   C   A C2    1 
ATOM   1129  O  O2    . C   A  1  61   ? 47.319  153.001 42.919  1.00 43.27  ? 62   C   A O2    1 
ATOM   1130  N  N3    . C   A  1  61   ? 48.452  154.944 42.572  1.00 42.63  ? 62   C   A N3    1 
ATOM   1131  C  C4    . C   A  1  61   ? 49.524  155.692 42.855  1.00 41.06  ? 62   C   A C4    1 
ATOM   1132  N  N4    . C   A  1  61   ? 49.637  156.872 42.251  1.00 40.62  ? 62   C   A N4    1 
ATOM   1133  C  C5    . C   A  1  61   ? 50.528  155.258 43.771  1.00 42.81  ? 62   C   A C5    1 
ATOM   1134  C  C6    . C   A  1  61   ? 50.368  154.055 44.344  1.00 42.44  ? 62   C   A C6    1 
ATOM   1135  P  P     . U   A  1  62   ? 52.591  149.224 42.692  1.00 44.37  ? 63   U   A P     1 
ATOM   1136  O  OP1   . U   A  1  62   ? 52.987  147.791 42.597  1.00 43.14  ? 63   U   A OP1   1 
ATOM   1137  O  OP2   . U   A  1  62   ? 53.643  150.264 42.776  1.00 43.75  ? 63   U   A OP2   1 
ATOM   1138  O  "O5'" . U   A  1  62   ? 51.680  149.571 41.429  1.00 44.01  ? 63   U   A "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  62   ? 50.610  148.689 41.019  1.00 43.00  ? 63   U   A "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  62   ? 49.809  149.314 39.902  1.00 43.33  ? 63   U   A "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  62   ? 49.132  150.512 40.364  1.00 43.45  ? 63   U   A "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  62   ? 50.596  149.789 38.695  1.00 43.31  ? 63   U   A "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  62   ? 50.911  148.715 37.830  1.00 43.63  ? 63   U   A "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  62   ? 49.620  150.755 38.051  1.00 43.47  ? 63   U   A "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  62   ? 48.604  150.058 37.365  1.00 45.43  ? 63   U   A "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  62   ? 49.019  151.431 39.286  1.00 44.35  ? 63   U   A "C1'" 1 
ATOM   1147  N  N1    . U   A  1  62   ? 49.757  152.655 39.631  1.00 45.45  ? 63   U   A N1    1 
ATOM   1148  C  C2    . U   A  1  62   ? 49.396  153.839 38.995  1.00 45.04  ? 63   U   A C2    1 
ATOM   1149  O  O2    . U   A  1  62   ? 48.482  153.911 38.185  1.00 45.62  ? 63   U   A O2    1 
ATOM   1150  N  N3    . U   A  1  62   ? 50.154  154.929 39.343  1.00 43.75  ? 63   U   A N3    1 
ATOM   1151  C  C4    . U   A  1  62   ? 51.206  154.960 40.234  1.00 44.47  ? 63   U   A C4    1 
ATOM   1152  O  O4    . U   A  1  62   ? 51.830  156.010 40.396  1.00 46.24  ? 63   U   A O4    1 
ATOM   1153  C  C5    . U   A  1  62   ? 51.502  153.712 40.856  1.00 44.90  ? 63   U   A C5    1 
ATOM   1154  C  C6    . U   A  1  62   ? 50.787  152.631 40.545  1.00 45.70  ? 63   U   A C6    1 
ATOM   1155  P  P     . G   A  1  63   ? 52.253  148.782 36.964  1.00 44.98  ? 64   G   A P     1 
ATOM   1156  O  OP1   . G   A  1  63   ? 52.392  147.513 36.205  1.00 45.80  ? 64   G   A OP1   1 
ATOM   1157  O  OP2   . G   A  1  63   ? 53.339  149.202 37.888  1.00 43.33  ? 64   G   A OP2   1 
ATOM   1158  O  "O5'" . G   A  1  63   ? 51.937  149.962 35.938  1.00 44.24  ? 64   G   A "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  63   ? 50.860  149.842 34.992  1.00 42.56  ? 64   G   A "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  63   ? 50.662  151.138 34.248  1.00 43.16  ? 64   G   A "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  63   ? 50.307  152.193 35.177  1.00 44.17  ? 64   G   A "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  63   ? 51.892  151.682 33.546  1.00 43.05  ? 64   G   A "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  63   ? 52.131  151.069 32.292  1.00 41.97  ? 64   G   A "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  63   ? 51.570  153.158 33.402  1.00 43.03  ? 64   G   A "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  63   ? 50.718  153.452 32.321  1.00 43.75  ? 64   G   A "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  63   ? 50.843  153.428 34.716  1.00 44.06  ? 64   G   A "C1'" 1 
ATOM   1167  N  N9    . G   A  1  63   ? 51.767  153.943 35.719  1.00 45.27  ? 64   G   A N9    1 
ATOM   1168  C  C8    . G   A  1  63   ? 52.325  153.257 36.769  1.00 44.66  ? 64   G   A C8    1 
ATOM   1169  N  N7    . G   A  1  63   ? 53.108  153.997 37.502  1.00 45.45  ? 64   G   A N7    1 
ATOM   1170  C  C5    . G   A  1  63   ? 53.068  155.243 36.896  1.00 45.60  ? 64   G   A C5    1 
ATOM   1171  C  C6    . G   A  1  63   ? 53.709  156.442 37.249  1.00 46.86  ? 64   G   A C6    1 
ATOM   1172  O  O6    . G   A  1  63   ? 54.480  156.646 38.195  1.00 48.42  ? 64   G   A O6    1 
ATOM   1173  N  N1    . G   A  1  63   ? 53.381  157.476 36.376  1.00 46.18  ? 64   G   A N1    1 
ATOM   1174  C  C2    . G   A  1  63   ? 52.547  157.359 35.299  1.00 45.32  ? 64   G   A C2    1 
ATOM   1175  N  N2    . G   A  1  63   ? 52.341  158.467 34.591  1.00 44.72  ? 64   G   A N2    1 
ATOM   1176  N  N3    . G   A  1  63   ? 51.951  156.235 34.949  1.00 45.90  ? 64   G   A N3    1 
ATOM   1177  C  C4    . G   A  1  63   ? 52.250  155.226 35.792  1.00 45.41  ? 64   G   A C4    1 
ATOM   1178  P  P     . C   A  1  64   ? 53.640  150.816 31.828  1.00 41.15  ? 65   C   A P     1 
ATOM   1179  O  OP1   . C   A  1  64   ? 53.639  150.001 30.592  1.00 42.57  ? 65   C   A OP1   1 
ATOM   1180  O  OP2   . C   A  1  64   ? 54.376  150.340 33.017  1.00 41.83  ? 65   C   A OP2   1 
ATOM   1181  O  "O5'" . C   A  1  64   ? 54.174  152.267 31.448  1.00 42.84  ? 65   C   A "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  64   ? 53.520  153.060 30.439  1.00 42.56  ? 65   C   A "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  64   ? 53.957  154.499 30.558  1.00 42.58  ? 65   C   A "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  64   ? 53.568  155.011 31.861  1.00 43.52  ? 65   C   A "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  64   ? 55.460  154.718 30.514  1.00 42.65  ? 65   C   A "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  64   ? 55.926  154.792 29.183  1.00 43.18  ? 65   C   A "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  64   ? 55.598  156.060 31.207  1.00 43.14  ? 65   C   A "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  64   ? 55.218  157.115 30.340  1.00 41.82  ? 65   C   A "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  64   ? 54.561  155.915 32.327  1.00 43.73  ? 65   C   A "C1'" 1 
ATOM   1190  N  N1    . C   A  1  64   ? 55.144  155.377 33.576  1.00 44.63  ? 65   C   A N1    1 
ATOM   1191  C  C2    . C   A  1  64   ? 55.808  156.259 34.452  1.00 45.23  ? 65   C   A C2    1 
ATOM   1192  O  O2    . C   A  1  64   ? 55.914  157.454 34.141  1.00 46.75  ? 65   C   A O2    1 
ATOM   1193  N  N3    . C   A  1  64   ? 56.320  155.779 35.607  1.00 43.88  ? 65   C   A N3    1 
ATOM   1194  C  C4    . C   A  1  64   ? 56.207  154.481 35.897  1.00 43.58  ? 65   C   A C4    1 
ATOM   1195  N  N4    . C   A  1  64   ? 56.720  154.054 37.051  1.00 44.39  ? 65   C   A N4    1 
ATOM   1196  C  C5    . C   A  1  64   ? 55.559  153.560 35.018  1.00 44.71  ? 65   C   A C5    1 
ATOM   1197  C  C6    . C   A  1  64   ? 55.044  154.048 33.885  1.00 44.33  ? 65   C   A C6    1 
ATOM   1198  P  P     . G   A  1  65   ? 57.481  154.560 28.874  1.00 44.02  ? 66   G   A P     1 
ATOM   1199  O  OP1   . G   A  1  65   ? 57.606  154.472 27.398  1.00 44.21  ? 66   G   A OP1   1 
ATOM   1200  O  OP2   . G   A  1  65   ? 57.931  153.425 29.720  1.00 44.47  ? 66   G   A OP2   1 
ATOM   1201  O  "O5'" . G   A  1  65   ? 58.212  155.879 29.394  1.00 41.16  ? 66   G   A "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  65   ? 57.820  157.184 28.933  1.00 39.72  ? 66   G   A "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  65   ? 58.712  158.239 29.548  1.00 36.98  ? 66   G   A "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  65   ? 58.687  158.126 30.995  1.00 36.73  ? 66   G   A "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  65   ? 60.182  158.164 29.177  1.00 37.01  ? 66   G   A "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  65   ? 60.683  159.482 29.327  1.00 39.29  ? 66   G   A "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  65   ? 60.760  157.298 30.285  1.00 35.48  ? 66   G   A "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  65   ? 62.145  157.493 30.474  1.00 35.00  ? 66   G   A "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  65   ? 59.984  157.836 31.477  1.00 35.16  ? 66   G   A "C1'" 1 
ATOM   1210  N  N9    . G   A  1  65   ? 59.854  156.913 32.594  1.00 35.33  ? 66   G   A N9    1 
ATOM   1211  C  C8    . G   A  1  65   ? 59.041  155.815 32.662  1.00 36.84  ? 66   G   A C8    1 
ATOM   1212  N  N7    . G   A  1  65   ? 59.074  155.226 33.824  1.00 37.84  ? 66   G   A N7    1 
ATOM   1213  C  C5    . G   A  1  65   ? 59.980  155.976 34.558  1.00 35.76  ? 66   G   A C5    1 
ATOM   1214  C  C6    . G   A  1  65   ? 60.412  155.843 35.897  1.00 35.92  ? 66   G   A C6    1 
ATOM   1215  O  O6    . G   A  1  65   ? 60.066  155.018 36.743  1.00 35.77  ? 66   G   A O6    1 
ATOM   1216  N  N1    . G   A  1  65   ? 61.341  156.816 36.229  1.00 35.81  ? 66   G   A N1    1 
ATOM   1217  C  C2    . G   A  1  65   ? 61.791  157.799 35.392  1.00 36.10  ? 66   G   A C2    1 
ATOM   1218  N  N2    . G   A  1  65   ? 62.696  158.646 35.908  1.00 37.00  ? 66   G   A N2    1 
ATOM   1219  N  N3    . G   A  1  65   ? 61.386  157.943 34.147  1.00 35.80  ? 66   G   A N3    1 
ATOM   1220  C  C4    . G   A  1  65   ? 60.487  157.005 33.801  1.00 34.81  ? 66   G   A C4    1 
ATOM   1221  P  P     . A   A  1  66   ? 60.636  160.497 28.086  1.00 39.40  ? 67   A   A P     1 
ATOM   1222  O  OP1   . A   A  1  66   ? 59.809  159.876 27.020  1.00 38.38  ? 67   A   A OP1   1 
ATOM   1223  O  OP2   . A   A  1  66   ? 62.033  160.888 27.800  1.00 36.90  ? 67   A   A OP2   1 
ATOM   1224  O  "O5'" . A   A  1  66   ? 59.866  161.772 28.647  1.00 38.09  ? 67   A   A "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  66   ? 60.274  162.400 29.873  1.00 40.63  ? 67   A   A "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  66   ? 60.654  163.842 29.616  1.00 41.55  ? 67   A   A "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  66   ? 61.091  164.444 30.863  1.00 42.41  ? 67   A   A "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  66   ? 61.820  164.022 28.650  1.00 42.65  ? 67   A   A "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  66   ? 61.724  165.297 28.006  1.00 40.87  ? 67   A   A "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  66   ? 63.021  164.001 29.586  1.00 42.80  ? 67   A   A "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  66   ? 64.144  164.655 29.035  1.00 45.33  ? 67   A   A "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  66   ? 62.467  164.766 30.786  1.00 43.30  ? 67   A   A "C1'" 1 
ATOM   1233  N  N9    . A   A  1  66   ? 63.079  164.382 32.056  1.00 44.72  ? 67   A   A N9    1 
ATOM   1234  C  C8    . A   A  1  66   ? 63.729  165.191 32.951  1.00 45.56  ? 67   A   A C8    1 
ATOM   1235  N  N7    . A   A  1  66   ? 64.166  164.560 34.014  1.00 44.91  ? 67   A   A N7    1 
ATOM   1236  C  C5    . A   A  1  66   ? 63.782  163.244 33.802  1.00 44.93  ? 67   A   A C5    1 
ATOM   1237  C  C6    . A   A  1  66   ? 63.958  162.075 34.556  1.00 44.43  ? 67   A   A C6    1 
ATOM   1238  N  N6    . A   A  1  66   ? 64.584  162.039 35.733  1.00 44.12  ? 67   A   A N6    1 
ATOM   1239  N  N1    . A   A  1  66   ? 63.466  160.925 34.055  1.00 44.52  ? 67   A   A N1    1 
ATOM   1240  C  C2    . A   A  1  66   ? 62.837  160.957 32.879  1.00 45.31  ? 67   A   A C2    1 
ATOM   1241  N  N3    . A   A  1  66   ? 62.605  161.990 32.077  1.00 45.42  ? 67   A   A N3    1 
ATOM   1242  C  C4    . A   A  1  66   ? 63.112  163.119 32.601  1.00 45.21  ? 67   A   A C4    1 
ATOM   1243  P  P     . U   A  1  67   ? 61.656  165.379 26.403  1.00 39.83  ? 68   U   A P     1 
ATOM   1244  O  OP1   . U   A  1  67   ? 62.576  164.348 25.838  1.00 38.17  ? 68   U   A OP1   1 
ATOM   1245  O  OP2   . U   A  1  67   ? 61.806  166.794 26.001  1.00 41.12  ? 68   U   A OP2   1 
ATOM   1246  O  "O5'" . U   A  1  67   ? 60.155  164.964 26.072  1.00 38.14  ? 68   U   A "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  67   ? 59.068  165.895 26.261  1.00 37.40  ? 68   U   A "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  67   ? 57.752  165.214 25.981  1.00 37.01  ? 68   U   A "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  67   ? 57.741  164.715 24.608  1.00 37.78  ? 68   U   A "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  67   ? 57.458  164.005 26.860  1.00 36.60  ? 68   U   A "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  67   ? 56.041  163.914 26.972  1.00 37.22  ? 68   U   A "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  67   ? 57.986  162.863 26.001  1.00 36.03  ? 68   U   A "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  67   ? 57.477  161.587 26.345  1.00 35.10  ? 68   U   A "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  67   ? 57.518  163.323 24.622  1.00 36.50  ? 68   U   A "C1'" 1 
ATOM   1255  N  N1    . U   A  1  67   ? 58.197  162.710 23.473  1.00 37.81  ? 68   U   A N1    1 
ATOM   1256  C  C2    . U   A  1  67   ? 57.457  161.849 22.676  1.00 38.58  ? 68   U   A C2    1 
ATOM   1257  O  O2    . U   A  1  67   ? 56.279  161.603 22.878  1.00 37.91  ? 68   U   A O2    1 
ATOM   1258  N  N3    . U   A  1  67   ? 58.150  161.286 21.632  1.00 40.65  ? 68   U   A N3    1 
ATOM   1259  C  C4    . U   A  1  67   ? 59.471  161.497 21.299  1.00 40.17  ? 68   U   A C4    1 
ATOM   1260  O  O4    . U   A  1  67   ? 59.933  160.953 20.294  1.00 41.75  ? 68   U   A O4    1 
ATOM   1261  C  C5    . U   A  1  67   ? 60.168  162.408 22.165  1.00 41.48  ? 68   U   A C5    1 
ATOM   1262  C  C6    . U   A  1  67   ? 59.523  162.970 23.196  1.00 38.74  ? 68   U   A C6    1 
ATOM   1263  P  P     . A   A  1  68   ? 55.305  164.396 28.316  1.00 38.58  ? 69   A   A P     1 
ATOM   1264  O  OP1   . A   A  1  68   ? 53.966  164.935 27.993  1.00 39.06  ? 69   A   A OP1   1 
ATOM   1265  O  OP2   . A   A  1  68   ? 56.254  165.230 29.120  1.00 36.91  ? 69   A   A OP2   1 
ATOM   1266  O  "O5'" . A   A  1  68   ? 55.011  163.022 29.050  1.00 37.28  ? 69   A   A "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  68   ? 56.036  162.056 29.171  1.00 37.93  ? 69   A   A "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  68   ? 55.609  160.939 30.085  1.00 37.77  ? 69   A   A "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  68   ? 56.868  160.398 30.559  1.00 39.25  ? 69   A   A "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  68   ? 54.821  161.332 31.344  1.00 38.13  ? 69   A   A "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  68   ? 53.417  161.038 31.253  1.00 38.51  ? 69   A   A "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  68   ? 55.489  160.502 32.429  1.00 39.10  ? 69   A   A "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  68   ? 55.012  159.174 32.419  1.00 37.35  ? 69   A   A "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  68   ? 56.944  160.531 31.961  1.00 41.19  ? 69   A   A "C1'" 1 
ATOM   1275  N  N9    . A   A  1  68   ? 57.641  161.790 32.278  1.00 43.18  ? 69   A   A N9    1 
ATOM   1276  C  C8    . A   A  1  68   ? 57.402  163.055 31.794  1.00 42.35  ? 69   A   A C8    1 
ATOM   1277  N  N7    . A   A  1  68   ? 58.172  163.974 32.319  1.00 43.46  ? 69   A   A N7    1 
ATOM   1278  C  C5    . A   A  1  68   ? 58.977  163.273 33.207  1.00 43.00  ? 69   A   A C5    1 
ATOM   1279  C  C6    . A   A  1  68   ? 59.982  163.680 34.097  1.00 42.30  ? 69   A   A C6    1 
ATOM   1280  N  N6    . A   A  1  68   ? 60.364  164.945 34.263  1.00 42.71  ? 69   A   A N6    1 
ATOM   1281  N  N1    . A   A  1  68   ? 60.588  162.730 34.832  1.00 43.35  ? 69   A   A N1    1 
ATOM   1282  C  C2    . A   A  1  68   ? 60.201  161.462 34.687  1.00 43.94  ? 69   A   A C2    1 
ATOM   1283  N  N3    . A   A  1  68   ? 59.265  160.957 33.897  1.00 44.58  ? 69   A   A N3    1 
ATOM   1284  C  C4    . A   A  1  68   ? 58.677  161.927 33.176  1.00 43.75  ? 69   A   A C4    1 
ATOM   1285  P  P     . A   A  1  69   ? 52.444  161.295 32.527  1.00 39.52  ? 70   A   A P     1 
ATOM   1286  O  OP1   . A   A  1  69   ? 51.699  162.569 32.346  1.00 40.45  ? 70   A   A OP1   1 
ATOM   1287  O  OP2   . A   A  1  69   ? 53.175  161.064 33.805  1.00 39.62  ? 70   A   A OP2   1 
ATOM   1288  O  "O5'" . A   A  1  69   ? 51.354  160.145 32.393  1.00 39.40  ? 70   A   A "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  69   ? 49.957  160.439 32.531  1.00 39.67  ? 70   A   A "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  69   ? 49.141  159.169 32.445  1.00 40.16  ? 70   A   A "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  69   ? 49.612  158.226 33.431  1.00 38.66  ? 70   A   A "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  69   ? 47.643  159.302 32.679  1.00 41.37  ? 70   A   A "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  69   ? 46.981  158.247 31.989  1.00 44.67  ? 70   A   A "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  69   ? 47.518  159.014 34.166  1.00 40.93  ? 70   A   A "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  69   ? 46.243  158.498 34.505  1.00 41.08  ? 70   A   A "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  69   ? 48.589  157.942 34.353  1.00 40.34  ? 70   A   A "C1'" 1 
ATOM   1297  N  N9    . A   A  1  69   ? 49.200  157.946 35.681  1.00 42.04  ? 70   A   A N9    1 
ATOM   1298  C  C8    . A   A  1  69   ? 49.260  156.901 36.561  1.00 42.78  ? 70   A   A C8    1 
ATOM   1299  N  N7    . A   A  1  69   ? 49.934  157.166 37.648  1.00 42.41  ? 70   A   A N7    1 
ATOM   1300  C  C5    . A   A  1  69   ? 50.332  158.481 37.483  1.00 42.52  ? 70   A   A C5    1 
ATOM   1301  C  C6    . A   A  1  69   ? 51.097  159.334 38.285  1.00 42.81  ? 70   A   A C6    1 
ATOM   1302  N  N6    . A   A  1  69   ? 51.621  158.966 39.457  1.00 42.51  ? 70   A   A N6    1 
ATOM   1303  N  N1    . A   A  1  69   ? 51.315  160.589 37.839  1.00 42.56  ? 70   A   A N1    1 
ATOM   1304  C  C2    . A   A  1  69   ? 50.797  160.945 36.658  1.00 42.27  ? 70   A   A C2    1 
ATOM   1305  N  N3    . A   A  1  69   ? 50.066  160.225 35.808  1.00 42.17  ? 70   A   A N3    1 
ATOM   1306  C  C4    . A   A  1  69   ? 49.869  158.985 36.287  1.00 42.39  ? 70   A   A C4    1 
ATOM   1307  P  P     . G   A  1  70   ? 46.463  158.471 30.489  1.00 48.23  ? 71   G   A P     1 
ATOM   1308  O  OP1   . G   A  1  70   ? 45.913  159.855 30.360  1.00 47.76  ? 71   G   A OP1   1 
ATOM   1309  O  OP2   . G   A  1  70   ? 45.620  157.297 30.130  1.00 48.26  ? 71   G   A OP2   1 
ATOM   1310  O  "O5'" . G   A  1  70   ? 47.802  158.387 29.642  1.00 45.99  ? 71   G   A "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  70   ? 47.911  158.988 28.352  1.00 45.00  ? 71   G   A "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  70   ? 49.123  159.875 28.311  1.00 44.85  ? 71   G   A "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  70   ? 50.200  159.288 29.090  1.00 41.71  ? 71   G   A "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  70   ? 49.696  160.078 26.924  1.00 46.54  ? 71   G   A "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  70   ? 48.979  161.104 26.234  1.00 49.69  ? 71   G   A "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  70   ? 51.156  160.399 27.233  1.00 44.16  ? 71   G   A "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  70   ? 51.346  161.723 27.701  1.00 44.54  ? 71   G   A "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  70   ? 51.427  159.451 28.406  1.00 41.47  ? 71   G   A "C1'" 1 
ATOM   1319  N  N9    . G   A  1  70   ? 51.888  158.118 28.025  1.00 39.15  ? 71   G   A N9    1 
ATOM   1320  C  C8    . G   A  1  70   ? 51.215  156.939 28.219  1.00 38.78  ? 71   G   A C8    1 
ATOM   1321  N  N7    . G   A  1  70   ? 51.869  155.894 27.787  1.00 38.36  ? 71   G   A N7    1 
ATOM   1322  C  C5    . G   A  1  70   ? 53.046  156.411 27.274  1.00 38.37  ? 71   G   A C5    1 
ATOM   1323  C  C6    . G   A  1  70   ? 54.152  155.755 26.670  1.00 38.79  ? 71   G   A C6    1 
ATOM   1324  O  O6    . G   A  1  70   ? 54.313  154.550 26.463  1.00 40.85  ? 71   G   A O6    1 
ATOM   1325  N  N1    . G   A  1  70   ? 55.141  156.655 26.296  1.00 38.64  ? 71   G   A N1    1 
ATOM   1326  C  C2    . G   A  1  70   ? 55.080  158.011 26.483  1.00 40.24  ? 71   G   A C2    1 
ATOM   1327  N  N2    . G   A  1  70   ? 56.146  158.714 26.065  1.00 41.67  ? 71   G   A N2    1 
ATOM   1328  N  N3    . G   A  1  70   ? 54.053  158.638 27.044  1.00 40.02  ? 71   G   A N3    1 
ATOM   1329  C  C4    . G   A  1  70   ? 53.078  157.783 27.412  1.00 38.97  ? 71   G   A C4    1 
ATOM   1330  P  P     . C   A  1  71   ? 48.436  160.837 24.740  1.00 51.02  ? 72   C   A P     1 
ATOM   1331  O  OP1   . C   A  1  71   ? 47.511  161.962 24.433  1.00 50.65  ? 72   C   A OP1   1 
ATOM   1332  O  OP2   . C   A  1  71   ? 47.955  159.439 24.590  1.00 49.97  ? 72   C   A OP2   1 
