data_1NKP
# 
_entry.id   1NKP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NKP         
NDB   PD0386       
RCSB  RCSB017956   
WWPDB D_1000017956 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NKP 
_pdbx_database_status.recvd_initial_deposition_date   2003-01-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nair, S.K.'   1 ?                   
'Burley, S.K.' 2 0000-0002-2487-9713 
# 
_citation.id                        primary 
_citation.title                     
'X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            112 
_citation.page_first                193 
_citation.page_last                 205 
_citation.year                      2003 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12553908 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01284-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nair, S.K.'   1 ?                   
primary 'Burley, S.K.' 2 0000-0002-2487-9713 
# 
_cell.entry_id           1NKP 
_cell.length_a           39.244 
_cell.length_b           45.128 
_cell.length_c           86.484 
_cell.angle_alpha        87.91 
_cell.angle_beta         84.61 
_cell.angle_gamma        71.50 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NKP 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*CP*GP*AP*GP*TP*AP*GP*CP*AP*CP*GP*TP*GP*CP*TP*AP*CP*TP*C)-3'" 5805.760  4   ? ? ?              ? 
2 polymer man 'Myc proto-oncogene protein'                                        10468.156 2   ? ? 'bHLHZ region' ? 
3 polymer man 'Max protein'                                                       9795.012  2   ? ? 'bHLHZ region' ? 
4 water   nat water                                                               18.015    581 ? ? ?              ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        c-myc 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DG)(DA)(DG)(DT)(DA)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DT)(DA)(DC)(DT)(DC)'              
CGAGTAGCACGTGCTACTC                                                                         F,G,H,J ? 
2 'polypeptide(L)'        no no 
;GHMNVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKH
KLEQLGGC
;
;GHMNVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKH
KLEQLGGC
;
A,D     ? 
3 'polypeptide(L)'        no no 
;DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRAL
GGC
;
;DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRAL
GGC
;
B,E     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DC  n 
1 2  DG  n 
1 3  DA  n 
1 4  DG  n 
1 5  DT  n 
1 6  DA  n 
1 7  DG  n 
1 8  DC  n 
1 9  DA  n 
1 10 DC  n 
1 11 DG  n 
1 12 DT  n 
1 13 DG  n 
1 14 DC  n 
1 15 DT  n 
1 16 DA  n 
1 17 DC  n 
1 18 DT  n 
1 19 DC  n 
2 1  GLY n 
2 2  HIS n 
2 3  MET n 
2 4  ASN n 
2 5  VAL n 
2 6  LYS n 
2 7  ARG n 
2 8  ARG n 
2 9  THR n 
2 10 HIS n 
2 11 ASN n 
2 12 VAL n 
2 13 LEU n 
2 14 GLU n 
2 15 ARG n 
2 16 GLN n 
2 17 ARG n 
2 18 ARG n 
2 19 ASN n 
2 20 GLU n 
2 21 LEU n 
2 22 LYS n 
2 23 ARG n 
2 24 SER n 
2 25 PHE n 
2 26 PHE n 
2 27 ALA n 
2 28 LEU n 
2 29 ARG n 
2 30 ASP n 
2 31 GLN n 
2 32 ILE n 
2 33 PRO n 
2 34 GLU n 
2 35 LEU n 
2 36 GLU n 
2 37 ASN n 
2 38 ASN n 
2 39 GLU n 
2 40 LYS n 
2 41 ALA n 
2 42 PRO n 
2 43 LYS n 
2 44 VAL n 
2 45 VAL n 
2 46 ILE n 
2 47 LEU n 
2 48 LYS n 
2 49 LYS n 
2 50 ALA n 
2 51 THR n 
2 52 ALA n 
2 53 TYR n 
2 54 ILE n 
2 55 LEU n 
2 56 SER n 
2 57 VAL n 
2 58 GLN n 
2 59 ALA n 
2 60 GLU n 
2 61 GLU n 
2 62 GLN n 
2 63 LYS n 
2 64 LEU n 
2 65 ILE n 
2 66 SER n 
2 67 GLU n 
2 68 GLU n 
2 69 ASP n 
2 70 LEU n 
2 71 LEU n 
2 72 ARG n 
2 73 LYS n 
2 74 ARG n 
2 75 ARG n 
2 76 GLU n 
2 77 GLN n 
2 78 LEU n 
2 79 LYS n 
2 80 HIS n 
2 81 LYS n 
2 82 LEU n 
2 83 GLU n 
2 84 GLN n 
2 85 LEU n 
2 86 GLY n 
2 87 GLY n 
2 88 CYS n 
3 1  ASP n 
3 2  LYS n 
3 3  ARG n 
3 4  ALA n 
3 5  HIS n 
3 6  HIS n 
3 7  ASN n 
3 8  ALA n 
3 9  LEU n 
3 10 GLU n 
3 11 ARG n 
3 12 LYS n 
3 13 ARG n 
3 14 ARG n 
3 15 ASP n 
3 16 HIS n 
3 17 ILE n 
3 18 LYS n 
3 19 ASP n 
3 20 SER n 
3 21 PHE n 
3 22 HIS n 
3 23 SER n 
3 24 LEU n 
3 25 ARG n 
3 26 ASP n 
3 27 SER n 
3 28 VAL n 
3 29 PRO n 
3 30 SER n 
3 31 LEU n 
3 32 GLN n 
3 33 GLY n 
3 34 GLU n 
3 35 LYS n 
3 36 ALA n 
3 37 SER n 
3 38 ARG n 
3 39 ALA n 
3 40 GLN n 
3 41 ILE n 
3 42 LEU n 
3 43 ASP n 
3 44 LYS n 
3 45 ALA n 
3 46 THR n 
3 47 GLU n 
3 48 TYR n 
3 49 ILE n 
3 50 GLN n 
3 51 TYR n 
3 52 MET n 
3 53 ARG n 
3 54 ARG n 
3 55 LYS n 
3 56 ASN n 
3 57 HIS n 
3 58 THR n 
3 59 HIS n 
3 60 GLN n 
3 61 GLN n 
3 62 ASP n 
3 63 ILE n 
3 64 ASP n 
3 65 ASP n 
3 66 LEU n 
3 67 LYS n 
3 68 ARG n 
3 69 GLN n 
3 70 ASN n 
3 71 ALA n 
3 72 LEU n 
3 73 LEU n 
3 74 GLU n 
3 75 GLN n 
3 76 GLN n 
3 77 VAL n 
3 78 ARG n 
3 79 ALA n 
3 80 LEU n 
3 81 GLY n 
3 82 GLY n 
3 83 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
2 1 sample ? ? ? human Homo Myc ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid pET     ? ? ? ? ? 
3 1 sample ? ? ? human Homo Max ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid 'pET 3' ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MYC_HUMAN 2 
;NVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLE
QL
;
353 P01106 ? 
2 UNP MAX_HUMAN 3 
;DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRAL

;
23  P61244 ? 
3 PDB 1NKP      1 ?                                                                                     ?   1NKP   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NKP A 4 ? 85 ? P01106 353 ? 434 ? 900 981 
2 1 1NKP D 4 ? 85 ? P01106 353 ? 434 ? 500 581 
3 2 1NKP B 1 ? 80 ? P61244 23  ? 102 ? 202 281 
4 2 1NKP E 1 ? 80 ? P61244 23  ? 102 ? 702 781 
5 3 1NKP F 1 ? 19 ? 1NKP   101 ? 119 ? 101 119 
6 3 1NKP G 1 ? 19 ? 1NKP   301 ? 319 ? 301 319 
7 3 1NKP H 1 ? 19 ? 1NKP   601 ? 619 ? 601 619 
8 3 1NKP J 1 ? 19 ? 1NKP   801 ? 819 ? 801 819 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1NKP GLY A 1  ? UNP P01106 ? ? 'cloning artifact' 897 1  
1 1NKP HIS A 2  ? UNP P01106 ? ? 'cloning artifact' 898 2  
1 1NKP MET A 3  ? UNP P01106 ? ? 'cloning artifact' 899 3  
1 1NKP GLY A 86 ? UNP P01106 ? ? insertion          982 4  
1 1NKP GLY A 87 ? UNP P01106 ? ? insertion          983 5  
1 1NKP CYS A 88 ? UNP P01106 ? ? insertion          984 6  
2 1NKP GLY D 1  ? UNP P01106 ? ? 'cloning artifact' 497 7  
2 1NKP HIS D 2  ? UNP P01106 ? ? 'cloning artifact' 498 8  
2 1NKP MET D 3  ? UNP P01106 ? ? 'cloning artifact' 499 9  
2 1NKP GLY D 86 ? UNP P01106 ? ? insertion          582 10 
2 1NKP GLY D 87 ? UNP P01106 ? ? insertion          583 11 
2 1NKP CYS D 88 ? UNP P01106 ? ? insertion          584 12 
3 1NKP GLY B 81 ? UNP P61244 ? ? insertion          282 13 
3 1NKP GLY B 82 ? UNP P61244 ? ? insertion          283 14 
3 1NKP CYS B 83 ? UNP P61244 ? ? insertion          284 15 
4 1NKP GLY E 81 ? UNP P61244 ? ? insertion          782 16 
4 1NKP GLY E 82 ? UNP P61244 ? ? insertion          783 17 
4 1NKP CYS E 83 ? UNP P61244 ? ? insertion          784 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1NKP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.density_percent_sol   44.95 
_exptl_crystal.description           ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 '3-7% PEG 4000'                 ? ? ? 
1 2 1 '30% methyl pentane diol'       ? ? ? 
1 3 1 '1MM cobalt hexamine chloride'  ? ? ? 
1 4 1 '50MM sodium cacodylate pH 6.5' ? ? ? 
1 5 2 'PEG 4000'                      ? ? ? 
1 6 2 'methyl pentane diol'           ? ? ? 
1 7 2 'cobalt hexamine chloride'      ? ? ? 
1 8 2 'sodium cacodylate pH 6.5'      ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.91 
# 
_reflns.entry_id                     1NKP 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   4.0 
_reflns.d_resolution_high            1.8 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   ? 
