data_1NKN
# 
_entry.id   1NKN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NKN         
RCSB  RCSB017954   
WWPDB D_1000017954 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NKN 
_pdbx_database_status.recvd_initial_deposition_date   2003-01-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, Y.'           1 
'Brown, J.H.'      2 
'Reshetnikova, L.' 3 
'Blazsek, A.'      4 
'Farkas, L.'       5 
'Nyitray, L.'      6 
'Cohen, C.'        7 
# 
_citation.id                        primary 
_citation.title                     'Visualization of an unstable coiled coil from the scallop myosin rod' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            424 
_citation.page_first                341 
_citation.page_last                 345 
_citation.year                      2003 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12867988 
_citation.pdbx_database_id_DOI      10.1038/nature01801 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, Y.'           1 
primary 'Brown, J.H.'      2 
primary 'Reshetnikova, L.' 3 
primary 'Blazsek, A.'      4 
primary 'Farkas, L.'       5 
primary 'Nyitray, L.'      6 
primary 'Cohen, C.'        7 
# 
_cell.entry_id           1NKN 
_cell.length_a           54.034 
_cell.length_b           73.303 
_cell.length_c           102.975 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NKN 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man S2N51-GCN4 10559.174 4  ? ? ? ? 
2 water   nat water      18.015    82 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVA
RLKKLVGER
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVA
RLKKLVGER
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  PRO n 
1 6  LEU n 
1 7  LEU n 
1 8  SER n 
1 9  ILE n 
1 10 ALA n 
1 11 ARG n 
1 12 GLN n 
1 13 GLU n 
1 14 GLU n 
1 15 GLU n 
1 16 MET n 
1 17 LYS n 
1 18 GLU n 
1 19 GLN n 
1 20 LEU n 
1 21 LYS n 
1 22 GLN n 
1 23 MET n 
1 24 ASP n 
1 25 LYS n 
1 26 MET n 
1 27 LYS n 
1 28 GLU n 
1 29 ASP n 
1 30 LEU n 
1 31 ALA n 
1 32 LYS n 
1 33 THR n 
1 34 GLU n 
1 35 ARG n 
1 36 ILE n 
1 37 LYS n 
1 38 LYS n 
1 39 GLU n 
1 40 LEU n 
1 41 GLU n 
1 42 GLU n 
1 43 GLN n 
1 44 ASN n 
1 45 VAL n 
1 46 THR n 
1 47 LEU n 
1 48 LEU n 
1 49 GLU n 
1 50 GLN n 
1 51 LYS n 
1 52 ASN n 
1 53 ASP n 
1 54 LEU n 
1 55 PHE n 
1 56 GLY n 
1 57 SER n 
1 58 MET n 
1 59 LYS n 
1 60 GLN n 
1 61 LEU n 
1 62 GLU n 
1 63 ASP n 
1 64 LYS n 
1 65 VAL n 
1 66 GLU n 
1 67 GLU n 
1 68 LEU n 
1 69 LEU n 
1 70 SER n 
1 71 LYS n 
1 72 ASN n 
1 73 TYR n 
1 74 HIS n 
1 75 LEU n 
1 76 GLU n 
1 77 ASN n 
1 78 GLU n 
1 79 VAL n 
1 80 ALA n 
1 81 ARG n 
1 82 LEU n 
1 83 LYS n 
1 84 LYS n 
1 85 LEU n 
1 86 VAL n 
1 87 GLY n 
1 88 GLU n 
1 89 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;, baker's yeast
;
_entity_src_gen.gene_src_genus                     'Argopecten, Saccharomyces' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   , 
_entity_src_gen.gene_src_strain                    , 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Argopecten irradians, Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     31199,4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NKN A 58 ? 89 ? P03069 250 ? 281 ? 888 919 
2 1 1NKN B 58 ? 89 ? P03069 250 ? 281 ? 888 919 
3 1 1NKN C 58 ? 89 ? P03069 250 ? 281 ? 888 919 
4 1 1NKN D 58 ? 89 ? P03069 250 ? 281 ? 888 919 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1NKN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_percent_sol   56.14 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.9 
_exptl_crystal_grow.pdbx_details    
'sodium chloride, sodium azide, MOPS, PEG 200 MME, pH 6.9, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.939 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.939 
# 
_reflns.entry_id                     1NKN 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            2.50 
_reflns.d_resolution_low             40.00 
_reflns.number_all                   14762 
_reflns.number_obs                   13342 
_reflns.percent_possible_obs         90.4 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.1 
_reflns.B_iso_Wilson_estimate        49.4 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   75.7 
_reflns_shell.Rmerge_I_obs           0.203 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.28 
_reflns_shell.pdbx_redundancy        2.76 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1458 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1NKN 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             40.00 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12880 
_refine.ls_number_reflns_R_free                  911 
_refine.ls_percent_reflns_obs                    87.4 
_refine.ls_R_factor_all                          0.2467 
_refine.ls_R_factor_obs                          0.2467 
_refine.ls_R_factor_R_work                       0.2435 
_refine.ls_R_factor_R_free                       0.2893 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2495 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             82 
_refine_hist.number_atoms_total               2577 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.012 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
. 2.50 2.55 . 0.3224 . 0.4153 . . 95  1268 . . 'X-RAY DIFFRACTION' . 
. 2.55 2.60 . 0.2988 . 0.3805 . . 113 1374 . . 'X-RAY DIFFRACTION' . 
. 2.60 2.66 . 0.2919 . 0.3244 . . 88  1445 . . 'X-RAY DIFFRACTION' . 
. 2.66 2.72 . 0.2878 . 0.3287 . . 100 1539 . . 'X-RAY DIFFRACTION' . 
. 2.72 2.79 . 0.2722 . 0.3055 . . 111 1680 . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1NKN 
_struct.title                     
'VISUALIZING AN UNSTABLE COILED COIL: THE CRYSTAL STRUCTURE OF AN N-TERMINAL SEGMENT OF THE SCALLOP MYOSIN ROD' 
_struct.pdbx_descriptor           S2N51-GCN4 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NKN 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            'alpha helix, coiled coil, CONTRACTILE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 16 ? GLY A 87 ? MET A 846 GLY A 917 1 ? 72 
HELX_P HELX_P2 2 GLU B 15 ? GLY B 87 ? GLU B 845 GLY B 917 1 ? 73 
HELX_P HELX_P3 3 GLU C 15 ? GLY C 87 ? GLU C 845 GLY C 917 1 ? 73 
HELX_P HELX_P4 4 GLU D 15 ? VAL D 86 ? GLU D 845 VAL D 916 1 ? 72 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1NKN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NKN 
_atom_sites.fract_transf_matrix[1][1]   0.018507 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013642 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009711 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 16 ? 49.002  11.346 92.873  1.00 129.36 ? 846 MET A N   1 
ATOM   2    C CA  . MET A 1 16 ? 47.535  11.567 93.017  1.00 130.83 ? 846 MET A CA  1 
ATOM   3    C C   . MET A 1 16 ? 47.100  12.850 92.322  1.00 131.24 ? 846 MET A C   1 
ATOM   4    O O   . MET A 1 16 ? 45.933  13.011 91.975  1.00 132.85 ? 846 MET A O   1 
ATOM   5    C CB  . MET A 1 16 ? 47.149  11.660 94.495  1.00 133.46 ? 846 MET A CB  1 
ATOM   6    C CG  . MET A 1 16 ? 45.653  11.865 94.723  1.00 136.69 ? 846 MET A CG  1 
ATOM   7    S SD  . MET A 1 16 ? 45.241  12.690 96.280  1.00 137.68 ? 846 MET A SD  1 
ATOM   8    C CE  . MET A 1 16 ? 45.059  14.394 95.711  1.00 134.67 ? 846 MET A CE  1 
ATOM   9    N N   . LYS A 1 17 ? 48.036  13.772 92.129  1.00 131.54 ? 847 LYS A N   1 
ATOM   10   C CA  . LYS A 1 17 ? 47.714  15.038 91.483  1.00 131.08 ? 847 LYS A CA  1 
ATOM   11   C C   . LYS A 1 17 ? 47.435  14.867 89.994  1.00 130.29 ? 847 LYS A C   1 
ATOM   12   O O   . LYS A 1 17 ? 46.484  15.444 89.465  1.00 131.27 ? 847 LYS A O   1 
ATOM   13   C CB  . LYS A 1 17 ? 48.847  16.048 91.702  1.00 129.81 ? 847 LYS A CB  1 
ATOM   14   C CG  . LYS A 1 17 ? 50.239  15.496 91.455  1.00 128.77 ? 847 LYS A CG  1 
ATOM   15   C CD  . LYS A 1 17 ? 51.302  16.525 91.793  1.00 127.06 ? 847 LYS A CD  1 
ATOM   16   C CE  . LYS A 1 17 ? 52.698  15.955 91.605  1.00 126.21 ? 847 LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 17 ? 53.753  16.966 91.886  1.00 122.83 ? 847 LYS A NZ  1 
ATOM   18   N N   . GLU A 1 18 ? 48.258  14.067 89.323  1.00 128.77 ? 848 GLU A N   1 
ATOM   19   C CA  . GLU A 1 18 ? 48.085  13.828 87.895  1.00 126.25 ? 848 GLU A CA  1 
ATOM   20   C C   . GLU A 1 18 ? 46.731  13.201 87.585  1.00 123.34 ? 848 GLU A C   1 
ATOM   21   O O   . GLU A 1 18 ? 46.113  13.522 86.570  1.00 123.90 ? 848 GLU A O   1 
ATOM   22   C CB  . GLU A 1 18 ? 49.196  12.917 87.366  1.00 129.11 ? 848 GLU A CB  1 
ATOM   23   C CG  . GLU A 1 18 ? 49.044  12.557 85.892  1.00 133.48 ? 848 GLU A CG  1 
ATOM   24   C CD  . GLU A 1 18 ? 50.148  11.644 85.392  1.00 135.62 ? 848 GLU A CD  1 
ATOM   25   O OE1 . GLU A 1 18 ? 50.327  10.552 85.973  1.00 136.12 ? 848 GLU A OE1 1 
ATOM   26   O OE2 . GLU A 1 18 ? 50.834  12.016 84.415  1.00 136.30 ? 848 GLU A OE2 1 
ATOM   27   N N   . GLN A 1 19 ? 46.274  12.304 88.457  1.00 118.23 ? 849 GLN A N   1 
ATOM   28   C CA  . GLN A 1 19 ? 44.993  11.638 88.253  1.00 110.30 ? 849 GLN A CA  1 
ATOM   29   C C   . GLN A 1 19 ? 43.883  12.678 88.189  1.00 108.22 ? 849 GLN A C   1 
ATOM   30   O O   . GLN A 1 19 ? 43.079  12.668 87.263  1.00 109.70 ? 849 GLN A O   1 
ATOM   31   C CB  . GLN A 1 19 ? 44.716  10.635 89.376  1.00 105.91 ? 849 GLN A CB  1 
ATOM   32   C CG  . GLN A 1 19 ? 44.279  11.252 90.691  1.00 104.60 ? 849 GLN A CG  1 
ATOM   33   C CD  . GLN A 1 19 ? 42.868  10.865 91.079  1.00 104.28 ? 849 GLN A CD  1 
ATOM   34   O OE1 . GLN A 1 19 ? 42.596  9.709  91.402  1.00 103.75 ? 849 GLN A OE1 1 
ATOM   35   N NE2 . GLN A 1 19 ? 41.958  11.831 91.046  1.00 103.93 ? 849 GLN A NE2 1 
ATOM   36   N N   . LEU A 1 20 ? 43.841  13.581 89.164  1.00 107.58 ? 850 LEU A N   1 
ATOM   37   C CA  . LEU A 1 20 ? 42.824  14.629 89.169  1.00 109.90 ? 850 LEU A CA  1 
ATOM   38   C C   . LEU A 1 20 ? 42.863  15.319 87.820  1.00 109.16 ? 850 LEU A C   1 
ATOM   39   O O   . LEU A 1 20 ? 41.840  15.762 87.304  1.00 109.24 ? 850 LEU A O   1 
ATOM   40   C CB  . LEU A 1 20 ? 43.108  15.654 90.273  1.00 113.63 ? 850 LEU A CB  1 
ATOM   41   C CG  . LEU A 1 20 ? 42.211  16.894 90.382  1.00 113.53 ? 850 LEU A CG  1 
ATOM   42   C CD1 . LEU A 1 20 ? 42.321  17.468 91.785  1.00 111.80 ? 850 LEU A CD1 1 
ATOM   43   C CD2 . LEU A 1 20 ? 42.601  17.939 89.341  1.00 111.95 ? 850 LEU A CD2 1 
ATOM   44   N N   . LYS A 1 21 ? 44.060  15.408 87.254  1.00 107.19 ? 851 LYS A N   1 
ATOM   45   C CA  . LYS A 1 21 ? 44.236  16.027 85.946  1.00 106.76 ? 851 LYS A CA  1 
ATOM   46   C C   . LYS A 1 21 ? 43.807  15.059 84.860  1.00 106.71 ? 851 LYS A C   1 
ATOM   47   O O   . LYS A 1 21 ? 43.007  15.397 83.981  1.00 109.75 ? 851 LYS A O   1 
ATOM   48   C CB  . LYS A 1 21 ? 45.696  16.423 85.736  1.00 105.76 ? 851 LYS A CB  1 
ATOM   49   C CG  . LYS A 1 21 ? 46.091  16.621 84.273  1.00 105.60 ? 851 LYS A CG  1 
ATOM   50   C CD  . LYS A 1 21 ? 47.402  17.377 84.117  1.00 99.14  ? 851 LYS A CD  1 
ATOM   51   C CE  . LYS A 1 21 ? 47.207  18.886 84.268  1.00 97.29  ? 851 LYS A CE  1 
ATOM   52   N NZ  . LYS A 1 21 ? 46.639  19.265 85.586  1.00 80.82  ? 851 LYS A NZ  1 
ATOM   53   N N   . GLN A 1 22 ? 44.337  13.845 84.938  1.00 104.04 ? 852 GLN A N   1 
ATOM   54   C CA  . GLN A 1 22 ? 44.005  12.801 83.981  1.00 102.35 ? 852 GLN A CA  1 
ATOM   55   C C   . GLN A 1 22 ? 42.490  12.642 83.939  1.00 98.63  ? 852 GLN A C   1 
ATOM   56   O O   . GLN A 1 22 ? 41.915  12.359 82.894  1.00 99.89  ? 852 GLN A O   1 
ATOM   57   C CB  . GLN A 1 22 ? 44.657  11.480 84.402  1.00 105.47 ? 852 GLN A CB  1 
ATOM   58   C CG  . GLN A 1 22 ? 44.536  10.355 83.385  1.00 111.21 ? 852 GLN A CG  1 
ATOM   59   C CD  . GLN A 1 22 ? 45.369  9.145  83.761  1.00 113.65 ? 852 GLN A CD  1 
ATOM   60   O OE1 . GLN A 1 22 ? 46.598  9.217  83.836  1.00 117.73 ? 852 GLN A OE1 1 
ATOM   61   N NE2 . GLN A 1 22 ? 44.703  8.021  83.990  1.00 113.18 ? 852 GLN A NE2 1 
ATOM   62   N N   . MET A 1 23 ? 41.851  12.848 85.086  1.00 95.03  ? 853 MET A N   1 
ATOM   63   C CA  . MET A 1 23 ? 40.399  12.737 85.198  1.00 90.08  ? 853 MET A CA  1 
ATOM   64   C C   . MET A 1 23 ? 39.727  13.967 84.616  1.00 88.48  ? 853 MET A C   1 
ATOM   65   O O   . MET A 1 23 ? 38.649  13.891 84.021  1.00 91.54  ? 853 MET A O   1 
ATOM   66   C CB  . MET A 1 23 ? 39.994  12.586 86.671  1.00 86.01  ? 853 MET A CB  1 
ATOM   67   C CG  . MET A 1 23 ? 38.487  12.463 86.920  1.00 89.57  ? 853 MET A CG  1 
ATOM   68   S SD  . MET A 1 23 ? 38.025  12.389 88.676  1.00 95.81  ? 853 MET A SD  1 
ATOM   69   C CE  . MET A 1 23 ? 37.839  14.135 89.076  1.00 96.85  ? 853 MET A CE  1 
ATOM   70   N N   . ASP A 1 24 ? 40.379  15.105 84.796  1.00 86.34  ? 854 ASP A N   1 
ATOM   71   C CA  . ASP A 1 24 ? 39.855  16.361 84.293  1.00 86.05  ? 854 ASP A CA  1 
ATOM   72   C C   . ASP A 1 24 ? 39.709  16.285 82.776  1.00 78.19  ? 854 ASP A C   1 
ATOM   73   O O   . ASP A 1 24 ? 38.665  16.643 82.222  1.00 73.01  ? 854 ASP A O   1 
ATOM   74   C CB  . ASP A 1 24 ? 40.787  17.515 84.695  1.00 100.72 ? 854 ASP A CB  1 
ATOM   75   C CG  . ASP A 1 24 ? 40.236  18.873 84.305  1.00 112.31 ? 854 ASP A CG  1 
ATOM   76   O OD1 . ASP A 1 24 ? 39.954  19.052 83.105  1.00 117.31 ? 854 ASP A OD1 1 
ATOM   77   O OD2 . ASP A 1 24 ? 40.088  19.748 85.188  1.00 118.95 ? 854 ASP A OD2 1 
ATOM   78   N N   . LYS A 1 25 ? 40.765  15.819 82.114  1.00 72.63  ? 855 LYS A N   1 
ATOM   79   C CA  . LYS A 1 25 ? 40.775  15.693 80.661  1.00 63.53  ? 855 LYS A CA  1 
ATOM   80   C C   . LYS A 1 25 ? 39.699  14.681 80.277  1.00 59.95  ? 855 LYS A C   1 
ATOM   81   O O   . LYS A 1 25 ? 38.878  14.929 79.393  1.00 52.72  ? 855 LYS A O   1 
ATOM   82   C CB  . LYS A 1 25 ? 42.142  15.200 80.183  1.00 68.99  ? 855 LYS A CB  1 
ATOM   83   C CG  . LYS A 1 25 ? 42.373  15.314 78.679  1.00 81.73  ? 855 LYS A CG  1 
ATOM   84   C CD  . LYS A 1 25 ? 43.824  14.981 78.353  1.00 85.79  ? 855 LYS A CD  1 
ATOM   85   C CE  . LYS A 1 25 ? 44.145  15.303 76.910  1.00 86.88  ? 855 LYS A CE  1 
ATOM   86   N NZ  . LYS A 1 25 ? 45.587  15.091 76.623  1.00 92.50  ? 855 LYS A NZ  1 
ATOM   87   N N   . MET A 1 26 ? 39.699  13.548 80.975  1.00 53.83  ? 856 MET A N   1 
ATOM   88   C CA  . MET A 1 26 ? 38.755  12.464 80.738  1.00 49.65  ? 856 MET A CA  1 
ATOM   89   C C   . MET A 1 26 ? 37.295  12.932 80.809  1.00 52.13  ? 856 MET A C   1 
ATOM   90   O O   . MET A 1 26 ? 36.440  12.434 80.070  1.00 44.71  ? 856 MET A O   1 
ATOM   91   C CB  . MET A 1 26 ? 39.012  11.364 81.759  1.00 49.65  ? 856 MET A CB  1 
ATOM   92   C CG  . MET A 1 26 ? 38.731  9.960  81.262  1.00 65.29  ? 856 MET A CG  1 
ATOM   93   S SD  . MET A 1 26 ? 39.535  8.747  82.340  1.00 80.05  ? 856 MET A SD  1 
ATOM   94   C CE  . MET A 1 26 ? 41.186  8.676  81.614  1.00 71.28  ? 856 MET A CE  1 
ATOM   95   N N   . LYS A 1 27 ? 37.016  13.888 81.691  1.00 41.65  ? 857 LYS A N   1 
ATOM   96   C CA  . LYS A 1 27 ? 35.669  14.418 81.840  1.00 44.52  ? 857 LYS A CA  1 
ATOM   97   C C   . LYS A 1 27 ? 35.249  15.194 80.599  1.00 43.08  ? 857 LYS A C   1 
ATOM   98   O O   . LYS A 1 27 ? 34.081  15.168 80.209  1.00 35.54  ? 857 LYS A O   1 
ATOM   99   C CB  . LYS A 1 27 ? 35.581  15.337 83.060  1.00 52.75  ? 857 LYS A CB  1 
ATOM   100  C CG  . LYS A 1 27 ? 35.556  14.625 84.402  1.00 59.15  ? 857 LYS A CG  1 
ATOM   101  C CD  . LYS A 1 27 ? 35.347  15.618 85.536  1.00 64.10  ? 857 LYS A CD  1 
ATOM   102  C CE  . LYS A 1 27 ? 35.286  14.927 86.891  1.00 70.83  ? 857 LYS A CE  1 
ATOM   103  N NZ  . LYS A 1 27 ? 35.098  15.899 88.013  1.00 77.54  ? 857 LYS A NZ  1 
ATOM   104  N N   . GLU A 1 28 ? 36.195  15.893 79.982  1.00 46.00  ? 858 GLU A N   1 
ATOM   105  C CA  . GLU A 1 28 ? 35.873  16.661 78.789  1.00 46.69  ? 858 GLU A CA  1 
ATOM   106  C C   . GLU A 1 28 ? 35.721  15.749 77.587  1.00 45.01  ? 858 GLU A C   1 
ATOM   107  O O   . GLU A 1 28 ? 34.959  16.048 76.665  1.00 47.07  ? 858 GLU A O   1 
ATOM   108  C CB  . GLU A 1 28 ? 36.933  17.727 78.519  1.00 49.62  ? 858 GLU A CB  1 
ATOM   109  C CG  . GLU A 1 28 ? 36.696  19.005 79.299  1.00 73.96  ? 858 GLU A CG  1 
ATOM   110  C CD  . GLU A 1 28 ? 35.383  19.685 78.927  1.00 85.16  ? 858 GLU A CD  1 
ATOM   111  O OE1 . GLU A 1 28 ? 34.317  19.042 79.033  1.00 83.67  ? 858 GLU A OE1 1 
ATOM   112  O OE2 . GLU A 1 28 ? 35.414  20.869 78.528  1.00 98.05  ? 858 GLU A OE2 1 
ATOM   113  N N   . ASP A 1 29 ? 36.440  14.633 77.600  1.00 37.72  ? 859 ASP A N   1 
ATOM   114  C CA  . ASP A 1 29 ? 36.347  13.676 76.509  1.00 36.30  ? 859 ASP A CA  1 
ATOM   115  C C   . ASP A 1 29 ? 35.018  12.945 76.593  1.00 32.34  ? 859 ASP A C   1 
ATOM   116  O O   . ASP A 1 29 ? 34.327  12.773 75.589  1.00 28.24  ? 859 ASP A O   1 
ATOM   117  C CB  . ASP A 1 29 ? 37.506  12.687 76.568  1.00 44.63  ? 859 ASP A CB  1 
ATOM   118  C CG  . ASP A 1 29 ? 38.712  13.174 75.794  1.00 56.64  ? 859 ASP A CG  1 
ATOM   119  O OD1 . ASP A 1 29 ? 38.579  13.326 74.561  1.00 69.51  ? 859 ASP A OD1 1 
ATOM   120  O OD2 . ASP A 1 29 ? 39.780  13.409 76.406  1.00 53.20  ? 859 ASP A OD2 1 
ATOM   121  N N   . LEU A 1 30 ? 34.647  12.533 77.800  1.00 28.25  ? 860 LEU A N   1 
ATOM   122  C CA  . LEU A 1 30 ? 33.391  11.839 77.980  1.00 23.75  ? 860 LEU A CA  1 
ATOM   123  C C   . LEU A 1 30 ? 32.264  12.780 77.574  1.00 28.59  ? 860 LEU A C   1 
ATOM   124  O O   . LEU A 1 30 ? 31.361  12.407 76.819  1.00 27.93  ? 860 LEU A O   1 
ATOM   125  C CB  . LEU A 1 30 ? 33.228  11.423 79.430  1.00 23.01  ? 860 LEU A CB  1 
ATOM   126  C CG  . LEU A 1 30 ? 32.008  10.551 79.698  1.00 28.26  ? 860 LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 30 ? 32.077  9.318  78.803  1.00 23.92  ? 860 LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 30 ? 31.968  10.159 81.171  1.00 27.20  ? 860 LEU A CD2 1 
ATOM   129  N N   . ALA A 1 31 ? 32.328  14.009 78.073  1.00 26.94  ? 861 ALA A N   1 
ATOM   130  C CA  . ALA A 1 31 ? 31.318  15.014 77.756  1.00 27.08  ? 861 ALA A CA  1 
ATOM   131  C C   . ALA A 1 31 ? 31.192  15.226 76.243  1.00 24.78  ? 861 ALA A C   1 
ATOM   132  O O   . ALA A 1 31 ? 30.087  15.399 75.727  1.00 20.60  ? 861 ALA A O   1 
ATOM   133  C CB  . ALA A 1 31 ? 31.661  16.334 78.441  1.00 20.26  ? 861 ALA A CB  1 
ATOM   134  N N   . LYS A 1 32 ? 32.320  15.220 75.538  1.00 16.25  ? 862 LYS A N   1 
ATOM   135  C CA  . LYS A 1 32 ? 32.302  15.409 74.091  1.00 23.39  ? 862 LYS A CA  1 
ATOM   136  C C   . LYS A 1 32 ? 31.685  14.185 73.418  1.00 28.39  ? 862 LYS A C   1 
ATOM   137  O O   . LYS A 1 32 ? 30.751  14.301 72.626  1.00 28.41  ? 862 LYS A O   1 
ATOM   138  C CB  . LYS A 1 32 ? 33.719  15.603 73.563  1.00 28.01  ? 862 LYS A CB  1 
ATOM   139  C CG  . LYS A 1 32 ? 33.800  15.935 72.078  1.00 37.42  ? 862 LYS A CG  1 
ATOM   140  C CD  . LYS A 1 32 ? 35.210  15.706 71.566  1.00 39.72  ? 862 LYS A CD  1 
ATOM   141  C CE  . LYS A 1 32 ? 35.413  16.216 70.145  1.00 39.18  ? 862 LYS A CE  1 
ATOM   142  N NZ  . LYS A 1 32 ? 35.554  17.696 70.099  1.00 47.22  ? 862 LYS A NZ  1 
ATOM   143  N N   . THR A 1 33 ? 32.212  13.011 73.752  1.00 28.91  ? 863 THR A N   1 
ATOM   144  C CA  . THR A 1 33 ? 31.725  11.771 73.182  1.00 23.93  ? 863 THR A CA  1 
ATOM   145  C C   . THR A 1 33 ? 30.237  11.604 73.446  1.00 24.29  ? 863 THR A C   1 
ATOM   146  O O   . THR A 1 33 ? 29.500  11.115 72.596  1.00 29.92  ? 863 THR A O   1 
ATOM   147  C CB  . THR A 1 33 ? 32.473  10.566 73.760  1.00 24.06  ? 863 THR A CB  1 
ATOM   148  O OG1 . THR A 1 33 ? 33.869  10.684 73.465  1.00 25.82  ? 863 THR A OG1 1 
ATOM   149  C CG2 . THR A 1 33 ? 31.950  9.281  73.154  1.00 26.52  ? 863 THR A CG2 1 
ATOM   150  N N   . GLU A 1 34 ? 29.790  12.014 74.622  1.00 26.80  ? 864 GLU A N   1 
ATOM   151  C CA  . GLU A 1 34 ? 28.383  11.896 74.963  1.00 29.59  ? 864 GLU A CA  1 
ATOM   152  C C   . GLU A 1 34 ? 27.522  12.826 74.124  1.00 32.07  ? 864 GLU A C   1 
ATOM   153  O O   . GLU A 1 34 ? 26.487  12.424 73.592  1.00 40.69  ? 864 GLU A O   1 
ATOM   154  C CB  . GLU A 1 34 ? 28.175  12.186 76.446  1.00 34.67  ? 864 GLU A CB  1 
ATOM   155  C CG  . GLU A 1 34 ? 28.412  10.986 77.325  1.00 51.21  ? 864 GLU A CG  1 
ATOM   156  C CD  . GLU A 1 34 ? 28.177  11.286 78.788  1.00 72.31  ? 864 GLU A CD  1 
ATOM   157  O OE1 . GLU A 1 34 ? 27.971  10.323 79.566  1.00 73.40  ? 864 GLU A OE1 1 
ATOM   158  O OE2 . GLU A 1 34 ? 28.205  12.483 79.159  1.00 79.73  ? 864 GLU A OE2 1 
ATOM   159  N N   . ARG A 1 35 ? 27.943  14.076 74.010  1.00 29.14  ? 865 ARG A N   1 
ATOM   160  C CA  . ARG A 1 35 ? 27.199  15.033 73.213  1.00 21.60  ? 865 ARG A CA  1 
ATOM   161  C C   . ARG A 1 35 ? 27.110  14.565 71.752  1.00 29.85  ? 865 ARG A C   1 
ATOM   162  O O   . ARG A 1 35 ? 26.082  14.769 71.095  1.00 21.54  ? 865 ARG A O   1 
ATOM   163  C CB  . ARG A 1 35 ? 27.878  16.395 73.249  1.00 20.48  ? 865 ARG A CB  1 
ATOM   164  C CG  . ARG A 1 35 ? 27.171  17.430 72.392  1.00 25.16  ? 865 ARG A CG  1 
ATOM   165  C CD  . ARG A 1 35 ? 28.074  18.599 72.075  1.00 24.19  ? 865 ARG A CD  1 
ATOM   166  N NE  . ARG A 1 35 ? 28.867  18.370 70.873  1.00 18.44  ? 865 ARG A NE  1 
ATOM   167  C CZ  . ARG A 1 35 ? 30.185  18.524 70.810  1.00 31.61  ? 865 ARG A CZ  1 
ATOM   168  N NH1 . ARG A 1 35 ? 30.872  18.902 71.888  1.00 20.63  ? 865 ARG A NH1 1 
ATOM   169  N NH2 . ARG A 1 35 ? 30.815  18.320 69.661  1.00 21.48  ? 865 ARG A NH2 1 
ATOM   170  N N   . ILE A 1 36 ? 28.184  13.955 71.242  1.00 20.09  ? 866 ILE A N   1 
ATOM   171  C CA  . ILE A 1 36 ? 28.181  13.487 69.863  1.00 20.58  ? 866 ILE A CA  1 
ATOM   172  C C   . ILE A 1 36 ? 27.317  12.253 69.738  1.00 21.95  ? 866 ILE A C   1 
ATOM   173  O O   . ILE A 1 36 ? 26.668  12.038 68.711  1.00 24.55  ? 866 ILE A O   1 
ATOM   174  C CB  . ILE A 1 36 ? 29.590  13.184 69.345  1.00 23.98  ? 866 ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 36 ? 30.393  14.486 69.254  1.00 24.13  ? 866 ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 36 ? 29.505  12.561 67.959  1.00 19.99  ? 866 ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 36 ? 31.870  14.303 68.969  1.00 12.92  ? 866 ILE A CD1 1 
ATOM   178  N N   . LYS A 1 37 ? 27.292  11.438 70.783  1.00 21.15  ? 867 LYS A N   1 
ATOM   179  C CA  . LYS A 1 37 ? 26.444  10.261 70.745  1.00 22.30  ? 867 LYS A CA  1 
ATOM   180  C C   . LYS A 1 37 ? 24.990  10.739 70.642  1.00 26.17  ? 867 LYS A C   1 
ATOM   181  O O   . LYS A 1 37 ? 24.189  10.186 69.881  1.00 28.33  ? 867 LYS A O   1 
ATOM   182  C CB  . LYS A 1 37 ? 26.644  9.411  72.001  1.00 19.24  ? 867 LYS A CB  1 
ATOM   183  C CG  . LYS A 1 37 ? 25.493  8.440  72.297  1.00 21.85  ? 867 LYS A CG  1 
ATOM   184  C CD  . LYS A 1 37 ? 25.891  7.418  73.346  1.00 26.06  ? 867 LYS A CD  1 
ATOM   185  C CE  . LYS A 1 37 ? 24.692  6.603  73.813  1.00 31.61  ? 867 LYS A CE  1 
ATOM   186  N NZ  . LYS A 1 37 ? 23.714  7.402  74.630  1.00 30.18  ? 867 LYS A NZ  1 
ATOM   187  N N   . LYS A 1 38 ? 24.654  11.784 71.385  1.00 20.32  ? 868 LYS A N   1 
ATOM   188  C CA  . LYS A 1 38 ? 23.293  12.299 71.351  1.00 28.09  ? 868 LYS A CA  1 
ATOM   189  C C   . LYS A 1 38 ? 22.929  12.909 69.996  1.00 26.51  ? 868 LYS A C   1 
ATOM   190  O O   . LYS A 1 38 ? 21.789  12.801 69.560  1.00 32.99  ? 868 LYS A O   1 
ATOM   191  C CB  . LYS A 1 38 ? 23.083  13.313 72.475  1.00 25.60  ? 868 LYS A CB  1 
ATOM   192  C CG  . LYS A 1 38 ? 21.773  13.109 73.215  1.00 42.14  ? 868 LYS A CG  1 
ATOM   193  C CD  . LYS A 1 38 ? 20.580  13.598 72.392  1.00 54.06  ? 868 LYS A CD  1 
ATOM   194  C CE  . LYS A 1 38 ? 19.269  12.924 72.809  1.00 60.10  ? 868 LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 38 ? 19.170  11.517 72.303  1.00 58.99  ? 868 LYS A NZ  1 
ATOM   196  N N   . GLU A 1 39 ? 23.890  13.542 69.326  1.00 25.74  ? 869 GLU A N   1 
ATOM   197  C CA  . GLU A 1 39 ? 23.642  14.130 68.007  1.00 24.00  ? 869 GLU A CA  1 
ATOM   198  C C   . GLU A 1 39 ? 23.321  13.013 67.006  1.00 26.99  ? 869 GLU A C   1 
ATOM   199  O O   . GLU A 1 39 ? 22.417  13.132 66.169  1.00 19.54  ? 869 GLU A O   1 
ATOM   200  C CB  . GLU A 1 39 ? 24.880  14.892 67.523  1.00 28.46  ? 869 GLU A CB  1 
ATOM   201  C CG  . GLU A 1 39 ? 25.080  16.272 68.149  1.00 31.12  ? 869 GLU A CG  1 
ATOM   202  C CD  . GLU A 1 39 ? 26.532  16.751 68.064  1.00 46.55  ? 869 GLU A CD  1 
ATOM   203  O OE1 . GLU A 1 39 ? 27.287  16.212 67.223  1.00 46.88  ? 869 GLU A OE1 1 
ATOM   204  O OE2 . GLU A 1 39 ? 26.916  17.668 68.831  1.00 37.80  ? 869 GLU A OE2 1 
ATOM   205  N N   . LEU A 1 40 ? 24.081  11.928 67.096  1.00 24.54  ? 870 LEU A N   1 
ATOM   206  C CA  . LEU A 1 40 ? 23.890  10.789 66.216  1.00 22.88  ? 870 LEU A CA  1 
ATOM   207  C C   . LEU A 1 40 ? 22.526  10.138 66.471  1.00 24.78  ? 870 LEU A C   1 
ATOM   208  O O   . LEU A 1 40 ? 21.847  9.726  65.537  1.00 24.73  ? 870 LEU A O   1 
ATOM   209  C CB  . LEU A 1 40 ? 25.027  9.784  66.420  1.00 16.43  ? 870 LEU A CB  1 
ATOM   210  C CG  . LEU A 1 40 ? 26.395  10.303 65.948  1.00 25.17  ? 870 LEU A CG  1 
ATOM   211  C CD1 . LEU A 1 40 ? 27.519  9.419  66.440  1.00 23.97  ? 870 LEU A CD1 1 
ATOM   212  C CD2 . LEU A 1 40 ? 26.408  10.358 64.436  1.00 12.46  ? 870 LEU A CD2 1 
ATOM   213  N N   . GLU A 1 41 ? 22.107  10.060 67.728  1.00 22.37  ? 871 GLU A N   1 
ATOM   214  C CA  . GLU A 1 41 ? 20.810  9.460  68.018  1.00 23.19  ? 871 GLU A CA  1 
ATOM   215  C C   . GLU A 1 41 ? 19.740  10.302 67.334  1.00 27.05  ? 871 GLU A C   1 
ATOM   216  O O   . GLU A 1 41 ? 18.868  9.780  66.638  1.00 24.01  ? 871 GLU A O   1 
ATOM   217  C CB  . GLU A 1 41 ? 20.575  9.404  69.526  1.00 23.73  ? 871 GLU A CB  1 
ATOM   218  C CG  . GLU A 1 41 ? 21.762  8.796  70.270  1.00 43.37  ? 871 GLU A CG  1 
ATOM   219  C CD  . GLU A 1 41 ? 21.480  8.484  71.729  1.00 45.02  ? 871 GLU A CD  1 
ATOM   220  O OE1 . GLU A 1 41 ? 21.037  9.392  72.473  1.00 40.68  ? 871 GLU A OE1 1 
ATOM   221  O OE2 . GLU A 1 41 ? 21.715  7.322  72.130  1.00 44.19  ? 871 GLU A OE2 1 
ATOM   222  N N   . GLU A 1 42 ? 19.816  11.613 67.515  1.00 25.63  ? 872 GLU A N   1 
ATOM   223  C CA  . GLU A 1 42 ? 18.855  12.481 66.872  1.00 25.79  ? 872 GLU A CA  1 
ATOM   224  C C   . GLU A 1 42 ? 18.931  12.289 65.362  1.00 29.53  ? 872 GLU A C   1 
ATOM   225  O O   . GLU A 1 42 ? 17.906  12.104 64.705  1.00 31.63  ? 872 GLU A O   1 
ATOM   226  C CB  . GLU A 1 42 ? 19.110  13.940 67.249  1.00 29.14  ? 872 GLU A CB  1 
ATOM   227  C CG  . GLU A 1 42 ? 18.607  14.286 68.650  1.00 46.41  ? 872 GLU A CG  1 
ATOM   228  C CD  . GLU A 1 42 ? 17.118  13.962 68.831  1.00 61.20  ? 872 GLU A CD  1 
ATOM   229  O OE1 . GLU A 1 42 ? 16.724  12.789 68.633  1.00 63.84  ? 872 GLU A OE1 1 
ATOM   230  O OE2 . GLU A 1 42 ? 16.337  14.878 69.173  1.00 69.51  ? 872 GLU A OE2 1 
ATOM   231  N N   . GLN A 1 43 ? 20.138  12.299 64.806  1.00 26.38  ? 873 GLN A N   1 
ATOM   232  C CA  . GLN A 1 43 ? 20.255  12.118 63.366  1.00 26.93  ? 873 GLN A CA  1 
ATOM   233  C C   . GLN A 1 43 ? 19.624  10.794 62.948  1.00 30.72  ? 873 GLN A C   1 
ATOM   234  O O   . GLN A 1 43 ? 18.908  10.708 61.940  1.00 29.40  ? 873 GLN A O   1 
ATOM   235  C CB  . GLN A 1 43 ? 21.712  12.135 62.921  1.00 25.13  ? 873 GLN A CB  1 
ATOM   236  C CG  . GLN A 1 43 ? 21.858  11.793 61.459  1.00 28.90  ? 873 GLN A CG  1 
ATOM   237  C CD  . GLN A 1 43 ? 23.282  11.852 60.974  1.00 40.90  ? 873 GLN A CD  1 
ATOM   238  O OE1 . GLN A 1 43 ? 24.181  11.213 61.536  1.00 39.80  ? 873 GLN A OE1 1 
ATOM   239  N NE2 . GLN A 1 43 ? 23.503  12.618 59.911  1.00 44.56  ? 873 GLN A NE2 1 
ATOM   240  N N   . ASN A 1 44 ? 19.895  9.757  63.726  1.00 19.45  ? 874 ASN A N   1 
ATOM   241  C CA  . ASN A 1 44 ? 19.341  8.452  63.427  1.00 22.75  ? 874 ASN A CA  1 
ATOM   242  C C   . ASN A 1 44 ? 17.815  8.545  63.357  1.00 27.77  ? 874 ASN A C   1 
ATOM   243  O O   . ASN A 1 44 ? 17.204  8.027  62.421  1.00 27.35  ? 874 ASN A O   1 
ATOM   244  C CB  . ASN A 1 44 ? 19.778  7.444  64.485  1.00 23.08  ? 874 ASN A CB  1 
ATOM   245  C CG  . ASN A 1 44 ? 19.412  6.025  64.121  1.00 39.90  ? 874 ASN A CG  1 
ATOM   246  O OD1 . ASN A 1 44 ? 18.308  5.561  64.417  1.00 50.66  ? 874 ASN A OD1 1 
ATOM   247  N ND2 . ASN A 1 44 ? 20.333  5.325  63.459  1.00 33.75  ? 874 ASN A ND2 1 
ATOM   248  N N   . VAL A 1 45 ? 17.203  9.225  64.326  1.00 21.26  ? 875 VAL A N   1 
ATOM   249  C CA  . VAL A 1 45 ? 15.750  9.367  64.335  1.00 23.49  ? 875 VAL A CA  1 
ATOM   250  C C   . VAL A 1 45 ? 15.237  10.118 63.105  1.00 32.32  ? 875 VAL A C   1 
ATOM   251  O O   . VAL A 1 45 ? 14.218  9.726  62.517  1.00 33.86  ? 875 VAL A O   1 
ATOM   252  C CB  . VAL A 1 45 ? 15.250  10.091 65.615  1.00 32.43  ? 875 VAL A CB  1 
ATOM   253  C CG1 . VAL A 1 45 ? 13.772  10.405 65.497  1.00 16.14  ? 875 VAL A CG1 1 
ATOM   254  C CG2 . VAL A 1 45 ? 15.478  9.208  66.832  1.00 21.56  ? 875 VAL A CG2 1 
ATOM   255  N N   . THR A 1 46 ? 15.933  11.184 62.707  1.00 24.47  ? 876 THR A N   1 
ATOM   256  C CA  . THR A 1 46 ? 15.510  11.957 61.541  1.00 19.43  ? 876 THR A CA  1 
ATOM   257  C C   . THR A 1 46 ? 15.584  11.110 60.254  1.00 27.10  ? 876 THR A C   1 
ATOM   258  O O   . THR A 1 46 ? 14.705  11.182 59.396  1.00 25.45  ? 876 THR A O   1 
ATOM   259  C CB  . THR A 1 46 ? 16.367  13.230 61.381  1.00 29.34  ? 876 THR A CB  1 
ATOM   260  O OG1 . THR A 1 46 ? 16.128  14.110 62.486  1.00 29.91  ? 876 THR A OG1 1 
ATOM   261  C CG2 . THR A 1 46 ? 16.022  13.962 60.092  1.00 28.34  ? 876 THR A CG2 1 
ATOM   262  N N   . LEU A 1 47 ? 16.617  10.294 60.117  1.00 26.63  ? 877 LEU A N   1 
ATOM   263  C CA  . LEU A 1 47 ? 16.728  9.470  58.919  1.00 30.08  ? 877 LEU A CA  1 
ATOM   264  C C   . LEU A 1 47 ? 15.594  8.437  58.825  1.00 29.60  ? 877 LEU A C   1 
ATOM   265  O O   . LEU A 1 47 ? 15.025  8.214  57.758  1.00 22.84  ? 877 LEU A O   1 
ATOM   266  C CB  . LEU A 1 47 ? 18.089  8.773  58.886  1.00 20.74  ? 877 LEU A CB  1 
ATOM   267  C CG  . LEU A 1 47 ? 19.260  9.742  58.661  1.00 25.68  ? 877 LEU A CG  1 
ATOM   268  C CD1 . LEU A 1 47 ? 20.604  9.095  59.008  1.00 18.66  ? 877 LEU A CD1 1 
ATOM   269  C CD2 . LEU A 1 47 ? 19.231  10.189 57.222  1.00 19.14  ? 877 LEU A CD2 1 
ATOM   270  N N   . LEU A 1 48 ? 15.251  7.804  59.937  1.00 29.10  ? 878 LEU A N   1 
ATOM   271  C CA  . LEU A 1 48 ? 14.179  6.824  59.890  1.00 27.24  ? 878 LEU A CA  1 
ATOM   272  C C   . LEU A 1 48 ? 12.884  7.507  59.470  1.00 28.56  ? 878 LEU A C   1 
ATOM   273  O O   . LEU A 1 48 ? 12.113  6.966  58.675  1.00 28.15  ? 878 LEU A O   1 
ATOM   274  C CB  . LEU A 1 48 ? 13.995  6.134  61.246  1.00 20.13  ? 878 LEU A CB  1 
ATOM   275  C CG  . LEU A 1 48 ? 15.077  5.136  61.668  1.00 31.52  ? 878 LEU A CG  1 
ATOM   276  C CD1 . LEU A 1 48 ? 14.765  4.540  63.043  1.00 22.80  ? 878 LEU A CD1 1 
ATOM   277  C CD2 . LEU A 1 48 ? 15.151  4.041  60.637  1.00 23.06  ? 878 LEU A CD2 1 
ATOM   278  N N   . GLU A 1 49 ? 12.644  8.706  59.982  1.00 27.56  ? 879 GLU A N   1 
ATOM   279  C CA  . GLU A 1 49 ? 11.424  9.383  59.605  1.00 27.56  ? 879 GLU A CA  1 
ATOM   280  C C   . GLU A 1 49 ? 11.504  9.857  58.157  1.00 30.47  ? 879 GLU A C   1 
ATOM   281  O O   . GLU A 1 49 ? 10.474  9.970  57.481  1.00 27.56  ? 879 GLU A O   1 
ATOM   282  C CB  . GLU A 1 49 ? 11.101  10.539 60.572  1.00 34.08  ? 879 GLU A CB  1 