ATOM   1333  O  "O5'" . C   A  1  71   ? 49.740  160.998 23.841  1.00 49.98  ? 72   C   A "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  71   ? 50.251  162.300 23.524  1.00 47.73  ? 72   C   A "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  71   ? 51.278  162.196 22.427  1.00 47.70  ? 72   C   A "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  71   ? 52.419  161.421 22.880  1.00 47.04  ? 72   C   A "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  71   ? 50.800  161.427 21.215  1.00 47.23  ? 72   C   A "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  71   ? 49.979  162.207 20.371  1.00 47.34  ? 72   C   A "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  71   ? 52.096  160.970 20.569  1.00 46.19  ? 72   C   A "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  71   ? 52.717  162.009 19.835  1.00 46.18  ? 72   C   A "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  71   ? 52.915  160.622 21.811  1.00 46.22  ? 72   C   A "C1'" 1 
ATOM   1342  N  N1    . C   A  1  71   ? 52.782  159.203 22.190  1.00 47.37  ? 72   C   A N1    1 
ATOM   1343  C  C2    . C   A  1  71   ? 53.452  158.234 21.425  1.00 46.91  ? 72   C   A C2    1 
ATOM   1344  O  O2    . C   A  1  71   ? 54.128  158.596 20.448  1.00 47.82  ? 72   C   A O2    1 
ATOM   1345  N  N3    . C   A  1  71   ? 53.347  156.930 21.770  1.00 47.18  ? 72   C   A N3    1 
ATOM   1346  C  C4    . C   A  1  71   ? 52.615  156.577 22.829  1.00 47.02  ? 72   C   A C4    1 
ATOM   1347  N  N4    . C   A  1  71   ? 52.553  155.285 23.141  1.00 47.18  ? 72   C   A N4    1 
ATOM   1348  C  C5    . C   A  1  71   ? 51.916  157.539 23.620  1.00 46.95  ? 72   C   A C5    1 
ATOM   1349  C  C6    . C   A  1  71   ? 52.025  158.827 23.269  1.00 46.68  ? 72   C   A C6    1 
ATOM   1350  P  P     . C   A  1  72   ? 48.800  161.480 19.592  1.00 47.47  ? 73   C   A P     1 
ATOM   1351  O  OP1   . C   A  1  72   ? 47.939  162.512 18.968  1.00 46.34  ? 73   C   A OP1   1 
ATOM   1352  O  OP2   . C   A  1  72   ? 48.208  160.491 20.537  1.00 46.43  ? 73   C   A OP2   1 
ATOM   1353  O  "O5'" . C   A  1  72   ? 49.587  160.700 18.455  1.00 46.34  ? 73   C   A "O5'" 1 
ATOM   1354  C  "C5'" . C   A  1  72   ? 50.328  161.430 17.477  1.00 46.79  ? 73   C   A "C5'" 1 
ATOM   1355  C  "C4'" . C   A  1  72   ? 50.890  160.494 16.460  1.00 47.31  ? 73   C   A "C4'" 1 
ATOM   1356  O  "O4'" . C   A  1  72   ? 51.824  159.597 17.107  1.00 47.48  ? 73   C   A "O4'" 1 
ATOM   1357  C  "C3'" . C   A  1  72   ? 49.880  159.570 15.806  1.00 47.28  ? 73   C   A "C3'" 1 
ATOM   1358  O  "O3'" . C   A  1  72   ? 49.223  160.242 14.741  1.00 48.57  ? 73   C   A "O3'" 1 
ATOM   1359  C  "C2'" . C   A  1  72   ? 50.777  158.449 15.312  1.00 46.62  ? 73   C   A "C2'" 1 
ATOM   1360  O  "O2'" . C   A  1  72   ? 51.484  158.875 14.162  1.00 46.22  ? 73   C   A "O2'" 1 
ATOM   1361  C  "C1'" . C   A  1  72   ? 51.761  158.327 16.481  1.00 46.97  ? 73   C   A "C1'" 1 
ATOM   1362  N  N1    . C   A  1  72   ? 51.374  157.321 17.489  1.00 46.78  ? 73   C   A N1    1 
ATOM   1363  C  C2    . C   A  1  72   ? 51.605  155.973 17.204  1.00 46.33  ? 73   C   A C2    1 
ATOM   1364  O  O2    . C   A  1  72   ? 52.105  155.677 16.111  1.00 46.73  ? 73   C   A O2    1 
ATOM   1365  N  N3    . C   A  1  72   ? 51.277  155.034 18.125  1.00 44.92  ? 73   C   A N3    1 
ATOM   1366  C  C4    . C   A  1  72   ? 50.734  155.404 19.288  1.00 45.04  ? 73   C   A C4    1 
ATOM   1367  N  N4    . C   A  1  72   ? 50.430  154.449 20.166  1.00 45.10  ? 73   C   A N4    1 
ATOM   1368  C  C5    . C   A  1  72   ? 50.478  156.773 19.601  1.00 46.06  ? 73   C   A C5    1 
ATOM   1369  C  C6    . C   A  1  72   ? 50.809  157.688 18.683  1.00 47.17  ? 73   C   A C6    1 
ATOM   1370  P  P     . A   A  1  73   ? 47.830  159.679 14.174  1.00 49.27  ? 74   A   A P     1 
ATOM   1371  O  OP1   . A   A  1  73   ? 47.429  160.578 13.066  1.00 49.29  ? 74   A   A OP1   1 
ATOM   1372  O  OP2   . A   A  1  73   ? 46.891  159.436 15.294  1.00 48.21  ? 74   A   A OP2   1 
ATOM   1373  O  "O5'" . A   A  1  73   ? 48.235  158.288 13.519  1.00 48.75  ? 74   A   A "O5'" 1 
ATOM   1374  C  "C5'" . A   A  1  73   ? 49.008  158.256 12.309  1.00 46.87  ? 74   A   A "C5'" 1 
ATOM   1375  C  "C4'" . A   A  1  73   ? 49.143  156.839 11.823  1.00 46.43  ? 74   A   A "C4'" 1 
ATOM   1376  O  "O4'" . A   A  1  73   ? 49.924  156.071 12.770  1.00 46.73  ? 74   A   A "O4'" 1 
ATOM   1377  C  "C3'" . A   A  1  73   ? 47.835  156.079 11.703  1.00 45.80  ? 74   A   A "C3'" 1 
ATOM   1378  O  "O3'" . A   A  1  73   ? 47.205  156.391 10.462  1.00 47.68  ? 74   A   A "O3'" 1 
ATOM   1379  C  "C2'" . A   A  1  73   ? 48.308  154.637 11.774  1.00 45.55  ? 74   A   A "C2'" 1 
ATOM   1380  O  "O2'" . A   A  1  73   ? 48.839  154.218 10.534  1.00 45.21  ? 74   A   A "O2'" 1 
ATOM   1381  C  "C1'" . A   A  1  73   ? 49.444  154.739 12.803  1.00 45.55  ? 74   A   A "C1'" 1 
ATOM   1382  N  N9    . A   A  1  73   ? 49.026  154.433 14.172  1.00 44.43  ? 74   A   A N9    1 
ATOM   1383  C  C8    . A   A  1  73   ? 48.675  155.310 15.167  1.00 44.29  ? 74   A   A C8    1 
ATOM   1384  N  N7    . A   A  1  73   ? 48.286  154.727 16.274  1.00 44.98  ? 74   A   A N7    1 
ATOM   1385  C  C5    . A   A  1  73   ? 48.402  153.372 15.995  1.00 45.10  ? 74   A   A C5    1 
ATOM   1386  C  C6    . A   A  1  73   ? 48.127  152.215 16.754  1.00 45.33  ? 74   A   A C6    1 
ATOM   1387  N  N6    . A   A  1  73   ? 47.632  152.243 17.992  1.00 45.22  ? 74   A   A N6    1 
ATOM   1388  N  N1    . A   A  1  73   ? 48.370  151.014 16.181  1.00 45.58  ? 74   A   A N1    1 
ATOM   1389  C  C2    . A   A  1  73   ? 48.843  150.986 14.928  1.00 44.55  ? 74   A   A C2    1 
ATOM   1390  N  N3    . A   A  1  73   ? 49.124  152.001 14.111  1.00 45.80  ? 74   A   A N3    1 
ATOM   1391  C  C4    . A   A  1  73   ? 48.876  153.178 14.711  1.00 44.46  ? 74   A   A C4    1 
ATOM   1392  P  P     . U   A  1  74   ? 45.606  156.306 10.327  1.00 48.84  ? 75   U   A P     1 
ATOM   1393  O  OP1   . U   A  1  74   ? 45.255  156.865 8.994   1.00 48.56  ? 75   U   A OP1   1 
ATOM   1394  O  OP2   . U   A  1  74   ? 44.983  156.887 11.546  1.00 47.20  ? 75   U   A OP2   1 
ATOM   1395  O  "O5'" . U   A  1  74   ? 45.323  154.740 10.292  1.00 48.07  ? 75   U   A "O5'" 1 
ATOM   1396  C  "C5'" . U   A  1  74   ? 45.745  153.944 9.174   1.00 48.39  ? 75   U   A "C5'" 1 
ATOM   1397  C  "C4'" . U   A  1  74   ? 45.543  152.477 9.472   1.00 50.02  ? 75   U   A "C4'" 1 
ATOM   1398  O  "O4'" . U   A  1  74   ? 46.439  152.030 10.528  1.00 49.92  ? 75   U   A "O4'" 1 
ATOM   1399  C  "C3'" . U   A  1  74   ? 44.169  152.136 10.007  1.00 50.89  ? 75   U   A "C3'" 1 
ATOM   1400  O  "O3'" . U   A  1  74   ? 43.228  152.020 8.977   1.00 53.85  ? 75   U   A "O3'" 1 
ATOM   1401  C  "C2'" . U   A  1  74   ? 44.407  150.803 10.685  1.00 50.70  ? 75   U   A "C2'" 1 
ATOM   1402  O  "O2'" . U   A  1  74   ? 44.443  149.743 9.754   1.00 50.46  ? 75   U   A "O2'" 1 
ATOM   1403  C  "C1'" . U   A  1  74   ? 45.776  151.052 11.327  1.00 50.45  ? 75   U   A "C1'" 1 
ATOM   1404  N  N1    . U   A  1  74   ? 45.608  151.592 12.688  1.00 50.07  ? 75   U   A N1    1 
ATOM   1405  C  C2    . U   A  1  74   ? 45.572  150.694 13.749  1.00 49.73  ? 75   U   A C2    1 
ATOM   1406  O  O2    . U   A  1  74   ? 45.703  149.487 13.611  1.00 50.38  ? 75   U   A O2    1 
ATOM   1407  N  N3    . U   A  1  74   ? 45.370  151.263 14.981  1.00 48.31  ? 75   U   A N3    1 
ATOM   1408  C  C4    . U   A  1  74   ? 45.201  152.600 15.263  1.00 48.11  ? 75   U   A C4    1 
ATOM   1409  O  O4    . U   A  1  74   ? 44.927  152.944 16.410  1.00 46.04  ? 75   U   A O4    1 
ATOM   1410  C  C5    . U   A  1  74   ? 45.271  153.462 14.129  1.00 48.94  ? 75   U   A C5    1 
ATOM   1411  C  C6    . U   A  1  74   ? 45.468  152.945 12.912  1.00 49.94  ? 75   U   A C6    1 
ATOM   1412  P  P     . G   A  1  75   ? 41.689  152.283 9.300   1.00 57.69  ? 76   G   A P     1 
ATOM   1413  O  OP1   . G   A  1  75   ? 40.997  152.215 7.992   1.00 58.26  ? 76   G   A OP1   1 
ATOM   1414  O  OP2   . G   A  1  75   ? 41.591  153.520 10.126  1.00 56.77  ? 76   G   A OP2   1 
ATOM   1415  O  "O5'" . G   A  1  75   ? 41.260  151.028 10.185  1.00 57.24  ? 76   G   A "O5'" 1 
ATOM   1416  C  "C5'" . G   A  1  75   ? 41.139  149.723 9.593   1.00 57.79  ? 76   G   A "C5'" 1 
ATOM   1417  C  "C4'" . G   A  1  75   ? 40.943  148.673 10.660  1.00 58.10  ? 76   G   A "C4'" 1 
ATOM   1418  O  "O4'" . G   A  1  75   ? 42.069  148.700 11.577  1.00 56.94  ? 76   G   A "O4'" 1 
ATOM   1419  C  "C3'" . G   A  1  75   ? 39.746  148.864 11.575  1.00 58.49  ? 76   G   A "C3'" 1 
ATOM   1420  O  "O3'" . G   A  1  75   ? 38.525  148.423 11.003  1.00 61.32  ? 76   G   A "O3'" 1 
ATOM   1421  C  "C2'" . G   A  1  75   ? 40.136  148.012 12.765  1.00 57.51  ? 76   G   A "C2'" 1 
ATOM   1422  O  "O2'" . G   A  1  75   ? 39.962  146.639 12.501  1.00 57.81  ? 76   G   A "O2'" 1 
ATOM   1423  C  "C1'" . G   A  1  75   ? 41.621  148.353 12.880  1.00 56.57  ? 76   G   A "C1'" 1 
ATOM   1424  N  N9    . G   A  1  75   ? 41.785  149.500 13.771  1.00 54.93  ? 76   G   A N9    1 
ATOM   1425  C  C8    . G   A  1  75   ? 42.079  150.805 13.449  1.00 53.44  ? 76   G   A C8    1 
ATOM   1426  N  N7    . G   A  1  75   ? 42.111  151.591 14.491  1.00 52.70  ? 76   G   A N7    1 
ATOM   1427  C  C5    . G   A  1  75   ? 41.829  150.751 15.563  1.00 52.08  ? 76   G   A C5    1 
ATOM   1428  C  C6    . G   A  1  75   ? 41.718  151.026 16.952  1.00 51.10  ? 76   G   A C6    1 
ATOM   1429  O  O6    . G   A  1  75   ? 41.856  152.104 17.538  1.00 49.69  ? 76   G   A O6    1 
ATOM   1430  N  N1    . G   A  1  75   ? 41.411  149.879 17.675  1.00 51.44  ? 76   G   A N1    1 
ATOM   1431  C  C2    . G   A  1  75   ? 41.235  148.627 17.133  1.00 52.24  ? 76   G   A C2    1 
ATOM   1432  N  N2    . G   A  1  75   ? 40.930  147.636 17.979  1.00 52.07  ? 76   G   A N2    1 
ATOM   1433  N  N3    . G   A  1  75   ? 41.345  148.362 15.852  1.00 52.95  ? 76   G   A N3    1 
ATOM   1434  C  C4    . G   A  1  75   ? 41.636  149.460 15.131  1.00 53.23  ? 76   G   A C4    1 
ATOM   1435  P  P     . G   A  1  76   ? 37.158  149.169 11.403  1.00 64.15  ? 77   G   A P     1 
ATOM   1436  O  OP1   . G   A  1  76   ? 36.109  148.678 10.474  1.00 64.43  ? 77   G   A OP1   1 
ATOM   1437  O  OP2   . G   A  1  76   ? 37.417  150.636 11.516  1.00 62.79  ? 77   G   A OP2   1 
ATOM   1438  O  "O5'" . G   A  1  76   ? 36.826  148.636 12.868  1.00 62.51  ? 77   G   A "O5'" 1 
ATOM   1439  C  "C5'" . G   A  1  76   ? 36.668  147.236 13.126  1.00 57.67  ? 77   G   A "C5'" 1 
ATOM   1440  C  "C4'" . G   A  1  76   ? 36.659  146.978 14.608  1.00 56.42  ? 77   G   A "C4'" 1 
ATOM   1441  O  "O4'" . G   A  1  76   ? 37.898  147.472 15.189  1.00 56.10  ? 77   G   A "O4'" 1 
ATOM   1442  C  "C3'" . G   A  1  76   ? 35.596  147.709 15.412  1.00 56.18  ? 77   G   A "C3'" 1 
ATOM   1443  O  "O3'" . G   A  1  76   ? 34.310  147.090 15.364  1.00 56.25  ? 77   G   A "O3'" 1 
ATOM   1444  C  "C2'" . G   A  1  76   ? 36.177  147.643 16.817  1.00 56.60  ? 77   G   A "C2'" 1 
ATOM   1445  O  "O2'" . G   A  1  76   ? 35.990  146.380 17.415  1.00 57.32  ? 77   G   A "O2'" 1 
ATOM   1446  C  "C1'" . G   A  1  76   ? 37.667  147.855 16.541  1.00 56.30  ? 77   G   A "C1'" 1 
ATOM   1447  N  N9    . G   A  1  76   ? 38.043  149.255 16.739  1.00 55.88  ? 77   G   A N9    1 
ATOM   1448  C  C8    . G   A  1  76   ? 38.364  150.186 15.780  1.00 54.92  ? 77   G   A C8    1 
ATOM   1449  N  N7    . G   A  1  76   ? 38.599  151.371 16.277  1.00 55.43  ? 77   G   A N7    1 
ATOM   1450  C  C5    . G   A  1  76   ? 38.438  151.211 17.649  1.00 55.76  ? 77   G   A C5    1 
ATOM   1451  C  C6    . G   A  1  76   ? 38.554  152.156 18.713  1.00 56.28  ? 77   G   A C6    1 
ATOM   1452  O  O6    . G   A  1  76   ? 38.820  153.363 18.652  1.00 57.98  ? 77   G   A O6    1 
ATOM   1453  N  N1    . G   A  1  76   ? 38.313  151.567 19.948  1.00 54.76  ? 77   G   A N1    1 
ATOM   1454  C  C2    . G   A  1  76   ? 37.994  150.248 20.143  1.00 54.56  ? 77   G   A C2    1 
ATOM   1455  N  N2    . G   A  1  76   ? 37.797  149.875 21.411  1.00 54.13  ? 77   G   A N2    1 
ATOM   1456  N  N3    . G   A  1  76   ? 37.876  149.361 19.165  1.00 54.82  ? 77   G   A N3    1 
ATOM   1457  C  C4    . G   A  1  76   ? 38.110  149.910 17.953  1.00 55.21  ? 77   G   A C4    1 
ATOM   1458  P  P     . G   A  1  77   ? 32.989  147.970 15.654  1.00 56.84  ? 78   G   A P     1 
ATOM   1459  O  OP1   . G   A  1  77   ? 31.841  147.036 15.791  1.00 57.23  ? 78   G   A OP1   1 
ATOM   1460  O  OP2   . G   A  1  77   ? 32.926  149.074 14.648  1.00 56.28  ? 78   G   A OP2   1 
ATOM   1461  O  "O5'" . G   A  1  77   ? 33.271  148.654 17.067  1.00 55.29  ? 78   G   A "O5'" 1 
ATOM   1462  C  "C5'" . G   A  1  77   ? 33.129  147.937 18.310  1.00 51.70  ? 78   G   A "C5'" 1 
ATOM   1463  C  "C4'" . G   A  1  77   ? 33.237  148.910 19.461  1.00 49.69  ? 78   G   A "C4'" 1 
ATOM   1464  O  "O4'" . G   A  1  77   ? 34.535  149.564 19.396  1.00 50.37  ? 78   G   A "O4'" 1 
ATOM   1465  C  "C3'" . G   A  1  77   ? 32.229  150.044 19.398  1.00 48.07  ? 78   G   A "C3'" 1 
ATOM   1466  O  "O3'" . G   A  1  77   ? 31.009  149.635 20.008  1.00 46.38  ? 78   G   A "O3'" 1 
ATOM   1467  C  "C2'" . G   A  1  77   ? 32.943  151.184 20.124  1.00 48.45  ? 78   G   A "C2'" 1 
ATOM   1468  O  "O2'" . G   A  1  77   ? 32.836  151.129 21.528  1.00 47.57  ? 78   G   A "O2'" 1 
ATOM   1469  C  "C1'" . G   A  1  77   ? 34.404  150.940 19.730  1.00 50.23  ? 78   G   A "C1'" 1 
ATOM   1470  N  N9    . G   A  1  77   ? 34.873  151.736 18.596  1.00 52.22  ? 78   G   A N9    1 
ATOM   1471  C  C8    . G   A  1  77   ? 34.842  151.379 17.270  1.00 52.79  ? 78   G   A C8    1 
ATOM   1472  N  N7    . G   A  1  77   ? 35.316  152.302 16.479  1.00 53.93  ? 78   G   A N7    1 
ATOM   1473  C  C5    . G   A  1  77   ? 35.684  153.334 17.332  1.00 52.85  ? 78   G   A C5    1 
ATOM   1474  C  C6    . G   A  1  77   ? 36.251  154.602 17.049  1.00 52.83  ? 78   G   A C6    1 
ATOM   1475  O  O6    . G   A  1  77   ? 36.533  155.096 15.952  1.00 54.23  ? 78   G   A O6    1 
ATOM   1476  N  N1    . G   A  1  77   ? 36.479  155.329 18.211  1.00 53.21  ? 78   G   A N1    1 
ATOM   1477  C  C2    . G   A  1  77   ? 36.197  154.903 19.483  1.00 52.95  ? 78   G   A C2    1 
ATOM   1478  N  N2    . G   A  1  77   ? 36.496  155.759 20.471  1.00 52.11  ? 78   G   A N2    1 
ATOM   1479  N  N3    . G   A  1  77   ? 35.660  153.725 19.762  1.00 53.66  ? 78   G   A N3    1 
ATOM   1480  C  C4    . G   A  1  77   ? 35.430  152.997 18.645  1.00 52.72  ? 78   G   A C4    1 
ATOM   1481  P  P     . G   A  1  78   ? 29.602  150.135 19.412  1.00 45.74  ? 79   G   A P     1 
ATOM   1482  O  OP1   . G   A  1  78   ? 28.523  149.315 20.019  1.00 45.59  ? 79   G   A OP1   1 
ATOM   1483  O  OP2   . G   A  1  78   ? 29.723  150.212 17.933  1.00 46.00  ? 79   G   A OP2   1 
ATOM   1484  O  "O5'" . G   A  1  78   ? 29.455  151.594 20.016  1.00 43.06  ? 79   G   A "O5'" 1 
ATOM   1485  C  "C5'" . G   A  1  78   ? 29.519  151.800 21.431  1.00 40.61  ? 79   G   A "C5'" 1 
ATOM   1486  C  "C4'" . G   A  1  78   ? 29.874  153.227 21.718  1.00 40.83  ? 79   G   A "C4'" 1 
ATOM   1487  O  "O4'" . G   A  1  78   ? 31.189  153.512 21.186  1.00 40.87  ? 79   G   A "O4'" 1 
ATOM   1488  C  "C3'" . G   A  1  78   ? 28.955  154.246 21.071  1.00 41.01  ? 79   G   A "C3'" 1 
ATOM   1489  O  "O3'" . G   A  1  78   ? 27.821  154.445 21.919  1.00 41.33  ? 79   G   A "O3'" 1 
ATOM   1490  C  "C2'" . G   A  1  78   ? 29.854  155.469 20.943  1.00 41.51  ? 79   G   A "C2'" 1 
ATOM   1491  O  "O2'" . G   A  1  78   ? 29.929  156.201 22.145  1.00 41.48  ? 79   G   A "O2'" 1 
ATOM   1492  C  "C1'" . G   A  1  78   ? 31.216  154.824 20.667  1.00 42.08  ? 79   G   A "C1'" 1 
ATOM   1493  N  N9    . G   A  1  78   ? 31.593  154.747 19.259  1.00 43.45  ? 79   G   A N9    1 
ATOM   1494  C  C8    . G   A  1  78   ? 31.164  153.832 18.327  1.00 44.49  ? 79   G   A C8    1 
ATOM   1495  N  N7    . G   A  1  78   ? 31.711  153.999 17.151  1.00 44.54  ? 79   G   A N7    1 
ATOM   1496  C  C5    . G   A  1  78   ? 32.546  155.094 17.315  1.00 44.41  ? 79   G   A C5    1 
ATOM   1497  C  C6    . G   A  1  78   ? 33.405  155.743 16.393  1.00 44.04  ? 79   G   A C6    1 
ATOM   1498  O  O6    . G   A  1  78   ? 33.611  155.470 15.205  1.00 43.63  ? 79   G   A O6    1 
ATOM   1499  N  N1    . G   A  1  78   ? 34.066  156.815 16.982  1.00 45.51  ? 79   G   A N1    1 
ATOM   1500  C  C2    . G   A  1  78   ? 33.921  157.214 18.285  1.00 46.10  ? 79   G   A C2    1 
ATOM   1501  N  N2    . G   A  1  78   ? 34.644  158.276 18.663  1.00 46.73  ? 79   G   A N2    1 
ATOM   1502  N  N3    . G   A  1  78   ? 33.128  156.620 19.154  1.00 46.06  ? 79   G   A N3    1 
ATOM   1503  C  C4    . G   A  1  78   ? 32.476  155.574 18.608  1.00 44.35  ? 79   G   A C4    1 
ATOM   1504  P  P     . A   A  1  79   ? 26.697  155.525 21.540  1.00 41.38  ? 80   A   A P     1 
ATOM   1505  O  OP1   . A   A  1  79   ? 25.404  154.987 22.027  1.00 39.55  ? 80   A   A OP1   1 
ATOM   1506  O  OP2   . A   A  1  79   ? 26.840  155.904 20.111  1.00 43.13  ? 80   A   A OP2   1 
ATOM   1507  O  "O5'" . A   A  1  79   ? 27.071  156.788 22.438  1.00 40.83  ? 80   A   A "O5'" 1 
ATOM   1508  C  "C5'" . A   A  1  79   ? 27.270  156.649 23.854  1.00 40.54  ? 80   A   A "C5'" 1 
ATOM   1509  C  "C4'" . A   A  1  79   ? 27.731  157.955 24.461  1.00 40.85  ? 80   A   A "C4'" 1 
ATOM   1510  O  "O4'" . A   A  1  79   ? 29.003  158.349 23.878  1.00 41.79  ? 80   A   A "O4'" 1 
ATOM   1511  C  "C3'" . A   A  1  79   ? 26.792  159.137 24.265  1.00 40.91  ? 80   A   A "C3'" 1 
ATOM   1512  O  "O3'" . A   A  1  79   ? 26.914  160.005 25.374  1.00 41.31  ? 80   A   A "O3'" 1 
ATOM   1513  C  "C2'" . A   A  1  79   ? 27.397  159.835 23.056  1.00 42.29  ? 80   A   A "C2'" 1 
ATOM   1514  O  "O2'" . A   A  1  79   ? 27.087  161.210 22.987  1.00 43.69  ? 80   A   A "O2'" 1 
ATOM   1515  C  "C1'" . A   A  1  79   ? 28.882  159.650 23.341  1.00 42.67  ? 80   A   A "C1'" 1 
ATOM   1516  N  N9    . A   A  1  79   ? 29.761  159.764 22.181  1.00 43.82  ? 80   A   A N9    1 
ATOM   1517  C  C8    . A   A  1  79   ? 29.595  159.265 20.915  1.00 43.21  ? 80   A   A C8    1 
ATOM   1518  N  N7    . A   A  1  79   ? 30.594  159.530 20.111  1.00 44.09  ? 80   A   A N7    1 
ATOM   1519  C  C5    . A   A  1  79   ? 31.478  160.252 20.901  1.00 44.58  ? 80   A   A C5    1 
ATOM   1520  C  C6    . A   A  1  79   ? 32.739  160.820 20.643  1.00 44.72  ? 80   A   A C6    1 
ATOM   1521  N  N6    . A   A  1  79   ? 33.369  160.722 19.472  1.00 44.80  ? 80   A   A N6    1 
ATOM   1522  N  N1    . A   A  1  79   ? 33.342  161.497 21.647  1.00 46.03  ? 80   A   A N1    1 
ATOM   1523  C  C2    . A   A  1  79   ? 32.721  161.580 22.830  1.00 46.61  ? 80   A   A C2    1 
ATOM   1524  N  N3    . A   A  1  79   ? 31.544  161.075 23.198  1.00 47.10  ? 80   A   A N3    1 
ATOM   1525  C  C4    . A   A  1  79   ? 30.970  160.416 22.174  1.00 45.25  ? 80   A   A C4    1 
ATOM   1526  P  P     . G   A  1  80   ? 26.140  159.672 26.734  1.00 43.69  ? 81   G   A P     1 
ATOM   1527  O  OP1   . G   A  1  80   ? 24.887  158.921 26.431  1.00 43.26  ? 81   G   A OP1   1 
ATOM   1528  O  OP2   . G   A  1  80   ? 26.085  160.928 27.512  1.00 41.70  ? 81   G   A OP2   1 
ATOM   1529  O  "O5'" . G   A  1  80   ? 27.123  158.666 27.472  1.00 44.45  ? 81   G   A "O5'" 1 
ATOM   1530  C  "C5'" . G   A  1  80   ? 28.192  159.152 28.302  1.00 42.47  ? 81   G   A "C5'" 1 
ATOM   1531  C  "C4'" . G   A  1  80   ? 29.521  158.828 27.668  1.00 40.61  ? 81   G   A "C4'" 1 
ATOM   1532  O  "O4'" . G   A  1  80   ? 29.685  159.589 26.439  1.00 38.96  ? 81   G   A "O4'" 1 
ATOM   1533  C  "C3'" . G   A  1  80   ? 30.746  159.168 28.495  1.00 38.90  ? 81   G   A "C3'" 1 
ATOM   1534  O  "O3'" . G   A  1  80   ? 31.012  158.144 29.445  1.00 39.79  ? 81   G   A "O3'" 1 
ATOM   1535  C  "C2'" . G   A  1  80   ? 31.799  159.299 27.410  1.00 37.38  ? 81   G   A "C2'" 1 
ATOM   1536  O  "O2'" . G   A  1  80   ? 32.129  158.030 26.868  1.00 37.05  ? 81   G   A "O2'" 1 
ATOM   1537  C  "C1'" . G   A  1  80   ? 31.007  160.099 26.373  1.00 36.80  ? 81   G   A "C1'" 1 
ATOM   1538  N  N9    . G   A  1  80   ? 30.955  161.509 26.755  1.00 35.17  ? 81   G   A N9    1 
ATOM   1539  C  C8    . G   A  1  80   ? 29.855  162.219 27.182  1.00 34.59  ? 81   G   A C8    1 
ATOM   1540  N  N7    . G   A  1  80   ? 30.135  163.451 27.507  1.00 33.42  ? 81   G   A N7    1 
ATOM   1541  C  C5    . G   A  1  80   ? 31.497  163.568 27.271  1.00 33.34  ? 81   G   A C5    1 
ATOM   1542  C  C6    . G   A  1  80   ? 32.371  164.676 27.444  1.00 33.43  ? 81   G   A C6    1 
ATOM   1543  O  O6    . G   A  1  80   ? 32.102  165.814 27.862  1.00 35.33  ? 81   G   A O6    1 
ATOM   1544  N  N1    . G   A  1  80   ? 33.678  164.361 27.078  1.00 32.62  ? 81   G   A N1    1 