_reflns.number_obs                   49228 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            0.053 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1NKP 
_refine.ls_d_res_high                            1.8 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     49228 
_refine.ls_number_reflns_obs                     40874 
_refine.ls_number_reflns_R_free                  4123 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'Phased translation search' 
_refine.pdbx_starting_model                      'PDB ENTRY 1AN2' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.674 
_refine.aniso_B[1][2]                            -1.363 
_refine.aniso_B[1][3]                            -2.839 
_refine.aniso_B[2][2]                            6.300 
_refine.aniso_B[2][3]                            -7.378 
_refine.aniso_B[3][3]                            -5.627 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2785 
_refine_hist.pdbx_number_atoms_nucleic_acid   1540 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             581 
_refine_hist.number_atoms_total               4906 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d  0.0048  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d 0.94736 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 water_rep.param   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1NKP 
_struct.title                     'Crystal structure of Myc-Max recognizing DNA' 
_struct.pdbx_descriptor           'Myc proto-oncogene protein/Max protein/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NKP 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'TRANSCRIPTION, DNA, bHLHZ, oncogene, heterodimer, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY E 1  ? ASP E 30 ? GLY A 897 ASP A 926 1 ? 30 
HELX_P HELX_P2  2  GLN E 31 ? GLU E 36 ? GLN A 927 GLU A 932 5 ? 6  
HELX_P HELX_P3  3  PRO E 42 ? GLY E 86 ? PRO A 938 GLY A 982 1 ? 45 
HELX_P HELX_P4  4  ASP F 1  ? ASP F 26 ? ASP B 202 ASP B 227 1 ? 26 
HELX_P HELX_P5  5  SER F 27 ? GLN F 32 ? SER B 228 GLN B 233 5 ? 6  
HELX_P HELX_P6  6  SER F 37 ? ALA F 79 ? SER B 238 ALA B 280 1 ? 43 
HELX_P HELX_P7  7  MET G 3  ? ASP G 30 ? MET D 499 ASP D 526 1 ? 28 
HELX_P HELX_P8  8  GLN G 31 ? GLU G 36 ? GLN D 527 GLU D 532 5 ? 6  
HELX_P HELX_P9  9  PRO G 42 ? LEU G 85 ? PRO D 538 LEU D 581 1 ? 44 
HELX_P HELX_P10 10 ARG H 3  ? ASP H 26 ? ARG E 704 ASP E 727 1 ? 24 
HELX_P HELX_P11 11 SER H 27 ? GLN H 32 ? SER E 728 GLN E 733 5 ? 6  
HELX_P HELX_P12 12 SER H 37 ? ALA H 79 ? SER E 738 ALA E 780 1 ? 43 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 19 N3 ? ? F DG 102 G DC 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 19 O2 ? ? F DG 102 G DC 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 19 N4 ? ? F DG 102 G DC 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 18 N3 ? ? F DA 103 G DT 318 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 18 O4 ? ? F DA 103 G DT 318 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC 17 N3 ? ? F DG 104 G DC 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC 17 O2 ? ? F DG 104 G DC 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC 17 N4 ? ? F DG 104 G DC 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 16 N1 ? ? F DT 105 G DA 316 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 16 N6 ? ? F DT 105 G DA 316 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT 15 N3 ? ? F DA 106 G DT 315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT 15 O4 ? ? F DA 106 G DT 315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC 14 N3 ? ? F DG 107 G DC 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC 14 O2 ? ? F DG 107 G DC 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC 14 N4 ? ? F DG 107 G DC 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG 13 N1 ? ? F DC 108 G DG 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG 13 O6 ? ? F DC 108 G DG 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG 13 N2 ? ? F DC 108 G DG 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 12 N3 ? ? F DA 109 G DT 312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 12 O4 ? ? F DA 109 G DT 312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 11 N1 ? ? F DC 110 G DG 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 11 O6 ? ? F DC 110 G DG 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 11 N2 ? ? F DC 110 G DG 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC 10 N3 ? ? F DG 111 G DC 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC 10 O2 ? ? F DG 111 G DC 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC 10 N4 ? ? F DG 111 G DC 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 9  N1 ? ? F DT 112 G DA 309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 9  N6 ? ? F DT 112 G DA 309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 8  N3 ? ? F DG 113 G DC 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 8  O2 ? ? F DG 113 G DC 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 8  N4 ? ? F DG 113 G DC 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DC 14 N3 ? ? ? 1_555 B DG 7  N1 ? ? F DC 114 G DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DC 14 N4 ? ? ? 1_555 B DG 7  O6 ? ? F DC 114 G DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DC 14 O2 ? ? ? 1_555 B DG 7  N2 ? ? F DC 114 G DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DT 15 N3 ? ? ? 1_555 B DA 6  N1 ? ? F DT 115 G DA 306 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DT 15 O4 ? ? ? 1_555 B DA 6  N6 ? ? F DT 115 G DA 306 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 5  N3 ? ? F DA 116 G DT 305 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 5  O4 ? ? F DA 116 G DT 305 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? A DC 17 N3 ? ? ? 1_555 B DG 4  N1 ? ? F DC 117 G DG 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? A DC 17 N4 ? ? ? 1_555 B DG 4  O6 ? ? F DC 117 G DG 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41 hydrog ? ? A DC 17 O2 ? ? ? 1_555 B DG 4  N2 ? ? F DC 117 G DG 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? A DT 18 N3 ? ? ? 1_555 B DA 3  N1 ? ? F DT 118 G DA 303 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43 hydrog ? ? A DT 18 O4 ? ? ? 1_555 B DA 3  N6 ? ? F DT 118 G DA 303 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44 hydrog ? ? A DC 19 N3 ? ? ? 1_555 B DG 2  N1 ? ? F DC 119 G DG 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45 hydrog ? ? A DC 19 N4 ? ? ? 1_555 B DG 2  O6 ? ? F DC 119 G DG 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog46 hydrog ? ? A DC 19 O2 ? ? ? 1_555 B DG 2  N2 ? ? F DC 119 G DG 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47 hydrog ? ? C DG 2  N1 ? ? ? 1_555 D DC 19 N3 ? ? H DG 602 J DC 819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog48 hydrog ? ? C DG 2  N2 ? ? ? 1_555 D DC 19 O2 ? ? H DG 602 J DC 819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog49 hydrog ? ? C DG 2  O6 ? ? ? 1_555 D DC 19 N4 ? ? H DG 602 J DC 819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog50 hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 18 N3 ? ? H DA 603 J DT 818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog51 hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 18 O4 ? ? H DA 603 J DT 818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog52 hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DC 17 N3 ? ? H DG 604 J DC 817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog53 hydrog ? ? C DG 4  N2 ? ? ? 1_555 D DC 17 O2 ? ? H DG 604 J DC 817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog54 hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DC 17 N4 ? ? H DG 604 J DC 817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog55 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 16 N1 ? ? H DT 605 J DA 816 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog56 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 16 N6 ? ? H DT 605 J DA 816 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog57 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT 15 N3 ? ? H DA 606 J DT 815 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog58 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT 15 O4 ? ? H DA 606 J DT 815 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog59 hydrog ? ? C DG 7  N1 ? ? ? 