ATOM   283  C CG  . GLU A 1 49 ? 12.098  11.677 60.636  1.00 47.39  ? 879 GLU A CG  1 
ATOM   284  C CD  . GLU A 1 49 ? 11.624  12.806 61.550  1.00 62.24  ? 879 GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 49 ? 11.337  12.536 62.740  1.00 50.79  ? 879 GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 49 ? 11.537  13.963 61.079  1.00 65.81  ? 879 GLU A OE2 1 
ATOM   287  N N   . GLN A 1 50 ? 12.712  10.105 57.653  1.00 22.84  ? 880 GLN A N   1 
ATOM   288  C CA  . GLN A 1 50 ? 12.816  10.545 56.265  1.00 21.01  ? 880 GLN A CA  1 
ATOM   289  C C   . GLN A 1 50 ? 12.613  9.377  55.295  1.00 22.89  ? 880 GLN A C   1 
ATOM   290  O O   . GLN A 1 50 ? 11.953  9.533  54.255  1.00 20.81  ? 880 GLN A O   1 
ATOM   291  C CB  . GLN A 1 50 ? 14.142  11.263 56.018  1.00 28.21  ? 880 GLN A CB  1 
ATOM   292  C CG  . GLN A 1 50 ? 14.266  12.561 56.824  1.00 34.16  ? 880 GLN A CG  1 
ATOM   293  C CD  . GLN A 1 50 ? 15.530  13.359 56.514  1.00 34.84  ? 880 GLN A CD  1 
ATOM   294  O OE1 . GLN A 1 50 ? 16.616  12.800 56.372  1.00 37.00  ? 880 GLN A OE1 1 
ATOM   295  N NE2 . GLN A 1 50 ? 15.391  14.675 56.429  1.00 30.41  ? 880 GLN A NE2 1 
ATOM   296  N N   . LYS A 1 51 ? 13.142  8.201  55.633  1.00 17.86  ? 881 LYS A N   1 
ATOM   297  C CA  . LYS A 1 51 ? 12.952  7.023  54.773  1.00 24.34  ? 881 LYS A CA  1 
ATOM   298  C C   . LYS A 1 51 ? 11.462  6.749  54.658  1.00 30.68  ? 881 LYS A C   1 
ATOM   299  O O   . LYS A 1 51 ? 10.951  6.419  53.588  1.00 33.85  ? 881 LYS A O   1 
ATOM   300  C CB  . LYS A 1 51 ? 13.618  5.780  55.366  1.00 15.90  ? 881 LYS A CB  1 
ATOM   301  C CG  . LYS A 1 51 ? 15.090  5.626  55.021  1.00 27.46  ? 881 LYS A CG  1 
ATOM   302  C CD  . LYS A 1 51 ? 15.687  4.371  55.648  1.00 36.89  ? 881 LYS A CD  1 
ATOM   303  C CE  . LYS A 1 51 ? 14.900  3.119  55.278  1.00 38.61  ? 881 LYS A CE  1 
ATOM   304  N NZ  . LYS A 1 51 ? 15.560  1.904  55.827  1.00 39.52  ? 881 LYS A NZ  1 
ATOM   305  N N   . ASN A 1 52 ? 10.779  6.891  55.788  1.00 33.71  ? 882 ASN A N   1 
ATOM   306  C CA  . ASN A 1 52 ? 9.347   6.672  55.882  1.00 33.31  ? 882 ASN A CA  1 
ATOM   307  C C   . ASN A 1 52 ? 8.604   7.655  54.984  1.00 37.39  ? 882 ASN A C   1 
ATOM   308  O O   . ASN A 1 52 ? 7.662   7.278  54.293  1.00 39.35  ? 882 ASN A O   1 
ATOM   309  C CB  . ASN A 1 52 ? 8.909   6.834  57.333  1.00 45.83  ? 882 ASN A CB  1 
ATOM   310  C CG  . ASN A 1 52 ? 7.744   5.942  57.693  1.00 55.18  ? 882 ASN A CG  1 
ATOM   311  O OD1 . ASN A 1 52 ? 6.604   6.201  57.302  1.00 55.81  ? 882 ASN A OD1 1 
ATOM   312  N ND2 . ASN A 1 52 ? 8.025   4.872  58.433  1.00 60.11  ? 882 ASN A ND2 1 
ATOM   313  N N   . ASP A 1 53 ? 9.032   8.915  54.991  1.00 39.59  ? 883 ASP A N   1 
ATOM   314  C CA  . ASP A 1 53 ? 8.416   9.936  54.151  1.00 34.50  ? 883 ASP A CA  1 
ATOM   315  C C   . ASP A 1 53 ? 8.576   9.566  52.675  1.00 34.67  ? 883 ASP A C   1 
ATOM   316  O O   . ASP A 1 53 ? 7.652   9.718  51.881  1.00 38.12  ? 883 ASP A O   1 
ATOM   317  C CB  . ASP A 1 53 ? 9.076   11.292 54.395  1.00 50.01  ? 883 ASP A CB  1 
ATOM   318  C CG  . ASP A 1 53 ? 8.846   11.811 55.794  1.00 63.20  ? 883 ASP A CG  1 
ATOM   319  O OD1 . ASP A 1 53 ? 9.352   12.912 56.115  1.00 69.14  ? 883 ASP A OD1 1 
ATOM   320  O OD2 . ASP A 1 53 ? 8.156   11.117 56.571  1.00 75.55  ? 883 ASP A OD2 1 
ATOM   321  N N   . LEU A 1 54 ? 9.759   9.091  52.303  1.00 33.59  ? 884 LEU A N   1 
ATOM   322  C CA  . LEU A 1 54 ? 9.998   8.706  50.923  1.00 32.45  ? 884 LEU A CA  1 
ATOM   323  C C   . LEU A 1 54 ? 9.136   7.510  50.525  1.00 34.06  ? 884 LEU A C   1 
ATOM   324  O O   . LEU A 1 54 ? 8.660   7.443  49.395  1.00 43.06  ? 884 LEU A O   1 
ATOM   325  C CB  . LEU A 1 54 ? 11.477  8.397  50.712  1.00 32.24  ? 884 LEU A CB  1 
ATOM   326  C CG  . LEU A 1 54 ? 12.378  9.634  50.743  1.00 31.44  ? 884 LEU A CG  1 
ATOM   327  C CD1 . LEU A 1 54 ? 13.817  9.267  51.158  1.00 29.83  ? 884 LEU A CD1 1 
ATOM   328  C CD2 . LEU A 1 54 ? 12.337  10.284 49.386  1.00 21.29  ? 884 LEU A CD2 1 
ATOM   329  N N   . PHE A 1 55 ? 8.929   6.562  51.437  1.00 25.93  ? 885 PHE A N   1 
ATOM   330  C CA  . PHE A 1 55 ? 8.083   5.415  51.113  1.00 30.04  ? 885 PHE A CA  1 
ATOM   331  C C   . PHE A 1 55 ? 6.669   5.903  50.857  1.00 34.90  ? 885 PHE A C   1 
ATOM   332  O O   . PHE A 1 55 ? 5.999   5.422  49.940  1.00 31.06  ? 885 PHE A O   1 
ATOM   333  C CB  . PHE A 1 55 ? 8.067   4.386  52.247  1.00 25.42  ? 885 PHE A CB  1 
ATOM   334  C CG  . PHE A 1 55 ? 9.228   3.436  52.208  1.00 42.22  ? 885 PHE A CG  1 
ATOM   335  C CD1 . PHE A 1 55 ? 9.539   2.746  51.037  1.00 40.81  ? 885 PHE A CD1 1 
ATOM   336  C CD2 . PHE A 1 55 ? 10.022  3.237  53.328  1.00 41.58  ? 885 PHE A CD2 1 
ATOM   337  C CE1 . PHE A 1 55 ? 10.620  1.879  50.988  1.00 44.28  ? 885 PHE A CE1 1 
ATOM   338  C CE2 . PHE A 1 55 ? 11.108  2.368  53.285  1.00 39.86  ? 885 PHE A CE2 1 
ATOM   339  C CZ  . PHE A 1 55 ? 11.406  1.690  52.115  1.00 40.74  ? 885 PHE A CZ  1 
ATOM   340  N N   . GLY A 1 56 ? 6.235   6.864  51.679  1.00 33.58  ? 886 GLY A N   1 
ATOM   341  C CA  . GLY A 1 56 ? 4.910   7.445  51.555  1.00 18.98  ? 886 GLY A CA  1 
ATOM   342  C C   . GLY A 1 56 ? 4.756   8.182  50.239  1.00 33.35  ? 886 GLY A C   1 
ATOM   343  O O   . GLY A 1 56 ? 3.700   8.126  49.605  1.00 33.98  ? 886 GLY A O   1 
ATOM   344  N N   . SER A 1 57 ? 5.812   8.869  49.816  1.00 32.92  ? 887 SER A N   1 
ATOM   345  C CA  . SER A 1 57 ? 5.769   9.607  48.561  1.00 36.46  ? 887 SER A CA  1 
ATOM   346  C C   . SER A 1 57 ? 5.812   8.687  47.359  1.00 33.94  ? 887 SER A C   1 
ATOM   347  O O   . SER A 1 57 ? 5.159   8.953  46.364  1.00 37.35  ? 887 SER A O   1 
ATOM   348  C CB  . SER A 1 57 ? 6.921   10.603 48.479  1.00 33.70  ? 887 SER A CB  1 
ATOM   349  O OG  . SER A 1 57 ? 6.645   11.751 49.261  1.00 40.85  ? 887 SER A OG  1 
ATOM   350  N N   . MET A 1 58 ? 6.579   7.608  47.441  1.00 35.01  ? 888 MET A N   1 
ATOM   351  C CA  . MET A 1 58 ? 6.656   6.684  46.322  1.00 34.00  ? 888 MET A CA  1 
ATOM   352  C C   . MET A 1 58 ? 5.316   5.995  46.084  1.00 31.52  ? 888 MET A C   1 
ATOM   353  O O   . MET A 1 58 ? 4.925   5.748  44.944  1.00 30.11  ? 888 MET A O   1 
ATOM   354  C CB  . MET A 1 58 ? 7.734   5.641  46.571  1.00 32.98  ? 888 MET A CB  1 
ATOM   355  C CG  . MET A 1 58 ? 9.138   6.147  46.313  1.00 48.80  ? 888 MET A CG  1 
ATOM   356  S SD  . MET A 1 58 ? 10.404  4.971  46.826  1.00 55.39  ? 888 MET A SD  1 
ATOM   357  C CE  . MET A 1 58 ? 10.151  3.684  45.647  1.00 39.54  ? 888 MET A CE  1 
ATOM   358  N N   . LYS A 1 59 ? 4.609   5.692  47.164  1.00 33.25  ? 889 LYS A N   1 
ATOM   359  C CA  . LYS A 1 59 ? 3.317   5.035  47.047  1.00 37.90  ? 889 LYS A CA  1 
ATOM   360  C C   . LYS A 1 59 ? 2.334   5.956  46.326  1.00 41.65  ? 889 LYS A C   1 
ATOM   361  O O   . LYS A 1 59 ? 1.486   5.501  45.560  1.00 37.42  ? 889 LYS A O   1 
ATOM   362  C CB  . LYS A 1 59 ? 2.784   4.664  48.433  1.00 43.84  ? 889 LYS A CB  1 
ATOM   363  C CG  . LYS A 1 59 ? 1.419   3.991  48.408  1.00 61.28  ? 889 LYS A CG  1 
ATOM   364  C CD  . LYS A 1 59 ? 1.432   2.750  47.522  1.00 68.78  ? 889 LYS A CD  1 
ATOM   365  C CE  . LYS A 1 59 ? 0.050   2.121  47.408  1.00 64.03  ? 889 LYS A CE  1 
ATOM   366  N NZ  . LYS A 1 59 ? 0.092   0.923  46.528  1.00 66.96  ? 889 LYS A NZ  1 
ATOM   367  N N   . GLN A 1 60 ? 2.460   7.256  46.566  1.00 46.01  ? 890 GLN A N   1 
ATOM   368  C CA  . GLN A 1 60 ? 1.590   8.231  45.924  1.00 43.80  ? 890 GLN A CA  1 
ATOM   369  C C   . GLN A 1 60 ? 1.915   8.355  44.442  1.00 41.08  ? 890 GLN A C   1 
ATOM   370  O O   . GLN A 1 60 ? 1.025   8.520  43.613  1.00 48.00  ? 890 GLN A O   1 
ATOM   371  C CB  . GLN A 1 60 ? 1.743   9.601  46.575  1.00 40.97  ? 890 GLN A CB  1 
ATOM   372  C CG  . GLN A 1 60 ? 1.153   9.715  47.956  1.00 59.07  ? 890 GLN A CG  1 
ATOM   373  C CD  . GLN A 1 60 ? 1.179   11.144 48.459  1.00 71.39  ? 890 GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 60 ? 2.240   11.770 48.538  1.00 73.89  ? 890 GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 60 ? 0.008   11.673 48.795  1.00 79.58  ? 890 GLN A NE2 1 
ATOM   376  N N   . LEU A 1 61 ? 3.198   8.289  44.117  1.00 38.49  ? 891 LEU A N   1 
ATOM   377  C CA  . LEU A 1 61 ? 3.634   8.400  42.737  1.00 39.65  ? 891 LEU A CA  1 
ATOM   378  C C   . LEU A 1 61 ? 3.286   7.133  41.959  1.00 43.87  ? 891 LEU A C   1 
ATOM   379  O O   . LEU A 1 61 ? 2.962   7.191  40.769  1.00 41.81  ? 891 LEU A O   1 
ATOM   380  C CB  . LEU A 1 61 ? 5.144   8.651  42.687  1.00 36.58  ? 891 LEU A CB  1 
ATOM   381  C CG  . LEU A 1 61 ? 5.610   10.030 43.150  1.00 32.52  ? 891 LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 61 ? 7.070   9.983  43.598  1.00 24.08  ? 891 LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 61 ? 5.427   11.016 42.022  1.00 27.35  ? 891 LEU A CD2 1 
ATOM   384  N N   . GLU A 1 62 ? 3.344   5.988  42.631  1.00 37.27  ? 892 GLU A N   1 
ATOM   385  C CA  . GLU A 1 62 ? 3.043   4.740  41.955  1.00 38.37  ? 892 GLU A CA  1 
ATOM   386  C C   . GLU A 1 62 ? 1.583   4.708  41.542  1.00 39.29  ? 892 GLU A C   1 
ATOM   387  O O   . GLU A 1 62 ? 1.252   4.239  40.452  1.00 36.87  ? 892 GLU A O   1 
ATOM   388  C CB  . GLU A 1 62 ? 3.383   3.540  42.852  1.00 41.98  ? 892 GLU A CB  1 
ATOM   389  C CG  . GLU A 1 62 ? 4.880   3.389  43.126  1.00 52.58  ? 892 GLU A CG  1 
ATOM   390  C CD  . GLU A 1 62 ? 5.215   2.173  43.979  1.00 60.44  ? 892 GLU A CD  1 
ATOM   391  O OE1 . GLU A 1 62 ? 4.505   1.937  44.978  1.00 62.18  ? 892 GLU A OE1 1 
ATOM   392  O OE2 . GLU A 1 62 ? 6.198   1.464  43.657  1.00 68.45  ? 892 GLU A OE2 1 
ATOM   393  N N   . ASP A 1 63 ? 0.713   5.214  42.412  1.00 32.50  ? 893 ASP A N   1 
ATOM   394  C CA  . ASP A 1 63 ? -0.711  5.240  42.120  1.00 35.18  ? 893 ASP A CA  1 
ATOM   395  C C   . ASP A 1 63 ? -0.956  6.247  41.009  1.00 38.86  ? 893 ASP A C   1 
ATOM   396  O O   . ASP A 1 63 ? -1.791  6.033  40.128  1.00 43.66  ? 893 ASP A O   1 
ATOM   397  C CB  . ASP A 1 63 ? -1.522  5.616  43.364  1.00 39.77  ? 893 ASP A CB  1 
ATOM   398  C CG  . ASP A 1 63 ? -1.449  4.557  44.456  1.00 52.38  ? 893 ASP A CG  1 
ATOM   399  O OD1 . ASP A 1 63 ? -1.087  3.397  44.154  1.00 55.68  ? 893 ASP A OD1 1 
ATOM   400  O OD2 . ASP A 1 63 ? -1.769  4.882  45.619  1.00 59.92  ? 893 ASP A OD2 1 
ATOM   401  N N   . LYS A 1 64 ? -0.219  7.348  41.051  1.00 31.79  ? 894 LYS A N   1 
ATOM   402  C CA  . LYS A 1 64 ? -0.345  8.364  40.029  1.00 28.49  ? 894 LYS A CA  1 
ATOM   403  C C   . LYS A 1 64 ? 0.052   7.736  38.686  1.00 35.80  ? 894 LYS A C   1 
ATOM   404  O O   . LYS A 1 64 ? -0.639  7.921  37.676  1.00 36.93  ? 894 LYS A O   1 
ATOM   405  C CB  . LYS A 1 64 ? 0.566   9.546  40.347  1.00 26.52  ? 894 LYS A CB  1 
ATOM   406  C CG  . LYS A 1 64 ? 0.432   10.702 39.378  1.00 35.96  ? 894 LYS A CG  1 
ATOM   407  C CD  . LYS A 1 64 ? -0.901  11.388 39.534  1.00 44.21  ? 894 LYS A CD  1 
ATOM   408  C CE  . LYS A 1 64 ? -0.975  12.627 38.663  1.00 57.26  ? 894 LYS A CE  1 
ATOM   409  N NZ  . LYS A 1 64 ? -2.306  13.293 38.751  1.00 65.19  ? 894 LYS A NZ  1 
ATOM   410  N N   . VAL A 1 65 ? 1.157   6.991  38.665  1.00 26.07  ? 895 VAL A N   1 
ATOM   411  C CA  . VAL A 1 65 ? 1.584   6.358  37.421  1.00 29.39  ? 895 VAL A CA  1 
ATOM   412  C C   . VAL A 1 65 ? 0.499   5.402  36.926  1.00 32.96  ? 895 VAL A C   1 
ATOM   413  O O   . VAL A 1 65 ? 0.236   5.311  35.726  1.00 34.55  ? 895 VAL A O   1 
ATOM   414  C CB  . VAL A 1 65 ? 2.918   5.596  37.590  1.00 21.98  ? 895 VAL A CB  1 
ATOM   415  C CG1 . VAL A 1 65 ? 3.187   4.701  36.377  1.00 22.12  ? 895 VAL A CG1 1 
ATOM   416  C CG2 . VAL A 1 65 ? 4.056   6.589  37.739  1.00 20.28  ? 895 VAL A CG2 1 
ATOM   417  N N   . GLU A 1 66 ? -0.141  4.701  37.852  1.00 26.76  ? 896 GLU A N   1 
ATOM   418  C CA  . GLU A 1 66 ? -1.195  3.774  37.481  1.00 32.60  ? 896 GLU A CA  1 
ATOM   419  C C   . GLU A 1 66 ? -2.294  4.538  36.760  1.00 31.26  ? 896 GLU A C   1 
ATOM   420  O O   . GLU A 1 66 ? -2.643  4.231  35.619  1.00 25.57  ? 896 GLU A O   1 
ATOM   421  C CB  . GLU A 1 66 ? -1.774  3.098  38.725  1.00 37.30  ? 896 GLU A CB  1 
ATOM   422  C CG  . GLU A 1 66 ? -1.023  1.870  39.173  1.00 53.92  ? 896 GLU A CG  1 
ATOM   423  C CD  . GLU A 1 66 ? -1.117  0.737  38.163  1.00 73.69  ? 896 GLU A CD  1 
ATOM   424  O OE1 . GLU A 1 66 ? -0.606  0.896  37.032  1.00 76.59  ? 896 GLU A OE1 1 
ATOM   425  O OE2 . GLU A 1 66 ? -1.708  -0.314 38.499  1.00 83.53  ? 896 GLU A OE2 1 
ATOM   426  N N   . GLU A 1 67 ? -2.820  5.543  37.448  1.00 27.84  ? 897 GLU A N   1 
ATOM   427  C CA  . GLU A 1 67 ? -3.878  6.394  36.938  1.00 24.89  ? 897 GLU A CA  1 
ATOM   428  C C   . GLU A 1 67 ? -3.574  6.971  35.550  1.00 29.57  ? 897 GLU A C   1 
ATOM   429  O O   . GLU A 1 67 ? -4.416  6.910  34.649  1.00 24.25  ? 897 GLU A O   1 
ATOM   430  C CB  . GLU A 1 67 ? -4.120  7.525  37.935  1.00 29.03  ? 897 GLU A CB  1 
ATOM   431  C CG  . GLU A 1 67 ? -5.043  8.620  37.450  1.00 57.56  ? 897 GLU A CG  1 
ATOM   432  C CD  . GLU A 1 67 ? -4.477  10.002 37.716  1.00 65.84  ? 897 GLU A CD  1 
ATOM   433  O OE1 . GLU A 1 67 ? -3.537  10.407 37.002  1.00 71.13  ? 897 GLU A OE1 1 
ATOM   434  O OE2 . GLU A 1 67 ? -4.964  10.678 38.646  1.00 80.81  ? 897 GLU A OE2 1 
ATOM   435  N N   . LEU A 1 68 ? -2.373  7.523  35.378  1.00 27.92  ? 898 LEU A N   1 
ATOM   436  C CA  . LEU A 1 68 ? -1.987  8.122  34.106  1.00 25.59  ? 898 LEU A CA  1 
ATOM   437  C C   . LEU A 1 68 ? -1.879  7.068  33.023  1.00 30.65  ? 898 LEU A C   1 
ATOM   438  O O   . LEU A 1 68 ? -2.155  7.347  31.856  1.00 32.47  ? 898 LEU A O   1 
ATOM   439  C CB  . LEU A 1 68 ? -0.646  8.867  34.232  1.00 27.42  ? 898 LEU A CB  1 
ATOM   440  C CG  . LEU A 1 68 ? -0.547  10.024 35.241  1.00 36.02  ? 898 LEU A CG  1 
ATOM   441  C CD1 . LEU A 1 68 ? 0.876   10.586 35.281  1.00 23.99  ? 898 LEU A CD1 1 
ATOM   442  C CD2 . LEU A 1 68 ? -1.538  11.115 34.868  1.00 22.60  ? 898 LEU A CD2 1 
ATOM   443  N N   . LEU A 1 69 ? -1.486  5.857  33.411  1.00 27.77  ? 899 LEU A N   1 
ATOM   444  C CA  . LEU A 1 69 ? -1.330  4.760  32.456  1.00 24.53  ? 899 LEU A CA  1 
ATOM   445  C C   . LEU A 1 69 ? -2.688  4.400  31.870  1.00 29.33  ? 899 LEU A C   1 
ATOM   446  O O   . LEU A 1 69 ? -2.809  4.177  30.666  1.00 28.20  ? 899 LEU A O   1 
ATOM   447  C CB  . LEU A 1 69 ? -0.719  3.549  33.148  1.00 26.79  ? 899 LEU A CB  1 
ATOM   448  C CG  . LEU A 1 69 ? 0.465   2.829  32.498  1.00 38.57  ? 899 LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 69 ? 1.252   3.758  31.595  1.00 32.00  ? 899 LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 69 ? 1.357   2.277  33.611  1.00 23.16  ? 899 LEU A CD2 1 
ATOM   451  N N   . SER A 1 70 ? -3.707  4.348  32.723  1.00 22.24  ? 900 SER A N   1 
ATOM   452  C CA  . SER A 1 70 ? -5.051  4.044  32.269  1.00 26.14  ? 900 SER A CA  1 
ATOM   453  C C   . SER A 1 70 ? -5.504  5.159  31.331  1.00 29.83  ? 900 SER A C   1 
ATOM   454  O O   . SER A 1 70 ? -6.067  4.896  30.271  1.00 28.97  ? 900 SER A O   1 
ATOM   455  C CB  . SER A 1 70 ? -6.009  3.944  33.453  1.00 31.46  ? 900 SER A CB  1 
ATOM   456  O OG  . SER A 1 70 ? -5.660  2.854  34.286  1.00 53.30  ? 900 SER A OG  1 
ATOM   457  N N   . LYS A 1 71 ? -5.253  6.404  31.718  1.00 21.68  ? 901 LYS A N   1 
ATOM   458  C CA  . LYS A 1 71 ? -5.633  7.530  30.881  1.00 20.28  ? 901 LYS A CA  1 
ATOM   459  C C   . LYS A 1 71 ? -4.899  7.457  29.564  1.00 20.51  ? 901 LYS A C   1 
ATOM   460  O O   . LYS A 1 71 ? -5.466  7.750  28.524  1.00 23.92  ? 901 LYS A O   1 
ATOM   461  C CB  . LYS A 1 71 ? -5.326  8.854  31.580  1.00 22.69  ? 901 LYS A CB  1 
ATOM   462  C CG  . LYS A 1 71 ? -6.347  9.185  32.671  1.00 37.04  ? 901 LYS A CG  1 
ATOM   463  C CD  . LYS A 1 71 ? -5.911  10.327 33.561  1.00 30.19  ? 901 LYS A CD  1 
ATOM   464  C CE  . LYS A 1 71 ? -6.953  10.594 34.624  1.00 40.56  ? 901 LYS A CE  1 
ATOM   465  N NZ  . LYS A 1 71 ? -6.533  11.707 35.514  1.00 55.84  ? 901 LYS A NZ  1 
ATOM   466  N N   . ASN A 1 72 ? -3.638  7.051  29.606  1.00 24.30  ? 902 ASN A N   1 
ATOM   467  C CA  . ASN A 1 72 ? -2.848  6.947  28.391  1.00 22.43  ? 902 ASN A CA  1 
ATOM   468  C C   . ASN A 1 72 ? -3.404  5.869  27.461  1.00 30.04  ? 902 ASN A C   1 
ATOM   469  O O   . ASN A 1 72 ? -3.524  6.082  26.257  1.00 22.92  ? 902 ASN A O   1 
ATOM   470  C CB  . ASN A 1 72 ? -1.392  6.633  28.731  1.00 21.28  ? 902 ASN A CB  1 
ATOM   471  C CG  . ASN A 1 72 ? -0.534  6.437  27.492  1.00 35.09  ? 902 ASN A CG  1 
ATOM   472  O OD1 . ASN A 1 72 ? -0.226  7.393  26.788  1.00 29.52  ? 902 ASN A OD1 1 
ATOM   473  N ND2 . ASN A 1 72 ? -0.155  5.190  27.216  1.00 38.00  ? 902 ASN A ND2 1 
ATOM   474  N N   . TYR A 1 73 ? -3.750  4.710  28.013  1.00 38.47  ? 903 TYR A N   1 
ATOM   475  C CA  . TYR A 1 73 ? -4.278  3.633  27.182  1.00 36.85  ? 903 TYR A CA  1 
ATOM   476  C C   . TYR A 1 73 ? -5.653  3.993  26.627  1.00 37.54  ? 903 TYR A C   1 
ATOM   477  O O   . TYR A 1 73 ? -5.964  3.691  25.480  1.00 37.80  ? 903 TYR A O   1 
ATOM   478  C CB  . TYR A 1 73 ? -4.342  2.313  27.967  1.00 38.29  ? 903 TYR A CB  1 
ATOM   479  C CG  . TYR A 1 73 ? -2.984  1.769  28.365  1.00 35.77  ? 903 TYR A CG  1 
ATOM   480  C CD1 . TYR A 1 73 ? -1.851  2.048  27.602  1.00 44.94  ? 903 TYR A CD1 1 
ATOM   481  C CD2 . TYR A 1 73 ? -2.832  0.979  29.500  1.00 35.43  ? 903 TYR A CD2 1 
ATOM   482  C CE1 . TYR A 1 73 ? -0.600  1.560  27.960  1.00 42.32  ? 903 TYR A CE1 1 
ATOM   483  C CE2 . TYR A 1 73 ? -1.583  0.481  29.868  1.00 42.56  ? 903 TYR A CE2 1 
ATOM   484  C CZ  . TYR A 1 73 ? -0.471  0.779  29.092  1.00 49.11  ? 903 TYR A CZ  1 
ATOM   485  O OH  . TYR A 1 73 ? 0.775   0.317  29.452  1.00 52.05  ? 903 TYR A OH  1 
ATOM   486  N N   . HIS A 1 74 ? -6.473  4.648  27.439  1.00 33.42  ? 904 HIS A N   1 
ATOM   487  C CA  . HIS A 1 74 ? -7.796  5.055  26.995  1.00 25.75  ? 904 HIS A CA  1 
ATOM   488  C C   . HIS A 1 74 ? -7.675  6.066  25.857  1.00 31.27  ? 904 HIS A C   1 
ATOM   489  O O   . HIS A 1 74 ? -8.388  5.982  24.852  1.00 30.56  ? 904 HIS A O   1 
ATOM   490  C CB  . HIS A 1 74 ? -8.580  5.684  28.147  1.00 19.84  ? 904 HIS A CB  1 
ATOM   491  C CG  . HIS A 1 74 ? -9.858  6.335  27.714  1.00 27.51  ? 904 HIS A CG  1 
ATOM   492  N ND1 . HIS A 1 74 ? -10.888 5.635  27.127  1.00 33.90  ? 904 HIS A ND1 1 
ATOM   493  C CD2 . HIS A 1 74 ? -10.268 7.624  27.785  1.00 34.39  ? 904 HIS A CD2 1 
ATOM   494  C CE1 . HIS A 1 74 ? -11.883 6.466  26.855  1.00 41.57  ? 904 HIS A CE1 1 
ATOM   495  N NE2 . HIS A 1 74 ? -11.531 7.677  27.244  1.00 37.48  ? 904 HIS A NE2 1 
ATOM   496  N N   . LEU A 1 75 ? -6.767  7.024  26.026  1.00 24.92  ? 905 LEU A N   1 
ATOM   497  C CA  . LEU A 1 75 ? -6.546  8.047  25.022  1.00 27.34  ? 905 LEU A CA  1 
ATOM   498  C C   . LEU A 1 75 ? -6.045  7.464  23.707  1.00 27.34  ? 905 LEU A C   1 
ATOM   499  O O   . LEU A 1 75 ? -6.445  7.911  22.635  1.00 39.79  ? 905 LEU A O   1 
ATOM   500  C CB  . LEU A 1 75 ? -5.569  9.096  25.547  1.00 26.94  ? 905 LEU A CB  1 
ATOM   501  C CG  . LEU A 1 75 ? -6.270  10.154 26.403  1.00 19.81  ? 905 LEU A CG  1 
ATOM   502  C CD1 . LEU A 1 75 ? -5.258  10.977 27.197  1.00 11.75  ? 905 LEU A CD1 1 
ATOM   503  C CD2 . LEU A 1 75 ? -7.090  11.038 25.488  1.00 31.21  ? 905 LEU A CD2 1 
ATOM   504  N N   . GLU A 1 76 ? -5.179  6.465  23.785  1.00 22.79  ? 906 GLU A N   1 
ATOM   505  C CA  . GLU A 1 76 ? -4.658  5.831  22.581  1.00 19.93  ? 906 GLU A CA  1 
ATOM   506  C C   . GLU A 1 76 ? -5.788  5.171  21.796  1.00 26.03  ? 906 GLU A C   1 
ATOM   507  O O   . GLU A 1 76 ? -5.782  5.169  20.571  1.00 37.07  ? 906 GLU A O   1 
ATOM   508  C CB  . GLU A 1 76 ? -3.621  4.771  22.953  1.00 23.42  ? 906 GLU A CB  1 
ATOM   509  C CG  . GLU A 1 76 ? -2.280  5.325  23.346  1.00 26.34  ? 906 GLU A CG  1 
ATOM   510  C CD  . GLU A 1 76 ? -1.444  5.748  22.151  1.00 42.33  ? 906 GLU A CD  1 
ATOM   511  O OE1 . GLU A 1 76 ? -2.004  5.887  21.035  1.00 39.25  ? 906 GLU A OE1 1 
ATOM   512  O OE2 . GLU A 1 76 ? -0.222  5.945  22.336  1.00 48.33  ? 906 GLU A OE2 1 
ATOM   513  N N   . ASN A 1 77 ? -6.757  4.611  22.510  1.00 25.39  ? 907 ASN A N   1 
ATOM   514  C CA  . ASN A 1 77 ? -7.887  3.939  21.881  1.00 34.13  ? 907 ASN A CA  1 
ATOM   515  C C   . ASN A 1 77 ? -8.837  4.924  21.217  1.00 34.42  ? 907 ASN A C   1 
ATOM   516  O O   . ASN A 1 77 ? -9.474  4.605  20.208  1.00 40.66  ? 907 ASN A O   1 
ATOM   517  C CB  . ASN A 1 77 ? -8.639  3.097  22.917  1.00 43.44  ? 907 ASN A CB  1 
ATOM   518  C CG  . ASN A 1 77 ? -7.853  1.860  23.344  1.00 60.17  ? 907 ASN A CG  1 
ATOM   519  O OD1 . ASN A 1 77 ? -8.103  1.283  24.408  1.00 66.75  ? 907 ASN A OD1 1 
ATOM   520  N ND2 . ASN A 1 77 ? -6.905  1.440  22.507  1.00 53.76  ? 907 ASN A ND2 1 
ATOM   521  N N   . GLU A 1 78 ? -8.939  6.118  21.786  1.00 33.27  ? 908 GLU A N   1 
ATOM   522  C CA  . GLU A 1 78 ? -9.799  7.142  21.221  1.00 32.66  ? 908 GLU A CA  1 
ATOM   523  C C   . GLU A 1 78 ? -9.177  7.614  19.929  1.00 35.74  ? 908 GLU A C   1 
ATOM   524  O O   . GLU A 1 78 ? -9.833  7.624  18.885  1.00 39.58  ? 908 GLU A O   1 
ATOM   525  C CB  . GLU A 1 78 ? -9.924  8.328  22.159  1.00 40.69  ? 908 GLU A CB  1 
ATOM   526  C CG  . GLU A 1 78 ? -11.279 8.471  22.803  1.00 59.80  ? 908 GLU A CG  1 
ATOM   527  C CD  . GLU A 1 78 ? -11.403 9.782  23.561  1.00 73.59  ? 908 GLU A CD  1 
ATOM   528  O OE1 . GLU A 1 78 ? -10.696 9.949  24.580  1.00 75.35  ? 908 GLU A OE1 1 
ATOM   529  O OE2 . GLU A 1 78 ? -12.195 10.651 23.130  1.00 69.14  ? 908 GLU A OE2 1 
ATOM   530  N N   . VAL A 1 79 ? -7.902  7.994  19.999  1.00 27.48  ? 909 VAL A N   1 
ATOM   531  C CA  . VAL A 1 79 ? -7.200  8.482  18.821  1.00 22.44  ? 909 VAL A CA  1 
ATOM   532  C C   . VAL A 1 79 ? -7.268  7.464  17.681  1.00 31.42  ? 909 VAL A C   1 
ATOM   533  O O   . VAL A 1 79 ? -7.558  7.816  16.533  1.00 29.73  ? 909 VAL A O   1 
ATOM   534  C CB  . VAL A 1 79 ? -5.735  8.807  19.150  1.00 22.07  ? 909 VAL A CB  1 
ATOM   535  C CG1 . VAL A 1 79 ? -4.967  9.149  17.880  1.00 19.76  ? 909 VAL A CG1 1 
ATOM   536  C CG2 . VAL A 1 79 ? -5.683  9.984  20.107  1.00 19.24  ? 909 VAL A CG2 1 
ATOM   537  N N   . ALA A 1 80 ? -7.025  6.198  17.999  1.00 23.31  ? 910 ALA A N   1 
ATOM   538  C CA  . ALA A 1 80 ? -7.075  5.166  16.983  1.00 18.39  ? 910 ALA A CA  1 
ATOM   539  C C   . ALA A 1 80 ? -8.459  5.082  16.332  1.00 25.24  ? 910 ALA A C   1 
ATOM   540  O O   . ALA A 1 80 ? -8.568  4.988  15.105  1.00 23.41  ? 910 ALA A O   1 
ATOM   541  C CB  . ALA A 1 80 ? -6.699  3.842  17.585  1.00 11.65  ? 910 ALA A CB  1 
ATOM   542  N N   . ARG A 1 81 ? -9.512  5.104  17.146  1.00 26.37  ? 911 ARG A N   1 
ATOM   543  C CA  . ARG A 1 81 ? -10.879 5.039  16.625  1.00 19.68  ? 911 ARG A CA  1 
ATOM   544  C C   . ARG A 1 81 ? -11.172 6.240  15.741  1.00 27.30  ? 911 ARG A C   1 
ATOM   545  O O   . ARG A 1 81 ? -11.726 6.088  14.654  1.00 32.77  ? 911 ARG A O   1 
ATOM   546  C CB  . ARG A 1 81 ? -11.899 5.006  17.760  1.00 19.64  ? 911 ARG A CB  1 
ATOM   547  C CG  . ARG A 1 81 ? -11.999 3.691  18.488  1.00 27.82  ? 911 ARG A CG  1 
ATOM   548  C CD  . ARG A 1 81 ? -13.467 3.289  18.651  1.00 31.95  ? 911 ARG A CD  1 
ATOM   549  N NE  . ARG A 1 81 ? -14.045 3.745  19.910  1.00 28.11  ? 911 ARG A NE  1 
ATOM   550  C CZ  . ARG A 1 81 ? -15.353 3.788  20.157  1.00 35.60  ? 911 ARG A CZ  1 
ATOM   551  N NH1 . ARG A 1 81 ? -16.224 3.413  19.228  1.00 28.62  ? 911 ARG A NH1 1 
ATOM   552  N NH2 . ARG A 1 81 ? -15.794 4.188  21.343  1.00 38.26  ? 911 ARG A NH2 1 
ATOM   553  N N   . LEU A 1 82 ? -10.802 7.434  16.211  1.00 33.15  ? 912 LEU A N   1 
ATOM   554  C CA  . LEU A 1 82 ? -11.021 8.663  15.450  1.00 33.52  ? 912 LEU A CA  1 
ATOM   555  C C   . LEU A 1 82 ? -10.139 8.716  14.199  1.00 31.90  ? 912 LEU A C   1 
ATOM   556  O O   . LEU A 1 82 ? -10.493 9.352  13.214  1.00 34.01  ? 912 LEU A O   1 
ATOM   557  C CB  . LEU A 1 82 ? -10.769 9.893  16.329  1.00 27.25  ? 912 LEU A CB  1 
ATOM   558  C CG  . LEU A 1 82 ? -11.778 10.165 17.458  1.00 33.36  ? 912 LEU A CG  1 
ATOM   559  C CD1 . LEU A 1 82 ? -11.195 11.196 18.424  1.00 28.22  ? 912 LEU A CD1 1 
ATOM   560  C CD2 . LEU A 1 82 ? -13.119 10.654 16.886  1.00 27.88  ? 912 LEU A CD2 1 
ATOM   561  N N   . LYS A 1 83 ? -8.995  8.044  14.238  1.00 28.68  ? 913 LYS A N   1 
ATOM   562  C CA  . LYS A 1 83 ? -8.101  8.008  13.085  1.00 32.45  ? 913 LYS A CA  1 
ATOM   563  C C   . LYS A 1 83 ? -8.838  7.309  11.949  1.00 39.36  ? 913 LYS A C   1 
ATOM   564  O O   . LYS A 1 83 ? -8.857  7.784  10.816  1.00 40.61  ? 913 LYS A O   1 
ATOM   565  C CB  . LYS A 1 83 ? -6.827  7.223  13.412  1.00 34.18  ? 913 LYS A CB  1 
ATOM   566  C CG  . LYS A 1 83 ? -5.768  7.970  14.219  1.00 39.37  ? 913 LYS A CG  1 
ATOM   567  C CD  . LYS A 1 83 ? -4.877  8.799  13.308  1.00 40.97  ? 913 LYS A CD  1 
ATOM   568  C CE  . LYS A 1 83 ? -3.619  9.296  14.025  1.00 47.69  ? 913 LYS A CE  1 
ATOM   569  N NZ  . LYS A 1 83 ? -2.666  8.201  14.404  1.00 43.82  ? 913 LYS A NZ  1 
ATOM   570  N N   . LYS A 1 84 ? -9.447  6.172  12.255  1.00 36.80  ? 914 LYS A N   1 
ATOM   571  C CA  . LYS A 1 84 ? -10.181 5.428  11.244  1.00 46.80  ? 914 LYS A CA  1 
ATOM   572  C C   . LYS A 1 84 ? -11.354 6.265  10.712  1.00 45.39  ? 914 LYS A C   1 
ATOM   573  O O   . LYS A 1 84 ? -11.477 6.497  9.514   1.00 49.17  ? 914 LYS A O   1 
ATOM   574  C CB  . LYS A 1 84 ? -10.702 4.113  11.835  1.00 52.78  ? 914 LYS A CB  1 
ATOM   575  C CG  . LYS A 1 84 ? -9.628  3.198  12.413  1.00 69.87  ? 914 LYS A CG  1 
ATOM   576  C CD  . LYS A 1 84 ? -8.532  2.837  11.398  1.00 76.46  ? 914 LYS A CD  1 
ATOM   577  C CE  . LYS A 1 84 ? -7.430  3.898  11.326  1.00 79.29  ? 914 LYS A CE  1 
ATOM   578  N NZ  . LYS A 1 84 ? -6.328  3.528  10.388  1.00 80.66  ? 914 LYS A NZ  1 
ATOM   579  N N   . LEU A 1 85 ? -12.203 6.718  11.623  1.00 40.42  ? 915 LEU A N   1 
ATOM   580  C CA  . LEU A 1 85 ? -13.364 7.521  11.288  1.00 37.80  ? 915 LEU A CA  1 
ATOM   581  C C   . LEU A 1 85 ? -13.094 8.632  10.275  1.00 43.66  ? 915 LEU A C   1 
ATOM   582  O O   . LEU A 1 85 ? -13.959 8.958  9.457   1.00 45.02  ? 915 LEU A O   1 
ATOM   583  C CB  . LEU A 1 85 ? -13.937 8.131  12.569  1.00 36.89  ? 915 LEU A CB  1 
ATOM   584  C CG  . LEU A 1 85 ? -15.134 9.067  12.419  1.00 34.99  ? 915 LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 85 ? -16.241 8.336  11.681  1.00 48.36  ? 915 LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 85 ? -15.615 9.531  13.786  1.00 35.82  ? 915 LEU A CD2 1 
ATOM   587  N N   . VAL A 1 86 ? -11.898 9.206  10.317  1.00 36.74  ? 916 VAL A N   1 
ATOM   588  C CA  . VAL A 1 86 ? -11.553 10.303 9.417   1.00 34.65  ? 916 VAL A CA  1 
ATOM   589  C C   . VAL A 1 86 ? -10.614 9.902  8.277   1.00 35.82  ? 916 VAL A C   1 
ATOM   590  O O   . VAL A 1 86 ? -10.237 10.734 7.455   1.00 29.07  ? 916 VAL A O   1 
ATOM   591  C CB  . VAL A 1 86 ? -10.911 11.450 10.217  1.00 31.45  ? 916 VAL A CB  1 
ATOM   592  C CG1 . VAL A 1 86 ? -10.617 12.626 9.321   1.00 48.35  ? 916 VAL A CG1 1 
ATOM   593  C CG2 . VAL A 1 86 ? -11.833 11.862 11.329  1.00 29.51  ? 916 VAL A CG2 1 
ATOM   594  N N   . GLY A 1 87 ? -10.242 8.627  8.228   1.00 35.37  ? 917 GLY A N   1 
ATOM   595  C CA  . GLY A 1 87 ? -9.346  8.162  7.184   1.00 39.95  ? 917 GLY A CA  1 
ATOM   596  C C   . GLY A 1 87 ? -7.913  8.658  7.311   1.00 47.94  ? 917 GLY A C   1 
ATOM   597  O O   . GLY A 1 87 ? -7.363  9.222  6.367   1.00 57.15  ? 917 GLY A O   1 
ATOM   598  N N   . GLU A 1 88 ? -7.304  8.456  8.476   1.00 49.16  ? 918 GLU A N   1 
ATOM   599  C CA  . GLU A 1 88 ? -5.929  8.880  8.700   1.00 42.58  ? 918 GLU A CA  1 
ATOM   600  C C   . GLU A 1 88 ? -4.975  7.710  8.868   1.00 54.30  ? 918 GLU A C   1 
ATOM   601  O O   . GLU A 1 88 ? -5.378  6.617  9.279   1.00 53.03  ? 918 GLU A O   1 
ATOM   602  C CB  . GLU A 1 88 ? -5.823  9.777  9.932   1.00 30.45  ? 918 GLU A CB  1 
ATOM   603  C CG  . GLU A 1 88 ? -5.499  11.208 9.580   1.00 36.37  ? 918 GLU A CG  1 
ATOM   604  C CD  . GLU A 1 88 ? -5.142  12.050 10.780  1.00 41.68  ? 918 GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 88 ? -4.261  11.631 11.563  1.00 47.95  ? 918 GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 88 ? -5.728  13.142 10.931  1.00 44.84  ? 918 GLU A OE2 1 
ATOM   607  N N   . ARG A 1 89 ? -3.708  7.974  8.548   1.00 65.26  ? 919 ARG A N   1 
ATOM   608  C CA  . ARG A 1 89 ? -2.640  6.994  8.650   1.00 72.74  ? 919 ARG A CA  1 
ATOM   609  C C   . ARG A 1 89 ? -3.065  5.544  8.669   1.00 77.97  ? 919 ARG A C   1 
ATOM   610  O O   . ARG A 1 89 ? -2.919  4.881  7.619   1.00 80.38  ? 919 ARG A O   1 
ATOM   611  N N   . GLU B 1 13 ? 42.492  11.836 104.189 1.00 129.87 ? 843 GLU B N   1 
ATOM   612  C CA  . GLU B 1 13 ? 43.195  11.818 102.874 1.00 129.93 ? 843 GLU B CA  1 
ATOM   613  C C   . GLU B 1 13 ? 43.145  10.434 102.239 1.00 130.14 ? 843 GLU B C   1 
ATOM   614  O O   . GLU B 1 13 ? 43.875  10.142 101.289 1.00 130.33 ? 843 GLU B O   1 
ATOM   615  C CB  . GLU B 1 13 ? 44.647  12.255 103.053 1.00 130.24 ? 843 GLU B CB  1 
ATOM   616  C CG  . GLU B 1 13 ? 44.789  13.670 103.580 1.00 129.41 ? 843 GLU B CG  1 
ATOM   617  C CD  . GLU B 1 13 ? 46.228  14.042 103.850 1.00 128.85 ? 843 GLU B CD  1 
ATOM   618  O OE1 . GLU B 1 13 ? 46.868  13.358 104.677 1.00 132.60 ? 843 GLU B OE1 1 
ATOM   619  O OE2 . GLU B 1 13 ? 46.718  15.014 103.238 1.00 126.15 ? 843 GLU B OE2 1 
ATOM   620  N N   . GLU B 1 14 ? 42.283  9.584  102.783 1.00 128.93 ? 844 GLU B N   1 
ATOM   621  C CA  . GLU B 1 14 ? 42.101  8.234  102.271 1.00 128.32 ? 844 GLU B CA  1 
ATOM   622  C C   . GLU B 1 14 ? 40.938  8.308  101.287 1.00 130.29 ? 844 GLU B C   1 
ATOM   623  O O   . GLU B 1 14 ? 40.317  7.300  100.945 1.00 129.38 ? 844 GLU B O   1 
ATOM   624  C CB  . GLU B 1 14 ? 41.775  7.281  103.421 1.00 125.93 ? 844 GLU B CB  1 
ATOM   625  C CG  . GLU B 1 14 ? 41.578  5.837  103.005 1.00 120.53 ? 844 GLU B CG  1 
ATOM   626  C CD  . GLU B 1 14 ? 41.437  4.915  104.193 1.00 115.67 ? 844 GLU B CD  1 
ATOM   627  O OE1 . GLU B 1 14 ? 40.566  5.175  105.050 1.00 114.63 ? 844 GLU B OE1 1 
ATOM   628  O OE2 . GLU B 1 14 ? 42.199  3.930  104.269 1.00 110.88 ? 844 GLU B OE2 1 
ATOM   629  N N   . GLU B 1 15 ? 40.661  9.530  100.842 1.00 132.15 ? 845 GLU B N   1 
ATOM   630  C CA  . GLU B 1 15 ? 39.584  9.817  99.904  1.00 132.33 ? 845 GLU B CA  1 
ATOM   631  C C   . GLU B 1 15 ? 39.985  9.486  98.472  1.00 133.00 ? 845 GLU B C   1 
ATOM   632  O O   . GLU B 1 15 ? 39.149  9.494  97.564  1.00 131.10 ? 845 GLU B O   1 
ATOM   633  C CB  . GLU B 1 15 ? 39.218  11.296 100.003 1.00 131.87 ? 845 GLU B CB  1 
ATOM   634  C CG  . GLU B 1 15 ? 38.011  11.709 99.193  1.00 133.36 ? 845 GLU B CG  1 
ATOM   635  C CD  . GLU B 1 15 ? 37.417  13.003 99.702  1.00 134.00 ? 845 GLU B CD  1 
ATOM   636  O OE1 . GLU B 1 15 ? 38.186  13.965 99.906  1.00 132.35 ? 845 GLU B OE1 1 
ATOM   637  O OE2 . GLU B 1 15 ? 36.186  13.059 99.900  1.00 138.57 ? 845 GLU B OE2 1 
ATOM   638  N N   . MET B 1 16 ? 41.268  9.196  98.278  1.00 134.81 ? 846 MET B N   1 
ATOM   639  C CA  . MET B 1 16 ? 41.801  8.879  96.959  1.00 135.83 ? 846 MET B CA  1 