ATOM   1545  C  C2    . G   A  1  80   ? 34.093  163.144 26.611  1.00 33.58  ? 81   G   A C2    1 
ATOM   1546  N  N2    . G   A  1  80   ? 35.395  163.036 26.322  1.00 32.69  ? 81   G   A N2    1 
ATOM   1547  N  N3    . G   A  1  80   ? 33.291  162.104 26.443  1.00 34.46  ? 81   G   A N3    1 
ATOM   1548  C  C4    . G   A  1  80   ? 32.016  162.385 26.792  1.00 34.22  ? 81   G   A C4    1 
ATOM   1549  P  P     . C   A  1  81   ? 31.493  158.537 30.929  1.00 39.59  ? 82   C   A P     1 
ATOM   1550  O  OP1   . C   A  1  81   ? 31.321  157.335 31.782  1.00 39.27  ? 82   C   A OP1   1 
ATOM   1551  O  OP2   . C   A  1  81   ? 30.822  159.807 31.304  1.00 37.00  ? 82   C   A OP2   1 
ATOM   1552  O  "O5'" . C   A  1  81   ? 33.053  158.809 30.754  1.00 38.65  ? 82   C   A "O5'" 1 
ATOM   1553  C  "C5'" . C   A  1  81   ? 33.879  157.910 29.974  1.00 37.84  ? 82   C   A "C5'" 1 
ATOM   1554  C  "C4'" . C   A  1  81   ? 35.151  158.611 29.528  1.00 38.21  ? 82   C   A "C4'" 1 
ATOM   1555  O  "O4'" . C   A  1  81   ? 34.815  159.793 28.752  1.00 36.72  ? 82   C   A "O4'" 1 
ATOM   1556  C  "C3'" . C   A  1  81   ? 36.019  159.163 30.647  1.00 38.34  ? 82   C   A "C3'" 1 
ATOM   1557  O  "O3'" . C   A  1  81   ? 36.842  158.164 31.241  1.00 40.10  ? 82   C   A "O3'" 1 
ATOM   1558  C  "C2'" . C   A  1  81   ? 36.824  160.240 29.938  1.00 36.49  ? 82   C   A "C2'" 1 
ATOM   1559  O  "O2'" . C   A  1  81   ? 37.877  159.703 29.158  1.00 36.68  ? 82   C   A "O2'" 1 
ATOM   1560  C  "C1'" . C   A  1  81   ? 35.761  160.824 29.008  1.00 35.05  ? 82   C   A "C1'" 1 
ATOM   1561  N  N1    . C   A  1  81   ? 35.049  162.001 29.561  1.00 32.12  ? 82   C   A N1    1 
ATOM   1562  C  C2    . C   A  1  81   ? 35.738  163.230 29.688  1.00 31.87  ? 82   C   A C2    1 
ATOM   1563  O  O2    . C   A  1  81   ? 36.933  163.292 29.350  1.00 31.24  ? 82   C   A O2    1 
ATOM   1564  N  N3    . C   A  1  81   ? 35.077  164.307 30.178  1.00 29.54  ? 82   C   A N3    1 
ATOM   1565  C  C4    . C   A  1  81   ? 33.789  164.197 30.533  1.00 29.44  ? 82   C   A C4    1 
ATOM   1566  N  N4    . C   A  1  81   ? 33.175  165.283 31.009  1.00 28.76  ? 82   C   A N4    1 
ATOM   1567  C  C5    . C   A  1  81   ? 33.075  162.969 30.418  1.00 29.59  ? 82   C   A C5    1 
ATOM   1568  C  C6    . C   A  1  81   ? 33.736  161.909 29.937  1.00 30.37  ? 82   C   A C6    1 
ATOM   1569  P  P     . C   A  1  82   ? 37.299  158.321 32.777  1.00 40.19  ? 83   C   A P     1 
ATOM   1570  O  OP1   . C   A  1  82   ? 38.066  157.088 33.082  1.00 38.84  ? 83   C   A OP1   1 
ATOM   1571  O  OP2   . C   A  1  82   ? 36.126  158.688 33.620  1.00 38.83  ? 83   C   A OP2   1 
ATOM   1572  O  "O5'" . C   A  1  82   ? 38.288  159.572 32.759  1.00 39.61  ? 83   C   A "O5'" 1 
ATOM   1573  C  "C5'" . C   A  1  82   ? 39.576  159.484 32.127  1.00 40.23  ? 83   C   A "C5'" 1 
ATOM   1574  C  "C4'" . C   A  1  82   ? 40.359  160.751 32.355  1.00 39.83  ? 83   C   A "C4'" 1 
ATOM   1575  O  "O4'" . C   A  1  82   ? 39.683  161.850 31.698  1.00 39.89  ? 83   C   A "O4'" 1 
ATOM   1576  C  "C3'" . C   A  1  82   ? 40.500  161.224 33.792  1.00 40.86  ? 83   C   A "C3'" 1 
ATOM   1577  O  "O3'" . C   A  1  82   ? 41.560  160.521 34.445  1.00 42.39  ? 83   C   A "O3'" 1 
ATOM   1578  C  "C2'" . C   A  1  82   ? 40.833  162.701 33.597  1.00 40.14  ? 83   C   A "C2'" 1 
ATOM   1579  O  "O2'" . C   A  1  82   ? 42.180  162.908 33.231  1.00 41.67  ? 83   C   A "O2'" 1 
ATOM   1580  C  "C1'" . C   A  1  82   ? 39.962  163.055 32.389  1.00 39.31  ? 83   C   A "C1'" 1 
ATOM   1581  N  N1    . C   A  1  82   ? 38.700  163.745 32.731  1.00 38.34  ? 83   C   A N1    1 
ATOM   1582  C  C2    . C   A  1  82   ? 38.750  165.115 32.922  1.00 37.81  ? 83   C   A C2    1 
ATOM   1583  O  O2    . C   A  1  82   ? 39.830  165.698 32.761  1.00 39.26  ? 83   C   A O2    1 
ATOM   1584  N  N3    . C   A  1  82   ? 37.625  165.782 33.273  1.00 38.65  ? 83   C   A N3    1 
ATOM   1585  C  C4    . C   A  1  82   ? 36.476  165.123 33.422  1.00 37.64  ? 83   C   A C4    1 
ATOM   1586  N  N4    . C   A  1  82   ? 35.399  165.827 33.791  1.00 39.83  ? 83   C   A N4    1 
ATOM   1587  C  C5    . C   A  1  82   ? 36.383  163.718 33.208  1.00 37.44  ? 83   C   A C5    1 
ATOM   1588  C  C6    . C   A  1  82   ? 37.512  163.073 32.870  1.00 39.33  ? 83   C   A C6    1 
ATOM   1589  P  P     . G   A  1  83   ? 41.377  159.976 35.957  1.00 43.68  ? 84   G   A P     1 
ATOM   1590  O  OP1   . G   A  1  83   ? 39.939  159.972 36.336  1.00 42.39  ? 84   G   A OP1   1 
ATOM   1591  O  OP2   . G   A  1  83   ? 42.352  160.712 36.806  1.00 43.40  ? 84   G   A OP2   1 
ATOM   1592  O  "O5'" . G   A  1  83   ? 41.868  158.461 35.860  1.00 42.64  ? 84   G   A "O5'" 1 
ATOM   1593  C  "C5'" . G   A  1  83   ? 41.192  157.501 35.016  1.00 43.87  ? 84   G   A "C5'" 1 
ATOM   1594  C  "C4'" . G   A  1  83   ? 41.489  156.089 35.482  1.00 45.27  ? 84   G   A "C4'" 1 
ATOM   1595  O  "O4'" . G   A  1  83   ? 42.908  155.810 35.341  1.00 46.30  ? 84   G   A "O4'" 1 
ATOM   1596  C  "C3'" . G   A  1  83   ? 41.191  155.837 36.948  1.00 46.51  ? 84   G   A "C3'" 1 
ATOM   1597  O  "O3'" . G   A  1  83   ? 39.833  155.484 37.123  1.00 49.62  ? 84   G   A "O3'" 1 
ATOM   1598  C  "C2'" . G   A  1  83   ? 42.132  154.695 37.288  1.00 45.71  ? 84   G   A "C2'" 1 
ATOM   1599  O  "O2'" . G   A  1  83   ? 41.639  153.452 36.840  1.00 47.39  ? 84   G   A "O2'" 1 
ATOM   1600  C  "C1'" . G   A  1  83   ? 43.368  155.076 36.469  1.00 46.11  ? 84   G   A "C1'" 1 
ATOM   1601  N  N9    . G   A  1  83   ? 44.294  155.923 37.221  1.00 46.19  ? 84   G   A N9    1 
ATOM   1602  C  C8    . G   A  1  83   ? 44.546  157.259 37.021  1.00 46.22  ? 84   G   A C8    1 
ATOM   1603  N  N7    . G   A  1  83   ? 45.429  157.746 37.850  1.00 45.91  ? 84   G   A N7    1 
ATOM   1604  C  C5    . G   A  1  83   ? 45.784  156.666 38.644  1.00 45.84  ? 84   G   A C5    1 
ATOM   1605  C  C6    . G   A  1  83   ? 46.706  156.577 39.714  1.00 45.29  ? 84   G   A C6    1 
ATOM   1606  O  O6    . G   A  1  83   ? 47.441  157.453 40.176  1.00 46.35  ? 84   G   A O6    1 
ATOM   1607  N  N1    . G   A  1  83   ? 46.733  155.298 40.255  1.00 44.80  ? 84   G   A N1    1 
ATOM   1608  C  C2    . G   A  1  83   ? 45.981  154.237 39.817  1.00 44.59  ? 84   G   A C2    1 
ATOM   1609  N  N2    . G   A  1  83   ? 46.132  153.084 40.482  1.00 43.40  ? 84   G   A N2    1 
ATOM   1610  N  N3    . G   A  1  83   ? 45.138  154.302 38.806  1.00 45.62  ? 84   G   A N3    1 
ATOM   1611  C  C4    . G   A  1  83   ? 45.086  155.536 38.273  1.00 45.71  ? 84   G   A C4    1 
ATOM   1612  P  P     . C   A  1  84   ? 39.108  155.788 38.523  1.00 53.18  ? 85   C   A P     1 
ATOM   1613  O  OP1   . C   A  1  84   ? 37.704  155.315 38.416  1.00 54.15  ? 85   C   A OP1   1 
ATOM   1614  O  OP2   . C   A  1  84   ? 39.382  157.205 38.895  1.00 52.86  ? 85   C   A OP2   1 
ATOM   1615  O  "O5'" . C   A  1  84   ? 39.833  154.796 39.530  1.00 52.93  ? 85   C   A "O5'" 1 
ATOM   1616  C  "C5'" . C   A  1  84   ? 39.712  153.376 39.333  1.00 54.42  ? 85   C   A "C5'" 1 
ATOM   1617  C  "C4'" . C   A  1  84   ? 40.412  152.631 40.435  1.00 54.89  ? 85   C   A "C4'" 1 
ATOM   1618  O  "O4'" . C   A  1  84   ? 41.843  152.851 40.341  1.00 54.22  ? 85   C   A "O4'" 1 
ATOM   1619  C  "C3'" . C   A  1  84   ? 40.054  153.083 41.838  1.00 55.23  ? 85   C   A "C3'" 1 
ATOM   1620  O  "O3'" . C   A  1  84   ? 38.833  152.501 42.272  1.00 56.82  ? 85   C   A "O3'" 1 
ATOM   1621  C  "C2'" . C   A  1  84   ? 41.265  152.622 42.638  1.00 55.09  ? 85   C   A "C2'" 1 
ATOM   1622  O  "O2'" . C   A  1  84   ? 41.243  151.237 42.924  1.00 55.11  ? 85   C   A "O2'" 1 
ATOM   1623  C  "C1'" . C   A  1  84   ? 42.395  152.907 41.645  1.00 54.41  ? 85   C   A "C1'" 1 
ATOM   1624  N  N1    . C   A  1  84   ? 43.022  154.229 41.840  1.00 54.09  ? 85   C   A N1    1 
ATOM   1625  C  C2    . C   A  1  84   ? 43.978  154.372 42.853  1.00 54.03  ? 85   C   A C2    1 
ATOM   1626  O  O2    . C   A  1  84   ? 44.241  153.396 43.573  1.00 54.39  ? 85   C   A O2    1 
ATOM   1627  N  N3    . C   A  1  84   ? 44.586  155.570 43.027  1.00 52.87  ? 85   C   A N3    1 
ATOM   1628  C  C4    . C   A  1  84   ? 44.262  156.601 42.248  1.00 52.05  ? 85   C   A C4    1 
ATOM   1629  N  N4    . C   A  1  84   ? 44.889  157.754 42.460  1.00 50.35  ? 85   C   A N4    1 
ATOM   1630  C  C5    . C   A  1  84   ? 43.280  156.492 41.219  1.00 53.10  ? 85   C   A C5    1 
ATOM   1631  C  C6    . C   A  1  84   ? 42.691  155.299 41.050  1.00 54.14  ? 85   C   A C6    1 
ATOM   1632  P  P     . A   A  1  85   ? 37.953  153.252 43.384  1.00 58.01  ? 86   A   A P     1 
ATOM   1633  O  OP1   . A   A  1  85   ? 38.739  153.200 44.644  1.00 58.67  ? 86   A   A OP1   1 
ATOM   1634  O  OP2   . A   A  1  85   ? 36.582  152.685 43.361  1.00 59.16  ? 86   A   A OP2   1 
ATOM   1635  O  "O5'" . A   A  1  85   ? 37.901  154.764 42.875  1.00 58.62  ? 86   A   A "O5'" 1 
ATOM   1636  C  "C5'" . A   A  1  85   ? 36.921  155.687 43.381  1.00 59.53  ? 86   A   A "C5'" 1 
ATOM   1637  C  "C4'" . A   A  1  85   ? 37.442  157.104 43.296  1.00 60.86  ? 86   A   A "C4'" 1 
ATOM   1638  O  "O4'" . A   A  1  85   ? 38.492  157.304 44.281  1.00 59.69  ? 86   A   A "O4'" 1 
ATOM   1639  C  "C3'" . A   A  1  85   ? 38.050  157.511 41.958  1.00 62.54  ? 86   A   A "C3'" 1 
ATOM   1640  O  "O3'" . A   A  1  85   ? 37.856  158.911 41.788  1.00 66.76  ? 86   A   A "O3'" 1 
ATOM   1641  C  "C2'" . A   A  1  85   ? 39.534  157.257 42.188  1.00 61.46  ? 86   A   A "C2'" 1 
ATOM   1642  O  "O2'" . A   A  1  85   ? 40.374  158.003 41.334  1.00 61.77  ? 86   A   A "O2'" 1 
ATOM   1643  C  "C1'" . A   A  1  85   ? 39.671  157.733 43.630  1.00 60.33  ? 86   A   A "C1'" 1 
ATOM   1644  N  N9    . A   A  1  85   ? 40.822  157.225 44.372  1.00 58.93  ? 86   A   A N9    1 
ATOM   1645  C  C8    . A   A  1  85   ? 41.033  155.954 44.839  1.00 58.81  ? 86   A   A C8    1 
ATOM   1646  N  N7    . A   A  1  85   ? 42.131  155.825 45.537  1.00 58.17  ? 86   A   A N7    1 
ATOM   1647  C  C5    . A   A  1  85   ? 42.691  157.094 45.514  1.00 57.98  ? 86   A   A C5    1 
ATOM   1648  C  C6    . A   A  1  85   ? 43.863  157.617 46.084  1.00 57.56  ? 86   A   A C6    1 
ATOM   1649  N  N6    . A   A  1  85   ? 44.708  156.902 46.830  1.00 57.35  ? 86   A   A N6    1 
ATOM   1650  N  N1    . A   A  1  85   ? 44.141  158.917 45.864  1.00 57.38  ? 86   A   A N1    1 
ATOM   1651  C  C2    . A   A  1  85   ? 43.289  159.634 45.121  1.00 58.40  ? 86   A   A C2    1 
ATOM   1652  N  N3    . A   A  1  85   ? 42.151  159.257 44.538  1.00 58.54  ? 86   A   A N3    1 
ATOM   1653  C  C4    . A   A  1  85   ? 41.907  157.960 44.780  1.00 58.33  ? 86   A   A C4    1 
ATOM   1654  P  P     . C   A  1  86   ? 36.719  159.444 40.794  1.00 70.31  ? 87   C   A P     1 
ATOM   1655  O  OP1   . C   A  1  86   ? 36.365  158.325 39.872  1.00 69.26  ? 87   C   A OP1   1 
ATOM   1656  O  OP2   . C   A  1  86   ? 37.196  160.742 40.228  1.00 68.50  ? 87   C   A OP2   1 
ATOM   1657  O  "O5'" . C   A  1  86   ? 35.478  159.723 41.756  1.00 70.48  ? 87   C   A "O5'" 1 
ATOM   1658  C  "C5'" . C   A  1  86   ? 34.259  160.253 41.214  1.00 74.11  ? 87   C   A "C5'" 1 
ATOM   1659  C  "C4'" . C   A  1  86   ? 33.214  160.438 42.290  1.00 75.39  ? 87   C   A "C4'" 1 
ATOM   1660  O  "O4'" . C   A  1  86   ? 32.826  159.147 42.834  1.00 77.08  ? 87   C   A "O4'" 1 
ATOM   1661  C  "C3'" . C   A  1  86   ? 33.549  161.326 43.485  1.00 74.06  ? 87   C   A "C3'" 1 
ATOM   1662  O  "O3'" . C   A  1  86   ? 32.443  162.181 43.720  1.00 71.56  ? 87   C   A "O3'" 1 
ATOM   1663  C  "C2'" . C   A  1  86   ? 33.661  160.330 44.638  1.00 75.70  ? 87   C   A "C2'" 1 
ATOM   1664  O  "O2'" . C   A  1  86   ? 33.301  160.894 45.882  1.00 75.60  ? 87   C   A "O2'" 1 
ATOM   1665  C  "C1'" . C   A  1  86   ? 32.642  159.273 44.225  1.00 77.86  ? 87   C   A "C1'" 1 
ATOM   1666  N  N1    . C   A  1  86   ? 32.831  157.946 44.840  1.00 81.30  ? 87   C   A N1    1 
ATOM   1667  C  C2    . C   A  1  86   ? 31.697  157.170 45.170  1.00 83.18  ? 87   C   A C2    1 
ATOM   1668  O  O2    . C   A  1  86   ? 30.559  157.627 44.955  1.00 83.96  ? 87   C   A O2    1 
ATOM   1669  N  N3    . C   A  1  86   ? 31.876  155.943 45.719  1.00 84.09  ? 87   C   A N3    1 
ATOM   1670  C  C4    . C   A  1  86   ? 33.111  155.490 45.950  1.00 84.10  ? 87   C   A C4    1 
ATOM   1671  N  N4    . C   A  1  86   ? 33.242  154.281 46.498  1.00 84.54  ? 87   C   A N4    1 
ATOM   1672  C  C5    . C   A  1  86   ? 34.271  156.259 45.633  1.00 84.12  ? 87   C   A C5    1 
ATOM   1673  C  C6    . C   A  1  86   ? 34.087  157.464 45.086  1.00 82.63  ? 87   C   A C6    1 
ATOM   1674  P  P     . G   A  1  87   ? 32.525  163.717 43.267  1.00 69.98  ? 88   G   A P     1 
ATOM   1675  O  OP1   . G   A  1  87   ? 31.171  164.116 42.798  1.00 71.28  ? 88   G   A OP1   1 
ATOM   1676  O  OP2   . G   A  1  87   ? 33.680  163.845 42.342  1.00 70.18  ? 88   G   A OP2   1 
ATOM   1677  O  "O5'" . G   A  1  87   ? 32.864  164.504 44.614  1.00 68.75  ? 88   G   A "O5'" 1 
ATOM   1678  C  "C5'" . G   A  1  87   ? 34.170  164.394 45.213  1.00 65.62  ? 88   G   A "C5'" 1 
ATOM   1679  C  "C4'" . G   A  1  87   ? 34.560  165.676 45.915  1.00 62.45  ? 88   G   A "C4'" 1 
ATOM   1680  O  "O4'" . G   A  1  87   ? 35.922  165.533 46.405  1.00 60.50  ? 88   G   A "O4'" 1 
ATOM   1681  C  "C3'" . G   A  1  87   ? 34.565  166.924 45.041  1.00 62.08  ? 88   G   A "C3'" 1 
ATOM   1682  O  "O3'" . G   A  1  87   ? 33.325  167.615 45.169  1.00 62.38  ? 88   G   A "O3'" 1 
ATOM   1683  C  "C2'" . G   A  1  87   ? 35.750  167.722 45.576  1.00 60.79  ? 88   G   A "C2'" 1 
ATOM   1684  O  "O2'" . G   A  1  87   ? 35.447  168.442 46.753  1.00 61.75  ? 88   G   A "O2'" 1 
ATOM   1685  C  "C1'" . G   A  1  87   ? 36.721  166.600 45.931  1.00 58.26  ? 88   G   A "C1'" 1 
ATOM   1686  N  N9    . G   A  1  87   ? 37.523  166.114 44.809  1.00 54.74  ? 88   G   A N9    1 
ATOM   1687  C  C8    . G   A  1  87   ? 37.244  165.059 43.976  1.00 53.44  ? 88   G   A C8    1 
ATOM   1688  N  N7    . G   A  1  87   ? 38.157  164.874 43.061  1.00 51.89  ? 88   G   A N7    1 
ATOM   1689  C  C5    . G   A  1  87   ? 39.094  165.862 43.305  1.00 52.05  ? 88   G   A C5    1 
ATOM   1690  C  C6    . G   A  1  87   ? 40.305  166.161 42.634  1.00 52.15  ? 88   G   A C6    1 
ATOM   1691  O  O6    . G   A  1  87   ? 40.800  165.605 41.648  1.00 52.92  ? 88   G   A O6    1 
ATOM   1692  N  N1    . G   A  1  87   ? 40.956  167.244 43.217  1.00 51.98  ? 88   G   A N1    1 
ATOM   1693  C  C2    . G   A  1  87   ? 40.489  167.957 44.294  1.00 52.67  ? 88   G   A C2    1 
ATOM   1694  N  N2    . G   A  1  87   ? 41.237  168.985 44.702  1.00 53.13  ? 88   G   A N2    1 
ATOM   1695  N  N3    . G   A  1  87   ? 39.361  167.687 44.924  1.00 53.43  ? 88   G   A N3    1 
ATOM   1696  C  C4    . G   A  1  87   ? 38.719  166.635 44.381  1.00 53.21  ? 88   G   A C4    1 
ATOM   1697  P  P     . G   A  1  88   ? 32.874  168.675 44.049  1.00 63.55  ? 89   G   A P     1 
ATOM   1698  O  OP1   . G   A  1  88   ? 31.597  169.263 44.542  1.00 63.37  ? 89   G   A OP1   1 
ATOM   1699  O  OP2   . G   A  1  88   ? 32.918  168.007 42.715  1.00 62.66  ? 89   G   A OP2   1 
ATOM   1700  O  "O5'" . G   A  1  88   ? 34.006  169.797 44.072  1.00 61.40  ? 89   G   A "O5'" 1 
ATOM   1701  C  "C5'" . G   A  1  88   ? 33.997  170.840 45.057  1.00 59.91  ? 89   G   A "C5'" 1 
ATOM   1702  C  "C4'" . G   A  1  88   ? 35.179  171.757 44.852  1.00 60.36  ? 89   G   A "C4'" 1 
ATOM   1703  O  "O4'" . G   A  1  88   ? 36.409  170.989 44.972  1.00 58.48  ? 89   G   A "O4'" 1 
ATOM   1704  C  "C3'" . G   A  1  88   ? 35.291  172.389 43.476  1.00 61.08  ? 89   G   A "C3'" 1 
ATOM   1705  O  "O3'" . G   A  1  88   ? 34.476  173.536 43.304  1.00 63.86  ? 89   G   A "O3'" 1 
ATOM   1706  C  "C2'" . G   A  1  88   ? 36.770  172.725 43.398  1.00 59.90  ? 89   G   A "C2'" 1 
ATOM   1707  O  "O2'" . G   A  1  88   ? 37.109  173.889 44.130  1.00 59.80  ? 89   G   A "O2'" 1 
ATOM   1708  C  "C1'" . G   A  1  88   ? 37.377  171.494 44.065  1.00 57.17  ? 89   G   A "C1'" 1 
ATOM   1709  N  N9    . G   A  1  88   ? 37.702  170.450 43.096  1.00 53.38  ? 89   G   A N9    1 
ATOM   1710  C  C8    . G   A  1  88   ? 36.917  169.391 42.705  1.00 52.50  ? 89   G   A C8    1 
ATOM   1711  N  N7    . G   A  1  88   ? 37.504  168.613 41.835  1.00 50.30  ? 89   G   A N7    1 
ATOM   1712  C  C5    . G   A  1  88   ? 38.748  169.197 41.639  1.00 49.07  ? 89   G   A C5    1 
ATOM   1713  C  C6    . G   A  1  88   ? 39.837  168.796 40.819  1.00 48.71  ? 89   G   A C6    1 
ATOM   1714  O  O6    . G   A  1  88   ? 39.928  167.804 40.083  1.00 47.07  ? 89   G   A O6    1 
ATOM   1715  N  N1    . G   A  1  88   ? 40.901  169.684 40.918  1.00 48.05  ? 89   G   A N1    1 
ATOM   1716  C  C2    . G   A  1  88   ? 40.917  170.810 41.703  1.00 48.24  ? 89   G   A C2    1 
ATOM   1717  N  N2    . G   A  1  88   ? 42.021  171.555 41.648  1.00 48.08  ? 89   G   A N2    1 
ATOM   1718  N  N3    . G   A  1  88   ? 39.921  171.183 42.482  1.00 48.22  ? 89   G   A N3    1 
ATOM   1719  C  C4    . G   A  1  88   ? 38.878  170.338 42.401  1.00 50.00  ? 89   G   A C4    1 
ATOM   1720  P  P     . A   A  1  89   ? 33.787  173.798 41.878  1.00 65.71  ? 90   A   A P     1 
ATOM   1721  O  OP1   . A   A  1  89   ? 32.822  174.918 42.065  1.00 66.52  ? 90   A   A OP1   1 
ATOM   1722  O  OP2   . A   A  1  89   ? 33.309  172.485 41.361  1.00 65.54  ? 90   A   A OP2   1 
ATOM   1723  O  "O5'" . A   A  1  89   ? 34.979  174.288 40.938  1.00 65.08  ? 90   A   A "O5'" 1 
ATOM   1724  C  "C5'" . A   A  1  89   ? 35.701  175.495 41.241  1.00 63.10  ? 90   A   A "C5'" 1 
ATOM   1725  C  "C4'" . A   A  1  89   ? 37.036  175.518 40.524  1.00 61.98  ? 90   A   A "C4'" 1 
ATOM   1726  O  "O4'" . A   A  1  89   ? 37.828  174.349 40.881  1.00 60.13  ? 90   A   A "O4'" 1 
ATOM   1727  C  "C3'" . A   A  1  89   ? 37.009  175.437 39.010  1.00 61.61  ? 90   A   A "C3'" 1 
ATOM   1728  O  "O3'" . A   A  1  89   ? 36.657  176.671 38.400  1.00 61.51  ? 90   A   A "O3'" 1 
ATOM   1729  C  "C2'" . A   A  1  89   ? 38.450  175.051 38.707  1.00 60.17  ? 90   A   A "C2'" 1 
ATOM   1730  O  "O2'" . A   A  1  89   ? 39.331  176.146 38.851  1.00 60.51  ? 90   A   A "O2'" 1 
ATOM   1731  C  "C1'" . A   A  1  89   ? 38.720  174.037 39.819  1.00 58.28  ? 90   A   A "C1'" 1 
ATOM   1732  N  N9    . A   A  1  89   ? 38.465  172.673 39.351  1.00 55.78  ? 90   A   A N9    1 
ATOM   1733  C  C8    . A   A  1  89   ? 37.325  171.908 39.473  1.00 55.35  ? 90   A   A C8    1 
ATOM   1734  N  N7    . A   A  1  89   ? 37.399  170.748 38.864  1.00 53.56  ? 90   A   A N7    1 
ATOM   1735  C  C5    . A   A  1  89   ? 38.676  170.740 38.316  1.00 53.26  ? 90   A   A C5    1 
ATOM   1736  C  C6    . A   A  1  89   ? 39.365  169.799 37.528  1.00 51.73  ? 90   A   A C6    1 
ATOM   1737  N  N6    . A   A  1  89   ? 38.832  168.648 37.112  1.00 52.02  ? 90   A   A N6    1 
ATOM   1738  N  N1    . A   A  1  89   ? 40.634  170.090 37.167  1.00 50.52  ? 90   A   A N1    1 
ATOM   1739  C  C2    . A   A  1  89   ? 41.164  171.252 37.560  1.00 50.87  ? 90   A   A C2    1 
ATOM   1740  N  N3    . A   A  1  89   ? 40.616  172.226 38.284  1.00 51.82  ? 90   A   A N3    1 
ATOM   1741  C  C4    . A   A  1  89   ? 39.354  171.906 38.633  1.00 53.93  ? 90   A   A C4    1 
ATOM   1742  P  P     . G   A  1  90   ? 35.912  176.655 36.983  1.00 62.51  ? 91   G   A P     1 
ATOM   1743  O  OP1   . G   A  1  90   ? 35.760  178.074 36.592  1.00 63.17  ? 91   G   A OP1   1 
ATOM   1744  O  OP2   . G   A  1  90   ? 34.707  175.782 37.078  1.00 62.12  ? 91   G   A OP2   1 
ATOM   1745  O  "O5'" . G   A  1  90   ? 36.945  175.944 35.993  1.00 58.62  ? 91   G   A "O5'" 1 
ATOM   1746  C  "C5'" . G   A  1  90   ? 38.070  176.654 35.456  1.00 54.08  ? 91   G   A "C5'" 1 
ATOM   1747  C  "C4'" . G   A  1  90   ? 39.044  175.696 34.810  1.00 52.55  ? 91   G   A "C4'" 1 
ATOM   1748  O  "O4'" . G   A  1  90   ? 39.208  174.541 35.679  1.00 50.66  ? 91   G   A "O4'" 1 
ATOM   1749  C  "C3'" . G   A  1  90   ? 38.629  175.056 33.494  1.00 51.97  ? 91   G   A "C3'" 1 
ATOM   1750  O  "O3'" . G   A  1  90   ? 38.838  175.893 32.367  1.00 53.81  ? 91   G   A "O3'" 1 
ATOM   1751  C  "C2'" . G   A  1  90   ? 39.553  173.852 33.444  1.00 50.13  ? 91   G   A "C2'" 1 
ATOM   1752  O  "O2'" . G   A  1  90   ? 40.880  174.222 33.135  1.00 49.75  ? 91   G   A "O2'" 1 
ATOM   1753  C  "C1'" . G   A  1  90   ? 39.481  173.385 34.894  1.00 48.44  ? 91   G   A "C1'" 1 
ATOM   1754  N  N9    . G   A  1  90   ? 38.389  172.430 35.064  1.00 45.43  ? 91   G   A N9    1 
ATOM   1755  C  C8    . G   A  1  90   ? 37.169  172.647 35.654  1.00 44.88  ? 91   G   A C8    1 
ATOM   1756  N  N7    . G   A  1  90   ? 36.388  171.603 35.605  1.00 44.58  ? 91   G   A N7    1 
ATOM   1757  C  C5    . G   A  1  90   ? 37.139  170.640 34.950  1.00 43.30  ? 91   G   A C5    1 