1_555 D DC 14 N3 ? ? H DG 607 J DC 814 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog60 hydrog ? ? C DG 7  N2 ? ? ? 1_555 D DC 14 O2 ? ? H DG 607 J DC 814 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog61 hydrog ? ? C DG 7  O6 ? ? ? 1_555 D DC 14 N4 ? ? H DG 607 J DC 814 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog62 hydrog ? ? C DC 8  N3 ? ? ? 1_555 D DG 13 N1 ? ? H DC 608 J DG 813 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog63 hydrog ? ? C DC 8  N4 ? ? ? 1_555 D DG 13 O6 ? ? H DC 608 J DG 813 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog64 hydrog ? ? C DC 8  O2 ? ? ? 1_555 D DG 13 N2 ? ? H DC 608 J DG 813 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog65 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 12 N3 ? ? H DA 609 J DT 812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog66 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 12 O4 ? ? H DA 609 J DT 812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog67 hydrog ? ? C DC 10 N3 ? ? ? 1_555 D DG 11 N1 ? ? H DC 610 J DG 811 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog68 hydrog ? ? C DC 10 N4 ? ? ? 1_555 D DG 11 O6 ? ? H DC 610 J DG 811 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog69 hydrog ? ? C DC 10 O2 ? ? ? 1_555 D DG 11 N2 ? ? H DC 610 J DG 811 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog70 hydrog ? ? C DG 11 N1 ? ? ? 1_555 D DC 10 N3 ? ? H DG 611 J DC 810 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog71 hydrog ? ? C DG 11 N2 ? ? ? 1_555 D DC 10 O2 ? ? H DG 611 J DC 810 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog72 hydrog ? ? C DG 11 O6 ? ? ? 1_555 D DC 10 N4 ? ? H DG 611 J DC 810 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog73 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 9  N1 ? ? H DT 612 J DA 809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog74 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 9  N6 ? ? H DT 612 J DA 809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog75 hydrog ? ? C DG 13 N1 ? ? ? 1_555 D DC 8  N3 ? ? H DG 613 J DC 808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog76 hydrog ? ? C DG 13 N2 ? ? ? 1_555 D DC 8  O2 ? ? H DG 613 J DC 808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog77 hydrog ? ? C DG 13 O6 ? ? ? 1_555 D DC 8  N4 ? ? H DG 613 J DC 808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog78 hydrog ? ? C DC 14 N3 ? ? ? 1_555 D DG 7  N1 ? ? H DC 614 J DG 807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog79 hydrog ? ? C DC 14 N4 ? ? ? 1_555 D DG 7  O6 ? ? H DC 614 J DG 807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog80 hydrog ? ? C DC 14 O2 ? ? ? 1_555 D DG 7  N2 ? ? H DC 614 J DG 807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog81 hydrog ? ? C DT 15 N3 ? ? ? 1_555 D DA 6  N1 ? ? H DT 615 J DA 806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog82 hydrog ? ? C DT 15 O4 ? ? ? 1_555 D DA 6  N6 ? ? H DT 615 J DA 806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog83 hydrog ? ? C DA 16 N1 ? ? ? 1_555 D DT 5  N3 ? ? H DA 616 J DT 805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog84 hydrog ? ? C DA 16 N6 ? ? ? 1_555 D DT 5  O4 ? ? H DA 616 J DT 805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog85 hydrog ? ? C DC 17 N3 ? ? ? 1_555 D DG 4  N1 ? ? H DC 617 J DG 804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog86 hydrog ? ? C DC 17 N4 ? ? ? 1_555 D DG 4  O6 ? ? H DC 617 J DG 804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog87 hydrog ? ? C DC 17 O2 ? ? ? 1_555 D DG 4  N2 ? ? H DC 617 J DG 804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog88 hydrog ? ? C DT 18 N3 ? ? ? 1_555 D DA 3  N1 ? ? H DT 618 J DA 803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog89 hydrog ? ? C DT 18 O4 ? ? ? 1_555 D DA 3  N6 ? ? H DT 618 J DA 803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog90 hydrog ? ? C DC 19 N3 ? ? ? 1_555 D DG 2  N1 ? ? H DC 619 J DG 802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog91 hydrog ? ? C DC 19 N4 ? ? ? 1_555 D DG 2  O6 ? ? H DC 619 J DG 802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog92 hydrog ? ? C DC 19 O2 ? ? ? 1_555 D DG 2  N2 ? ? H DC 619 J DG 802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1NKP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NKP 
_atom_sites.fract_transf_matrix[1][1]   0.025482 
_atom_sites.fract_transf_matrix[1][2]   -0.008526 
_atom_sites.fract_transf_matrix[1][3]   -0.002344 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023367 
_atom_sites.fract_transf_matrix[2][3]   -0.000165 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011614 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1  ? 44.956  100.718 28.401  1.00 36.00 ? 101 DC  F "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1  ? 44.592  102.009 27.914  1.00 31.76 ? 101 DC  F "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1  ? 45.755  102.972 27.984  1.00 31.62 ? 101 DC  F "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1  ? 46.232  103.061 29.350  1.00 29.66 ? 101 DC  F "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1  ? 46.969  102.580 27.140  1.00 30.84 ? 101 DC  F "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1  ? 47.562  103.760 26.590  1.00 31.62 ? 101 DC  F "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1  ? 47.904  101.942 28.151  1.00 30.34 ? 101 DC  F "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1  ? 47.617  102.754 29.401  1.00 28.91 ? 101 DC  F "C1'" 1 
ATOM   9    N N1    . DC  A 1 1  ? 47.868  102.053 30.668  1.00 27.60 ? 101 DC  F N1    1 
ATOM   10   C C2    . DC  A 1 1  ? 48.898  102.507 31.497  1.00 26.96 ? 101 DC  F C2    1 
ATOM   11   O O2    . DC  A 1 1  ? 49.580  103.477 31.132  1.00 27.19 ? 101 DC  F O2    1 
ATOM   12   N N3    . DC  A 1 1  ? 49.123  101.880 32.673  1.00 27.33 ? 101 DC  F N3    1 
ATOM   13   C C4    . DC  A 1 1  ? 48.361  100.845 33.033  1.00 27.61 ? 101 DC  F C4    1 
ATOM   14   N N4    . DC  A 1 1  ? 48.610  100.270 34.208  1.00 27.26 ? 101 DC  F N4    1 
ATOM   15   C C5    . DC  A 1 1  ? 47.309  100.358 32.205  1.00 27.39 ? 101 DC  F C5    1 
ATOM   16   C C6    . DC  A 1 1  ? 47.101  100.983 31.041  1.00 27.60 ? 101 DC  F C6    1 
ATOM   17   P P     . DG  A 1 2  ? 48.532  103.651 25.311  1.00 32.36 ? 102 DG  F P     1 
ATOM   18   O OP1   . DG  A 1 2  ? 48.546  104.985 24.654  1.00 30.46 ? 102 DG  F OP1   1 
ATOM   19   O OP2   . DG  A 1 2  ? 48.131  102.454 24.524  1.00 32.07 ? 102 DG  F OP2   1 
ATOM   20   O "O5'" . DG  A 1 2  ? 49.968  103.351 25.935  1.00 31.25 ? 102 DG  F "O5'" 1 
ATOM   21   C "C5'" . DG  A 1 2  ? 50.667  104.332 26.706  1.00 32.97 ? 102 DG  F "C5'" 1 
ATOM   22   C "C4'" . DG  A 1 2  ? 51.897  103.720 27.341  1.00 32.89 ? 102 DG  F "C4'" 1 
ATOM   23   O "O4'" . DG  A 1 2  ? 51.508  102.615 28.186  1.00 33.82 ? 102 DG  F "O4'" 1 
ATOM   24   C "C3'" . DG  A 1 2  ? 52.936  103.129 26.389  1.00 33.93 ? 102 DG  F "C3'" 1 
ATOM   25   O "O3'" . DG  A 1 2  ? 54.173  103.084 27.103  1.00 35.35 ? 102 DG  F "O3'" 1 
ATOM   26   C "C2'" . DG  A 1 2  ? 52.465  101.697 26.256  1.00 33.12 ? 102 DG  F "C2'" 1 
ATOM   27   C "C1'" . DG  A 1 2  ? 52.103  101.417 27.700  1.00 32.30 ? 102 DG  F "C1'" 1 
ATOM   28   N N9    . DG  A 1 2  ? 51.149  100.338 27.910  1.00 31.76 ? 102 DG  F N9    1 
ATOM   29   C C8    . DG  A 1 2  ? 50.308  99.767  26.986  1.00 31.25 ? 102 DG  F C8    1 
ATOM   30   N N7    . DG  A 1 2  ? 49.553  98.833  27.495  1.00 31.11 ? 102 DG  F N7    1 
ATOM   31   C C5    . DG  A 1 2  ? 49.922  98.787  28.832  1.00 30.73 ? 102 DG  F C5    1 
ATOM   32   C C6    . DG  A 1 2  ? 49.440  97.979  29.885  1.00 31.07 ? 102 DG  F C6    1 
ATOM   33   O O6    . DG  A 1 2  ? 48.558  97.118  29.848  1.00 32.88 ? 102 DG  F O6    1 
ATOM   34   N N1    . DG  A 1 2  ? 50.092  98.258  31.085  1.00 30.92 ? 102 DG  F N1    1 
ATOM   35   C C2    . DG  A 1 2  ? 51.078  99.198  31.246  1.00 31.01 ? 102 DG  F C2    1 
ATOM   36   N N2    . DG  A 1 2  ? 51.587  99.322  32.479  1.00 30.78 ? 102 DG  F N2    1 
ATOM   37   N N3    . DG  A 1 2  ? 51.534  99.963  30.268  1.00 30.95 ? 102 DG  F N3    1 
ATOM   38   C C4    . DG  A 1 2  ? 50.913  99.703  29.098  1.00 30.85 ? 102 DG  F C4    1 
ATOM   39   P P     . DA  A 1 3  ? 55.517  103.621 26.430  1.00 36.12 ? 103 DA  F P     1 