ATOM   640  C C   . MET B 1 16 ? 41.183  7.636  96.347  1.00 135.42 ? 846 MET B C   1 
ATOM   641  O O   . MET B 1 16 ? 40.914  7.598  95.149  1.00 135.23 ? 846 MET B O   1 
ATOM   642  C CB  . MET B 1 16 ? 43.324  8.718  97.025  1.00 139.61 ? 846 MET B CB  1 
ATOM   643  C CG  . MET B 1 16 ? 43.845  7.686  98.034  1.00 142.15 ? 846 MET B CG  1 
ATOM   644  S SD  . MET B 1 16 ? 43.670  5.947  97.549  1.00 141.95 ? 846 MET B SD  1 
ATOM   645  C CE  . MET B 1 16 ? 45.118  5.733  96.516  1.00 139.98 ? 846 MET B CE  1 
ATOM   646  N N   . LYS B 1 17 ? 40.948  6.624  97.169  1.00 134.13 ? 847 LYS B N   1 
ATOM   647  C CA  . LYS B 1 17 ? 40.342  5.387  96.693  1.00 132.45 ? 847 LYS B CA  1 
ATOM   648  C C   . LYS B 1 17 ? 38.993  5.663  96.057  1.00 127.98 ? 847 LYS B C   1 
ATOM   649  O O   . LYS B 1 17 ? 38.564  4.960  95.148  1.00 123.36 ? 847 LYS B O   1 
ATOM   650  C CB  . LYS B 1 17 ? 40.144  4.438  97.863  1.00 137.16 ? 847 LYS B CB  1 
ATOM   651  C CG  . LYS B 1 17 ? 40.499  2.992  97.586  1.00 140.81 ? 847 LYS B CG  1 
ATOM   652  C CD  . LYS B 1 17 ? 39.523  2.304  96.634  1.00 145.83 ? 847 LYS B CD  1 
ATOM   653  C CE  . LYS B 1 17 ? 39.889  0.825  96.449  1.00 146.39 ? 847 LYS B CE  1 
ATOM   654  N NZ  . LYS B 1 17 ? 38.901  0.122  95.578  1.00 148.25 ? 847 LYS B NZ  1 
ATOM   655  N N   . GLU B 1 18 ? 38.330  6.706  96.541  1.00 125.93 ? 848 GLU B N   1 
ATOM   656  C CA  . GLU B 1 18 ? 37.020  7.076  96.010  1.00 125.02 ? 848 GLU B CA  1 
ATOM   657  C C   . GLU B 1 18 ? 37.064  7.608  94.598  1.00 124.40 ? 848 GLU B C   1 
ATOM   658  O O   . GLU B 1 18 ? 36.266  7.210  93.745  1.00 125.52 ? 848 GLU B O   1 
ATOM   659  C CB  . GLU B 1 18 ? 36.342  8.108  96.911  1.00 124.33 ? 848 GLU B CB  1 
ATOM   660  C CG  . GLU B 1 18 ? 34.996  8.636  96.378  1.00 128.28 ? 848 GLU B CG  1 
ATOM   661  C CD  . GLU B 1 18 ? 33.965  7.534  96.094  1.00 130.24 ? 848 GLU B CD  1 
ATOM   662  O OE1 . GLU B 1 18 ? 33.621  6.754  97.014  1.00 133.39 ? 848 GLU B OE1 1 
ATOM   663  O OE2 . GLU B 1 18 ? 33.488  7.451  94.941  1.00 129.85 ? 848 GLU B OE2 1 
ATOM   664  N N   . GLN B 1 19 ? 37.988  8.525  94.360  1.00 121.74 ? 849 GLN B N   1 
ATOM   665  C CA  . GLN B 1 19 ? 38.130  9.100  93.038  1.00 114.77 ? 849 GLN B CA  1 
ATOM   666  C C   . GLN B 1 19 ? 39.009  8.221  92.165  1.00 110.31 ? 849 GLN B C   1 
ATOM   667  O O   . GLN B 1 19 ? 38.873  8.214  90.942  1.00 109.28 ? 849 GLN B O   1 
ATOM   668  C CB  . GLN B 1 19 ? 38.706  10.514 93.118  1.00 116.24 ? 849 GLN B CB  1 
ATOM   669  C CG  . GLN B 1 19 ? 37.773  11.497 93.795  1.00 124.32 ? 849 GLN B CG  1 
ATOM   670  C CD  . GLN B 1 19 ? 38.187  12.928 93.598  1.00 129.73 ? 849 GLN B CD  1 
ATOM   671  O OE1 . GLN B 1 19 ? 38.310  13.398 92.467  1.00 133.18 ? 849 GLN B OE1 1 
ATOM   672  N NE2 . GLN B 1 19 ? 38.393  13.641 94.699  1.00 131.04 ? 849 GLN B NE2 1 
ATOM   673  N N   . LEU B 1 20 ? 39.893  7.451  92.793  1.00 106.87 ? 850 LEU B N   1 
ATOM   674  C CA  . LEU B 1 20 ? 40.767  6.553  92.037  1.00 103.61 ? 850 LEU B CA  1 
ATOM   675  C C   . LEU B 1 20 ? 39.892  5.496  91.389  1.00 101.52 ? 850 LEU B C   1 
ATOM   676  O O   . LEU B 1 20 ? 40.238  4.913  90.368  1.00 101.33 ? 850 LEU B O   1 
ATOM   677  C CB  . LEU B 1 20 ? 41.794  5.881  92.958  1.00 106.52 ? 850 LEU B CB  1 
ATOM   678  C CG  . LEU B 1 20 ? 42.983  5.140  92.329  1.00 106.49 ? 850 LEU B CG  1 
ATOM   679  C CD1 . LEU B 1 20 ? 43.687  6.047  91.326  1.00 100.89 ? 850 LEU B CD1 1 
ATOM   680  C CD2 . LEU B 1 20 ? 43.950  4.707  93.423  1.00 106.69 ? 850 LEU B CD2 1 
ATOM   681  N N   . LYS B 1 21 ? 38.743  5.253  92.000  1.00 100.25 ? 851 LYS B N   1 
ATOM   682  C CA  . LYS B 1 21 ? 37.795  4.290  91.466  1.00 96.85  ? 851 LYS B CA  1 
ATOM   683  C C   . LYS B 1 21 ? 36.856  5.029  90.525  1.00 86.49  ? 851 LYS B C   1 
ATOM   684  O O   . LYS B 1 21 ? 36.514  4.545  89.443  1.00 81.59  ? 851 LYS B O   1 
ATOM   685  C CB  . LYS B 1 21 ? 36.996  3.652  92.600  1.00 105.86 ? 851 LYS B CB  1 
ATOM   686  C CG  . LYS B 1 21 ? 35.757  2.868  92.130  1.00 115.94 ? 851 LYS B CG  1 
ATOM   687  C CD  . LYS B 1 21 ? 36.094  1.779  91.096  1.00 121.08 ? 851 LYS B CD  1 
ATOM   688  C CE  . LYS B 1 21 ? 34.825  1.069  90.598  1.00 123.39 ? 851 LYS B CE  1 
ATOM   689  N NZ  . LYS B 1 21 ? 35.129  0.038  89.558  1.00 124.62 ? 851 LYS B NZ  1 
ATOM   690  N N   . GLN B 1 22 ? 36.442  6.213  90.957  1.00 78.66  ? 852 GLN B N   1 
ATOM   691  C CA  . GLN B 1 22 ? 35.565  7.059  90.162  1.00 78.15  ? 852 GLN B CA  1 
ATOM   692  C C   . GLN B 1 22 ? 36.241  7.236  88.807  1.00 76.02  ? 852 GLN B C   1 
ATOM   693  O O   . GLN B 1 22 ? 35.590  7.411  87.780  1.00 73.21  ? 852 GLN B O   1 
ATOM   694  C CB  . GLN B 1 22 ? 35.391  8.421  90.857  1.00 84.42  ? 852 GLN B CB  1 
ATOM   695  C CG  . GLN B 1 22 ? 34.412  9.387  90.193  1.00 98.52  ? 852 GLN B CG  1 
ATOM   696  C CD  . GLN B 1 22 ? 34.186  10.649 91.020  1.00 103.02 ? 852 GLN B CD  1 
ATOM   697  O OE1 . GLN B 1 22 ? 35.131  11.361 91.380  1.00 102.41 ? 852 GLN B OE1 1 
ATOM   698  N NE2 . GLN B 1 22 ? 32.926  10.936 91.312  1.00 105.05 ? 852 GLN B NE2 1 
ATOM   699  N N   . MET B 1 23 ? 37.567  7.162  88.827  1.00 73.85  ? 853 MET B N   1 
ATOM   700  C CA  . MET B 1 23 ? 38.384  7.300  87.626  1.00 66.71  ? 853 MET B CA  1 
ATOM   701  C C   . MET B 1 23 ? 38.216  6.077  86.726  1.00 64.14  ? 853 MET B C   1 
ATOM   702  O O   . MET B 1 23 ? 38.120  6.188  85.499  1.00 59.34  ? 853 MET B O   1 
ATOM   703  C CB  . MET B 1 23 ? 39.850  7.465  88.032  1.00 73.15  ? 853 MET B CB  1 
ATOM   704  C CG  . MET B 1 23 ? 40.844  7.530  86.883  1.00 84.02  ? 853 MET B CG  1 
ATOM   705  S SD  . MET B 1 23 ? 40.747  9.060  85.945  1.00 102.15 ? 853 MET B SD  1 
ATOM   706  C CE  . MET B 1 23 ? 42.133  9.919  86.618  1.00 98.93  ? 853 MET B CE  1 
ATOM   707  N N   . ASP B 1 24 ? 38.190  4.910  87.357  1.00 60.45  ? 854 ASP B N   1 
ATOM   708  C CA  . ASP B 1 24 ? 38.025  3.653  86.649  1.00 53.93  ? 854 ASP B CA  1 
ATOM   709  C C   . ASP B 1 24 ? 36.659  3.511  85.980  1.00 55.77  ? 854 ASP B C   1 
ATOM   710  O O   . ASP B 1 24 ? 36.554  3.011  84.857  1.00 51.49  ? 854 ASP B O   1 
ATOM   711  C CB  . ASP B 1 24 ? 38.241  2.491  87.606  1.00 59.80  ? 854 ASP B CB  1 
ATOM   712  C CG  . ASP B 1 24 ? 39.678  2.037  87.627  1.00 73.40  ? 854 ASP B CG  1 
ATOM   713  O OD1 . ASP B 1 24 ? 40.144  1.537  86.578  1.00 70.20  ? 854 ASP B OD1 1 
ATOM   714  O OD2 . ASP B 1 24 ? 40.342  2.196  88.676  1.00 78.20  ? 854 ASP B OD2 1 
ATOM   715  N N   . LYS B 1 25 ? 35.607  3.924  86.677  1.00 54.32  ? 855 LYS B N   1 
ATOM   716  C CA  . LYS B 1 25 ? 34.270  3.830  86.121  1.00 51.29  ? 855 LYS B CA  1 
ATOM   717  C C   . LYS B 1 25 ? 34.163  4.789  84.943  1.00 53.72  ? 855 LYS B C   1 
ATOM   718  O O   . LYS B 1 25 ? 33.434  4.541  83.976  1.00 49.15  ? 855 LYS B O   1 
ATOM   719  C CB  . LYS B 1 25 ? 33.228  4.189  87.178  1.00 48.83  ? 855 LYS B CB  1 
ATOM   720  C CG  . LYS B 1 25 ? 31.798  4.334  86.644  1.00 55.49  ? 855 LYS B CG  1 
ATOM   721  C CD  . LYS B 1 25 ? 31.255  3.053  85.976  1.00 68.88  ? 855 LYS B CD  1 
ATOM   722  C CE  . LYS B 1 25 ? 29.827  3.295  85.463  1.00 65.17  ? 855 LYS B CE  1 
ATOM   723  N NZ  . LYS B 1 25 ? 29.242  2.206  84.621  1.00 58.79  ? 855 LYS B NZ  1 
ATOM   724  N N   . MET B 1 26 ? 34.920  5.877  85.020  1.00 47.84  ? 856 MET B N   1 
ATOM   725  C CA  . MET B 1 26 ? 34.911  6.864  83.957  1.00 47.09  ? 856 MET B CA  1 
ATOM   726  C C   . MET B 1 26 ? 35.656  6.331  82.753  1.00 44.44  ? 856 MET B C   1 
ATOM   727  O O   . MET B 1 26 ? 35.298  6.620  81.616  1.00 39.96  ? 856 MET B O   1 
ATOM   728  C CB  . MET B 1 26 ? 35.535  8.170  84.435  1.00 49.15  ? 856 MET B CB  1 
ATOM   729  C CG  . MET B 1 26 ? 35.243  9.337  83.521  1.00 58.34  ? 856 MET B CG  1 
ATOM   730  S SD  . MET B 1 26 ? 35.142  10.935 84.357  1.00 70.93  ? 856 MET B SD  1 
ATOM   731  C CE  . MET B 1 26 ? 36.687  11.673 83.880  1.00 70.87  ? 856 MET B CE  1 
ATOM   732  N N   . LYS B 1 27 ? 36.696  5.547  82.997  1.00 44.13  ? 857 LYS B N   1 
ATOM   733  C CA  . LYS B 1 27 ? 37.428  4.978  81.883  1.00 48.37  ? 857 LYS B CA  1 
ATOM   734  C C   . LYS B 1 27 ? 36.513  4.054  81.099  1.00 45.95  ? 857 LYS B C   1 
ATOM   735  O O   . LYS B 1 27 ? 36.596  3.975  79.871  1.00 42.81  ? 857 LYS B O   1 
ATOM   736  C CB  . LYS B 1 27 ? 38.661  4.204  82.355  1.00 53.38  ? 857 LYS B CB  1 
ATOM   737  C CG  . LYS B 1 27 ? 39.829  5.101  82.709  1.00 65.86  ? 857 LYS B CG  1 
ATOM   738  C CD  . LYS B 1 27 ? 41.086  4.303  83.008  1.00 69.14  ? 857 LYS B CD  1 
ATOM   739  C CE  . LYS B 1 27 ? 42.252  5.223  83.355  1.00 75.45  ? 857 LYS B CE  1 
ATOM   740  N NZ  . LYS B 1 27 ? 43.532  4.493  83.593  1.00 77.98  ? 857 LYS B NZ  1 
ATOM   741  N N   . GLU B 1 28 ? 35.612  3.364  81.788  1.00 39.42  ? 858 GLU B N   1 
ATOM   742  C CA  . GLU B 1 28 ? 34.753  2.470  81.042  1.00 37.56  ? 858 GLU B CA  1 
ATOM   743  C C   . GLU B 1 28 ? 33.538  3.175  80.464  1.00 35.32  ? 858 GLU B C   1 
ATOM   744  O O   . GLU B 1 28 ? 33.049  2.794  79.406  1.00 33.20  ? 858 GLU B O   1 
ATOM   745  C CB  . GLU B 1 28 ? 34.339  1.267  81.883  1.00 39.60  ? 858 GLU B CB  1 
ATOM   746  C CG  . GLU B 1 28 ? 33.353  1.523  82.979  1.00 52.66  ? 858 GLU B CG  1 
ATOM   747  C CD  . GLU B 1 28 ? 32.950  0.229  83.661  1.00 56.43  ? 858 GLU B CD  1 
ATOM   748  O OE1 . GLU B 1 28 ? 33.845  -0.432 84.228  1.00 51.37  ? 858 GLU B OE1 1 
ATOM   749  O OE2 . GLU B 1 28 ? 31.749  -0.128 83.621  1.00 56.95  ? 858 GLU B OE2 1 
ATOM   750  N N   . ASP B 1 29 ? 33.061  4.215  81.135  1.00 36.14  ? 859 ASP B N   1 
ATOM   751  C CA  . ASP B 1 29 ? 31.920  4.944  80.615  1.00 33.33  ? 859 ASP B CA  1 
ATOM   752  C C   . ASP B 1 29 ? 32.302  5.574  79.290  1.00 31.10  ? 859 ASP B C   1 
ATOM   753  O O   . ASP B 1 29 ? 31.468  5.713  78.388  1.00 29.68  ? 859 ASP B O   1 
ATOM   754  C CB  . ASP B 1 29 ? 31.459  6.017  81.598  1.00 39.60  ? 859 ASP B CB  1 
ATOM   755  C CG  . ASP B 1 29 ? 30.401  5.505  82.547  1.00 53.42  ? 859 ASP B CG  1 
ATOM   756  O OD1 . ASP B 1 29 ? 29.817  6.318  83.293  1.00 66.99  ? 859 ASP B OD1 1 
ATOM   757  O OD2 . ASP B 1 29 ? 30.151  4.279  82.545  1.00 62.66  ? 859 ASP B OD2 1 
ATOM   758  N N   . LEU B 1 30 ? 33.575  5.936  79.176  1.00 26.02  ? 860 LEU B N   1 
ATOM   759  C CA  . LEU B 1 30 ? 34.106  6.547  77.966  1.00 30.06  ? 860 LEU B CA  1 
ATOM   760  C C   . LEU B 1 30 ? 34.251  5.536  76.828  1.00 31.81  ? 860 LEU B C   1 
ATOM   761  O O   . LEU B 1 30 ? 33.883  5.825  75.687  1.00 42.20  ? 860 LEU B O   1 
ATOM   762  C CB  . LEU B 1 30 ? 35.469  7.189  78.246  1.00 32.57  ? 860 LEU B CB  1 
ATOM   763  C CG  . LEU B 1 30 ? 36.110  7.913  77.056  1.00 35.52  ? 860 LEU B CG  1 
ATOM   764  C CD1 . LEU B 1 30 ? 35.204  9.055  76.624  1.00 44.40  ? 860 LEU B CD1 1 
ATOM   765  C CD2 . LEU B 1 30 ? 37.482  8.445  77.429  1.00 29.93  ? 860 LEU B CD2 1 
ATOM   766  N N   . ALA B 1 31 ? 34.783  4.356  77.137  1.00 28.27  ? 861 ALA B N   1 
ATOM   767  C CA  . ALA B 1 31 ? 34.986  3.318  76.121  1.00 28.51  ? 861 ALA B CA  1 
ATOM   768  C C   . ALA B 1 31 ? 33.667  2.815  75.583  1.00 29.97  ? 861 ALA B C   1 
ATOM   769  O O   . ALA B 1 31 ? 33.559  2.482  74.404  1.00 31.84  ? 861 ALA B O   1 
ATOM   770  C CB  . ALA B 1 31 ? 35.778  2.146  76.699  1.00 14.69  ? 861 ALA B CB  1 
ATOM   771  N N   . LYS B 1 32 ? 32.677  2.756  76.469  1.00 28.55  ? 862 LYS B N   1 
ATOM   772  C CA  . LYS B 1 32 ? 31.335  2.295  76.148  1.00 29.15  ? 862 LYS B CA  1 
ATOM   773  C C   . LYS B 1 32 ? 30.684  3.284  75.169  1.00 38.36  ? 862 LYS B C   1 
ATOM   774  O O   . LYS B 1 32 ? 30.241  2.920  74.070  1.00 35.41  ? 862 LYS B O   1 
ATOM   775  C CB  . LYS B 1 32 ? 30.519  2.202  77.448  1.00 20.84  ? 862 LYS B CB  1 
ATOM   776  C CG  . LYS B 1 32 ? 29.072  1.847  77.228  1.00 36.17  ? 862 LYS B CG  1 
ATOM   777  C CD  . LYS B 1 32 ? 28.208  2.151  78.446  1.00 34.42  ? 862 LYS B CD  1 
ATOM   778  C CE  . LYS B 1 32 ? 26.757  1.829  78.123  1.00 43.82  ? 862 LYS B CE  1 
ATOM   779  N NZ  . LYS B 1 32 ? 25.789  2.347  79.123  1.00 57.56  ? 862 LYS B NZ  1 
ATOM   780  N N   . THR B 1 33 ? 30.648  4.543  75.589  1.00 37.79  ? 863 THR B N   1 
ATOM   781  C CA  . THR B 1 33 ? 30.089  5.631  74.811  1.00 30.75  ? 863 THR B CA  1 
ATOM   782  C C   . THR B 1 33 ? 30.766  5.729  73.436  1.00 31.61  ? 863 THR B C   1 
ATOM   783  O O   . THR B 1 33 ? 30.102  5.955  72.430  1.00 37.18  ? 863 THR B O   1 
ATOM   784  C CB  . THR B 1 33 ? 30.257  6.938  75.591  1.00 31.13  ? 863 THR B CB  1 
ATOM   785  O OG1 . THR B 1 33 ? 29.800  6.729  76.934  1.00 23.49  ? 863 THR B OG1 1 
ATOM   786  C CG2 . THR B 1 33 ? 29.450  8.055  74.968  1.00 21.44  ? 863 THR B CG2 1 
ATOM   787  N N   . GLU B 1 34 ? 32.081  5.551  73.377  1.00 34.83  ? 864 GLU B N   1 
ATOM   788  C CA  . GLU B 1 34 ? 32.766  5.614  72.088  1.00 35.19  ? 864 GLU B CA  1 
ATOM   789  C C   . GLU B 1 34 ? 32.321  4.452  71.217  1.00 32.55  ? 864 GLU B C   1 
ATOM   790  O O   . GLU B 1 34 ? 32.150  4.600  70.013  1.00 31.76  ? 864 GLU B O   1 
ATOM   791  C CB  . GLU B 1 34 ? 34.282  5.531  72.257  1.00 31.43  ? 864 GLU B CB  1 
ATOM   792  C CG  . GLU B 1 34 ? 35.036  6.814  71.913  1.00 61.47  ? 864 GLU B CG  1 
ATOM   793  C CD  . GLU B 1 34 ? 35.056  7.143  70.422  1.00 70.36  ? 864 GLU B CD  1 
ATOM   794  O OE1 . GLU B 1 34 ? 35.541  6.316  69.621  1.00 74.35  ? 864 GLU B OE1 1 
ATOM   795  O OE2 . GLU B 1 34 ? 34.593  8.243  70.052  1.00 77.58  ? 864 GLU B OE2 1 
ATOM   796  N N   . ARG B 1 35 ? 32.144  3.289  71.830  1.00 23.68  ? 865 ARG B N   1 
ATOM   797  C CA  . ARG B 1 35 ? 31.738  2.117  71.079  1.00 21.29  ? 865 ARG B CA  1 
ATOM   798  C C   . ARG B 1 35 ? 30.333  2.314  70.526  1.00 28.02  ? 865 ARG B C   1 
ATOM   799  O O   . ARG B 1 35 ? 30.069  1.981  69.373  1.00 26.95  ? 865 ARG B O   1 
ATOM   800  C CB  . ARG B 1 35 ? 31.814  0.867  71.959  1.00 25.82  ? 865 ARG B CB  1 
ATOM   801  C CG  . ARG B 1 35 ? 31.249  -0.383 71.318  1.00 30.20  ? 865 ARG B CG  1 
ATOM   802  C CD  . ARG B 1 35 ? 31.419  -1.587 72.228  1.00 43.93  ? 865 ARG B CD  1 
ATOM   803  N NE  . ARG B 1 35 ? 30.817  -1.444 73.561  1.00 36.58  ? 865 ARG B NE  1 
ATOM   804  C CZ  . ARG B 1 35 ? 29.508  -1.461 73.809  1.00 44.38  ? 865 ARG B CZ  1 
ATOM   805  N NH1 . ARG B 1 35 ? 28.646  -1.605 72.813  1.00 33.28  ? 865 ARG B NH1 1 
ATOM   806  N NH2 . ARG B 1 35 ? 29.060  -1.367 75.058  1.00 31.65  ? 865 ARG B NH2 1 
ATOM   807  N N   . ILE B 1 36 ? 29.435  2.856  71.344  1.00 32.61  ? 866 ILE B N   1 
ATOM   808  C CA  . ILE B 1 36 ? 28.074  3.116  70.897  1.00 26.22  ? 866 ILE B CA  1 
ATOM   809  C C   . ILE B 1 36 ? 28.084  4.200  69.810  1.00 38.33  ? 866 ILE B C   1 
ATOM   810  O O   . ILE B 1 36 ? 27.357  4.107  68.814  1.00 35.16  ? 866 ILE B O   1 
ATOM   811  C CB  . ILE B 1 36 ? 27.186  3.577  72.071  1.00 31.04  ? 866 ILE B CB  1 
ATOM   812  C CG1 . ILE B 1 36 ? 27.041  2.428  73.075  1.00 31.56  ? 866 ILE B CG1 1 
ATOM   813  C CG2 . ILE B 1 36 ? 25.807  4.024  71.561  1.00 23.18  ? 866 ILE B CG2 1 
ATOM   814  C CD1 . ILE B 1 36 ? 26.100  2.723  74.234  1.00 34.26  ? 866 ILE B CD1 1 
ATOM   815  N N   . LYS B 1 37 ? 28.914  5.224  70.001  1.00 35.12  ? 867 LYS B N   1 
ATOM   816  C CA  . LYS B 1 37 ? 29.015  6.313  69.035  1.00 31.38  ? 867 LYS B CA  1 
ATOM   817  C C   . LYS B 1 37 ? 29.368  5.787  67.643  1.00 36.11  ? 867 LYS B C   1 
ATOM   818  O O   . LYS B 1 37 ? 28.694  6.090  66.659  1.00 43.13  ? 867 LYS B O   1 
ATOM   819  C CB  . LYS B 1 37 ? 30.083  7.310  69.474  1.00 30.64  ? 867 LYS B CB  1 
ATOM   820  C CG  . LYS B 1 37 ? 30.095  8.577  68.653  1.00 33.47  ? 867 LYS B CG  1 
ATOM   821  C CD  . LYS B 1 37 ? 31.271  9.462  69.003  1.00 41.26  ? 867 LYS B CD  1 
ATOM   822  C CE  . LYS B 1 37 ? 32.529  9.037  68.266  1.00 48.57  ? 867 LYS B CE  1 
ATOM   823  N NZ  . LYS B 1 37 ? 33.634  10.022 68.467  1.00 58.76  ? 867 LYS B NZ  1 
ATOM   824  N N   . LYS B 1 38 ? 30.435  4.999  67.569  1.00 36.01  ? 868 LYS B N   1 
ATOM   825  C CA  . LYS B 1 38 ? 30.885  4.425  66.311  1.00 31.24  ? 868 LYS B CA  1 
ATOM   826  C C   . LYS B 1 38 ? 29.821  3.519  65.685  1.00 31.35  ? 868 LYS B C   1 
ATOM   827  O O   . LYS B 1 38 ? 29.700  3.448  64.467  1.00 32.67  ? 868 LYS B O   1 
ATOM   828  C CB  . LYS B 1 38 ? 32.169  3.630  66.526  1.00 33.63  ? 868 LYS B CB  1 
ATOM   829  C CG  . LYS B 1 38 ? 33.432  4.452  66.705  1.00 43.60  ? 868 LYS B CG  1 
ATOM   830  C CD  . LYS B 1 38 ? 34.634  3.516  66.716  1.00 55.52  ? 868 LYS B CD  1 
ATOM   831  C CE  . LYS B 1 38 ? 35.959  4.252  66.745  1.00 63.72  ? 868 LYS B CE  1 
ATOM   832  N NZ  . LYS B 1 38 ? 37.102  3.288  66.727  1.00 60.70  ? 868 LYS B NZ  1 
ATOM   833  N N   . GLU B 1 39 ? 29.061  2.817  66.514  1.00 25.85  ? 869 GLU B N   1 
ATOM   834  C CA  . GLU B 1 39 ? 28.002  1.947  66.015  1.00 31.20  ? 869 GLU B CA  1 
ATOM   835  C C   . GLU B 1 39 ? 26.960  2.812  65.297  1.00 31.11  ? 869 GLU B C   1 
ATOM   836  O O   . GLU B 1 39 ? 26.547  2.516  64.168  1.00 24.73  ? 869 GLU B O   1 
ATOM   837  C CB  . GLU B 1 39 ? 27.354  1.181  67.181  1.00 29.78  ? 869 GLU B CB  1 
ATOM   838  C CG  . GLU B 1 39 ? 27.749  -0.299 67.242  1.00 57.10  ? 869 GLU B CG  1 
ATOM   839  C CD  . GLU B 1 39 ? 27.814  -0.865 68.664  1.00 66.08  ? 869 GLU B CD  1 
ATOM   840  O OE1 . GLU B 1 39 ? 26.905  -0.576 69.475  1.00 66.62  ? 869 GLU B OE1 1 
ATOM   841  O OE2 . GLU B 1 39 ? 28.771  -1.618 68.965  1.00 62.61  ? 869 GLU B OE2 1 
ATOM   842  N N   . LEU B 1 40 ? 26.558  3.891  65.964  1.00 28.84  ? 870 LEU B N   1 
ATOM   843  C CA  . LEU B 1 40 ? 25.580  4.821  65.432  1.00 24.02  ? 870 LEU B CA  1 
ATOM   844  C C   . LEU B 1 40 ? 26.052  5.474  64.137  1.00 29.81  ? 870 LEU B C   1 
ATOM   845  O O   . LEU B 1 40 ? 25.283  5.593  63.187  1.00 34.42  ? 870 LEU B O   1 
ATOM   846  C CB  . LEU B 1 40 ? 25.269  5.892  66.470  1.00 27.44  ? 870 LEU B CB  1 
ATOM   847  C CG  . LEU B 1 40 ? 24.357  5.457  67.609  1.00 25.96  ? 870 LEU B CG  1 
ATOM   848  C CD1 . LEU B 1 40 ? 24.318  6.537  68.660  1.00 34.59  ? 870 LEU B CD1 1 
ATOM   849  C CD2 . LEU B 1 40 ? 22.963  5.213  67.077  1.00 26.64  ? 870 LEU B CD2 1 
ATOM   850  N N   . GLU B 1 41 ? 27.309  5.903  64.093  1.00 30.25  ? 871 GLU B N   1 
ATOM   851  C CA  . GLU B 1 41 ? 27.830  6.524  62.881  1.00 28.46  ? 871 GLU B CA  1 
ATOM   852  C C   . GLU B 1 41 ? 27.619  5.532  61.763  1.00 32.53  ? 871 GLU B C   1 
ATOM   853  O O   . GLU B 1 41 ? 27.162  5.884  60.669  1.00 32.76  ? 871 GLU B O   1 
ATOM   854  C CB  . GLU B 1 41 ? 29.327  6.801  63.000  1.00 21.42  ? 871 GLU B CB  1 
ATOM   855  C CG  . GLU B 1 41 ? 29.730  7.422  64.304  1.00 45.11  ? 871 GLU B CG  1 
ATOM   856  C CD  . GLU B 1 41 ? 31.198  7.764  64.343  1.00 46.44  ? 871 GLU B CD  1 
ATOM   857  O OE1 . GLU B 1 41 ? 31.555  8.909  63.978  1.00 47.05  ? 871 GLU B OE1 1 
ATOM   858  O OE2 . GLU B 1 41 ? 31.993  6.880  64.731  1.00 57.04  ? 871 GLU B OE2 1 
ATOM   859  N N   . GLU B 1 42 ? 27.969  4.284  62.057  1.00 33.44  ? 872 GLU B N   1 
ATOM   860  C CA  . GLU B 1 42 ? 27.843  3.200  61.100  1.00 35.40  ? 872 GLU B CA  1 
ATOM   861  C C   . GLU B 1 42 ? 26.398  3.050  60.624  1.00 30.98  ? 872 GLU B C   1 
ATOM   862  O O   . GLU B 1 42 ? 26.125  3.149  59.433  1.00 32.82  ? 872 GLU B O   1 
ATOM   863  C CB  . GLU B 1 42 ? 28.336  1.890  61.719  1.00 43.40  ? 872 GLU B CB  1 
ATOM   864  C CG  . GLU B 1 42 ? 28.377  0.742  60.729  1.00 62.17  ? 872 GLU B CG  1 
ATOM   865  C CD  . GLU B 1 42 ? 29.170  1.092  59.477  1.00 71.36  ? 872 GLU B CD  1 
ATOM   866  O OE1 . GLU B 1 42 ? 30.413  1.198  59.570  1.00 71.31  ? 872 GLU B OE1 1 
ATOM   867  O OE2 . GLU B 1 42 ? 28.549  1.274  58.403  1.00 71.79  ? 872 GLU B OE2 1 
ATOM   868  N N   . GLN B 1 43 ? 25.476  2.818  61.552  1.00 24.43  ? 873 GLN B N   1 
ATOM   869  C CA  . GLN B 1 43 ? 24.079  2.668  61.184  1.00 22.70  ? 873 GLN B CA  1 
ATOM   870  C C   . GLN B 1 43 ? 23.594  3.887  60.392  1.00 28.63  ? 873 GLN B C   1 
ATOM   871  O O   . GLN B 1 43 ? 22.896  3.748  59.381  1.00 29.13  ? 873 GLN B O   1 
ATOM   872  C CB  . GLN B 1 43 ? 23.216  2.500  62.430  1.00 23.47  ? 873 GLN B CB  1 
ATOM   873  C CG  . GLN B 1 43 ? 23.835  1.602  63.484  1.00 39.47  ? 873 GLN B CG  1 
ATOM   874  C CD  . GLN B 1 43 ? 22.828  1.128  64.512  1.00 44.85  ? 873 GLN B CD  1 
ATOM   875  O OE1 . GLN B 1 43 ? 21.979  1.895  64.972  1.00 46.25  ? 873 GLN B OE1 1 
ATOM   876  N NE2 . GLN B 1 43 ? 22.921  -0.145 64.885  1.00 50.76  ? 873 GLN B NE2 1 
ATOM   877  N N   . ASN B 1 44 ? 23.962  5.083  60.838  1.00 19.39  ? 874 ASN B N   1 
ATOM   878  C CA  . ASN B 1 44 ? 23.528  6.277  60.135  1.00 22.01  ? 874 ASN B CA  1 
ATOM   879  C C   . ASN B 1 44 ? 24.053  6.346  58.708  1.00 23.92  ? 874 ASN B C   1 
ATOM   880  O O   . ASN B 1 44 ? 23.375  6.872  57.834  1.00 29.23  ? 874 ASN B O   1 
ATOM   881  C CB  . ASN B 1 44 ? 23.915  7.530  60.911  1.00 15.21  ? 874 ASN B CB  1 
ATOM   882  C CG  . ASN B 1 44 ? 23.041  7.737  62.135  1.00 31.95  ? 874 ASN B CG  1 
ATOM   883  O OD1 . ASN B 1 44 ? 22.105  6.965  62.396  1.00 22.79  ? 874 ASN B OD1 1 
ATOM   884  N ND2 . ASN B 1 44 ? 23.338  8.784  62.896  1.00 37.41  ? 874 ASN B ND2 1 
ATOM   885  N N   . VAL B 1 45 ? 25.250  5.819  58.464  1.00 22.66  ? 875 VAL B N   1 
ATOM   886  C CA  . VAL B 1 45 ? 25.792  5.822  57.112  1.00 13.26  ? 875 VAL B CA  1 
ATOM   887  C C   . VAL B 1 45 ? 24.986  4.847  56.279  1.00 23.48  ? 875 VAL B C   1 
ATOM   888  O O   . VAL B 1 45 ? 24.795  5.041  55.080  1.00 26.68  ? 875 VAL B O   1 
ATOM   889  C CB  . VAL B 1 45 ? 27.248  5.383  57.075  1.00 24.06  ? 875 VAL B CB  1 
ATOM   890  C CG1 . VAL B 1 45 ? 27.613  4.932  55.665  1.00 24.05  ? 875 VAL B CG1 1 
ATOM   891  C CG2 . VAL B 1 45 ? 28.144  6.543  57.489  1.00 25.50  ? 875 VAL B CG2 1 
ATOM   892  N N   . THR B 1 46 ? 24.509  3.791  56.921  1.00 26.55  ? 876 THR B N   1 
ATOM   893  C CA  . THR B 1 46 ? 23.711  2.809  56.219  1.00 29.64  ? 876 THR B CA  1 
ATOM   894  C C   . THR B 1 46 ? 22.372  3.419  55.849  1.00 34.85  ? 876 THR B C   1 
ATOM   895  O O   . THR B 1 46 ? 21.953  3.343  54.695  1.00 32.28  ? 876 THR B O   1 
ATOM   896  C CB  . THR B 1 46 ? 23.472  1.567  57.073  1.00 31.63  ? 876 THR B CB  1 
ATOM   897  O OG1 . THR B 1 46 ? 24.710  0.870  57.245  1.00 27.98  ? 876 THR B OG1 1 
ATOM   898  C CG2 . THR B 1 46 ? 22.448  0.645  56.399  1.00 32.40  ? 876 THR B CG2 1 
ATOM   899  N N   . LEU B 1 47 ? 21.707  4.027  56.829  1.00 32.71  ? 877 LEU B N   1 
ATOM   900  C CA  . LEU B 1 47 ? 20.409  4.654  56.587  1.00 32.64  ? 877 LEU B CA  1 
ATOM   901  C C   . LEU B 1 47 ? 20.554  5.730  55.504  1.00 32.58  ? 877 LEU B C   1 
ATOM   902  O O   . LEU B 1 47 ? 19.658  5.930  54.679  1.00 26.10  ? 877 LEU B O   1 
ATOM   903  C CB  . LEU B 1 47 ? 19.857  5.272  57.881  1.00 20.60  ? 877 LEU B CB  1 
ATOM   904  C CG  . LEU B 1 47 ? 19.484  4.298  59.005  1.00 26.51  ? 877 LEU B CG  1 
ATOM   905  C CD1 . LEU B 1 47 ? 19.175  5.058  60.288  1.00 28.11  ? 877 LEU B CD1 1 
ATOM   906  C CD2 . LEU B 1 47 ? 18.284  3.479  58.593  1.00 35.86  ? 877 LEU B CD2 1 
ATOM   907  N N   . LEU B 1 48 ? 21.696  6.407  55.497  1.00 20.17  ? 878 LEU B N   1 
ATOM   908  C CA  . LEU B 1 48 ? 21.937  7.442  54.511  1.00 24.65  ? 878 LEU B CA  1 
ATOM   909  C C   . LEU B 1 48 ? 21.967  6.856  53.113  1.00 30.53  ? 878 LEU B C   1 
ATOM   910  O O   . LEU B 1 48 ? 21.418  7.434  52.182  1.00 38.30  ? 878 LEU B O   1 
ATOM   911  C CB  . LEU B 1 48 ? 23.254  8.145  54.802  1.00 26.27  ? 878 LEU B CB  1 
ATOM   912  C CG  . LEU B 1 48 ? 23.064  9.639  55.021  1.00 38.03  ? 878 LEU B CG  1 
ATOM   913  C CD1 . LEU B 1 48 ? 24.348  10.279 55.511  1.00 44.11  ? 878 LEU B CD1 1 
ATOM   914  C CD2 . LEU B 1 48 ? 22.605  10.244 53.722  1.00 38.64  ? 878 LEU B CD2 1 
ATOM   915  N N   . GLU B 1 49 ? 22.610  5.703  52.967  1.00 34.08  ? 879 GLU B N   1 
ATOM   916  C CA  . GLU B 1 49 ? 22.707  5.062  51.668  1.00 36.97  ? 879 GLU B CA  1 
ATOM   917  C C   . GLU B 1 49 ? 21.319  4.584  51.243  1.00 38.50  ? 879 GLU B C   1 
ATOM   918  O O   . GLU B 1 49 ? 20.912  4.782  50.099  1.00 36.11  ? 879 GLU B O   1 
ATOM   919  C CB  . GLU B 1 49 ? 23.707  3.908  51.744  1.00 40.78  ? 879 GLU B CB  1 
ATOM   920  C CG  . GLU B 1 49 ? 25.018  4.323  52.434  1.00 62.82  ? 879 GLU B CG  1 
ATOM   921  C CD  . GLU B 1 49 ? 26.183  3.352  52.229  1.00 69.45  ? 879 GLU B CD  1 
ATOM   922  O OE1 . GLU B 1 49 ? 26.019  2.128  52.449  1.00 71.61  ? 879 GLU B OE1 1 
ATOM   923  O OE2 . GLU B 1 49 ? 27.279  3.828  51.858  1.00 68.41  ? 879 GLU B OE2 1 
ATOM   924  N N   . GLN B 1 50 ? 20.583  3.989  52.181  1.00 23.33  ? 880 GLN B N   1 
ATOM   925  C CA  . GLN B 1 50 ? 19.239  3.508  51.905  1.00 28.14  ? 880 GLN B CA  1 
ATOM   926  C C   . GLN B 1 50 ? 18.316  4.673  51.578  1.00 35.75  ? 880 GLN B C   1 
ATOM   927  O O   . GLN B 1 50 ? 17.390  4.538  50.775  1.00 35.92  ? 880 GLN B O   1 
ATOM   928  C CB  . GLN B 1 50 ? 18.689  2.725  53.104  1.00 21.75  ? 880 GLN B CB  1 
ATOM   929  C CG  . GLN B 1 50 ? 19.588  1.568  53.499  1.00 28.13  ? 880 GLN B CG  1 
ATOM   930  C CD  . GLN B 1 50 ? 19.080  0.799  54.691  1.00 38.58  ? 880 GLN B CD  1 
ATOM   931  O OE1 . GLN B 1 50 ? 18.467  1.365  55.597  1.00 41.85  ? 880 GLN B OE1 1 
ATOM   932  N NE2 . GLN B 1 50 ? 19.349  -0.498 54.712  1.00 34.34  ? 880 GLN B NE2 1 
ATOM   933  N N   . LYS B 1 51 ? 18.570  5.820  52.196  1.00 36.86  ? 881 LYS B N   1 
ATOM   934  C CA  . LYS B 1 51 ? 17.744  6.983  51.940  1.00 33.29  ? 881 LYS B CA  1 
ATOM   935  C C   . LYS B 1 51 ? 18.018  7.522  50.538  1.00 35.53  ? 881 LYS B C   1 
ATOM   936  O O   . LYS B 1 51 ? 17.111  8.005  49.863  1.00 30.77  ? 881 LYS B O   1 
ATOM   937  C CB  . LYS B 1 51 ? 18.012  8.079  52.968  1.00 29.13  ? 881 LYS B CB  1 
ATOM   938  C CG  . LYS B 1 51 ? 16.797  8.941  53.232  1.00 44.00  ? 881 LYS B CG  1 
ATOM   939  C CD  . LYS B 1 51 ? 17.141  10.248 53.910  1.00 45.44  ? 881 LYS B CD  1 
ATOM   940  C CE  . LYS B 1 51 ? 17.807  11.201 52.941  1.00 45.92  ? 881 LYS B CE  1 
ATOM   941  N NZ  . LYS B 1 51 ? 17.940  12.560 53.534  1.00 51.32  ? 881 LYS B NZ  1 
ATOM   942  N N   . ASN B 1 52 ? 19.267  7.437  50.091  1.00 32.56  ? 882 ASN B N   1 
ATOM   943  C CA  . ASN B 1 52 ? 19.594  7.938  48.762  1.00 38.04  ? 882 ASN B CA  1 
ATOM   944  C C   . ASN B 1 52 ? 19.010  7.044  47.674  1.00 37.37  ? 882 ASN B C   1 
ATOM   945  O O   . ASN B 1 52 ? 18.434  7.532  46.703  1.00 37.47  ? 882 ASN B O   1 
ATOM   946  C CB  . ASN B 1 52 ? 21.102  8.057  48.596  1.00 39.15  ? 882 ASN B CB  1 
ATOM   947  C CG  . ASN B 1 52 ? 21.693  9.159  49.458  1.00 53.81  ? 882 ASN B CG  1 
ATOM   948  O OD1 . ASN B 1 52 ? 22.908  9.344  49.490  1.00 65.83  ? 882 ASN B OD1 1 
ATOM   949  N ND2 . ASN B 1 52 ? 20.834  9.902  50.158  1.00 43.79  ? 882 ASN B ND2 1 
ATOM   950  N N   . ASP B 1 53 ? 19.144  5.734  47.848  1.00 32.50  ? 883 ASP B N   1 
ATOM   951  C CA  . ASP B 1 53 ? 18.613  4.796  46.879  1.00 27.35  ? 883 ASP B CA  1 
ATOM   952  C C   . ASP B 1 53 ? 17.109  4.993  46.718  1.00 34.98  ? 883 ASP B C   1 
ATOM   953  O O   . ASP B 1 53 ? 16.587  4.965  45.602  1.00 35.90  ? 883 ASP B O   1 
ATOM   954  C CB  . ASP B 1 53 ? 18.919  3.364  47.313  1.00 30.21  ? 883 ASP B CB  1 
ATOM   955  C CG  . ASP B 1 53 ? 20.284  2.894  46.844  1.00 45.63  ? 883 ASP B CG  1 
ATOM   956  O OD1 . ASP B 1 53 ? 21.036  3.720  46.272  1.00 44.10  ? 883 ASP B OD1 1 
ATOM   957  O OD2 . ASP B 1 53 ? 20.601  1.697  47.045  1.00 43.06  ? 883 ASP B OD2 1 
ATOM   958  N N   . LEU B 1 54 ? 16.415  5.194  47.835  1.00 35.90  ? 884 LEU B N   1 
ATOM   959  C CA  . LEU B 1 54 ? 14.977  5.409  47.795  1.00 34.73  ? 884 LEU B CA  1 
ATOM   960  C C   . LEU B 1 54 ? 14.684  6.698  47.054  1.00 38.31  ? 884 LEU B C   1 
ATOM   961  O O   . LEU B 1 54 ? 13.762  6.755  46.230  1.00 35.64  ? 884 LEU B O   1 
ATOM   962  C CB  . LEU B 1 54 ? 14.401  5.493  49.207  1.00 31.71  ? 884 LEU B CB  1 
ATOM   963  C CG  . LEU B 1 54 ? 14.421  4.178  49.980  1.00 36.33  ? 884 LEU B CG  1 
ATOM   964  C CD1 . LEU B 1 54 ? 13.975  4.437  51.407  1.00 36.79  ? 884 LEU B CD1 1 
ATOM   965  C CD2 . LEU B 1 54 ? 13.512  3.152  49.302  1.00 26.77  ? 884 LEU B CD2 1 
ATOM   966  N N   . PHE B 1 55 ? 15.478  7.726  47.350  1.00 34.91  ? 885 PHE B N   1 
ATOM   967  C CA  . PHE B 1 55 ? 15.317  9.027  46.721  1.00 31.51  ? 885 PHE B CA  1 
ATOM   968  C C   . PHE B 1 55 ? 15.495  8.873  45.223  1.00 32.93  ? 885 PHE B C   1 
ATOM   969  O O   . PHE B 1 55 ? 14.812  9.519  44.434  1.00 41.94  ? 885 PHE B O   1 
ATOM   970  C CB  . PHE B 1 55 ? 16.351  10.013 47.255  1.00 41.33  ? 885 PHE B CB  1 
ATOM   971  C CG  . PHE B 1 55 ? 16.037  11.449 46.946  1.00 46.46  ? 885 PHE B CG  1 
ATOM   972  C CD1 . PHE B 1 55 ? 15.014  12.109 47.614  1.00 54.70  ? 885 PHE B CD1 1 
ATOM   973  C CD2 . PHE B 1 55 ? 16.749  12.138 45.972  1.00 55.28  ? 885 PHE B CD2 1 
ATOM   974  C CE1 . PHE B 1 55 ? 14.704  13.440 47.322  1.00 58.16  ? 885 PHE B CE1 1 
ATOM   975  C CE2 . PHE B 1 55 ? 16.449  13.469 45.672  1.00 61.91  ? 885 PHE B CE2 1 
ATOM   976  C CZ  . PHE B 1 55 ? 15.421  14.119 46.349  1.00 59.11  ? 885 PHE B CZ  1 
ATOM   977  N N   . GLY B 1 56 ? 16.412  8.010  44.824  1.00 28.04  ? 886 GLY B N   1 
ATOM   978  C CA  . GLY B 1 56 ? 16.622  7.819  43.406  1.00 30.18  ? 886 GLY B CA  1 
ATOM   979  C C   . GLY B 1 56 ? 15.404  7.194  42.753  1.00 30.69  ? 886 GLY B C   1 
ATOM   980  O O   . GLY B 1 56 ? 14.984  7.618  41.677  1.00 34.80  ? 886 GLY B O   1 
ATOM   981  N N   . SER B 1 57 ? 14.843  6.171  43.392  1.00 31.13  ? 887 SER B N   1 
ATOM   982  C CA  . SER B 1 57 ? 13.665  5.504  42.852  1.00 38.42  ? 887 SER B CA  1 
ATOM   983  C C   . SER B 1 57 ? 12.563  6.523  42.658  1.00 39.56  ? 887 SER B C   1 
ATOM   984  O O   . SER B 1 57 ? 11.941  6.592  41.593  1.00 41.09  ? 887 SER B O   1 
ATOM   985  C CB  . SER B 1 57 ? 13.167  4.402  43.793  1.00 24.80  ? 887 SER B CB  1 
ATOM   986  O OG  . SER B 1 57 ? 14.043  3.290  43.794  1.00 32.97  ? 887 SER B OG  1 
ATOM   987  N N   . MET B 1 58 ? 12.334  7.320  43.697  1.00 39.14  ? 888 MET B N   1 
ATOM   988  C CA  . MET B 1 58 ? 11.306  8.341  43.652  1.00 35.79  ? 888 MET B CA  1 
ATOM   989  C C   . MET B 1 58 ? 11.491  9.248  42.454  1.00 34.75  ? 888 MET B C   1 
ATOM   990  O O   . MET B 1 58 ? 10.535  9.522  41.730  1.00 31.55  ? 888 MET B O   1 
ATOM   991  C CB  . MET B 1 58 ? 11.329  9.180  44.917  1.00 36.94  ? 888 MET B CB  1 
ATOM   992  C CG  . MET B 1 58 ? 10.204  10.170 44.956  1.00 38.37  ? 888 MET B CG  1 
ATOM   993  S SD  . MET B 1 58 ? 10.273  11.213 46.379  1.00 63.08  ? 888 MET B SD  1 
ATOM   994  C CE  . MET B 1 58 ? 11.431  12.502 45.807  1.00 49.72  ? 888 MET B CE  1 
ATOM   995  N N   . LYS B 1 59 ? 12.720  9.713  42.249  1.00 33.33  ? 889 LYS B N   1 
ATOM   996  C CA  . LYS B 1 59 ? 13.019  10.593 41.129  1.00 30.17  ? 889 LYS B CA  1 
ATOM   997  C C   . LYS B 1 59 ? 12.611  9.900  39.842  1.00 31.21  ? 889 LYS B C   1 