ATOM   1758  C  C6    . G   A  1  90   ? 36.814  169.306 34.599  1.00 43.63  ? 91   G   A C6    1 
ATOM   1759  O  O6    . G   A  1  90   ? 35.756  168.693 34.788  1.00 43.15  ? 91   G   A O6    1 
ATOM   1760  N  N1    . G   A  1  90   ? 37.870  168.675 33.959  1.00 42.10  ? 91   G   A N1    1 
ATOM   1761  C  C2    . G   A  1  90   ? 39.080  169.251 33.689  1.00 42.96  ? 91   G   A C2    1 
ATOM   1762  N  N2    . G   A  1  90   ? 39.975  168.478 33.077  1.00 43.37  ? 91   G   A N2    1 
ATOM   1763  N  N3    . G   A  1  90   ? 39.393  170.498 33.998  1.00 42.92  ? 91   G   A N3    1 
ATOM   1764  C  C4    . G   A  1  90   ? 38.380  171.128 34.624  1.00 43.53  ? 91   G   A C4    1 
ATOM   1765  P  P     . G   A  1  91   ? 37.963  175.665 31.037  1.00 55.28  ? 92   G   A P     1 
ATOM   1766  O  OP1   . G   A  1  91   ? 38.259  176.809 30.142  1.00 55.00  ? 92   G   A OP1   1 
ATOM   1767  O  OP2   . G   A  1  91   ? 36.562  175.396 31.456  1.00 54.53  ? 92   G   A OP2   1 
ATOM   1768  O  "O5'" . G   A  1  91   ? 38.542  174.328 30.383  1.00 52.91  ? 92   G   A "O5'" 1 
ATOM   1769  C  "C5'" . G   A  1  91   ? 39.917  174.247 29.985  1.00 50.33  ? 92   G   A "C5'" 1 
ATOM   1770  C  "C4'" . G   A  1  91   ? 40.338  172.807 29.793  1.00 48.37  ? 92   G   A "C4'" 1 
ATOM   1771  O  "O4'" . G   A  1  91   ? 39.896  172.002 30.922  1.00 46.11  ? 92   G   A "O4'" 1 
ATOM   1772  C  "C3'" . G   A  1  91   ? 39.737  172.065 28.616  1.00 47.85  ? 92   G   A "C3'" 1 
ATOM   1773  O  "O3'" . G   A  1  91   ? 40.358  172.428 27.389  1.00 49.50  ? 92   G   A "O3'" 1 
ATOM   1774  C  "C2'" . G   A  1  91   ? 40.007  170.614 29.005  1.00 45.40  ? 92   G   A "C2'" 1 
ATOM   1775  O  "O2'" . G   A  1  91   ? 41.357  170.223 28.844  1.00 45.91  ? 92   G   A "O2'" 1 
ATOM   1776  C  "C1'" . G   A  1  91   ? 39.707  170.655 30.500  1.00 43.01  ? 92   G   A "C1'" 1 
ATOM   1777  N  N9    . G   A  1  91   ? 38.333  170.248 30.778  1.00 38.95  ? 92   G   A N9    1 
ATOM   1778  C  C8    . G   A  1  91   ? 37.301  171.040 31.212  1.00 39.00  ? 92   G   A C8    1 
ATOM   1779  N  N7    . G   A  1  91   ? 36.181  170.387 31.352  1.00 37.04  ? 92   G   A N7    1 
ATOM   1780  C  C5    . G   A  1  91   ? 36.491  169.086 30.996  1.00 35.28  ? 92   G   A C5    1 
ATOM   1781  C  C6    . G   A  1  91   ? 35.673  167.935 30.953  1.00 35.30  ? 92   G   A C6    1 
ATOM   1782  O  O6    . G   A  1  91   ? 34.471  167.833 31.240  1.00 36.34  ? 92   G   A O6    1 
ATOM   1783  N  N1    . G   A  1  91   ? 36.383  166.819 30.529  1.00 33.73  ? 92   G   A N1    1 
ATOM   1784  C  C2    . G   A  1  91   ? 37.715  166.812 30.203  1.00 35.06  ? 92   G   A C2    1 
ATOM   1785  N  N2    . G   A  1  91   ? 38.226  165.628 29.834  1.00 33.65  ? 92   G   A N2    1 
ATOM   1786  N  N3    . G   A  1  91   ? 38.491  167.886 30.241  1.00 35.19  ? 92   G   A N3    1 
ATOM   1787  C  C4    . G   A  1  91   ? 37.816  168.980 30.642  1.00 35.71  ? 92   G   A C4    1 
ATOM   1788  P  P     . C   A  1  92   ? 39.563  172.223 26.009  1.00 51.32  ? 93   C   A P     1 
ATOM   1789  O  OP1   . C   A  1  92   ? 40.362  172.892 24.948  1.00 51.46  ? 93   C   A OP1   1 
ATOM   1790  O  OP2   . C   A  1  92   ? 38.140  172.608 26.211  1.00 50.76  ? 93   C   A OP2   1 
ATOM   1791  O  "O5'" . C   A  1  92   ? 39.607  170.647 25.780  1.00 49.96  ? 93   C   A "O5'" 1 
ATOM   1792  C  "C5'" . C   A  1  92   ? 40.862  169.963 25.639  1.00 48.73  ? 93   C   A "C5'" 1 
ATOM   1793  C  "C4'" . C   A  1  92   ? 40.638  168.485 25.484  1.00 48.58  ? 93   C   A "C4'" 1 
ATOM   1794  O  "O4'" . C   A  1  92   ? 40.042  167.952 26.698  1.00 47.64  ? 93   C   A "O4'" 1 
ATOM   1795  C  "C3'" . C   A  1  92   ? 39.655  168.079 24.404  1.00 49.02  ? 93   C   A "C3'" 1 
ATOM   1796  O  "O3'" . C   A  1  92   ? 40.220  168.121 23.093  1.00 49.81  ? 93   C   A "O3'" 1 
ATOM   1797  C  "C2'" . C   A  1  92   ? 39.267  166.679 24.862  1.00 48.42  ? 93   C   A "C2'" 1 
ATOM   1798  O  "O2'" . C   A  1  92   ? 40.302  165.743 24.615  1.00 49.34  ? 93   C   A "O2'" 1 
ATOM   1799  C  "C1'" . C   A  1  92   ? 39.150  166.891 26.372  1.00 45.50  ? 93   C   A "C1'" 1 
ATOM   1800  N  N1    . C   A  1  92   ? 37.786  167.255 26.818  1.00 42.44  ? 93   C   A N1    1 
ATOM   1801  C  C2    . C   A  1  92   ? 36.795  166.265 26.856  1.00 42.15  ? 93   C   A C2    1 
ATOM   1802  O  O2    . C   A  1  92   ? 37.087  165.107 26.541  1.00 43.60  ? 93   C   A O2    1 
ATOM   1803  N  N3    . C   A  1  92   ? 35.544  166.594 27.242  1.00 41.92  ? 93   C   A N3    1 
ATOM   1804  C  C4    . C   A  1  92   ? 35.261  167.848 27.597  1.00 40.74  ? 93   C   A C4    1 
ATOM   1805  N  N4    . C   A  1  92   ? 34.005  168.124 27.968  1.00 39.39  ? 93   C   A N4    1 
ATOM   1806  C  C5    . C   A  1  92   ? 36.247  168.872 27.586  1.00 41.28  ? 93   C   A C5    1 
ATOM   1807  C  C6    . C   A  1  92   ? 37.485  168.536 27.189  1.00 41.35  ? 93   C   A C6    1 
ATOM   1808  P  P     . G   A  1  93   ? 39.266  168.439 21.833  1.00 48.12  ? 94   G   A P     1 
ATOM   1809  O  OP1   . G   A  1  93   ? 40.042  168.292 20.575  1.00 48.31  ? 94   G   A OP1   1 
ATOM   1810  O  OP2   . G   A  1  93   ? 38.532  169.702 22.100  1.00 48.73  ? 94   G   A OP2   1 
ATOM   1811  O  "O5'" . G   A  1  93   ? 38.232  167.233 21.862  1.00 48.92  ? 94   G   A "O5'" 1 
ATOM   1812  C  "C5'" . G   A  1  93   ? 38.679  165.898 21.579  1.00 47.40  ? 94   G   A "C5'" 1 
ATOM   1813  C  "C4'" . G   A  1  93   ? 37.513  164.955 21.552  1.00 46.35  ? 94   G   A "C4'" 1 
ATOM   1814  O  "O4'" . G   A  1  93   ? 36.943  164.864 22.879  1.00 44.30  ? 94   G   A "O4'" 1 
ATOM   1815  C  "C3'" . G   A  1  93   ? 36.328  165.407 20.719  1.00 46.90  ? 94   G   A "C3'" 1 
ATOM   1816  O  "O3'" . G   A  1  93   ? 36.538  165.228 19.330  1.00 50.54  ? 94   G   A "O3'" 1 
ATOM   1817  C  "C2'" . G   A  1  93   ? 35.217  164.541 21.286  1.00 44.06  ? 94   G   A "C2'" 1 
ATOM   1818  O  "O2'" . G   A  1  93   ? 35.318  163.190 20.885  1.00 43.21  ? 94   G   A "O2'" 1 
ATOM   1819  C  "C1'" . G   A  1  93   ? 35.547  164.623 22.775  1.00 42.44  ? 94   G   A "C1'" 1 
ATOM   1820  N  N9    . G   A  1  93   ? 34.832  165.711 23.429  1.00 39.54  ? 94   G   A N9    1 
ATOM   1821  C  C8    . G   A  1  93   ? 35.312  166.943 23.804  1.00 39.46  ? 94   G   A C8    1 
ATOM   1822  N  N7    . G   A  1  93   ? 34.408  167.683 24.386  1.00 39.02  ? 94   G   A N7    1 
ATOM   1823  C  C5    . G   A  1  93   ? 33.267  166.892 24.384  1.00 37.51  ? 94   G   A C5    1 
ATOM   1824  C  C6    . G   A  1  93   ? 31.970  167.151 24.880  1.00 38.17  ? 94   G   A C6    1 
ATOM   1825  O  O6    . G   A  1  93   ? 31.546  168.171 25.432  1.00 40.64  ? 94   G   A O6    1 
ATOM   1826  N  N1    . G   A  1  93   ? 31.122  166.066 24.683  1.00 38.42  ? 94   G   A N1    1 
ATOM   1827  C  C2    . G   A  1  93   ? 31.480  164.880 24.080  1.00 38.57  ? 94   G   A C2    1 
ATOM   1828  N  N2    . G   A  1  93   ? 30.529  163.931 23.999  1.00 37.73  ? 94   G   A N2    1 
ATOM   1829  N  N3    . G   A  1  93   ? 32.684  164.639 23.602  1.00 37.43  ? 94   G   A N3    1 
ATOM   1830  C  C4    . G   A  1  93   ? 33.518  165.678 23.793  1.00 37.93  ? 94   G   A C4    1 
ATOM   1831  P  P     . A   A  1  94   ? 36.256  166.451 18.326  1.00 52.35  ? 95   A   A P     1 
ATOM   1832  O  OP1   . A   A  1  94   ? 37.575  167.053 18.005  1.00 51.23  ? 95   A   A OP1   1 
ATOM   1833  O  OP2   . A   A  1  94   ? 35.180  167.313 18.888  1.00 52.51  ? 95   A   A OP2   1 
ATOM   1834  O  "O5'" . A   A  1  94   ? 35.635  165.728 17.051  1.00 54.92  ? 95   A   A "O5'" 1 
ATOM   1835  C  "C5'" . A   A  1  94   ? 34.451  164.903 17.181  1.00 56.29  ? 95   A   A "C5'" 1 
ATOM   1836  C  "C4'" . A   A  1  94   ? 33.596  165.018 15.945  1.00 58.06  ? 95   A   A "C4'" 1 
ATOM   1837  O  "O4'" . A   A  1  94   ? 32.504  164.055 16.001  1.00 58.46  ? 95   A   A "O4'" 1 
ATOM   1838  C  "C3'" . A   A  1  94   ? 32.940  166.379 15.739  1.00 59.34  ? 95   A   A "C3'" 1 
ATOM   1839  O  "O3'" . A   A  1  94   ? 32.811  166.635 14.352  1.00 61.36  ? 95   A   A "O3'" 1 
ATOM   1840  C  "C2'" . A   A  1  94   ? 31.545  166.179 16.307  1.00 59.22  ? 95   A   A "C2'" 1 
ATOM   1841  O  "O2'" . A   A  1  94   ? 30.623  167.081 15.727  1.00 59.23  ? 95   A   A "O2'" 1 
ATOM   1842  C  "C1'" . A   A  1  94   ? 31.266  164.736 15.884  1.00 59.67  ? 95   A   A "C1'" 1 
ATOM   1843  N  N9    . A   A  1  94   ? 30.280  164.065 16.729  1.00 60.85  ? 95   A   A N9    1 
ATOM   1844  C  C8    . A   A  1  94   ? 29.091  163.509 16.329  1.00 61.79  ? 95   A   A C8    1 
ATOM   1845  N  N7    . A   A  1  94   ? 28.392  162.990 17.309  1.00 62.14  ? 95   A   A N7    1 
ATOM   1846  C  C5    . A   A  1  94   ? 29.178  163.214 18.431  1.00 62.49  ? 95   A   A C5    1 
ATOM   1847  C  C6    . A   A  1  94   ? 28.992  162.909 19.790  1.00 63.34  ? 95   A   A C6    1 
ATOM   1848  N  N6    . A   A  1  94   ? 27.917  162.270 20.260  1.00 63.37  ? 95   A   A N6    1 
ATOM   1849  N  N1    . A   A  1  94   ? 29.960  163.282 20.658  1.00 62.80  ? 95   A   A N1    1 
ATOM   1850  C  C2    . A   A  1  94   ? 31.040  163.913 20.178  1.00 62.56  ? 95   A   A C2    1 
ATOM   1851  N  N3    . A   A  1  94   ? 31.332  164.253 18.923  1.00 62.95  ? 95   A   A N3    1 
ATOM   1852  C  C4    . A   A  1  94   ? 30.346  163.872 18.088  1.00 61.93  ? 95   A   A C4    1 
ATOM   1853  P  P     . A   A  1  95   ? 33.563  167.888 13.710  1.00 62.17  ? 96   A   A P     1 
ATOM   1854  O  OP1   . A   A  1  95   ? 33.517  169.012 14.688  1.00 61.69  ? 96   A   A OP1   1 
ATOM   1855  O  OP2   . A   A  1  95   ? 33.009  168.073 12.345  1.00 63.33  ? 96   A   A OP2   1 
ATOM   1856  O  "O5'" . A   A  1  95   ? 35.064  167.383 13.573  1.00 60.23  ? 96   A   A "O5'" 1 
ATOM   1857  C  "C5'" . A   A  1  95   ? 35.423  166.413 12.587  1.00 58.49  ? 96   A   A "C5'" 1 
ATOM   1858  C  "C4'" . A   A  1  95   ? 36.889  166.110 12.693  1.00 58.75  ? 96   A   A "C4'" 1 
ATOM   1859  O  "O4'" . A   A  1  95   ? 37.636  167.353 12.501  1.00 59.80  ? 96   A   A "O4'" 1 
ATOM   1860  C  "C3'" . A   A  1  95   ? 37.323  165.573 14.058  1.00 58.63  ? 96   A   A "C3'" 1 
ATOM   1861  O  "O3'" . A   A  1  95   ? 38.374  164.629 13.879  1.00 57.49  ? 96   A   A "O3'" 1 
ATOM   1862  C  "C2'" . A   A  1  95   ? 37.893  166.816 14.733  1.00 60.04  ? 96   A   A "C2'" 1 
ATOM   1863  O  "O2'" . A   A  1  95   ? 38.846  166.538 15.738  1.00 60.58  ? 96   A   A "O2'" 1 
ATOM   1864  C  "C1'" . A   A  1  95   ? 38.569  167.481 13.545  1.00 60.67  ? 96   A   A "C1'" 1 
ATOM   1865  N  N9    . A   A  1  95   ? 38.967  168.878 13.706  1.00 61.90  ? 96   A   A N9    1 
ATOM   1866  C  C8    . A   A  1  95   ? 38.310  169.921 14.319  1.00 62.13  ? 96   A   A C8    1 
ATOM   1867  N  N7    . A   A  1  95   ? 38.989  171.049 14.316  1.00 63.21  ? 96   A   A N7    1 
ATOM   1868  C  C5    . A   A  1  95   ? 40.166  170.728 13.645  1.00 63.46  ? 96   A   A C5    1 
ATOM   1869  C  C6    . A   A  1  95   ? 41.306  171.488 13.299  1.00 63.69  ? 96   A   A C6    1 
ATOM   1870  N  N6    . A   A  1  95   ? 41.450  172.784 13.590  1.00 64.59  ? 96   A   A N6    1 
ATOM   1871  N  N1    . A   A  1  95   ? 42.302  170.860 12.635  1.00 63.23  ? 96   A   A N1    1 
ATOM   1872  C  C2    . A   A  1  95   ? 42.155  169.562 12.338  1.00 63.19  ? 96   A   A C2    1 
ATOM   1873  N  N3    . A   A  1  95   ? 41.136  168.744 12.600  1.00 63.02  ? 96   A   A N3    1 
ATOM   1874  C  C4    . A   A  1  95   ? 40.162  169.396 13.263  1.00 62.93  ? 96   A   A C4    1 
ATOM   1875  P  P     . G   A  1  96   ? 38.021  163.076 13.707  1.00 55.75  ? 97   G   A P     1 
ATOM   1876  O  OP1   . G   A  1  96   ? 39.247  162.264 13.907  1.00 54.31  ? 97   G   A OP1   1 
ATOM   1877  O  OP2   . G   A  1  96   ? 37.263  162.951 12.443  1.00 57.22  ? 97   G   A OP2   1 
ATOM   1878  O  "O5'" . G   A  1  96   ? 37.021  162.792 14.909  1.00 56.67  ? 97   G   A "O5'" 1 
ATOM   1879  C  "C5'" . G   A  1  96   ? 37.438  162.947 16.277  1.00 56.29  ? 97   G   A "C5'" 1 
ATOM   1880  C  "C4'" . G   A  1  96   ? 36.860  161.830 17.116  1.00 54.93  ? 97   G   A "C4'" 1 
ATOM   1881  O  "O4'" . G   A  1  96   ? 35.411  161.885 17.017  1.00 55.17  ? 97   G   A "O4'" 1 
ATOM   1882  C  "C3'" . G   A  1  96   ? 37.245  160.427 16.666  1.00 54.59  ? 97   G   A "C3'" 1 
ATOM   1883  O  "O3'" . G   A  1  96   ? 37.252  159.563 17.794  1.00 53.59  ? 97   G   A "O3'" 1 
ATOM   1884  C  "C2'" . G   A  1  96   ? 36.129  160.075 15.688  1.00 53.92  ? 97   G   A "C2'" 1 
ATOM   1885  O  "O2'" . G   A  1  96   ? 35.969  158.685 15.500  1.00 53.40  ? 97   G   A "O2'" 1 
ATOM   1886  C  "C1'" . G   A  1  96   ? 34.921  160.721 16.370  1.00 54.81  ? 97   G   A "C1'" 1 
ATOM   1887  N  N9    . G   A  1  96   ? 33.857  161.141 15.458  1.00 56.65  ? 97   G   A N9    1 
ATOM   1888  C  C8    . G   A  1  96   ? 33.999  161.893 14.315  1.00 56.91  ? 97   G   A C8    1 
ATOM   1889  N  N7    . G   A  1  96   ? 32.867  162.125 13.708  1.00 57.45  ? 97   G   A N7    1 
ATOM   1890  C  C5    . G   A  1  96   ? 31.916  161.485 14.491  1.00 56.98  ? 97   G   A C5    1 
ATOM   1891  C  C6    . G   A  1  96   ? 30.508  161.385 14.329  1.00 57.07  ? 97   G   A C6    1 
ATOM   1892  O  O6    . G   A  1  96   ? 29.799  161.840 13.419  1.00 58.78  ? 97   G   A O6    1 
ATOM   1893  N  N1    . G   A  1  96   ? 29.925  160.662 15.365  1.00 57.22  ? 97   G   A N1    1 
ATOM   1894  C  C2    . G   A  1  96   ? 30.605  160.097 16.417  1.00 57.21  ? 97   G   A C2    1 
ATOM   1895  N  N2    . G   A  1  96   ? 29.859  159.444 17.323  1.00 57.01  ? 97   G   A N2    1 
ATOM   1896  N  N3    . G   A  1  96   ? 31.920  160.170 16.571  1.00 57.29  ? 97   G   A N3    1 
ATOM   1897  C  C4    . G   A  1  96   ? 32.507  160.876 15.579  1.00 57.12  ? 97   G   A C4    1 
ATOM   1898  P  P     . A   A  1  97   ? 38.566  158.710 18.128  1.00 54.23  ? 98   A   A P     1 
ATOM   1899  O  OP1   . A   A  1  97   ? 39.620  159.089 17.155  1.00 55.79  ? 98   A   A OP1   1 
ATOM   1900  O  OP2   . A   A  1  97   ? 38.173  157.291 18.258  1.00 55.18  ? 98   A   A OP2   1 
ATOM   1901  O  "O5'" . A   A  1  97   ? 39.001  159.244 19.562  1.00 53.27  ? 98   A   A "O5'" 1 
ATOM   1902  C  "C5'" . A   A  1  97   ? 39.748  160.473 19.704  1.00 50.94  ? 98   A   A "C5'" 1 
ATOM   1903  C  "C4'" . A   A  1  97   ? 39.537  161.060 21.082  1.00 49.30  ? 98   A   A "C4'" 1 
ATOM   1904  O  "O4'" . A   A  1  97   ? 38.175  161.564 21.190  1.00 50.14  ? 98   A   A "O4'" 1 
ATOM   1905  C  "C3'" . A   A  1  97   ? 39.651  160.065 22.223  1.00 48.14  ? 98   A   A "C3'" 1 
ATOM   1906  O  "O3'" . A   A  1  97   ? 40.993  159.828 22.600  1.00 45.38  ? 98   A   A "O3'" 1 
ATOM   1907  C  "C2'" . A   A  1  97   ? 38.825  160.730 23.312  1.00 48.17  ? 98   A   A "C2'" 1 
ATOM   1908  O  "O2'" . A   A  1  97   ? 39.502  161.793 23.945  1.00 48.57  ? 98   A   A "O2'" 1 
ATOM   1909  C  "C1'" . A   A  1  97   ? 37.668  161.294 22.489  1.00 48.23  ? 98   A   A "C1'" 1 
ATOM   1910  N  N9    . A   A  1  97   ? 36.601  160.303 22.368  1.00 47.61  ? 98   A   A N9    1 
ATOM   1911  C  C8    . A   A  1  97   ? 36.237  159.556 21.269  1.00 47.75  ? 98   A   A C8    1 
ATOM   1912  N  N7    . A   A  1  97   ? 35.246  158.730 21.498  1.00 48.39  ? 98   A   A N7    1 
ATOM   1913  C  C5    . A   A  1  97   ? 34.934  158.947 22.835  1.00 48.26  ? 98   A   A C5    1 
ATOM   1914  C  C6    . A   A  1  97   ? 33.975  158.375 23.689  1.00 47.67  ? 98   A   A C6    1 
ATOM   1915  N  N6    . A   A  1  97   ? 33.131  157.415 23.314  1.00 48.32  ? 98   A   A N6    1 
ATOM   1916  N  N1    . A   A  1  97   ? 33.918  158.824 24.960  1.00 48.11  ? 98   A   A N1    1 
ATOM   1917  C  C2    . A   A  1  97   ? 34.776  159.774 25.344  1.00 47.84  ? 98   A   A C2    1 
ATOM   1918  N  N3    . A   A  1  97   ? 35.727  160.384 24.643  1.00 48.12  ? 98   A   A N3    1 
ATOM   1919  C  C4    . A   A  1  97   ? 35.755  159.919 23.379  1.00 48.08  ? 98   A   A C4    1 
ATOM   1920  P  P     . A   A  1  98   ? 41.436  158.347 23.017  1.00 45.83  ? 99   A   A P     1 
ATOM   1921  O  OP1   . A   A  1  98   ? 42.831  158.436 23.520  1.00 46.00  ? 99   A   A OP1   1 
ATOM   1922  O  OP2   . A   A  1  98   ? 41.125  157.440 21.885  1.00 45.75  ? 99   A   A OP2   1 
ATOM   1923  O  "O5'" . A   A  1  98   ? 40.471  157.992 24.241  1.00 45.72  ? 99   A   A "O5'" 1 
ATOM   1924  C  "C5'" . A   A  1  98   ? 40.558  158.733 25.483  1.00 44.32  ? 99   A   A "C5'" 1 
ATOM   1925  C  "C4'" . A   A  1  98   ? 39.503  158.276 26.469  1.00 43.74  ? 99   A   A "C4'" 1 
ATOM   1926  O  "O4'" . A   A  1  98   ? 38.188  158.406 25.864  1.00 45.31  ? 99   A   A "O4'" 1 
ATOM   1927  C  "C3'" . A   A  1  98   ? 39.557  156.826 26.926  1.00 43.66  ? 99   A   A "C3'" 1 
ATOM   1928  O  "O3'" . A   A  1  98   ? 40.514  156.650 27.966  1.00 43.46  ? 99   A   A "O3'" 1 
ATOM   1929  C  "C2'" . A   A  1  98   ? 38.131  156.608 27.420  1.00 44.56  ? 99   A   A "C2'" 1 
ATOM   1930  O  "O2'" . A   A  1  98   ? 37.900  157.172 28.696  1.00 43.48  ? 99   A   A "O2'" 1 
ATOM   1931  C  "C1'" . A   A  1  98   ? 37.331  157.400 26.379  1.00 45.56  ? 99   A   A "C1'" 1 
ATOM   1932  N  N9    . A   A  1  98   ? 36.888  156.551 25.272  1.00 47.50  ? 99   A   A N9    1 
ATOM   1933  C  C8    . A   A  1  98   ? 37.503  156.310 24.066  1.00 48.68  ? 99   A   A C8    1 
ATOM   1934  N  N7    . A   A  1  98   ? 36.867  155.442 23.315  1.00 48.99  ? 99   A   A N7    1 
ATOM   1935  C  C5    . A   A  1  98   ? 35.752  155.104 24.069  1.00 49.04  ? 99   A   A C5    1 
ATOM   1936  C  C6    . A   A  1  98   ? 34.680  154.220 23.836  1.00 49.88  ? 99   A   A C6    1 
ATOM   1937  N  N6    . A   A  1  98   ? 34.548  153.482 22.732  1.00 50.36  ? 99   A   A N6    1 
ATOM   1938  N  N1    . A   A  1  98   ? 33.734  154.116 24.795  1.00 50.90  ? 99   A   A N1    1 
ATOM   1939  C  C2    . A   A  1  98   ? 33.864  154.852 25.904  1.00 50.87  ? 99   A   A C2    1 
ATOM   1940  N  N3    . A   A  1  98   ? 34.823  155.712 26.236  1.00 50.09  ? 99   A   A N3    1 
ATOM   1941  C  C4    . A   A  1  98   ? 35.746  155.790 25.267  1.00 48.39  ? 99   A   A C4    1 
ATOM   1942  P  P     . C   A  1  99   ? 41.725  155.608 27.774  1.00 43.88  ? 100  C   A P     1 
ATOM   1943  O  OP1   . C   A  1  99   ? 42.480  155.563 29.055  1.00 44.31  ? 100  C   A OP1   1 
ATOM   1944  O  OP2   . C   A  1  99   ? 42.442  155.897 26.509  1.00 43.54  ? 100  C   A OP2   1 
ATOM   1945  O  "O5'" . C   A  1  99   ? 40.993  154.216 27.587  1.00 44.24  ? 100  C   A "O5'" 1 
ATOM   1946  C  "C5'" . C   A  1  99   ? 40.052  153.749 28.554  1.00 43.97  ? 100  C   A "C5'" 1 
ATOM   1947  C  "C4'" . C   A  1  99   ? 39.194  152.691 27.935  1.00 44.14  ? 100  C   A "C4'" 1 
ATOM   1948  O  "O4'" . C   A  1  99   ? 38.378  153.298 26.898  1.00 46.14  ? 100  C   A "O4'" 1 
ATOM   1949  C  "C3'" . C   A  1  99   ? 39.980  151.626 27.191  1.00 43.39  ? 100  C   A "C3'" 1 
ATOM   1950  O  "O3'" . C   A  1  99   ? 40.516  150.645 28.061  1.00 41.92  ? 100  C   A "O3'" 1 
ATOM   1951  C  "C2'" . C   A  1  99   ? 38.937  151.091 26.224  1.00 45.29  ? 100  C   A "C2'" 1 
ATOM   1952  O  "O2'" . C   A  1  99   ? 37.985  150.267 26.868  1.00 44.99  ? 100  C   A "O2'" 1 
ATOM   1953  C  "C1'" . C   A  1  99   ? 38.233  152.386 25.816  1.00 45.90  ? 100  C   A "C1'" 1 
ATOM   1954  N  N1    . C   A  1  99   ? 38.776  153.004 24.587  1.00 46.71  ? 100  C   A N1    1 
ATOM   1955  C  C2    . C   A  1  99   ? 38.270  152.593 23.346  1.00 46.70  ? 100  C   A C2    1 
ATOM   1956  O  O2    . C   A  1  99   ? 37.432  151.682 23.314  1.00 47.26  ? 100  C   A O2    1 
ATOM   1957  N  N3    . C   A  1  99   ? 38.715  153.194 22.220  1.00 46.30  ? 100  C   A N3    1 
ATOM   1958  C  C4    . C   A  1  99   ? 39.636  154.159 22.298  1.00 46.97  ? 100  C   A C4    1 
ATOM   1959  N  N4    . C   A  1  99   ? 40.029  154.740 21.166  1.00 48.17  ? 100  C   A N4    1 
ATOM   1960  C  C5    . C   A  1  99   ? 40.191  154.574 23.544  1.00 47.11  ? 100  C   A C5    1 
ATOM   1961  C  C6    . C   A  1  99   ? 39.739  153.975 24.651  1.00 46.33  ? 100  C   A C6    1 
ATOM   1962  P  P     . C   A  1  100  ? 41.943  149.982 27.725  1.00 42.28  ? 101  C   A P     1 
ATOM   1963  O  OP1   . C   A  1  100  ? 42.362  149.178 28.905  1.00 41.88  ? 101  C   A OP1   1 
ATOM   1964  O  OP2   . C   A  1  100  ? 42.851  151.040 27.207  1.00 42.49  ? 101  C   A OP2   1 
ATOM   1965  O  "O5'" . C   A  1  100  ? 41.616  148.977 26.535  1.00 42.93  ? 101  C   A "O5'" 1 
ATOM   1966  C  "C5'" . C   A  1  100  ? 40.900  147.754 26.775  1.00 44.49  ? 101  C   A "C5'" 1 
ATOM   1967  C  "C4'" . C   A  1  100  ? 40.756  146.969 25.493  1.00 45.76  ? 101  C   A "C4'" 1 
ATOM   1968  O  "O4'" . C   A  1  100  ? 39.956  147.734 24.558  1.00 46.33  ? 101  C   A "O4'" 1 
ATOM   1969  C  "C3'" . C   A  1  100  ? 42.044  146.696 24.732  1.00 46.38  ? 101  C   A "C3'" 1 
ATOM   1970  O  "O3'" . C   A  1  100  ? 42.728  145.568 25.228  1.00 48.34  ? 101  C   A "O3'" 1 
ATOM   1971  C  "C2'" . C   A  1  100  ? 41.551  146.464 23.315  1.00 46.70  ? 101  C   A "C2'" 1 