ATOM   40   O OP1   . DA  A 1 3  ? 55.379  105.090 26.286  1.00 37.65 ? 103 DA  F OP1   1 
ATOM   41   O OP2   . DA  A 1 3  ? 55.818  102.790 25.237  1.00 37.92 ? 103 DA  F OP2   1 
ATOM   42   O "O5'" . DA  A 1 3  ? 56.607  103.342 27.560  1.00 35.98 ? 103 DA  F "O5'" 1 
ATOM   43   C "C5'" . DA  A 1 3  ? 56.578  104.075 28.785  1.00 35.19 ? 103 DA  F "C5'" 1 
ATOM   44   C "C4'" . DA  A 1 3  ? 56.900  103.179 29.960  1.00 35.81 ? 103 DA  F "C4'" 1 
ATOM   45   O "O4'" . DA  A 1 3  ? 55.931  102.106 30.052  1.00 35.50 ? 103 DA  F "O4'" 1 
ATOM   46   C "C3'" . DA  A 1 3  ? 58.271  102.503 29.935  1.00 35.85 ? 103 DA  F "C3'" 1 
ATOM   47   O "O3'" . DA  A 1 3  ? 58.770  102.449 31.276  1.00 37.68 ? 103 DA  F "O3'" 1 
ATOM   48   C "C2'" . DA  A 1 3  ? 57.959  101.106 29.432  1.00 34.90 ? 103 DA  F "C2'" 1 
ATOM   49   C "C1'" . DA  A 1 3  ? 56.599  100.852 30.058  1.00 34.22 ? 103 DA  F "C1'" 1 
ATOM   50   N N9    . DA  A 1 3  ? 55.754  99.896  29.344  1.00 31.64 ? 103 DA  F N9    1 
ATOM   51   C C8    . DA  A 1 3  ? 55.528  99.798  27.995  1.00 30.95 ? 103 DA  F C8    1 
ATOM   52   N N7    . DA  A 1 3  ? 54.687  98.848  27.669  1.00 30.96 ? 103 DA  F N7    1 
ATOM   53   C C5    . DA  A 1 3  ? 54.342  98.277  28.885  1.00 31.32 ? 103 DA  F C5    1 
ATOM   54   C C6    . DA  A 1 3  ? 53.481  97.221  29.224  1.00 30.89 ? 103 DA  F C6    1 
ATOM   55   N N6    . DA  A 1 3  ? 52.776  96.526  28.329  1.00 31.02 ? 103 DA  F N6    1 
ATOM   56   N N1    . DA  A 1 3  ? 53.366  96.899  30.530  1.00 30.85 ? 103 DA  F N1    1 
ATOM   57   C C2    . DA  A 1 3  ? 54.067  97.602  31.428  1.00 31.52 ? 103 DA  F C2    1 
ATOM   58   N N3    . DA  A 1 3  ? 54.904  98.620  31.233  1.00 31.58 ? 103 DA  F N3    1 
ATOM   59   C C4    . DA  A 1 3  ? 54.998  98.909  29.924  1.00 31.36 ? 103 DA  F C4    1 
ATOM   60   P P     . DG  A 1 4  ? 60.216  101.805 31.571  1.00 39.35 ? 104 DG  F P     1 
ATOM   61   O OP1   . DG  A 1 4  ? 60.962  102.764 32.422  1.00 38.26 ? 104 DG  F OP1   1 
ATOM   62   O OP2   . DG  A 1 4  ? 60.806  101.351 30.286  1.00 37.35 ? 104 DG  F OP2   1 
ATOM   63   O "O5'" . DG  A 1 4  ? 59.872  100.547 32.481  1.00 37.20 ? 104 DG  F "O5'" 1 
ATOM   64   C "C5'" . DG  A 1 4  ? 59.212  100.720 33.737  1.00 36.22 ? 104 DG  F "C5'" 1 
ATOM   65   C "C4'" . DG  A 1 4  ? 59.158  99.407  34.480  1.00 35.60 ? 104 DG  F "C4'" 1 
ATOM   66   O "O4'" . DG  A 1 4  ? 58.199  98.528  33.838  1.00 34.36 ? 104 DG  F "O4'" 1 
ATOM   67   C "C3'" . DG  A 1 4  ? 60.489  98.660  34.483  1.00 35.88 ? 104 DG  F "C3'" 1 
ATOM   68   O "O3'" . DG  A 1 4  ? 60.726  98.055  35.759  1.00 38.59 ? 104 DG  F "O3'" 1 
ATOM   69   C "C2'" . DG  A 1 4  ? 60.327  97.628  33.377  1.00 34.47 ? 104 DG  F "C2'" 1 
ATOM   70   C "C1'" . DG  A 1 4  ? 58.831  97.339  33.377  1.00 31.91 ? 104 DG  F "C1'" 1 
ATOM   71   N N9    . DG  A 1 4  ? 58.283  97.029  32.057  1.00 30.46 ? 104 DG  F N9    1 
ATOM   72   C C8    . DG  A 1 4  ? 58.598  97.639  30.865  1.00 29.57 ? 104 DG  F C8    1 
ATOM   73   N N7    . DG  A 1 4  ? 57.933  97.154  29.847  1.00 29.58 ? 104 DG  F N7    1 
ATOM   74   C C5    . DG  A 1 4  ? 57.135  96.161  30.400  1.00 29.54 ? 104 DG  F C5    1 
ATOM   75   C C6    . DG  A 1 4  ? 56.187  95.286  29.786  1.00 29.46 ? 104 DG  F C6    1 
ATOM   76   O O6    . DG  A 1 4  ? 55.841  95.227  28.595  1.00 28.36 ? 104 DG  F O6    1 
ATOM   77   N N1    . DG  A 1 4  ? 55.615  94.428  30.713  1.00 29.04 ? 104 DG  F N1    1 
ATOM   78   C C2    . DG  A 1 4  ? 55.900  94.412  32.057  1.00 30.19 ? 104 DG  F C2    1 
ATOM   79   N N2    . DG  A 1 4  ? 55.252  93.492  32.785  1.00 29.86 ? 104 DG  F N2    1 
ATOM   80   N N3    . DG  A 1 4  ? 56.760  95.230  32.643  1.00 29.80 ? 104 DG  F N3    1 
ATOM   81   C C4    . DG  A 1 4  ? 57.340  96.069  31.761  1.00 29.74 ? 104 DG  F C4    1 
ATOM   82   P P     . DT  A 1 5  ? 62.079  97.218  36.005  1.00 40.24 ? 105 DT  F P     1 
ATOM   83   O OP1   . DT  A 1 5  ? 62.550  97.504  37.382  1.00 41.05 ? 105 DT  F OP1   1 
ATOM   84   O OP2   . DT  A 1 5  ? 63.000  97.418  34.859  1.00 39.59 ? 105 DT  F OP2   1 
ATOM   85   O "O5'" . DT  A 1 5  ? 61.560  95.718  35.977  1.00 40.66 ? 105 DT  F "O5'" 1 
ATOM   86   C "C5'" . DT  A 1 5  ? 60.434  95.345  36.762  1.00 41.58 ? 105 DT  F "C5'" 1 
ATOM   87   C "C4'" . DT  A 1 5  ? 60.062  93.909  36.490  1.00 41.90 ? 105 DT  F "C4'" 1 
ATOM   88   O "O4'" . DT  A 1 5  ? 59.400  93.796  35.204  1.00 41.53 ? 105 DT  F "O4'" 1 
ATOM   89   C "C3'" . DT  A 1 5  ? 61.257  92.959  36.450  1.00 42.84 ? 105 DT  F "C3'" 1 
ATOM   90   O "O3'" . DT  A 1 5  ? 60.965  91.785  37.207  1.00 44.53 ? 105 DT  F "O3'" 1 
ATOM   91   C "C2'" . DT  A 1 5  ? 61.417  92.641  34.970  1.00 41.69 ? 105 DT  F "C2'" 1 
ATOM   92   C "C1'" . DT  A 1 5  ? 59.993  92.751  34.452  1.00 40.16 ? 105 DT  F "C1'" 1 
ATOM   93   N N1    . DT  A 1 5  ? 59.865  93.088  33.014  1.00 38.40 ? 105 DT  F N1    1 
ATOM   94   C C2    . DT  A 1 5  ? 58.975  92.360  32.251  1.00 37.22 ? 105 DT  F C2    1 
ATOM   95   O O2    . DT  A 1 5  ? 58.282  91.467  32.704  1.00 37.79 ? 105 DT  F O2    1 
ATOM   96   N N3    . DT  A 1 5  ? 58.929  92.718  30.926  1.00 36.47 ? 105 DT  F N3    1 
ATOM   97   C C4    . DT  A 1 5  ? 59.668  93.702  30.301  1.00 35.23 ? 105 DT  F C4    1 
ATOM   98   O O4    . DT  A 1 5  ? 59.533  93.897  29.094  1.00 33.81 ? 105 DT  F O4    1 
ATOM   99   C C5    . DT  A 1 5  ? 60.570  94.432  31.160  1.00 35.94 ? 105 DT  F C5    1 
ATOM   100  C C7    . DT  A 1 5  ? 61.404  95.526  30.570  1.00 36.31 ? 105 DT  F C7    1 
ATOM   101  C C6    . DT  A 1 5  ? 60.622  94.095  32.455  1.00 36.72 ? 105 DT  F C6    1 
ATOM   102  P P     . DA  A 1 6  ? 62.118  90.705  37.473  1.00 45.89 ? 106 DA  F P     1 
ATOM   103  O OP1   . DA  A 1 6  ? 62.193  90.479  38.942  1.00 46.22 ? 106 DA  F OP1   1 
ATOM   104  O OP2   . DA  A 1 6  ? 63.340  91.110  36.726  1.00 46.46 ? 106 DA  F OP2   1 
ATOM   105  O "O5'" . DA  A 1 6  ? 61.519  89.398  36.793  1.00 44.10 ? 106 DA  F "O5'" 1 
ATOM   106  C "C5'" . DA  A 1 6  ? 60.129  89.098  36.920  1.00 40.98 ? 106 DA  F "C5'" 1 
ATOM   107  C "C4'" . DA  A 1 6  ? 59.745  87.992  35.968  1.00 38.44 ? 106 DA  F "C4'" 1 
ATOM   108  O "O4'" . DA  A 1 6  ? 59.700  88.477  34.604  1.00 37.14 ? 106 DA  F "O4'" 1 
ATOM   109  C "C3'" . DA  A 1 6  ? 60.718  86.822  35.969  1.00 36.86 ? 106 DA  F "C3'" 1 
ATOM   110  O "O3'" . DA  A 1 6  ? 59.975  85.612  35.838  1.00 35.28 ? 106 DA  F "O3'" 1 
ATOM   111  C "C2'" . DA  A 1 6  ? 61.602  87.097  34.762  1.00 36.30 ? 106 DA  F "C2'" 1 
ATOM   112  C "C1'" . DA  A 1 6  ? 60.657  87.799  33.798  1.00 36.09 ? 106 DA  F "C1'" 1 
ATOM   113  N N9    . DA  A 1 6  ? 61.281  88.803  32.935  1.00 35.24 ? 106 DA  F N9    1 
ATOM   114  C C8    . DA  A 1 6  ? 62.279  89.691  33.252  1.00 34.61 ? 106 DA  F C8    1 
ATOM   115  N N7    . DA  A 1 6  ? 62.585  90.515  32.278  1.00 34.53 ? 106 DA  F N7    1 
ATOM   116  C C5    . DA  A 1 6  ? 61.739  90.140  31.245  1.00 33.61 ? 106 DA  F C5    1 
ATOM   117  C C6    . DA  A 1 6  ? 61.557  90.636  29.937  1.00 34.50 ? 106 DA  F C6    1 
ATOM   118  N N6    . DA  A 1 6  ? 62.234  91.673  29.429  1.00 33.80 ? 106 DA  F N6    1 
ATOM   119  N N1    . DA  A 1 6  ? 60.637  90.026  29.158  1.00 33.89 ? 106 DA  F N1    1 
ATOM   120  C C2    . DA  A 1 6  ? 59.946  88.999  29.668  1.00 34.31 ? 106 DA  F C2    1 
ATOM   121  N N3    . DA  A 1 6  ? 60.018  88.450  30.880  1.00 34.36 ? 106 DA  F N3    1 
ATOM   122  C C4    . DA  A 1 6  ? 60.944  89.074  31.628  1.00 34.62 ? 106 DA  F C4    1 
ATOM   123  P P     . DG  A 1 7  ? 60.614  84.231  36.336  1.00 34.74 ? 107 DG  F P     1 
ATOM   124  O OP1   . DG  A 1 7  ? 59.479  83.380  36.769  1.00 35.60 ? 107 DG  F OP1   1 
ATOM   125  O OP2   . DG  A 1 7  ? 61.740  84.498  37.264  1.00 33.99 ? 107 DG  F OP2   1 
ATOM   126  O "O5'" . DG  A 1 7  ? 61.223  83.613  35.010  1.00 32.52 ? 107 DG  F "O5'" 1 
ATOM   127  C "C5'" . DG  A 1 7  ? 60.371  83.188  33.963  1.00 28.98 ? 107 DG  F "C5'" 1 
ATOM   128  C "C4'" . DG  A 1 7  ? 61.168  83.017  32.696  1.00 27.00 ? 107 DG  F "C4'" 1 
ATOM   129  O "O4'" . DG  A 1 7  ? 61.478  84.304  32.102  1.00 25.73 ? 107 DG  F "O4'" 1 
ATOM   130  C "C3'" . DG  A 1 7  ? 62.509  82.288  32.858  1.00 25.45 ? 107 DG  F "C3'" 1 