ATOM   998  O O   . LYS B 1 59 ? 11.958  10.498 38.995  1.00 31.38  ? 889 LYS B O   1 
ATOM   999  C CB  . LYS B 1 59 ? 14.515  10.916 41.069  1.00 42.64  ? 889 LYS B CB  1 
ATOM   1000 C CG  . LYS B 1 59 ? 15.105  11.601 42.295  1.00 56.76  ? 889 LYS B CG  1 
ATOM   1001 C CD  . LYS B 1 59 ? 14.786  13.094 42.371  1.00 66.76  ? 889 LYS B CD  1 
ATOM   1002 C CE  . LYS B 1 59 ? 13.422  13.368 42.986  1.00 75.33  ? 889 LYS B CE  1 
ATOM   1003 N NZ  . LYS B 1 59 ? 13.193  14.828 43.230  1.00 77.89  ? 889 LYS B NZ  1 
ATOM   1004 N N   . GLN B 1 60 ? 13.002  8.638  39.688  1.00 34.05  ? 890 GLN B N   1 
ATOM   1005 C CA  . GLN B 1 60 ? 12.649  7.894  38.479  1.00 30.89  ? 890 GLN B CA  1 
ATOM   1006 C C   . GLN B 1 60 ? 11.128  7.833  38.354  1.00 30.06  ? 890 GLN B C   1 
ATOM   1007 O O   . GLN B 1 60 ? 10.584  8.003  37.270  1.00 27.60  ? 890 GLN B O   1 
ATOM   1008 C CB  . GLN B 1 60 ? 13.219  6.474  38.520  1.00 25.76  ? 890 GLN B CB  1 
ATOM   1009 C CG  . GLN B 1 60 ? 14.731  6.403  38.645  1.00 40.71  ? 890 GLN B CG  1 
ATOM   1010 C CD  . GLN B 1 60 ? 15.256  4.975  38.676  1.00 37.44  ? 890 GLN B CD  1 
ATOM   1011 O OE1 . GLN B 1 60 ? 14.637  4.082  39.262  1.00 38.39  ? 890 GLN B OE1 1 
ATOM   1012 N NE2 . GLN B 1 60 ? 16.413  4.759  38.064  1.00 34.46  ? 890 GLN B NE2 1 
ATOM   1013 N N   . LEU B 1 61 ? 10.441  7.581  39.463  1.00 32.22  ? 891 LEU B N   1 
ATOM   1014 C CA  . LEU B 1 61 ? 8.990   7.536  39.430  1.00 31.04  ? 891 LEU B CA  1 
ATOM   1015 C C   . LEU B 1 61 ? 8.501   8.879  38.880  1.00 39.48  ? 891 LEU B C   1 
ATOM   1016 O O   . LEU B 1 61 ? 7.619   8.920  38.017  1.00 41.64  ? 891 LEU B O   1 
ATOM   1017 C CB  . LEU B 1 61 ? 8.423   7.297  40.830  1.00 30.46  ? 891 LEU B CB  1 
ATOM   1018 C CG  . LEU B 1 61 ? 8.313   5.849  41.306  1.00 28.57  ? 891 LEU B CG  1 
ATOM   1019 C CD1 . LEU B 1 61 ? 7.734   5.808  42.712  1.00 33.72  ? 891 LEU B CD1 1 
ATOM   1020 C CD2 . LEU B 1 61 ? 7.415   5.073  40.360  1.00 34.21  ? 891 LEU B CD2 1 
ATOM   1021 N N   . GLU B 1 62 ? 9.091   9.969  39.374  1.00 30.39  ? 892 GLU B N   1 
ATOM   1022 C CA  . GLU B 1 62 ? 8.733   11.304 38.925  1.00 31.04  ? 892 GLU B CA  1 
ATOM   1023 C C   . GLU B 1 62 ? 8.995   11.430 37.429  1.00 32.55  ? 892 GLU B C   1 
ATOM   1024 O O   . GLU B 1 62 ? 8.187   12.009 36.706  1.00 39.45  ? 892 GLU B O   1 
ATOM   1025 C CB  . GLU B 1 62 ? 9.535   12.374 39.676  1.00 35.02  ? 892 GLU B CB  1 
ATOM   1026 C CG  . GLU B 1 62 ? 9.215   12.497 41.159  1.00 47.13  ? 892 GLU B CG  1 
ATOM   1027 C CD  . GLU B 1 62 ? 9.828   13.747 41.789  1.00 53.33  ? 892 GLU B CD  1 
ATOM   1028 O OE1 . GLU B 1 62 ? 10.999  14.059 41.475  1.00 50.27  ? 892 GLU B OE1 1 
ATOM   1029 O OE2 . GLU B 1 62 ? 9.145   14.410 42.602  1.00 52.48  ? 892 GLU B OE2 1 
ATOM   1030 N N   . ASP B 1 63 ? 10.123  10.898 36.964  1.00 34.41  ? 893 ASP B N   1 
ATOM   1031 C CA  . ASP B 1 63 ? 10.444  10.954 35.537  1.00 42.08  ? 893 ASP B CA  1 
ATOM   1032 C C   . ASP B 1 63 ? 9.316   10.295 34.752  1.00 43.53  ? 893 ASP B C   1 
ATOM   1033 O O   . ASP B 1 63 ? 8.878   10.805 33.721  1.00 40.29  ? 893 ASP B O   1 
ATOM   1034 C CB  . ASP B 1 63 ? 11.747  10.215 35.224  1.00 40.18  ? 893 ASP B CB  1 
ATOM   1035 C CG  . ASP B 1 63 ? 12.986  10.983 35.659  1.00 58.32  ? 893 ASP B CG  1 
ATOM   1036 O OD1 . ASP B 1 63 ? 13.145  12.147 35.235  1.00 62.94  ? 893 ASP B OD1 1 
ATOM   1037 O OD2 . ASP B 1 63 ? 13.809  10.418 36.414  1.00 65.21  ? 893 ASP B OD2 1 
ATOM   1038 N N   . LYS B 1 64 ? 8.843   9.159  35.252  1.00 40.26  ? 894 LYS B N   1 
ATOM   1039 C CA  . LYS B 1 64 ? 7.776   8.439  34.581  1.00 42.12  ? 894 LYS B CA  1 
ATOM   1040 C C   . LYS B 1 64 ? 6.488   9.262  34.588  1.00 42.37  ? 894 LYS B C   1 
ATOM   1041 O O   . LYS B 1 64 ? 5.767   9.299  33.590  1.00 47.06  ? 894 LYS B O   1 
ATOM   1042 C CB  . LYS B 1 64 ? 7.550   7.080  35.252  1.00 41.57  ? 894 LYS B CB  1 
ATOM   1043 C CG  . LYS B 1 64 ? 6.673   6.129  34.450  1.00 49.52  ? 894 LYS B CG  1 
ATOM   1044 C CD  . LYS B 1 64 ? 7.272   5.859  33.070  1.00 57.09  ? 894 LYS B CD  1 
ATOM   1045 C CE  . LYS B 1 64 ? 6.412   4.901  32.258  1.00 55.77  ? 894 LYS B CE  1 
ATOM   1046 N NZ  . LYS B 1 64 ? 6.981   4.647  30.902  1.00 57.26  ? 894 LYS B NZ  1 
ATOM   1047 N N   . VAL B 1 65 ? 6.212   9.939  35.701  1.00 36.25  ? 895 VAL B N   1 
ATOM   1048 C CA  . VAL B 1 65 ? 5.006   10.741 35.801  1.00 33.65  ? 895 VAL B CA  1 
ATOM   1049 C C   . VAL B 1 65 ? 4.988   11.834 34.753  1.00 36.83  ? 895 VAL B C   1 
ATOM   1050 O O   . VAL B 1 65 ? 3.994   11.988 34.043  1.00 44.30  ? 895 VAL B O   1 
ATOM   1051 C CB  . VAL B 1 65 ? 4.844   11.375 37.197  1.00 33.17  ? 895 VAL B CB  1 
ATOM   1052 C CG1 . VAL B 1 65 ? 3.696   12.382 37.184  1.00 19.42  ? 895 VAL B CG1 1 
ATOM   1053 C CG2 . VAL B 1 65 ? 4.533   10.293 38.221  1.00 34.05  ? 895 VAL B CG2 1 
ATOM   1054 N N   . GLU B 1 66 ? 6.084   12.580 34.645  1.00 35.56  ? 896 GLU B N   1 
ATOM   1055 C CA  . GLU B 1 66 ? 6.183   13.663 33.666  1.00 35.01  ? 896 GLU B CA  1 
ATOM   1056 C C   . GLU B 1 66 ? 5.995   13.162 32.236  1.00 34.31  ? 896 GLU B C   1 
ATOM   1057 O O   . GLU B 1 66 ? 5.222   13.742 31.473  1.00 37.39  ? 896 GLU B O   1 
ATOM   1058 C CB  . GLU B 1 66 ? 7.528   14.379 33.802  1.00 34.04  ? 896 GLU B CB  1 
ATOM   1059 C CG  . GLU B 1 66 ? 7.861   15.373 32.680  1.00 52.58  ? 896 GLU B CG  1 
ATOM   1060 C CD  . GLU B 1 66 ? 6.905   16.562 32.593  1.00 52.33  ? 896 GLU B CD  1 
ATOM   1061 O OE1 . GLU B 1 66 ? 6.489   17.084 33.648  1.00 59.70  ? 896 GLU B OE1 1 
ATOM   1062 O OE2 . GLU B 1 66 ? 6.585   16.990 31.462  1.00 51.74  ? 896 GLU B OE2 1 
ATOM   1063 N N   . GLU B 1 67 ? 6.683   12.080 31.884  1.00 34.84  ? 897 GLU B N   1 
ATOM   1064 C CA  . GLU B 1 67 ? 6.584   11.504 30.544  1.00 33.42  ? 897 GLU B CA  1 
ATOM   1065 C C   . GLU B 1 67 ? 5.144   11.152 30.168  1.00 28.50  ? 897 GLU B C   1 
ATOM   1066 O O   . GLU B 1 67 ? 4.693   11.433 29.061  1.00 23.29  ? 897 GLU B O   1 
ATOM   1067 C CB  . GLU B 1 67 ? 7.437   10.243 30.446  1.00 40.84  ? 897 GLU B CB  1 
ATOM   1068 C CG  . GLU B 1 67 ? 7.353   9.553  29.094  1.00 56.08  ? 897 GLU B CG  1 
ATOM   1069 C CD  . GLU B 1 67 ? 7.986   8.176  29.098  1.00 64.58  ? 897 GLU B CD  1 
ATOM   1070 O OE1 . GLU B 1 67 ? 7.472   7.281  29.810  1.00 59.74  ? 897 GLU B OE1 1 
ATOM   1071 O OE2 . GLU B 1 67 ? 9.001   7.994  28.390  1.00 71.08  ? 897 GLU B OE2 1 
ATOM   1072 N N   . LEU B 1 68 ? 4.428   10.534 31.096  1.00 24.22  ? 898 LEU B N   1 
ATOM   1073 C CA  . LEU B 1 68 ? 3.050   10.150 30.851  1.00 26.20  ? 898 LEU B CA  1 
ATOM   1074 C C   . LEU B 1 68 ? 2.136   11.353 30.673  1.00 23.95  ? 898 LEU B C   1 
ATOM   1075 O O   . LEU B 1 68 ? 1.263   11.367 29.795  1.00 22.58  ? 898 LEU B O   1 
ATOM   1076 C CB  . LEU B 1 68 ? 2.547   9.279  32.001  1.00 27.01  ? 898 LEU B CB  1 
ATOM   1077 C CG  . LEU B 1 68 ? 2.655   7.763  31.807  1.00 27.69  ? 898 LEU B CG  1 
ATOM   1078 C CD1 . LEU B 1 68 ? 4.014   7.412  31.268  1.00 36.88  ? 898 LEU B CD1 1 
ATOM   1079 C CD2 . LEU B 1 68 ? 2.411   7.063  33.134  1.00 30.39  ? 898 LEU B CD2 1 
ATOM   1080 N N   . LEU B 1 69 ? 2.348   12.356 31.516  1.00 26.14  ? 899 LEU B N   1 
ATOM   1081 C CA  . LEU B 1 69 ? 1.566   13.586 31.504  1.00 21.75  ? 899 LEU B CA  1 
ATOM   1082 C C   . LEU B 1 69 ? 1.768   14.266 30.161  1.00 27.84  ? 899 LEU B C   1 
ATOM   1083 O O   . LEU B 1 69 ? 0.849   14.880 29.613  1.00 28.56  ? 899 LEU B O   1 
ATOM   1084 C CB  . LEU B 1 69 ? 2.052   14.510 32.626  1.00 14.96  ? 899 LEU B CB  1 
ATOM   1085 C CG  . LEU B 1 69 ? 1.213   14.864 33.862  1.00 27.60  ? 899 LEU B CG  1 
ATOM   1086 C CD1 . LEU B 1 69 ? 0.000   13.949 34.029  1.00 13.38  ? 899 LEU B CD1 1 
ATOM   1087 C CD2 . LEU B 1 69 ? 2.140   14.820 35.084  1.00 9.19   ? 899 LEU B CD2 1 
ATOM   1088 N N   . SER B 1 70 ? 2.987   14.141 29.642  1.00 24.41  ? 900 SER B N   1 
ATOM   1089 C CA  . SER B 1 70 ? 3.371   14.736 28.371  1.00 22.94  ? 900 SER B CA  1 
ATOM   1090 C C   . SER B 1 70 ? 2.800   13.980 27.175  1.00 25.63  ? 900 SER B C   1 
ATOM   1091 O O   . SER B 1 70 ? 2.378   14.588 26.191  1.00 30.14  ? 900 SER B O   1 
ATOM   1092 C CB  . SER B 1 70 ? 4.893   14.785 28.269  1.00 24.86  ? 900 SER B CB  1 
ATOM   1093 O OG  . SER B 1 70 ? 5.294   15.307 27.020  1.00 55.23  ? 900 SER B OG  1 
ATOM   1094 N N   . LYS B 1 71 ? 2.801   12.654 27.247  1.00 25.97  ? 901 LYS B N   1 
ATOM   1095 C CA  . LYS B 1 71 ? 2.254   11.856 26.159  1.00 21.66  ? 901 LYS B CA  1 
ATOM   1096 C C   . LYS B 1 71 ? 0.743   12.067 26.130  1.00 27.21  ? 901 LYS B C   1 
ATOM   1097 O O   . LYS B 1 71 ? 0.144   12.226 25.062  1.00 21.96  ? 901 LYS B O   1 
ATOM   1098 C CB  . LYS B 1 71 ? 2.540   10.372 26.377  1.00 26.80  ? 901 LYS B CB  1 
ATOM   1099 C CG  . LYS B 1 71 ? 3.973   9.962  26.176  1.00 28.05  ? 901 LYS B CG  1 
ATOM   1100 C CD  . LYS B 1 71 ? 4.137   8.480  26.450  1.00 33.49  ? 901 LYS B CD  1 
ATOM   1101 C CE  . LYS B 1 71 ? 5.580   8.038  26.267  1.00 37.46  ? 901 LYS B CE  1 
ATOM   1102 N NZ  . LYS B 1 71 ? 5.701   6.566  26.455  1.00 50.11  ? 901 LYS B NZ  1 
ATOM   1103 N N   . ASN B 1 72 ? 0.131   12.059 27.313  1.00 14.28  ? 902 ASN B N   1 
ATOM   1104 C CA  . ASN B 1 72 ? -1.307  12.241 27.405  1.00 27.44  ? 902 ASN B CA  1 
ATOM   1105 C C   . ASN B 1 72 ? -1.715  13.609 26.874  1.00 32.41  ? 902 ASN B C   1 
ATOM   1106 O O   . ASN B 1 72 ? -2.765  13.770 26.241  1.00 27.71  ? 902 ASN B O   1 
ATOM   1107 C CB  . ASN B 1 72 ? -1.760  12.065 28.850  1.00 20.42  ? 902 ASN B CB  1 
ATOM   1108 C CG  . ASN B 1 72 ? -1.626  10.631 29.324  1.00 28.57  ? 902 ASN B CG  1 
ATOM   1109 O OD1 . ASN B 1 72 ? -1.864  10.331 30.489  1.00 38.27  ? 902 ASN B OD1 1 
ATOM   1110 N ND2 . ASN B 1 72 ? -1.249  9.730  28.414  1.00 21.85  ? 902 ASN B ND2 1 
ATOM   1111 N N   . TYR B 1 73 ? -0.879  14.605 27.119  1.00 30.29  ? 903 TYR B N   1 
ATOM   1112 C CA  . TYR B 1 73 ? -1.203  15.923 26.630  1.00 20.60  ? 903 TYR B CA  1 
ATOM   1113 C C   . TYR B 1 73 ? -1.239  15.881 25.104  1.00 30.86  ? 903 TYR B C   1 
ATOM   1114 O O   . TYR B 1 73 ? -2.204  16.344 24.485  1.00 28.98  ? 903 TYR B O   1 
ATOM   1115 C CB  . TYR B 1 73 ? -0.168  16.930 27.106  1.00 19.89  ? 903 TYR B CB  1 
ATOM   1116 C CG  . TYR B 1 73 ? -0.454  18.346 26.666  1.00 26.09  ? 903 TYR B CG  1 
ATOM   1117 C CD1 . TYR B 1 73 ? 0.456   19.035 25.866  1.00 19.82  ? 903 TYR B CD1 1 
ATOM   1118 C CD2 . TYR B 1 73 ? -1.638  18.992 27.035  1.00 24.51  ? 903 TYR B CD2 1 
ATOM   1119 C CE1 . TYR B 1 73 ? 0.205   20.324 25.439  1.00 25.22  ? 903 TYR B CE1 1 
ATOM   1120 C CE2 . TYR B 1 73 ? -1.903  20.289 26.608  1.00 28.88  ? 903 TYR B CE2 1 
ATOM   1121 C CZ  . TYR B 1 73 ? -0.969  20.948 25.806  1.00 35.69  ? 903 TYR B CZ  1 
ATOM   1122 O OH  . TYR B 1 73 ? -1.198  22.229 25.360  1.00 48.17  ? 903 TYR B OH  1 
ATOM   1123 N N   . HIS B 1 74 ? -0.203  15.310 24.492  1.00 19.45  ? 904 HIS B N   1 
ATOM   1124 C CA  . HIS B 1 74 ? -0.169  15.249 23.044  1.00 15.08  ? 904 HIS B CA  1 
ATOM   1125 C C   . HIS B 1 74 ? -1.366  14.463 22.543  1.00 23.17  ? 904 HIS B C   1 
ATOM   1126 O O   . HIS B 1 74 ? -2.022  14.846 21.572  1.00 27.54  ? 904 HIS B O   1 
ATOM   1127 C CB  . HIS B 1 74 ? 1.129   14.603 22.560  1.00 24.34  ? 904 HIS B CB  1 
ATOM   1128 C CG  . HIS B 1 74 ? 1.099   14.203 21.118  1.00 48.23  ? 904 HIS B CG  1 
ATOM   1129 N ND1 . HIS B 1 74 ? 0.444   13.074 20.672  1.00 52.50  ? 904 HIS B ND1 1 
ATOM   1130 C CD2 . HIS B 1 74 ? 1.609   14.801 20.014  1.00 51.33  ? 904 HIS B CD2 1 
ATOM   1131 C CE1 . HIS B 1 74 ? 0.551   12.995 19.358  1.00 55.03  ? 904 HIS B CE1 1 
ATOM   1132 N NE2 . HIS B 1 74 ? 1.253   14.032 18.934  1.00 49.45  ? 904 HIS B NE2 1 
ATOM   1133 N N   . LEU B 1 75 ? -1.661  13.363 23.218  1.00 22.84  ? 905 LEU B N   1 
ATOM   1134 C CA  . LEU B 1 75 ? -2.787  12.536 22.828  1.00 21.40  ? 905 LEU B CA  1 
ATOM   1135 C C   . LEU B 1 75 ? -4.102  13.308 22.932  1.00 21.52  ? 905 LEU B C   1 
ATOM   1136 O O   . LEU B 1 75 ? -4.961  13.177 22.062  1.00 32.33  ? 905 LEU B O   1 
ATOM   1137 C CB  . LEU B 1 75 ? -2.821  11.263 23.682  1.00 25.59  ? 905 LEU B CB  1 
ATOM   1138 C CG  . LEU B 1 75 ? -2.250  9.979  23.060  1.00 29.01  ? 905 LEU B CG  1 
ATOM   1139 C CD1 . LEU B 1 75 ? -1.035  10.274 22.216  1.00 39.45  ? 905 LEU B CD1 1 
ATOM   1140 C CD2 . LEU B 1 75 ? -1.911  8.996  24.164  1.00 25.62  ? 905 LEU B CD2 1 
ATOM   1141 N N   . GLU B 1 76 ? -4.265  14.126 23.968  1.00 22.44  ? 906 GLU B N   1 
ATOM   1142 C CA  . GLU B 1 76 ? -5.510  14.889 24.097  1.00 31.64  ? 906 GLU B CA  1 
ATOM   1143 C C   . GLU B 1 76 ? -5.636  15.933 22.998  1.00 30.31  ? 906 GLU B C   1 
ATOM   1144 O O   . GLU B 1 76 ? -6.747  16.247 22.550  1.00 24.77  ? 906 GLU B O   1 
ATOM   1145 C CB  . GLU B 1 76 ? -5.623  15.550 25.471  1.00 31.02  ? 906 GLU B CB  1 
ATOM   1146 C CG  . GLU B 1 76 ? -5.949  14.557 26.568  1.00 49.85  ? 906 GLU B CG  1 
ATOM   1147 C CD  . GLU B 1 76 ? -6.093  15.202 27.928  1.00 60.55  ? 906 GLU B CD  1 
ATOM   1148 O OE1 . GLU B 1 76 ? -5.122  15.840 28.394  1.00 70.30  ? 906 GLU B OE1 1 
ATOM   1149 O OE2 . GLU B 1 76 ? -7.179  15.067 28.532  1.00 68.36  ? 906 GLU B OE2 1 
ATOM   1150 N N   . ASN B 1 77 ? -4.505  16.471 22.551  1.00 18.95  ? 907 ASN B N   1 
ATOM   1151 C CA  . ASN B 1 77 ? -4.566  17.439 21.477  1.00 24.66  ? 907 ASN B CA  1 
ATOM   1152 C C   . ASN B 1 77 ? -4.947  16.719 20.188  1.00 26.01  ? 907 ASN B C   1 
ATOM   1153 O O   . ASN B 1 77 ? -5.633  17.287 19.343  1.00 30.48  ? 907 ASN B O   1 
ATOM   1154 C CB  . ASN B 1 77 ? -3.239  18.165 21.333  1.00 18.72  ? 907 ASN B CB  1 
ATOM   1155 C CG  . ASN B 1 77 ? -2.913  18.979 22.557  1.00 38.24  ? 907 ASN B CG  1 
ATOM   1156 O OD1 . ASN B 1 77 ? -3.811  19.506 23.208  1.00 37.28  ? 907 ASN B OD1 1 
ATOM   1157 N ND2 . ASN B 1 77 ? -1.631  19.096 22.877  1.00 41.66  ? 907 ASN B ND2 1 
ATOM   1158 N N   . GLU B 1 78 ? -4.519  15.466 20.042  1.00 22.61  ? 908 GLU B N   1 
ATOM   1159 C CA  . GLU B 1 78 ? -4.879  14.696 18.856  1.00 21.15  ? 908 GLU B CA  1 
ATOM   1160 C C   . GLU B 1 78 ? -6.394  14.509 18.827  1.00 23.31  ? 908 GLU B C   1 
ATOM   1161 O O   . GLU B 1 78 ? -7.036  14.794 17.822  1.00 38.35  ? 908 GLU B O   1 
ATOM   1162 C CB  . GLU B 1 78 ? -4.188  13.338 18.867  1.00 25.20  ? 908 GLU B CB  1 
ATOM   1163 C CG  . GLU B 1 78 ? -2.778  13.405 18.376  1.00 35.21  ? 908 GLU B CG  1 
ATOM   1164 C CD  . GLU B 1 78 ? -2.718  13.923 16.967  1.00 42.68  ? 908 GLU B CD  1 
ATOM   1165 O OE1 . GLU B 1 78 ? -2.696  13.093 16.037  1.00 52.71  ? 908 GLU B OE1 1 
ATOM   1166 O OE2 . GLU B 1 78 ? -2.718  15.162 16.790  1.00 43.03  ? 908 GLU B OE2 1 
ATOM   1167 N N   . VAL B 1 79 ? -6.965  14.045 19.936  1.00 25.28  ? 909 VAL B N   1 
ATOM   1168 C CA  . VAL B 1 79 ? -8.402  13.847 20.012  1.00 21.96  ? 909 VAL B CA  1 
ATOM   1169 C C   . VAL B 1 79 ? -9.068  15.141 19.592  1.00 26.70  ? 909 VAL B C   1 
ATOM   1170 O O   . VAL B 1 79 ? -9.978  15.136 18.759  1.00 29.49  ? 909 VAL B O   1 
ATOM   1171 C CB  . VAL B 1 79 ? -8.870  13.485 21.456  1.00 19.10  ? 909 VAL B CB  1 
ATOM   1172 C CG1 . VAL B 1 79 ? -10.385 13.551 21.548  1.00 17.43  ? 909 VAL B CG1 1 
ATOM   1173 C CG2 . VAL B 1 79 ? -8.427  12.074 21.821  1.00 23.03  ? 909 VAL B CG2 1 
ATOM   1174 N N   . ALA B 1 80 ? -8.596  16.252 20.155  1.00 22.19  ? 910 ALA B N   1 
ATOM   1175 C CA  . ALA B 1 80 ? -9.158  17.564 19.842  1.00 19.35  ? 910 ALA B CA  1 
ATOM   1176 C C   . ALA B 1 80 ? -9.074  17.851 18.343  1.00 32.72  ? 910 ALA B C   1 
ATOM   1177 O O   . ALA B 1 80 ? -10.072 18.228 17.717  1.00 30.72  ? 910 ALA B O   1 
ATOM   1178 C CB  . ALA B 1 80 ? -8.436  18.639 20.627  1.00 23.11  ? 910 ALA B CB  1 
ATOM   1179 N N   . ARG B 1 81 ? -7.884  17.663 17.772  1.00 26.11  ? 911 ARG B N   1 
ATOM   1180 C CA  . ARG B 1 81 ? -7.675  17.873 16.346  1.00 17.56  ? 911 ARG B CA  1 
ATOM   1181 C C   . ARG B 1 81 ? -8.604  16.979 15.542  1.00 27.06  ? 911 ARG B C   1 
ATOM   1182 O O   . ARG B 1 81 ? -9.357  17.464 14.699  1.00 33.55  ? 911 ARG B O   1 
ATOM   1183 C CB  . ARG B 1 81 ? -6.237  17.544 15.965  1.00 20.55  ? 911 ARG B CB  1 
ATOM   1184 C CG  . ARG B 1 81 ? -5.940  17.666 14.468  1.00 23.71  ? 911 ARG B CG  1 
ATOM   1185 C CD  . ARG B 1 81 ? -4.443  17.473 14.172  1.00 24.23  ? 911 ARG B CD  1 
ATOM   1186 N NE  . ARG B 1 81 ? -4.047  16.074 14.271  1.00 24.12  ? 911 ARG B NE  1 
ATOM   1187 C CZ  . ARG B 1 81 ? -4.544  15.117 13.490  1.00 40.58  ? 911 ARG B CZ  1 
ATOM   1188 N NH1 . ARG B 1 81 ? -5.445  15.421 12.560  1.00 39.99  ? 911 ARG B NH1 1 
ATOM   1189 N NH2 . ARG B 1 81 ? -4.155  13.857 13.644  1.00 29.20  ? 911 ARG B NH2 1 
ATOM   1190 N N   . LEU B 1 82 ? -8.541  15.671 15.794  1.00 22.52  ? 912 LEU B N   1 
ATOM   1191 C CA  . LEU B 1 82 ? -9.382  14.721 15.070  1.00 20.79  ? 912 LEU B CA  1 
ATOM   1192 C C   . LEU B 1 82 ? -10.880 15.051 15.217  1.00 30.90  ? 912 LEU B C   1 
ATOM   1193 O O   . LEU B 1 82 ? -11.627 15.005 14.251  1.00 29.77  ? 912 LEU B O   1 
ATOM   1194 C CB  . LEU B 1 82 ? -9.109  13.288 15.546  1.00 19.52  ? 912 LEU B CB  1 
ATOM   1195 C CG  . LEU B 1 82 ? -7.855  12.518 15.101  1.00 24.94  ? 912 LEU B CG  1 
ATOM   1196 C CD1 . LEU B 1 82 ? -7.628  12.707 13.603  1.00 15.15  ? 912 LEU B CD1 1 
ATOM   1197 C CD2 . LEU B 1 82 ? -6.652  12.983 15.864  1.00 28.91  ? 912 LEU B CD2 1 
ATOM   1198 N N   . LYS B 1 83 ? -11.333 15.380 16.419  1.00 24.13  ? 913 LYS B N   1 
ATOM   1199 C CA  . LYS B 1 83 ? -12.736 15.717 16.574  1.00 32.78  ? 913 LYS B CA  1 
ATOM   1200 C C   . LYS B 1 83 ? -13.096 16.916 15.688  1.00 39.42  ? 913 LYS B C   1 
ATOM   1201 O O   . LYS B 1 83 ? -14.132 16.912 15.020  1.00 40.96  ? 913 LYS B O   1 
ATOM   1202 C CB  . LYS B 1 83 ? -13.055 16.034 18.035  1.00 32.72  ? 913 LYS B CB  1 
ATOM   1203 C CG  . LYS B 1 83 ? -13.405 14.819 18.869  1.00 35.64  ? 913 LYS B CG  1 
ATOM   1204 C CD  . LYS B 1 83 ? -13.651 15.211 20.313  1.00 48.46  ? 913 LYS B CD  1 
ATOM   1205 C CE  . LYS B 1 83 ? -14.471 14.154 21.034  1.00 50.87  ? 913 LYS B CE  1 
ATOM   1206 N NZ  . LYS B 1 83 ? -13.932 12.791 20.770  1.00 63.21  ? 913 LYS B NZ  1 
ATOM   1207 N N   . LYS B 1 84 ? -12.238 17.935 15.679  1.00 41.55  ? 914 LYS B N   1 
ATOM   1208 C CA  . LYS B 1 84 ? -12.477 19.129 14.871  1.00 44.55  ? 914 LYS B CA  1 
ATOM   1209 C C   . LYS B 1 84 ? -12.537 18.740 13.406  1.00 48.40  ? 914 LYS B C   1 
ATOM   1210 O O   . LYS B 1 84 ? -13.374 19.229 12.648  1.00 48.65  ? 914 LYS B O   1 
ATOM   1211 C CB  . LYS B 1 84 ? -11.363 20.163 15.071  1.00 45.17  ? 914 LYS B CB  1 
ATOM   1212 C CG  . LYS B 1 84 ? -11.507 21.407 14.193  1.00 42.65  ? 914 LYS B CG  1 
ATOM   1213 C CD  . LYS B 1 84 ? -10.400 22.428 14.450  1.00 53.31  ? 914 LYS B CD  1 
ATOM   1214 C CE  . LYS B 1 84 ? -9.099  22.059 13.748  1.00 66.25  ? 914 LYS B CE  1 
ATOM   1215 N NZ  . LYS B 1 84 ? -9.221  22.140 12.260  1.00 64.59  ? 914 LYS B NZ  1 
ATOM   1216 N N   . LEU B 1 85 ? -11.645 17.840 13.018  1.00 45.02  ? 915 LEU B N   1 
ATOM   1217 C CA  . LEU B 1 85 ? -11.585 17.384 11.644  1.00 44.86  ? 915 LEU B CA  1 
ATOM   1218 C C   . LEU B 1 85 ? -12.884 16.702 11.217  1.00 45.61  ? 915 LEU B C   1 
ATOM   1219 O O   . LEU B 1 85 ? -13.318 16.848 10.078  1.00 47.84  ? 915 LEU B O   1 
ATOM   1220 C CB  . LEU B 1 85 ? -10.404 16.437 11.478  1.00 42.90  ? 915 LEU B CB  1 
ATOM   1221 C CG  . LEU B 1 85 ? -9.650  16.598 10.165  1.00 39.33  ? 915 LEU B CG  1 
ATOM   1222 C CD1 . LEU B 1 85 ? -8.287  15.960 10.286  1.00 39.26  ? 915 LEU B CD1 1 
ATOM   1223 C CD2 . LEU B 1 85 ? -10.456 15.980 9.046   1.00 47.81  ? 915 LEU B CD2 1 
ATOM   1224 N N   . VAL B 1 86 ? -13.505 15.960 12.128  1.00 48.12  ? 916 VAL B N   1 
ATOM   1225 C CA  . VAL B 1 86 ? -14.755 15.276 11.822  1.00 51.69  ? 916 VAL B CA  1 
ATOM   1226 C C   . VAL B 1 86 ? -15.891 16.284 11.637  1.00 56.40  ? 916 VAL B C   1 
ATOM   1227 O O   . VAL B 1 86 ? -16.738 16.123 10.762  1.00 51.42  ? 916 VAL B O   1 
ATOM   1228 C CB  . VAL B 1 86 ? -15.149 14.302 12.951  1.00 54.50  ? 916 VAL B CB  1 
ATOM   1229 C CG1 . VAL B 1 86 ? -16.596 13.840 12.767  1.00 52.00  ? 916 VAL B CG1 1 
ATOM   1230 C CG2 . VAL B 1 86 ? -14.224 13.112 12.946  1.00 37.76  ? 916 VAL B CG2 1 
ATOM   1231 N N   . GLY B 1 87 ? -15.896 17.321 12.469  1.00 60.44  ? 917 GLY B N   1 
ATOM   1232 C CA  . GLY B 1 87 ? -16.932 18.337 12.394  1.00 62.62  ? 917 GLY B CA  1 
ATOM   1233 C C   . GLY B 1 87 ? -16.805 19.350 11.267  1.00 65.81  ? 917 GLY B C   1 
ATOM   1234 O O   . GLY B 1 87 ? -17.651 20.236 11.147  1.00 62.74  ? 917 GLY B O   1 
ATOM   1235 N N   . GLU B 1 88 ? -15.755 19.234 10.454  1.00 69.22  ? 918 GLU B N   1 
ATOM   1236 C CA  . GLU B 1 88 ? -15.539 20.144 9.328   1.00 76.67  ? 918 GLU B CA  1 
ATOM   1237 C C   . GLU B 1 88 ? -15.909 19.463 8.005   1.00 81.92  ? 918 GLU B C   1 
ATOM   1238 O O   . GLU B 1 88 ? -16.789 19.998 7.294   1.00 82.84  ? 918 GLU B O   1 
ATOM   1239 C CB  . GLU B 1 88 ? -14.077 20.610 9.280   1.00 72.54  ? 918 GLU B CB  1 
ATOM   1240 C CG  . GLU B 1 88 ? -13.679 21.563 10.404  1.00 78.80  ? 918 GLU B CG  1 
ATOM   1241 C CD  . GLU B 1 88 ? -12.185 21.866 10.430  1.00 79.73  ? 918 GLU B CD  1 
ATOM   1242 O OE1 . GLU B 1 88 ? -11.446 21.308 9.588   1.00 84.18  ? 918 GLU B OE1 1 
ATOM   1243 O OE2 . GLU B 1 88 ? -11.750 22.659 11.296  1.00 81.23  ? 918 GLU B OE2 1 
ATOM   1244 N N   . GLU C 1 15 ? -11.256 9.814  65.703  1.00 124.15 ? 845 GLU C N   1 
ATOM   1245 C CA  . GLU C 1 15 ? -10.993 10.963 64.794  1.00 125.80 ? 845 GLU C CA  1 
ATOM   1246 C C   . GLU C 1 15 ? -9.969  10.570 63.735  1.00 125.18 ? 845 GLU C C   1 
ATOM   1247 O O   . GLU C 1 15 ? -9.933  11.141 62.644  1.00 122.43 ? 845 GLU C O   1 
ATOM   1248 C CB  . GLU C 1 15 ? -10.465 12.159 65.595  1.00 130.10 ? 845 GLU C CB  1 
ATOM   1249 C CG  . GLU C 1 15 ? -10.434 13.468 64.822  1.00 137.10 ? 845 GLU C CG  1 
ATOM   1250 C CD  . GLU C 1 15 ? -11.822 13.991 64.513  1.00 140.64 ? 845 GLU C CD  1 
ATOM   1251 O OE1 . GLU C 1 15 ? -12.600 14.197 65.468  1.00 141.41 ? 845 GLU C OE1 1 
ATOM   1252 O OE2 . GLU C 1 15 ? -12.134 14.200 63.320  1.00 144.15 ? 845 GLU C OE2 1 
ATOM   1253 N N   . MET C 1 16 ? -9.136  9.588  64.065  1.00 126.52 ? 846 MET C N   1 
ATOM   1254 C CA  . MET C 1 16 ? -8.104  9.125  63.145  1.00 129.96 ? 846 MET C CA  1 
ATOM   1255 C C   . MET C 1 16 ? -8.644  8.144  62.094  1.00 129.95 ? 846 MET C C   1 
ATOM   1256 O O   . MET C 1 16 ? -8.387  8.312  60.895  1.00 131.12 ? 846 MET C O   1 
ATOM   1257 C CB  . MET C 1 16 ? -6.961  8.479  63.928  1.00 133.82 ? 846 MET C CB  1 
ATOM   1258 C CG  . MET C 1 16 ? -5.875  7.890  63.053  1.00 139.15 ? 846 MET C CG  1 
ATOM   1259 S SD  . MET C 1 16 ? -5.200  9.107  61.910  1.00 144.06 ? 846 MET C SD  1 
ATOM   1260 C CE  . MET C 1 16 ? -3.839  9.722  62.886  1.00 145.13 ? 846 MET C CE  1 
ATOM   1261 N N   . LYS C 1 17 ? -9.363  7.113  62.543  1.00 127.08 ? 847 LYS C N   1 
ATOM   1262 C CA  . LYS C 1 17 ? -9.933  6.123  61.631  1.00 121.94 ? 847 LYS C CA  1 
ATOM   1263 C C   . LYS C 1 17 ? -10.932 6.809  60.703  1.00 120.87 ? 847 LYS C C   1 
ATOM   1264 O O   . LYS C 1 17 ? -10.971 6.527  59.511  1.00 121.52 ? 847 LYS C O   1 
ATOM   1265 C CB  . LYS C 1 17 ? -10.622 5.006  62.417  1.00 118.48 ? 847 LYS C CB  1 
ATOM   1266 C CG  . LYS C 1 17 ? -9.681  4.284  63.352  1.00 116.61 ? 847 LYS C CG  1 
ATOM   1267 C CD  . LYS C 1 17 ? -10.359 3.134  64.055  1.00 114.55 ? 847 LYS C CD  1 
ATOM   1268 C CE  . LYS C 1 17 ? -9.360  2.373  64.876  1.00 112.86 ? 847 LYS C CE  1 
ATOM   1269 N NZ  . LYS C 1 17 ? -9.971  1.215  65.549  1.00 112.98 ? 847 LYS C NZ  1 
ATOM   1270 N N   . GLU C 1 18 ? -11.734 7.717  61.252  1.00 117.40 ? 848 GLU C N   1 
ATOM   1271 C CA  . GLU C 1 18 ? -12.718 8.450  60.457  1.00 114.96 ? 848 GLU C CA  1 
ATOM   1272 C C   . GLU C 1 18 ? -12.029 9.062  59.242  1.00 114.14 ? 848 GLU C C   1 
ATOM   1273 O O   . GLU C 1 18 ? -12.602 9.127  58.155  1.00 117.69 ? 848 GLU C O   1 
ATOM   1274 C CB  . GLU C 1 18 ? -13.356 9.561  61.304  1.00 113.72 ? 848 GLU C CB  1 
ATOM   1275 C CG  . GLU C 1 18 ? -14.366 10.445 60.572  1.00 113.83 ? 848 GLU C CG  1 
ATOM   1276 C CD  . GLU C 1 18 ? -15.553 9.667  60.026  1.00 114.55 ? 848 GLU C CD  1 
ATOM   1277 O OE1 . GLU C 1 18 ? -16.299 9.069  60.830  1.00 115.86 ? 848 GLU C OE1 1 
ATOM   1278 O OE2 . GLU C 1 18 ? -15.739 9.655  58.791  1.00 118.00 ? 848 GLU C OE2 1 
ATOM   1279 N N   . GLN C 1 19 ? -10.789 9.503  59.443  1.00 111.36 ? 849 GLN C N   1 
ATOM   1280 C CA  . GLN C 1 19 ? -10.006 10.125 58.384  1.00 106.48 ? 849 GLN C CA  1 
ATOM   1281 C C   . GLN C 1 19 ? -9.607  9.126  57.305  1.00 99.41  ? 849 GLN C C   1 
ATOM   1282 O O   . GLN C 1 19 ? -9.859  9.359  56.126  1.00 99.18  ? 849 GLN C O   1 
ATOM   1283 C CB  . GLN C 1 19 ? -8.762  10.790 58.971  1.00 110.51 ? 849 GLN C CB  1 
ATOM   1284 C CG  . GLN C 1 19 ? -7.934  11.564 57.960  1.00 116.06 ? 849 GLN C CG  1 
ATOM   1285 C CD  . GLN C 1 19 ? -8.715  12.683 57.287  1.00 119.41 ? 849 GLN C CD  1 
ATOM   1286 O OE1 . GLN C 1 19 ? -9.307  13.531 57.956  1.00 118.10 ? 849 GLN C OE1 1 
ATOM   1287 N NE2 . GLN C 1 19 ? -8.708  12.697 55.956  1.00 121.00 ? 849 GLN C NE2 1 
ATOM   1288 N N   . LEU C 1 20 ? -8.971  8.027  57.689  1.00 92.94  ? 850 LEU C N   1 
ATOM   1289 C CA  . LEU C 1 20 ? -8.586  7.032  56.696  1.00 87.80  ? 850 LEU C CA  1 
ATOM   1290 C C   . LEU C 1 20 ? -9.816  6.566  55.931  1.00 86.37  ? 850 LEU C C   1 
ATOM   1291 O O   . LEU C 1 20 ? -9.748  6.286  54.734  1.00 85.68  ? 850 LEU C O   1 
ATOM   1292 C CB  . LEU C 1 20 ? -7.950  5.817  57.358  1.00 84.52  ? 850 LEU C CB  1 
ATOM   1293 C CG  . LEU C 1 20 ? -6.433  5.781  57.346  1.00 88.82  ? 850 LEU C CG  1 
ATOM   1294 C CD1 . LEU C 1 20 ? -5.932  4.560  58.108  1.00 85.36  ? 850 LEU C CD1 1 
ATOM   1295 C CD2 . LEU C 1 20 ? -5.974  5.745  55.901  1.00 90.78  ? 850 LEU C CD2 1 
ATOM   1296 N N   . LYS C 1 21 ? -10.945 6.490  56.631  1.00 84.17  ? 851 LYS C N   1 
ATOM   1297 C CA  . LYS C 1 21 ? -12.197 6.046  56.020  1.00 83.47  ? 851 LYS C CA  1 
ATOM   1298 C C   . LYS C 1 21 ? -12.717 7.096  55.050  1.00 82.70  ? 851 LYS C C   1 
ATOM   1299 O O   . LYS C 1 21 ? -13.082 6.785  53.913  1.00 86.87  ? 851 LYS C O   1 
ATOM   1300 C CB  . LYS C 1 21 ? -13.243 5.768  57.103  1.00 84.80  ? 851 LYS C CB  1 
ATOM   1301 C CG  . LYS C 1 21 ? -14.377 4.837  56.660  1.00 89.88  ? 851 LYS C CG  1 
ATOM   1302 C CD  . LYS C 1 21 ? -13.851 3.448  56.277  1.00 94.03  ? 851 LYS C CD  1 
ATOM   1303 C CE  . LYS C 1 21 ? -14.961 2.537  55.768  1.00 94.27  ? 851 LYS C CE  1 
ATOM   1304 N NZ  . LYS C 1 21 ? -14.418 1.225  55.330  1.00 91.03  ? 851 LYS C NZ  1 
ATOM   1305 N N   . GLN C 1 22 ? -12.761 8.336  55.517  1.00 74.46  ? 852 GLN C N   1 
ATOM   1306 C CA  . GLN C 1 22 ? -13.203 9.457  54.708  1.00 69.64  ? 852 GLN C CA  1 
ATOM   1307 C C   . GLN C 1 22 ? -12.326 9.496  53.447  1.00 68.06  ? 852 GLN C C   1 
ATOM   1308 O O   . GLN C 1 22 ? -12.772 9.879  52.367  1.00 58.12  ? 852 GLN C O   1 
ATOM   1309 C CB  . GLN C 1 22 ? -12.988 10.747 55.492  1.00 72.97  ? 852 GLN C CB  1 
ATOM   1310 C CG  . GLN C 1 22 ? -13.983 11.835 55.228  1.00 84.31  ? 852 GLN C CG  1 
ATOM   1311 C CD  . GLN C 1 22 ? -15.292 11.565 55.919  1.00 91.22  ? 852 GLN C CD  1 
ATOM   1312 O OE1 . GLN C 1 22 ? -15.910 10.516 55.721  1.00 95.91  ? 852 GLN C OE1 1 
ATOM   1313 N NE2 . GLN C 1 22 ? -15.726 12.510 56.743  1.00 91.35  ? 852 GLN C NE2 1 
ATOM   1314 N N   . MET C 1 23 ? -11.070 9.086  53.606  1.00 67.59  ? 853 MET C N   1 
ATOM   1315 C CA  . MET C 1 23 ? -10.093 9.076  52.518  1.00 70.62  ? 853 MET C CA  1 
ATOM   1316 C C   . MET C 1 23 ? -10.469 8.109  51.414  1.00 69.78  ? 853 MET C C   1 
ATOM   1317 O O   . MET C 1 23 ? -10.308 8.406  50.230  1.00 65.62  ? 853 MET C O   1 
ATOM   1318 C CB  . MET C 1 23 ? -8.711  8.688  53.048  1.00 78.16  ? 853 MET C CB  1 
ATOM   1319 C CG  . MET C 1 23 ? -7.554  9.345  52.318  1.00 85.62  ? 853 MET C CG  1 
ATOM   1320 S SD  . MET C 1 23 ? -7.430  11.084 52.768  1.00 97.52  ? 853 MET C SD  1 
ATOM   1321 C CE  . MET C 1 23 ? -6.593  10.925 54.300  1.00 86.69  ? 853 MET C CE  1 
ATOM   1322 N N   . ASP C 1 24 ? -10.955 6.943  51.811  1.00 67.63  ? 854 ASP C N   1 
ATOM   1323 C CA  . ASP C 1 24 ? -11.334 5.945  50.839  1.00 73.54  ? 854 ASP C CA  1 
ATOM   1324 C C   . ASP C 1 24 ? -12.703 6.199  50.253  1.00 69.12  ? 854 ASP C C   1 
ATOM   1325 O O   . ASP C 1 24 ? -12.948 5.873  49.094  1.00 72.68  ? 854 ASP C O   1 
ATOM   1326 C CB  . ASP C 1 24 ? -11.286 4.562  51.461  1.00 79.41  ? 854 ASP C CB  1 
ATOM   1327 C CG  . ASP C 1 24 ? -9.900  4.186  51.908  1.00 87.36  ? 854 ASP C CG  1 
ATOM   1328 O OD1 . ASP C 1 24 ? -9.716  3.019  52.310  1.00 92.76  ? 854 ASP C OD1 1 
ATOM   1329 O OD2 . ASP C 1 24 ? -9.001  5.057  51.865  1.00 89.89  ? 854 ASP C OD2 1 
ATOM   1330 N N   . LYS C 1 25 ? -13.599 6.790  51.036  1.00 65.60  ? 855 LYS C N   1 
ATOM   1331 C CA  . LYS C 1 25 ? -14.932 7.077  50.516  1.00 67.93  ? 855 LYS C CA  1 
ATOM   1332 C C   . LYS C 1 25 ? -14.736 7.954  49.283  1.00 66.80  ? 855 LYS C C   1 
ATOM   1333 O O   . LYS C 1 25 ? -15.426 7.806  48.274  1.00 64.93  ? 855 LYS C O   1 
ATOM   1334 C CB  . LYS C 1 25 ? -15.773 7.854  51.530  1.00 66.04  ? 855 LYS C CB  1 
ATOM   1335 C CG  . LYS C 1 25 ? -15.448 9.345  51.555  1.00 72.70  ? 855 LYS C CG  1 
ATOM   1336 C CD  . LYS C 1 25 ? -16.511 10.195 52.212  1.00 75.39  ? 855 LYS C CD  1 
ATOM   1337 C CE  . LYS C 1 25 ? -16.287 11.658 51.858  1.00 70.43  ? 855 LYS C CE  1 
ATOM   1338 N NZ  . LYS C 1 25 ? -14.892 12.118 52.144  1.00 60.35  ? 855 LYS C NZ  1 
ATOM   1339 N N   . MET C 1 26 ? -13.778 8.871  49.384  1.00 64.02  ? 856 MET C N   1 
ATOM   1340 C CA  . MET C 1 26 ? -13.488 9.783  48.298  1.00 63.81  ? 856 MET C CA  1 
ATOM   1341 C C   . MET C 1 26 ? -12.613 9.134  47.251  1.00 60.04  ? 856 MET C C   1 
ATOM   1342 O O   . MET C 1 26 ? -12.819 9.338  46.060  1.00 58.32  ? 856 MET C O   1 
ATOM   1343 C CB  . MET C 1 26 ? -12.808 11.044 48.816  1.00 66.23  ? 856 MET C CB  1 
ATOM   1344 C CG  . MET C 1 26 ? -12.530 12.028 47.708  1.00 74.38  ? 856 MET C CG  1 
ATOM   1345 S SD  . MET C 1 26 ? -12.375 13.706 48.278  1.00 91.83  ? 856 MET C SD  1 
ATOM   1346 C CE  . MET C 1 26 ? -14.104 14.197 48.368  1.00 87.29  ? 856 MET C CE  1 
ATOM   1347 N N   . LYS C 1 27 ? -11.633 8.357  47.689  1.00 55.77  ? 857 LYS C N   1 
ATOM   1348 C CA  . LYS C 1 27 ? -10.754 7.680  46.754  1.00 56.05  ? 857 LYS C CA  1 
ATOM   1349 C C   . LYS C 1 27 ? -11.608 6.892  45.760  1.00 57.76  ? 857 LYS C C   1 
ATOM   1350 O O   . LYS C 1 27 ? -11.240 6.748  44.598  1.00 61.64  ? 857 LYS C O   1 
ATOM   1351 C CB  . LYS C 1 27 ? -9.818  6.733  47.514  1.00 57.53  ? 857 LYS C CB  1 
ATOM   1352 C CG  . LYS C 1 27 ? -8.687  6.125  46.683  1.00 64.16  ? 857 LYS C CG  1 
ATOM   1353 C CD  . LYS C 1 27 ? -7.621  7.144  46.277  1.00 68.82  ? 857 LYS C CD  1 
ATOM   1354 C CE  . LYS C 1 27 ? -7.942  7.776  44.929  1.00 70.69  ? 857 LYS C CE  1 
ATOM   1355 N NZ  . LYS C 1 27 ? -6.834  8.622  44.403  1.00 66.50  ? 857 LYS C NZ  1 
ATOM   1356 N N   . GLU C 1 28 ? -12.762 6.412  46.221  1.00 59.81  ? 858 GLU C N   1 