ATOM   1972  O  "O2'" . C   A  1  100  ? 41.056  145.164 23.079  1.00 48.42  ? 101  C   A "O2'" 1 
ATOM   1973  C  "C1'" . C   A  1  100  ? 40.414  147.482 23.236  1.00 46.32  ? 101  C   A "C1'" 1 
ATOM   1974  N  N1    . C   A  1  100  ? 40.866  148.744 22.629  1.00 45.17  ? 101  C   A N1    1 
ATOM   1975  C  C2    . C   A  1  100  ? 40.991  148.788 21.249  1.00 44.38  ? 101  C   A C2    1 
ATOM   1976  O  O2    . C   A  1  100  ? 40.748  147.758 20.597  1.00 44.60  ? 101  C   A O2    1 
ATOM   1977  N  N3    . C   A  1  100  ? 41.373  149.938 20.652  1.00 44.58  ? 101  C   A N3    1 
ATOM   1978  C  C4    . C   A  1  100  ? 41.628  151.016 21.389  1.00 44.72  ? 101  C   A C4    1 
ATOM   1979  N  N4    . C   A  1  100  ? 41.967  152.138 20.753  1.00 44.40  ? 101  C   A N4    1 
ATOM   1980  C  C5    . C   A  1  100  ? 41.535  150.994 22.812  1.00 44.27  ? 101  C   A C5    1 
ATOM   1981  C  C6    . C   A  1  100  ? 41.153  149.848 23.386  1.00 44.67  ? 101  C   A C6    1 
ATOM   1982  P  P     . A   A  1  101  ? 44.270  145.340 24.844  1.00 50.26  ? 102  A   A P     1 
ATOM   1983  O  OP1   . A   A  1  101  ? 44.722  144.155 25.616  1.00 51.13  ? 102  A   A OP1   1 
ATOM   1984  O  OP2   . A   A  1  101  ? 45.016  146.621 24.954  1.00 50.27  ? 102  A   A OP2   1 
ATOM   1985  O  "O5'" . A   A  1  101  ? 44.238  144.953 23.304  1.00 50.97  ? 102  A   A "O5'" 1 
ATOM   1986  C  "C5'" . A   A  1  101  ? 43.715  143.688 22.862  1.00 51.61  ? 102  A   A "C5'" 1 
ATOM   1987  C  "C4'" . A   A  1  101  ? 43.915  143.551 21.377  1.00 51.80  ? 102  A   A "C4'" 1 
ATOM   1988  O  "O4'" . A   A  1  101  ? 43.099  144.520 20.673  1.00 52.17  ? 102  A   A "O4'" 1 
ATOM   1989  C  "C3'" . A   A  1  101  ? 45.322  143.871 20.927  1.00 51.71  ? 102  A   A "C3'" 1 
ATOM   1990  O  "O3'" . A   A  1  101  ? 46.168  142.761 21.120  1.00 53.81  ? 102  A   A "O3'" 1 
ATOM   1991  C  "C2'" . A   A  1  101  ? 45.124  144.229 19.468  1.00 52.08  ? 102  A   A "C2'" 1 
ATOM   1992  O  "O2'" . A   A  1  101  ? 44.975  143.085 18.657  1.00 51.12  ? 102  A   A "O2'" 1 
ATOM   1993  C  "C1'" . A   A  1  101  ? 43.802  144.994 19.539  1.00 52.66  ? 102  A   A "C1'" 1 
ATOM   1994  N  N9    . A   A  1  101  ? 43.988  146.434 19.694  1.00 53.76  ? 102  A   A N9    1 
ATOM   1995  C  C8    . A   A  1  101  ? 43.946  147.177 20.847  1.00 53.86  ? 102  A   A C8    1 
ATOM   1996  N  N7    . A   A  1  101  ? 44.146  148.459 20.657  1.00 54.53  ? 102  A   A N7    1 
ATOM   1997  C  C5    . A   A  1  101  ? 44.339  148.565 19.288  1.00 54.59  ? 102  A   A C5    1 
ATOM   1998  C  C6    . A   A  1  101  ? 44.605  149.660 18.458  1.00 55.27  ? 102  A   A C6    1 
ATOM   1999  N  N6    . A   A  1  101  ? 44.738  150.910 18.910  1.00 55.76  ? 102  A   A N6    1 
ATOM   2000  N  N1    . A   A  1  101  ? 44.735  149.427 17.134  1.00 55.14  ? 102  A   A N1    1 
ATOM   2001  C  C2    . A   A  1  101  ? 44.609  148.172 16.691  1.00 54.60  ? 102  A   A C2    1 
ATOM   2002  N  N3    . A   A  1  101  ? 44.366  147.060 17.373  1.00 53.57  ? 102  A   A N3    1 
ATOM   2003  C  C4    . A   A  1  101  ? 44.241  147.327 18.682  1.00 54.16  ? 102  A   A C4    1 
ATOM   2004  P  P     . U   A  1  102  ? 47.718  143.003 21.423  1.00 55.57  ? 103  U   A P     1 
ATOM   2005  O  OP1   . U   A  1  102  ? 48.310  141.699 21.809  1.00 56.40  ? 103  U   A OP1   1 
ATOM   2006  O  OP2   . U   A  1  102  ? 47.818  144.163 22.348  1.00 54.67  ? 103  U   A OP2   1 
ATOM   2007  O  "O5'" . U   A  1  102  ? 48.300  143.372 19.988  1.00 55.13  ? 103  U   A "O5'" 1 
ATOM   2008  C  "C5'" . U   A  1  102  ? 48.199  142.422 18.916  1.00 53.67  ? 103  U   A "C5'" 1 
ATOM   2009  C  "C4'" . U   A  1  102  ? 48.501  143.073 17.597  1.00 53.53  ? 103  U   A "C4'" 1 
ATOM   2010  O  "O4'" . U   A  1  102  ? 47.538  144.122 17.331  1.00 52.87  ? 103  U   A "O4'" 1 
ATOM   2011  C  "C3'" . U   A  1  102  ? 49.836  143.780 17.512  1.00 54.04  ? 103  U   A "C3'" 1 
ATOM   2012  O  "O3'" . U   A  1  102  ? 50.908  142.889 17.263  1.00 55.00  ? 103  U   A "O3'" 1 
ATOM   2013  C  "C2'" . U   A  1  102  ? 49.615  144.737 16.356  1.00 54.79  ? 103  U   A "C2'" 1 
ATOM   2014  O  "O2'" . U   A  1  102  ? 49.713  144.083 15.108  1.00 57.01  ? 103  U   A "O2'" 1 
ATOM   2015  C  "C1'" . U   A  1  102  ? 48.169  145.168 16.606  1.00 54.29  ? 103  U   A "C1'" 1 
ATOM   2016  N  N1    . U   A  1  102  ? 48.085  146.404 17.399  1.00 55.34  ? 103  U   A N1    1 
ATOM   2017  C  C2    . U   A  1  102  ? 47.990  147.610 16.715  1.00 55.37  ? 103  U   A C2    1 
ATOM   2018  O  O2    . U   A  1  102  ? 47.981  147.689 15.498  1.00 56.29  ? 103  U   A O2    1 
ATOM   2019  N  N3    . U   A  1  102  ? 47.913  148.721 17.515  1.00 55.59  ? 103  U   A N3    1 
ATOM   2020  C  C4    . U   A  1  102  ? 47.934  148.756 18.893  1.00 55.54  ? 103  U   A C4    1 
ATOM   2021  O  O4    . U   A  1  102  ? 47.924  149.841 19.471  1.00 56.56  ? 103  U   A O4    1 
ATOM   2022  C  C5    . U   A  1  102  ? 48.036  147.478 19.523  1.00 55.64  ? 103  U   A C5    1 
ATOM   2023  C  C6    . U   A  1  102  ? 48.105  146.374 18.776  1.00 55.52  ? 103  U   A C6    1 
ATOM   2024  P  P     . G   A  1  103  ? 52.340  143.187 17.924  1.00 58.21  ? 104  G   A P     1 
ATOM   2025  O  OP1   . G   A  1  103  ? 53.246  142.039 17.632  1.00 56.35  ? 104  G   A OP1   1 
ATOM   2026  O  OP2   . G   A  1  103  ? 52.096  143.592 19.332  1.00 56.96  ? 104  G   A OP2   1 
ATOM   2027  O  "O5'" . G   A  1  103  ? 52.872  144.457 17.115  1.00 58.23  ? 104  G   A "O5'" 1 
ATOM   2028  C  "C5'" . G   A  1  103  ? 53.280  144.327 15.741  1.00 57.54  ? 104  G   A "C5'" 1 
ATOM   2029  C  "C4'" . G   A  1  103  ? 53.352  145.675 15.056  1.00 57.65  ? 104  G   A "C4'" 1 
ATOM   2030  O  "O4'" . G   A  1  103  ? 52.089  146.380 15.195  1.00 58.28  ? 104  G   A "O4'" 1 
ATOM   2031  C  "C3'" . G   A  1  103  ? 54.350  146.689 15.582  1.00 57.54  ? 104  G   A "C3'" 1 
ATOM   2032  O  "O3'" . G   A  1  103  ? 55.690  146.435 15.179  1.00 56.94  ? 104  G   A "O3'" 1 
ATOM   2033  C  "C2'" . G   A  1  103  ? 53.830  147.974 14.952  1.00 57.84  ? 104  G   A "C2'" 1 
ATOM   2034  O  "O2'" . G   A  1  103  ? 54.153  148.090 13.578  1.00 57.77  ? 104  G   A "O2'" 1 
ATOM   2035  C  "C1'" . G   A  1  103  ? 52.322  147.785 15.111  1.00 58.14  ? 104  G   A "C1'" 1 
ATOM   2036  N  N9    . G   A  1  103  ? 51.856  148.425 16.338  1.00 58.59  ? 104  G   A N9    1 
ATOM   2037  C  C8    . G   A  1  103  ? 51.503  147.820 17.518  1.00 58.32  ? 104  G   A C8    1 
ATOM   2038  N  N7    . G   A  1  103  ? 51.162  148.671 18.447  1.00 58.68  ? 104  G   A N7    1 
ATOM   2039  C  C5    . G   A  1  103  ? 51.291  149.913 17.843  1.00 58.36  ? 104  G   A C5    1 
ATOM   2040  C  C6    . G   A  1  103  ? 51.067  151.213 18.363  1.00 58.48  ? 104  G   A C6    1 
ATOM   2041  O  O6    . G   A  1  103  ? 50.703  151.536 19.498  1.00 58.22  ? 104  G   A O6    1 
ATOM   2042  N  N1    . G   A  1  103  ? 51.314  152.192 17.415  1.00 58.20  ? 104  G   A N1    1 
ATOM   2043  C  C2    . G   A  1  103  ? 51.729  151.956 16.129  1.00 59.76  ? 104  G   A C2    1 
ATOM   2044  N  N2    . G   A  1  103  ? 51.908  153.038 15.359  1.00 61.38  ? 104  G   A N2    1 
ATOM   2045  N  N3    . G   A  1  103  ? 51.949  150.748 15.630  1.00 59.49  ? 104  G   A N3    1 
ATOM   2046  C  C4    . G   A  1  103  ? 51.710  149.780 16.539  1.00 58.83  ? 104  G   A C4    1 
ATOM   2047  P  P     . G   A  1  104  ? 56.905  146.880 16.143  1.00 57.81  ? 105  G   A P     1 
ATOM   2048  O  OP1   . G   A  1  104  ? 58.142  146.352 15.505  1.00 57.81  ? 105  G   A OP1   1 
ATOM   2049  O  OP2   . G   A  1  104  ? 56.585  146.513 17.550  1.00 57.39  ? 105  G   A OP2   1 
ATOM   2050  O  "O5'" . G   A  1  104  ? 56.914  148.476 16.080  1.00 55.59  ? 105  G   A "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  104  ? 57.341  149.150 14.890  1.00 53.02  ? 105  G   A "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  104  ? 57.085  150.639 14.975  1.00 52.19  ? 105  G   A "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  104  ? 55.692  150.906 15.301  1.00 52.55  ? 105  G   A "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  104  ? 57.810  151.456 16.025  1.00 51.17  ? 105  G   A "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  104  ? 59.179  151.688 15.721  1.00 49.99  ? 105  G   A "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  104  ? 57.008  152.755 15.973  1.00 51.84  ? 105  G   A "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  104  ? 57.286  153.589 14.860  1.00 51.75  ? 105  G   A "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  104  ? 55.584  152.216 15.843  1.00 50.92  ? 105  G   A "C1'" 1 
ATOM   2059  N  N9    . G   A  1  104  ? 55.000  152.127 17.172  1.00 49.98  ? 105  G   A N9    1 
ATOM   2060  C  C8    . G   A  1  104  ? 54.680  150.992 17.866  1.00 49.80  ? 105  G   A C8    1 
ATOM   2061  N  N7    . G   A  1  104  ? 54.211  151.237 19.060  1.00 49.81  ? 105  G   A N7    1 
ATOM   2062  C  C5    . G   A  1  104  ? 54.213  152.620 19.154  1.00 49.17  ? 105  G   A C5    1 
ATOM   2063  C  C6    . G   A  1  104  ? 53.816  153.463 20.216  1.00 49.39  ? 105  G   A C6    1 
ATOM   2064  O  O6    . G   A  1  104  ? 53.371  153.149 21.317  1.00 50.05  ? 105  G   A O6    1 
ATOM   2065  N  N1    . G   A  1  104  ? 53.984  154.804 19.897  1.00 50.07  ? 105  G   A N1    1 
ATOM   2066  C  C2    . G   A  1  104  ? 54.472  155.276 18.708  1.00 49.65  ? 105  G   A C2    1 
ATOM   2067  N  N2    . G   A  1  104  ? 54.565  156.609 18.597  1.00 48.46  ? 105  G   A N2    1 
ATOM   2068  N  N3    . G   A  1  104  ? 54.845  154.496 17.703  1.00 49.64  ? 105  G   A N3    1 
ATOM   2069  C  C4    . G   A  1  104  ? 54.688  153.187 17.996  1.00 49.43  ? 105  G   A C4    1 
ATOM   2070  P  P     . A   A  1  105  ? 60.193  152.118 16.900  1.00 49.53  ? 106  A   A P     1 
ATOM   2071  O  OP1   . A   A  1  105  ? 61.518  152.374 16.294  1.00 48.52  ? 106  A   A OP1   1 
ATOM   2072  O  OP2   . A   A  1  105  ? 60.069  151.147 18.031  1.00 49.46  ? 106  A   A OP2   1 
ATOM   2073  O  "O5'" . A   A  1  105  ? 59.635  153.529 17.371  1.00 45.11  ? 106  A   A "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  105  ? 59.705  154.654 16.490  1.00 43.16  ? 106  A   A "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  105  ? 59.401  155.926 17.238  1.00 41.93  ? 106  A   A "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  105  ? 58.020  155.914 17.679  1.00 42.05  ? 106  A   A "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  105  ? 60.201  156.190 18.506  1.00 40.77  ? 106  A   A "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  105  ? 61.485  156.744 18.224  1.00 40.33  ? 106  A   A "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  105  ? 59.297  157.171 19.239  1.00 40.34  ? 106  A   A "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  105  ? 59.382  158.479 18.739  1.00 38.08  ? 106  A   A "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  105  ? 57.911  156.615 18.905  1.00 42.06  ? 106  A   A "C1'" 1 
ATOM   2082  N  N9    . A   A  1  105  ? 57.456  155.680 19.926  1.00 42.80  ? 106  A   A N9    1 
ATOM   2083  C  C8    . A   A  1  105  ? 57.505  154.311 19.896  1.00 43.73  ? 106  A   A C8    1 
ATOM   2084  N  N7    . A   A  1  105  ? 57.038  153.742 20.980  1.00 44.84  ? 106  A   A N7    1 
ATOM   2085  C  C5    . A   A  1  105  ? 56.656  154.811 21.779  1.00 44.15  ? 106  A   A C5    1 
ATOM   2086  C  C6    . A   A  1  105  ? 56.093  154.878 23.067  1.00 44.09  ? 106  A   A C6    1 
ATOM   2087  N  N6    . A   A  1  105  ? 55.800  153.808 23.805  1.00 44.00  ? 106  A   A N6    1 
ATOM   2088  N  N1    . A   A  1  105  ? 55.838  156.103 23.577  1.00 45.29  ? 106  A   A N1    1 
ATOM   2089  C  C2    . A   A  1  105  ? 56.128  157.180 22.833  1.00 44.66  ? 106  A   A C2    1 
ATOM   2090  N  N3    . A   A  1  105  ? 56.653  157.243 21.611  1.00 44.32  ? 106  A   A N3    1 
ATOM   2091  C  C4    . A   A  1  105  ? 56.900  156.010 21.138  1.00 43.42  ? 106  A   A C4    1 
ATOM   2092  P  P     . U   A  1  106  ? 62.740  156.398 19.177  1.00 39.96  ? 107  U   A P     1 
ATOM   2093  O  OP1   . U   A  1  106  ? 63.930  157.098 18.630  1.00 40.69  ? 107  U   A OP1   1 
ATOM   2094  O  OP2   . U   A  1  106  ? 62.788  154.937 19.372  1.00 40.63  ? 107  U   A OP2   1 
ATOM   2095  O  "O5'" . U   A  1  106  ? 62.374  157.094 20.563  1.00 39.46  ? 107  U   A "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  106  ? 62.038  158.492 20.612  1.00 39.76  ? 107  U   A "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  106  ? 61.424  158.854 21.948  1.00 40.27  ? 107  U   A "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  106  ? 60.081  158.321 22.089  1.00 41.15  ? 107  U   A "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  106  ? 62.127  158.375 23.204  1.00 39.21  ? 107  U   A "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  106  ? 63.242  159.179 23.514  1.00 38.44  ? 107  U   A "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  106  ? 61.041  158.587 24.241  1.00 40.49  ? 107  U   A "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  106  ? 60.921  159.963 24.557  1.00 39.09  ? 107  U   A "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  106  ? 59.808  158.099 23.471  1.00 40.97  ? 107  U   A "C1'" 1 
ATOM   2104  N  N1    . U   A  1  106  ? 59.581  156.658 23.673  1.00 42.00  ? 107  U   A N1    1 
ATOM   2105  C  C2    . U   A  1  106  ? 58.796  156.251 24.746  1.00 41.88  ? 107  U   A C2    1 
ATOM   2106  O  O2    . U   A  1  106  ? 58.262  157.028 25.517  1.00 42.42  ? 107  U   A O2    1 
ATOM   2107  N  N3    . U   A  1  106  ? 58.665  154.894 24.882  1.00 41.83  ? 107  U   A N3    1 
ATOM   2108  C  C4    . U   A  1  106  ? 59.220  153.924 24.076  1.00 42.09  ? 107  U   A C4    1 
ATOM   2109  O  O4    . U   A  1  106  ? 59.087  152.739 24.377  1.00 44.03  ? 107  U   A O4    1 
ATOM   2110  C  C5    . U   A  1  106  ? 59.996  154.426 22.984  1.00 42.66  ? 107  U   A C5    1 
ATOM   2111  C  C6    . U   A  1  106  ? 60.146  155.737 22.825  1.00 41.49  ? 107  U   A C6    1 
ATOM   2112  P  P     . U   A  1  107  ? 64.631  158.489 23.899  1.00 39.13  ? 108  U   A P     1 
ATOM   2113  O  OP1   . U   A  1  107  ? 65.544  159.597 24.259  1.00 37.88  ? 108  U   A OP1   1 
ATOM   2114  O  OP2   . U   A  1  107  ? 64.999  157.551 22.814  1.00 36.97  ? 108  U   A OP2   1 
ATOM   2115  O  "O5'" . U   A  1  107  ? 64.308  157.643 25.213  1.00 40.72  ? 108  U   A "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  107  ? 63.708  158.260 26.370  1.00 42.72  ? 108  U   A "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  107  ? 63.173  157.207 27.308  1.00 43.97  ? 108  U   A "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  107  ? 62.116  156.455 26.650  1.00 45.49  ? 108  U   A "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  107  ? 64.162  156.141 27.753  1.00 45.64  ? 108  U   A "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  107  ? 64.964  156.598 28.837  1.00 45.21  ? 108  U   A "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  107  ? 63.228  155.020 28.180  1.00 45.58  ? 108  U   A "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  107  ? 62.654  155.298 29.443  1.00 44.96  ? 108  U   A "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  107  ? 62.138  155.109 27.104  1.00 46.29  ? 108  U   A "C1'" 1 
ATOM   2124  N  N1    . U   A  1  107  ? 62.368  154.213 25.954  1.00 48.28  ? 108  U   A N1    1 
ATOM   2125  C  C2    . U   A  1  107  ? 61.863  152.924 26.033  1.00 49.11  ? 108  U   A C2    1 
ATOM   2126  O  O2    . U   A  1  107  ? 61.263  152.509 27.006  1.00 50.81  ? 108  U   A O2    1 
ATOM   2127  N  N3    . U   A  1  107  ? 62.096  152.134 24.931  1.00 50.58  ? 108  U   A N3    1 
ATOM   2128  C  C4    . U   A  1  107  ? 62.782  152.481 23.784  1.00 50.54  ? 108  U   A C4    1 
ATOM   2129  O  O4    . U   A  1  107  ? 62.924  151.645 22.881  1.00 50.69  ? 108  U   A O4    1 
ATOM   2130  C  C5    . U   A  1  107  ? 63.286  153.825 23.778  1.00 49.80  ? 108  U   A C5    1 
ATOM   2131  C  C6    . U   A  1  107  ? 63.065  154.625 24.832  1.00 48.69  ? 108  U   A C6    1 
ATOM   2132  P  P     . U   A  1  108  ? 66.526  156.192 28.920  1.00 43.48  ? 109  U   A P     1 
ATOM   2133  O  OP1   . U   A  1  108  ? 67.165  156.488 27.604  1.00 43.62  ? 109  U   A OP1   1 
ATOM   2134  O  OP2   . U   A  1  108  ? 66.632  154.829 29.489  1.00 43.32  ? 109  U   A OP2   1 
ATOM   2135  O  "O5'" . U   A  1  108  ? 67.098  157.202 30.012  1.00 40.62  ? 109  U   A "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  108  ? 67.330  158.591 29.705  1.00 40.07  ? 109  U   A "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  108  ? 67.591  159.356 30.977  1.00 38.57  ? 109  U   A "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  108  ? 66.350  159.564 31.685  1.00 39.48  ? 109  U   A "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  108  ? 68.504  158.639 31.955  1.00 38.26  ? 109  U   A "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  108  ? 69.857  158.962 31.691  1.00 36.91  ? 109  U   A "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  108  ? 68.044  159.175 33.296  1.00 39.05  ? 109  U   A "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  108  ? 68.582  160.458 33.540  1.00 41.76  ? 109  U   A "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  108  ? 66.536  159.298 33.063  1.00 39.75  ? 109  U   A "C1'" 1 
ATOM   2144  N  N1    . U   A  1  108  ? 65.747  158.100 33.410  1.00 40.25  ? 109  U   A N1    1 
ATOM   2145  C  C2    . U   A  1  108  ? 65.707  157.706 34.735  1.00 40.50  ? 109  U   A C2    1 
ATOM   2146  O  O2    . U   A  1  108  ? 66.353  158.264 35.612  1.00 41.71  ? 109  U   A O2    1 
ATOM   2147  N  N3    . U   A  1  108  ? 64.888  156.627 34.993  1.00 39.49  ? 109  U   A N3    1 
ATOM   2148  C  C4    . U   A  1  108  ? 64.140  155.907 34.083  1.00 38.65  ? 109  U   A C4    1 
ATOM   2149  O  O4    . U   A  1  108  ? 63.392  155.015 34.482  1.00 38.41  ? 109  U   A O4    1 
ATOM   2150  C  C5    . U   A  1  108  ? 64.267  156.346 32.732  1.00 39.85  ? 109  U   A C5    1 
ATOM   2151  C  C6    . U   A  1  108  ? 65.043  157.399 32.446  1.00 40.16  ? 109  U   A C6    1 
ATOM   2152  P  P     . C   A  1  109  ? 70.941  157.794 31.576  1.00 36.18  ? 110  C   A P     1 
ATOM   2153  O  OP1   . C   A  1  109  ? 72.207  158.380 31.091  1.00 37.36  ? 110  C   A OP1   1 
ATOM   2154  O  OP2   . C   A  1  109  ? 70.323  156.671 30.843  1.00 36.70  ? 110  C   A OP2   1 
ATOM   2155  O  "O5'" . C   A  1  109  ? 71.206  157.398 33.085  1.00 34.36  ? 110  C   A "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  109  ? 71.873  158.318 33.953  1.00 33.59  ? 110  C   A "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  109  ? 71.795  157.829 35.357  1.00 31.70  ? 110  C   A "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  109  ? 70.407  157.783 35.753  1.00 34.37  ? 110  C   A "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  109  ? 72.284  156.410 35.567  1.00 30.77  ? 110  C   A "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  109  ? 73.695  156.398 35.703  1.00 27.91  ? 110  C   A "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  109  ? 71.571  156.045 36.854  1.00 33.02  ? 110  C   A "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  109  ? 72.138  156.750 37.939  1.00 33.06  ? 110  C   A "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  109  ? 70.198  156.669 36.604  1.00 34.54  ? 110  C   A "C1'" 1 
ATOM   2164  N  N1    . C   A  1  109  ? 69.209  155.757 35.977  1.00 35.99  ? 110  C   A N1    1 
ATOM   2165  C  C2    . C   A  1  109  ? 68.560  154.835 36.793  1.00 36.31  ? 110  C   A C2    1 
ATOM   2166  O  O2    . C   A  1  109  ? 68.860  154.787 37.991  1.00 35.86  ? 110  C   A O2    1 
ATOM   2167  N  N3    . C   A  1  109  ? 67.625  154.016 36.263  1.00 37.15  ? 110  C   A N3    1 
ATOM   2168  C  C4    . C   A  1  109  ? 67.328  154.092 34.965  1.00 38.25  ? 110  C   A C4    1 
ATOM   2169  N  N4    . C   A  1  109  ? 66.380  153.278 34.500  1.00 38.25  ? 110  C   A N4    1 
ATOM   2170  C  C5    . C   A  1  109  ? 67.990  155.011 34.092  1.00 37.16  ? 110  C   A C5    1 
ATOM   2171  C  C6    . C   A  1  109  ? 68.919  155.814 34.636  1.00 36.48  ? 110  C   A C6    1 
ATOM   2172  P  P     . C   A  1  110  ? 74.522  155.091 35.290  1.00 29.32  ? 111  C   A P     1 
ATOM   2173  O  OP1   . C   A  1  110  ? 75.973  155.387 35.453  1.00 27.03  ? 111  C   A OP1   1 
ATOM   2174  O  OP2   . C   A  1  110  ? 74.005  154.619 33.977  1.00 29.59  ? 111  C   A OP2   1 