ATOM   131  O "O3'" . DG  A 1 7  ? 62.687  81.464  31.713  1.00 27.60 ? 107 DG  F "O3'" 1 
ATOM   132  C "C2'" . DG  A 1 7  ? 63.520  83.414  32.735  1.00 25.17 ? 107 DG  F "C2'" 1 
ATOM   133  C "C1'" . DG  A 1 7  ? 62.825  84.246  31.675  1.00 23.98 ? 107 DG  F "C1'" 1 
ATOM   134  N N9    . DG  A 1 7  ? 63.312  85.601  31.421  1.00 25.11 ? 107 DG  F N9    1 
ATOM   135  C C8    . DG  A 1 7  ? 64.068  86.403  32.244  1.00 23.65 ? 107 DG  F C8    1 
ATOM   136  N N7    . DG  A 1 7  ? 64.418  87.528  31.680  1.00 23.63 ? 107 DG  F N7    1 
ATOM   137  C C5    . DG  A 1 7  ? 63.839  87.479  30.417  1.00 22.67 ? 107 DG  F C5    1 
ATOM   138  C C6    . DG  A 1 7  ? 63.884  88.413  29.329  1.00 21.12 ? 107 DG  F C6    1 
ATOM   139  O O6    . DG  A 1 7  ? 64.462  89.510  29.263  1.00 21.36 ? 107 DG  F O6    1 
ATOM   140  N N1    . DG  A 1 7  ? 63.165  87.955  28.236  1.00 20.54 ? 107 DG  F N1    1 
ATOM   141  C C2    . DG  A 1 7  ? 62.488  86.761  28.178  1.00 21.83 ? 107 DG  F C2    1 
ATOM   142  N N2    . DG  A 1 7  ? 61.854  86.500  27.023  1.00 22.37 ? 107 DG  F N2    1 
ATOM   143  N N3    . DG  A 1 7  ? 62.438  85.889  29.171  1.00 22.82 ? 107 DG  F N3    1 
ATOM   144  C C4    . DG  A 1 7  ? 63.134  86.308  30.250  1.00 22.74 ? 107 DG  F C4    1 
ATOM   145  P P     . DC  A 1 8  ? 63.252  79.970  31.856  1.00 28.73 ? 108 DC  F P     1 
ATOM   146  O OP1   . DC  A 1 8  ? 62.132  79.114  32.297  1.00 26.48 ? 108 DC  F OP1   1 
ATOM   147  O OP2   . DC  A 1 8  ? 64.534  79.957  32.608  1.00 27.42 ? 108 DC  F OP2   1 
ATOM   148  O "O5'" . DC  A 1 8  ? 63.538  79.614  30.336  1.00 28.05 ? 108 DC  F "O5'" 1 
ATOM   149  C "C5'" . DC  A 1 8  ? 62.473  79.671  29.396  1.00 28.57 ? 108 DC  F "C5'" 1 
ATOM   150  C "C4'" . DC  A 1 8  ? 62.950  80.257  28.091  1.00 27.94 ? 108 DC  F "C4'" 1 
ATOM   151  O "O4'" . DC  A 1 8  ? 63.212  81.681  28.215  1.00 26.94 ? 108 DC  F "O4'" 1 
ATOM   152  C "C3'" . DC  A 1 8  ? 64.230  79.628  27.540  1.00 27.86 ? 108 DC  F "C3'" 1 
ATOM   153  O "O3'" . DC  A 1 8  ? 64.047  79.353  26.152  1.00 29.09 ? 108 DC  F "O3'" 1 
ATOM   154  C "C2'" . DC  A 1 8  ? 65.275  80.714  27.741  1.00 27.58 ? 108 DC  F "C2'" 1 
ATOM   155  C "C1'" . DC  A 1 8  ? 64.436  81.964  27.556  1.00 26.24 ? 108 DC  F "C1'" 1 
ATOM   156  N N1    . DC  A 1 8  ? 65.008  83.211  28.101  1.00 24.12 ? 108 DC  F N1    1 
ATOM   157  C C2    . DC  A 1 8  ? 65.026  84.349  27.282  1.00 22.91 ? 108 DC  F C2    1 
ATOM   158  O O2    . DC  A 1 8  ? 64.517  84.285  26.151  1.00 20.68 ? 108 DC  F O2    1 
ATOM   159  N N3    . DC  A 1 8  ? 65.596  85.490  27.738  1.00 20.91 ? 108 DC  F N3    1 
ATOM   160  C C4    . DC  A 1 8  ? 66.132  85.529  28.958  1.00 20.92 ? 108 DC  F C4    1 
ATOM   161  N N4    . DC  A 1 8  ? 66.720  86.677  29.347  1.00 17.68 ? 108 DC  F N4    1 
ATOM   162  C C5    . DC  A 1 8  ? 66.104  84.397  29.830  1.00 20.55 ? 108 DC  F C5    1 
ATOM   163  C C6    . DC  A 1 8  ? 65.535  83.266  29.363  1.00 23.25 ? 108 DC  F C6    1 
ATOM   164  P P     . DA  A 1 9  ? 65.237  78.699  25.300  1.00 30.45 ? 109 DA  F P     1 
ATOM   165  O OP1   . DA  A 1 9  ? 64.689  77.492  24.638  1.00 31.45 ? 109 DA  F OP1   1 
ATOM   166  O OP2   . DA  A 1 9  ? 66.468  78.594  26.117  1.00 30.83 ? 109 DA  F OP2   1 
ATOM   167  O "O5'" . DA  A 1 9  ? 65.487  79.787  24.171  1.00 28.83 ? 109 DA  F "O5'" 1 
ATOM   168  C "C5'" . DA  A 1 9  ? 64.391  80.339  23.450  1.00 23.96 ? 109 DA  F "C5'" 1 
ATOM   169  C "C4'" . DA  A 1 9  ? 64.909  81.207  22.331  1.00 21.76 ? 109 DA  F "C4'" 1 
ATOM   170  O "O4'" . DA  A 1 9  ? 65.364  82.469  22.871  1.00 20.91 ? 109 DA  F "O4'" 1 
ATOM   171  C "C3'" . DA  A 1 9  ? 66.107  80.588  21.617  1.00 21.26 ? 109 DA  F "C3'" 1 
ATOM   172  O "O3'" . DA  A 1 9  ? 66.021  80.867  20.222  1.00 19.91 ? 109 DA  F "O3'" 1 
ATOM   173  C "C2'" . DA  A 1 9  ? 67.301  81.258  22.283  1.00 20.32 ? 109 DA  F "C2'" 1 
ATOM   174  C "C1'" . DA  A 1 9  ? 66.760  82.630  22.688  1.00 19.41 ? 109 DA  F "C1'" 1 
ATOM   175  N N9    . DA  A 1 9  ? 67.304  83.145  23.949  1.00 17.84 ? 109 DA  F N9    1 
ATOM   176  C C8    . DA  A 1 9  ? 67.282  82.533  25.176  1.00 18.62 ? 109 DA  F C8    1 
ATOM   177  N N7    . DA  A 1 9  ? 67.842  83.240  26.132  1.00 17.46 ? 109 DA  F N7    1 
ATOM   178  C C5    . DA  A 1 9  ? 68.266  84.395  25.488  1.00 17.17 ? 109 DA  F C5    1 
ATOM   179  C C6    . DA  A 1 9  ? 68.935  85.548  25.948  1.00 16.30 ? 109 DA  F C6    1 
ATOM   180  N N6    . DA  A 1 9  ? 69.312  85.726  27.218  1.00 16.41 ? 109 DA  F N6    1 
ATOM   181  N N1    . DA  A 1 9  ? 69.205  86.519  25.052  1.00 15.71 ? 109 DA  F N1    1 
ATOM   182  C C2    . DA  A 1 9  ? 68.824  86.343  23.780  1.00 16.56 ? 109 DA  F C2    1 
ATOM   183  N N3    . DA  A 1 9  ? 68.189  85.302  23.226  1.00 18.01 ? 109 DA  F N3    1 
ATOM   184  C C4    . DA  A 1 9  ? 67.939  84.353  24.143  1.00 16.49 ? 109 DA  F C4    1 
ATOM   185  P P     . DC  A 1 10 ? 67.096  80.246  19.215  1.00 22.62 ? 110 DC  F P     1 
ATOM   186  O OP1   . DC  A 1 10 ? 66.390  80.051  17.921  1.00 20.71 ? 110 DC  F OP1   1 
ATOM   187  O OP2   . DC  A 1 10 ? 67.819  79.118  19.836  1.00 20.50 ? 110 DC  F OP2   1 
ATOM   188  O "O5'" . DC  A 1 10 ? 68.134  81.428  19.049  1.00 19.95 ? 110 DC  F "O5'" 1 
ATOM   189  C "C5'" . DC  A 1 10 ? 67.665  82.735  18.783  1.00 18.03 ? 110 DC  F "C5'" 1 
ATOM   190  C "C4'" . DC  A 1 10 ? 68.815  83.706  18.751  1.00 19.46 ? 110 DC  F "C4'" 1 
ATOM   191  O "O4'" . DC  A 1 10 ? 69.175  84.093  20.098  1.00 18.76 ? 110 DC  F "O4'" 1 
ATOM   192  C "C3'" . DC  A 1 10 ? 70.090  83.182  18.087  1.00 18.62 ? 110 DC  F "C3'" 1 
ATOM   193  O "O3'" . DC  A 1 10 ? 70.400  83.976  16.952  1.00 19.40 ? 110 DC  F "O3'" 1 
ATOM   194  C "C2'" . DC  A 1 10 ? 71.162  83.312  19.163  1.00 18.68 ? 110 DC  F "C2'" 1 
ATOM   195  C "C1'" . DC  A 1 10 ? 70.571  84.308  20.158  1.00 19.42 ? 110 DC  F "C1'" 1 
ATOM   196  N N1    . DC  A 1 10 ? 70.984  84.120  21.564  1.00 18.24 ? 110 DC  F N1    1 
ATOM   197  C C2    . DC  A 1 10 ? 71.597  85.181  22.243  1.00 18.36 ? 110 DC  F C2    1 
ATOM   198  O O2    . DC  A 1 10 ? 71.826  86.237  21.630  1.00 18.98 ? 110 DC  F O2    1 
ATOM   199  N N3    . DC  A 1 10 ? 71.927  85.025  23.553  1.00 18.21 ? 110 DC  F N3    1 
ATOM   200  C C4    . DC  A 1 10 ? 71.672  83.869  24.173  1.00 18.30 ? 110 DC  F C4    1 
ATOM   201  N N4    . DC  A 1 10 ? 71.989  83.758  25.471  1.00 16.31 ? 110 DC  F N4    1 
ATOM   202  C C5    . DC  A 1 10 ? 71.076  82.767  23.492  1.00 18.49 ? 110 DC  F C5    1 
ATOM   203  C C6    . DC  A 1 10 ? 70.755  82.933  22.204  1.00 17.93 ? 110 DC  F C6    1 
ATOM   204  P P     . DG  A 1 11 ? 71.533  83.487  15.919  1.00 17.11 ? 111 DG  F P     1 
ATOM   205  O OP1   . DG  A 1 11 ? 71.031  83.850  14.570  1.00 19.95 ? 111 DG  F OP1   1 
ATOM   206  O OP2   . DG  A 1 11 ? 71.931  82.087  16.191  1.00 20.75 ? 111 DG  F OP2   1 
ATOM   207  O "O5'" . DG  A 1 11 ? 72.733  84.471  16.265  1.00 19.46 ? 111 DG  F "O5'" 1 
ATOM   208  C "C5'" . DG  A 1 11 ? 72.524  85.877  16.221  1.00 17.19 ? 111 DG  F "C5'" 1 
ATOM   209  C "C4'" . DG  A 1 11 ? 73.764  86.608  16.671  1.00 17.83 ? 111 DG  F "C4'" 1 
ATOM   210  O "O4'" . DG  A 1 11 ? 73.956  86.418  18.094  1.00 15.16 ? 111 DG  F "O4'" 1 
ATOM   211  C "C3'" . DG  A 1 11 ? 75.046  86.130  15.989  1.00 17.17 ? 111 DG  F "C3'" 1 
ATOM   212  O "O3'" . DG  A 1 11 ? 75.847  87.275  15.649  1.00 15.16 ? 111 DG  F "O3'" 1 
ATOM   213  C "C2'" . DG  A 1 11 ? 75.680  85.217  17.034  1.00 15.89 ? 111 DG  F "C2'" 1 
ATOM   214  C "C1'" . DG  A 1 11 ? 75.242  85.858  18.345  1.00 16.07 ? 111 DG  F "C1'" 1 
ATOM   215  N N9    . DG  A 1 11 ? 75.119  84.976  19.508  1.00 16.36 ? 111 DG  F N9    1 
ATOM   216  C C8    . DG  A 1 11 ? 74.547  83.726  19.554  1.00 15.35 ? 111 DG  F C8    1 
ATOM   217  N N7    . DG  A 1 11 ? 74.519  83.215  20.758  1.00 16.38 ? 111 DG  F N7    1 
ATOM   218  C C5    . DG  A 1 11 ? 75.118  84.184  21.558  1.00 16.69 ? 111 DG  F C5    1 
ATOM   219  C C6    . DG  A 1 11 ? 75.359  84.206  22.972  1.00 16.72 ? 111 DG  F C6    1 
ATOM   220  O O6    . DG  A 1 11 ? 75.035  83.366  23.832  1.00 15.16 ? 111 DG  F O6    1 
ATOM   221  N N1    . DG  A 1 11 ? 76.031  85.366  23.356  1.00 16.31 ? 111 DG  F N1    1 
ATOM   222  C C2    . DG  A 1 11 ? 76.397  86.382  22.509  1.00 16.18 ? 111 DG  F C2    1 