ATOM   1357 C CA  . GLU C 1 28 ? -13.671 5.634  45.377  1.00 65.16  ? 858 GLU C CA  1 
ATOM   1358 C C   . GLU C 1 28 ? -14.590 6.474  44.500  1.00 65.03  ? 858 GLU C C   1 
ATOM   1359 O O   . GLU C 1 28 ? -14.874 6.104  43.361  1.00 66.90  ? 858 GLU C O   1 
ATOM   1360 C CB  . GLU C 1 28 ? -14.521 4.691  46.229  1.00 70.11  ? 858 GLU C CB  1 
ATOM   1361 C CG  . GLU C 1 28 ? -13.740 3.708  47.106  1.00 85.77  ? 858 GLU C CG  1 
ATOM   1362 C CD  . GLU C 1 28 ? -12.572 3.033  46.386  1.00 91.33  ? 858 GLU C CD  1 
ATOM   1363 O OE1 . GLU C 1 28 ? -12.068 2.013  46.900  1.00 99.53  ? 858 GLU C OE1 1 
ATOM   1364 O OE2 . GLU C 1 28 ? -12.138 3.516  45.319  1.00 92.09  ? 858 GLU C OE2 1 
ATOM   1365 N N   . ASP C 1 29 ? -15.072 7.589  45.039  1.00 64.87  ? 859 ASP C N   1 
ATOM   1366 C CA  . ASP C 1 29 ? -15.924 8.492  44.274  1.00 60.99  ? 859 ASP C CA  1 
ATOM   1367 C C   . ASP C 1 29 ? -15.099 9.028  43.111  1.00 53.82  ? 859 ASP C C   1 
ATOM   1368 O O   . ASP C 1 29 ? -15.614 9.298  42.030  1.00 52.81  ? 859 ASP C O   1 
ATOM   1369 C CB  . ASP C 1 29 ? -16.374 9.658  45.150  1.00 66.10  ? 859 ASP C CB  1 
ATOM   1370 C CG  . ASP C 1 29 ? -17.484 9.277  46.095  1.00 74.90  ? 859 ASP C CG  1 
ATOM   1371 O OD1 . ASP C 1 29 ? -17.423 8.176  46.683  1.00 71.75  ? 859 ASP C OD1 1 
ATOM   1372 O OD2 . ASP C 1 29 ? -18.418 10.092 46.252  1.00 82.66  ? 859 ASP C OD2 1 
ATOM   1373 N N   . LEU C 1 30 ? -13.802 9.163  43.351  1.00 49.01  ? 860 LEU C N   1 
ATOM   1374 C CA  . LEU C 1 30 ? -12.878 9.672  42.355  1.00 41.11  ? 860 LEU C CA  1 
ATOM   1375 C C   . LEU C 1 30 ? -12.675 8.655  41.254  1.00 42.85  ? 860 LEU C C   1 
ATOM   1376 O O   . LEU C 1 30 ? -12.693 8.995  40.072  1.00 39.55  ? 860 LEU C O   1 
ATOM   1377 C CB  . LEU C 1 30 ? -11.533 9.989  43.008  1.00 40.65  ? 860 LEU C CB  1 
ATOM   1378 C CG  . LEU C 1 30 ? -10.474 10.678 42.156  1.00 45.06  ? 860 LEU C CG  1 
ATOM   1379 C CD1 . LEU C 1 30 ? -11.027 11.981 41.589  1.00 54.70  ? 860 LEU C CD1 1 
ATOM   1380 C CD2 . LEU C 1 30 ? -9.253  10.947 43.009  1.00 40.79  ? 860 LEU C CD2 1 
ATOM   1381 N N   . ALA C 1 31 ? -12.477 7.402  41.651  1.00 41.51  ? 861 ALA C N   1 
ATOM   1382 C CA  . ALA C 1 31 ? -12.258 6.326  40.695  1.00 39.61  ? 861 ALA C CA  1 
ATOM   1383 C C   . ALA C 1 31 ? -13.540 6.046  39.929  1.00 41.16  ? 861 ALA C C   1 
ATOM   1384 O O   . ALA C 1 31 ? -13.509 5.814  38.723  1.00 43.49  ? 861 ALA C O   1 
ATOM   1385 C CB  . ALA C 1 31 ? -11.789 5.070  41.416  1.00 35.57  ? 861 ALA C CB  1 
ATOM   1386 N N   . LYS C 1 32 ? -14.663 6.078  40.636  1.00 43.25  ? 862 LYS C N   1 
ATOM   1387 C CA  . LYS C 1 32 ? -15.965 5.837  40.029  1.00 46.18  ? 862 LYS C CA  1 
ATOM   1388 C C   . LYS C 1 32 ? -16.318 6.920  39.009  1.00 42.37  ? 862 LYS C C   1 
ATOM   1389 O O   . LYS C 1 32 ? -16.722 6.607  37.895  1.00 43.81  ? 862 LYS C O   1 
ATOM   1390 C CB  . LYS C 1 32 ? -17.042 5.767  41.111  1.00 46.29  ? 862 LYS C CB  1 
ATOM   1391 C CG  . LYS C 1 32 ? -18.420 5.465  40.573  1.00 63.03  ? 862 LYS C CG  1 
ATOM   1392 C CD  . LYS C 1 32 ? -19.362 5.049  41.688  1.00 73.89  ? 862 LYS C CD  1 
ATOM   1393 C CE  . LYS C 1 32 ? -20.738 4.701  41.138  1.00 83.84  ? 862 LYS C CE  1 
ATOM   1394 N NZ  . LYS C 1 32 ? -20.668 3.647  40.084  1.00 87.05  ? 862 LYS C NZ  1 
ATOM   1395 N N   . THR C 1 33 ? -16.162 8.187  39.389  1.00 41.09  ? 863 THR C N   1 
ATOM   1396 C CA  . THR C 1 33 ? -16.456 9.302  38.488  1.00 41.45  ? 863 THR C CA  1 
ATOM   1397 C C   . THR C 1 33 ? -15.536 9.260  37.266  1.00 43.73  ? 863 THR C C   1 
ATOM   1398 O O   . THR C 1 33 ? -15.980 9.476  36.139  1.00 41.85  ? 863 THR C O   1 
ATOM   1399 C CB  . THR C 1 33 ? -16.276 10.669 39.189  1.00 40.16  ? 863 THR C CB  1 
ATOM   1400 O OG1 . THR C 1 33 ? -17.155 10.750 40.315  1.00 54.22  ? 863 THR C OG1 1 
ATOM   1401 C CG2 . THR C 1 33 ? -16.610 11.803 38.243  1.00 40.50  ? 863 THR C CG2 1 
ATOM   1402 N N   . GLU C 1 34 ? -14.257 8.977  37.493  1.00 40.94  ? 864 GLU C N   1 
ATOM   1403 C CA  . GLU C 1 34 ? -13.283 8.895  36.410  1.00 40.49  ? 864 GLU C CA  1 
ATOM   1404 C C   . GLU C 1 34 ? -13.654 7.773  35.461  1.00 40.46  ? 864 GLU C C   1 
ATOM   1405 O O   . GLU C 1 34 ? -13.343 7.833  34.273  1.00 46.12  ? 864 GLU C O   1 
ATOM   1406 C CB  . GLU C 1 34 ? -11.885 8.637  36.973  1.00 40.23  ? 864 GLU C CB  1 
ATOM   1407 C CG  . GLU C 1 34 ? -10.795 8.398  35.926  1.00 51.84  ? 864 GLU C CG  1 
ATOM   1408 C CD  . GLU C 1 34 ? -10.488 9.625  35.074  1.00 64.92  ? 864 GLU C CD  1 
ATOM   1409 O OE1 . GLU C 1 34 ? -10.402 10.741 35.633  1.00 68.76  ? 864 GLU C OE1 1 
ATOM   1410 O OE2 . GLU C 1 34 ? -10.315 9.471  33.844  1.00 77.87  ? 864 GLU C OE2 1 
ATOM   1411 N N   . ARG C 1 35 ? -14.317 6.748  35.992  1.00 43.81  ? 865 ARG C N   1 
ATOM   1412 C CA  . ARG C 1 35 ? -14.738 5.593  35.194  1.00 45.62  ? 865 ARG C CA  1 
ATOM   1413 C C   . ARG C 1 35 ? -15.810 6.039  34.219  1.00 37.74  ? 865 ARG C C   1 
ATOM   1414 O O   . ARG C 1 35 ? -15.704 5.827  33.015  1.00 27.02  ? 865 ARG C O   1 
ATOM   1415 C CB  . ARG C 1 35 ? -15.311 4.505  36.095  1.00 47.04  ? 865 ARG C CB  1 
ATOM   1416 C CG  . ARG C 1 35 ? -15.620 3.202  35.391  1.00 58.34  ? 865 ARG C CG  1 
ATOM   1417 C CD  . ARG C 1 35 ? -16.521 2.332  36.261  1.00 66.08  ? 865 ARG C CD  1 
ATOM   1418 N NE  . ARG C 1 35 ? -17.899 2.819  36.258  1.00 70.27  ? 865 ARG C NE  1 
ATOM   1419 C CZ  . ARG C 1 35 ? -18.733 2.720  37.288  1.00 75.91  ? 865 ARG C CZ  1 
ATOM   1420 N NH1 . ARG C 1 35 ? -18.330 2.151  38.417  1.00 78.90  ? 865 ARG C NH1 1 
ATOM   1421 N NH2 . ARG C 1 35 ? -19.972 3.191  37.190  1.00 74.08  ? 865 ARG C NH2 1 
ATOM   1422 N N   . ILE C 1 36 ? -16.848 6.657  34.764  1.00 38.34  ? 866 ILE C N   1 
ATOM   1423 C CA  . ILE C 1 36 ? -17.952 7.167  33.968  1.00 41.25  ? 866 ILE C CA  1 
ATOM   1424 C C   . ILE C 1 36 ? -17.445 8.194  32.944  1.00 39.53  ? 866 ILE C C   1 
ATOM   1425 O O   . ILE C 1 36 ? -17.984 8.289  31.843  1.00 35.81  ? 866 ILE C O   1 
ATOM   1426 C CB  . ILE C 1 36 ? -19.014 7.826  34.871  1.00 35.35  ? 866 ILE C CB  1 
ATOM   1427 C CG1 . ILE C 1 36 ? -19.598 6.786  35.830  1.00 44.50  ? 866 ILE C CG1 1 
ATOM   1428 C CG2 . ILE C 1 36 ? -20.093 8.459  34.025  1.00 34.67  ? 866 ILE C CG2 1 
ATOM   1429 C CD1 . ILE C 1 36 ? -20.682 7.329  36.768  1.00 43.95  ? 866 ILE C CD1 1 
ATOM   1430 N N   . LYS C 1 37 ? -16.415 8.959  33.306  1.00 37.78  ? 867 LYS C N   1 
ATOM   1431 C CA  . LYS C 1 37 ? -15.851 9.953  32.391  1.00 32.52  ? 867 LYS C CA  1 
ATOM   1432 C C   . LYS C 1 37 ? -15.307 9.227  31.168  1.00 32.13  ? 867 LYS C C   1 
ATOM   1433 O O   . LYS C 1 37 ? -15.485 9.684  30.039  1.00 31.92  ? 867 LYS C O   1 
ATOM   1434 C CB  . LYS C 1 37 ? -14.709 10.742 33.040  1.00 25.87  ? 867 LYS C CB  1 
ATOM   1435 C CG  . LYS C 1 37 ? -14.090 11.792 32.114  1.00 37.08  ? 867 LYS C CG  1 
ATOM   1436 C CD  . LYS C 1 37 ? -12.570 11.893 32.277  1.00 43.45  ? 867 LYS C CD  1 
ATOM   1437 C CE  . LYS C 1 37 ? -11.839 11.388 31.029  1.00 42.91  ? 867 LYS C CE  1 
ATOM   1438 N NZ  . LYS C 1 37 ? -10.391 11.078 31.266  1.00 52.55  ? 867 LYS C NZ  1 
ATOM   1439 N N   . LYS C 1 38 ? -14.639 8.098  31.390  1.00 24.39  ? 868 LYS C N   1 
ATOM   1440 C CA  . LYS C 1 38 ? -14.102 7.342  30.276  1.00 31.63  ? 868 LYS C CA  1 
ATOM   1441 C C   . LYS C 1 38 ? -15.248 6.733  29.485  1.00 35.50  ? 868 LYS C C   1 
ATOM   1442 O O   . LYS C 1 38 ? -15.255 6.769  28.256  1.00 45.06  ? 868 LYS C O   1 
ATOM   1443 C CB  . LYS C 1 38 ? -13.151 6.259  30.771  1.00 29.53  ? 868 LYS C CB  1 
ATOM   1444 C CG  . LYS C 1 38 ? -11.806 6.813  31.205  1.00 35.59  ? 868 LYS C CG  1 
ATOM   1445 C CD  . LYS C 1 38 ? -10.851 5.737  31.689  1.00 41.20  ? 868 LYS C CD  1 
ATOM   1446 C CE  . LYS C 1 38 ? -9.612  6.370  32.316  1.00 49.70  ? 868 LYS C CE  1 
ATOM   1447 N NZ  . LYS C 1 38 ? -8.659  5.367  32.863  1.00 53.37  ? 868 LYS C NZ  1 
ATOM   1448 N N   . GLU C 1 39 ? -16.233 6.196  30.192  1.00 37.45  ? 869 GLU C N   1 
ATOM   1449 C CA  . GLU C 1 39 ? -17.385 5.593  29.538  1.00 35.40  ? 869 GLU C CA  1 
ATOM   1450 C C   . GLU C 1 39 ? -18.072 6.579  28.601  1.00 34.51  ? 869 GLU C C   1 
ATOM   1451 O O   . GLU C 1 39 ? -18.555 6.207  27.536  1.00 34.67  ? 869 GLU C O   1 
ATOM   1452 C CB  . GLU C 1 39 ? -18.379 5.099  30.586  1.00 31.75  ? 869 GLU C CB  1 
ATOM   1453 C CG  . GLU C 1 39 ? -18.114 3.680  31.084  1.00 47.90  ? 869 GLU C CG  1 
ATOM   1454 C CD  . GLU C 1 39 ? -19.012 3.289  32.254  1.00 62.05  ? 869 GLU C CD  1 
ATOM   1455 O OE1 . GLU C 1 39 ? -20.198 3.697  32.263  1.00 60.77  ? 869 GLU C OE1 1 
ATOM   1456 O OE2 . GLU C 1 39 ? -18.531 2.566  33.156  1.00 62.65  ? 869 GLU C OE2 1 
ATOM   1457 N N   . LEU C 1 40 ? -18.107 7.840  29.014  1.00 32.16  ? 870 LEU C N   1 
ATOM   1458 C CA  . LEU C 1 40 ? -18.735 8.890  28.239  1.00 29.01  ? 870 LEU C CA  1 
ATOM   1459 C C   . LEU C 1 40 ? -17.892 9.302  27.033  1.00 32.83  ? 870 LEU C C   1 
ATOM   1460 O O   . LEU C 1 40 ? -18.430 9.567  25.956  1.00 30.29  ? 870 LEU C O   1 
ATOM   1461 C CB  . LEU C 1 40 ? -19.007 10.095 29.139  1.00 25.45  ? 870 LEU C CB  1 
ATOM   1462 C CG  . LEU C 1 40 ? -20.146 9.866  30.134  1.00 40.85  ? 870 LEU C CG  1 
ATOM   1463 C CD1 . LEU C 1 40 ? -20.195 10.979 31.165  1.00 41.54  ? 870 LEU C CD1 1 
ATOM   1464 C CD2 . LEU C 1 40 ? -21.454 9.791  29.368  1.00 41.82  ? 870 LEU C CD2 1 
ATOM   1465 N N   . GLU C 1 41 ? -16.576 9.360  27.205  1.00 30.24  ? 871 GLU C N   1 
ATOM   1466 C CA  . GLU C 1 41 ? -15.725 9.741  26.094  1.00 37.12  ? 871 GLU C CA  1 
ATOM   1467 C C   . GLU C 1 41 ? -15.906 8.681  25.029  1.00 37.37  ? 871 GLU C C   1 
ATOM   1468 O O   . GLU C 1 41 ? -15.858 8.971  23.837  1.00 47.13  ? 871 GLU C O   1 
ATOM   1469 C CB  . GLU C 1 41 ? -14.257 9.820  26.525  1.00 37.09  ? 871 GLU C CB  1 
ATOM   1470 C CG  . GLU C 1 41 ? -14.017 10.833 27.629  1.00 54.04  ? 871 GLU C CG  1 
ATOM   1471 C CD  . GLU C 1 41 ? -12.549 11.048 27.946  1.00 63.97  ? 871 GLU C CD  1 
ATOM   1472 O OE1 . GLU C 1 41 ? -11.835 10.059 28.213  1.00 67.59  ? 871 GLU C OE1 1 
ATOM   1473 O OE2 . GLU C 1 41 ? -12.108 12.218 27.941  1.00 74.24  ? 871 GLU C OE2 1 
ATOM   1474 N N   . GLU C 1 42 ? -16.140 7.451  25.472  1.00 34.41  ? 872 GLU C N   1 
ATOM   1475 C CA  . GLU C 1 42 ? -16.324 6.331  24.559  1.00 37.25  ? 872 GLU C CA  1 
ATOM   1476 C C   . GLU C 1 42 ? -17.668 6.434  23.827  1.00 32.91  ? 872 GLU C C   1 
ATOM   1477 O O   . GLU C 1 42 ? -17.729 6.289  22.615  1.00 30.99  ? 872 GLU C O   1 
ATOM   1478 C CB  . GLU C 1 42 ? -16.244 5.013  25.331  1.00 40.48  ? 872 GLU C CB  1 
ATOM   1479 C CG  . GLU C 1 42 ? -15.532 3.913  24.576  1.00 58.89  ? 872 GLU C CG  1 
ATOM   1480 C CD  . GLU C 1 42 ? -14.066 4.226  24.380  1.00 73.18  ? 872 GLU C CD  1 
ATOM   1481 O OE1 . GLU C 1 42 ? -13.356 4.348  25.400  1.00 81.98  ? 872 GLU C OE1 1 
ATOM   1482 O OE2 . GLU C 1 42 ? -13.620 4.353  23.216  1.00 80.21  ? 872 GLU C OE2 1 
ATOM   1483 N N   . GLN C 1 43 ? -18.738 6.686  24.571  1.00 35.35  ? 873 GLN C N   1 
ATOM   1484 C CA  . GLN C 1 43 ? -20.066 6.812  23.984  1.00 42.24  ? 873 GLN C CA  1 
ATOM   1485 C C   . GLN C 1 43 ? -20.017 7.928  22.942  1.00 36.32  ? 873 GLN C C   1 
ATOM   1486 O O   . GLN C 1 43 ? -20.522 7.797  21.829  1.00 35.92  ? 873 GLN C O   1 
ATOM   1487 C CB  . GLN C 1 43 ? -21.092 7.151  25.076  1.00 43.46  ? 873 GLN C CB  1 
ATOM   1488 C CG  . GLN C 1 43 ? -22.519 7.336  24.563  1.00 54.90  ? 873 GLN C CG  1 
ATOM   1489 C CD  . GLN C 1 43 ? -23.473 7.862  25.629  1.00 63.00  ? 873 GLN C CD  1 
ATOM   1490 O OE1 . GLN C 1 43 ? -23.292 8.964  26.153  1.00 67.02  ? 873 GLN C OE1 1 
ATOM   1491 N NE2 . GLN C 1 43 ? -24.498 7.075  25.952  1.00 60.58  ? 873 GLN C NE2 1 
ATOM   1492 N N   . ASN C 1 44 ? -19.387 9.024  23.331  1.00 36.44  ? 874 ASN C N   1 
ATOM   1493 C CA  . ASN C 1 44 ? -19.229 10.196 22.488  1.00 34.99  ? 874 ASN C CA  1 
ATOM   1494 C C   . ASN C 1 44 ? -18.666 9.827  21.107  1.00 36.61  ? 874 ASN C C   1 
ATOM   1495 O O   . ASN C 1 44 ? -19.224 10.192 20.072  1.00 42.02  ? 874 ASN C O   1 
ATOM   1496 C CB  . ASN C 1 44 ? -18.283 11.169 23.187  1.00 32.09  ? 874 ASN C CB  1 
ATOM   1497 C CG  . ASN C 1 44 ? -18.317 12.540 22.588  1.00 39.75  ? 874 ASN C CG  1 
ATOM   1498 O OD1 . ASN C 1 44 ? -19.113 13.383 22.995  1.00 51.01  ? 874 ASN C OD1 1 
ATOM   1499 N ND2 . ASN C 1 44 ? -17.458 12.779 21.606  1.00 29.03  ? 874 ASN C ND2 1 
ATOM   1500 N N   . VAL C 1 45 ? -17.557 9.101  21.095  1.00 34.07  ? 875 VAL C N   1 
ATOM   1501 C CA  . VAL C 1 45 ? -16.936 8.710  19.840  1.00 33.13  ? 875 VAL C CA  1 
ATOM   1502 C C   . VAL C 1 45 ? -17.825 7.736  19.078  1.00 37.50  ? 875 VAL C C   1 
ATOM   1503 O O   . VAL C 1 45 ? -17.886 7.779  17.850  1.00 33.80  ? 875 VAL C O   1 
ATOM   1504 C CB  . VAL C 1 45 ? -15.556 8.071  20.079  1.00 31.35  ? 875 VAL C CB  1 
ATOM   1505 C CG1 . VAL C 1 45 ? -14.911 7.699  18.753  1.00 27.19  ? 875 VAL C CG1 1 
ATOM   1506 C CG2 . VAL C 1 45 ? -14.668 9.043  20.851  1.00 35.13  ? 875 VAL C CG2 1 
ATOM   1507 N N   . THR C 1 46 ? -18.517 6.861  19.802  1.00 32.66  ? 876 THR C N   1 
ATOM   1508 C CA  . THR C 1 46 ? -19.398 5.907  19.147  1.00 33.55  ? 876 THR C CA  1 
ATOM   1509 C C   . THR C 1 46 ? -20.508 6.660  18.431  1.00 32.26  ? 876 THR C C   1 
ATOM   1510 O O   . THR C 1 46 ? -20.884 6.320  17.314  1.00 34.81  ? 876 THR C O   1 
ATOM   1511 C CB  . THR C 1 46 ? -20.018 4.913  20.148  1.00 32.28  ? 876 THR C CB  1 
ATOM   1512 O OG1 . THR C 1 46 ? -19.038 3.928  20.496  1.00 28.89  ? 876 THR C OG1 1 
ATOM   1513 C CG2 . THR C 1 46 ? -21.243 4.211  19.527  1.00 21.18  ? 876 THR C CG2 1 
ATOM   1514 N N   . LEU C 1 47 ? -21.030 7.688  19.081  1.00 29.80  ? 877 LEU C N   1 
ATOM   1515 C CA  . LEU C 1 47 ? -22.082 8.489  18.480  1.00 30.49  ? 877 LEU C CA  1 
ATOM   1516 C C   . LEU C 1 47 ? -21.588 9.093  17.179  1.00 27.78  ? 877 LEU C C   1 
ATOM   1517 O O   . LEU C 1 47 ? -22.288 9.089  16.173  1.00 34.36  ? 877 LEU C O   1 
ATOM   1518 C CB  . LEU C 1 47 ? -22.506 9.602  19.437  1.00 27.66  ? 877 LEU C CB  1 
ATOM   1519 C CG  . LEU C 1 47 ? -23.361 9.109  20.601  1.00 35.31  ? 877 LEU C CG  1 
ATOM   1520 C CD1 . LEU C 1 47 ? -23.629 10.242 21.568  1.00 32.66  ? 877 LEU C CD1 1 
ATOM   1521 C CD2 . LEU C 1 47 ? -24.660 8.548  20.049  1.00 32.15  ? 877 LEU C CD2 1 
ATOM   1522 N N   . LEU C 1 48 ? -20.369 9.612  17.204  1.00 31.55  ? 878 LEU C N   1 
ATOM   1523 C CA  . LEU C 1 48 ? -19.797 10.227 16.027  1.00 25.01  ? 878 LEU C CA  1 
ATOM   1524 C C   . LEU C 1 48 ? -19.730 9.236  14.878  1.00 24.83  ? 878 LEU C C   1 
ATOM   1525 O O   . LEU C 1 48 ? -20.006 9.592  13.737  1.00 27.19  ? 878 LEU C O   1 
ATOM   1526 C CB  . LEU C 1 48 ? -18.395 10.756 16.338  1.00 33.74  ? 878 LEU C CB  1 
ATOM   1527 C CG  . LEU C 1 48 ? -18.280 11.969 17.263  1.00 33.94  ? 878 LEU C CG  1 
ATOM   1528 C CD1 . LEU C 1 48 ? -16.800 12.325 17.478  1.00 24.61  ? 878 LEU C CD1 1 
ATOM   1529 C CD2 . LEU C 1 48 ? -19.028 13.141 16.643  1.00 20.13  ? 878 LEU C CD2 1 
ATOM   1530 N N   . GLU C 1 49 ? -19.357 7.995  15.183  1.00 24.83  ? 879 GLU C N   1 
ATOM   1531 C CA  . GLU C 1 49 ? -19.242 6.956  14.164  1.00 27.38  ? 879 GLU C CA  1 
ATOM   1532 C C   . GLU C 1 49 ? -20.631 6.605  13.640  1.00 27.47  ? 879 GLU C C   1 
ATOM   1533 O O   . GLU C 1 49 ? -20.824 6.414  12.443  1.00 30.69  ? 879 GLU C O   1 
ATOM   1534 C CB  . GLU C 1 49 ? -18.579 5.692  14.738  1.00 23.22  ? 879 GLU C CB  1 
ATOM   1535 C CG  . GLU C 1 49 ? -17.182 5.897  15.331  1.00 37.58  ? 879 GLU C CG  1 
ATOM   1536 C CD  . GLU C 1 49 ? -16.584 4.615  15.933  1.00 49.70  ? 879 GLU C CD  1 
ATOM   1537 O OE1 . GLU C 1 49 ? -17.286 3.925  16.711  1.00 55.75  ? 879 GLU C OE1 1 
ATOM   1538 O OE2 . GLU C 1 49 ? -15.406 4.300  15.640  1.00 48.14  ? 879 GLU C OE2 1 
ATOM   1539 N N   . GLN C 1 50 ? -21.597 6.523  14.547  1.00 30.03  ? 880 GLN C N   1 
ATOM   1540 C CA  . GLN C 1 50 ? -22.957 6.188  14.173  1.00 25.20  ? 880 GLN C CA  1 
ATOM   1541 C C   . GLN C 1 50 ? -23.538 7.291  13.305  1.00 29.06  ? 880 GLN C C   1 
ATOM   1542 O O   . GLN C 1 50 ? -24.139 7.017  12.268  1.00 25.75  ? 880 GLN C O   1 
ATOM   1543 C CB  . GLN C 1 50 ? -23.807 5.984  15.422  1.00 25.99  ? 880 GLN C CB  1 
ATOM   1544 C CG  . GLN C 1 50 ? -23.248 4.906  16.335  1.00 42.60  ? 880 GLN C CG  1 
ATOM   1545 C CD  . GLN C 1 50 ? -24.180 4.531  17.475  1.00 47.65  ? 880 GLN C CD  1 
ATOM   1546 O OE1 . GLN C 1 50 ? -24.728 5.395  18.163  1.00 46.71  ? 880 GLN C OE1 1 
ATOM   1547 N NE2 . GLN C 1 50 ? -24.349 3.232  17.689  1.00 34.84  ? 880 GLN C NE2 1 
ATOM   1548 N N   . LYS C 1 51 ? -23.359 8.544  13.709  1.00 25.24  ? 881 LYS C N   1 
ATOM   1549 C CA  . LYS C 1 51 ? -23.885 9.622  12.887  1.00 27.58  ? 881 LYS C CA  1 
ATOM   1550 C C   . LYS C 1 51 ? -23.264 9.518  11.511  1.00 30.17  ? 881 LYS C C   1 
ATOM   1551 O O   . LYS C 1 51 ? -23.954 9.641  10.504  1.00 38.87  ? 881 LYS C O   1 
ATOM   1552 C CB  . LYS C 1 51 ? -23.561 10.993 13.474  1.00 17.91  ? 881 LYS C CB  1 
ATOM   1553 C CG  . LYS C 1 51 ? -24.431 11.405 14.639  1.00 34.16  ? 881 LYS C CG  1 
ATOM   1554 C CD  . LYS C 1 51 ? -24.094 12.834 15.069  1.00 39.16  ? 881 LYS C CD  1 
ATOM   1555 C CE  . LYS C 1 51 ? -24.232 13.819 13.913  1.00 35.71  ? 881 LYS C CE  1 
ATOM   1556 N NZ  . LYS C 1 51 ? -23.951 15.221 14.319  1.00 40.32  ? 881 LYS C NZ  1 
ATOM   1557 N N   . ASN C 1 52 ? -21.958 9.274  11.471  1.00 30.61  ? 882 ASN C N   1 
ATOM   1558 C CA  . ASN C 1 52 ? -21.244 9.176  10.202  1.00 28.46  ? 882 ASN C CA  1 
ATOM   1559 C C   . ASN C 1 52 ? -21.864 8.123  9.294   1.00 34.06  ? 882 ASN C C   1 
ATOM   1560 O O   . ASN C 1 52 ? -21.965 8.322  8.082   1.00 28.95  ? 882 ASN C O   1 
ATOM   1561 C CB  . ASN C 1 52 ? -19.776 8.851  10.447  1.00 16.98  ? 882 ASN C CB  1 
ATOM   1562 C CG  . ASN C 1 52 ? -18.929 9.026  9.205   1.00 29.39  ? 882 ASN C CG  1 
ATOM   1563 O OD1 . ASN C 1 52 ? -18.610 8.061  8.511   1.00 28.87  ? 882 ASN C OD1 1 
ATOM   1564 N ND2 . ASN C 1 52 ? -18.569 10.271 8.908   1.00 36.71  ? 882 ASN C ND2 1 
ATOM   1565 N N   . ASP C 1 53 ? -22.281 7.002  9.881   1.00 38.51  ? 883 ASP C N   1 
ATOM   1566 C CA  . ASP C 1 53 ? -22.907 5.931  9.109   1.00 43.27  ? 883 ASP C CA  1 
ATOM   1567 C C   . ASP C 1 53 ? -24.262 6.381  8.566   1.00 46.33  ? 883 ASP C C   1 
ATOM   1568 O O   . ASP C 1 53 ? -24.557 6.195  7.381   1.00 42.72  ? 883 ASP C O   1 
ATOM   1569 C CB  . ASP C 1 53 ? -23.094 4.683  9.970   1.00 45.54  ? 883 ASP C CB  1 
ATOM   1570 C CG  . ASP C 1 53 ? -21.804 3.949  10.210  1.00 49.96  ? 883 ASP C CG  1 
ATOM   1571 O OD1 . ASP C 1 53 ? -21.843 2.907  10.891  1.00 60.32  ? 883 ASP C OD1 1 
ATOM   1572 O OD2 . ASP C 1 53 ? -20.753 4.410  9.718   1.00 60.98  ? 883 ASP C OD2 1 
ATOM   1573 N N   . LEU C 1 54 ? -25.088 6.960  9.435   1.00 36.24  ? 884 LEU C N   1 
ATOM   1574 C CA  . LEU C 1 54 ? -26.390 7.438  9.005   1.00 39.79  ? 884 LEU C CA  1 
ATOM   1575 C C   . LEU C 1 54 ? -26.207 8.395  7.817   1.00 37.07  ? 884 LEU C C   1 
ATOM   1576 O O   . LEU C 1 54 ? -26.971 8.331  6.856   1.00 40.29  ? 884 LEU C O   1 
ATOM   1577 C CB  . LEU C 1 54 ? -27.121 8.135  10.160  1.00 37.05  ? 884 LEU C CB  1 
ATOM   1578 C CG  . LEU C 1 54 ? -27.556 7.270  11.352  1.00 48.60  ? 884 LEU C CG  1 
ATOM   1579 C CD1 . LEU C 1 54 ? -28.040 8.170  12.480  1.00 53.96  ? 884 LEU C CD1 1 
ATOM   1580 C CD2 . LEU C 1 54 ? -28.657 6.300  10.942  1.00 43.95  ? 884 LEU C CD2 1 
ATOM   1581 N N   . PHE C 1 55 ? -25.199 9.270  7.875   1.00 32.36  ? 885 PHE C N   1 
ATOM   1582 C CA  . PHE C 1 55 ? -24.948 10.199 6.769   1.00 35.43  ? 885 PHE C CA  1 
ATOM   1583 C C   . PHE C 1 55 ? -24.612 9.361  5.548   1.00 36.31  ? 885 PHE C C   1 
ATOM   1584 O O   . PHE C 1 55 ? -24.957 9.707  4.419   1.00 36.47  ? 885 PHE C O   1 
ATOM   1585 C CB  . PHE C 1 55 ? -23.751 11.112 7.039   1.00 43.67  ? 885 PHE C CB  1 
ATOM   1586 C CG  . PHE C 1 55 ? -24.033 12.239 7.979   1.00 46.09  ? 885 PHE C CG  1 
ATOM   1587 C CD1 . PHE C 1 55 ? -25.114 13.084 7.771   1.00 49.10  ? 885 PHE C CD1 1 
ATOM   1588 C CD2 . PHE C 1 55 ? -23.169 12.496 9.045   1.00 51.49  ? 885 PHE C CD2 1 
ATOM   1589 C CE1 . PHE C 1 55 ? -25.339 14.174 8.611   1.00 54.30  ? 885 PHE C CE1 1 
ATOM   1590 C CE2 . PHE C 1 55 ? -23.379 13.578 9.890   1.00 46.82  ? 885 PHE C CE2 1 
ATOM   1591 C CZ  . PHE C 1 55 ? -24.469 14.424 9.671   1.00 57.10  ? 885 PHE C CZ  1 
ATOM   1592 N N   . GLY C 1 56 ? -23.908 8.261  5.783   1.00 34.41  ? 886 GLY C N   1 
ATOM   1593 C CA  . GLY C 1 56 ? -23.561 7.391  4.682   1.00 36.29  ? 886 GLY C CA  1 
ATOM   1594 C C   . GLY C 1 56 ? -24.830 6.877  4.032   1.00 40.31  ? 886 GLY C C   1 
ATOM   1595 O O   . GLY C 1 56 ? -25.023 7.039  2.823   1.00 41.66  ? 886 GLY C O   1 
ATOM   1596 N N   . SER C 1 57 ? -25.706 6.286  4.849   1.00 34.76  ? 887 SER C N   1 
ATOM   1597 C CA  . SER C 1 57 ? -26.963 5.719  4.372   1.00 34.58  ? 887 SER C CA  1 
ATOM   1598 C C   . SER C 1 57 ? -27.864 6.727  3.679   1.00 34.51  ? 887 SER C C   1 
ATOM   1599 O O   . SER C 1 57 ? -28.425 6.439  2.628   1.00 35.63  ? 887 SER C O   1 
ATOM   1600 C CB  . SER C 1 57 ? -27.735 5.058  5.524   1.00 32.87  ? 887 SER C CB  1 
ATOM   1601 O OG  . SER C 1 57 ? -27.089 3.882  5.981   1.00 36.00  ? 887 SER C OG  1 
ATOM   1602 N N   . MET C 1 58 ? -28.001 7.911  4.253   1.00 32.81  ? 888 MET C N   1 
ATOM   1603 C CA  . MET C 1 58 ? -28.862 8.910  3.651   1.00 36.77  ? 888 MET C CA  1 
ATOM   1604 C C   . MET C 1 58 ? -28.438 9.289  2.243   1.00 36.92  ? 888 MET C C   1 
ATOM   1605 O O   . MET C 1 58 ? -29.283 9.510  1.366   1.00 28.96  ? 888 MET C O   1 
ATOM   1606 C CB  . MET C 1 58 ? -28.930 10.143 4.544   1.00 38.14  ? 888 MET C CB  1 
ATOM   1607 C CG  . MET C 1 58 ? -29.736 9.884  5.810   1.00 51.05  ? 888 MET C CG  1 
ATOM   1608 S SD  . MET C 1 58 ? -29.799 11.302 6.906   1.00 61.06  ? 888 MET C SD  1 
ATOM   1609 C CE  . MET C 1 58 ? -30.566 12.524 5.825   1.00 55.26  ? 888 MET C CE  1 
ATOM   1610 N N   . LYS C 1 59 ? -27.132 9.344  2.012   1.00 39.21  ? 889 LYS C N   1 
ATOM   1611 C CA  . LYS C 1 59 ? -26.640 9.708  0.696   1.00 35.28  ? 889 LYS C CA  1 
ATOM   1612 C C   . LYS C 1 59 ? -27.049 8.641  -0.310  1.00 31.81  ? 889 LYS C C   1 
ATOM   1613 O O   . LYS C 1 59 ? -27.515 8.956  -1.404  1.00 30.65  ? 889 LYS C O   1 
ATOM   1614 C CB  . LYS C 1 59 ? -25.126 9.869  0.734   1.00 34.89  ? 889 LYS C CB  1 
ATOM   1615 C CG  . LYS C 1 59 ? -24.525 10.525 -0.504  1.00 47.09  ? 889 LYS C CG  1 
ATOM   1616 C CD  . LYS C 1 59 ? -24.362 9.539  -1.644  1.00 53.06  ? 889 LYS C CD  1 
ATOM   1617 C CE  . LYS C 1 59 ? -23.380 10.058 -2.687  1.00 62.29  ? 889 LYS C CE  1 
ATOM   1618 N NZ  . LYS C 1 59 ? -23.071 9.030  -3.726  1.00 60.36  ? 889 LYS C NZ  1 
ATOM   1619 N N   . GLN C 1 60 ? -26.891 7.379  0.068   1.00 26.12  ? 890 GLN C N   1 
ATOM   1620 C CA  . GLN C 1 60 ? -27.254 6.284  -0.819  1.00 28.11  ? 890 GLN C CA  1 
ATOM   1621 C C   . GLN C 1 60 ? -28.746 6.343  -1.100  1.00 31.36  ? 890 GLN C C   1 
ATOM   1622 O O   . GLN C 1 60 ? -29.181 6.109  -2.221  1.00 35.53  ? 890 GLN C O   1 
ATOM   1623 C CB  . GLN C 1 60 ? -26.898 4.944  -0.180  1.00 33.33  ? 890 GLN C CB  1 
ATOM   1624 C CG  . GLN C 1 60 ? -25.431 4.827  0.180   1.00 49.24  ? 890 GLN C CG  1 
ATOM   1625 C CD  . GLN C 1 60 ? -25.066 3.456  0.703   1.00 57.58  ? 890 GLN C CD  1 
ATOM   1626 O OE1 . GLN C 1 60 ? -25.595 3.000  1.719   1.00 67.21  ? 890 GLN C OE1 1 
ATOM   1627 N NE2 . GLN C 1 60 ? -24.154 2.787  0.007   1.00 61.91  ? 890 GLN C NE2 1 
ATOM   1628 N N   . LEU C 1 61 ? -29.525 6.665  -0.072  1.00 31.12  ? 891 LEU C N   1 
ATOM   1629 C CA  . LEU C 1 61 ? -30.968 6.765  -0.211  1.00 28.74  ? 891 LEU C CA  1 
ATOM   1630 C C   . LEU C 1 61 ? -31.350 7.923  -1.137  1.00 30.65  ? 891 LEU C C   1 
ATOM   1631 O O   . LEU C 1 61 ? -32.140 7.750  -2.073  1.00 27.81  ? 891 LEU C O   1 
ATOM   1632 C CB  . LEU C 1 61 ? -31.621 6.948  1.165   1.00 28.37  ? 891 LEU C CB  1 
ATOM   1633 C CG  . LEU C 1 61 ? -31.716 5.721  2.078   1.00 31.38  ? 891 LEU C CG  1 
ATOM   1634 C CD1 . LEU C 1 61 ? -32.329 6.129  3.409   1.00 24.80  ? 891 LEU C CD1 1 
ATOM   1635 C CD2 . LEU C 1 61 ? -32.563 4.641  1.426   1.00 29.37  ? 891 LEU C CD2 1 
ATOM   1636 N N   . GLU C 1 62 ? -30.793 9.103  -0.877  1.00 29.01  ? 892 GLU C N   1 
ATOM   1637 C CA  . GLU C 1 62 ? -31.093 10.262 -1.706  1.00 29.85  ? 892 GLU C CA  1 
ATOM   1638 C C   . GLU C 1 62 ? -30.803 9.922  -3.156  1.00 36.43  ? 892 GLU C C   1 
ATOM   1639 O O   . GLU C 1 62 ? -31.632 10.172 -4.030  1.00 38.72  ? 892 GLU C O   1 
ATOM   1640 C CB  . GLU C 1 62 ? -30.261 11.466 -1.279  1.00 28.93  ? 892 GLU C CB  1 
ATOM   1641 C CG  . GLU C 1 62 ? -30.546 11.922 0.135   1.00 45.93  ? 892 GLU C CG  1 
ATOM   1642 C CD  . GLU C 1 62 ? -29.611 13.022 0.604   1.00 56.39  ? 892 GLU C CD  1 
ATOM   1643 O OE1 . GLU C 1 62 ? -28.379 12.805 0.583   1.00 60.68  ? 892 GLU C OE1 1 
ATOM   1644 O OE2 . GLU C 1 62 ? -30.110 14.100 1.001   1.00 65.63  ? 892 GLU C OE2 1 
ATOM   1645 N N   . ASP C 1 63 ? -29.637 9.335  -3.412  1.00 29.62  ? 893 ASP C N   1 
ATOM   1646 C CA  . ASP C 1 63 ? -29.277 8.972  -4.779  1.00 35.60  ? 893 ASP C CA  1 
ATOM   1647 C C   . ASP C 1 63 ? -30.266 7.983  -5.394  1.00 36.34  ? 893 ASP C C   1 
ATOM   1648 O O   . ASP C 1 63 ? -30.501 8.006  -6.607  1.00 41.51  ? 893 ASP C O   1 
ATOM   1649 C CB  . ASP C 1 63 ? -27.865 8.375  -4.833  1.00 35.75  ? 893 ASP C CB  1 
ATOM   1650 C CG  . ASP C 1 63 ? -26.777 9.416  -4.618  1.00 42.01  ? 893 ASP C CG  1 
ATOM   1651 O OD1 . ASP C 1 63 ? -27.095 10.626 -4.565  1.00 54.37  ? 893 ASP C OD1 1 
ATOM   1652 O OD2 . ASP C 1 63 ? -25.598 9.023  -4.511  1.00 43.21  ? 893 ASP C OD2 1 
ATOM   1653 N N   . LYS C 1 64 ? -30.847 7.124  -4.560  1.00 29.33  ? 894 LYS C N   1 
ATOM   1654 C CA  . LYS C 1 64 ? -31.806 6.127  -5.034  1.00 31.85  ? 894 LYS C CA  1 
ATOM   1655 C C   . LYS C 1 64 ? -33.088 6.832  -5.436  1.00 31.21  ? 894 LYS C C   1 
ATOM   1656 O O   . LYS C 1 64 ? -33.678 6.556  -6.491  1.00 27.23  ? 894 LYS C O   1 
ATOM   1657 C CB  . LYS C 1 64 ? -32.105 5.111  -3.937  1.00 29.24  ? 894 LYS C CB  1 
ATOM   1658 C CG  . LYS C 1 64 ? -32.976 3.956  -4.381  1.00 46.87  ? 894 LYS C CG  1 
ATOM   1659 C CD  . LYS C 1 64 ? -32.275 3.114  -5.424  1.00 51.47  ? 894 LYS C CD  1 
ATOM   1660 C CE  . LYS C 1 64 ? -33.097 1.886  -5.777  1.00 57.66  ? 894 LYS C CE  1 
ATOM   1661 N NZ  . LYS C 1 64 ? -32.392 1.021  -6.768  1.00 64.73  ? 894 LYS C NZ  1 
ATOM   1662 N N   . VAL C 1 65 ? -33.520 7.747  -4.582  1.00 28.51  ? 895 VAL C N   1 
ATOM   1663 C CA  . VAL C 1 65 ? -34.719 8.507  -4.869  1.00 28.59  ? 895 VAL C CA  1 
ATOM   1664 C C   . VAL C 1 65 ? -34.542 9.228  -6.211  1.00 31.92  ? 895 VAL C C   1 
ATOM   1665 O O   . VAL C 1 65 ? -35.465 9.282  -7.024  1.00 41.24  ? 895 VAL C O   1 
ATOM   1666 C CB  . VAL C 1 65 ? -35.000 9.507  -3.745  1.00 24.27  ? 895 VAL C CB  1 
ATOM   1667 C CG1 . VAL C 1 65 ? -35.949 10.586 -4.218  1.00 19.81  ? 895 VAL C CG1 1 
ATOM   1668 C CG2 . VAL C 1 65 ? -35.579 8.770  -2.555  1.00 10.37  ? 895 VAL C CG2 1 
ATOM   1669 N N   . GLU C 1 66 ? -33.355 9.767  -6.459  1.00 32.25  ? 896 GLU C N   1 
ATOM   1670 C CA  . GLU C 1 66 ? -33.128 10.449 -7.724  1.00 39.24  ? 896 GLU C CA  1 
ATOM   1671 C C   . GLU C 1 66 ? -33.177 9.452  -8.864  1.00 34.10  ? 896 GLU C C   1 
ATOM   1672 O O   . GLU C 1 66 ? -33.741 9.740  -9.913  1.00 29.68  ? 896 GLU C O   1 
ATOM   1673 C CB  . GLU C 1 66 ? -31.782 11.174 -7.739  1.00 50.76  ? 896 GLU C CB  1 
ATOM   1674 C CG  . GLU C 1 66 ? -31.739 12.405 -6.861  1.00 64.17  ? 896 GLU C CG  1 
ATOM   1675 C CD  . GLU C 1 66 ? -33.003 13.230 -6.970  1.00 71.01  ? 896 GLU C CD  1 
ATOM   1676 O OE1 . GLU C 1 66 ? -33.885 13.081 -6.095  1.00 74.92  ? 896 GLU C OE1 1 
ATOM   1677 O OE2 . GLU C 1 66 ? -33.121 14.013 -7.935  1.00 72.97  ? 896 GLU C OE2 1 
ATOM   1678 N N   . GLU C 1 67 ? -32.596 8.274  -8.659  1.00 33.86  ? 897 GLU C N   1 
ATOM   1679 C CA  . GLU C 1 67 ? -32.606 7.261  -9.705  1.00 28.29  ? 897 GLU C CA  1 
ATOM   1680 C C   . GLU C 1 67 ? -34.050 6.917  -10.062 1.00 31.56  ? 897 GLU C C   1 
ATOM   1681 O O   . GLU C 1 67 ? -34.427 6.896  -11.238 1.00 29.32  ? 897 GLU C O   1 
ATOM   1682 C CB  . GLU C 1 67 ? -31.894 6.000  -9.231  1.00 26.18  ? 897 GLU C CB  1 
ATOM   1683 C CG  . GLU C 1 67 ? -31.691 4.960  -10.328 1.00 46.34  ? 897 GLU C CG  1 
ATOM   1684 C CD  . GLU C 1 67 ? -31.217 3.618  -9.788  1.00 64.42  ? 897 GLU C CD  1 
ATOM   1685 O OE1 . GLU C 1 67 ? -32.051 2.871  -9.231  1.00 70.19  ? 897 GLU C OE1 1 
ATOM   1686 O OE2 . GLU C 1 67 ? -30.009 3.312  -9.912  1.00 72.76  ? 897 GLU C OE2 1 
ATOM   1687 N N   . LEU C 1 68 ? -34.851 6.660  -9.030  1.00 25.30  ? 898 LEU C N   1 
ATOM   1688 C CA  . LEU C 1 68 ? -36.251 6.300  -9.194  1.00 27.94  ? 898 LEU C CA  1 
ATOM   1689 C C   . LEU C 1 68 ? -37.103 7.351  -9.887  1.00 26.58  ? 898 LEU C C   1 
ATOM   1690 O O   . LEU C 1 68 ? -37.918 7.014  -10.746 1.00 30.31  ? 898 LEU C O   1 
ATOM   1691 C CB  . LEU C 1 68 ? -36.860 5.939  -7.832  1.00 24.39  ? 898 LEU C CB  1 
ATOM   1692 C CG  . LEU C 1 68 ? -36.336 4.588  -7.339  1.00 25.63  ? 898 LEU C CG  1 
ATOM   1693 C CD1 . LEU C 1 68 ? -36.875 4.253  -5.960  1.00 35.12  ? 898 LEU C CD1 1 
ATOM   1694 C CD2 . LEU C 1 68 ? -36.757 3.532  -8.340  1.00 24.61  ? 898 LEU C CD2 1 
ATOM   1695 N N   . LEU C 1 69 ? -36.927 8.614  -9.513  1.00 26.07  ? 899 LEU C N   1 
ATOM   1696 C CA  . LEU C 1 69 ? -37.690 9.703  -10.123 1.00 27.33  ? 899 LEU C CA  1 
ATOM   1697 C C   . LEU C 1 69 ? -37.404 9.739  -11.620 1.00 34.45  ? 899 LEU C C   1 
ATOM   1698 O O   . LEU C 1 69 ? -38.301 9.945  -12.433 1.00 36.53  ? 899 LEU C O   1 
ATOM   1699 C CB  . LEU C 1 69 ? -37.277 11.036 -9.520  1.00 20.14  ? 899 LEU C CB  1 
ATOM   1700 C CG  . LEU C 1 69 ? -38.187 11.812 -8.569  1.00 34.08  ? 899 LEU C CG  1 
ATOM   1701 C CD1 . LEU C 1 69 ? -39.349 10.986 -8.083  1.00 11.31  ? 899 LEU C CD1 1 
ATOM   1702 C CD2 . LEU C 1 69 ? -37.325 12.304 -7.415  1.00 29.28  ? 899 LEU C CD2 1 
ATOM   1703 N N   . SER C 1 70 ? -36.141 9.546  -11.981 1.00 33.63  ? 900 SER C N   1 
ATOM   1704 C CA  . SER C 1 70 ? -35.765 9.563  -13.378 1.00 32.36  ? 900 SER C CA  1 
ATOM   1705 C C   . SER C 1 70 ? -36.369 8.359  -14.106 1.00 37.45  ? 900 SER C C   1 
ATOM   1706 O O   . SER C 1 70 ? -37.007 8.522  -15.148 1.00 35.10  ? 900 SER C O   1 
ATOM   1707 C CB  . SER C 1 70 ? -34.247 9.570  -13.508 1.00 25.52  ? 900 SER C CB  1 
ATOM   1708 O OG  . SER C 1 70 ? -33.862 9.576  -14.870 1.00 44.08  ? 900 SER C OG  1 
ATOM   1709 N N   . LYS C 1 71 ? -36.184 7.155  -13.567 1.00 35.84  ? 901 LYS C N   1 
ATOM   1710 C CA  . LYS C 1 71 ? -36.754 5.963  -14.206 1.00 42.05  ? 901 LYS C CA  1 
ATOM   1711 C C   . LYS C 1 71 ? -38.265 6.107  -14.383 1.00 44.02  ? 901 LYS C C   1 
ATOM   1712 O O   . LYS C 1 71 ? -38.814 5.750  -15.427 1.00 39.80  ? 901 LYS C O   1 
ATOM   1713 C CB  . LYS C 1 71 ? -36.492 4.700  -13.378 1.00 36.52  ? 901 LYS C CB  1 
ATOM   1714 C CG  . LYS C 1 71 ? -35.099 4.116  -13.502 1.00 44.04  ? 901 LYS C CG  1 