ATOM   2175  O  "O5'" . C   A  1  110  ? 74.127  154.037 36.411  1.00 29.10  ? 111  C   A "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  110  ? 74.603  154.198 37.754  1.00 28.66  ? 111  C   A "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  110  ? 74.006  153.145 38.645  1.00 29.74  ? 111  C   A "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  110  ? 72.560  153.266 38.614  1.00 30.47  ? 111  C   A "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  110  ? 74.268  151.696 38.261  1.00 27.69  ? 111  C   A "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  110  ? 75.537  151.252 38.741  1.00 25.18  ? 111  C   A "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  110  ? 73.121  150.976 38.956  1.00 28.61  ? 111  C   A "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  110  ? 73.362  150.765 40.318  1.00 27.87  ? 111  C   A "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  110  ? 71.981  151.988 38.818  1.00 31.34  ? 111  C   A "C1'" 1 
ATOM   2184  N  N1    . C   A  1  110  ? 71.067  151.685 37.701  1.00 34.89  ? 111  C   A N1    1 
ATOM   2185  C  C2    . C   A  1  110  ? 70.070  150.712 37.887  1.00 35.52  ? 111  C   A C2    1 
ATOM   2186  O  O2    . C   A  1  110  ? 69.951  150.178 39.004  1.00 34.95  ? 111  C   A O2    1 
ATOM   2187  N  N3    . C   A  1  110  ? 69.256  150.393 36.843  1.00 36.95  ? 111  C   A N3    1 
ATOM   2188  C  C4    . C   A  1  110  ? 69.398  151.019 35.668  1.00 35.50  ? 111  C   A C4    1 
ATOM   2189  N  N4    . C   A  1  110  ? 68.590  150.665 34.663  1.00 35.54  ? 111  C   A N4    1 
ATOM   2190  C  C5    . C   A  1  110  ? 70.379  152.030 35.467  1.00 36.19  ? 111  C   A C5    1 
ATOM   2191  C  C6    . C   A  1  110  ? 71.187  152.325 36.497  1.00 35.08  ? 111  C   A C6    1 
ATOM   2192  P  P     . G   A  1  111  ? 76.243  149.962 38.087  1.00 23.43  ? 112  G   A P     1 
ATOM   2193  O  OP1   . G   A  1  111  ? 77.216  149.404 39.065  1.00 24.02  ? 112  G   A OP1   1 
ATOM   2194  O  OP2   . G   A  1  111  ? 76.711  150.345 36.751  1.00 22.71  ? 112  G   A OP2   1 
ATOM   2195  O  "O5'" . G   A  1  111  ? 75.057  148.911 37.958  1.00 25.96  ? 112  G   A "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  111  ? 74.598  148.174 39.108  1.00 26.27  ? 112  G   A "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  111  ? 73.468  147.250 38.723  1.00 28.97  ? 112  G   A "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  111  ? 72.380  148.026 38.145  1.00 30.55  ? 112  G   A "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  111  ? 73.796  146.205 37.665  1.00 28.23  ? 112  G   A "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  111  ? 74.385  145.067 38.260  1.00 27.12  ? 112  G   A "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  111  ? 72.420  145.881 37.098  1.00 30.54  ? 112  G   A "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  111  ? 71.644  145.020 37.908  1.00 29.70  ? 112  G   A "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  111  ? 71.744  147.255 37.136  1.00 32.48  ? 112  G   A "C1'" 1 
ATOM   2204  N  N9    . G   A  1  111  ? 71.819  147.990 35.877  1.00 34.68  ? 112  G   A N9    1 
ATOM   2205  C  C8    . G   A  1  111  ? 72.774  148.904 35.507  1.00 34.48  ? 112  G   A C8    1 
ATOM   2206  N  N7    . G   A  1  111  ? 72.526  149.464 34.356  1.00 35.68  ? 112  G   A N7    1 
ATOM   2207  C  C5    . G   A  1  111  ? 71.345  148.874 33.932  1.00 35.54  ? 112  G   A C5    1 
ATOM   2208  C  C6    . G   A  1  111  ? 70.569  149.103 32.771  1.00 35.85  ? 112  G   A C6    1 
ATOM   2209  O  O6    . G   A  1  111  ? 70.756  149.913 31.867  1.00 35.65  ? 112  G   A O6    1 
ATOM   2210  N  N1    . G   A  1  111  ? 69.459  148.272 32.729  1.00 36.07  ? 112  G   A N1    1 
ATOM   2211  C  C2    . G   A  1  111  ? 69.122  147.344 33.683  1.00 34.93  ? 112  G   A C2    1 
ATOM   2212  N  N2    . G   A  1  111  ? 68.014  146.624 33.442  1.00 34.98  ? 112  G   A N2    1 
ATOM   2213  N  N3    . G   A  1  111  ? 69.822  147.138 34.783  1.00 35.11  ? 112  G   A N3    1 
ATOM   2214  C  C4    . G   A  1  111  ? 70.913  147.935 34.843  1.00 35.04  ? 112  G   A C4    1 
ATOM   2215  P  P     . A   A  1  112  ? 75.762  144.495 37.695  1.00 27.95  ? 113  A   A P     1 
ATOM   2216  O  OP1   . A   A  1  112  ? 76.285  143.605 38.756  1.00 27.53  ? 113  A   A OP1   1 
ATOM   2217  O  OP2   . A   A  1  112  ? 76.579  145.636 37.232  1.00 28.48  ? 113  A   A OP2   1 
ATOM   2218  O  "O5'" . A   A  1  112  ? 75.360  143.601 36.433  1.00 29.86  ? 113  A   A "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  112  ? 75.031  142.203 36.596  1.00 31.61  ? 113  A   A "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  112  ? 75.570  141.366 35.447  1.00 31.94  ? 113  A   A "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  112  ? 74.685  141.403 34.296  1.00 32.70  ? 113  A   A "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  112  ? 76.899  141.780 34.854  1.00 31.73  ? 113  A   A "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  112  ? 77.972  141.427 35.704  1.00 30.27  ? 113  A   A "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  112  ? 76.910  141.016 33.530  1.00 31.82  ? 113  A   A "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  112  ? 77.348  139.681 33.677  1.00 29.69  ? 113  A   A "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  112  ? 75.420  141.027 33.142  1.00 32.66  ? 113  A   A "C1'" 1 
ATOM   2227  N  N9    . A   A  1  112  ? 75.040  141.911 32.027  1.00 34.65  ? 113  A   A N9    1 
ATOM   2228  C  C8    . A   A  1  112  ? 75.697  143.030 31.586  1.00 35.55  ? 113  A   A C8    1 
ATOM   2229  N  N7    . A   A  1  112  ? 75.137  143.601 30.544  1.00 36.68  ? 113  A   A N7    1 
ATOM   2230  C  C5    . A   A  1  112  ? 74.028  142.812 30.282  1.00 36.24  ? 113  A   A C5    1 
ATOM   2231  C  C6    . A   A  1  112  ? 73.023  142.880 29.291  1.00 36.49  ? 113  A   A C6    1 
ATOM   2232  N  N6    . A   A  1  112  ? 72.988  143.807 28.327  1.00 36.42  ? 113  A   A N6    1 
ATOM   2233  N  N1    . A   A  1  112  ? 72.050  141.944 29.319  1.00 37.31  ? 113  A   A N1    1 
ATOM   2234  C  C2    . A   A  1  112  ? 72.096  141.006 30.263  1.00 37.12  ? 113  A   A C2    1 
ATOM   2235  N  N3    . A   A  1  112  ? 72.990  140.828 31.235  1.00 37.86  ? 113  A   A N3    1 
ATOM   2236  C  C4    . A   A  1  112  ? 73.946  141.773 31.191  1.00 35.96  ? 113  A   A C4    1 
ATOM   2237  P  P     . A   A  1  113  ? 79.443  141.988 35.398  1.00 31.10  ? 114  A   A P     1 
ATOM   2238  O  OP1   . A   A  1  113  ? 80.110  141.030 34.471  1.00 29.43  ? 114  A   A OP1   1 
ATOM   2239  O  OP2   . A   A  1  113  ? 80.090  142.324 36.695  1.00 31.54  ? 114  A   A OP2   1 
ATOM   2240  O  "O5'" . A   A  1  113  ? 79.170  143.337 34.599  1.00 30.51  ? 114  A   A "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  113  ? 78.853  144.563 35.290  1.00 30.42  ? 114  A   A "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  113  ? 78.765  145.693 34.297  1.00 30.65  ? 114  A   A "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  113  ? 77.608  145.473 33.435  1.00 30.31  ? 114  A   A "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  113  ? 78.586  147.088 34.891  1.00 31.38  ? 114  A   A "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  113  ? 79.255  148.054 34.076  1.00 31.73  ? 114  A   A "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  113  ? 77.077  147.299 34.749  1.00 31.37  ? 114  A   A "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  113  ? 76.661  148.657 34.780  1.00 32.72  ? 114  A   A "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  113  ? 76.843  146.658 33.384  1.00 30.19  ? 114  A   A "C1'" 1 
ATOM   2249  N  N9    . A   A  1  113  ? 75.452  146.333 33.068  1.00 30.85  ? 114  A   A N9    1 
ATOM   2250  C  C8    . A   A  1  113  ? 74.652  145.389 33.650  1.00 31.96  ? 114  A   A C8    1 
ATOM   2251  N  N7    . A   A  1  113  ? 73.427  145.368 33.174  1.00 35.03  ? 114  A   A N7    1 
ATOM   2252  C  C5    . A   A  1  113  ? 73.420  146.363 32.210  1.00 33.65  ? 114  A   A C5    1 
ATOM   2253  C  C6    . A   A  1  113  ? 72.398  146.862 31.360  1.00 34.29  ? 114  A   A C6    1 
ATOM   2254  N  N6    . A   A  1  113  ? 71.144  146.409 31.356  1.00 34.70  ? 114  A   A N6    1 
ATOM   2255  N  N1    . A   A  1  113  ? 72.715  147.859 30.515  1.00 34.91  ? 114  A   A N1    1 
ATOM   2256  C  C2    . A   A  1  113  ? 73.970  148.319 30.527  1.00 36.63  ? 114  A   A C2    1 
ATOM   2257  N  N3    . A   A  1  113  ? 75.016  147.941 31.281  1.00 35.49  ? 114  A   A N3    1 
ATOM   2258  C  C4    . A   A  1  113  ? 74.667  146.951 32.117  1.00 32.92  ? 114  A   A C4    1 
ATOM   2259  P  P     . U   A  1  114  ? 80.868  148.139 34.049  1.00 32.06  ? 115  U   A P     1 
ATOM   2260  O  OP1   . U   A  1  114  ? 81.438  146.930 34.682  1.00 30.09  ? 115  U   A OP1   1 
ATOM   2261  O  OP2   . U   A  1  114  ? 81.295  149.482 34.522  1.00 30.58  ? 115  U   A OP2   1 
ATOM   2262  O  "O5'" . U   A  1  114  ? 81.200  148.047 32.496  1.00 33.55  ? 115  U   A "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  114  ? 82.526  148.286 31.993  1.00 36.19  ? 115  U   A "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  114  ? 82.531  148.165 30.482  1.00 37.91  ? 115  U   A "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  114  ? 82.385  146.770 30.098  1.00 37.47  ? 115  U   A "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  114  ? 81.398  148.909 29.786  1.00 40.05  ? 115  U   A "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  114  ? 81.791  149.295 28.470  1.00 43.10  ? 115  U   A "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  114  ? 80.329  147.829 29.681  1.00 39.87  ? 115  U   A "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  114  ? 79.374  148.096 28.668  1.00 39.51  ? 115  U   A "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  114  ? 81.184  146.596 29.368  1.00 40.81  ? 115  U   A "C1'" 1 
ATOM   2271  N  N1    . U   A  1  114  ? 80.566  145.321 29.780  1.00 43.14  ? 115  U   A N1    1 
ATOM   2272  C  C2    . U   A  1  114  ? 79.683  144.706 28.903  1.00 44.56  ? 115  U   A C2    1 
ATOM   2273  O  O2    . U   A  1  114  ? 79.470  145.115 27.768  1.00 45.28  ? 115  U   A O2    1 
ATOM   2274  N  N3    . U   A  1  114  ? 79.067  143.583 29.400  1.00 45.59  ? 115  U   A N3    1 
ATOM   2275  C  C4    . U   A  1  114  ? 79.249  143.005 30.640  1.00 44.52  ? 115  U   A C4    1 
ATOM   2276  O  O4    . U   A  1  114  ? 78.450  142.140 31.027  1.00 44.29  ? 115  U   A O4    1 
ATOM   2277  C  C5    . U   A  1  114  ? 80.227  143.652 31.446  1.00 43.81  ? 115  U   A C5    1 
ATOM   2278  C  C6    . U   A  1  114  ? 80.830  144.760 31.006  1.00 43.06  ? 115  U   A C6    1 
ATOM   2279  P  P     . G   A  1  115  ? 82.061  150.845 28.125  1.00 43.82  ? 116  G   A P     1 
ATOM   2280  O  OP1   . G   A  1  115  ? 81.057  151.726 28.786  1.00 43.16  ? 116  G   A OP1   1 
ATOM   2281  O  OP2   . G   A  1  115  ? 82.233  150.903 26.651  1.00 43.72  ? 116  G   A OP2   1 
ATOM   2282  O  "O5'" . G   A  1  115  ? 83.480  151.128 28.786  1.00 41.45  ? 116  G   A "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  115  ? 84.677  150.570 28.205  1.00 38.52  ? 116  G   A "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  115  ? 85.871  151.367 28.641  1.00 36.50  ? 116  G   A "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  115  ? 85.640  152.741 28.261  1.00 34.94  ? 116  G   A "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  115  ? 86.071  151.425 30.144  1.00 36.38  ? 116  G   A "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  115  ? 86.858  150.334 30.575  1.00 39.47  ? 116  G   A "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  115  ? 86.792  152.749 30.330  1.00 34.61  ? 116  G   A "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  115  ? 88.157  152.669 29.968  1.00 34.57  ? 116  G   A "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  115  ? 86.077  153.607 29.293  1.00 33.11  ? 116  G   A "C1'" 1 
ATOM   2291  N  N9    . G   A  1  115  ? 84.910  154.337 29.773  1.00 29.00  ? 116  G   A N9    1 
ATOM   2292  C  C8    . G   A  1  115  ? 83.603  154.096 29.434  1.00 29.23  ? 116  G   A C8    1 
ATOM   2293  N  N7    . G   A  1  115  ? 82.776  154.958 29.950  1.00 28.62  ? 116  G   A N7    1 
ATOM   2294  C  C5    . G   A  1  115  ? 83.583  155.802 30.696  1.00 25.38  ? 116  G   A C5    1 
ATOM   2295  C  C6    . G   A  1  115  ? 83.247  156.928 31.466  1.00 25.28  ? 116  G   A C6    1 
ATOM   2296  O  O6    . G   A  1  115  ? 82.131  157.416 31.667  1.00 27.15  ? 116  G   A O6    1 
ATOM   2297  N  N1    . G   A  1  115  ? 84.369  157.507 32.039  1.00 25.37  ? 116  G   A N1    1 
ATOM   2298  C  C2    . G   A  1  115  ? 85.655  157.048 31.896  1.00 26.41  ? 116  G   A C2    1 
ATOM   2299  N  N2    . G   A  1  115  ? 86.611  157.743 32.532  1.00 27.40  ? 116  G   A N2    1 
ATOM   2300  N  N3    . G   A  1  115  ? 85.981  155.986 31.181  1.00 25.23  ? 116  G   A N3    1 
ATOM   2301  C  C4    . G   A  1  115  ? 84.902  155.421 30.608  1.00 26.02  ? 116  G   A C4    1 
ATOM   2302  P  P     . A   A  1  116  ? 86.705  149.789 32.072  1.00 41.97  ? 117  A   A P     1 
ATOM   2303  O  OP1   . A   A  1  116  ? 87.688  148.692 32.185  1.00 40.87  ? 117  A   A OP1   1 
ATOM   2304  O  OP2   . A   A  1  116  ? 85.274  149.530 32.348  1.00 43.12  ? 117  A   A OP2   1 
ATOM   2305  O  "O5'" . A   A  1  116  ? 87.145  151.013 32.989  1.00 38.94  ? 117  A   A "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  116  ? 88.531  151.371 33.142  1.00 37.35  ? 117  A   A "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  116  ? 88.663  152.499 34.136  1.00 35.28  ? 117  A   A "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  116  ? 88.039  153.698 33.607  1.00 34.82  ? 117  A   A "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  116  ? 87.931  152.280 35.444  1.00 36.68  ? 117  A   A "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  116  ? 88.663  151.434 36.319  1.00 39.13  ? 117  A   A "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  116  ? 87.777  153.702 35.958  1.00 34.35  ? 117  A   A "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  116  ? 88.998  154.205 36.462  1.00 35.20  ? 117  A   A "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  116  ? 87.449  154.436 34.662  1.00 31.64  ? 117  A   A "C1'" 1 
ATOM   2314  N  N9    . A   A  1  116  ? 86.018  154.537 34.401  1.00 28.99  ? 117  A   A N9    1 
ATOM   2315  C  C8    . A   A  1  116  ? 85.233  153.731 33.611  1.00 30.12  ? 117  A   A C8    1 
ATOM   2316  N  N7    . A   A  1  116  ? 83.973  154.098 33.565  1.00 28.31  ? 117  A   A N7    1 
ATOM   2317  C  C5    . A   A  1  116  ? 83.928  155.217 34.379  1.00 27.68  ? 117  A   A C5    1 
ATOM   2318  C  C6    . A   A  1  116  ? 82.877  156.076 34.742  1.00 27.77  ? 117  A   A C6    1 
ATOM   2319  N  N6    . A   A  1  116  ? 81.624  155.951 34.293  1.00 27.99  ? 117  A   A N6    1 
ATOM   2320  N  N1    . A   A  1  116  ? 83.160  157.086 35.588  1.00 28.72  ? 117  A   A N1    1 
ATOM   2321  C  C2    . A   A  1  116  ? 84.415  157.223 36.021  1.00 30.94  ? 117  A   A C2    1 
ATOM   2322  N  N3    . A   A  1  116  ? 85.494  156.491 35.741  1.00 29.48  ? 117  A   A N3    1 
ATOM   2323  C  C4    . A   A  1  116  ? 85.178  155.492 34.906  1.00 28.41  ? 117  A   A C4    1 
ATOM   2324  P  P     . G   A  1  117  ? 87.868  150.432 37.292  1.00 41.03  ? 118  G   A P     1 
ATOM   2325  O  OP1   . G   A  1  117  ? 88.865  149.588 38.002  1.00 39.69  ? 118  G   A OP1   1 
ATOM   2326  O  OP2   . G   A  1  117  ? 86.782  149.789 36.505  1.00 40.72  ? 118  G   A OP2   1 
ATOM   2327  O  "O5'" . G   A  1  117  ? 87.244  151.413 38.375  1.00 36.88  ? 118  G   A "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  117  ? 88.107  152.021 39.340  1.00 34.04  ? 118  G   A "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  117  ? 87.447  153.210 39.963  1.00 32.03  ? 118  G   A "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  117  ? 86.928  154.071 38.920  1.00 29.91  ? 118  G   A "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  117  ? 86.221  152.966 40.818  1.00 31.12  ? 118  G   A "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  117  ? 86.574  152.498 42.115  1.00 33.20  ? 118  G   A "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  117  ? 85.656  154.375 40.893  1.00 28.57  ? 118  G   A "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  117  ? 86.384  155.177 41.797  1.00 29.44  ? 118  G   A "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  117  ? 85.894  154.877 39.463  1.00 27.24  ? 118  G   A "C1'" 1 
ATOM   2336  N  N9    . G   A  1  117  ? 84.686  154.728 38.656  1.00 25.23  ? 118  G   A N9    1 
ATOM   2337  C  C8    . G   A  1  117  ? 84.447  153.840 37.634  1.00 24.16  ? 118  G   A C8    1 
ATOM   2338  N  N7    . G   A  1  117  ? 83.217  153.881 37.201  1.00 20.73  ? 118  G   A N7    1 
ATOM   2339  C  C5    . G   A  1  117  ? 82.619  154.871 37.966  1.00 22.23  ? 118  G   A C5    1 
ATOM   2340  C  C6    . G   A  1  117  ? 81.281  155.336 37.982  1.00 23.12  ? 118  G   A C6    1 
ATOM   2341  O  O6    . G   A  1  117  ? 80.326  154.948 37.308  1.00 22.59  ? 118  G   A O6    1 
ATOM   2342  N  N1    . G   A  1  117  ? 81.102  156.348 38.919  1.00 23.34  ? 118  G   A N1    1 
ATOM   2343  C  C2    . G   A  1  117  ? 82.081  156.839 39.743  1.00 23.91  ? 118  G   A C2    1 
ATOM   2344  N  N2    . G   A  1  117  ? 81.713  157.806 40.594  1.00 25.29  ? 118  G   A N2    1 
ATOM   2345  N  N3    . G   A  1  117  ? 83.330  156.409 39.740  1.00 23.52  ? 118  G   A N3    1 
ATOM   2346  C  C4    . G   A  1  117  ? 83.524  155.428 38.838  1.00 22.92  ? 118  G   A C4    1 
ATOM   2347  P  P     . A   A  1  118  ? 85.526  151.613 42.958  1.00 36.17  ? 119  A   A P     1 
ATOM   2348  O  OP1   . A   A  1  118  ? 86.206  151.253 44.233  1.00 35.77  ? 119  A   A OP1   1 
ATOM   2349  O  OP2   . A   A  1  118  ? 84.990  150.546 42.079  1.00 35.23  ? 119  A   A OP2   1 
ATOM   2350  O  "O5'" . A   A  1  118  ? 84.315  152.601 43.283  1.00 32.53  ? 119  A   A "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  118  ? 84.446  153.613 44.298  1.00 29.65  ? 119  A   A "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  118  ? 83.169  154.400 44.429  1.00 27.81  ? 119  A   A "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  118  ? 82.856  154.981 43.144  1.00 28.32  ? 119  A   A "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  118  ? 81.902  153.661 44.829  1.00 27.67  ? 119  A   A "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  118  ? 81.840  153.506 46.247  1.00 28.44  ? 119  A   A "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  118  ? 80.828  154.613 44.324  1.00 27.31  ? 119  A   A "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  118  ? 80.620  155.713 45.175  1.00 25.81  ? 119  A   A "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  118  ? 81.457  155.116 43.022  1.00 27.42  ? 119  A   A "C1'" 1 
ATOM   2359  N  N9    . A   A  1  118  ? 81.028  154.319 41.879  1.00 27.16  ? 119  A   A N9    1 
ATOM   2360  C  C8    . A   A  1  118  ? 81.725  153.343 41.210  1.00 26.22  ? 119  A   A C8    1 
ATOM   2361  N  N7    . A   A  1  118  ? 81.042  152.776 40.248  1.00 26.37  ? 119  A   A N7    1 
ATOM   2362  C  C5    . A   A  1  118  ? 79.819  153.430 40.278  1.00 25.76  ? 119  A   A C5    1 
ATOM   2363  C  C6    . A   A  1  118  ? 78.659  153.284 39.517  1.00 26.22  ? 119  A   A C6    1 
ATOM   2364  N  N6    . A   A  1  118  ? 78.552  152.429 38.507  1.00 27.03  ? 119  A   A N6    1 
ATOM   2365  N  N1    . A   A  1  118  ? 77.602  154.064 39.825  1.00 27.95  ? 119  A   A N1    1 
ATOM   2366  C  C2    . A   A  1  118  ? 77.727  154.946 40.825  1.00 27.94  ? 119  A   A C2    1 
ATOM   2367  N  N3    . A   A  1  118  ? 78.776  155.192 41.599  1.00 25.51  ? 119  A   A N3    1 
ATOM   2368  C  C4    . A   A  1  118  ? 79.799  154.387 41.272  1.00 26.24  ? 119  A   A C4    1 
ATOM   2369  P  P     . A   A  1  119  ? 80.881  152.391 46.905  1.00 28.92  ? 120  A   A P     1 
ATOM   2370  O  OP1   . A   A  1  119  ? 81.292  152.263 48.325  1.00 27.70  ? 120  A   A OP1   1 
ATOM   2371  O  OP2   . A   A  1  119  ? 80.871  151.187 46.038  1.00 26.80  ? 120  A   A OP2   1 
ATOM   2372  O  "O5'" . A   A  1  119  ? 79.450  153.094 46.929  1.00 27.62  ? 120  A   A "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  119  ? 78.492  152.872 45.877  1.00 28.67  ? 120  A   A "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  119  ? 77.092  152.843 46.444  1.00 29.20  ? 120  A   A "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  119  ? 77.151  152.149 47.710  1.00 29.88  ? 120  A   A "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  119  ? 76.473  154.178 46.812  1.00 29.31  ? 120  A   A "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  119  ? 75.806  154.753 45.692  1.00 32.00  ? 120  A   A "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  119  ? 75.442  153.780 47.856  1.00 28.33  ? 120  A   A "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  119  ? 74.270  153.220 47.311  1.00 28.27  ? 120  A   A "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  119  ? 76.176  152.671 48.595  1.00 29.08  ? 120  A   A "C1'" 1 