ATOM   223  N N2    . DG  A 1 11 ? 77.049  87.411  23.073  1.00 15.16 ? 111 DG  F N2    1 
ATOM   224  N N3    . DG  A 1 11 ? 76.149  86.389  21.202  1.00 15.69 ? 111 DG  F N3    1 
ATOM   225  C C4    . DG  A 1 11 ? 75.518  85.266  20.800  1.00 16.08 ? 111 DG  F C4    1 
ATOM   226  P P     . DT  A 1 12 ? 77.237  87.079  14.867  1.00 18.43 ? 112 DT  F P     1 
ATOM   227  O OP1   . DT  A 1 12 ? 77.525  88.341  14.146  1.00 18.94 ? 112 DT  F OP1   1 
ATOM   228  O OP2   . DT  A 1 12 ? 77.207  85.798  14.118  1.00 17.02 ? 112 DT  F OP2   1 
ATOM   229  O "O5'" . DT  A 1 12 ? 78.269  86.961  16.067  1.00 19.39 ? 112 DT  F "O5'" 1 
ATOM   230  C "C5'" . DT  A 1 12 ? 78.229  87.923  17.111  1.00 21.24 ? 112 DT  F "C5'" 1 
ATOM   231  C "C4'" . DT  A 1 12 ? 79.253  87.594  18.167  1.00 22.45 ? 112 DT  F "C4'" 1 
ATOM   232  O "O4'" . DT  A 1 12 ? 78.732  86.683  19.167  1.00 21.80 ? 112 DT  F "O4'" 1 
ATOM   233  C "C3'" . DT  A 1 12 ? 80.533  86.968  17.622  1.00 23.46 ? 112 DT  F "C3'" 1 
ATOM   234  O "O3'" . DT  A 1 12 ? 81.631  87.788  18.000  1.00 27.09 ? 112 DT  F "O3'" 1 
ATOM   235  C "C2'" . DT  A 1 12 ? 80.585  85.597  18.288  1.00 23.16 ? 112 DT  F "C2'" 1 
ATOM   236  C "C1'" . DT  A 1 12 ? 79.769  85.802  19.552  1.00 21.49 ? 112 DT  F "C1'" 1 
ATOM   237  N N1    . DT  A 1 12 ? 79.149  84.587  20.154  1.00 18.75 ? 112 DT  F N1    1 
ATOM   238  C C2    . DT  A 1 12 ? 79.206  84.454  21.530  1.00 18.21 ? 112 DT  F C2    1 
ATOM   239  O O2    . DT  A 1 12 ? 79.742  85.274  22.259  1.00 19.82 ? 112 DT  F O2    1 
ATOM   240  N N3    . DT  A 1 12 ? 78.606  83.319  22.025  1.00 16.10 ? 112 DT  F N3    1 
ATOM   241  C C4    . DT  A 1 12 ? 77.974  82.325  21.300  1.00 15.50 ? 112 DT  F C4    1 
ATOM   242  O O4    . DT  A 1 12 ? 77.479  81.360  21.885  1.00 15.16 ? 112 DT  F O4    1 
ATOM   243  C C5    . DT  A 1 12 ? 77.955  82.524  19.865  1.00 16.47 ? 112 DT  F C5    1 
ATOM   244  C C7    . DT  A 1 12 ? 77.291  81.495  19.005  1.00 17.60 ? 112 DT  F C7    1 
ATOM   245  C C6    . DT  A 1 12 ? 78.536  83.630  19.370  1.00 16.93 ? 112 DT  F C6    1 
ATOM   246  P P     . DG  A 1 13 ? 83.002  87.721  17.171  1.00 26.41 ? 113 DG  F P     1 
ATOM   247  O OP1   . DG  A 1 13 ? 83.231  89.085  16.641  1.00 28.36 ? 113 DG  F OP1   1 
ATOM   248  O OP2   . DG  A 1 13 ? 83.016  86.557  16.251  1.00 26.30 ? 113 DG  F OP2   1 
ATOM   249  O "O5'" . DG  A 1 13 ? 84.062  87.452  18.324  1.00 26.59 ? 113 DG  F "O5'" 1 
ATOM   250  C "C5'" . DG  A 1 13 ? 84.025  88.219  19.523  1.00 23.22 ? 113 DG  F "C5'" 1 
ATOM   251  C "C4'" . DG  A 1 13 ? 84.700  87.461  20.639  1.00 21.39 ? 113 DG  F "C4'" 1 
ATOM   252  O "O4'" . DG  A 1 13 ? 83.844  86.418  21.152  1.00 18.83 ? 113 DG  F "O4'" 1 
ATOM   253  C "C3'" . DG  A 1 13 ? 85.997  86.766  20.225  1.00 23.06 ? 113 DG  F "C3'" 1 
ATOM   254  O "O3'" . DG  A 1 13 ? 86.834  86.709  21.369  1.00 27.46 ? 113 DG  F "O3'" 1 
ATOM   255  C "C2'" . DG  A 1 13 ? 85.542  85.349  19.944  1.00 19.75 ? 113 DG  F "C2'" 1 
ATOM   256  C "C1'" . DG  A 1 13 ? 84.531  85.177  21.052  1.00 18.34 ? 113 DG  F "C1'" 1 
ATOM   257  N N9    . DG  A 1 13 ? 83.552  84.123  20.830  1.00 17.42 ? 113 DG  F N9    1 
ATOM   258  C C8    . DG  A 1 13 ? 83.064  83.665  19.632  1.00 16.79 ? 113 DG  F C8    1 
ATOM   259  N N7    . DG  A 1 13 ? 82.218  82.681  19.770  1.00 16.96 ? 113 DG  F N7    1 
ATOM   260  C C5    . DG  A 1 13 ? 82.139  82.488  21.143  1.00 15.16 ? 113 DG  F C5    1 
ATOM   261  C C6    . DG  A 1 13 ? 81.396  81.547  21.900  1.00 16.57 ? 113 DG  F C6    1 
ATOM   262  O O6    . DG  A 1 13 ? 80.615  80.686  21.492  1.00 16.09 ? 113 DG  F O6    1 
ATOM   263  N N1    . DG  A 1 13 ? 81.634  81.681  23.269  1.00 15.16 ? 113 DG  F N1    1 
ATOM   264  C C2    . DG  A 1 13 ? 82.470  82.618  23.831  1.00 17.76 ? 113 DG  F C2    1 
ATOM   265  N N2    . DG  A 1 13 ? 82.580  82.605  25.166  1.00 18.64 ? 113 DG  F N2    1 
ATOM   266  N N3    . DG  A 1 13 ? 83.154  83.507  23.134  1.00 16.53 ? 113 DG  F N3    1 
ATOM   267  C C4    . DG  A 1 13 ? 82.950  83.378  21.807  1.00 17.38 ? 113 DG  F C4    1 
ATOM   268  P P     . DC  A 1 14 ? 88.342  87.210  21.278  1.00 27.05 ? 114 DC  F P     1 
ATOM   269  O OP1   . DC  A 1 14 ? 88.358  88.527  21.961  1.00 29.18 ? 114 DC  F OP1   1 
ATOM   270  O OP2   . DC  A 1 14 ? 88.822  87.099  19.884  1.00 26.99 ? 114 DC  F OP2   1 
ATOM   271  O "O5'" . DC  A 1 14 ? 89.090  86.138  22.181  1.00 28.66 ? 114 DC  F "O5'" 1 
ATOM   272  C "C5'" . DC  A 1 14 ? 88.786  86.053  23.565  1.00 29.31 ? 114 DC  F "C5'" 1 
ATOM   273  C "C4'" . DC  A 1 14 ? 88.747  84.617  24.039  1.00 25.86 ? 114 DC  F "C4'" 1 
ATOM   274  O "O4'" . DC  A 1 14 ? 87.466  83.977  23.771  1.00 25.72 ? 114 DC  F "O4'" 1 
ATOM   275  C "C3'" . DC  A 1 14 ? 89.840  83.657  23.548  1.00 26.31 ? 114 DC  F "C3'" 1 
ATOM   276  O "O3'" . DC  A 1 14 ? 90.617  83.191  24.652  1.00 23.17 ? 114 DC  F "O3'" 1 
ATOM   277  C "C2'" . DC  A 1 14 ? 89.056  82.492  22.966  1.00 24.59 ? 114 DC  F "C2'" 1 
ATOM   278  C "C1'" . DC  A 1 14 ? 87.703  82.585  23.671  1.00 25.05 ? 114 DC  F "C1'" 1 
ATOM   279  N N1    . DC  A 1 14 ? 86.622  81.952  22.881  1.00 20.85 ? 114 DC  F N1    1 
ATOM   280  C C2    . DC  A 1 14 ? 85.766  81.007  23.496  1.00 20.81 ? 114 DC  F C2    1 
ATOM   281  O O2    . DC  A 1 14 ? 85.814  80.848  24.726  1.00 18.97 ? 114 DC  F O2    1 
ATOM   282  N N3    . DC  A 1 14 ? 84.910  80.297  22.724  1.00 17.49 ? 114 DC  F N3    1 
ATOM   283  C C4    . DC  A 1 14 ? 84.859  80.519  21.406  1.00 19.75 ? 114 DC  F C4    1 
ATOM   284  N N4    . DC  A 1 14 ? 84.046  79.757  20.665  1.00 18.32 ? 114 DC  F N4    1 
ATOM   285  C C5    . DC  A 1 14 ? 85.650  81.529  20.779  1.00 19.63 ? 114 DC  F C5    1 
ATOM   286  C C6    . DC  A 1 14 ? 86.501  82.218  21.547  1.00 20.96 ? 114 DC  F C6    1 
ATOM   287  P P     . DT  A 1 15 ? 91.776  82.091  24.433  1.00 26.15 ? 115 DT  F P     1 
ATOM   288  O OP1   . DT  A 1 15 ? 93.004  82.632  25.081  1.00 24.30 ? 115 DT  F OP1   1 
ATOM   289  O OP2   . DT  A 1 15 ? 91.839  81.634  23.019  1.00 22.67 ? 115 DT  F OP2   1 
ATOM   290  O "O5'" . DT  A 1 15 ? 91.275  80.886  25.333  1.00 24.86 ? 115 DT  F "O5'" 1 
ATOM   291  C "C5'" . DT  A 1 15 ? 90.771  81.123  26.645  1.00 26.04 ? 115 DT  F "C5'" 1 
ATOM   292  C "C4'" . DT  A 1 15 ? 90.383  79.816  27.291  1.00 26.49 ? 115 DT  F "C4'" 1 
ATOM   293  O "O4'" . DT  A 1 15 ? 89.206  79.296  26.620  1.00 25.26 ? 115 DT  F "O4'" 1 
ATOM   294  C "C3'" . DT  A 1 15 ? 91.465  78.744  27.165  1.00 27.53 ? 115 DT  F "C3'" 1 
ATOM   295  O "O3'" . DT  A 1 15 ? 91.623  78.020  28.388  1.00 28.48 ? 115 DT  F "O3'" 1 
ATOM   296  C "C2'" . DT  A 1 15 ? 90.981  77.868  26.019  1.00 25.24 ? 115 DT  F "C2'" 1 
ATOM   297  C "C1'" . DT  A 1 15 ? 89.465  78.013  26.067  1.00 24.56 ? 115 DT  F "C1'" 1 
ATOM   298  N N1    . DT  A 1 15 ? 88.795  77.955  24.743  1.00 22.28 ? 115 DT  F N1    1 
ATOM   299  C C2    . DT  A 1 15 ? 87.694  77.135  24.596  1.00 22.35 ? 115 DT  F C2    1 
ATOM   300  O O2    . DT  A 1 15 ? 87.242  76.445  25.505  1.00 21.05 ? 115 DT  F O2    1 
ATOM   301  N N3    . DT  A 1 15 ? 87.133  77.151  23.341  1.00 20.79 ? 115 DT  F N3    1 
ATOM   302  C C4    . DT  A 1 15 ? 87.554  77.886  22.245  1.00 21.05 ? 115 DT  F C4    1 
ATOM   303  O O4    . DT  A 1 15 ? 86.953  77.799  21.177  1.00 21.85 ? 115 DT  F O4    1 
ATOM   304  C C5    . DT  A 1 15 ? 88.708  78.717  22.469  1.00 20.61 ? 115 DT  F C5    1 
ATOM   305  C C7    . DT  A 1 15 ? 89.232  79.545  21.340  1.00 18.41 ? 115 DT  F C7    1 
ATOM   306  C C6    . DT  A 1 15 ? 89.265  78.710  23.688  1.00 21.45 ? 115 DT  F C6    1 
ATOM   307  P P     . DA  A 1 16 ? 92.820  76.956  28.529  1.00 29.85 ? 116 DA  F P     1 
ATOM   308  O OP1   . DA  A 1 16 ? 93.177  76.853  29.965  1.00 30.40 ? 116 DA  F OP1   1 
ATOM   309  O OP2   . DA  A 1 16 ? 93.864  77.276  27.527  1.00 30.10 ? 116 DA  F OP2   1 
ATOM   310  O "O5'" . DA  A 1 16 ? 92.118  75.598  28.102  1.00 28.65 ? 116 DA  F "O5'" 1 
ATOM   311  C "C5'" . DA  A 1 16 ? 90.962  75.159  28.795  1.00 28.11 ? 116 DA  F "C5'" 1 
ATOM   312  C "C4'" . DA  A 1 16 ? 90.474  73.857  28.217  1.00 27.13 ? 116 DA  F "C4'" 1 
ATOM   313  O "O4'" . DA  A 1 16 ? 89.822  74.094  26.946  1.00 26.58 ? 116 DA  F "O4'" 1 