ATOM   1715 C CD  . LYS C 1 71 ? -34.940 2.874  -12.623 1.00 51.55  ? 901 LYS C CD  1 
ATOM   1716 C CE  . LYS C 1 71 ? -33.556 2.246  -12.788 1.00 60.27  ? 901 LYS C CE  1 
ATOM   1717 N NZ  . LYS C 1 71 ? -33.374 1.019  -11.956 1.00 69.21  ? 901 LYS C NZ  1 
ATOM   1718 N N   . ASN C 1 72 ? -38.929 6.623  -13.353 1.00 36.35  ? 902 ASN C N   1 
ATOM   1719 C CA  . ASN C 1 72 ? -40.378 6.797  -13.382 1.00 40.53  ? 902 ASN C CA  1 
ATOM   1720 C C   . ASN C 1 72 ? -40.799 7.850  -14.397 1.00 39.91  ? 902 ASN C C   1 
ATOM   1721 O O   . ASN C 1 72 ? -41.894 7.791  -14.960 1.00 41.16  ? 902 ASN C O   1 
ATOM   1722 C CB  . ASN C 1 72 ? -40.892 7.168  -11.984 1.00 18.08  ? 902 ASN C CB  1 
ATOM   1723 C CG  . ASN C 1 72 ? -41.163 5.946  -11.119 1.00 34.41  ? 902 ASN C CG  1 
ATOM   1724 O OD1 . ASN C 1 72 ? -40.539 4.885  -11.279 1.00 28.24  ? 902 ASN C OD1 1 
ATOM   1725 N ND2 . ASN C 1 72 ? -42.097 6.090  -10.188 1.00 31.14  ? 902 ASN C ND2 1 
ATOM   1726 N N   . TYR C 1 73 ? -39.924 8.816  -14.629 1.00 39.05  ? 903 TYR C N   1 
ATOM   1727 C CA  . TYR C 1 73 ? -40.223 9.867  -15.583 1.00 40.91  ? 903 TYR C CA  1 
ATOM   1728 C C   . TYR C 1 73 ? -40.235 9.256  -16.974 1.00 36.47  ? 903 TYR C C   1 
ATOM   1729 O O   . TYR C 1 73 ? -41.190 9.426  -17.723 1.00 33.56  ? 903 TYR C O   1 
ATOM   1730 C CB  . TYR C 1 73 ? -39.180 10.977 -15.458 1.00 39.97  ? 903 TYR C CB  1 
ATOM   1731 C CG  . TYR C 1 73 ? -39.000 11.877 -16.666 1.00 52.55  ? 903 TYR C CG  1 
ATOM   1732 C CD1 . TYR C 1 73 ? -38.066 11.560 -17.659 1.00 56.99  ? 903 TYR C CD1 1 
ATOM   1733 C CD2 . TYR C 1 73 ? -39.680 13.095 -16.766 1.00 49.32  ? 903 TYR C CD2 1 
ATOM   1734 C CE1 . TYR C 1 73 ? -37.801 12.434 -18.708 1.00 51.37  ? 903 TYR C CE1 1 
ATOM   1735 C CE2 . TYR C 1 73 ? -39.423 13.979 -17.815 1.00 55.39  ? 903 TYR C CE2 1 
ATOM   1736 C CZ  . TYR C 1 73 ? -38.478 13.644 -18.780 1.00 61.14  ? 903 TYR C CZ  1 
ATOM   1737 O OH  . TYR C 1 73 ? -38.190 14.529 -19.797 1.00 62.96  ? 903 TYR C OH  1 
ATOM   1738 N N   . HIS C 1 74 ? -39.186 8.520  -17.310 1.00 33.51  ? 904 HIS C N   1 
ATOM   1739 C CA  . HIS C 1 74 ? -39.114 7.889  -18.614 1.00 44.10  ? 904 HIS C CA  1 
ATOM   1740 C C   . HIS C 1 74 ? -40.209 6.836  -18.784 1.00 49.45  ? 904 HIS C C   1 
ATOM   1741 O O   . HIS C 1 74 ? -40.637 6.544  -19.905 1.00 48.39  ? 904 HIS C O   1 
ATOM   1742 C CB  . HIS C 1 74 ? -37.731 7.272  -18.817 1.00 55.26  ? 904 HIS C CB  1 
ATOM   1743 C CG  . HIS C 1 74 ? -36.641 8.287  -18.970 1.00 71.15  ? 904 HIS C CG  1 
ATOM   1744 N ND1 . HIS C 1 74 ? -36.302 9.177  -17.972 1.00 71.45  ? 904 HIS C ND1 1 
ATOM   1745 C CD2 . HIS C 1 74 ? -35.827 8.573  -20.016 1.00 70.05  ? 904 HIS C CD2 1 
ATOM   1746 C CE1 . HIS C 1 74 ? -35.330 9.963  -18.394 1.00 72.59  ? 904 HIS C CE1 1 
ATOM   1747 N NE2 . HIS C 1 74 ? -35.023 9.617  -19.633 1.00 71.40  ? 904 HIS C NE2 1 
ATOM   1748 N N   . LEU C 1 75 ? -40.667 6.270  -17.673 1.00 51.32  ? 905 LEU C N   1 
ATOM   1749 C CA  . LEU C 1 75 ? -41.725 5.274  -17.729 1.00 49.67  ? 905 LEU C CA  1 
ATOM   1750 C C   . LEU C 1 75 ? -43.051 5.948  -18.048 1.00 47.96  ? 905 LEU C C   1 
ATOM   1751 O O   . LEU C 1 75 ? -43.784 5.500  -18.929 1.00 48.27  ? 905 LEU C O   1 
ATOM   1752 C CB  . LEU C 1 75 ? -41.840 4.504  -16.403 1.00 42.85  ? 905 LEU C CB  1 
ATOM   1753 C CG  . LEU C 1 75 ? -40.924 3.283  -16.229 1.00 45.76  ? 905 LEU C CG  1 
ATOM   1754 C CD1 . LEU C 1 75 ? -41.211 2.627  -14.882 1.00 37.19  ? 905 LEU C CD1 1 
ATOM   1755 C CD2 . LEU C 1 75 ? -41.147 2.281  -17.374 1.00 27.22  ? 905 LEU C CD2 1 
ATOM   1756 N N   . GLU C 1 76 ? -43.366 7.022  -17.336 1.00 48.00  ? 906 GLU C N   1 
ATOM   1757 C CA  . GLU C 1 76 ? -44.618 7.717  -17.593 1.00 53.85  ? 906 GLU C CA  1 
ATOM   1758 C C   . GLU C 1 76 ? -44.663 8.151  -19.059 1.00 56.05  ? 906 GLU C C   1 
ATOM   1759 O O   . GLU C 1 76 ? -45.709 8.070  -19.719 1.00 45.99  ? 906 GLU C O   1 
ATOM   1760 C CB  . GLU C 1 76 ? -44.746 8.933  -16.679 1.00 55.14  ? 906 GLU C CB  1 
ATOM   1761 C CG  . GLU C 1 76 ? -44.769 8.588  -15.201 1.00 68.75  ? 906 GLU C CG  1 
ATOM   1762 C CD  . GLU C 1 76 ? -44.983 9.808  -14.320 1.00 75.04  ? 906 GLU C CD  1 
ATOM   1763 O OE1 . GLU C 1 76 ? -46.093 9.956  -13.764 1.00 73.24  ? 906 GLU C OE1 1 
ATOM   1764 O OE2 . GLU C 1 76 ? -44.042 10.621 -14.189 1.00 75.87  ? 906 GLU C OE2 1 
ATOM   1765 N N   . ASN C 1 77 ? -43.513 8.589  -19.565 1.00 51.52  ? 907 ASN C N   1 
ATOM   1766 C CA  . ASN C 1 77 ? -43.409 9.036  -20.947 1.00 55.19  ? 907 ASN C CA  1 
ATOM   1767 C C   . ASN C 1 77 ? -43.707 7.928  -21.942 1.00 57.65  ? 907 ASN C C   1 
ATOM   1768 O O   . ASN C 1 77 ? -44.384 8.155  -22.949 1.00 60.36  ? 907 ASN C O   1 
ATOM   1769 C CB  . ASN C 1 77 ? -42.015 9.607  -21.220 1.00 51.91  ? 907 ASN C CB  1 
ATOM   1770 C CG  . ASN C 1 77 ? -41.815 10.972 -20.594 1.00 58.84  ? 907 ASN C CG  1 
ATOM   1771 O OD1 . ASN C 1 77 ? -40.701 11.496 -20.562 1.00 58.25  ? 907 ASN C OD1 1 
ATOM   1772 N ND2 . ASN C 1 77 ? -42.901 11.560 -20.092 1.00 49.47  ? 907 ASN C ND2 1 
ATOM   1773 N N   . GLU C 1 78 ? -43.206 6.730  -21.673 1.00 52.60  ? 908 GLU C N   1 
ATOM   1774 C CA  . GLU C 1 78 ? -43.450 5.636  -22.592 1.00 56.60  ? 908 GLU C CA  1 
ATOM   1775 C C   . GLU C 1 78 ? -44.881 5.152  -22.504 1.00 57.72  ? 908 GLU C C   1 
ATOM   1776 O O   . GLU C 1 78 ? -45.403 4.580  -23.458 1.00 64.01  ? 908 GLU C O   1 
ATOM   1777 C CB  . GLU C 1 78 ? -42.491 4.479  -22.337 1.00 60.87  ? 908 GLU C CB  1 
ATOM   1778 C CG  . GLU C 1 78 ? -41.480 4.303  -23.453 1.00 74.59  ? 908 GLU C CG  1 
ATOM   1779 C CD  . GLU C 1 78 ? -41.344 2.860  -23.889 1.00 81.61  ? 908 GLU C CD  1 
ATOM   1780 O OE1 . GLU C 1 78 ? -40.553 2.593  -24.815 1.00 89.59  ? 908 GLU C OE1 1 
ATOM   1781 O OE2 . GLU C 1 78 ? -42.028 1.992  -23.309 1.00 84.11  ? 908 GLU C OE2 1 
ATOM   1782 N N   . VAL C 1 79 ? -45.513 5.379  -21.358 1.00 55.23  ? 909 VAL C N   1 
ATOM   1783 C CA  . VAL C 1 79 ? -46.897 4.975  -21.175 1.00 57.02  ? 909 VAL C CA  1 
ATOM   1784 C C   . VAL C 1 79 ? -47.762 5.909  -22.011 1.00 59.92  ? 909 VAL C C   1 
ATOM   1785 O O   . VAL C 1 79 ? -48.842 5.533  -22.455 1.00 62.75  ? 909 VAL C O   1 
ATOM   1786 C CB  . VAL C 1 79 ? -47.325 5.051  -19.678 1.00 59.62  ? 909 VAL C CB  1 
ATOM   1787 C CG1 . VAL C 1 79 ? -48.845 5.045  -19.557 1.00 57.53  ? 909 VAL C CG1 1 
ATOM   1788 C CG2 . VAL C 1 79 ? -46.755 3.858  -18.914 1.00 60.24  ? 909 VAL C CG2 1 
ATOM   1789 N N   . ALA C 1 80 ? -47.268 7.125  -22.233 1.00 60.19  ? 910 ALA C N   1 
ATOM   1790 C CA  . ALA C 1 80 ? -47.986 8.117  -23.028 1.00 58.06  ? 910 ALA C CA  1 
ATOM   1791 C C   . ALA C 1 80 ? -47.747 7.904  -24.522 1.00 62.33  ? 910 ALA C C   1 
ATOM   1792 O O   . ALA C 1 80 ? -48.650 8.115  -25.336 1.00 63.47  ? 910 ALA C O   1 
ATOM   1793 C CB  . ALA C 1 80 ? -47.557 9.516  -22.629 1.00 51.64  ? 910 ALA C CB  1 
ATOM   1794 N N   . ARG C 1 81 ? -46.532 7.494  -24.880 1.00 62.55  ? 911 ARG C N   1 
ATOM   1795 C CA  . ARG C 1 81 ? -46.206 7.246  -26.277 1.00 62.46  ? 911 ARG C CA  1 
ATOM   1796 C C   . ARG C 1 81 ? -47.032 6.067  -26.767 1.00 70.51  ? 911 ARG C C   1 
ATOM   1797 O O   . ARG C 1 81 ? -47.638 6.126  -27.834 1.00 73.39  ? 911 ARG C O   1 
ATOM   1798 C CB  . ARG C 1 81 ? -44.730 6.906  -26.444 1.00 62.90  ? 911 ARG C CB  1 
ATOM   1799 C CG  . ARG C 1 81 ? -44.329 6.776  -27.894 1.00 63.51  ? 911 ARG C CG  1 
ATOM   1800 C CD  . ARG C 1 81 ? -43.124 5.881  -28.075 1.00 71.77  ? 911 ARG C CD  1 
ATOM   1801 N NE  . ARG C 1 81 ? -43.433 4.483  -27.781 1.00 80.51  ? 911 ARG C NE  1 
ATOM   1802 C CZ  . ARG C 1 81 ? -42.751 3.450  -28.272 1.00 78.82  ? 911 ARG C CZ  1 
ATOM   1803 N NH1 . ARG C 1 81 ? -41.723 3.657  -29.083 1.00 78.86  ? 911 ARG C NH1 1 
ATOM   1804 N NH2 . ARG C 1 81 ? -43.096 2.211  -27.957 1.00 77.22  ? 911 ARG C NH2 1 
ATOM   1805 N N   . LEU C 1 82 ? -47.044 4.994  -25.979 1.00 76.37  ? 912 LEU C N   1 
ATOM   1806 C CA  . LEU C 1 82 ? -47.802 3.792  -26.317 1.00 78.31  ? 912 LEU C CA  1 
ATOM   1807 C C   . LEU C 1 82 ? -49.308 3.983  -26.144 1.00 78.58  ? 912 LEU C C   1 
ATOM   1808 O O   . LEU C 1 82 ? -50.101 3.311  -26.804 1.00 77.98  ? 912 LEU C O   1 
ATOM   1809 C CB  . LEU C 1 82 ? -47.340 2.606  -25.461 1.00 74.73  ? 912 LEU C CB  1 
ATOM   1810 C CG  . LEU C 1 82 ? -46.005 1.954  -25.827 1.00 78.76  ? 912 LEU C CG  1 
ATOM   1811 C CD1 . LEU C 1 82 ? -45.713 0.814  -24.864 1.00 81.56  ? 912 LEU C CD1 1 
ATOM   1812 C CD2 . LEU C 1 82 ? -46.060 1.432  -27.254 1.00 78.54  ? 912 LEU C CD2 1 
ATOM   1813 N N   . LYS C 1 83 ? -49.703 4.894  -25.261 1.00 79.82  ? 913 LYS C N   1 
ATOM   1814 C CA  . LYS C 1 83 ? -51.121 5.144  -25.027 1.00 85.06  ? 913 LYS C CA  1 
ATOM   1815 C C   . LYS C 1 83 ? -51.748 5.870  -26.214 1.00 92.06  ? 913 LYS C C   1 
ATOM   1816 O O   . LYS C 1 83 ? -52.841 5.515  -26.657 1.00 96.17  ? 913 LYS C O   1 
ATOM   1817 C CB  . LYS C 1 83 ? -51.321 5.967  -23.753 1.00 82.53  ? 913 LYS C CB  1 
ATOM   1818 C CG  . LYS C 1 83 ? -52.345 5.378  -22.797 1.00 85.09  ? 913 LYS C CG  1 
ATOM   1819 C CD  . LYS C 1 83 ? -52.443 6.184  -21.508 1.00 86.16  ? 913 LYS C CD  1 
ATOM   1820 C CE  . LYS C 1 83 ? -53.419 5.550  -20.519 1.00 88.68  ? 913 LYS C CE  1 
ATOM   1821 N NZ  . LYS C 1 83 ? -53.006 4.179  -20.096 1.00 90.75  ? 913 LYS C NZ  1 
ATOM   1822 N N   . LYS C 1 84 ? -51.065 6.886  -26.733 1.00 96.74  ? 914 LYS C N   1 
ATOM   1823 C CA  . LYS C 1 84 ? -51.596 7.621  -27.875 1.00 98.90  ? 914 LYS C CA  1 
ATOM   1824 C C   . LYS C 1 84 ? -51.327 6.880  -29.178 1.00 98.92  ? 914 LYS C C   1 
ATOM   1825 O O   . LYS C 1 84 ? -51.698 7.339  -30.256 1.00 98.02  ? 914 LYS C O   1 
ATOM   1826 C CB  . LYS C 1 84 ? -51.011 9.036  -27.931 1.00 101.75 ? 914 LYS C CB  1 
ATOM   1827 C CG  . LYS C 1 84 ? -51.602 9.960  -26.876 1.00 102.48 ? 914 LYS C CG  1 
ATOM   1828 C CD  . LYS C 1 84 ? -51.292 11.423 -27.134 1.00 98.81  ? 914 LYS C CD  1 
ATOM   1829 C CE  . LYS C 1 84 ? -52.012 12.302 -26.124 1.00 93.51  ? 914 LYS C CE  1 
ATOM   1830 N NZ  . LYS C 1 84 ? -51.877 13.748 -26.441 1.00 96.40  ? 914 LYS C NZ  1 
ATOM   1831 N N   . LEU C 1 85 ? -50.682 5.725  -29.067 1.00 100.24 ? 915 LEU C N   1 
ATOM   1832 C CA  . LEU C 1 85 ? -50.384 4.898  -30.228 1.00 99.84  ? 915 LEU C CA  1 
ATOM   1833 C C   . LEU C 1 85 ? -51.516 3.882  -30.361 1.00 101.35 ? 915 LEU C C   1 
ATOM   1834 O O   . LEU C 1 85 ? -52.157 3.785  -31.406 1.00 102.59 ? 915 LEU C O   1 
ATOM   1835 C CB  . LEU C 1 85 ? -49.051 4.169  -30.038 1.00 97.15  ? 915 LEU C CB  1 
ATOM   1836 C CG  . LEU C 1 85 ? -48.472 3.432  -31.251 1.00 94.26  ? 915 LEU C CG  1 
ATOM   1837 C CD1 . LEU C 1 85 ? -48.079 4.441  -32.318 1.00 93.73  ? 915 LEU C CD1 1 
ATOM   1838 C CD2 . LEU C 1 85 ? -47.258 2.619  -30.831 1.00 92.02  ? 915 LEU C CD2 1 
ATOM   1839 N N   . VAL C 1 86 ? -51.758 3.133  -29.290 1.00 102.20 ? 916 VAL C N   1 
ATOM   1840 C CA  . VAL C 1 86 ? -52.819 2.132  -29.273 1.00 104.70 ? 916 VAL C CA  1 
ATOM   1841 C C   . VAL C 1 86 ? -54.178 2.824  -29.262 1.00 107.79 ? 916 VAL C C   1 
ATOM   1842 O O   . VAL C 1 86 ? -55.156 2.297  -29.790 1.00 112.36 ? 916 VAL C O   1 
ATOM   1843 C CB  . VAL C 1 86 ? -52.728 1.228  -28.022 1.00 105.13 ? 916 VAL C CB  1 
ATOM   1844 C CG1 . VAL C 1 86 ? -53.826 0.176  -28.053 1.00 106.45 ? 916 VAL C CG1 1 
ATOM   1845 C CG2 . VAL C 1 86 ? -51.374 0.565  -27.957 1.00 107.32 ? 916 VAL C CG2 1 
ATOM   1846 N N   . GLY C 1 87 ? -54.230 4.005  -28.653 1.00 109.79 ? 917 GLY C N   1 
ATOM   1847 C CA  . GLY C 1 87 ? -55.474 4.749  -28.580 1.00 111.45 ? 917 GLY C CA  1 
ATOM   1848 C C   . GLY C 1 87 ? -56.284 4.420  -27.340 1.00 113.09 ? 917 GLY C C   1 
ATOM   1849 O O   . GLY C 1 87 ? -57.053 3.458  -27.327 1.00 114.32 ? 917 GLY C O   1 
ATOM   1850 N N   . GLU C 1 88 ? -56.109 5.221  -26.293 1.00 114.18 ? 918 GLU C N   1 
ATOM   1851 C CA  . GLU C 1 88 ? -56.823 5.026  -25.033 1.00 113.45 ? 918 GLU C CA  1 
ATOM   1852 C C   . GLU C 1 88 ? -56.935 6.337  -24.260 1.00 113.00 ? 918 GLU C C   1 
ATOM   1853 O O   . GLU C 1 88 ? -58.016 6.708  -23.798 1.00 114.14 ? 918 GLU C O   1 
ATOM   1854 C CB  . GLU C 1 88 ? -56.108 3.981  -24.171 1.00 111.85 ? 918 GLU C CB  1 
ATOM   1855 C CG  . GLU C 1 88 ? -56.292 2.546  -24.643 1.00 113.21 ? 918 GLU C CG  1 
ATOM   1856 C CD  . GLU C 1 88 ? -55.563 1.544  -23.767 1.00 113.60 ? 918 GLU C CD  1 
ATOM   1857 O OE1 . GLU C 1 88 ? -55.667 1.653  -22.527 1.00 114.64 ? 918 GLU C OE1 1 
ATOM   1858 O OE2 . GLU C 1 88 ? -54.895 0.643  -24.317 1.00 112.55 ? 918 GLU C OE2 1 
ATOM   1859 N N   . ARG C 1 89 ? -55.810 7.031  -24.121 1.00 109.72 ? 919 ARG C N   1 
ATOM   1860 C CA  . ARG C 1 89 ? -55.805 8.295  -23.410 1.00 107.90 ? 919 ARG C CA  1 
ATOM   1861 C C   . ARG C 1 89 ? -54.640 9.165  -23.831 1.00 106.96 ? 919 ARG C C   1 
ATOM   1862 O O   . ARG C 1 89 ? -53.962 9.722  -22.943 1.00 109.43 ? 919 ARG C O   1 
ATOM   1863 N N   . GLU D 1 13 ? 3.197   10.260 64.151  1.00 131.20 ? 843 GLU D N   1 
ATOM   1864 C CA  . GLU D 1 13 ? 2.019   10.942 64.760  1.00 134.72 ? 843 GLU D CA  1 
ATOM   1865 C C   . GLU D 1 13 ? 1.435   12.002 63.839  1.00 135.87 ? 843 GLU D C   1 
ATOM   1866 O O   . GLU D 1 13 ? 0.419   11.792 63.176  1.00 138.26 ? 843 GLU D O   1 
ATOM   1867 C CB  . GLU D 1 13 ? 2.416   11.627 66.067  1.00 136.36 ? 843 GLU D CB  1 
ATOM   1868 C CG  . GLU D 1 13 ? 2.712   10.709 67.227  1.00 140.95 ? 843 GLU D CG  1 
ATOM   1869 C CD  . GLU D 1 13 ? 3.040   11.488 68.484  1.00 143.35 ? 843 GLU D CD  1 
ATOM   1870 O OE1 . GLU D 1 13 ? 4.061   12.207 68.485  1.00 145.81 ? 843 GLU D OE1 1 
ATOM   1871 O OE2 . GLU D 1 13 ? 2.273   11.391 69.466  1.00 142.55 ? 843 GLU D OE2 1 
ATOM   1872 N N   . GLU D 1 14 ? 2.104   13.149 63.830  1.00 136.20 ? 844 GLU D N   1 
ATOM   1873 C CA  . GLU D 1 14 ? 1.730   14.323 63.052  1.00 136.82 ? 844 GLU D CA  1 
ATOM   1874 C C   . GLU D 1 14 ? 1.312   14.090 61.600  1.00 135.38 ? 844 GLU D C   1 
ATOM   1875 O O   . GLU D 1 14 ? 0.828   15.014 60.944  1.00 134.88 ? 844 GLU D O   1 
ATOM   1876 C CB  . GLU D 1 14 ? 2.893   15.317 63.093  1.00 141.35 ? 844 GLU D CB  1 
ATOM   1877 C CG  . GLU D 1 14 ? 2.604   16.660 62.467  1.00 148.25 ? 844 GLU D CG  1 
ATOM   1878 C CD  . GLU D 1 14 ? 3.773   17.614 62.602  1.00 152.81 ? 844 GLU D CD  1 
ATOM   1879 O OE1 . GLU D 1 14 ? 4.884   17.266 62.144  1.00 153.59 ? 844 GLU D OE1 1 
ATOM   1880 O OE2 . GLU D 1 14 ? 3.583   18.711 63.167  1.00 156.14 ? 844 GLU D OE2 1 
ATOM   1881 N N   . GLU D 1 15 ? 1.490   12.868 61.103  1.00 133.74 ? 845 GLU D N   1 
ATOM   1882 C CA  . GLU D 1 15 ? 1.155   12.536 59.719  1.00 129.26 ? 845 GLU D CA  1 
ATOM   1883 C C   . GLU D 1 15 ? -0.311  12.736 59.349  1.00 123.85 ? 845 GLU D C   1 
ATOM   1884 O O   . GLU D 1 15 ? -0.654  12.747 58.166  1.00 121.56 ? 845 GLU D O   1 
ATOM   1885 C CB  . GLU D 1 15 ? 1.571   11.096 59.398  1.00 134.50 ? 845 GLU D CB  1 
ATOM   1886 C CG  . GLU D 1 15 ? 1.829   10.868 57.906  1.00 140.84 ? 845 GLU D CG  1 
ATOM   1887 C CD  . GLU D 1 15 ? 2.555   9.565  57.608  1.00 143.89 ? 845 GLU D CD  1 
ATOM   1888 O OE1 . GLU D 1 15 ? 3.624   9.320  58.212  1.00 142.63 ? 845 GLU D OE1 1 
ATOM   1889 O OE2 . GLU D 1 15 ? 2.062   8.793  56.759  1.00 146.28 ? 845 GLU D OE2 1 
ATOM   1890 N N   . MET D 1 16 ? -1.177  12.890 60.343  1.00 119.16 ? 846 MET D N   1 
ATOM   1891 C CA  . MET D 1 16 ? -2.592  13.112 60.069  1.00 112.24 ? 846 MET D CA  1 
ATOM   1892 C C   . MET D 1 16 ? -2.739  14.308 59.143  1.00 106.28 ? 846 MET D C   1 
ATOM   1893 O O   . MET D 1 16 ? -3.653  14.376 58.328  1.00 105.40 ? 846 MET D O   1 
ATOM   1894 C CB  . MET D 1 16 ? -3.338  13.409 61.362  1.00 115.07 ? 846 MET D CB  1 
ATOM   1895 C CG  . MET D 1 16 ? -4.720  12.783 61.434  1.00 118.45 ? 846 MET D CG  1 
ATOM   1896 S SD  . MET D 1 16 ? -5.944  13.434 60.269  1.00 116.64 ? 846 MET D SD  1 
ATOM   1897 C CE  . MET D 1 16 ? -7.278  13.873 61.406  1.00 113.63 ? 846 MET D CE  1 
ATOM   1898 N N   . LYS D 1 17 ? -1.823  15.256 59.286  1.00 102.01 ? 847 LYS D N   1 
ATOM   1899 C CA  . LYS D 1 17 ? -1.818  16.457 58.458  1.00 98.61  ? 847 LYS D CA  1 
ATOM   1900 C C   . LYS D 1 17 ? -1.540  16.075 57.013  1.00 93.65  ? 847 LYS D C   1 
ATOM   1901 O O   . LYS D 1 17 ? -2.066  16.675 56.073  1.00 94.18  ? 847 LYS D O   1 
ATOM   1902 C CB  . LYS D 1 17 ? -0.742  17.421 58.965  1.00 100.73 ? 847 LYS D CB  1 
ATOM   1903 C CG  . LYS D 1 17 ? -0.428  18.598 58.049  1.00 105.67 ? 847 LYS D CG  1 
ATOM   1904 C CD  . LYS D 1 17 ? 0.817   19.348 58.510  1.00 106.98 ? 847 LYS D CD  1 
ATOM   1905 C CE  . LYS D 1 17 ? 2.047   18.437 58.495  1.00 109.90 ? 847 LYS D CE  1 
ATOM   1906 N NZ  . LYS D 1 17 ? 3.282   19.108 58.993  1.00 106.99 ? 847 LYS D NZ  1 
ATOM   1907 N N   . GLU D 1 18 ? -0.697  15.064 56.857  1.00 86.31  ? 848 GLU D N   1 
ATOM   1908 C CA  . GLU D 1 18 ? -0.321  14.567 55.546  1.00 79.62  ? 848 GLU D CA  1 
ATOM   1909 C C   . GLU D 1 18 ? -1.516  13.932 54.850  1.00 73.71  ? 848 GLU D C   1 
ATOM   1910 O O   . GLU D 1 18 ? -1.649  14.007 53.628  1.00 72.28  ? 848 GLU D O   1 
ATOM   1911 C CB  . GLU D 1 18 ? 0.799   13.536 55.680  1.00 86.24  ? 848 GLU D CB  1 
ATOM   1912 C CG  . GLU D 1 18 ? 2.039   13.878 54.894  1.00 87.17  ? 848 GLU D CG  1 
ATOM   1913 C CD  . GLU D 1 18 ? 1.759   13.983 53.414  1.00 85.41  ? 848 GLU D CD  1 
ATOM   1914 O OE1 . GLU D 1 18 ? 1.344   12.971 52.812  1.00 87.32  ? 848 GLU D OE1 1 
ATOM   1915 O OE2 . GLU D 1 18 ? 1.950   15.079 52.851  1.00 88.52  ? 848 GLU D OE2 1 
ATOM   1916 N N   . GLN D 1 19 ? -2.381  13.299 55.633  1.00 67.91  ? 849 GLN D N   1 
ATOM   1917 C CA  . GLN D 1 19 ? -3.572  12.655 55.085  1.00 64.14  ? 849 GLN D CA  1 
ATOM   1918 C C   . GLN D 1 19 ? -4.567  13.690 54.574  1.00 59.14  ? 849 GLN D C   1 
ATOM   1919 O O   . GLN D 1 19 ? -5.355  13.424 53.664  1.00 56.86  ? 849 GLN D O   1 
ATOM   1920 C CB  . GLN D 1 19 ? -4.245  11.784 56.146  1.00 69.97  ? 849 GLN D CB  1 
ATOM   1921 C CG  . GLN D 1 19 ? -3.528  10.474 56.424  1.00 82.93  ? 849 GLN D CG  1 
ATOM   1922 C CD  . GLN D 1 19 ? -4.177  9.684  57.543  1.00 91.59  ? 849 GLN D CD  1 
ATOM   1923 O OE1 . GLN D 1 19 ? -4.119  10.074 58.714  1.00 95.39  ? 849 GLN D OE1 1 
ATOM   1924 N NE2 . GLN D 1 19 ? -4.810  8.569  57.188  1.00 92.06  ? 849 GLN D NE2 1 
ATOM   1925 N N   . LEU D 1 20 ? -4.529  14.876 55.165  1.00 53.24  ? 850 LEU D N   1 
ATOM   1926 C CA  . LEU D 1 20 ? -5.425  15.936 54.750  1.00 50.56  ? 850 LEU D CA  1 
ATOM   1927 C C   . LEU D 1 20 ? -4.875  16.623 53.499  1.00 49.97  ? 850 LEU D C   1 
ATOM   1928 O O   . LEU D 1 20 ? -5.634  16.994 52.602  1.00 43.76  ? 850 LEU D O   1 
ATOM   1929 C CB  . LEU D 1 20 ? -5.632  16.931 55.900  1.00 50.68  ? 850 LEU D CB  1 
ATOM   1930 C CG  . LEU D 1 20 ? -6.418  16.351 57.098  1.00 57.88  ? 850 LEU D CG  1 
ATOM   1931 C CD1 . LEU D 1 20 ? -6.492  17.367 58.227  1.00 52.07  ? 850 LEU D CD1 1 
ATOM   1932 C CD2 . LEU D 1 20 ? -7.827  15.951 56.657  1.00 40.59  ? 850 LEU D CD2 1 
ATOM   1933 N N   . LYS D 1 21 ? -3.557  16.773 53.424  1.00 46.90  ? 851 LYS D N   1 
ATOM   1934 C CA  . LYS D 1 21 ? -2.948  17.400 52.253  1.00 54.51  ? 851 LYS D CA  1 
ATOM   1935 C C   . LYS D 1 21 ? -3.220  16.547 51.011  1.00 51.73  ? 851 LYS D C   1 
ATOM   1936 O O   . LYS D 1 21 ? -3.359  17.075 49.908  1.00 49.14  ? 851 LYS D O   1 
ATOM   1937 C CB  . LYS D 1 21 ? -1.439  17.583 52.461  1.00 61.13  ? 851 LYS D CB  1 
ATOM   1938 C CG  . LYS D 1 21 ? -1.095  18.578 53.572  1.00 75.04  ? 851 LYS D CG  1 
ATOM   1939 C CD  . LYS D 1 21 ? 0.397   18.584 53.909  1.00 85.21  ? 851 LYS D CD  1 
ATOM   1940 C CE  . LYS D 1 21 ? 1.249   19.032 52.730  1.00 90.70  ? 851 LYS D CE  1 
ATOM   1941 N NZ  . LYS D 1 21 ? 2.702   18.998 53.056  1.00 91.18  ? 851 LYS D NZ  1 
ATOM   1942 N N   . GLN D 1 22 ? -3.294  15.230 51.192  1.00 43.27  ? 852 GLN D N   1 
ATOM   1943 C CA  . GLN D 1 22 ? -3.583  14.340 50.077  1.00 45.58  ? 852 GLN D CA  1 
ATOM   1944 C C   . GLN D 1 22 ? -5.070  14.486 49.777  1.00 51.12  ? 852 GLN D C   1 
ATOM   1945 O O   . GLN D 1 22 ? -5.486  14.550 48.620  1.00 51.63  ? 852 GLN D O   1 
ATOM   1946 C CB  . GLN D 1 22 ? -3.292  12.887 50.441  1.00 38.09  ? 852 GLN D CB  1 
ATOM   1947 C CG  . GLN D 1 22 ? -1.878  12.628 50.898  1.00 55.60  ? 852 GLN D CG  1 
ATOM   1948 C CD  . GLN D 1 22 ? -1.641  11.172 51.264  1.00 61.63  ? 852 GLN D CD  1 
ATOM   1949 O OE1 . GLN D 1 22 ? -2.586  10.410 51.492  1.00 60.42  ? 852 GLN D OE1 1 
ATOM   1950 N NE2 . GLN D 1 22 ? -0.372  10.783 51.338  1.00 58.73  ? 852 GLN D NE2 1 
ATOM   1951 N N   . MET D 1 23 ? -5.868  14.533 50.838  1.00 54.47  ? 853 MET D N   1 
ATOM   1952 C CA  . MET D 1 23 ? -7.308  14.675 50.707  1.00 48.22  ? 853 MET D CA  1 
ATOM   1953 C C   . MET D 1 23 ? -7.633  15.858 49.810  1.00 47.16  ? 853 MET D C   1 
ATOM   1954 O O   . MET D 1 23 ? -8.504  15.774 48.948  1.00 44.59  ? 853 MET D O   1 
ATOM   1955 C CB  . MET D 1 23 ? -7.937  14.886 52.080  1.00 56.17  ? 853 MET D CB  1 
ATOM   1956 C CG  . MET D 1 23 ? -9.376  15.371 52.035  1.00 67.68  ? 853 MET D CG  1 
ATOM   1957 S SD  . MET D 1 23 ? -10.499 14.144 51.368  1.00 79.09  ? 853 MET D SD  1 
ATOM   1958 C CE  . MET D 1 23 ? -11.005 13.325 52.884  1.00 74.63  ? 853 MET D CE  1 
ATOM   1959 N N   . ASP D 1 24 ? -6.926  16.963 50.015  1.00 48.94  ? 854 ASP D N   1 
ATOM   1960 C CA  . ASP D 1 24 ? -7.162  18.160 49.219  1.00 53.08  ? 854 ASP D CA  1 
ATOM   1961 C C   . ASP D 1 24 ? -6.795  17.980 47.751  1.00 49.14  ? 854 ASP D C   1 
ATOM   1962 O O   . ASP D 1 24 ? -7.505  18.468 46.875  1.00 45.72  ? 854 ASP D O   1 
ATOM   1963 C CB  . ASP D 1 24 ? -6.418  19.354 49.827  1.00 56.55  ? 854 ASP D CB  1 
ATOM   1964 C CG  . ASP D 1 24 ? -7.051  19.824 51.130  1.00 64.39  ? 854 ASP D CG  1 
ATOM   1965 O OD1 . ASP D 1 24 ? -7.086  19.033 52.094  1.00 69.81  ? 854 ASP D OD1 1 
ATOM   1966 O OD2 . ASP D 1 24 ? -7.526  20.979 51.191  1.00 70.94  ? 854 ASP D OD2 1 
ATOM   1967 N N   . LYS D 1 25 ? -5.695  17.284 47.477  1.00 43.29  ? 855 LYS D N   1 
ATOM   1968 C CA  . LYS D 1 25 ? -5.295  17.039 46.098  1.00 40.07  ? 855 LYS D CA  1 
ATOM   1969 C C   . LYS D 1 25 ? -6.367  16.180 45.435  1.00 44.20  ? 855 LYS D C   1 
ATOM   1970 O O   . LYS D 1 25 ? -6.746  16.410 44.288  1.00 47.66  ? 855 LYS D O   1 
ATOM   1971 C CB  . LYS D 1 25 ? -3.962  16.302 46.047  1.00 36.93  ? 855 LYS D CB  1 
ATOM   1972 C CG  . LYS D 1 25 ? -3.509  15.873 44.645  1.00 57.76  ? 855 LYS D CG  1 
ATOM   1973 C CD  . LYS D 1 25 ? -2.957  17.032 43.809  1.00 68.37  ? 855 LYS D CD  1 
ATOM   1974 C CE  . LYS D 1 25 ? -4.039  18.013 43.372  1.00 73.39  ? 855 LYS D CE  1 
ATOM   1975 N NZ  . LYS D 1 25 ? -3.472  19.235 42.722  1.00 79.81  ? 855 LYS D NZ  1 
ATOM   1976 N N   . MET D 1 26 ? -6.854  15.194 46.177  1.00 45.13  ? 856 MET D N   1 
ATOM   1977 C CA  . MET D 1 26 ? -7.880  14.277 45.705  1.00 38.48  ? 856 MET D CA  1 
ATOM   1978 C C   . MET D 1 26 ? -9.174  15.028 45.451  1.00 38.03  ? 856 MET D C   1 
ATOM   1979 O O   . MET D 1 26 ? -9.908  14.725 44.515  1.00 36.61  ? 856 MET D O   1 
ATOM   1980 C CB  . MET D 1 26 ? -8.103  13.198 46.760  1.00 45.68  ? 856 MET D CB  1 
ATOM   1981 C CG  . MET D 1 26 ? -8.789  11.941 46.282  1.00 61.80  ? 856 MET D CG  1 
ATOM   1982 S SD  . MET D 1 26 ? -8.418  10.529 47.377  1.00 61.61  ? 856 MET D SD  1 
ATOM   1983 C CE  . MET D 1 26 ? -9.139  11.082 48.940  1.00 66.33  ? 856 MET D CE  1 
ATOM   1984 N N   . LYS D 1 27 ? -9.434  16.033 46.276  1.00 33.39  ? 857 LYS D N   1 
ATOM   1985 C CA  . LYS D 1 27 ? -10.648 16.830 46.145  1.00 32.75  ? 857 LYS D CA  1 
ATOM   1986 C C   . LYS D 1 27 ? -10.609 17.735 44.922  1.00 35.55  ? 857 LYS D C   1 
ATOM   1987 O O   . LYS D 1 27 ? -11.636 18.005 44.296  1.00 39.36  ? 857 LYS D O   1 
ATOM   1988 C CB  . LYS D 1 27 ? -10.861 17.661 47.405  1.00 40.25  ? 857 LYS D CB  1 
ATOM   1989 C CG  . LYS D 1 27 ? -11.257 16.829 48.618  1.00 46.73  ? 857 LYS D CG  1 
ATOM   1990 C CD  . LYS D 1 27 ? -11.485 17.675 49.857  1.00 52.87  ? 857 LYS D CD  1 
ATOM   1991 C CE  . LYS D 1 27 ? -12.592 18.694 49.668  1.00 48.62  ? 857 LYS D CE  1 
ATOM   1992 N NZ  . LYS D 1 27 ? -12.820 19.474 50.923  1.00 60.51  ? 857 LYS D NZ  1 
ATOM   1993 N N   . GLU D 1 28 ? -9.416  18.198 44.576  1.00 37.72  ? 858 GLU D N   1 
ATOM   1994 C CA  . GLU D 1 28 ? -9.266  19.047 43.410  1.00 37.95  ? 858 GLU D CA  1 
ATOM   1995 C C   . GLU D 1 28 ? -9.437  18.197 42.161  1.00 37.09  ? 858 GLU D C   1 
ATOM   1996 O O   . GLU D 1 28 ? -10.024 18.651 41.174  1.00 36.90  ? 858 GLU D O   1 
ATOM   1997 C CB  . GLU D 1 28 ? -7.893  19.725 43.400  1.00 44.06  ? 858 GLU D CB  1 
ATOM   1998 C CG  . GLU D 1 28 ? -7.746  20.835 44.420  1.00 54.36  ? 858 GLU D CG  1 
ATOM   1999 C CD  . GLU D 1 28 ? -6.519  21.701 44.178  1.00 69.36  ? 858 GLU D CD  1 
ATOM   2000 O OE1 . GLU D 1 28 ? -6.335  22.692 44.921  1.00 75.26  ? 858 GLU D OE1 1 
ATOM   2001 O OE2 . GLU D 1 28 ? -5.740  21.394 43.248  1.00 68.81  ? 858 GLU D OE2 1 
ATOM   2002 N N   . ASP D 1 29 ? -8.939  16.961 42.207  1.00 32.13  ? 859 ASP D N   1 
ATOM   2003 C CA  . ASP D 1 29 ? -9.048  16.068 41.060  1.00 37.69  ? 859 ASP D CA  1 
ATOM   2004 C C   . ASP D 1 29 ? -10.503 15.720 40.800  1.00 37.99  ? 859 ASP D C   1 
ATOM   2005 O O   . ASP D 1 29 ? -10.938 15.618 39.651  1.00 39.83  ? 859 ASP D O   1 
ATOM   2006 C CB  . ASP D 1 29 ? -8.236  14.784 41.268  1.00 44.57  ? 859 ASP D CB  1 
ATOM   2007 C CG  . ASP D 1 29 ? -6.734  14.999 41.085  1.00 57.85  ? 859 ASP D CG  1 
ATOM   2008 O OD1 . ASP D 1 29 ? -6.348  15.936 40.346  1.00 66.14  ? 859 ASP D OD1 1 
ATOM   2009 O OD2 . ASP D 1 29 ? -5.939  14.222 41.667  1.00 52.13  ? 859 ASP D OD2 1 
ATOM   2010 N N   . LEU D 1 30 ? -11.253 15.549 41.879  1.00 36.34  ? 860 LEU D N   1 
ATOM   2011 C CA  . LEU D 1 30 ? -12.663 15.231 41.785  1.00 27.33  ? 860 LEU D CA  1 
ATOM   2012 C C   . LEU D 1 30 ? -13.399 16.388 41.106  1.00 33.29  ? 860 LEU D C   1 
ATOM   2013 O O   . LEU D 1 30 ? -14.194 16.182 40.186  1.00 34.30  ? 860 LEU D O   1 
ATOM   2014 C CB  . LEU D 1 30 ? -13.218 14.996 43.188  1.00 33.99  ? 860 LEU D CB  1 
ATOM   2015 C CG  . LEU D 1 30 ? -14.639 14.451 43.314  1.00 38.27  ? 860 LEU D CG  1 
ATOM   2016 C CD1 . LEU D 1 30 ? -14.780 13.207 42.458  1.00 39.61  ? 860 LEU D CD1 1 
ATOM   2017 C CD2 . LEU D 1 30 ? -14.931 14.136 44.772  1.00 35.78  ? 860 LEU D CD2 1 
ATOM   2018 N N   . ALA D 1 31 ? -13.135 17.609 41.560  1.00 33.46  ? 861 ALA D N   1 
ATOM   2019 C CA  . ALA D 1 31 ? -13.773 18.790 40.978  1.00 33.55  ? 861 ALA D CA  1 
ATOM   2020 C C   . ALA D 1 31 ? -13.496 18.895 39.472  1.00 36.41  ? 861 ALA D C   1 
ATOM   2021 O O   . ALA D 1 31 ? -14.406 19.144 38.667  1.00 35.27  ? 861 ALA D O   1 
ATOM   2022 C CB  . ALA D 1 31 ? -13.275 20.035 41.683  1.00 28.31  ? 861 ALA D CB  1 
ATOM   2023 N N   . LYS D 1 32 ? -12.233 18.708 39.104  1.00 29.36  ? 862 LYS D N   1 
ATOM   2024 C CA  . LYS D 1 32 ? -11.802 18.776 37.715  1.00 26.74  ? 862 LYS D CA  1 
ATOM   2025 C C   . LYS D 1 32 ? -12.550 17.746 36.888  1.00 37.07  ? 862 LYS D C   1 
ATOM   2026 O O   . LYS D 1 32 ? -13.099 18.061 35.832  1.00 43.15  ? 862 LYS D O   1 
ATOM   2027 C CB  . LYS D 1 32 ? -10.306 18.491 37.630  1.00 32.04  ? 862 LYS D CB  1 
ATOM   2028 C CG  . LYS D 1 32 ? -9.742  18.412 36.229  1.00 41.55  ? 862 LYS D CG  1 
ATOM   2029 C CD  . LYS D 1 32 ? -8.408  17.677 36.248  1.00 58.24  ? 862 LYS D CD  1 
ATOM   2030 C CE  . LYS D 1 32 ? -7.434  18.296 37.250  1.00 65.13  ? 862 LYS D CE  1 
ATOM   2031 N NZ  . LYS D 1 32 ? -6.207  17.466 37.445  1.00 67.77  ? 862 LYS D NZ  1 
ATOM   2032 N N   . THR D 1 33 ? -12.559 16.508 37.376  1.00 35.05  ? 863 THR D N   1 
ATOM   2033 C CA  . THR D 1 33 ? -13.228 15.408 36.694  1.00 26.70  ? 863 THR D CA  1 
ATOM   2034 C C   . THR D 1 33 ? -14.728 15.640 36.534  1.00 32.02  ? 863 THR D C   1 
ATOM   2035 O O   . THR D 1 33 ? -15.261 15.568 35.422  1.00 28.35  ? 863 THR D O   1 
ATOM   2036 C CB  . THR D 1 33 ? -13.006 14.092 37.446  1.00 30.90  ? 863 THR D CB  1 
ATOM   2037 O OG1 . THR D 1 33 ? -11.607 13.770 37.441  1.00 32.62  ? 863 THR D OG1 1 
ATOM   2038 C CG2 . THR D 1 33 ? -13.783 12.968 36.788  1.00 32.54  ? 863 THR D CG2 1 
ATOM   2039 N N   . GLU D 1 34 ? -15.408 15.916 37.642  1.00 30.15  ? 864 GLU D N   1 
ATOM   2040 C CA  . GLU D 1 34 ? -16.840 16.154 37.596  1.00 32.98  ? 864 GLU D CA  1 
ATOM   2041 C C   . GLU D 1 34 ? -17.164 17.203 36.547  1.00 34.68  ? 864 GLU D C   1 
ATOM   2042 O O   . GLU D 1 34 ? -18.113 17.060 35.766  1.00 33.37  ? 864 GLU D O   1 
ATOM   2043 C CB  . GLU D 1 34 ? -17.343 16.606 38.968  1.00 35.81  ? 864 GLU D CB  1 
ATOM   2044 C CG  . GLU D 1 34 ? -17.926 15.476 39.799  1.00 52.53  ? 864 GLU D CG  1 
ATOM   2045 C CD  . GLU D 1 34 ? -19.261 14.984 39.251  1.00 62.72  ? 864 GLU D CD  1 
ATOM   2046 O OE1 . GLU D 1 34 ? -19.790 13.970 39.754  1.00 73.81  ? 864 GLU D OE1 1 
ATOM   2047 O OE2 . GLU D 1 34 ? -19.789 15.621 38.316  1.00 59.05  ? 864 GLU D OE2 1 
ATOM   2048 N N   . ARG D 1 35 ? -16.352 18.252 36.529  1.00 34.50  ? 865 ARG D N   1 
ATOM   2049 C CA  . ARG D 1 35 ? -16.523 19.358 35.598  1.00 32.18  ? 865 ARG D CA  1 
ATOM   2050 C C   . ARG D 1 35 ? -16.426 18.882 34.154  1.00 37.51  ? 865 ARG D C   1 
ATOM   2051 O O   . ARG D 1 35 ? -17.195 19.317 33.299  1.00 38.81  ? 865 ARG D O   1 
ATOM   2052 C CB  . ARG D 1 35 ? -15.464 20.413 35.899  1.00 30.93  ? 865 ARG D CB  1 
ATOM   2053 C CG  . ARG D 1 35 ? -15.469 21.625 35.012  1.00 44.11  ? 865 ARG D CG  1 
ATOM   2054 C CD  . ARG D 1 35 ? -15.482 22.900 35.849  1.00 33.83  ? 865 ARG D CD  1 
ATOM   2055 N NE  . ARG D 1 35 ? -14.888 22.725 37.171  1.00 45.03  ? 865 ARG D NE  1 
ATOM   2056 C CZ  . ARG D 1 35 ? -13.584 22.740 37.446  1.00 34.63  ? 865 ARG D CZ  1 
ATOM   2057 N NH1 . ARG D 1 35 ? -12.688 22.918 36.492  1.00 27.06  ? 865 ARG D NH1 1 
ATOM   2058 N NH2 . ARG D 1 35 ? -13.182 22.614 38.703  1.00 20.22  ? 865 ARG D NH2 1 
ATOM   2059 N N   . ILE D 1 36 ? -15.500 17.966 33.884  1.00 43.93  ? 866 ILE D N   1 
ATOM   2060 C CA  . ILE D 1 36 ? -15.338 17.446 32.531  1.00 41.67  ? 866 ILE D CA  1 
ATOM   2061 C C   . ILE D 1 36 ? -16.460 16.490 32.138  1.00 36.37  ? 866 ILE D C   1 
ATOM   2062 O O   . ILE D 1 36 ? -17.010 16.600 31.042  1.00 39.47  ? 866 ILE D O   1 
ATOM   2063 C CB  . ILE D 1 36 ? -13.965 16.728 32.341  1.00 43.79  ? 866 ILE D CB  1 
ATOM   2064 C CG1 . ILE D 1 36 ? -12.819 17.732 32.522  1.00 42.76  ? 866 ILE D CG1 1 
ATOM   2065 C CG2 . ILE D 1 36 ? -13.879 16.114 30.936  1.00 36.48  ? 866 ILE D CG2 1 
ATOM   2066 C CD1 . ILE D 1 36 ? -11.437 17.164 32.221  1.00 45.43  ? 866 ILE D CD1 1 
ATOM   2067 N N   . LYS D 1 37 ? -16.812 15.557 33.015  1.00 33.63  ? 867 LYS D N   1 
ATOM   2068 C CA  . LYS D 1 37 ? -17.879 14.619 32.679  1.00 37.05  ? 867 LYS D CA  1 
ATOM   2069 C C   . LYS D 1 37 ? -19.209 15.310 32.402  1.00 39.57  ? 867 LYS D C   1 
ATOM   2070 O O   . LYS D 1 37 ? -19.959 14.887 31.522  1.00 46.14  ? 867 LYS D O   1 
ATOM   2071 C CB  . LYS D 1 37 ? -18.072 13.577 33.779  1.00 18.83  ? 867 LYS D CB  1 
ATOM   2072 C CG  . LYS D 1 37 ? -18.508 14.114 35.095  1.00 38.92  ? 867 LYS D CG  1 
ATOM   2073 C CD  . LYS D 1 37 ? -18.937 12.974 36.015  1.00 51.25  ? 867 LYS D CD  1 