ATOM   2381  N  N9    . A   A  1  119  ? 76.843  153.157 49.799  1.00 28.98  ? 120  A   A N9    1 
ATOM   2382  C  C8    . A   A  1  119  ? 78.092  152.830 50.272  1.00 28.33  ? 120  A   A C8    1 
ATOM   2383  N  N7    . A   A  1  119  ? 78.412  153.457 51.377  1.00 27.02  ? 120  A   A N7    1 
ATOM   2384  C  C5    . A   A  1  119  ? 77.301  154.243 51.653  1.00 27.04  ? 120  A   A C5    1 
ATOM   2385  C  C6    . A   A  1  119  ? 77.017  155.127 52.693  1.00 26.31  ? 120  A   A C6    1 
ATOM   2386  N  N6    . A   A  1  119  ? 77.864  155.388 53.682  1.00 28.95  ? 120  A   A N6    1 
ATOM   2387  N  N1    . A   A  1  119  ? 75.820  155.742 52.690  1.00 27.59  ? 120  A   A N1    1 
ATOM   2388  C  C2    . A   A  1  119  ? 74.965  155.476 51.696  1.00 29.72  ? 120  A   A C2    1 
ATOM   2389  N  N3    . A   A  1  119  ? 75.117  154.657 50.654  1.00 28.95  ? 120  A   A N3    1 
ATOM   2390  C  C4    . A   A  1  119  ? 76.324  154.064 50.696  1.00 27.89  ? 120  A   A C4    1 
ATOM   2391  P  P     . U   A  1  120  ? 75.223  156.243 45.798  1.00 31.90  ? 121  U   A P     1 
ATOM   2392  O  OP1   . U   A  1  120  ? 76.400  157.124 45.617  1.00 32.71  ? 121  U   A OP1   1 
ATOM   2393  O  OP2   . U   A  1  120  ? 74.434  156.329 47.047  1.00 32.08  ? 121  U   A OP2   1 
ATOM   2394  O  "O5'" . U   A  1  120  ? 74.260  156.387 44.535  1.00 31.77  ? 121  U   A "O5'" 1 
ATOM   2395  C  "C5'" . U   A  1  120  ? 74.798  156.371 43.182  1.00 32.84  ? 121  U   A "C5'" 1 
ATOM   2396  C  "C4'" . U   A  1  120  ? 73.703  156.086 42.169  1.00 32.49  ? 121  U   A "C4'" 1 
ATOM   2397  O  "O4'" . U   A  1  120  ? 73.310  154.702 42.261  1.00 33.36  ? 121  U   A "O4'" 1 
ATOM   2398  C  "C3'" . U   A  1  120  ? 72.416  156.891 42.309  1.00 32.09  ? 121  U   A "C3'" 1 
ATOM   2399  O  "O3'" . U   A  1  120  ? 72.559  158.096 41.547  1.00 32.34  ? 121  U   A "O3'" 1 
ATOM   2400  C  "C2'" . U   A  1  120  ? 71.363  155.973 41.688  1.00 31.39  ? 121  U   A "C2'" 1 
ATOM   2401  O  "O2'" . U   A  1  120  ? 71.235  156.093 40.289  1.00 33.23  ? 121  U   A "O2'" 1 
ATOM   2402  C  "C1'" . U   A  1  120  ? 71.930  154.583 41.988  1.00 33.52  ? 121  U   A "C1'" 1 
ATOM   2403  N  N1    . U   A  1  120  ? 71.289  153.838 43.084  1.00 35.86  ? 121  U   A N1    1 
ATOM   2404  C  C2    . U   A  1  120  ? 70.275  152.946 42.749  1.00 37.24  ? 121  U   A C2    1 
ATOM   2405  O  O2    . U   A  1  120  ? 69.904  152.751 41.605  1.00 39.04  ? 121  U   A O2    1 
ATOM   2406  N  N3    . U   A  1  120  ? 69.710  152.284 43.808  1.00 38.05  ? 121  U   A N3    1 
ATOM   2407  C  C4    . U   A  1  120  ? 70.039  152.409 45.135  1.00 37.36  ? 121  U   A C4    1 
ATOM   2408  O  O4    . U   A  1  120  ? 69.375  151.807 45.975  1.00 37.48  ? 121  U   A O4    1 
ATOM   2409  C  C5    . U   A  1  120  ? 71.096  153.333 45.405  1.00 36.40  ? 121  U   A C5    1 
ATOM   2410  C  C6    . U   A  1  120  ? 71.670  154.004 44.399  1.00 35.61  ? 121  U   A C6    1 
ATOM   2411  P  P     . C   A  1  121  ? 71.647  159.388 41.854  1.00 34.00  ? 122  C   A P     1 
ATOM   2412  O  OP1   . C   A  1  121  ? 70.688  159.110 42.949  1.00 34.76  ? 122  C   A OP1   1 
ATOM   2413  O  OP2   . C   A  1  121  ? 71.136  159.904 40.554  1.00 33.38  ? 122  C   A OP2   1 
ATOM   2414  O  "O5'" . C   A  1  121  ? 72.714  160.439 42.384  1.00 33.57  ? 122  C   A "O5'" 1 
ATOM   2415  C  "C5'" . C   A  1  121  ? 73.642  161.055 41.478  1.00 34.45  ? 122  C   A "C5'" 1 
ATOM   2416  C  "C4'" . C   A  1  121  ? 75.044  160.926 42.013  1.00 34.02  ? 122  C   A "C4'" 1 
ATOM   2417  O  "O4'" . C   A  1  121  ? 75.428  159.526 42.012  1.00 33.01  ? 122  C   A "O4'" 1 
ATOM   2418  C  "C3'" . C   A  1  121  ? 76.139  161.564 41.181  1.00 34.98  ? 122  C   A "C3'" 1 
ATOM   2419  O  "O3'" . C   A  1  121  ? 76.236  162.956 41.394  1.00 38.58  ? 122  C   A "O3'" 1 
ATOM   2420  C  "C2'" . C   A  1  121  ? 77.370  160.844 41.692  1.00 32.89  ? 122  C   A "C2'" 1 
ATOM   2421  O  "O2'" . C   A  1  121  ? 77.737  161.289 42.981  1.00 32.89  ? 122  C   A "O2'" 1 
ATOM   2422  C  "C1'" . C   A  1  121  ? 76.833  159.423 41.807  1.00 31.21  ? 122  C   A "C1'" 1 
ATOM   2423  N  N1    . C   A  1  121  ? 77.101  158.625 40.588  1.00 28.66  ? 122  C   A N1    1 
ATOM   2424  C  C2    . C   A  1  121  ? 78.410  158.185 40.352  1.00 27.45  ? 122  C   A C2    1 
ATOM   2425  O  O2    . C   A  1  121  ? 79.312  158.558 41.110  1.00 30.31  ? 122  C   A O2    1 
ATOM   2426  N  N3    . C   A  1  121  ? 78.658  157.378 39.303  1.00 23.80  ? 122  C   A N3    1 
ATOM   2427  C  C4    . C   A  1  121  ? 77.669  157.019 38.492  1.00 24.11  ? 122  C   A C4    1 
ATOM   2428  N  N4    . C   A  1  121  ? 77.952  156.162 37.515  1.00 26.20  ? 122  C   A N4    1 
ATOM   2429  C  C5    . C   A  1  121  ? 76.341  157.503 38.661  1.00 26.19  ? 122  C   A C5    1 
ATOM   2430  C  C6    . C   A  1  121  ? 76.102  158.296 39.715  1.00 27.98  ? 122  C   A C6    1 
ATOM   2431  P  P     . U   A  1  122  ? 76.690  163.895 40.180  1.00 41.34  ? 123  U   A P     1 
ATOM   2432  O  OP1   . U   A  1  122  ? 76.662  165.278 40.726  1.00 39.28  ? 123  U   A OP1   1 
ATOM   2433  O  OP2   . U   A  1  122  ? 75.843  163.550 39.003  1.00 41.64  ? 123  U   A OP2   1 
ATOM   2434  O  "O5'" . U   A  1  122  ? 78.188  163.433 39.852  1.00 39.24  ? 123  U   A "O5'" 1 
ATOM   2435  C  "C5'" . U   A  1  122  ? 79.270  163.788 40.730  1.00 39.70  ? 123  U   A "C5'" 1 
ATOM   2436  C  "C4'" . U   A  1  122  ? 80.560  163.084 40.343  1.00 40.84  ? 123  U   A "C4'" 1 
ATOM   2437  O  "O4'" . U   A  1  122  ? 80.329  161.671 40.120  1.00 39.63  ? 123  U   A "O4'" 1 
ATOM   2438  C  "C3'" . U   A  1  122  ? 81.295  163.488 39.073  1.00 41.88  ? 123  U   A "C3'" 1 
ATOM   2439  O  "O3'" . U   A  1  122  ? 82.033  164.701 39.241  1.00 46.98  ? 123  U   A "O3'" 1 
ATOM   2440  C  "C2'" . U   A  1  122  ? 82.272  162.328 38.921  1.00 40.09  ? 123  U   A "C2'" 1 
ATOM   2441  O  "O2'" . U   A  1  122  ? 83.368  162.404 39.816  1.00 39.76  ? 123  U   A "O2'" 1 
ATOM   2442  C  "C1'" . U   A  1  122  ? 81.409  161.152 39.366  1.00 38.45  ? 123  U   A "C1'" 1 
ATOM   2443  N  N1    . U   A  1  122  ? 80.890  160.366 38.240  1.00 36.83  ? 123  U   A N1    1 
ATOM   2444  C  C2    . U   A  1  122  ? 81.758  159.463 37.655  1.00 35.18  ? 123  U   A C2    1 
ATOM   2445  O  O2    . U   A  1  122  ? 82.918  159.337 38.006  1.00 32.96  ? 123  U   A O2    1 
ATOM   2446  N  N3    . U   A  1  122  ? 81.219  158.719 36.636  1.00 36.22  ? 123  U   A N3    1 
ATOM   2447  C  C4    . U   A  1  122  ? 79.928  158.794 36.146  1.00 38.19  ? 123  U   A C4    1 
ATOM   2448  O  O4    . U   A  1  122  ? 79.587  158.038 35.236  1.00 41.16  ? 123  U   A O4    1 
ATOM   2449  C  C5    . U   A  1  122  ? 79.097  159.774 36.786  1.00 37.39  ? 123  U   A C5    1 
ATOM   2450  C  C6    . U   A  1  122  ? 79.594  160.507 37.785  1.00 37.21  ? 123  U   A C6    1 
ATOM   2451  P  P     . C   A  1  123  ? 82.619  165.468 37.951  1.00 49.18  ? 124  C   A P     1 
ATOM   2452  O  OP1   . C   A  1  123  ? 83.183  166.754 38.442  1.00 49.80  ? 124  C   A OP1   1 
ATOM   2453  O  OP2   . C   A  1  123  ? 81.568  165.475 36.888  1.00 47.76  ? 124  C   A OP2   1 
ATOM   2454  O  "O5'" . C   A  1  123  ? 83.833  164.563 37.458  1.00 45.55  ? 124  C   A "O5'" 1 
ATOM   2455  C  "C5'" . C   A  1  123  ? 85.038  164.463 38.229  1.00 45.86  ? 124  C   A "C5'" 1 
ATOM   2456  C  "C4'" . C   A  1  123  ? 86.027  163.548 37.543  1.00 47.16  ? 124  C   A "C4'" 1 
ATOM   2457  O  "O4'" . C   A  1  123  ? 85.459  162.211 37.422  1.00 45.87  ? 124  C   A "O4'" 1 
ATOM   2458  C  "C3'" . C   A  1  123  ? 86.391  163.910 36.111  1.00 49.86  ? 124  C   A "C3'" 1 
ATOM   2459  O  "O3'" . C   A  1  123  ? 87.371  164.942 36.025  1.00 53.94  ? 124  C   A "O3'" 1 
ATOM   2460  C  "C2'" . C   A  1  123  ? 86.902  162.579 35.577  1.00 47.96  ? 124  C   A "C2'" 1 
ATOM   2461  O  "O2'" . C   A  1  123  ? 88.194  162.280 36.084  1.00 48.44  ? 124  C   A "O2'" 1 
ATOM   2462  C  "C1'" . C   A  1  123  ? 85.899  161.609 36.206  1.00 44.24  ? 124  C   A "C1'" 1 
ATOM   2463  N  N1    . C   A  1  123  ? 84.712  161.307 35.365  1.00 39.98  ? 124  C   A N1    1 
ATOM   2464  C  C2    . C   A  1  123  ? 84.784  160.263 34.418  1.00 37.76  ? 124  C   A C2    1 
ATOM   2465  O  O2    . C   A  1  123  ? 85.867  159.687 34.236  1.00 36.27  ? 124  C   A O2    1 
ATOM   2466  N  N3    . C   A  1  123  ? 83.663  159.920 33.724  1.00 35.47  ? 124  C   A N3    1 
ATOM   2467  C  C4    . C   A  1  123  ? 82.516  160.581 33.935  1.00 34.53  ? 124  C   A C4    1 
ATOM   2468  N  N4    . C   A  1  123  ? 81.421  160.174 33.287  1.00 33.39  ? 124  C   A N4    1 
ATOM   2469  C  C5    . C   A  1  123  ? 82.437  161.683 34.838  1.00 36.26  ? 124  C   A C5    1 
ATOM   2470  C  C6    . C   A  1  123  ? 83.546  162.007 35.524  1.00 37.86  ? 124  C   A C6    1 
ATOM   2471  P  P     . U   A  1  124  ? 87.365  165.944 34.761  1.00 58.00  ? 125  U   A P     1 
ATOM   2472  O  OP1   . U   A  1  124  ? 88.385  166.986 35.053  1.00 57.98  ? 125  U   A OP1   1 
ATOM   2473  O  OP2   . U   A  1  124  ? 85.964  166.349 34.448  1.00 56.93  ? 125  U   A OP2   1 
ATOM   2474  O  "O5'" . U   A  1  124  ? 87.879  165.045 33.547  1.00 58.69  ? 125  U   A "O5'" 1 
ATOM   2475  C  "C5'" . U   A  1  124  ? 89.267  164.659 33.442  1.00 60.59  ? 125  U   A "C5'" 1 
ATOM   2476  C  "C4'" . U   A  1  124  ? 89.515  163.902 32.156  1.00 61.99  ? 125  U   A "C4'" 1 
ATOM   2477  O  "O4'" . U   A  1  124  ? 88.878  162.600 32.206  1.00 62.04  ? 125  U   A "O4'" 1 
ATOM   2478  C  "C3'" . U   A  1  124  ? 88.965  164.508 30.872  1.00 63.32  ? 125  U   A "C3'" 1 
ATOM   2479  O  "O3'" . U   A  1  124  ? 89.660  165.667 30.365  1.00 63.92  ? 125  U   A "O3'" 1 
ATOM   2480  C  "C2'" . U   A  1  124  ? 89.009  163.308 29.934  1.00 62.89  ? 125  U   A "C2'" 1 
ATOM   2481  O  "O2'" . U   A  1  124  ? 90.324  163.070 29.465  1.00 64.54  ? 125  U   A "O2'" 1 
ATOM   2482  C  "C1'" . U   A  1  124  ? 88.610  162.165 30.880  1.00 61.68  ? 125  U   A "C1'" 1 
ATOM   2483  N  N1    . U   A  1  124  ? 87.206  161.723 30.787  1.00 59.49  ? 125  U   A N1    1 
ATOM   2484  C  C2    . U   A  1  124  ? 86.932  160.570 30.060  1.00 58.71  ? 125  U   A C2    1 
ATOM   2485  O  O2    . U   A  1  124  ? 87.797  159.907 29.515  1.00 59.50  ? 125  U   A O2    1 
ATOM   2486  N  N3    . U   A  1  124  ? 85.605  160.223 29.998  1.00 56.74  ? 125  U   A N3    1 
ATOM   2487  C  C4    . U   A  1  124  ? 84.546  160.885 30.576  1.00 56.35  ? 125  U   A C4    1 
ATOM   2488  O  O4    . U   A  1  124  ? 83.397  160.485 30.378  1.00 54.63  ? 125  U   A O4    1 
ATOM   2489  C  C5    . U   A  1  124  ? 84.909  162.051 31.317  1.00 57.22  ? 125  U   A C5    1 
ATOM   2490  C  C6    . U   A  1  124  ? 86.192  162.423 31.394  1.00 58.10  ? 125  U   A C6    1 
ATOM   2491  O  "O5'" . A   A  1  127  ? 85.302  161.032 21.072  1.00 81.82  ? 128  A   A "O5'" 1 
ATOM   2492  C  "C5'" . A   A  1  127  ? 86.441  160.234 20.698  1.00 80.96  ? 128  A   A "C5'" 1 
ATOM   2493  C  "C4'" . A   A  1  127  ? 86.794  159.070 21.616  1.00 80.33  ? 128  A   A "C4'" 1 
ATOM   2494  O  "O4'" . A   A  1  127  ? 87.035  159.541 22.978  1.00 79.24  ? 128  A   A "O4'" 1 
ATOM   2495  C  "C3'" . A   A  1  127  ? 85.730  157.997 21.790  1.00 79.60  ? 128  A   A "C3'" 1 
ATOM   2496  O  "O3'" . A   A  1  127  ? 85.641  157.064 20.720  1.00 78.95  ? 128  A   A "O3'" 1 
ATOM   2497  C  "C2'" . A   A  1  127  ? 86.123  157.373 23.124  1.00 78.47  ? 128  A   A "C2'" 1 
ATOM   2498  O  "O2'" . A   A  1  127  ? 87.246  156.513 23.055  1.00 79.44  ? 128  A   A "O2'" 1 
ATOM   2499  C  "C1'" . A   A  1  127  ? 86.467  158.630 23.915  1.00 76.57  ? 128  A   A "C1'" 1 
ATOM   2500  N  N9    . A   A  1  127  ? 85.244  159.241 24.440  1.00 73.73  ? 128  A   A N9    1 
ATOM   2501  C  C8    . A   A  1  127  ? 83.951  159.041 24.000  1.00 73.21  ? 128  A   A C8    1 
ATOM   2502  N  N7    . A   A  1  127  ? 83.057  159.744 24.644  1.00 73.01  ? 128  A   A N7    1 
ATOM   2503  C  C5    . A   A  1  127  ? 83.803  160.454 25.575  1.00 72.28  ? 128  A   A C5    1 
ATOM   2504  C  C6    . A   A  1  127  ? 83.438  161.383 26.557  1.00 71.11  ? 128  A   A C6    1 
ATOM   2505  N  N6    . A   A  1  127  ? 82.179  161.774 26.764  1.00 70.69  ? 128  A   A N6    1 
ATOM   2506  N  N1    . A   A  1  127  ? 84.421  161.905 27.326  1.00 69.69  ? 128  A   A N1    1 
ATOM   2507  C  C2    . A   A  1  127  ? 85.684  161.513 27.107  1.00 68.97  ? 128  A   A C2    1 
ATOM   2508  N  N3    . A   A  1  127  ? 86.155  160.650 26.210  1.00 70.35  ? 128  A   A N3    1 
ATOM   2509  C  C4    . A   A  1  127  ? 85.152  160.148 25.466  1.00 72.42  ? 128  A   A C4    1 
ATOM   2510  P  P     . A   A  1  128  ? 84.386  156.060 20.665  1.00 77.66  ? 129  A   A P     1 
ATOM   2511  O  OP1   . A   A  1  128  ? 84.423  155.363 19.346  1.00 76.78  ? 129  A   A OP1   1 
ATOM   2512  O  OP2   . A   A  1  128  ? 83.162  156.817 21.074  1.00 77.61  ? 129  A   A OP2   1 
ATOM   2513  O  "O5'" . A   A  1  128  ? 84.726  155.021 21.818  1.00 72.32  ? 129  A   A "O5'" 1 
ATOM   2514  C  "C5'" . A   A  1  128  ? 85.965  154.296 21.793  1.00 65.33  ? 129  A   A "C5'" 1 
ATOM   2515  C  "C4'" . A   A  1  128  ? 86.030  153.339 22.954  1.00 59.52  ? 129  A   A "C4'" 1 
ATOM   2516  O  "O4'" . A   A  1  128  ? 86.432  154.041 24.165  1.00 55.81  ? 129  A   A "O4'" 1 
ATOM   2517  C  "C3'" . A   A  1  128  ? 84.707  152.695 23.342  1.00 56.58  ? 129  A   A "C3'" 1 
ATOM   2518  O  "O3'" . A   A  1  128  ? 84.144  151.769 22.397  1.00 54.76  ? 129  A   A "O3'" 1 
ATOM   2519  C  "C2'" . A   A  1  128  ? 84.962  152.275 24.780  1.00 53.46  ? 129  A   A "C2'" 1 
ATOM   2520  O  "O2'" . A   A  1  128  ? 85.714  151.095 24.936  1.00 53.61  ? 129  A   A "O2'" 1 
ATOM   2521  C  "C1'" . A   A  1  128  ? 85.758  153.483 25.285  1.00 51.42  ? 129  A   A "C1'" 1 
ATOM   2522  N  N9    . A   A  1  128  ? 84.878  154.508 25.855  1.00 46.17  ? 129  A   A N9    1 
ATOM   2523  C  C8    . A   A  1  128  ? 83.515  154.593 25.705  1.00 45.39  ? 129  A   A C8    1 
ATOM   2524  N  N7    . A   A  1  128  ? 82.968  155.584 26.360  1.00 44.53  ? 129  A   A N7    1 
ATOM   2525  C  C5    . A   A  1  128  ? 84.039  156.207 26.976  1.00 42.43  ? 129  A   A C5    1 
ATOM   2526  C  C6    . A   A  1  128  ? 84.105  157.313 27.833  1.00 40.10  ? 129  A   A C6    1 
ATOM   2527  N  N6    . A   A  1  128  ? 83.034  158.009 28.212  1.00 39.30  ? 129  A   A N6    1 
ATOM   2528  N  N1    . A   A  1  128  ? 85.316  157.680 28.295  1.00 40.79  ? 129  A   A N1    1 
ATOM   2529  C  C2    . A   A  1  128  ? 86.385  156.970 27.903  1.00 43.90  ? 129  A   A C2    1 
ATOM   2530  N  N3    . A   A  1  128  ? 86.450  155.906 27.092  1.00 44.29  ? 129  A   A N3    1 
ATOM   2531  C  C4    . A   A  1  128  ? 85.225  155.566 26.664  1.00 44.05  ? 129  A   A C4    1 
ATOM   2532  P  P     . C   A  1  129  ? 84.993  150.520 21.847  1.00 54.85  ? 130  C   A P     1 
ATOM   2533  O  OP1   . C   A  1  129  ? 86.326  150.466 22.510  1.00 55.65  ? 130  C   A OP1   1 
ATOM   2534  O  OP2   . C   A  1  129  ? 84.921  150.596 20.368  1.00 54.51  ? 130  C   A OP2   1 
ATOM   2535  O  "O5'" . C   A  1  129  ? 84.134  149.254 22.294  1.00 54.27  ? 130  C   A "O5'" 1 
ATOM   2536  C  "C5'" . C   A  1  129  ? 83.330  149.288 23.493  1.00 52.14  ? 130  C   A "C5'" 1 
ATOM   2537  C  "C4'" . C   A  1  129  ? 83.016  147.885 23.956  1.00 50.14  ? 130  C   A "C4'" 1 
ATOM   2538  O  "O4'" . C   A  1  129  ? 82.134  147.230 23.005  1.00 51.53  ? 130  C   A "O4'" 1 
ATOM   2539  C  "C3'" . C   A  1  129  ? 84.204  146.949 24.033  1.00 49.07  ? 130  C   A "C3'" 1 
ATOM   2540  O  "O3'" . C   A  1  129  ? 84.936  147.142 25.215  1.00 45.43  ? 130  C   A "O3'" 1 
ATOM   2541  C  "C2'" . C   A  1  129  ? 83.540  145.584 23.984  1.00 49.75  ? 130  C   A "C2'" 1 
ATOM   2542  O  "O2'" . C   A  1  129  ? 82.931  145.249 25.212  1.00 50.70  ? 130  C   A "O2'" 1 
ATOM   2543  C  "C1'" . C   A  1  129  ? 82.435  145.838 22.958  1.00 51.56  ? 130  C   A "C1'" 1 
ATOM   2544  N  N1    . C   A  1  129  ? 82.828  145.460 21.581  1.00 53.41  ? 130  C   A N1    1 
ATOM   2545  C  C2    . C   A  1  129  ? 83.031  144.099 21.294  1.00 54.17  ? 130  C   A C2    1 
ATOM   2546  O  O2    . C   A  1  129  ? 82.873  143.263 22.195  1.00 53.09  ? 130  C   A O2    1 
ATOM   2547  N  N3    . C   A  1  129  ? 83.395  143.730 20.043  1.00 55.91  ? 130  C   A N3    1 
ATOM   2548  C  C4    . C   A  1  129  ? 83.552  144.651 19.090  1.00 54.98  ? 130  C   A C4    1 
ATOM   2549  N  N4    . C   A  1  129  ? 83.910  144.227 17.874  1.00 53.04  ? 130  C   A N4    1 
ATOM   2550  C  C5    . C   A  1  129  ? 83.349  146.046 19.347  1.00 54.85  ? 130  C   A C5    1 
ATOM   2551  C  C6    . C   A  1  129  ? 82.995  146.402 20.596  1.00 54.04  ? 130  C   A C6    1 
ATOM   2552  P  P     . A   A  1  130  ? 86.511  147.373 25.125  1.00 44.17  ? 131  A   A P     1 
ATOM   2553  O  OP1   . A   A  1  130  ? 86.702  148.815 24.873  1.00 44.29  ? 131  A   A OP1   1 
ATOM   2554  O  OP2   . A   A  1  130  ? 87.099  146.381 24.190  1.00 44.24  ? 131  A   A OP2   1 
ATOM   2555  O  "O5'" . A   A  1  130  ? 87.032  147.018 26.583  1.00 41.82  ? 131  A   A "O5'" 1 
ATOM   2556  C  "C5'" . A   A  1  130  ? 87.420  148.046 27.502  1.00 40.04  ? 131  A   A "C5'" 1 
ATOM   2557  C  "C4'" . A   A  1  130  ? 87.373  147.517 28.905  1.00 38.63  ? 131  A   A "C4'" 1 
ATOM   2558  O  "O4'" . A   A  1  130  ? 86.000  147.381 29.329  1.00 39.11  ? 131  A   A "O4'" 1 
ATOM   2559  C  "C3'" . A   A  1  130  ? 87.952  146.122 29.010  1.00 38.91  ? 131  A   A "C3'" 1 
ATOM   2560  O  "O3'" . A   A  1  130  ? 89.348  146.177 29.197  1.00 40.36  ? 131  A   A "O3'" 1 
ATOM   2561  C  "C2'" . A   A  1  130  ? 87.219  145.539 30.206  1.00 38.83  ? 131  A   A "C2'" 1 
ATOM   2562  O  "O2'" . A   A  1  130  ? 87.735  146.000 31.438  1.00 38.57  ? 131  A   A "O2'" 1 
ATOM   2563  C  "C1'" . A   A  1  130  ? 85.832  146.152 30.018  1.00 38.93  ? 131  A   A "C1'" 1 
ATOM   2564  N  N9    . A   A  1  130  ? 84.871  145.340 29.268  1.00 37.79  ? 131  A   A N9    1 
ATOM   2565  C  C8    . A   A  1  130  ? 84.266  145.673 28.081  1.00 37.99  ? 131  A   A C8    1 
ATOM   2566  N  N7    . A   A  1  130  ? 83.369  144.812 27.686  1.00 37.58  ? 131  A   A N7    1 
ATOM   2567  C  C5    . A   A  1  130  ? 83.399  143.832 28.663  1.00 38.79  ? 131  A   A C5    1 
ATOM   2568  C  C6    . A   A  1  130  ? 82.664  142.656 28.828  1.00 39.20  ? 131  A   A C6    1 
ATOM   2569  N  N6    . A   A  1  130  ? 81.699  142.272 27.992  1.00 39.95  ? 131  A   A N6    1 
ATOM   2570  N  N1    . A   A  1  130  ? 82.947  141.881 29.897  1.00 38.16  ? 131  A   A N1    1 
ATOM   2571  C  C2    . A   A  1  130  ? 83.903  142.283 30.739  1.00 38.45  ? 131  A   A C2    1 
ATOM   2572  N  N3    . A   A  1  130  ? 84.653  143.377 30.700  1.00 37.62  ? 131  A   A N3    1 
ATOM   2573  C  C4    . A   A  1  130  ? 84.343  144.124 29.626  1.00 38.45  ? 131  A   A C4    1 
ATOM   2574  P  P     . A   A  1  131  ? 90.271  145.069 28.518  1.00 41.56  ? 132  A   A P     1 
ATOM   2575  O  OP1   . A   A  1  131  ? 91.669  145.197 29.007  1.00 43.05  ? 132  A   A OP1   1 
ATOM   2576  O  OP2   . A   A  1  131  ? 89.980  145.135 27.061  1.00 42.52  ? 132  A   A OP2   1 
ATOM   2577  O  "O5'" . A   A  1  131  ? 89.699  143.717 29.115  1.00 42.35  ? 132  A   A "O5'" 1 
ATOM   2578  C  "C5'" . A   A  1  131  ? 89.949  143.349 30.478  1.00 39.60  ? 132  A   A "C5'" 1 
ATOM   2579  C  "C4'" . A   A  1  131  ? 89.311  142.020 30.756  1.00 39.74  ? 132  A   A "C4'" 1 
ATOM   2580  O  "O4'" . A   A  1  131  ? 87.865  142.145 30.615  1.00 40.01  ? 132  A   A "O4'" 1 
ATOM   2581  C  "C3'" . A   A  1  131  ? 89.673  140.961 29.738  1.00 38.77  ? 132  A   A "C3'" 1 
ATOM   2582  O  "O3'" . A   A  1  131  ? 90.944  140.381 29.961  1.00 37.95  ? 132  A   A "O3'" 1 
ATOM   2583  C  "C2'" . A   A  1  131  ? 88.502  139.999 29.836  1.00 38.71  ? 132  A   A "C2'" 1 
ATOM   2584  O  "O2'" . A   A  1  131  ? 88.578  139.177 30.981  1.00 39.13  ? 132  A   A "O2'" 1 
ATOM   2585  C  "C1'" . A   A  1  131  ? 87.337  140.975 30.006  1.00 38.50  ? 132  A   A "C1'" 1 
ATOM   2586  N  N9    . A   A  1  131  ? 86.671  141.367 28.761  1.00 37.97  ? 132  A   A N9    1 
ATOM   2587  C  C8    . A   A  1  131  ? 86.919  142.482 27.995  1.00 38.79  ? 132  A   A C8    1 
ATOM   2588  N  N7    . A   A  1  131  ? 86.123  142.601 26.960  1.00 38.38  ? 132  A   A N7    1 
ATOM   2589  C  C5    . A   A  1  131  ? 85.303  141.487 27.041  1.00 38.25  ? 132  A   A C5    1 
ATOM   2590  C  C6    . A   A  1  131  ? 84.244  141.033 26.237  1.00 38.86  ? 132  A   A C6    1 
ATOM   2591  N  N6    . A   A  1  131  ? 83.812  141.668 25.143  1.00 39.89  ? 132  A   A N6    1 
ATOM   2592  N  N1    . A   A  1  131  ? 83.639  139.883 26.596  1.00 39.59  ? 132  A   A N1    1 
ATOM   2593  C  C2    . A   A  1  131  ? 84.081  139.237 27.678  1.00 37.90  ? 132  A   A C2    1 
ATOM   2594  N  N3    . A   A  1  131  ? 85.066  139.560 28.507  1.00 37.41  ? 132  A   A N3    1 