ATOM   314  C "C3'" . DA  A 1 16 ? 91.572  72.825  27.962  1.00 27.46 ? 116 DA  F "C3'" 1 
ATOM   315  O "O3'" . DA  A 1 16 ? 91.131  71.568  28.460  1.00 30.04 ? 116 DA  F "O3'" 1 
ATOM   316  C "C2'" . DA  A 1 16 ? 91.721  72.817  26.447  1.00 27.15 ? 116 DA  F "C2'" 1 
ATOM   317  C "C1'" . DA  A 1 16 ? 90.338  73.220  25.957  1.00 25.56 ? 116 DA  F "C1'" 1 
ATOM   318  N N9    . DA  A 1 16 ? 90.315  73.942  24.684  1.00 24.35 ? 116 DA  F N9    1 
ATOM   319  C C8    . DA  A 1 16 ? 91.168  74.937  24.276  1.00 23.86 ? 116 DA  F C8    1 
ATOM   320  N N7    . DA  A 1 16 ? 90.882  75.431  23.097  1.00 23.77 ? 116 DA  F N7    1 
ATOM   321  C C5    . DA  A 1 16 ? 89.770  74.706  22.692  1.00 23.89 ? 116 DA  F C5    1 
ATOM   322  C C6    . DA  A 1 16 ? 88.980  74.759  21.527  1.00 23.20 ? 116 DA  F C6    1 
ATOM   323  N N6    . DA  A 1 16 ? 89.200  75.610  20.524  1.00 24.26 ? 116 DA  F N6    1 
ATOM   324  N N1    . DA  A 1 16 ? 87.941  73.898  21.431  1.00 23.52 ? 116 DA  F N1    1 
ATOM   325  C C2    . DA  A 1 16 ? 87.719  73.051  22.444  1.00 23.16 ? 116 DA  F C2    1 
ATOM   326  N N3    . DA  A 1 16 ? 88.388  72.911  23.594  1.00 23.94 ? 116 DA  F N3    1 
ATOM   327  C C4    . DA  A 1 16 ? 89.413  73.779  23.655  1.00 23.34 ? 116 DA  F C4    1 
ATOM   328  P P     . DC  A 1 17 ? 92.141  70.322  28.511  1.00 31.07 ? 117 DC  F P     1 
ATOM   329  O OP1   . DC  A 1 17 ? 92.044  69.792  29.893  1.00 31.87 ? 117 DC  F OP1   1 
ATOM   330  O OP2   . DC  A 1 17 ? 93.464  70.695  27.954  1.00 30.79 ? 117 DC  F OP2   1 
ATOM   331  O "O5'" . DC  A 1 17 ? 91.431  69.314  27.510  1.00 29.93 ? 117 DC  F "O5'" 1 
ATOM   332  C "C5'" . DC  A 1 17 ? 90.013  69.205  27.529  1.00 29.95 ? 117 DC  F "C5'" 1 
ATOM   333  C "C4'" . DC  A 1 17 ? 89.508  68.576  26.256  1.00 29.68 ? 117 DC  F "C4'" 1 
ATOM   334  O "O4'" . DC  A 1 17 ? 89.512  69.521  25.158  1.00 30.26 ? 117 DC  F "O4'" 1 
ATOM   335  C "C3'" . DC  A 1 17 ? 90.301  67.357  25.787  1.00 30.55 ? 117 DC  F "C3'" 1 
ATOM   336  O "O3'" . DC  A 1 17 ? 89.395  66.273  25.580  1.00 30.87 ? 117 DC  F "O3'" 1 
ATOM   337  C "C2'" . DC  A 1 17 ? 90.947  67.814  24.486  1.00 29.11 ? 117 DC  F "C2'" 1 
ATOM   338  C "C1'" . DC  A 1 17 ? 89.972  68.870  23.989  1.00 29.18 ? 117 DC  F "C1'" 1 
ATOM   339  N N1    . DC  A 1 17 ? 90.518  69.899  23.085  1.00 28.11 ? 117 DC  F N1    1 
ATOM   340  C C2    . DC  A 1 17 ? 89.831  70.186  21.889  1.00 28.22 ? 117 DC  F C2    1 
ATOM   341  O O2    . DC  A 1 17 ? 88.814  69.535  21.605  1.00 29.27 ? 117 DC  F O2    1 
ATOM   342  N N3    . DC  A 1 17 ? 90.295  71.160  21.077  1.00 26.73 ? 117 DC  F N3    1 
ATOM   343  C C4    . DC  A 1 17 ? 91.401  71.829  21.403  1.00 27.03 ? 117 DC  F C4    1 
ATOM   344  N N4    . DC  A 1 17 ? 91.818  72.784  20.567  1.00 26.35 ? 117 DC  F N4    1 
ATOM   345  C C5    . DC  A 1 17 ? 92.131  71.549  22.599  1.00 27.32 ? 117 DC  F C5    1 
ATOM   346  C C6    . DC  A 1 17 ? 91.659  70.584  23.401  1.00 27.37 ? 117 DC  F C6    1 
ATOM   347  P P     . DT  A 1 18 ? 89.959  64.770  25.485  1.00 32.33 ? 118 DT  F P     1 
ATOM   348  O OP1   . DT  A 1 18 ? 88.906  63.872  26.040  1.00 31.44 ? 118 DT  F OP1   1 
ATOM   349  O OP2   . DT  A 1 18 ? 91.336  64.717  26.032  1.00 29.99 ? 118 DT  F OP2   1 
ATOM   350  O "O5'" . DT  A 1 18 ? 90.000  64.561  23.912  1.00 31.32 ? 118 DT  F "O5'" 1 
ATOM   351  C "C5'" . DT  A 1 18 ? 88.799  64.709  23.168  1.00 32.06 ? 118 DT  F "C5'" 1 
ATOM   352  C "C4'" . DT  A 1 18 ? 89.070  64.601  21.689  1.00 30.58 ? 118 DT  F "C4'" 1 
ATOM   353  O "O4'" . DT  A 1 18 ? 89.502  65.872  21.146  1.00 30.12 ? 118 DT  F "O4'" 1 
ATOM   354  C "C3'" . DT  A 1 18 ? 90.130  63.571  21.304  1.00 31.29 ? 118 DT  F "C3'" 1 
ATOM   355  O "O3'" . DT  A 1 18 ? 89.600  62.692  20.322  1.00 32.32 ? 118 DT  F "O3'" 1 
ATOM   356  C "C2'" . DT  A 1 18 ? 91.255  64.408  20.713  1.00 31.29 ? 118 DT  F "C2'" 1 
ATOM   357  C "C1'" . DT  A 1 18 ? 90.523  65.637  20.198  1.00 30.62 ? 118 DT  F "C1'" 1 
ATOM   358  N N1    . DT  A 1 18 ? 91.352  66.859  20.094  1.00 30.24 ? 118 DT  F N1    1 
ATOM   359  C C2    . DT  A 1 18 ? 91.208  67.651  18.973  1.00 30.49 ? 118 DT  F C2    1 
ATOM   360  O O2    . DT  A 1 18 ? 90.416  67.407  18.078  1.00 31.82 ? 118 DT  F O2    1 
ATOM   361  N N3    . DT  A 1 18 ? 92.035  68.748  18.942  1.00 29.65 ? 118 DT  F N3    1 
ATOM   362  C C4    . DT  A 1 18 ? 92.963  69.124  19.898  1.00 29.21 ? 118 DT  F C4    1 
ATOM   363  O O4    . DT  A 1 18 ? 93.631  70.142  19.742  1.00 28.65 ? 118 DT  F O4    1 
ATOM   364  C C5    . DT  A 1 18 ? 93.060  68.253  21.036  1.00 30.07 ? 118 DT  F C5    1 
ATOM   365  C C7    . DT  A 1 18 ? 94.060  68.571  22.103  1.00 30.53 ? 118 DT  F C7    1 
ATOM   366  C C6    . DT  A 1 18 ? 92.255  67.184  21.084  1.00 29.83 ? 118 DT  F C6    1 
ATOM   367  P P     . DC  A 1 19 ? 90.435  61.400  19.878  1.00 32.84 ? 119 DC  F P     1 
ATOM   368  O OP1   . DC  A 1 19 ? 89.482  60.269  19.892  1.00 34.29 ? 119 DC  F OP1   1 
ATOM   369  O OP2   . DC  A 1 19 ? 91.687  61.318  20.672  1.00 33.83 ? 119 DC  F OP2   1 
ATOM   370  O "O5'" . DC  A 1 19 ? 90.785  61.726  18.360  1.00 32.41 ? 119 DC  F "O5'" 1 
ATOM   371  C "C5'" . DC  A 1 19 ? 89.741  62.073  17.448  1.00 31.55 ? 119 DC  F "C5'" 1 
ATOM   372  C "C4'" . DC  A 1 19 ? 90.303  62.729  16.209  1.00 30.33 ? 119 DC  F "C4'" 1 
ATOM   373  O "O4'" . DC  A 1 19 ? 90.807  64.049  16.522  1.00 29.64 ? 119 DC  F "O4'" 1 
ATOM   374  C "C3'" . DC  A 1 19 ? 91.451  61.969  15.539  1.00 30.27 ? 119 DC  F "C3'" 1 
ATOM   375  O "O3'" . DC  A 1 19 ? 91.111  61.245  14.352  1.00 33.05 ? 119 DC  F "O3'" 1 
ATOM   376  C "C2'" . DC  A 1 19 ? 92.588  62.973  15.446  1.00 29.61 ? 119 DC  F "C2'" 1 
ATOM   377  C "C1'" . DC  A 1 19 ? 91.927  64.326  15.699  1.00 28.43 ? 119 DC  F "C1'" 1 
ATOM   378  N N1    . DC  A 1 19 ? 92.811  65.253  16.429  1.00 26.81 ? 119 DC  F N1    1 
ATOM   379  C C2    . DC  A 1 19 ? 93.121  66.499  15.862  1.00 24.92 ? 119 DC  F C2    1 
ATOM   380  O O2    . DC  A 1 19 ? 92.596  66.817  14.788  1.00 23.11 ? 119 DC  F O2    1 
ATOM   381  N N3    . DC  A 1 19 ? 93.986  67.323  16.506  1.00 24.84 ? 119 DC  F N3    1 
ATOM   382  C C4    . DC  A 1 19 ? 94.518  66.948  17.674  1.00 25.62 ? 119 DC  F C4    1 
ATOM   383  N N4    . DC  A 1 19 ? 95.382  67.778  18.270  1.00 26.30 ? 119 DC  F N4    1 
ATOM   384  C C5    . DC  A 1 19 ? 94.195  65.703  18.284  1.00 26.08 ? 119 DC  F C5    1 
ATOM   385  C C6    . DC  A 1 19 ? 93.345  64.895  17.636  1.00 26.61 ? 119 DC  F C6    1 
ATOM   386  O "O5'" . DC  B 1 1  ? 95.840  80.987  11.760  1.00 51.40 ? 301 DC  G "O5'" 1 
ATOM   387  C "C5'" . DC  B 1 1  ? 96.937  80.518  10.965  1.00 51.62 ? 301 DC  G "C5'" 1 
ATOM   388  C "C4'" . DC  B 1 1  ? 98.160  80.224  11.803  1.00 50.78 ? 301 DC  G "C4'" 1 
ATOM   389  O "O4'" . DC  B 1 1  ? 98.595  81.443  12.453  1.00 51.13 ? 301 DC  G "O4'" 1 
ATOM   390  C "C3'" . DC  B 1 1  ? 97.924  79.210  12.923  1.00 49.88 ? 301 DC  G "C3'" 1 
ATOM   391  O "O3'" . DC  B 1 1  ? 99.080  78.389  13.117  1.00 47.98 ? 301 DC  G "O3'" 1 
ATOM   392  C "C2'" . DC  B 1 1  ? 97.695  80.081  14.142  1.00 50.52 ? 301 DC  G "C2'" 1 
ATOM   393  C "C1'" . DC  B 1 1  ? 98.596  81.271  13.863  1.00 51.20 ? 301 DC  G "C1'" 1 
ATOM   394  N N1    . DC  B 1 1  ? 98.125  82.523  14.470  1.00 51.33 ? 301 DC  G N1    1 
ATOM   395  C C2    . DC  B 1 1  ? 98.604  82.879  15.734  1.00 51.35 ? 301 DC  G C2    1 
ATOM   396  O O2    . DC  B 1 1  ? 99.410  82.129  16.303  1.00 50.94 ? 301 DC  G O2    1 
ATOM   397  N N3    . DC  B 1 1  ? 98.174  84.026  16.304  1.00 51.48 ? 301 DC  G N3    1 
ATOM   398  C C4    . DC  B 1 1  ? 97.296  84.801  15.662  1.00 52.13 ? 301 DC  G C4    1 
ATOM   399  N N4    . DC  B 1 1  ? 96.886  85.918  16.268  1.00 52.30 ? 301 DC  G N4    1 
ATOM   400  C C5    . DC  B 1 1  ? 96.795  84.463  14.371  1.00 51.60 ? 301 DC  G C5    1 
ATOM   401  C C6    . DC  B 1 1  ? 97.232  83.326  13.818  1.00 51.44 ? 301 DC  G C6    1 
ATOM   402  P P     . DG  B 1 2  ? 98.919  76.950  13.810  1.00 46.26 ? 302 DG  G P     1 
ATOM   403  O OP1   . DG  B 1 2  ? 98.350  77.155  15.165  1.00 45.32 ? 302 DG  G OP1   1 
ATOM   404  O OP2   . DG  B 1 2  ? 100.205 76.226  13.655  1.00 46.69 ? 302 DG  G OP2   1 
ATOM   405  O "O5'" . DG  B 1 2  ? 97.836  76.217  12.902  1.00 45.29 ? 302 DG  G "O5'" 1 