ATOM   2074 C CE  . LYS D 1 37 ? -20.236 12.346 35.540  1.00 49.79  ? 867 LYS D CE  1 
ATOM   2075 N NZ  . LYS D 1 37 ? -20.809 11.443 36.566  1.00 55.82  ? 867 LYS D NZ  1 
ATOM   2076 N N   . LYS D 1 38 ? -19.499 16.374 33.145  1.00 44.48  ? 868 LYS D N   1 
ATOM   2077 C CA  . LYS D 1 38 ? -20.742 17.110 32.949  1.00 43.03  ? 868 LYS D CA  1 
ATOM   2078 C C   . LYS D 1 38 ? -20.725 17.695 31.545  1.00 40.48  ? 868 LYS D C   1 
ATOM   2079 O O   . LYS D 1 38 ? -21.753 17.788 30.880  1.00 43.28  ? 868 LYS D O   1 
ATOM   2080 C CB  . LYS D 1 38 ? -20.881 18.230 33.986  1.00 45.34  ? 868 LYS D CB  1 
ATOM   2081 C CG  . LYS D 1 38 ? -22.192 18.998 33.880  1.00 56.09  ? 868 LYS D CG  1 
ATOM   2082 C CD  . LYS D 1 38 ? -22.281 20.111 34.916  1.00 74.99  ? 868 LYS D CD  1 
ATOM   2083 C CE  . LYS D 1 38 ? -23.586 20.900 34.789  1.00 82.23  ? 868 LYS D CE  1 
ATOM   2084 N NZ  . LYS D 1 38 ? -23.677 21.996 35.801  1.00 80.28  ? 868 LYS D NZ  1 
ATOM   2085 N N   . GLU D 1 39 ? -19.541 18.086 31.098  1.00 38.24  ? 869 GLU D N   1 
ATOM   2086 C CA  . GLU D 1 39 ? -19.388 18.639 29.767  1.00 41.19  ? 869 GLU D CA  1 
ATOM   2087 C C   . GLU D 1 39 ? -19.638 17.526 28.756  1.00 40.36  ? 869 GLU D C   1 
ATOM   2088 O O   . GLU D 1 39 ? -20.335 17.736 27.766  1.00 38.81  ? 869 GLU D O   1 
ATOM   2089 C CB  . GLU D 1 39 ? -17.979 19.215 29.589  1.00 48.87  ? 869 GLU D CB  1 
ATOM   2090 C CG  . GLU D 1 39 ? -17.639 19.630 28.161  1.00 73.15  ? 869 GLU D CG  1 
ATOM   2091 C CD  . GLU D 1 39 ? -16.256 20.269 28.037  1.00 86.83  ? 869 GLU D CD  1 
ATOM   2092 O OE1 . GLU D 1 39 ? -15.285 19.715 28.599  1.00 91.87  ? 869 GLU D OE1 1 
ATOM   2093 O OE2 . GLU D 1 39 ? -16.139 21.320 27.367  1.00 92.24  ? 869 GLU D OE2 1 
ATOM   2094 N N   . LEU D 1 40 ? -19.081 16.339 29.007  1.00 38.43  ? 870 LEU D N   1 
ATOM   2095 C CA  . LEU D 1 40 ? -19.270 15.218 28.084  1.00 33.32  ? 870 LEU D CA  1 
ATOM   2096 C C   . LEU D 1 40 ? -20.732 14.801 28.097  1.00 37.91  ? 870 LEU D C   1 
ATOM   2097 O O   . LEU D 1 40 ? -21.301 14.465 27.060  1.00 34.52  ? 870 LEU D O   1 
ATOM   2098 C CB  . LEU D 1 40 ? -18.399 14.020 28.470  1.00 22.00  ? 870 LEU D CB  1 
ATOM   2099 C CG  . LEU D 1 40 ? -16.879 14.114 28.299  1.00 34.87  ? 870 LEU D CG  1 
ATOM   2100 C CD1 . LEU D 1 40 ? -16.209 12.909 28.966  1.00 30.49  ? 870 LEU D CD1 1 
ATOM   2101 C CD2 . LEU D 1 40 ? -16.513 14.179 26.815  1.00 36.13  ? 870 LEU D CD2 1 
ATOM   2102 N N   . GLU D 1 41 ? -21.344 14.829 29.274  1.00 31.06  ? 871 GLU D N   1 
ATOM   2103 C CA  . GLU D 1 41 ? -22.743 14.451 29.376  1.00 38.70  ? 871 GLU D CA  1 
ATOM   2104 C C   . GLU D 1 41 ? -23.616 15.356 28.506  1.00 39.18  ? 871 GLU D C   1 
ATOM   2105 O O   . GLU D 1 41 ? -24.429 14.869 27.728  1.00 38.77  ? 871 GLU D O   1 
ATOM   2106 C CB  . GLU D 1 41 ? -23.203 14.492 30.838  1.00 37.67  ? 871 GLU D CB  1 
ATOM   2107 C CG  . GLU D 1 41 ? -22.733 13.286 31.652  1.00 47.82  ? 871 GLU D CG  1 
ATOM   2108 C CD  . GLU D 1 41 ? -23.064 13.386 33.134  1.00 50.79  ? 871 GLU D CD  1 
ATOM   2109 O OE1 . GLU D 1 41 ? -22.996 12.348 33.831  1.00 40.40  ? 871 GLU D OE1 1 
ATOM   2110 O OE2 . GLU D 1 41 ? -23.380 14.498 33.605  1.00 53.01  ? 871 GLU D OE2 1 
ATOM   2111 N N   . GLU D 1 42 ? -23.429 16.667 28.611  1.00 42.52  ? 872 GLU D N   1 
ATOM   2112 C CA  . GLU D 1 42 ? -24.230 17.590 27.817  1.00 43.03  ? 872 GLU D CA  1 
ATOM   2113 C C   . GLU D 1 42 ? -24.062 17.317 26.329  1.00 43.47  ? 872 GLU D C   1 
ATOM   2114 O O   . GLU D 1 42 ? -25.044 17.219 25.600  1.00 42.44  ? 872 GLU D O   1 
ATOM   2115 C CB  . GLU D 1 42 ? -23.841 19.044 28.099  1.00 44.95  ? 872 GLU D CB  1 
ATOM   2116 C CG  . GLU D 1 42 ? -23.848 19.426 29.572  1.00 73.16  ? 872 GLU D CG  1 
ATOM   2117 C CD  . GLU D 1 42 ? -23.487 20.889 29.811  1.00 82.67  ? 872 GLU D CD  1 
ATOM   2118 O OE1 . GLU D 1 42 ? -22.485 21.369 29.231  1.00 83.58  ? 872 GLU D OE1 1 
ATOM   2119 O OE2 . GLU D 1 42 ? -24.206 21.555 30.590  1.00 90.11  ? 872 GLU D OE2 1 
ATOM   2120 N N   . GLN D 1 43 ? -22.818 17.184 25.875  1.00 46.32  ? 873 GLN D N   1 
ATOM   2121 C CA  . GLN D 1 43 ? -22.587 16.954 24.458  1.00 46.47  ? 873 GLN D CA  1 
ATOM   2122 C C   . GLN D 1 43 ? -23.045 15.582 23.954  1.00 45.05  ? 873 GLN D C   1 
ATOM   2123 O O   . GLN D 1 43 ? -23.430 15.458 22.791  1.00 44.42  ? 873 GLN D O   1 
ATOM   2124 C CB  . GLN D 1 43 ? -21.118 17.239 24.093  1.00 32.67  ? 873 GLN D CB  1 
ATOM   2125 C CG  . GLN D 1 43 ? -20.066 16.402 24.786  1.00 54.92  ? 873 GLN D CG  1 
ATOM   2126 C CD  . GLN D 1 43 ? -18.652 16.945 24.562  1.00 58.03  ? 873 GLN D CD  1 
ATOM   2127 O OE1 . GLN D 1 43 ? -17.665 16.228 24.724  1.00 66.04  ? 873 GLN D OE1 1 
ATOM   2128 N NE2 . GLN D 1 43 ? -18.555 18.221 24.204  1.00 35.41  ? 873 GLN D NE2 1 
ATOM   2129 N N   . ASN D 1 44 ? -23.029 14.558 24.805  1.00 39.76  ? 874 ASN D N   1 
ATOM   2130 C CA  . ASN D 1 44 ? -23.508 13.254 24.360  1.00 43.66  ? 874 ASN D CA  1 
ATOM   2131 C C   . ASN D 1 44 ? -25.023 13.346 24.169  1.00 48.32  ? 874 ASN D C   1 
ATOM   2132 O O   . ASN D 1 44 ? -25.600 12.626 23.351  1.00 48.73  ? 874 ASN D O   1 
ATOM   2133 C CB  . ASN D 1 44 ? -23.185 12.146 25.367  1.00 34.88  ? 874 ASN D CB  1 
ATOM   2134 C CG  . ASN D 1 44 ? -21.733 11.701 25.303  1.00 44.17  ? 874 ASN D CG  1 
ATOM   2135 O OD1 . ASN D 1 44 ? -21.124 11.672 24.237  1.00 43.84  ? 874 ASN D OD1 1 
ATOM   2136 N ND2 . ASN D 1 44 ? -21.179 11.332 26.449  1.00 61.58  ? 874 ASN D ND2 1 
ATOM   2137 N N   . VAL D 1 45 ? -25.669 14.235 24.922  1.00 42.44  ? 875 VAL D N   1 
ATOM   2138 C CA  . VAL D 1 45 ? -27.110 14.412 24.794  1.00 37.72  ? 875 VAL D CA  1 
ATOM   2139 C C   . VAL D 1 45 ? -27.415 15.077 23.460  1.00 43.42  ? 875 VAL D C   1 
ATOM   2140 O O   . VAL D 1 45 ? -28.360 14.699 22.772  1.00 44.49  ? 875 VAL D O   1 
ATOM   2141 C CB  . VAL D 1 45 ? -27.691 15.283 25.934  1.00 41.39  ? 875 VAL D CB  1 
ATOM   2142 C CG1 . VAL D 1 45 ? -29.094 15.765 25.570  1.00 43.58  ? 875 VAL D CG1 1 
ATOM   2143 C CG2 . VAL D 1 45 ? -27.760 14.473 27.214  1.00 25.19  ? 875 VAL D CG2 1 
ATOM   2144 N N   . THR D 1 46 ? -26.611 16.067 23.092  1.00 43.39  ? 876 THR D N   1 
ATOM   2145 C CA  . THR D 1 46 ? -26.812 16.761 21.829  1.00 45.09  ? 876 THR D CA  1 
ATOM   2146 C C   . THR D 1 46 ? -26.529 15.818 20.671  1.00 47.30  ? 876 THR D C   1 
ATOM   2147 O O   . THR D 1 46 ? -27.174 15.898 19.624  1.00 56.62  ? 876 THR D O   1 
ATOM   2148 C CB  . THR D 1 46 ? -25.897 17.980 21.710  1.00 45.45  ? 876 THR D CB  1 
ATOM   2149 O OG1 . THR D 1 46 ? -26.265 18.942 22.703  1.00 55.81  ? 876 THR D OG1 1 
ATOM   2150 C CG2 . THR D 1 46 ? -26.020 18.607 20.334  1.00 41.30  ? 876 THR D CG2 1 
ATOM   2151 N N   . LEU D 1 47 ? -25.562 14.926 20.856  1.00 42.91  ? 877 LEU D N   1 
ATOM   2152 C CA  . LEU D 1 47 ? -25.232 13.972 19.812  1.00 33.22  ? 877 LEU D CA  1 
ATOM   2153 C C   . LEU D 1 47 ? -26.387 12.998 19.647  1.00 32.14  ? 877 LEU D C   1 
ATOM   2154 O O   . LEU D 1 47 ? -26.761 12.673 18.521  1.00 32.49  ? 877 LEU D O   1 
ATOM   2155 C CB  . LEU D 1 47 ? -23.943 13.219 20.144  1.00 23.84  ? 877 LEU D CB  1 
ATOM   2156 C CG  . LEU D 1 47 ? -22.634 14.012 20.048  1.00 30.14  ? 877 LEU D CG  1 
ATOM   2157 C CD1 . LEU D 1 47 ? -21.455 13.069 20.302  1.00 27.48  ? 877 LEU D CD1 1 
ATOM   2158 C CD2 . LEU D 1 47 ? -22.503 14.653 18.682  1.00 16.38  ? 877 LEU D CD2 1 
ATOM   2159 N N   . LEU D 1 48 ? -26.955 12.548 20.768  1.00 35.08  ? 878 LEU D N   1 
ATOM   2160 C CA  . LEU D 1 48 ? -28.092 11.620 20.752  1.00 41.80  ? 878 LEU D CA  1 
ATOM   2161 C C   . LEU D 1 48 ? -29.284 12.218 19.995  1.00 42.04  ? 878 LEU D C   1 
ATOM   2162 O O   . LEU D 1 48 ? -29.951 11.534 19.215  1.00 34.59  ? 878 LEU D O   1 
ATOM   2163 C CB  . LEU D 1 48 ? -28.531 11.282 22.179  1.00 43.89  ? 878 LEU D CB  1 
ATOM   2164 C CG  . LEU D 1 48 ? -28.208 9.882  22.704  1.00 54.48  ? 878 LEU D CG  1 
ATOM   2165 C CD1 . LEU D 1 48 ? -28.814 8.841  21.779  1.00 53.29  ? 878 LEU D CD1 1 
ATOM   2166 C CD2 . LEU D 1 48 ? -26.706 9.697  22.791  1.00 63.84  ? 878 LEU D CD2 1 
ATOM   2167 N N   . GLU D 1 49 ? -29.550 13.496 20.245  1.00 34.05  ? 879 GLU D N   1 
ATOM   2168 C CA  . GLU D 1 49 ? -30.637 14.181 19.581  1.00 35.49  ? 879 GLU D CA  1 
ATOM   2169 C C   . GLU D 1 49 ? -30.395 14.099 18.077  1.00 42.41  ? 879 GLU D C   1 
ATOM   2170 O O   . GLU D 1 49 ? -31.268 13.706 17.299  1.00 35.95  ? 879 GLU D O   1 
ATOM   2171 C CB  . GLU D 1 49 ? -30.694 15.650 20.025  1.00 41.38  ? 879 GLU D CB  1 
ATOM   2172 C CG  . GLU D 1 49 ? -31.526 15.907 21.287  1.00 47.56  ? 879 GLU D CG  1 
ATOM   2173 C CD  . GLU D 1 49 ? -31.538 17.379 21.696  1.00 54.66  ? 879 GLU D CD  1 
ATOM   2174 O OE1 . GLU D 1 49 ? -31.439 18.254 20.807  1.00 63.38  ? 879 GLU D OE1 1 
ATOM   2175 O OE2 . GLU D 1 49 ? -31.661 17.664 22.905  1.00 52.90  ? 879 GLU D OE2 1 
ATOM   2176 N N   . GLN D 1 50 ? -29.190 14.461 17.671  1.00 41.17  ? 880 GLN D N   1 
ATOM   2177 C CA  . GLN D 1 50 ? -28.852 14.436 16.266  1.00 39.61  ? 880 GLN D CA  1 
ATOM   2178 C C   . GLN D 1 50 ? -28.961 13.050 15.621  1.00 42.85  ? 880 GLN D C   1 
ATOM   2179 O O   . GLN D 1 50 ? -29.495 12.919 14.511  1.00 43.52  ? 880 GLN D O   1 
ATOM   2180 C CB  . GLN D 1 50 ? -27.461 15.029 16.091  1.00 29.19  ? 880 GLN D CB  1 
ATOM   2181 C CG  . GLN D 1 50 ? -27.464 16.524 16.355  1.00 38.81  ? 880 GLN D CG  1 
ATOM   2182 C CD  . GLN D 1 50 ? -26.087 17.079 16.624  1.00 46.30  ? 880 GLN D CD  1 
ATOM   2183 O OE1 . GLN D 1 50 ? -25.077 16.430 16.355  1.00 46.27  ? 880 GLN D OE1 1 
ATOM   2184 N NE2 . GLN D 1 50 ? -26.037 18.293 17.153  1.00 51.88  ? 880 GLN D NE2 1 
ATOM   2185 N N   . LYS D 1 51 ? -28.487 12.018 16.314  1.00 26.92  ? 881 LYS D N   1 
ATOM   2186 C CA  . LYS D 1 51 ? -28.540 10.670 15.766  1.00 25.56  ? 881 LYS D CA  1 
ATOM   2187 C C   . LYS D 1 51 ? -29.991 10.293 15.494  1.00 35.33  ? 881 LYS D C   1 
ATOM   2188 O O   . LYS D 1 51 ? -30.308 9.682  14.476  1.00 37.66  ? 881 LYS D O   1 
ATOM   2189 C CB  . LYS D 1 51 ? -27.905 9.677  16.744  1.00 22.61  ? 881 LYS D CB  1 
ATOM   2190 C CG  . LYS D 1 51 ? -28.064 8.217  16.356  1.00 23.25  ? 881 LYS D CG  1 
ATOM   2191 C CD  . LYS D 1 51 ? -27.462 7.286  17.400  1.00 35.42  ? 881 LYS D CD  1 
ATOM   2192 C CE  . LYS D 1 51 ? -28.443 6.216  17.881  1.00 40.99  ? 881 LYS D CE  1 
ATOM   2193 N NZ  . LYS D 1 51 ? -29.524 6.769  18.746  1.00 48.35  ? 881 LYS D NZ  1 
ATOM   2194 N N   . ASN D 1 52 ? -30.866 10.673 16.418  1.00 43.54  ? 882 ASN D N   1 
ATOM   2195 C CA  . ASN D 1 52 ? -32.284 10.393 16.308  1.00 46.78  ? 882 ASN D CA  1 
ATOM   2196 C C   . ASN D 1 52 ? -32.888 11.196 15.160  1.00 49.99  ? 882 ASN D C   1 
ATOM   2197 O O   . ASN D 1 52 ? -33.643 10.661 14.346  1.00 50.73  ? 882 ASN D O   1 
ATOM   2198 C CB  . ASN D 1 52 ? -32.977 10.738 17.631  1.00 52.53  ? 882 ASN D CB  1 
ATOM   2199 C CG  . ASN D 1 52 ? -32.629 9.762  18.746  1.00 56.38  ? 882 ASN D CG  1 
ATOM   2200 O OD1 . ASN D 1 52 ? -31.659 9.006  18.650  1.00 62.88  ? 882 ASN D OD1 1 
ATOM   2201 N ND2 . ASN D 1 52 ? -33.417 9.780  19.815  1.00 49.24  ? 882 ASN D ND2 1 
ATOM   2202 N N   . ASP D 1 53 ? -32.549 12.479 15.098  1.00 46.04  ? 883 ASP D N   1 
ATOM   2203 C CA  . ASP D 1 53 ? -33.048 13.353 14.043  1.00 51.35  ? 883 ASP D CA  1 
ATOM   2204 C C   . ASP D 1 53 ? -32.679 12.808 12.664  1.00 55.13  ? 883 ASP D C   1 
ATOM   2205 O O   . ASP D 1 53 ? -33.433 12.963 11.699  1.00 49.67  ? 883 ASP D O   1 
ATOM   2206 C CB  . ASP D 1 53 ? -32.480 14.764 14.216  1.00 65.35  ? 883 ASP D CB  1 
ATOM   2207 C CG  . ASP D 1 53 ? -33.175 15.545 15.322  1.00 81.90  ? 883 ASP D CG  1 
ATOM   2208 O OD1 . ASP D 1 53 ? -33.397 14.980 16.416  1.00 91.13  ? 883 ASP D OD1 1 
ATOM   2209 O OD2 . ASP D 1 53 ? -33.495 16.730 15.098  1.00 89.36  ? 883 ASP D OD2 1 
ATOM   2210 N N   . LEU D 1 54 ? -31.514 12.171 12.578  1.00 51.98  ? 884 LEU D N   1 
ATOM   2211 C CA  . LEU D 1 54 ? -31.056 11.595 11.320  1.00 47.71  ? 884 LEU D CA  1 
ATOM   2212 C C   . LEU D 1 54 ? -31.819 10.317 11.030  1.00 47.32  ? 884 LEU D C   1 
ATOM   2213 O O   . LEU D 1 54 ? -32.359 10.134 9.937   1.00 44.85  ? 884 LEU D O   1 
ATOM   2214 C CB  . LEU D 1 54 ? -29.560 11.287 11.381  1.00 43.84  ? 884 LEU D CB  1 
ATOM   2215 C CG  . LEU D 1 54 ? -28.637 12.498 11.265  1.00 54.77  ? 884 LEU D CG  1 
ATOM   2216 C CD1 . LEU D 1 54 ? -27.197 12.087 11.506  1.00 51.89  ? 884 LEU D CD1 1 
ATOM   2217 C CD2 . LEU D 1 54 ? -28.800 13.112 9.884   1.00 50.02  ? 884 LEU D CD2 1 
ATOM   2218 N N   . PHE D 1 55 ? -31.866 9.435  12.021  1.00 41.47  ? 885 PHE D N   1 
ATOM   2219 C CA  . PHE D 1 55 ? -32.551 8.168  11.861  1.00 43.34  ? 885 PHE D CA  1 
ATOM   2220 C C   . PHE D 1 55 ? -33.969 8.440  11.371  1.00 46.92  ? 885 PHE D C   1 
ATOM   2221 O O   . PHE D 1 55 ? -34.523 7.671  10.589  1.00 51.62  ? 885 PHE D O   1 
ATOM   2222 C CB  . PHE D 1 55 ? -32.587 7.413  13.190  1.00 41.07  ? 885 PHE D CB  1 
ATOM   2223 C CG  . PHE D 1 55 ? -32.534 5.919  13.038  1.00 50.61  ? 885 PHE D CG  1 
ATOM   2224 C CD1 . PHE D 1 55 ? -31.325 5.277  12.779  1.00 60.44  ? 885 PHE D CD1 1 
ATOM   2225 C CD2 . PHE D 1 55 ? -33.697 5.150  13.129  1.00 56.74  ? 885 PHE D CD2 1 
ATOM   2226 C CE1 . PHE D 1 55 ? -31.271 3.888  12.609  1.00 63.49  ? 885 PHE D CE1 1 
ATOM   2227 C CE2 . PHE D 1 55 ? -33.659 3.761  12.962  1.00 55.80  ? 885 PHE D CE2 1 
ATOM   2228 C CZ  . PHE D 1 55 ? -32.441 3.128  12.701  1.00 62.03  ? 885 PHE D CZ  1 
ATOM   2229 N N   . GLY D 1 56 ? -34.549 9.546  11.824  1.00 40.66  ? 886 GLY D N   1 
ATOM   2230 C CA  . GLY D 1 56 ? -35.894 9.884  11.406  1.00 36.79  ? 886 GLY D CA  1 
ATOM   2231 C C   . GLY D 1 56 ? -35.927 10.324 9.955   1.00 38.55  ? 886 GLY D C   1 
ATOM   2232 O O   . GLY D 1 56 ? -36.913 10.116 9.246   1.00 41.27  ? 886 GLY D O   1 
ATOM   2233 N N   . SER D 1 57 ? -34.845 10.944 9.507   1.00 38.83  ? 887 SER D N   1 
ATOM   2234 C CA  . SER D 1 57 ? -34.768 11.402 8.131   1.00 41.76  ? 887 SER D CA  1 
ATOM   2235 C C   . SER D 1 57 ? -34.493 10.210 7.222   1.00 41.39  ? 887 SER D C   1 
ATOM   2236 O O   . SER D 1 57 ? -35.000 10.135 6.102   1.00 41.77  ? 887 SER D O   1 
ATOM   2237 C CB  . SER D 1 57 ? -33.662 12.443 7.983   1.00 45.31  ? 887 SER D CB  1 
ATOM   2238 O OG  . SER D 1 57 ? -33.964 13.602 8.738   1.00 56.00  ? 887 SER D OG  1 
ATOM   2239 N N   . MET D 1 58 ? -33.694 9.274  7.719   1.00 36.95  ? 888 MET D N   1 
ATOM   2240 C CA  . MET D 1 58 ? -33.354 8.082  6.959   1.00 36.21  ? 888 MET D CA  1 
ATOM   2241 C C   . MET D 1 58 ? -34.611 7.254  6.736   1.00 33.15  ? 888 MET D C   1 
ATOM   2242 O O   . MET D 1 58 ? -34.715 6.508  5.769   1.00 38.66  ? 888 MET D O   1 
ATOM   2243 C CB  . MET D 1 58 ? -32.307 7.263  7.716   1.00 33.04  ? 888 MET D CB  1 
ATOM   2244 C CG  . MET D 1 58 ? -31.706 6.150  6.910   1.00 38.33  ? 888 MET D CG  1 
ATOM   2245 S SD  . MET D 1 58 ? -30.710 5.060  7.910   1.00 58.18  ? 888 MET D SD  1 
ATOM   2246 C CE  . MET D 1 58 ? -31.984 4.160  8.817   1.00 52.19  ? 888 MET D CE  1 
ATOM   2247 N N   . LYS D 1 59 ? -35.572 7.397  7.638   1.00 39.11  ? 889 LYS D N   1 
ATOM   2248 C CA  . LYS D 1 59 ? -36.828 6.673  7.535   1.00 40.09  ? 889 LYS D CA  1 
ATOM   2249 C C   . LYS D 1 59 ? -37.754 7.256  6.468   1.00 36.77  ? 889 LYS D C   1 
ATOM   2250 O O   . LYS D 1 59 ? -38.415 6.509  5.743   1.00 41.39  ? 889 LYS D O   1 
ATOM   2251 C CB  . LYS D 1 59 ? -37.537 6.654  8.891   1.00 44.87  ? 889 LYS D CB  1 
ATOM   2252 C CG  . LYS D 1 59 ? -36.848 5.761  9.910   1.00 53.31  ? 889 LYS D CG  1 
ATOM   2253 C CD  . LYS D 1 59 ? -36.804 4.321  9.419   1.00 56.20  ? 889 LYS D CD  1 
ATOM   2254 C CE  . LYS D 1 59 ? -36.030 3.419  10.362  1.00 58.98  ? 889 LYS D CE  1 
ATOM   2255 N NZ  . LYS D 1 59 ? -35.936 2.029  9.818   1.00 57.26  ? 889 LYS D NZ  1 
ATOM   2256 N N   . GLN D 1 60 ? -37.815 8.579  6.371   1.00 31.58  ? 890 GLN D N   1 
ATOM   2257 C CA  . GLN D 1 60 ? -38.674 9.195  5.367   1.00 38.79  ? 890 GLN D CA  1 
ATOM   2258 C C   . GLN D 1 60 ? -38.194 8.773  3.986   1.00 36.81  ? 890 GLN D C   1 
ATOM   2259 O O   . GLN D 1 60 ? -38.985 8.320  3.163   1.00 38.65  ? 890 GLN D O   1 
ATOM   2260 C CB  . GLN D 1 60 ? -38.642 10.720 5.467   1.00 35.10  ? 890 GLN D CB  1 
ATOM   2261 C CG  . GLN D 1 60 ? -38.825 11.254 6.863   1.00 57.77  ? 890 GLN D CG  1 
ATOM   2262 C CD  . GLN D 1 60 ? -39.316 12.679 6.856   1.00 63.81  ? 890 GLN D CD  1 
ATOM   2263 O OE1 . GLN D 1 60 ? -38.772 13.533 6.151   1.00 62.21  ? 890 GLN D OE1 1 
ATOM   2264 N NE2 . GLN D 1 60 ? -40.353 12.948 7.643   1.00 65.42  ? 890 GLN D NE2 1 
ATOM   2265 N N   . LEU D 1 61 ? -36.894 8.920  3.746   1.00 27.81  ? 891 LEU D N   1 
ATOM   2266 C CA  . LEU D 1 61 ? -36.293 8.553  2.469   1.00 35.69  ? 891 LEU D CA  1 
ATOM   2267 C C   . LEU D 1 61 ? -36.644 7.112  2.070   1.00 34.97  ? 891 LEU D C   1 
ATOM   2268 O O   . LEU D 1 61 ? -37.038 6.861  0.924   1.00 36.38  ? 891 LEU D O   1 
ATOM   2269 C CB  . LEU D 1 61 ? -34.770 8.721  2.539   1.00 34.49  ? 891 LEU D CB  1 
ATOM   2270 C CG  . LEU D 1 61 ? -34.212 10.130 2.752   1.00 32.53  ? 891 LEU D CG  1 
ATOM   2271 C CD1 . LEU D 1 61 ? -32.699 10.049 2.934   1.00 33.93  ? 891 LEU D CD1 1 
ATOM   2272 C CD2 . LEU D 1 61 ? -34.556 11.009 1.558   1.00 25.56  ? 891 LEU D CD2 1 
ATOM   2273 N N   . GLU D 1 62 ? -36.483 6.179  3.014   1.00 30.51  ? 892 GLU D N   1 
ATOM   2274 C CA  . GLU D 1 62 ? -36.799 4.766  2.795   1.00 27.30  ? 892 GLU D CA  1 
ATOM   2275 C C   . GLU D 1 62 ? -38.263 4.640  2.411   1.00 27.20  ? 892 GLU D C   1 
ATOM   2276 O O   . GLU D 1 62 ? -38.605 3.878  1.511   1.00 37.17  ? 892 GLU D O   1 
ATOM   2277 C CB  . GLU D 1 62 ? -36.551 3.940  4.056   1.00 27.66  ? 892 GLU D CB  1 
ATOM   2278 C CG  . GLU D 1 62 ? -35.115 3.897  4.527   1.00 43.23  ? 892 GLU D CG  1 
ATOM   2279 C CD  . GLU D 1 62 ? -34.955 3.067  5.793   1.00 54.10  ? 892 GLU D CD  1 
ATOM   2280 O OE1 . GLU D 1 62 ? -35.681 3.339  6.773   1.00 55.87  ? 892 GLU D OE1 1 
ATOM   2281 O OE2 . GLU D 1 62 ? -34.109 2.144  5.809   1.00 54.03  ? 892 GLU D OE2 1 
ATOM   2282 N N   . ASP D 1 63 ? -39.128 5.380  3.101   1.00 23.59  ? 893 ASP D N   1 
ATOM   2283 C CA  . ASP D 1 63 ? -40.550 5.370  2.779   1.00 20.50  ? 893 ASP D CA  1 
ATOM   2284 C C   . ASP D 1 63 ? -40.700 5.854  1.340   1.00 22.40  ? 893 ASP D C   1 
ATOM   2285 O O   . ASP D 1 63 ? -41.370 5.230  0.529   1.00 30.64  ? 893 ASP D O   1 
ATOM   2286 C CB  . ASP D 1 63 ? -41.337 6.309  3.709   1.00 34.44  ? 893 ASP D CB  1 
ATOM   2287 C CG  . ASP D 1 63 ? -41.626 5.692  5.084   1.00 48.71  ? 893 ASP D CG  1 
ATOM   2288 O OD1 . ASP D 1 63 ? -41.368 4.479  5.276   1.00 51.20  ? 893 ASP D OD1 1 
ATOM   2289 O OD2 . ASP D 1 63 ? -42.126 6.425  5.972   1.00 44.55  ? 893 ASP D OD2 1 
ATOM   2290 N N   . LYS D 1 64 ? -40.066 6.977  1.028   1.00 24.18  ? 894 LYS D N   1 
ATOM   2291 C CA  . LYS D 1 64 ? -40.137 7.533  -0.307  1.00 33.09  ? 894 LYS D CA  1 
ATOM   2292 C C   . LYS D 1 64 ? -39.690 6.468  -1.297  1.00 31.89  ? 894 LYS D C   1 
ATOM   2293 O O   . LYS D 1 64 ? -40.408 6.151  -2.243  1.00 38.75  ? 894 LYS D O   1 
ATOM   2294 C CB  . LYS D 1 64 ? -39.239 8.761  -0.410  1.00 44.03  ? 894 LYS D CB  1 
ATOM   2295 C CG  . LYS D 1 64 ? -39.425 9.565  -1.684  1.00 48.86  ? 894 LYS D CG  1 
ATOM   2296 C CD  . LYS D 1 64 ? -40.810 10.184 -1.765  1.00 63.41  ? 894 LYS D CD  1 
ATOM   2297 C CE  . LYS D 1 64 ? -40.907 11.123 -2.964  1.00 75.47  ? 894 LYS D CE  1 
ATOM   2298 N NZ  . LYS D 1 64 ? -42.273 11.682 -3.166  1.00 83.88  ? 894 LYS D NZ  1 
ATOM   2299 N N   . VAL D 1 65 ? -38.512 5.899  -1.070  1.00 29.78  ? 895 VAL D N   1 
ATOM   2300 C CA  . VAL D 1 65 ? -38.004 4.856  -1.958  1.00 27.93  ? 895 VAL D CA  1 
ATOM   2301 C C   . VAL D 1 65 ? -39.006 3.720  -2.158  1.00 26.25  ? 895 VAL D C   1 
ATOM   2302 O O   . VAL D 1 65 ? -39.107 3.183  -3.246  1.00 28.48  ? 895 VAL D O   1 
ATOM   2303 C CB  . VAL D 1 65 ? -36.687 4.260  -1.436  1.00 22.11  ? 895 VAL D CB  1 
ATOM   2304 C CG1 . VAL D 1 65 ? -36.376 2.976  -2.183  1.00 14.53  ? 895 VAL D CG1 1 
ATOM   2305 C CG2 . VAL D 1 65 ? -35.549 5.260  -1.629  1.00 19.10  ? 895 VAL D CG2 1 
ATOM   2306 N N   . GLU D 1 66 ? -39.753 3.360  -1.116  1.00 31.11  ? 896 GLU D N   1 
ATOM   2307 C CA  . GLU D 1 66 ? -40.734 2.288  -1.244  1.00 35.48  ? 896 GLU D CA  1 
ATOM   2308 C C   . GLU D 1 66 ? -41.905 2.735  -2.112  1.00 31.69  ? 896 GLU D C   1 
ATOM   2309 O O   . GLU D 1 66 ? -42.370 1.981  -2.965  1.00 29.83  ? 896 GLU D O   1 
ATOM   2310 C CB  . GLU D 1 66 ? -41.247 1.828  0.127   1.00 30.68  ? 896 GLU D CB  1 
ATOM   2311 C CG  . GLU D 1 66 ? -41.329 0.301  0.248   1.00 47.11  ? 896 GLU D CG  1 
ATOM   2312 C CD  . GLU D 1 66 ? -41.834 -0.184 1.609   1.00 55.93  ? 896 GLU D CD  1 
ATOM   2313 O OE1 . GLU D 1 66 ? -43.067 -0.300 1.778   1.00 50.69  ? 896 GLU D OE1 1 
ATOM   2314 O OE2 . GLU D 1 66 ? -40.998 -0.446 2.509   1.00 48.96  ? 896 GLU D OE2 1 
ATOM   2315 N N   . GLU D 1 67 ? -42.376 3.958  -1.900  1.00 23.74  ? 897 GLU D N   1 
ATOM   2316 C CA  . GLU D 1 67 ? -43.480 4.487  -2.695  1.00 26.09  ? 897 GLU D CA  1 
ATOM   2317 C C   . GLU D 1 67 ? -43.044 4.566  -4.167  1.00 25.49  ? 897 GLU D C   1 
ATOM   2318 O O   . GLU D 1 67 ? -43.710 4.023  -5.044  1.00 25.65  ? 897 GLU D O   1 
ATOM   2319 C CB  . GLU D 1 67 ? -43.869 5.862  -2.164  1.00 29.77  ? 897 GLU D CB  1 
ATOM   2320 C CG  . GLU D 1 67 ? -44.751 6.702  -3.058  1.00 48.47  ? 897 GLU D CG  1 
ATOM   2321 C CD  . GLU D 1 67 ? -44.679 8.170  -2.659  1.00 62.14  ? 897 GLU D CD  1 
ATOM   2322 O OE1 . GLU D 1 67 ? -44.690 9.048  -3.551  1.00 66.58  ? 897 GLU D OE1 1 
ATOM   2323 O OE2 . GLU D 1 67 ? -44.599 8.442  -1.442  1.00 62.42  ? 897 GLU D OE2 1 
ATOM   2324 N N   . LEU D 1 68 ? -41.917 5.218  -4.436  1.00 25.27  ? 898 LEU D N   1 
ATOM   2325 C CA  . LEU D 1 68 ? -41.407 5.333  -5.811  1.00 25.59  ? 898 LEU D CA  1 
ATOM   2326 C C   . LEU D 1 68 ? -41.280 3.960  -6.477  1.00 27.96  ? 898 LEU D C   1 
ATOM   2327 O O   . LEU D 1 68 ? -41.676 3.757  -7.631  1.00 27.18  ? 898 LEU D O   1 
ATOM   2328 C CB  . LEU D 1 68 ? -40.045 6.021  -5.802  1.00 16.96  ? 898 LEU D CB  1 
ATOM   2329 C CG  . LEU D 1 68 ? -39.941 7.514  -6.151  1.00 24.26  ? 898 LEU D CG  1 
ATOM   2330 C CD1 . LEU D 1 68 ? -41.247 8.222  -5.957  1.00 24.75  ? 898 LEU D CD1 1 
ATOM   2331 C CD2 . LEU D 1 68 ? -38.840 8.142  -5.302  1.00 20.24  ? 898 LEU D CD2 1 
ATOM   2332 N N   . LEU D 1 69 ? -40.734 3.012  -5.731  1.00 29.13  ? 899 LEU D N   1 
ATOM   2333 C CA  . LEU D 1 69 ? -40.552 1.655  -6.224  1.00 23.44  ? 899 LEU D CA  1 
ATOM   2334 C C   . LEU D 1 69 ? -41.923 1.080  -6.573  1.00 29.40  ? 899 LEU D C   1 
ATOM   2335 O O   . LEU D 1 69 ? -42.074 0.382  -7.573  1.00 37.88  ? 899 LEU D O   1 
ATOM   2336 C CB  . LEU D 1 69 ? -39.881 0.823  -5.138  1.00 16.96  ? 899 LEU D CB  1 
ATOM   2337 C CG  . LEU D 1 69 ? -38.981 -0.361 -5.457  1.00 27.12  ? 899 LEU D CG  1 
ATOM   2338 C CD1 . LEU D 1 69 ? -38.060 -0.060 -6.615  1.00 20.96  ? 899 LEU D CD1 1 
ATOM   2339 C CD2 . LEU D 1 69 ? -38.172 -0.669 -4.197  1.00 32.90  ? 899 LEU D CD2 1 
ATOM   2340 N N   . SER D 1 70 ? -42.927 1.390  -5.756  1.00 21.18  ? 900 SER D N   1 
ATOM   2341 C CA  . SER D 1 70 ? -44.266 0.886  -6.001  1.00 20.48  ? 900 SER D CA  1 
ATOM   2342 C C   . SER D 1 70 ? -44.808 1.464  -7.305  1.00 27.70  ? 900 SER D C   1 
ATOM   2343 O O   . SER D 1 70 ? -45.216 0.721  -8.190  1.00 34.14  ? 900 SER D O   1 
ATOM   2344 C CB  . SER D 1 70 ? -45.199 1.236  -4.838  1.00 17.31  ? 900 SER D CB  1 
ATOM   2345 O OG  . SER D 1 70 ? -46.500 0.737  -5.090  1.00 28.24  ? 900 SER D OG  1 
ATOM   2346 N N   . LYS D 1 71 ? -44.808 2.787  -7.426  1.00 30.30  ? 901 LYS D N   1 
ATOM   2347 C CA  . LYS D 1 71 ? -45.286 3.420  -8.646  1.00 32.53  ? 901 LYS D CA  1 
ATOM   2348 C C   . LYS D 1 71 ? -44.549 2.764  -9.801  1.00 35.46  ? 901 LYS D C   1 
ATOM   2349 O O   . LYS D 1 71 ? -45.146 2.367  -10.798 1.00 41.44  ? 901 LYS D O   1 
ATOM   2350 C CB  . LYS D 1 71 ? -44.970 4.917  -8.644  1.00 23.18  ? 901 LYS D CB  1 
ATOM   2351 C CG  . LYS D 1 71 ? -45.544 5.695  -7.476  1.00 37.99  ? 901 LYS D CG  1 
ATOM   2352 C CD  . LYS D 1 71 ? -45.025 7.127  -7.507  1.00 56.71  ? 901 LYS D CD  1 
ATOM   2353 C CE  . LYS D 1 71 ? -45.594 7.981  -6.382  1.00 65.06  ? 901 LYS D CE  1 
ATOM   2354 N NZ  . LYS D 1 71 ? -45.063 9.377  -6.434  1.00 67.97  ? 901 LYS D NZ  1 
ATOM   2355 N N   . ASN D 1 72 ? -43.238 2.644  -9.637  1.00 38.21  ? 902 ASN D N   1 
ATOM   2356 C CA  . ASN D 1 72 ? -42.375 2.064  -10.649 1.00 30.50  ? 902 ASN D CA  1 
ATOM   2357 C C   . ASN D 1 72 ? -42.856 0.692  -11.104 1.00 31.98  ? 902 ASN D C   1 
ATOM   2358 O O   . ASN D 1 72 ? -42.842 0.385  -12.297 1.00 26.47  ? 902 ASN D O   1 
ATOM   2359 C CB  . ASN D 1 72 ? -40.947 1.983  -10.097 1.00 33.20  ? 902 ASN D CB  1 
ATOM   2360 C CG  . ASN D 1 72 ? -39.958 1.436  -11.100 1.00 34.74  ? 902 ASN D CG  1 
ATOM   2361 O OD1 . ASN D 1 72 ? -39.792 0.220  -11.237 1.00 39.20  ? 902 ASN D OD1 1 
ATOM   2362 N ND2 . ASN D 1 72 ? -39.298 2.335  -11.818 1.00 34.34  ? 902 ASN D ND2 1 
ATOM   2363 N N   . TYR D 1 73 ? -43.279 -0.135 -10.154 1.00 33.15  ? 903 TYR D N   1 
ATOM   2364 C CA  . TYR D 1 73 ? -43.757 -1.472 -10.480 1.00 32.80  ? 903 TYR D CA  1 
ATOM   2365 C C   . TYR D 1 73 ? -45.073 -1.433 -11.265 1.00 36.16  ? 903 TYR D C   1 
ATOM   2366 O O   . TYR D 1 73 ? -45.263 -2.188 -12.215 1.00 30.00  ? 903 TYR D O   1 
ATOM   2367 C CB  . TYR D 1 73 ? -43.915 -2.286 -9.199  1.00 29.48  ? 903 TYR D CB  1 
ATOM   2368 C CG  . TYR D 1 73 ? -44.827 -3.485 -9.320  1.00 38.20  ? 903 TYR D CG  1 
ATOM   2369 C CD1 . TYR D 1 73 ? -46.122 -3.452 -8.800  1.00 44.19  ? 903 TYR D CD1 1 
ATOM   2370 C CD2 . TYR D 1 73 ? -44.387 -4.663 -9.915  1.00 40.85  ? 903 TYR D CD2 1 
ATOM   2371 C CE1 . TYR D 1 73 ? -46.952 -4.567 -8.858  1.00 49.98  ? 903 TYR D CE1 1 
ATOM   2372 C CE2 . TYR D 1 73 ? -45.212 -5.789 -9.984  1.00 41.99  ? 903 TYR D CE2 1 
ATOM   2373 C CZ  . TYR D 1 73 ? -46.488 -5.734 -9.449  1.00 51.97  ? 903 TYR D CZ  1 
ATOM   2374 O OH  . TYR D 1 73 ? -47.288 -6.854 -9.469  1.00 54.67  ? 903 TYR D OH  1 
ATOM   2375 N N   . HIS D 1 74 ? -45.981 -0.551 -10.874 1.00 26.81  ? 904 HIS D N   1 
ATOM   2376 C CA  . HIS D 1 74 ? -47.242 -0.449 -11.573 1.00 32.18  ? 904 HIS D CA  1 
ATOM   2377 C C   . HIS D 1 74 ? -47.057 0.119  -12.980 1.00 37.42  ? 904 HIS D C   1 
ATOM   2378 O O   . HIS D 1 74 ? -47.780 -0.243 -13.904 1.00 38.96  ? 904 HIS D O   1 
ATOM   2379 C CB  . HIS D 1 74 ? -48.204 0.392  -10.748 1.00 31.65  ? 904 HIS D CB  1 
ATOM   2380 C CG  . HIS D 1 74 ? -48.685 -0.312 -9.516  1.00 39.58  ? 904 HIS D CG  1 
ATOM   2381 N ND1 . HIS D 1 74 ? -49.459 -1.449 -9.572  1.00 47.68  ? 904 HIS D ND1 1 
ATOM   2382 C CD2 . HIS D 1 74 ? -48.461 -0.071 -8.203  1.00 45.34  ? 904 HIS D CD2 1 
ATOM   2383 C CE1 . HIS D 1 74 ? -49.693 -1.881 -8.343  1.00 51.71  ? 904 HIS D CE1 1 
ATOM   2384 N NE2 . HIS D 1 74 ? -49.099 -1.064 -7.495  1.00 44.90  ? 904 HIS D NE2 1 
ATOM   2385 N N   . LEU D 1 75 ? -46.072 0.993  -13.145 1.00 32.56  ? 905 LEU D N   1 
ATOM   2386 C CA  . LEU D 1 75 ? -45.803 1.572  -14.446 1.00 32.23  ? 905 LEU D CA  1 
ATOM   2387 C C   . LEU D 1 75 ? -45.252 0.507  -15.384 1.00 40.02  ? 905 LEU D C   1 
ATOM   2388 O O   . LEU D 1 75 ? -45.738 0.350  -16.505 1.00 42.17  ? 905 LEU D O   1 
ATOM   2389 C CB  . LEU D 1 75 ? -44.807 2.723  -14.321 1.00 35.35  ? 905 LEU D CB  1 
ATOM   2390 C CG  . LEU D 1 75 ? -45.364 4.039  -13.775 1.00 32.84  ? 905 LEU D CG  1 
ATOM   2391 C CD1 . LEU D 1 75 ? -44.276 5.099  -13.708 1.00 32.31  ? 905 LEU D CD1 1 
ATOM   2392 C CD2 . LEU D 1 75 ? -46.480 4.505  -14.685 1.00 35.46  ? 905 LEU D CD2 1 
ATOM   2393 N N   . GLU D 1 76 ? -44.243 -0.227 -14.925 1.00 36.33  ? 906 GLU D N   1 
ATOM   2394 C CA  . GLU D 1 76 ? -43.641 -1.288 -15.731 1.00 41.27  ? 906 GLU D CA  1 
ATOM   2395 C C   . GLU D 1 76 ? -44.687 -2.246 -16.290 1.00 42.56  ? 906 GLU D C   1 
ATOM   2396 O O   . GLU D 1 76 ? -44.499 -2.817 -17.373 1.00 44.80  ? 906 GLU D O   1 
ATOM   2397 C CB  . GLU D 1 76 ? -42.630 -2.095 -14.911 1.00 39.31  ? 906 GLU D CB  1 
ATOM   2398 C CG  . GLU D 1 76 ? -41.303 -1.400 -14.680 1.00 51.99  ? 906 GLU D CG  1 
ATOM   2399 C CD  . GLU D 1 76 ? -40.524 -1.177 -15.964 1.00 58.10  ? 906 GLU D CD  1 
ATOM   2400 O OE1 . GLU D 1 76 ? -39.345 -0.755 -15.877 1.00 56.00  ? 906 GLU D OE1 1 
ATOM   2401 O OE2 . GLU D 1 76 ? -41.090 -1.423 -17.055 1.00 56.38  ? 906 GLU D OE2 1 
ATOM   2402 N N   . ASN D 1 77 ? -45.777 -2.431 -15.548 1.00 38.39  ? 907 ASN D N   1 
ATOM   2403 C CA  . ASN D 1 77 ? -46.841 -3.322 -15.990 1.00 41.00  ? 907 ASN D CA  1 
ATOM   2404 C C   . ASN D 1 77 ? -47.625 -2.672 -17.129 1.00 40.57  ? 907 ASN D C   1 
ATOM   2405 O O   . ASN D 1 77 ? -47.944 -3.322 -18.124 1.00 48.42  ? 907 ASN D O   1 
ATOM   2406 C CB  . ASN D 1 77 ? -47.778 -3.675 -14.827 1.00 43.36  ? 907 ASN D CB  1 
ATOM   2407 C CG  . ASN D 1 77 ? -47.129 -4.607 -13.811 1.00 48.47  ? 907 ASN D CG  1 
ATOM   2408 O OD1 . ASN D 1 77 ? -46.430 -5.552 -14.172 1.00 47.47  ? 907 ASN D OD1 1 
ATOM   2409 N ND2 . ASN D 1 77 ? -47.377 -4.352 -12.532 1.00 56.10  ? 907 ASN D ND2 1 
ATOM   2410 N N   . GLU D 1 78 ? -47.921 -1.388 -16.994 1.00 38.86  ? 908 GLU D N   1 
ATOM   2411 C CA  . GLU D 1 78 ? -48.648 -0.682 -18.037 1.00 47.97  ? 908 GLU D CA  1 
ATOM   2412 C C   . GLU D 1 78 ? -47.877 -0.693 -19.351 1.00 47.74  ? 908 GLU D C   1 
ATOM   2413 O O   . GLU D 1 78 ? -48.467 -0.695 -20.429 1.00 52.14  ? 908 GLU D O   1 
ATOM   2414 C CB  . GLU D 1 78 ? -48.918 0.753  -17.604 1.00 54.43  ? 908 GLU D CB  1 
ATOM   2415 C CG  . GLU D 1 78 ? -50.099 0.853  -16.695 1.00 66.34  ? 908 GLU D CG  1 
ATOM   2416 C CD  . GLU D 1 78 ? -51.366 0.448  -17.407 1.00 77.94  ? 908 GLU D CD  1 
ATOM   2417 O OE1 . GLU D 1 78 ? -51.860 1.249  -18.231 1.00 78.05  ? 908 GLU D OE1 1 
ATOM   2418 O OE2 . GLU D 1 78 ? -51.853 -0.675 -17.157 1.00 79.31  ? 908 GLU D OE2 1 
ATOM   2419 N N   . VAL D 1 79 ? -46.554 -0.697 -19.263 1.00 44.25  ? 909 VAL D N   1 
ATOM   2420 C CA  . VAL D 1 79 ? -45.744 -0.712 -20.465 1.00 42.43  ? 909 VAL D CA  1 
ATOM   2421 C C   . VAL D 1 79 ? -45.832 -2.087 -21.088 1.00 47.28  ? 909 VAL D C   1 
ATOM   2422 O O   . VAL D 1 79 ? -46.103 -2.223 -22.285 1.00 47.20  ? 909 VAL D O   1 
ATOM   2423 C CB  . VAL D 1 79 ? -44.271 -0.383 -20.160 1.00 40.87  ? 909 VAL D CB  1 
ATOM   2424 C CG1 . VAL D 1 79 ? -43.378 -0.832 -21.324 1.00 30.48  ? 909 VAL D CG1 1 
ATOM   2425 C CG2 . VAL D 1 79 ? -44.124 1.116  -19.936 1.00 35.21  ? 909 VAL D CG2 1 
ATOM   2426 N N   . ALA D 1 80 ? -45.604 -3.103 -20.263 1.00 49.46  ? 910 ALA D N   1 
ATOM   2427 C CA  . ALA D 1 80 ? -45.653 -4.486 -20.716 1.00 49.71  ? 910 ALA D CA  1 
ATOM   2428 C C   . ALA D 1 80 ? -46.996 -4.705 -21.402 1.00 53.59  ? 910 ALA D C   1 
ATOM   2429 O O   . ALA D 1 80 ? -47.063 -5.237 -22.514 1.00 53.45  ? 910 ALA D O   1 
ATOM   2430 C CB  . ALA D 1 80 ? -45.498 -5.432 -19.522 1.00 31.40  ? 910 ALA D CB  1 
ATOM   2431 N N   . ARG D 1 81 ? -48.055 -4.265 -20.727 1.00 52.81  ? 911 ARG D N   1 
ATOM   2432 C CA  . ARG D 1 81 ? -49.427 -4.379 -21.214 1.00 46.72  ? 911 ARG D CA  1 