ATOM   2595  C  C4    . A   A  1  131  ? 85.640  140.709 28.134  1.00 37.74  ? 132  A   A C4    1 
ATOM   2596  P  P     . U   A  1  132  ? 91.739  139.770 28.714  1.00 38.90  ? 133  U   A P     1 
ATOM   2597  O  OP1   . U   A  1  132  ? 93.056  139.248 29.181  1.00 38.16  ? 133  U   A OP1   1 
ATOM   2598  O  OP2   . U   A  1  132  ? 91.689  140.749 27.600  1.00 39.39  ? 133  U   A OP2   1 
ATOM   2599  O  "O5'" . U   A  1  132  ? 90.821  138.547 28.282  1.00 37.86  ? 133  U   A "O5'" 1 
ATOM   2600  C  "C5'" . U   A  1  132  ? 90.684  137.400 29.127  1.00 36.57  ? 133  U   A "C5'" 1 
ATOM   2601  C  "C4'" . U   A  1  132  ? 89.845  136.364 28.441  1.00 35.80  ? 133  U   A "C4'" 1 
ATOM   2602  O  "O4'" . U   A  1  132  ? 88.487  136.852 28.294  1.00 35.45  ? 133  U   A "O4'" 1 
ATOM   2603  C  "C3'" . U   A  1  132  ? 90.259  136.040 27.021  1.00 35.70  ? 133  U   A "C3'" 1 
ATOM   2604  O  "O3'" . U   A  1  132  ? 91.383  135.159 26.973  1.00 36.92  ? 133  U   A "O3'" 1 
ATOM   2605  C  "C2'" . U   A  1  132  ? 88.982  135.434 26.457  1.00 35.06  ? 133  U   A "C2'" 1 
ATOM   2606  O  "O2'" . U   A  1  132  ? 88.793  134.115 26.923  1.00 33.94  ? 133  U   A "O2'" 1 
ATOM   2607  C  "C1'" . U   A  1  132  ? 87.921  136.326 27.103  1.00 35.63  ? 133  U   A "C1'" 1 
ATOM   2608  N  N1    . U   A  1  132  ? 87.455  137.445 26.265  1.00 38.25  ? 133  U   A N1    1 
ATOM   2609  C  C2    . U   A  1  132  ? 86.379  137.228 25.404  1.00 39.22  ? 133  U   A C2    1 
ATOM   2610  O  O2    . U   A  1  132  ? 85.817  136.157 25.299  1.00 40.30  ? 133  U   A O2    1 
ATOM   2611  N  N3    . U   A  1  132  ? 85.990  138.323 24.668  1.00 39.29  ? 133  U   A N3    1 
ATOM   2612  C  C4    . U   A  1  132  ? 86.552  139.579 24.694  1.00 39.95  ? 133  U   A C4    1 
ATOM   2613  O  O4    . U   A  1  132  ? 86.094  140.460 23.965  1.00 41.14  ? 133  U   A O4    1 
ATOM   2614  C  C5    . U   A  1  132  ? 87.658  139.722 25.596  1.00 40.71  ? 133  U   A C5    1 
ATOM   2615  C  C6    . U   A  1  132  ? 88.059  138.680 26.330  1.00 39.57  ? 133  U   A C6    1 
ATOM   2616  P  P     . U   A  1  133  ? 92.176  134.966 25.586  1.00 38.60  ? 134  U   A P     1 
ATOM   2617  O  OP1   . U   A  1  133  ? 93.366  134.092 25.802  1.00 35.11  ? 134  U   A OP1   1 
ATOM   2618  O  OP2   . U   A  1  133  ? 92.341  136.295 24.919  1.00 33.30  ? 134  U   A OP2   1 
ATOM   2619  O  "O5'" . U   A  1  133  ? 91.131  134.124 24.741  1.00 33.96  ? 134  U   A "O5'" 1 
ATOM   2620  C  "C5'" . U   A  1  133  ? 91.002  134.332 23.355  1.00 30.99  ? 134  U   A "C5'" 1 
ATOM   2621  C  "C4'" . U   A  1  133  ? 89.718  133.756 22.859  1.00 26.93  ? 134  U   A "C4'" 1 
ATOM   2622  O  "O4'" . U   A  1  133  ? 88.580  134.508 23.338  1.00 26.26  ? 134  U   A "O4'" 1 
ATOM   2623  C  "C3'" . U   A  1  133  ? 89.636  133.906 21.369  1.00 27.00  ? 134  U   A "C3'" 1 
ATOM   2624  O  "O3'" . U   A  1  133  ? 90.415  132.894 20.789  1.00 26.16  ? 134  U   A "O3'" 1 
ATOM   2625  C  "C2'" . U   A  1  133  ? 88.144  133.818 21.119  1.00 27.75  ? 134  U   A "C2'" 1 
ATOM   2626  O  "O2'" . U   A  1  133  ? 87.658  132.494 21.236  1.00 29.37  ? 134  U   A "O2'" 1 
ATOM   2627  C  "C1'" . U   A  1  133  ? 87.626  134.641 22.294  1.00 27.01  ? 134  U   A "C1'" 1 
ATOM   2628  N  N1    . U   A  1  133  ? 87.478  136.073 21.981  1.00 28.16  ? 134  U   A N1    1 
ATOM   2629  C  C2    . U   A  1  133  ? 86.432  136.468 21.143  1.00 28.30  ? 134  U   A C2    1 
ATOM   2630  O  O2    . U   A  1  133  ? 85.652  135.684 20.637  1.00 27.75  ? 134  U   A O2    1 
ATOM   2631  N  N3    . U   A  1  133  ? 86.350  137.822 20.920  1.00 27.83  ? 134  U   A N3    1 
ATOM   2632  C  C4    . U   A  1  133  ? 87.193  138.800 21.416  1.00 28.86  ? 134  U   A C4    1 
ATOM   2633  O  O4    . U   A  1  133  ? 87.094  139.953 20.990  1.00 29.81  ? 134  U   A O4    1 
ATOM   2634  C  C5    . U   A  1  133  ? 88.237  138.315 22.265  1.00 28.55  ? 134  U   A C5    1 
ATOM   2635  C  C6    . U   A  1  133  ? 88.346  137.005 22.509  1.00 28.83  ? 134  U   A C6    1 
ATOM   2636  P  P     . G   A  1  134  ? 91.165  133.187 19.415  1.00 27.50  ? 135  G   A P     1 
ATOM   2637  O  OP1   . G   A  1  134  ? 92.113  132.059 19.231  1.00 25.98  ? 135  G   A OP1   1 
ATOM   2638  O  OP2   . G   A  1  134  ? 91.675  134.576 19.406  1.00 25.36  ? 135  G   A OP2   1 
ATOM   2639  O  "O5'" . G   A  1  134  ? 89.987  133.060 18.348  1.00 26.04  ? 135  G   A "O5'" 1 
ATOM   2640  C  "C5'" . G   A  1  134  ? 89.287  131.807 18.195  1.00 27.29  ? 135  G   A "C5'" 1 
ATOM   2641  C  "C4'" . G   A  1  134  ? 88.191  131.925 17.169  1.00 29.78  ? 135  G   A "C4'" 1 
ATOM   2642  O  "O4'" . G   A  1  134  ? 87.145  132.821 17.635  1.00 31.32  ? 135  G   A "O4'" 1 
ATOM   2643  C  "C3'" . G   A  1  134  ? 88.635  132.565 15.877  1.00 32.17  ? 135  G   A "C3'" 1 
ATOM   2644  O  "O3'" . G   A  1  134  ? 89.345  131.696 15.028  1.00 33.09  ? 135  G   A "O3'" 1 
ATOM   2645  C  "C2'" . G   A  1  134  ? 87.328  133.050 15.285  1.00 32.40  ? 135  G   A "C2'" 1 
ATOM   2646  O  "O2'" . G   A  1  134  ? 86.593  131.978 14.729  1.00 33.86  ? 135  G   A "O2'" 1 
ATOM   2647  C  "C1'" . G   A  1  134  ? 86.646  133.591 16.539  1.00 32.60  ? 135  G   A "C1'" 1 
ATOM   2648  N  N9    . G   A  1  134  ? 86.971  134.998 16.779  1.00 34.67  ? 135  G   A N9    1 
ATOM   2649  C  C8    . G   A  1  134  ? 87.914  135.486 17.652  1.00 35.39  ? 135  G   A C8    1 
ATOM   2650  N  N7    . G   A  1  134  ? 87.962  136.792 17.681  1.00 35.33  ? 135  G   A N7    1 
ATOM   2651  C  C5    . G   A  1  134  ? 86.996  137.195 16.771  1.00 34.55  ? 135  G   A C5    1 
ATOM   2652  C  C6    . G   A  1  134  ? 86.592  138.494 16.388  1.00 34.56  ? 135  G   A C6    1 
ATOM   2653  O  O6    . G   A  1  134  ? 87.013  139.581 16.789  1.00 35.08  ? 135  G   A O6    1 
ATOM   2654  N  N1    . G   A  1  134  ? 85.587  138.455 15.433  1.00 35.38  ? 135  G   A N1    1 
ATOM   2655  C  C2    . G   A  1  134  ? 85.042  137.309 14.908  1.00 36.25  ? 135  G   A C2    1 
ATOM   2656  N  N2    . G   A  1  134  ? 84.079  137.478 14.004  1.00 36.81  ? 135  G   A N2    1 
ATOM   2657  N  N3    . G   A  1  134  ? 85.415  136.085 15.253  1.00 36.46  ? 135  G   A N3    1 
ATOM   2658  C  C4    . G   A  1  134  ? 86.385  136.103 16.190  1.00 35.07  ? 135  G   A C4    1 
ATOM   2659  P  P     . C   A  1  135  ? 90.516  132.310 14.135  1.00 34.53  ? 136  C   A P     1 
ATOM   2660  O  OP1   . C   A  1  135  ? 91.164  131.176 13.428  1.00 33.90  ? 136  C   A OP1   1 
ATOM   2661  O  OP2   . C   A  1  135  ? 91.326  133.190 15.011  1.00 32.99  ? 136  C   A OP2   1 
ATOM   2662  O  "O5'" . C   A  1  135  ? 89.742  133.232 13.087  1.00 33.16  ? 136  C   A "O5'" 1 
ATOM   2663  C  "C5'" . C   A  1  135  ? 88.803  132.646 12.171  1.00 34.71  ? 136  C   A "C5'" 1 
ATOM   2664  C  "C4'" . C   A  1  135  ? 88.099  133.711 11.362  1.00 37.40  ? 136  C   A "C4'" 1 
ATOM   2665  O  "O4'" . C   A  1  135  ? 87.318  134.562 12.244  1.00 37.41  ? 136  C   A "O4'" 1 
ATOM   2666  C  "C3'" . C   A  1  135  ? 88.984  134.687 10.609  1.00 38.80  ? 136  C   A "C3'" 1 
ATOM   2667  O  "O3'" . C   A  1  135  ? 89.408  134.131 9.375   1.00 43.30  ? 136  C   A "O3'" 1 
ATOM   2668  C  "C2'" . C   A  1  135  ? 88.034  135.852 10.387  1.00 36.77  ? 136  C   A "C2'" 1 
ATOM   2669  O  "O2'" . C   A  1  135  ? 87.107  135.567 9.359   1.00 37.10  ? 136  C   A "O2'" 1 
ATOM   2670  C  "C1'" . C   A  1  135  ? 87.288  135.881 11.721  1.00 35.99  ? 136  C   A "C1'" 1 
ATOM   2671  N  N1    . C   A  1  135  ? 87.932  136.789 12.680  1.00 35.31  ? 136  C   A N1    1 
ATOM   2672  C  C2    . C   A  1  135  ? 87.568  138.142 12.672  1.00 35.27  ? 136  C   A C2    1 
ATOM   2673  O  O2    . C   A  1  135  ? 86.671  138.523 11.889  1.00 34.89  ? 136  C   A O2    1 
ATOM   2674  N  N3    . C   A  1  135  ? 88.197  138.996 13.523  1.00 34.40  ? 136  C   A N3    1 
ATOM   2675  C  C4    . C   A  1  135  ? 89.135  138.540 14.360  1.00 32.36  ? 136  C   A C4    1 
ATOM   2676  N  N4    . C   A  1  135  ? 89.736  139.417 15.171  1.00 31.72  ? 136  C   A N4    1 
ATOM   2677  C  C5    . C   A  1  135  ? 89.501  137.168 14.403  1.00 32.45  ? 136  C   A C5    1 
ATOM   2678  C  C6    . C   A  1  135  ? 88.882  136.335 13.557  1.00 34.59  ? 136  C   A C6    1 
ATOM   2679  P  P     . U   A  1  136  ? 90.887  134.447 8.831   1.00 46.75  ? 137  U   A P     1 
ATOM   2680  O  OP1   . U   A  1  136  ? 90.906  133.928 7.454   1.00 46.72  ? 137  U   A OP1   1 
ATOM   2681  O  OP2   . U   A  1  136  ? 91.903  133.957 9.816   1.00 43.12  ? 137  U   A OP2   1 
ATOM   2682  O  "O5'" . U   A  1  136  ? 90.935  136.044 8.758   1.00 48.23  ? 137  U   A "O5'" 1 
ATOM   2683  C  "C5'" . U   A  1  136  ? 90.050  136.772 7.864   1.00 51.89  ? 137  U   A "C5'" 1 
ATOM   2684  C  "C4'" . U   A  1  136  ? 89.986  138.241 8.245   1.00 54.72  ? 137  U   A "C4'" 1 
ATOM   2685  O  "O4'" . U   A  1  136  ? 89.663  138.324 9.658   1.00 55.55  ? 137  U   A "O4'" 1 
ATOM   2686  C  "C3'" . U   A  1  136  ? 91.276  139.043 8.094   1.00 57.52  ? 137  U   A "C3'" 1 
ATOM   2687  O  "O3'" . U   A  1  136  ? 91.400  139.579 6.764   1.00 62.30  ? 137  U   A "O3'" 1 
ATOM   2688  C  "C2'" . U   A  1  136  ? 91.108  140.139 9.143   1.00 56.18  ? 137  U   A "C2'" 1 
ATOM   2689  O  "O2'" . U   A  1  136  ? 90.248  141.179 8.716   1.00 56.07  ? 137  U   A "O2'" 1 
ATOM   2690  C  "C1'" . U   A  1  136  ? 90.392  139.379 10.261  1.00 53.94  ? 137  U   A "C1'" 1 
ATOM   2691  N  N1    . U   A  1  136  ? 91.252  138.813 11.316  1.00 51.10  ? 137  U   A N1    1 
ATOM   2692  C  C2    . U   A  1  136  ? 91.592  139.631 12.379  1.00 49.68  ? 137  U   A C2    1 
ATOM   2693  O  O2    . U   A  1  136  ? 91.242  140.792 12.460  1.00 50.92  ? 137  U   A O2    1 
ATOM   2694  N  N3    . U   A  1  136  ? 92.362  139.040 13.350  1.00 48.15  ? 137  U   A N3    1 
ATOM   2695  C  C4    . U   A  1  136  ? 92.828  137.743 13.370  1.00 48.33  ? 137  U   A C4    1 
ATOM   2696  O  O4    . U   A  1  136  ? 93.589  137.385 14.278  1.00 45.95  ? 137  U   A O4    1 
ATOM   2697  C  C5    . U   A  1  136  ? 92.442  136.957 12.232  1.00 50.20  ? 137  U   A C5    1 
ATOM   2698  C  C6    . U   A  1  136  ? 91.691  137.507 11.267  1.00 50.25  ? 137  U   A C6    1 
ATOM   2699  P  P     . U   A  1  137  ? 92.847  140.024 6.191   1.00 65.65  ? 138  U   A P     1 
ATOM   2700  O  OP1   . U   A  1  137  ? 92.759  139.838 4.720   1.00 64.86  ? 138  U   A OP1   1 
ATOM   2701  O  OP2   . U   A  1  137  ? 93.912  139.325 6.953   1.00 63.22  ? 138  U   A OP2   1 
ATOM   2702  O  "O5'" . U   A  1  137  ? 92.945  141.595 6.489   1.00 69.29  ? 138  U   A "O5'" 1 
ATOM   2703  C  "C5'" . U   A  1  137  ? 93.796  142.471 5.685   1.00 76.85  ? 138  U   A "C5'" 1 
ATOM   2704  C  "C4'" . U   A  1  137  ? 93.124  143.821 5.446   1.00 81.74  ? 138  U   A "C4'" 1 
ATOM   2705  O  "O4'" . U   A  1  137  ? 91.831  143.589 4.834   1.00 85.82  ? 138  U   A "O4'" 1 
ATOM   2706  C  "C3'" . U   A  1  137  ? 92.846  144.678 6.679   1.00 83.49  ? 138  U   A "C3'" 1 
ATOM   2707  O  "O3'" . U   A  1  137  ? 93.919  145.603 6.905   1.00 80.91  ? 138  U   A "O3'" 1 
ATOM   2708  C  "C2'" . U   A  1  137  ? 91.618  145.498 6.269   1.00 86.28  ? 138  U   A "C2'" 1 
ATOM   2709  O  "O2'" . U   A  1  137  ? 91.936  146.698 5.592   1.00 88.09  ? 138  U   A "O2'" 1 
ATOM   2710  C  "C1'" . U   A  1  137  ? 90.900  144.557 5.290   1.00 88.66  ? 138  U   A "C1'" 1 
ATOM   2711  N  N1    . U   A  1  137  ? 89.690  143.855 5.757   1.00 92.65  ? 138  U   A N1    1 
ATOM   2712  C  C2    . U   A  1  137  ? 89.056  142.998 4.853   1.00 94.79  ? 138  U   A C2    1 
ATOM   2713  O  O2    . U   A  1  137  ? 89.421  142.861 3.685   1.00 94.89  ? 138  U   A O2    1 
ATOM   2714  N  N3    . U   A  1  137  ? 87.973  142.317 5.365   1.00 96.60  ? 138  U   A N3    1 
ATOM   2715  C  C4    . U   A  1  137  ? 87.453  142.412 6.648   1.00 96.86  ? 138  U   A C4    1 
ATOM   2716  O  O4    . U   A  1  137  ? 86.513  141.681 6.980   1.00 97.41  ? 138  U   A O4    1 
ATOM   2717  C  C5    . U   A  1  137  ? 88.133  143.346 7.501   1.00 95.96  ? 138  U   A C5    1 
ATOM   2718  C  C6    . U   A  1  137  ? 89.200  144.015 7.041   1.00 94.21  ? 138  U   A C6    1 
ATOM   2719  P  P     . C   A  1  138  ? 95.296  145.122 7.585   1.00 80.04  ? 139  C   A P     1 
ATOM   2720  O  OP1   . C   A  1  138  ? 96.073  146.352 7.868   1.00 79.19  ? 139  C   A OP1   1 
ATOM   2721  O  OP2   . C   A  1  138  ? 95.911  144.053 6.758   1.00 79.57  ? 139  C   A OP2   1 
ATOM   2722  O  "O5'" . C   A  1  138  ? 94.853  144.519 8.993   1.00 78.92  ? 139  C   A "O5'" 1 
ATOM   2723  C  "C5'" . C   A  1  138  ? 94.239  145.353 10.002  1.00 75.63  ? 139  C   A "C5'" 1 
ATOM   2724  C  "C4'" . C   A  1  138  ? 94.722  144.955 11.382  1.00 73.78  ? 139  C   A "C4'" 1 
ATOM   2725  O  "O4'" . C   A  1  138  ? 94.327  143.579 11.642  1.00 72.97  ? 139  C   A "O4'" 1 
ATOM   2726  C  "C3'" . C   A  1  138  ? 96.235  145.010 11.612  1.00 73.16  ? 139  C   A "C3'" 1 
ATOM   2727  O  "O3'" . C   A  1  138  ? 96.532  145.323 12.980  1.00 70.61  ? 139  C   A "O3'" 1 
ATOM   2728  C  "C2'" . C   A  1  138  ? 96.654  143.571 11.337  1.00 73.63  ? 139  C   A "C2'" 1 
ATOM   2729  O  "O2'" . C   A  1  138  ? 97.864  143.220 11.978  1.00 75.41  ? 139  C   A "O2'" 1 
ATOM   2730  C  "C1'" . C   A  1  138  ? 95.473  142.809 11.934  1.00 72.94  ? 139  C   A "C1'" 1 
ATOM   2731  N  N1    . C   A  1  138  ? 95.280  141.452 11.403  1.00 72.54  ? 139  C   A N1    1 
ATOM   2732  C  C2    . C   A  1  138  ? 95.663  140.366 12.200  1.00 72.48  ? 139  C   A C2    1 
ATOM   2733  O  O2    . C   A  1  138  ? 96.150  140.583 13.323  1.00 71.74  ? 139  C   A O2    1 
ATOM   2734  N  N3    . C   A  1  138  ? 95.491  139.109 11.731  1.00 73.19  ? 139  C   A N3    1 
ATOM   2735  C  C4    . C   A  1  138  ? 94.956  138.916 10.521  1.00 73.99  ? 139  C   A C4    1 
ATOM   2736  N  N4    . C   A  1  138  ? 94.797  137.656 10.104  1.00 74.17  ? 139  C   A N4    1 
ATOM   2737  C  C5    . C   A  1  138  ? 94.559  140.004 9.687   1.00 73.28  ? 139  C   A C5    1 
ATOM   2738  C  C6    . C   A  1  138  ? 94.738  141.243 10.162  1.00 73.08  ? 139  C   A C6    1 
ATOM   2739  P  P     . G   A  1  139  ? 96.770  146.852 13.419  1.00 68.25  ? 140  G   A P     1 
ATOM   2740  O  OP1   . G   A  1  139  ? 97.686  147.476 12.420  1.00 67.28  ? 140  G   A OP1   1 
ATOM   2741  O  OP2   . G   A  1  139  ? 97.135  146.882 14.863  1.00 67.19  ? 140  G   A OP2   1 
ATOM   2742  O  "O5'" . G   A  1  139  ? 95.312  147.473 13.243  1.00 63.65  ? 140  G   A "O5'" 1 
ATOM   2743  C  "C5'" . G   A  1  139  ? 95.084  148.879 13.360  1.00 59.04  ? 140  G   A "C5'" 1 
ATOM   2744  C  "C4'" . G   A  1  139  ? 93.609  149.160 13.542  1.00 55.44  ? 140  G   A "C4'" 1 
ATOM   2745  O  "O4'" . G   A  1  139  ? 92.873  148.834 12.344  1.00 55.83  ? 140  G   A "O4'" 1 
ATOM   2746  C  "C3'" . G   A  1  139  ? 92.892  148.323 14.580  1.00 53.87  ? 140  G   A "C3'" 1 
ATOM   2747  O  "O3'" . G   A  1  139  ? 93.227  148.814 15.878  1.00 52.18  ? 140  G   A "O3'" 1 
ATOM   2748  C  "C2'" . G   A  1  139  ? 91.417  148.527 14.201  1.00 54.30  ? 140  G   A "C2'" 1 
ATOM   2749  O  "O2'" . G   A  1  139  ? 90.834  149.707 14.717  1.00 55.12  ? 140  G   A "O2'" 1 
ATOM   2750  C  "C1'" . G   A  1  139  ? 91.503  148.685 12.678  1.00 54.13  ? 140  G   A "C1'" 1 
ATOM   2751  N  N9    . G   A  1  139  ? 90.950  147.601 11.872  1.00 53.15  ? 140  G   A N9    1 
ATOM   2752  C  C8    . G   A  1  139  ? 90.199  147.736 10.732  1.00 53.11  ? 140  G   A C8    1 
ATOM   2753  N  N7    . G   A  1  139  ? 89.901  146.595 10.177  1.00 52.34  ? 140  G   A N7    1 
ATOM   2754  C  C5    . G   A  1  139  ? 90.479  145.650 11.011  1.00 52.59  ? 140  G   A C5    1 
ATOM   2755  C  C6    . G   A  1  139  ? 90.509  144.242 10.917  1.00 53.40  ? 140  G   A C6    1 
ATOM   2756  O  O6    . G   A  1  139  ? 90.032  143.519 10.037  1.00 54.00  ? 140  G   A O6    1 
ATOM   2757  N  N1    . G   A  1  139  ? 91.190  143.673 11.986  1.00 54.40  ? 140  G   A N1    1 
ATOM   2758  C  C2    . G   A  1  139  ? 91.776  144.369 13.012  1.00 54.58  ? 140  G   A C2    1 
ATOM   2759  N  N2    . G   A  1  139  ? 92.385  143.633 13.966  1.00 54.82  ? 140  G   A N2    1 
ATOM   2760  N  N3    . G   A  1  139  ? 91.769  145.686 13.102  1.00 53.75  ? 140  G   A N3    1 
ATOM   2761  C  C4    . G   A  1  139  ? 91.110  146.256 12.074  1.00 52.53  ? 140  G   A C4    1 
ATOM   2762  P  P     . C   A  1  140  ? 92.623  148.109 17.185  1.00 50.86  ? 141  C   A P     1 
ATOM   2763  O  OP1   . C   A  1  140  ? 93.276  148.711 18.373  1.00 49.54  ? 141  C   A OP1   1 
ATOM   2764  O  OP2   . C   A  1  140  ? 92.662  146.634 16.996  1.00 50.66  ? 141  C   A OP2   1 
ATOM   2765  O  "O5'" . C   A  1  140  ? 91.110  148.598 17.169  1.00 50.39  ? 141  C   A "O5'" 1 
ATOM   2766  C  "C5'" . C   A  1  140  ? 90.137  147.948 17.970  1.00 47.81  ? 141  C   A "C5'" 1 
ATOM   2767  C  "C4'" . C   A  1  140  ? 88.932  147.608 17.143  1.00 47.13  ? 141  C   A "C4'" 1 
ATOM   2768  O  "O4'" . C   A  1  140  ? 88.443  146.317 17.564  1.00 48.27  ? 141  C   A "O4'" 1 
ATOM   2769  C  "C3'" . C   A  1  140  ? 87.747  148.559 17.241  1.00 46.77  ? 141  C   A "C3'" 1 
ATOM   2770  O  "O3'" . C   A  1  140  ? 86.993  148.413 16.041  1.00 47.91  ? 141  C   A "O3'" 1 
ATOM   2771  C  "C2'" . C   A  1  140  ? 86.946  147.939 18.379  1.00 46.09  ? 141  C   A "C2'" 1 
ATOM   2772  O  "O2'" . C   A  1  140  ? 85.580  148.291 18.355  1.00 43.87  ? 141  C   A "O2'" 1 
ATOM   2773  C  "C1'" . C   A  1  140  ? 87.133  146.450 18.078  1.00 47.60  ? 141  C   A "C1'" 1 
ATOM   2774  N  N1    . C   A  1  140  ? 87.005  145.511 19.208  1.00 49.03  ? 141  C   A N1    1 
ATOM   2775  C  C2    . C   A  1  140  ? 87.299  144.156 18.981  1.00 49.40  ? 141  C   A C2    1 
ATOM   2776  O  O2    . C   A  1  140  ? 87.641  143.797 17.840  1.00 49.47  ? 141  C   A O2    1 
ATOM   2777  N  N3    . C   A  1  140  ? 87.207  143.279 20.001  1.00 49.90  ? 141  C   A N3    1 
ATOM   2778  C  C4    . C   A  1  140  ? 86.837  143.700 21.211  1.00 49.64  ? 141  C   A C4    1 
ATOM   2779  N  N4    . C   A  1  140  ? 86.780  142.800 22.194  1.00 48.58  ? 141  C   A N4    1 
ATOM   2780  C  C5    . C   A  1  140  ? 86.517  145.067 21.469  1.00 50.41  ? 141  C   A C5    1 
ATOM   2781  C  C6    . C   A  1  140  ? 86.617  145.931 20.450  1.00 49.05  ? 141  C   A C6    1 
ATOM   2782  P  P     . G   A  1  141  ? 86.889  149.624 14.990  1.00 48.21  ? 142  G   A P     1 
ATOM   2783  O  OP1   . G   A  1  141  ? 88.223  149.788 14.350  1.00 47.02  ? 142  G   A OP1   1 
ATOM   2784  O  OP2   . G   A  1  141  ? 86.226  150.785 15.641  1.00 45.83  ? 142  G   A OP2   1 
ATOM   2785  O  "O5'" . G   A  1  141  ? 85.889  149.044 13.900  1.00 46.42  ? 142  G   A "O5'" 1 
ATOM   2786  C  "C5'" . G   A  1  141  ? 85.777  149.632 12.602  1.00 44.60  ? 142  G   A "C5'" 1 
ATOM   2787  C  "C4'" . G   A  1  141  ? 85.615  148.546 11.570  1.00 43.91  ? 142  G   A "C4'" 1 
ATOM   2788  O  "O4'" . G   A  1  141  ? 86.869  147.836 11.390  1.00 44.19  ? 142  G   A "O4'" 1 
ATOM   2789  C  "C3'" . G   A  1  141  ? 84.647  147.452 11.971  1.00 42.72  ? 142  G   A "C3'" 1 
ATOM   2790  O  "O3'" . G   A  1  141  ? 83.305  147.831 11.772  1.00 42.31  ? 142  G   A "O3'" 1 
ATOM   2791  C  "C2'" . G   A  1  141  ? 85.085  146.296 11.092  1.00 43.04  ? 142  G   A "C2'" 1 
ATOM   2792  O  "O2'" . G   A  1  141  ? 84.636  146.438 9.759   1.00 44.44  ? 142  G   A "O2'" 1 
ATOM   2793  C  "C1'" . G   A  1  141  ? 86.604  146.466 11.135  1.00 43.93  ? 142  G   A "C1'" 1 
ATOM   2794  N  N9    . G   A  1  141  ? 87.253  145.669 12.173  1.00 44.81  ? 142  G   A N9    1 
ATOM   2795  C  C8    . G   A  1  141  ? 87.959  146.132 13.260  1.00 43.82  ? 142  G   A C8    1 
ATOM   2796  N  N7    . G   A  1  141  ? 88.499  145.175 13.966  1.00 43.34  ? 142  G   A N7    1 
ATOM   2797  C  C5    . G   A  1  141  ? 88.114  144.008 13.320  1.00 43.85  ? 142  G   A C5    1 
ATOM   2798  C  C6    . G   A  1  141  ? 88.421  142.657 13.611  1.00 43.72  ? 142  G   A C6    1 
ATOM   2799  O  O6    . G   A  1  141  ? 89.138  142.210 14.515  1.00 42.76  ? 142  G   A O6    1 
ATOM   2800  N  N1    . G   A  1  141  ? 87.806  141.787 12.714  1.00 43.39  ? 142  G   A N1    1 
ATOM   2801  C  C2    . G   A  1  141  ? 87.007  142.169 11.668  1.00 44.57  ? 142  G   A C2    1 
ATOM   2802  N  N2    . G   A  1  141  ? 86.491  141.183 10.927  1.00 45.21  ? 142  G   A N2    1 
ATOM   2803  N  N3    . G   A  1  141  ? 86.730  143.428 11.371  1.00 45.39  ? 142  G   A N3    1 
ATOM   2804  C  C4    . G   A  1  141  ? 87.316  144.290 12.232  1.00 45.03  ? 142  G   A C4    1 
ATOM   2805  P  P     . C   A  1  142  ? 82.167  147.180 12.694  1.00 43.89  ? 143  C   A P     1 
ATOM   2806  O  OP1   . C   A  1  142  ? 80.879  147.795 12.295  1.00 42.33  ? 143  C   A OP1   1 
ATOM   2807  O  OP2   . C   A  1  142  ? 82.597  147.218 14.130  1.00 42.26  ? 143  C   A OP2   1 
ATOM