ATOM   2433 C C   . ARG D 1 81 ? -49.576 -3.798 -22.612 1.00 48.51  ? 911 ARG D C   1 
ATOM   2434 O O   . ARG D 1 81 ? -49.837 -4.523 -23.568 1.00 56.92  ? 911 ARG D O   1 
ATOM   2435 C CB  . ARG D 1 81 ? -50.365 -3.630 -20.276 1.00 46.99  ? 911 ARG D CB  1 
ATOM   2436 C CG  . ARG D 1 81 ? -51.718 -4.263 -20.099 1.00 43.60  ? 911 ARG D CG  1 
ATOM   2437 C CD  . ARG D 1 81 ? -52.711 -3.210 -19.707 1.00 40.03  ? 911 ARG D CD  1 
ATOM   2438 N NE  . ARG D 1 81 ? -53.186 -2.502 -20.886 1.00 52.06  ? 911 ARG D NE  1 
ATOM   2439 C CZ  . ARG D 1 81 ? -53.437 -1.202 -20.922 1.00 50.80  ? 911 ARG D CZ  1 
ATOM   2440 N NH1 . ARG D 1 81 ? -53.247 -0.463 -19.840 1.00 45.79  ? 911 ARG D NH1 1 
ATOM   2441 N NH2 . ARG D 1 81 ? -53.898 -0.647 -22.035 1.00 60.21  ? 911 ARG D NH2 1 
ATOM   2442 N N   . LEU D 1 82 ? -49.418 -2.482 -22.721 1.00 49.99  ? 912 LEU D N   1 
ATOM   2443 C CA  . LEU D 1 82 ? -49.535 -1.796 -24.003 1.00 50.02  ? 912 LEU D CA  1 
ATOM   2444 C C   . LEU D 1 82 ? -48.670 -2.436 -25.083 1.00 55.26  ? 912 LEU D C   1 
ATOM   2445 O O   . LEU D 1 82 ? -49.171 -2.781 -26.148 1.00 64.19  ? 912 LEU D O   1 
ATOM   2446 C CB  . LEU D 1 82 ? -49.145 -0.324 -23.857 1.00 47.43  ? 912 LEU D CB  1 
ATOM   2447 C CG  . LEU D 1 82 ? -49.926 0.485  -22.827 1.00 44.50  ? 912 LEU D CG  1 
ATOM   2448 C CD1 . LEU D 1 82 ? -49.444 1.925  -22.844 1.00 51.87  ? 912 LEU D CD1 1 
ATOM   2449 C CD2 . LEU D 1 82 ? -51.407 0.415  -23.145 1.00 52.55  ? 912 LEU D CD2 1 
ATOM   2450 N N   . LYS D 1 83 ? -47.376 -2.590 -24.811 1.00 56.88  ? 913 LYS D N   1 
ATOM   2451 C CA  . LYS D 1 83 ? -46.454 -3.187 -25.777 1.00 60.22  ? 913 LYS D CA  1 
ATOM   2452 C C   . LYS D 1 83 ? -46.969 -4.489 -26.380 1.00 59.16  ? 913 LYS D C   1 
ATOM   2453 O O   . LYS D 1 83 ? -46.620 -4.843 -27.505 1.00 56.83  ? 913 LYS D O   1 
ATOM   2454 C CB  . LYS D 1 83 ? -45.082 -3.432 -25.134 1.00 57.95  ? 913 LYS D CB  1 
ATOM   2455 C CG  . LYS D 1 83 ? -44.199 -2.193 -25.091 1.00 65.51  ? 913 LYS D CG  1 
ATOM   2456 C CD  . LYS D 1 83 ? -42.819 -2.491 -24.513 1.00 64.06  ? 913 LYS D CD  1 
ATOM   2457 C CE  . LYS D 1 83 ? -41.925 -1.257 -24.576 1.00 56.45  ? 913 LYS D CE  1 
ATOM   2458 N NZ  . LYS D 1 83 ? -40.605 -1.483 -23.932 1.00 60.82  ? 913 LYS D NZ  1 
ATOM   2459 N N   . LYS D 1 84 ? -47.804 -5.196 -25.629 1.00 57.11  ? 914 LYS D N   1 
ATOM   2460 C CA  . LYS D 1 84 ? -48.367 -6.463 -26.083 1.00 61.39  ? 914 LYS D CA  1 
ATOM   2461 C C   . LYS D 1 84 ? -49.447 -6.221 -27.148 1.00 64.02  ? 914 LYS D C   1 
ATOM   2462 O O   . LYS D 1 84 ? -49.578 -6.986 -28.105 1.00 56.00  ? 914 LYS D O   1 
ATOM   2463 C CB  . LYS D 1 84 ? -48.954 -7.207 -24.879 1.00 66.68  ? 914 LYS D CB  1 
ATOM   2464 C CG  . LYS D 1 84 ? -49.029 -8.719 -25.024 1.00 69.23  ? 914 LYS D CG  1 
ATOM   2465 C CD  . LYS D 1 84 ? -49.250 -9.376 -23.665 1.00 69.93  ? 914 LYS D CD  1 
ATOM   2466 C CE  . LYS D 1 84 ? -48.085 -9.082 -22.723 1.00 76.09  ? 914 LYS D CE  1 
ATOM   2467 N NZ  . LYS D 1 84 ? -48.268 -9.676 -21.370 1.00 74.74  ? 914 LYS D NZ  1 
ATOM   2468 N N   . LEU D 1 85 ? -50.209 -5.144 -26.976 1.00 60.34  ? 915 LEU D N   1 
ATOM   2469 C CA  . LEU D 1 85 ? -51.264 -4.788 -27.911 1.00 57.73  ? 915 LEU D CA  1 
ATOM   2470 C C   . LEU D 1 85 ? -50.673 -4.195 -29.186 1.00 65.25  ? 915 LEU D C   1 
ATOM   2471 O O   . LEU D 1 85 ? -51.257 -4.312 -30.265 1.00 69.60  ? 915 LEU D O   1 
ATOM   2472 C CB  . LEU D 1 85 ? -52.201 -3.752 -27.287 1.00 51.82  ? 915 LEU D CB  1 
ATOM   2473 C CG  . LEU D 1 85 ? -52.809 -3.996 -25.904 1.00 54.56  ? 915 LEU D CG  1 
ATOM   2474 C CD1 . LEU D 1 85 ? -53.732 -2.832 -25.560 1.00 31.92  ? 915 LEU D CD1 1 
ATOM   2475 C CD2 . LEU D 1 85 ? -53.569 -5.317 -25.883 1.00 53.90  ? 915 LEU D CD2 1 
ATOM   2476 N N   . VAL D 1 86 ? -49.511 -3.561 -29.052 1.00 68.15  ? 916 VAL D N   1 
ATOM   2477 C CA  . VAL D 1 86 ? -48.846 -2.906 -30.177 1.00 73.49  ? 916 VAL D CA  1 
ATOM   2478 C C   . VAL D 1 86 ? -47.853 -3.783 -30.925 1.00 77.05  ? 916 VAL D C   1 
ATOM   2479 O O   . VAL D 1 86 ? -47.245 -3.338 -31.898 1.00 75.38  ? 916 VAL D O   1 
ATOM   2480 C CB  . VAL D 1 86 ? -48.073 -1.658 -29.711 1.00 76.30  ? 916 VAL D CB  1 
ATOM   2481 C CG1 . VAL D 1 86 ? -47.989 -0.653 -30.838 1.00 84.92  ? 916 VAL D CG1 1 
ATOM   2482 C CG2 . VAL D 1 86 ? -48.732 -1.053 -28.493 1.00 81.94  ? 916 VAL D CG2 1 
ATOM   2483 N N   . GLY D 1 87 ? -47.679 -5.022 -30.479 1.00 80.42  ? 917 GLY D N   1 
ATOM   2484 C CA  . GLY D 1 87 ? -46.724 -5.895 -31.136 1.00 82.82  ? 917 GLY D CA  1 
ATOM   2485 C C   . GLY D 1 87 ? -45.313 -5.352 -30.977 1.00 87.40  ? 917 GLY D C   1 
ATOM   2486 O O   . GLY D 1 87 ? -44.646 -5.020 -31.960 1.00 86.66  ? 917 GLY D O   1 
ATOM   2487 N N   . GLU D 1 88 ? -44.866 -5.250 -29.726 1.00 93.19  ? 918 GLU D N   1 
ATOM   2488 C CA  . GLU D 1 88 ? -43.531 -4.751 -29.394 1.00 94.51  ? 918 GLU D CA  1 
ATOM   2489 C C   . GLU D 1 88 ? -42.853 -5.636 -28.347 1.00 93.81  ? 918 GLU D C   1 
ATOM   2490 O O   . GLU D 1 88 ? -41.711 -6.083 -28.596 1.00 91.63  ? 918 GLU D O   1 
ATOM   2491 C CB  . GLU D 1 88 ? -43.610 -3.313 -28.868 1.00 96.22  ? 918 GLU D CB  1 
ATOM   2492 C CG  . GLU D 1 88 ? -43.905 -2.267 -29.933 1.00 104.14 ? 918 GLU D CG  1 
ATOM   2493 C CD  . GLU D 1 88 ? -43.967 -0.858 -29.367 1.00 107.27 ? 918 GLU D CD  1 
ATOM   2494 O OE1 . GLU D 1 88 ? -43.006 -0.446 -28.683 1.00 108.43 ? 918 GLU D OE1 1 
ATOM   2495 O OE2 . GLU D 1 88 ? -44.974 -0.161 -29.610 1.00 113.13 ? 918 GLU D OE2 1 
HETATM 2496 O O   . HOH E 2 .  ? 54.655  20.043 90.943  1.00 37.38  ? 1   HOH A O   1 
HETATM 2497 O O   . HOH E 2 .  ? 30.288  18.443 74.929  1.00 39.43  ? 2   HOH A O   1 
HETATM 2498 O O   . HOH E 2 .  ? -8.272  2.452  30.834  1.00 54.55  ? 4   HOH A O   1 
HETATM 2499 O O   . HOH E 2 .  ? -1.486  10.800 43.919  1.00 53.52  ? 11  HOH A O   1 
HETATM 2500 O O   . HOH E 2 .  ? 21.687  15.790 64.640  1.00 37.50  ? 14  HOH A O   1 
HETATM 2501 O O   . HOH E 2 .  ? 9.099   15.036 58.685  1.00 56.50  ? 15  HOH A O   1 
HETATM 2502 O O   . HOH E 2 .  ? -6.237  2.328  37.351  1.00 77.76  ? 17  HOH A O   1 
HETATM 2503 O O   . HOH E 2 .  ? 35.184  12.251 71.071  1.00 47.24  ? 24  HOH A O   1 
HETATM 2504 O O   . HOH E 2 .  ? 29.951  17.651 66.610  1.00 46.43  ? 25  HOH A O   1 
HETATM 2505 O O   . HOH E 2 .  ? 27.249  14.595 64.620  1.00 49.02  ? 26  HOH A O   1 
HETATM 2506 O O   . HOH E 2 .  ? 14.098  12.835 69.856  1.00 47.84  ? 27  HOH A O   1 
HETATM 2507 O O   . HOH E 2 .  ? 9.940   15.798 62.750  1.00 71.21  ? 28  HOH A O   1 
HETATM 2508 O O   . HOH E 2 .  ? 6.662   9.029  57.853  1.00 45.52  ? 29  HOH A O   1 
HETATM 2509 O O   . HOH E 2 .  ? 6.729   1.085  47.817  1.00 39.43  ? 30  HOH A O   1 
HETATM 2510 O O   . HOH E 2 .  ? -1.909  16.390 37.052  1.00 43.47  ? 32  HOH A O   1 
HETATM 2511 O O   . HOH E 2 .  ? -3.704  4.954  19.308  1.00 33.25  ? 34  HOH A O   1 
HETATM 2512 O O   . HOH E 2 .  ? 1.388   7.131  24.467  1.00 39.64  ? 41  HOH A O   1 
HETATM 2513 O O   . HOH E 2 .  ? 8.300   1.090  41.743  1.00 60.87  ? 46  HOH A O   1 
HETATM 2514 O O   . HOH E 2 .  ? 36.788  9.078  72.710  1.00 67.84  ? 47  HOH A O   1 
HETATM 2515 O O   . HOH E 2 .  ? 14.235  13.921 73.336  1.00 60.11  ? 48  HOH A O   1 
HETATM 2516 O O   . HOH E 2 .  ? 4.044   13.693 45.934  1.00 77.03  ? 49  HOH A O   1 
HETATM 2517 O O   . HOH E 2 .  ? -5.005  1.130  24.603  1.00 41.84  ? 57  HOH A O   1 
HETATM 2518 O O   . HOH E 2 .  ? 34.458  23.249 79.694  1.00 43.26  ? 58  HOH A O   1 
HETATM 2519 O O   . HOH E 2 .  ? -2.811  5.800  16.454  1.00 57.64  ? 59  HOH A O   1 
HETATM 2520 O O   . HOH E 2 .  ? -14.465 12.037 23.354  1.00 43.97  ? 61  HOH A O   1 
HETATM 2521 O O   . HOH E 2 .  ? 7.365   -0.742 52.561  1.00 53.73  ? 72  HOH A O   1 
HETATM 2522 O O   . HOH E 2 .  ? 18.672  5.532  68.632  1.00 50.63  ? 73  HOH A O   1 
HETATM 2523 O O   . HOH E 2 .  ? 4.772   6.002  55.333  1.00 46.81  ? 75  HOH A O   1 
HETATM 2524 O O   . HOH E 2 .  ? 5.452   2.354  55.498  1.00 46.86  ? 76  HOH A O   1 
HETATM 2525 O O   . HOH E 2 .  ? -8.655  14.339 35.033  1.00 60.83  ? 78  HOH A O   1 
HETATM 2526 O O   . HOH E 2 .  ? 31.899  15.037 81.739  1.00 31.27  ? 80  HOH A O   1 
HETATM 2527 O O   . HOH E 2 .  ? -7.161  6.222  35.461  1.00 38.94  ? 81  HOH A O   1 
HETATM 2528 O O   . HOH F 2 .  ? 10.991  3.491  41.159  1.00 43.49  ? 3   HOH B O   1 
HETATM 2529 O O   . HOH F 2 .  ? -1.592  15.397 30.783  1.00 20.19  ? 5   HOH B O   1 
HETATM 2530 O O   . HOH F 2 .  ? 33.543  0.074  78.384  1.00 22.58  ? 8   HOH B O   1 
HETATM 2531 O O   . HOH F 2 .  ? 10.536  12.531 31.888  1.00 35.35  ? 12  HOH B O   1 
HETATM 2532 O O   . HOH F 2 .  ? 30.065  -0.432 85.889  1.00 43.30  ? 19  HOH B O   1 
HETATM 2533 O O   . HOH F 2 .  ? 23.090  1.001  47.335  1.00 49.51  ? 20  HOH B O   1 
HETATM 2534 O O   . HOH F 2 .  ? -5.519  17.839 10.792  1.00 32.91  ? 21  HOH B O   1 
HETATM 2535 O O   . HOH F 2 .  ? 35.748  -0.147 86.495  1.00 54.29  ? 23  HOH B O   1 
HETATM 2536 O O   . HOH F 2 .  ? 26.448  1.700  83.975  1.00 50.25  ? 33  HOH B O   1 
HETATM 2537 O O   . HOH F 2 .  ? 22.079  1.645  68.758  1.00 45.17  ? 35  HOH B O   1 
HETATM 2538 O O   . HOH F 2 .  ? 6.405   17.947 26.811  1.00 36.44  ? 36  HOH B O   1 
HETATM 2539 O O   . HOH F 2 .  ? -9.453  16.314 23.887  1.00 38.90  ? 37  HOH B O   1 
HETATM 2540 O O   . HOH F 2 .  ? 3.589   4.461  27.909  1.00 42.52  ? 40  HOH B O   1 
HETATM 2541 O O   . HOH F 2 .  ? 26.550  -1.799 75.973  1.00 39.75  ? 42  HOH B O   1 
HETATM 2542 O O   . HOH F 2 .  ? 24.307  0.329  76.720  1.00 54.18  ? 43  HOH B O   1 
HETATM 2543 O O   . HOH F 2 .  ? 6.388   15.466 42.744  1.00 46.23  ? 50  HOH B O   1 
HETATM 2544 O O   . HOH F 2 .  ? -6.732  22.160 21.041  1.00 51.25  ? 51  HOH B O   1 
HETATM 2545 O O   . HOH F 2 .  ? 19.620  1.640  62.426  1.00 45.23  ? 62  HOH B O   1 
HETATM 2546 O O   . HOH F 2 .  ? 32.987  9.450  61.718  1.00 39.35  ? 67  HOH B O   1 
HETATM 2547 O O   . HOH F 2 .  ? 8.444   16.803 29.222  1.00 62.46  ? 71  HOH B O   1 
HETATM 2548 O O   . HOH F 2 .  ? -8.989  12.681 28.195  1.00 31.61  ? 74  HOH B O   1 
HETATM 2549 O O   . HOH G 2 .  ? -34.217 14.513 -17.639 1.00 48.12  ? 7   HOH C O   1 
HETATM 2550 O O   . HOH G 2 .  ? -42.957 9.135  -10.600 1.00 42.72  ? 9   HOH C O   1 
HETATM 2551 O O   . HOH G 2 .  ? -33.321 -1.975 -13.752 1.00 60.19  ? 10  HOH C O   1 
HETATM 2552 O O   . HOH G 2 .  ? -34.359 12.667 -10.871 1.00 41.75  ? 18  HOH C O   1 
HETATM 2553 O O   . HOH G 2 .  ? -26.403 14.473 2.435   1.00 64.63  ? 22  HOH C O   1 
HETATM 2554 O O   . HOH G 2 .  ? -26.402 9.366  27.808  1.00 68.89  ? 38  HOH C O   1 
HETATM 2555 O O   . HOH G 2 .  ? -8.202  10.094 29.688  1.00 50.57  ? 44  HOH C O   1 
HETATM 2556 O O   . HOH G 2 .  ? -19.143 1.426  9.426   1.00 66.24  ? 53  HOH C O   1 
HETATM 2557 O O   . HOH G 2 .  ? -27.234 3.483  14.372  1.00 56.33  ? 54  HOH C O   1 
HETATM 2558 O O   . HOH G 2 .  ? -29.755 1.665  2.725   1.00 56.19  ? 55  HOH C O   1 
HETATM 2559 O O   . HOH G 2 .  ? -50.790 9.260  -24.088 1.00 33.59  ? 56  HOH C O   1 
HETATM 2560 O O   . HOH G 2 .  ? -25.191 6.306  -4.256  1.00 46.58  ? 66  HOH C O   1 
HETATM 2561 O O   . HOH G 2 .  ? -33.225 14.689 -2.337  1.00 44.79  ? 68  HOH C O   1 
HETATM 2562 O O   . HOH G 2 .  ? -43.784 12.505 -10.072 1.00 58.65  ? 69  HOH C O   1 
HETATM 2563 O O   . HOH G 2 .  ? -9.064  13.327 32.028  1.00 71.80  ? 79  HOH C O   1 
HETATM 2564 O O   . HOH G 2 .  ? -14.060 1.977  39.637  1.00 40.78  ? 82  HOH C O   1 
HETATM 2565 O O   . HOH H 2 .  ? -50.106 -3.179 -12.009 1.00 33.96  ? 6   HOH D O   1 
HETATM 2566 O O   . HOH H 2 .  ? 1.316   13.737 50.399  1.00 46.52  ? 13  HOH D O   1 
HETATM 2567 O O   . HOH H 2 .  ? -14.118 18.042 45.172  1.00 36.25  ? 16  HOH D O   1 
HETATM 2568 O O   . HOH H 2 .  ? 0.978   7.757  51.743  1.00 39.78  ? 31  HOH D O   1 
HETATM 2569 O O   . HOH H 2 .  ? -44.763 -7.143 -15.615 1.00 55.01  ? 39  HOH D O   1 
HETATM 2570 O O   . HOH H 2 .  ? -13.011 22.173 50.999  1.00 40.23  ? 45  HOH D O   1 
HETATM 2571 O O   . HOH H 2 .  ? -44.054 -9.437 -13.624 1.00 68.07  ? 52  HOH D O   1 
HETATM 2572 O O   . HOH H 2 .  ? -42.533 -0.702 -2.934  1.00 44.38  ? 60  HOH D O   1 
HETATM 2573 O O   . HOH H 2 .  ? -8.750  23.060 53.245  1.00 67.01  ? 63  HOH D O   1 
HETATM 2574 O O   . HOH H 2 .  ? -21.801 17.421 20.967  1.00 47.70  ? 64  HOH D O   1 
HETATM 2575 O O   . HOH H 2 .  ? -39.820 9.146  10.032  1.00 45.90  ? 65  HOH D O   1 
HETATM 2576 O O   . HOH H 2 .  ? -52.324 0.128  -7.073  1.00 55.31  ? 70  HOH D O   1 
HETATM 2577 O O   . HOH H 2 .  ? -53.586 2.959  -16.941 1.00 66.30  ? 77  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  831 ?   ?   ?   A . n 
A 1 2  SER 2  832 ?   ?   ?   A . n 
A 1 3  HIS 3  833 ?   ?   ?   A . n 
A 1 4  MET 4  834 ?   ?   ?   A . n 
A 1 5  PRO 5  835 ?   ?   ?   A . n 
A 1 6  LEU 6  836 ?   ?   ?   A . n 
A 1 7  LEU 7  837 ?   ?   ?   A . n 
A 1 8  SER 8  838 ?   ?   ?   A . n 
A 1 9  ILE 9  839 ?   ?   ?   A . n 
A 1 10 ALA 10 840 ?   ?   ?   A . n 
A 1 11 ARG 11 841 ?   ?   ?   A . n 
A 1 12 GLN 12 842 ?   ?   ?   A . n 
A 1 13 GLU 13 843 ?   ?   ?   A . n 
A 1 14 GLU 14 844 ?   ?   ?   A . n 
A 1 15 GLU 15 845 ?   ?   ?   A . n 
A 1 16 MET 16 846 846 MET MET A . n 
A 1 17 LYS 17 847 847 LYS LYS A . n 
A 1 18 GLU 18 848 848 GLU GLU A . n 
A 1 19 GLN 19 849 849 GLN GLN A . n 
A 1 20 LEU 20 850 850 LEU LEU A . n 
A 1 21 LYS 21 851 851 LYS LYS A . n 
A 1 22 GLN 22 852 852 GLN GLN A . n 
A 1 23 MET 23 853 853 MET MET A . n 
A 1 24 ASP 24 854 854 ASP ASP A . n 
A 1 25 LYS 25 855 855 LYS LYS A . n 
A 1 26 MET 26 856 856 MET MET A . n 
A 1 27 LYS 27 857 857 LYS LYS A . n 
A 1 28 GLU 28 858 858 GLU GLU A . n 
A 1 29 ASP 29 859 859 ASP ASP A . n 
A 1 30 LEU 30 860 860 LEU LEU A . n 
A 1 31 ALA 31 861 861 ALA ALA A . n 
A 1 32 LYS 32 862 862 LYS LYS A . n 
A 1 33 THR 33 863 863 THR THR A . n 
A 1 34 GLU 34 864 864 GLU GLU A . n 
A 1 35 ARG 35 865 865 ARG ARG A . n 
A 1 36 ILE 36 866 866 ILE ILE A . n 
A 1 37 LYS 37 867 867 LYS LYS A . n 
A 1 38 LYS 38 868 868 LYS LYS A . n 
A 1 39 GLU 39 869 869 GLU GLU A . n 
A 1 40 LEU 40 870 870 LEU LEU A . n 
A 1 41 GLU 41 871 871 GLU GLU A . n 
A 1 42 GLU 42 872 872 GLU GLU A . n 
A 1 43 GLN 43 873 873 GLN GLN A . n 
A 1 44 ASN 44 874 874 ASN ASN A . n 
A 1 45 VAL 45 875 875 VAL VAL A . n 
A 1 46 THR 46 876 876 THR THR A . n 
A 1 47 LEU 47 877 877 LEU LEU A . n 
A 1 48 LEU 48 878 878 LEU LEU A . n 
A 1 49 GLU 49 879 879 GLU GLU A . n 
A 1 50 GLN 50 880 880 GLN GLN A . n 
A 1 51 LYS 51 881 881 LYS LYS A . n 
A 1 52 ASN 52 882 882 ASN ASN A . n 
A 1 53 ASP 53 883 883 ASP ASP A . n 
A 1 54 LEU 54 884 884 LEU LEU A . n 
A 1 55 PHE 55 885 885 PHE PHE A . n 
A 1 56 GLY 56 886 886 GLY GLY A . n 
A 1 57 SER 57 887 887 SER SER A . n 
A 1 58 MET 58 888 888 MET MET A . n 
A 1 59 LYS 59 889 889 LYS LYS A . n 
A 1 60 GLN 60 890 890 GLN GLN A . n 
A 1 61 LEU 61 891 891 LEU LEU A . n 
A 1 62 GLU 62 892 892 GLU GLU A . n 
A 1 63 ASP 63 893 893 ASP ASP A . n 
A 1 64 LYS 64 894 894 LYS LYS A . n 
A 1 65 VAL 65 895 895 VAL VAL A . n 
A 1 66 GLU 66 896 896 GLU GLU A . n 
A 1 67 GLU 67 897 897 GLU GLU A . n 
A 1 68 LEU 68 898 898 LEU LEU A . n 
A 1 69 LEU 69 899 899 LEU LEU A . n 
A 1 70 SER 70 900 900 SER SER A . n 
A 1 71 LYS 71 901 901 LYS LYS A . n 
A 1 72 ASN 72 902 902 ASN ASN A . n 
A 1 73 TYR 73 903 903 TYR TYR A . n 
A 1 74 HIS 74 904 904 HIS HIS A . n 
A 1 75 LEU 75 905 905 LEU LEU A . n 
A 1 76 GLU 76 906 906 GLU GLU A . n 
A 1 77 ASN 77 907 907 ASN ASN A . n 
A 1 78 GLU 78 908 908 GLU GLU A . n 
A 1 79 VAL 79 909 909 VAL VAL A . n 
A 1 80 ALA 80 910 910 ALA ALA A . n 
A 1 81 ARG 81 911 911 ARG ARG A . n 
A 1 82 LEU 82 912 912 LEU LEU A . n 
A 1 83 LYS 83 913 913 LYS LYS A . n 
A 1 84 LYS 84 914 914 LYS LYS A . n 
A 1 85 LEU 85 915 915 LEU LEU A . n 
A 1 86 VAL 86 916 916 VAL VAL A . n 
A 1 87 GLY 87 917 917 GLY GLY A . n 
A 1 88 GLU 88 918 918 GLU GLU A . n 
A 1 89 ARG 89 919 919 ARG GLY A . n 
B 1 1  GLY 1  831 ?   ?   ?   B . n 
B 1 2  SER 2  832 ?   ?   ?   B . n 
B 1 3  HIS 3  833 ?   ?   ?   B . n 
B 1 4  MET 4  834 ?   ?   ?   B . n 
B 1 5  PRO 5  835 ?   ?   ?   B . n 
B 1 6  LEU 6  836 ?   ?   ?   B . n 
B 1 7  LEU 7  837 ?   ?   ?   B . n 
B 1 8  SER 8  838 ?   ?   ?   B . n 
B 1 9  ILE 9  839 ?   ?   ?   B . n 
B 1 10 ALA 10 840 ?   ?   ?   B . n 
B 1 11 ARG 11 841 ?   ?   ?   B . n 
B 1 12 GLN 12 842 ?   ?   ?   B . n 
B 1 13 GLU 13 843 843 GLU GLU B . n 
B 1 14 GLU 14 844 844 GLU GLU B . n 
B 1 15 GLU 15 845 845 GLU GLU B . n 
B 1 16 MET 16 846 846 MET MET B . n 
B 1 17 LYS 17 847 847 LYS LYS B . n 
B 1 18 GLU 18 848 848 GLU GLU B . n 
B 1 19 GLN 19 849 849 GLN GLN B . n 
B 1 20 LEU 20 850 850 LEU LEU B . n 
B 1 21 LYS 21 851 851 LYS LYS B . n 
B 1 22 GLN 22 852 852 GLN GLN B . n 
B 1 23 MET 23 853 853 MET MET B . n 
B 1 24 ASP 24 854 854 ASP ASP B . n 
B 1 25 LYS 25 855 855 LYS LYS B . n 
B 1 26 MET 26 856 856 MET MET B . n 
B 1 27 LYS 27 857 857 LYS LYS B . n 
B 1 28 GLU 28 858 858 GLU GLU B . n 
B 1 29 ASP 29 859 859 ASP ASP B . n 
B 1 30 LEU 30 860 860 LEU LEU B . n 
B 1 31 ALA 31 861 861 ALA ALA B . n 
B 1 32 LYS 32 862 862 LYS LYS B . n 
B 1 33 THR 33 863 863 THR THR B . n 
B 1 34 GLU 34 864 864 GLU GLU B . n 
B 1 35 ARG 35 865 865 ARG ARG B . n 
B 1 36 ILE 36 866 866 ILE ILE B . n 
B 1 37 LYS 37 867 867 LYS LYS B . n 
B 1 38 LYS 38 868 868 LYS LYS B . n 
B 1 39 GLU 39 869 869 GLU GLU B . n 
B 1 40 LEU 40 870 870 LEU LEU B . n 
B 1 41 GLU 41 871 871 GLU GLU B . n 
B 1 42 GLU 42 872 872 GLU GLU B . n 
B 1 43 GLN 43 873 873 GLN GLN B . n 
B 1 44 ASN 44 874 874 ASN ASN B . n 
B 1 45 VAL 45 875 875 VAL VAL B . n 
B 1 46 THR 46 876 876 THR THR B . n 
B 1 47 LEU 47 877 877 LEU LEU B . n 
B 1 48 LEU 48 878 878 LEU LEU B . n 
B 1 49 GLU 49 879 879 GLU GLU B . n 
B 1 50 GLN 50 880 880 GLN GLN B . n 
B 1 51 LYS 51 881 881 LYS LYS B . n 
B 1 52 ASN 52 882 882 ASN ASN B . n 
B 1 53 ASP 53 883 883 ASP ASP B . n 
B 1 54 LEU 54 884 884 LEU LEU B . n 
B 1 55 PHE 55 885 885 PHE PHE B . n 
B 1 56 GLY 56 886 886 GLY GLY B . n 
B 1 57 SER 57 887 887 SER SER B . n 
B 1 58 MET 58 888 888 MET MET B . n 
B 1 59 LYS 59 889 889 LYS LYS B . n 
B 1 60 GLN 60 890 890 GLN GLN B . n 
B 1 61 LEU 61 891 891 LEU LEU B . n 
B 1 62 GLU 62 892 892 GLU GLU B . n 
B 1 63 ASP 63 893 893 ASP ASP B . n 
B 1 64 LYS 64 894 894 LYS LYS B . n 
B 1 65 VAL 65 895 895 VAL VAL B . n 
B 1 66 GLU 66 896 896 GLU GLU B . n 
B 1 67 GLU 67 897 897 GLU GLU B . n 
B 1 68 LEU 68 898 898 LEU LEU B . n 
B 1 69 LEU 69 899 899 LEU LEU B . n 
B 1 70 SER 70 900 900 SER SER B . n 
B 1 71 LYS 71 901 901 LYS LYS B . n 
B 1 72 ASN 72 902 902 ASN ASN B . n 
B 1 73 TYR 73 903 903 TYR TYR B . n 
B 1 74 HIS 74 904 904 HIS HIS B . n 
B 1 75 LEU 75 905 905 LEU LEU B . n 
B 1 76 GLU 76 906 906 GLU GLU B . n 
B 1 77 ASN 77 907 907 ASN ASN B . n 
B 1 78 GLU 78 908 908 GLU GLU B . n 
B 1 79 VAL 79 909 909 VAL VAL B . n 
B 1 80 ALA 80 910 910 ALA ALA B . n 
B 1 81 ARG 81 911 911 ARG ARG B . n 
B 1 82 LEU 82 912 912 LEU LEU B . n 
B 1 83 LYS 83 913 913 LYS LYS B . n 
B 1 84 LYS 84 914 914 LYS LYS B . n 
B 1 85 LEU 85 915 915 LEU LEU B . n 
B 1 86 VAL 86 916 916 VAL VAL B . n 
B 1 87 GLY 87 917 917 GLY GLY B . n 
B 1 88 GLU 88 918 918 GLU GLU B . n 
B 1 89 ARG 89 919 ?   ?   ?   B . n 
C 1 1  GLY 1  831 ?   ?   ?   C . n 
C 1 2  SER 2  832 ?   ?   ?   C . n 
C 1 3  HIS 3  833 ?   ?   ?   C . n 
C 1 4  MET 4  834 ?   ?   ?   C . n 
C 1 5  PRO 5  835 ?   ?   ?   C . n 
C 1 6  LEU 6  836 ?   ?   ?   C . n 
C 1 7  LEU 7  837 ?   ?   ?   C . n 
C 1 8  SER 8  838 ?   ?   ?   C . n 
C 1 9  ILE 9  839 ?   ?   ?   C . n 
C 1 10 ALA 10 840 ?   ?   ?   C . n 
C 1 11 ARG 11 841 ?   ?   ?   C . n 
C 1 12 GLN 12 842 ?   ?   ?   C . n 
C 1 13 GLU 13 843 ?   ?   ?   C . n 
C 1 14 GLU 14 844 ?   ?   ?   C . n 
C 1 15 GLU 15 845 845 GLU GLU C . n 
C 1 16 MET 16 846 846 MET MET C . n 
C 1 17 LYS 17 847 847 LYS LYS C . n 
C 1 18 GLU 18 848 848 GLU GLU C . n 
C 1 19 GLN 19 849 849 GLN GLN C . n 
C 1 20 LEU 20 850 850 LEU LEU C . n 
C 1 21 LYS 21 851 851 LYS LYS C . n 
C 1 22 GLN 22 852 852 GLN GLN C . n 
C 1 23 MET 23 853 853 MET MET C . n 
C 1 24 ASP 24 854 854 ASP ASP C . n 
C 1 25 LYS 25 855 855 LYS LYS C . n 
C 1 26 MET 26 856 856 MET MET C . n 
C 1 27 LYS 27 857 857 LYS LYS C . n 
C 1 28 GLU 28 858 858 GLU GLU C . n 
C 1 29 ASP 29 859 859 ASP ASP C . n 
C 1 30 LEU 30 860 860 LEU LEU C . n 
C 1 31 ALA 31 861 861 ALA ALA C . n 
C 1 32 LYS 32 862 862 LYS LYS C . n 
C 1 33 THR 33 863 863 THR THR C . n 
C 1 34 GLU 34 864 864 GLU GLU C . n 
C 1 35 ARG 35 865 865 ARG ARG C . n 
C 1 36 ILE 36 866 866 ILE ILE C . n 
C 1 37 LYS 37 867 867 LYS LYS C . n 
C 1 38 LYS 38 868 868 LYS LYS C . n 
C 1 39 GLU 39 869 869 GLU GLU C . n 
C 1 40 LEU 40 870 870 LEU LEU C . n 
C 1 41 GLU 41 871 871 GLU GLU C . n 
C 1 42 GLU 42 872 872 GLU GLU C . n 
C 1 43 GLN 43 873 873 GLN GLN C . n 
C 1 44 ASN 44 874 874 ASN ASN C . n 
C 1 45 VAL 45 875 875 VAL VAL C . n 
C 1 46 THR 46 876 876 THR THR C . n 
C 1 47 LEU 47 877 877 LEU LEU C . n 
C 1 48 LEU 48 878 878 LEU LEU C . n 
C 1 49 GLU 49 879 879 GLU GLU C . n 
C 1 50 GLN 50 880 880 GLN GLN C . n 
C 1 51 LYS 51 881 881 LYS LYS C . n 
C 1 52 ASN 52 882 882 ASN ASN C . n 
C 1 53 ASP 53 883 883 ASP ASP C . n 
C 1 54 LEU 54 884 884 LEU LEU C . n 
C 1 55 PHE 55 885 885 PHE PHE C . n 
C 1 56 GLY 56 886 886 GLY GLY C . n 
C 1 57 SER 57 887 887 SER SER C . n 
C 1 58 MET 58 888 888 MET MET C . n 
C 1 59 LYS 59 889 889 LYS LYS C . n 
C 1 60 GLN 60 890 890 GLN GLN C . n 
C 1 61 LEU 61 891 891 LEU LEU C . n 
C 1 62 GLU 62 892 892 GLU GLU C . n 
C 1 63 ASP 63 893 893 ASP ASP C . n 
C 1 64 LYS 64 894 894 LYS LYS C . n 
C 1 65 VAL 65 895 895 VAL VAL C . n 
C 1 66 GLU 66 896 896 GLU GLU C . n 
C 1 67 GLU 67 897 897 GLU GLU C . n 
C 1 68 LEU 68 898 898 LEU LEU C . n 
C 1 69 LEU 69 899 899 LEU LEU C . n 
C 1 70 SER 70 900 900 SER SER C . n 
C 1 71 LYS 71 901 901 LYS LYS C . n 
C 1 72 ASN 72 902 902 ASN ASN C . n 
C 1 73 TYR 73 903 903 TYR TYR C . n 
C 1 74 HIS 74 904 904 HIS HIS C . n 
C 1 75 LEU 75 905 905 LEU LEU C . n 
C 1 76 GLU 76 906 906 GLU GLU C . n 
C 1 77 ASN 77 907 907 ASN ASN C . n 
C 1 78 GLU 78 908 908 GLU GLU C . n 
C 1 79 VAL 79 909 909 VAL VAL C . n 
C 1 80 ALA 80 910 910 ALA ALA C . n 
C 1 81 ARG 81 911 911 ARG ARG C . n 
C 1 82 LEU 82 912 912 LEU LEU C . n 
C 1 83 LYS 83 913 913 LYS LYS C . n 
C 1 84 LYS 84 914 914 LYS LYS C . n 
C 1 85 LEU 85 915 915 LEU LEU C . n 
C 1 86 VAL 86 916 916 VAL VAL C . n 
C 1 87 GLY 87 917 917 GLY GLY C . n 
C 1 88 GLU 88 918 918 GLU GLU C . n 
C 1 89 ARG 89 919 919 ARG GLY C . n 
D 1 1  GLY 1  831 ?   ?   ?   D . n 
D 1 2  SER 2  832 ?   ?   ?   D . n 
D 1 3  HIS 3  833 ?   ?   ?   D . n 
D 1 4  MET 4  834 ?   ?   ?   D . n 
D 1 5  PRO 5  835 ?   ?   ?   D . n 
D 1 6  LEU 6  836 ?   ?   ?   D . n 
D 1 7  LEU 7  837 ?   ?   ?   D . n 
D 1 8  SER 8  838 ?   ?   ?   D . n 
D 1 9  ILE 9  839 ?   ?   ?   D . n 
D 1 10 ALA 10 840 ?   ?   ?   D . n 
D 1 11 ARG 11 841 ?   ?   ?   D . n 
D 1 12 GLN 12 842 ?   ?   ?   D . n 
D 1 13 GLU 13 843 843 GLU GLU D . n 
D 1 14 GLU 14 844 844 GLU GLU D . n 
D 1 15 GLU 15 845 845 GLU GLU D . n 
D 1 16 MET 16 846 846 MET MET D . n 
D 1 17 LYS 17 847 847 LYS LYS D . n 
D 1 18 GLU 18 848 848 GLU GLU D . n 
D 1 19 GLN 19 849 849 GLN GLN D . n 
D 1 20 LEU 20 850 850 LEU LEU D . n 
D 1 21 LYS 21 851 851 LYS LYS D . n 
D 1 22 GLN 22 852 852 GLN GLN D . n 
D 1 23 MET 23 853 853 MET MET D . n 
D 1 24 ASP 24 854 854 ASP ASP D . n 
D 1 25 LYS 25 855 855 LYS LYS D . n 
D 1 26 MET 26 856 856 MET MET D . n 
D 1 27 LYS 27 857 857 LYS LYS D . n 
D 1 28 GLU 28 858 858 GLU GLU D . n 
D 1 29 ASP 29 859 859 ASP ASP D . n 
D 1 30 LEU 30 860 860 LEU LEU D . n 
D 1 31 ALA 31 861 861 ALA ALA D . n 
D 1 32 LYS 32 862 862 LYS LYS D . n 
D 1 33 THR 33 863 863 THR THR D . n 
D 1 34 GLU 34 864 864 GLU GLU D . n 
D 1 35 ARG 35 865 865 ARG ARG D . n 
D 1 36 ILE 36 866 866 ILE ILE D . n 
D 1 37 LYS 37 867 867 LYS LYS D . n 
D 1 38 LYS 38 868 868 LYS LYS D . n 
D 1 39 GLU 39 869 869 GLU GLU D . n 
D 1 40 LEU 40 870 870 LEU LEU D . n 
D 1 41 GLU 41 871 871 GLU GLU D . n 
D 1 42 GLU 42 872 872 GLU GLU D . n 
D 1 43 GLN 43 873 873 GLN GLN D . n 
D 1 44 ASN 44 874 874 ASN ASN D . n 
D 1 45 VAL 45 875 875 VAL VAL D . n 
D 1 46 THR 46 876 876 THR THR D . n 
D 1 47 LEU 47 877 877 LEU LEU D . n 
D 1 48 LEU 48 878 878 LEU LEU D . n 
D 1 49 GLU 49 879 879 GLU GLU D . n 
D 1 50 GLN 50 880 880 GLN GLN D . n 
D 1 51 LYS 51 881 881 LYS LYS D . n 
D 1 52 ASN 52 882 882 ASN ASN D . n 
D 1 53 ASP 53 883 883 ASP ASP D . n 
D 1 54 LEU 54 884 884 LEU LEU D . n 
D 1 55 PHE 55 885 885 PHE PHE D . n 
D 1 56 GLY 56 886 886 GLY GLY D . n 
D 1 57 SER 57 887 887 SER SER D . n 
D 1 58 MET 58 888 888 MET MET D . n 
D 1 59 LYS 59 889 889 LYS LYS D . n 
D 1 60 GLN 60 890 890 GLN GLN D . n 
D 1 61 LEU 61 891 891 LEU LEU D . n 
D 1 62 GLU 62 892 892 GLU GLU D . n 
D 1 63 ASP 63 893 893 ASP ASP D . n 
D 1 64 LYS 64 894 894 LYS LYS D . n 
D 1 65 VAL 65 895 895 VAL VAL D . n 
D 1 66 GLU 66 896 896 GLU GLU D . n 
D 1 67 GLU 67 897 897 GLU GLU D . n 
D 1 68 LEU 68 898 898 LEU LEU D . n 
D 1 69 LEU 69 899 899 LEU LEU D . n 
D 1 70 SER 70 900 900 SER SER D . n 
D 1 71 LYS 71 901 901 LYS LYS D . n 
D 1 72 ASN 72 902 902 ASN ASN D . n 
D 1 73 TYR 73 903 903 TYR TYR D . n 
D 1 74 HIS 74 904 904 HIS HIS D . n 
D 1 75 LEU 75 905 905 LEU LEU D . n 
D 1 76 GLU 76 906 906 GLU GLU D . n 
D 1 77 ASN 77 907 907 ASN ASN D . n 
D 1 78 GLU 78 908 908 GLU GLU D . n 
D 1 79 VAL 79 909 909 VAL VAL D . n 
D 1 80 ALA 80 910 910 ALA ALA D . n 
D 1 81 ARG 81 911 911 ARG ARG D . n 
D 1 82 LEU 82 912 912 LEU LEU D . n 
D 1 83 LYS 83 913 913 LYS LYS D . n 
D 1 84 LYS 84 914 914 LYS LYS D . n 
D 1 85 LEU 85 915 915 LEU LEU D . n 
D 1 86 VAL 86 916 916 VAL VAL D . n 
D 1 87 GLY 87 917 917 GLY GLY D . n 
D 1 88 GLU 88 918 918 GLU GLU D . n 
D 1 89 ARG 89 919 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3920  ? 
1 MORE         -47   ? 
1 'SSA (A^2)'  11150 ? 
2 'ABSA (A^2)' 4050  ? 
2 MORE         -46   ? 
2 'SSA (A^2)'  11070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-07-22 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
AN APPROPRIATE SEQUENCE DATABASE REFERENCE WAS NOT AVAILABLE AT THE TIME OF PROCESSING. 
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU C 918 ? ? -155.00 -48.99 
2 1 GLU D 844 ? ? -44.48  -8.74  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 919 ? CB  ? A ARG 89 CB  
2  1 Y 1 A ARG 919 ? CG  ? A ARG 89 CG  
3  1 Y 1 A ARG 919 ? CD  ? A ARG 89 CD  
4  1 Y 1 A ARG 919 ? NE  ? A ARG 89 NE  
5  1 Y 1 A ARG 919 ? CZ  ? A ARG 89 CZ  
6  1 Y 1 A ARG 919 ? NH1 ? A ARG 89 NH1 
7  1 Y 1 A ARG 919 ? NH2 ? A ARG 89 NH2 
8  1 Y 1 C ARG 919 ? CB  ? C ARG 89 CB  
9  1 Y 1 C ARG 919 ? CG  ? C ARG 89 CG  
10 1 Y 1 C ARG 919 ? CD  ? C ARG 89 CD  
11 1 Y 1 C ARG 919 ? NE  ? C ARG 89 NE  
12 1 Y 1 C ARG 919 ? CZ  ? C ARG 89 CZ  
13 1 Y 1 C ARG 919 ? NH1 ? C ARG 89 NH1 
14 1 Y 1 C ARG 919 ? NH2 ? C ARG 89 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 831 ? A GLY 1  
2  1 Y 1 A SER 832 ? A SER 2  
3  1 Y 1 A HIS 833 ? A HIS 3  
4  1 Y 1 A MET 834 ? A MET 4  
5  1 Y 1 A PRO 835 ? A PRO 5  
6  1 Y 1 A LEU 836 ? A LEU 6  
7  1 Y 1 A LEU 837 ? A LEU 7  
8  1 Y 1 A SER 838 ? A SER 8  
9  1 Y 1 A ILE 839 ? A ILE 9  
10 1 Y 1 A ALA 840 ? A ALA 10 
11 1 Y 1 A ARG 841 ? A ARG 11 
12 1 Y 1 A GLN 842 ? A GLN 12 
13 1 Y 1 A GLU 843 ? A GLU 13 
14 1 Y 1 A GLU 844 ? A GLU 14 
15 1 Y 1 A GLU 845 ? A GLU 15 
16 1 Y 1 B GLY 831 ? B GLY 1  
17 1 Y 1 B SER 832 ? B SER 2  
18 1 Y 1 B HIS 833 ? B HIS 3  
19 1 Y 1 B MET 834 ? B MET 4  
20 1 Y 1 B PRO 835 ? B PRO 5  
21 1 Y 1 B LEU 836 ? B LEU 6  
22 1 Y 1 B LEU 837 ? B LEU 7  
23 1 Y 1 B SER 838 ? B SER 8  
24 1 Y 1 B ILE 839 ? B ILE 9  
25 1 Y 1 B ALA 840 ? B ALA 10 
26 1 Y 1 B ARG 841 ? B ARG 11 
27 1 Y 1 B GLN 842 ? B GLN 12 
28 1 Y 1 B ARG 919 ? B ARG 89 
29 1 Y 1 C GLY 831 ? C GLY 1  
30 1 Y 1 C SER 832 ? C SER 2  
31 1 Y 1 C HIS 833 ? C HIS 3  
32 1 Y 1 C MET 834 ? C MET 4  
33 1 Y 1 C PRO 835 ? C PRO 5  
34 1 Y 1 C LEU 836 ? C LEU 6  
35 1 Y 1 C LEU 837 ? C LEU 7  
36 1 Y 1 C SER 838 ? C SER 8  
37 1 Y 1 C ILE 839 ? C ILE 9  
38 1 Y 1 C ALA 840 ? C ALA 10 
39 1 Y 1 C ARG 841 ? C ARG 11 
40 1 Y 1 C GLN 842 ? C GLN 12 
41 1 Y 1 C GLU 843 ? C GLU 13 
42 1 Y 1 C GLU 844 ? C GLU 14 
43 1 Y 1 D GLY 831 ? D GLY 1  
44 1 Y 1 D SER 832 ? D SER 2  
45 1 Y 1 D HIS 833 ? D HIS 3  
46 1 Y 1 D MET 834 ? D MET 4  
47 1 Y 1 D PRO 835 ? D PRO 5  
48 1 Y 1 D LEU 836 ? D LEU 6  
49 1 Y 1 D LEU 837 ? D LEU 7  
50 1 Y 1 D SER 838 ? D SER 8  
51 1 Y 1 D ILE 839 ? D ILE 9  
52 1 Y 1 D ALA 840 ? D ALA 10 
53 1 Y 1 D ARG 841 ? D ARG 11 
54 1 Y 1 D GLN 842 ? D GLN 12 
55 1 Y 1 D ARG 919 ? D ARG 89 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 HOH 1  1  1  HOH HOH A . 
E 2 HOH 2  2  2  HOH HOH A . 
E 2 HOH 3  4  4  HOH HOH A . 
E 2 HOH 4  11 11 HOH HOH A . 
E 2 HOH 5  14 14 HOH HOH A . 
E 2 HOH 6  15 15 HOH HOH A . 
E 2 HOH 7  17 17 HOH HOH A . 
E 2 HOH 8  24 24 HOH HOH A . 
E 2 HOH 9  25 25 HOH HOH A . 
E 2 HOH 10 26 26 HOH HOH A . 
E 2 HOH 11 27 27 HOH HOH A . 
E 2 HOH 12 28 28 HOH HOH A . 
E 2 HOH 13 29 29 HOH HOH A . 
E 2 HOH 14 30 30 HOH HOH A . 
E 2 HOH 15 32 32 HOH HOH A . 
E 2 HOH 16 34 34 HOH HOH A . 
E 2 HOH 17 41 41 HOH HOH A . 
E 2 HOH 18 46 46 HOH HOH A . 
E 2 HOH 19 47 47 HOH HOH A . 
E 2 HOH 20 48 48 HOH HOH A . 
E 2 HOH 21 49 49 HOH HOH A . 
E 2 HOH 22 57 57 HOH HOH A . 
E 2 HOH 23 58 58 HOH HOH A . 
E 2 HOH 24 59 59 HOH HOH A . 
E 2 HOH 25 61 61 HOH HOH A . 
E 2 HOH 26 72 72 HOH HOH A . 
E 2 HOH 27 73 73 HOH HOH A . 
E 2 HOH 28 75 75 HOH HOH A . 
E 2 HOH 29 76 76 HOH HOH A . 
E 2 HOH 30 78 78 HOH HOH A . 
E 2 HOH 31 80 80 HOH HOH A . 
E 2 HOH 32 81 81 HOH HOH A . 
F 2 HOH 1  3  3  HOH HOH B . 
F 2 HOH 2  5  5  HOH HOH B . 
F 2 HOH 3  8  8  HOH HOH B . 
F 2 HOH 4  12 12 HOH HOH B . 
F 2 HOH 5  19 19 HOH HOH B . 
F 2 HOH 6  20 20 HOH HOH B . 
F 2 HOH 7  21 21 HOH HOH B . 
F 2 HOH 8  23 23 HOH HOH B . 
F 2 HOH 9  33 33 HOH HOH B . 
F 2 HOH 10 35 35 HOH HOH B . 
F 2 HOH 11 36 36 HOH HOH B . 
F 2 HOH 12 37 37 HOH HOH B . 
F 2 HOH 13 40 40 HOH HOH B . 
F 2 HOH 14 42 42 HOH HOH B . 
F 2 HOH 15 43 43 HOH HOH B . 
F 2 HOH 16 50 50 HOH HOH B . 
F 2 HOH 17 51 51 HOH HOH B . 
F 2 HOH 18 62 62 HOH HOH B . 
F 2 HOH 19 67 67 HOH HOH B . 
F 2 HOH 20 71 71 HOH HOH B . 
F 2 HOH 21 74 74 HOH HOH B . 
G 2 HOH 1  7  7  HOH HOH C . 
G 2 HOH 2  9  9  HOH HOH C . 
G 2 HOH 3  10 10 HOH HOH C . 
G 2 HOH 4  18 18 HOH HOH C . 
G 2 HOH 5  22 22 HOH HOH C . 
G 2 HOH 6  38 38 HOH HOH C . 
G 2 HOH 7  44 44 HOH HOH C . 
G 2 HOH 8  53 53 HOH HOH C . 
G 2 HOH 9  54 54 HOH HOH C . 
G 2 HOH 10 55 55 HOH HOH C . 
G 2 HOH 11 56 56 HOH HOH C . 
G 2 HOH 12 66 66 HOH HOH C . 
G 2 HOH 13 68 68 HOH HOH C . 
G 2 HOH 14 69 69 HOH HOH C . 
G 2 HOH 15 79 79 HOH HOH C . 
G 2 HOH 16 82 82 HOH HOH C . 
H 2 HOH 1  6  6  HOH HOH D . 
H 2 HOH 2  13 13 HOH HOH D . 
H 2 HOH 3  16 16 HOH HOH D . 
H 2 HOH 4  31 31 HOH HOH D . 
H 2 HOH 5  39 39 HOH HOH D . 
H 2 HOH 6  45 45 HOH HOH D . 
H 2 HOH 7  52 52 HOH HOH D . 
H 2 HOH 8  60 60 HOH HOH D . 
H 2 HOH 9  63 63 HOH HOH D . 
H 2 HOH 10 64 64 HOH HOH D . 
H 2 HOH 11 65 65 HOH HOH D . 
H 2 HOH 12 70 70 HOH HOH D . 
H 2 HOH 13 77 77 HOH HOH D . 
#