ATOM   406  C "C5'" . DG  B 1 2  ? 98.047  76.051  11.504  1.00 42.87 ? 302 DG  G "C5'" 1 
ATOM   407  C "C4'" . DG  B 1 2  ? 96.895  75.288  10.893  1.00 41.74 ? 302 DG  G "C4'" 1 
ATOM   408  O "O4'" . DG  B 1 2  ? 96.798  74.008  11.559  1.00 41.44 ? 302 DG  G "O4'" 1 
ATOM   409  C "C3'" . DG  B 1 2  ? 95.521  75.941  11.047  1.00 41.89 ? 302 DG  G "C3'" 1 
ATOM   410  O "O3'" . DG  B 1 2  ? 94.725  75.632  9.897   1.00 42.68 ? 302 DG  G "O3'" 1 
ATOM   411  C "C2'" . DG  B 1 2  ? 94.960  75.278  12.292  1.00 40.52 ? 302 DG  G "C2'" 1 
ATOM   412  C "C1'" . DG  B 1 2  ? 95.533  73.873  12.193  1.00 38.84 ? 302 DG  G "C1'" 1 
ATOM   413  N N9    . DG  B 1 2  ? 95.753  73.215  13.476  1.00 36.42 ? 302 DG  G N9    1 
ATOM   414  C C8    . DG  B 1 2  ? 96.457  73.708  14.548  1.00 36.11 ? 302 DG  G C8    1 
ATOM   415  N N7    . DG  B 1 2  ? 96.490  72.884  15.561  1.00 35.42 ? 302 DG  G N7    1 
ATOM   416  C C5    . DG  B 1 2  ? 95.763  71.783  15.132  1.00 34.39 ? 302 DG  G C5    1 
ATOM   417  C C6    . DG  B 1 2  ? 95.447  70.576  15.801  1.00 32.35 ? 302 DG  G C6    1 
ATOM   418  O O6    . DG  B 1 2  ? 95.757  70.225  16.941  1.00 32.76 ? 302 DG  G O6    1 
ATOM   419  N N1    . DG  B 1 2  ? 94.684  69.733  15.003  1.00 31.81 ? 302 DG  G N1    1 
ATOM   420  C C2    . DG  B 1 2  ? 94.276  70.013  13.724  1.00 32.52 ? 302 DG  G C2    1 
ATOM   421  N N2    . DG  B 1 2  ? 93.541  69.068  13.117  1.00 31.80 ? 302 DG  G N2    1 
ATOM   422  N N3    . DG  B 1 2  ? 94.564  71.137  13.086  1.00 33.67 ? 302 DG  G N3    1 
ATOM   423  C C4    . DG  B 1 2  ? 95.302  71.971  13.846  1.00 34.59 ? 302 DG  G C4    1 
ATOM   424  P P     . DA  B 1 3  ? 93.231  76.215  9.768   1.00 44.41 ? 303 DA  G P     1 
ATOM   425  O OP1   . DA  B 1 3  ? 93.036  76.620  8.351   1.00 43.86 ? 303 DA  G OP1   1 
ATOM   426  O OP2   . DA  B 1 3  ? 92.982  77.200  10.855  1.00 43.52 ? 303 DA  G OP2   1 
ATOM   427  O "O5'" . DA  B 1 3  ? 92.314  74.943  10.030  1.00 42.34 ? 303 DA  G "O5'" 1 
ATOM   428  C "C5'" . DA  B 1 3  ? 92.334  73.839  9.132   1.00 41.11 ? 303 DA  G "C5'" 1 
ATOM   429  C "C4'" . DA  B 1 3  ? 91.300  72.818  9.539   1.00 39.52 ? 303 DA  G "C4'" 1 
ATOM   430  O "O4'" . DA  B 1 3  ? 91.682  72.212  10.798  1.00 38.89 ? 303 DA  G "O4'" 1 
ATOM   431  C "C3'" . DA  B 1 3  ? 89.908  73.405  9.759   1.00 39.26 ? 303 DA  G "C3'" 1 
ATOM   432  O "O3'" . DA  B 1 3  ? 88.917  72.496  9.281   1.00 38.09 ? 303 DA  G "O3'" 1 
ATOM   433  C "C2'" . DA  B 1 3  ? 89.820  73.567  11.267  1.00 38.77 ? 303 DA  G "C2'" 1 
ATOM   434  C "C1'" . DA  B 1 3  ? 90.661  72.407  11.771  1.00 39.17 ? 303 DA  G "C1'" 1 
ATOM   435  N N9    . DA  B 1 3  ? 91.315  72.645  13.058  1.00 38.43 ? 303 DA  G N9    1 
ATOM   436  C C8    . DA  B 1 3  ? 92.075  73.724  13.433  1.00 39.28 ? 303 DA  G C8    1 
ATOM   437  N N7    . DA  B 1 3  ? 92.563  73.632  14.648  1.00 39.30 ? 303 DA  G N7    1 
ATOM   438  C C5    . DA  B 1 3  ? 92.085  72.411  15.106  1.00 38.98 ? 303 DA  G C5    1 
ATOM   439  C C6    . DA  B 1 3  ? 92.255  71.724  16.321  1.00 39.59 ? 303 DA  G C6    1 
ATOM   440  N N6    . DA  B 1 3  ? 93.001  72.180  17.334  1.00 39.74 ? 303 DA  G N6    1 
ATOM   441  N N1    . DA  B 1 3  ? 91.632  70.534  16.459  1.00 38.43 ? 303 DA  G N1    1 
ATOM   442  C C2    . DA  B 1 3  ? 90.904  70.068  15.437  1.00 38.54 ? 303 DA  G C2    1 
ATOM   443  N N3    . DA  B 1 3  ? 90.680  70.614  14.244  1.00 38.78 ? 303 DA  G N3    1 
ATOM   444  C C4    . DA  B 1 3  ? 91.305  71.799  14.141  1.00 38.99 ? 303 DA  G C4    1 
ATOM   445  P P     . DG  B 1 4  ? 87.369  72.911  9.339   1.00 38.61 ? 304 DG  G P     1 
ATOM   446  O OP1   . DG  B 1 4  ? 86.674  72.295  8.174   1.00 37.46 ? 304 DG  G OP1   1 
ATOM   447  O OP2   . DG  B 1 4  ? 87.295  74.384  9.550   1.00 36.86 ? 304 DG  G OP2   1 
ATOM   448  O "O5'" . DG  B 1 4  ? 86.849  72.186  10.654  1.00 35.20 ? 304 DG  G "O5'" 1 
ATOM   449  C "C5'" . DG  B 1 4  ? 86.762  70.772  10.701  1.00 31.92 ? 304 DG  G "C5'" 1 
ATOM   450  C "C4'" . DG  B 1 4  ? 86.105  70.336  11.986  1.00 30.28 ? 304 DG  G "C4'" 1 
ATOM   451  O "O4'" . DG  B 1 4  ? 87.002  70.549  13.105  1.00 29.86 ? 304 DG  G "O4'" 1 
ATOM   452  C "C3'" . DG  B 1 4  ? 84.805  71.069  12.326  1.00 28.45 ? 304 DG  G "C3'" 1 
ATOM   453  O "O3'" . DG  B 1 4  ? 83.860  70.105  12.783  1.00 26.95 ? 304 DG  G "O3'" 1 
ATOM   454  C "C2'" . DG  B 1 4  ? 85.213  72.018  13.443  1.00 29.09 ? 304 DG  G "C2'" 1 
ATOM   455  C "C1'" . DG  B 1 4  ? 86.308  71.229  14.141  1.00 28.56 ? 304 DG  G "C1'" 1 
ATOM   456  N N9    . DG  B 1 4  ? 87.283  72.020  14.884  1.00 26.90 ? 304 DG  G N9    1 
ATOM   457  C C8    . DG  B 1 4  ? 87.926  73.160  14.467  1.00 26.53 ? 304 DG  G C8    1 
ATOM   458  N N7    . DG  B 1 4  ? 88.764  73.629  15.353  1.00 25.55 ? 304 DG  G N7    1 
ATOM   459  C C5    . DG  B 1 4  ? 88.667  72.747  16.419  1.00 26.04 ? 304 DG  G C5    1 
ATOM   460  C C6    . DG  B 1 4  ? 89.348  72.730  17.665  1.00 25.67 ? 304 DG  G C6    1 
ATOM   461  O O6    . DG  B 1 4  ? 90.210  73.510  18.082  1.00 25.62 ? 304 DG  G O6    1 
ATOM   462  N N1    . DG  B 1 4  ? 88.940  71.663  18.457  1.00 25.76 ? 304 DG  G N1    1 
ATOM   463  C C2    . DG  B 1 4  ? 88.009  70.721  18.094  1.00 27.20 ? 304 DG  G C2    1 
ATOM   464  N N2    . DG  B 1 4  ? 87.742  69.767  19.003  1.00 26.83 ? 304 DG  G N2    1 
ATOM   465  N N3    . DG  B 1 4  ? 87.381  70.715  16.928  1.00 26.69 ? 304 DG  G N3    1 
ATOM   466  C C4    . DG  B 1 4  ? 87.753  71.751  16.149  1.00 26.64 ? 304 DG  G C4    1 
ATOM   467  P P     . DT  B 1 5  ? 82.340  70.532  13.065  1.00 26.94 ? 305 DT  G P     1 
ATOM   468  O OP1   . DT  B 1 5  ? 81.506  69.359  12.708  1.00 24.97 ? 305 DT  G OP1   1 
ATOM   469  O OP2   . DT  B 1 5  ? 82.038  71.858  12.474  1.00 24.75 ? 305 DT  G OP2   1 
ATOM   470  O "O5'" . DT  B 1 5  ? 82.306  70.697  14.645  1.00 24.17 ? 305 DT  G "O5'" 1 
ATOM   471  C "C5'" . DT  B 1 5  ? 82.615  69.597  15.493  1.00 24.59 ? 305 DT  G "C5'" 1 
ATOM   472  C "C4'" . DT  B 1 5  ? 82.634  70.051  16.931  1.00 23.54 ? 305 DT  G "C4'" 1 
ATOM   473  O "O4'" . DT  B 1 5  ? 83.845  70.796  17.227  1.00 24.00 ? 305 DT  G "O4'" 1 
ATOM   474  C "C3'" . DT  B 1 5  ? 81.469  70.978  17.297  1.00 21.85 ? 305 DT  G "C3'" 1 
ATOM   475  O "O3'" . DT  B 1 5  ? 81.059  70.662  18.624  1.00 21.90 ? 305 DT  G "O3'" 1 
ATOM   476  C "C2'" . DT  B 1 5  ? 82.125  72.346  17.322  1.00 23.43 ? 305 DT  G "C2'" 1 
ATOM   477  C "C1'" . DT  B 1 5  ? 83.457  71.963  17.926  1.00 23.69 ? 305 DT  G "C1'" 1 
ATOM   478  N N1    . DT  B 1 5  ? 84.550  72.955  17.870  1.00 23.10 ? 305 DT  G N1    1 
ATOM   479  C C2    . DT  B 1 5  ? 85.398  72.985  18.950  1.00 22.17 ? 305 DT  G C2    1 
ATOM   480  O O2    . DT  B 1 5  ? 85.304  72.206  19.892  1.00 22.56 ? 305 DT  G O2    1 
ATOM   481  N N3    . DT  B 1 5  ? 86.366  73.953  18.889  1.00 23.37 ? 305 DT  G N3    1 
ATOM   482  C C4    . DT  B 1 5  ? 86.573  74.864  17.874  1.00 23.21 ? 305 DT  G C4    1 
ATOM   483  O O4    . DT  B 1 5  ? 87.483  75.685  17.963  1.00 25.11 ? 305 DT  G O4    1 
ATOM   484  C C5    . DT  B 1 5  ? 85.663  74.762  16.759  1.00 23.27 ? 305 DT  G C5    1 
ATOM   485  C C7    . DT  B 1 5  ? 85.827  75.701  15.610  1.00 24.87 ? 305 DT  G C7    1 
ATOM   486  C C6    . DT  B 1 5  ? 84.707  73.822  16.809  1.00 23.98 ? 305 DT  G C6    1 
ATOM   487  P P     . DA  B 1 6  ? 79.553  70.204  18.917  1.00 22.22 ? 306 DA  G P     1 
ATOM   488  O OP1   . DA  B 1 6  ? 79.299  68.931  18.191  1.00 19.47 ? 306 DA  G OP1   1 
ATOM   489  O OP2   . DA  B 1 6  ? 78.643  71.369  18.712  1.00 20.03 ? 306 DA  G OP2   1 
ATOM   490  O "O5'" . DA  B 1 6  ? 79.613  69.855  20.460  1.00 18.48 ? 306 DA  G "O5'" 1 
ATOM   491  C "C5'" . DA  B 1 6  ? 80.533  68.878  20.939  1.00 17.63 ? 306 DA  G "C5'" 1 
ATOM   492  C "C4'" . DA  B 1 6  ? 80.993  69.251  22.328  1.00 18.06 ? 306 DA  G "C4'" 1 
ATOM   493  O "O4'" . DA  B 1 6  ? 82.023  70.269  22.272  1.00 17.84 ? 306 DA  G "O4'" 1 
ATOM   494  C "C3'" . DA  B 1 6  ? 79.871  69.822  23.194  1.00 17.51 ? 306 DA  G "C3'" 1 
ATOM   495  O "O3'" . DA  B 1 6  ? 80.015  69.300  24.510  1.00 16.96 ? 306 DA  G "O3'" 1 
ATOM   496  C "C2'" . DA  B 1 6  ? 80.101  71.326  23.124  1.00 18.65 ? 306 DA  G "C2'" 1 
ATOM   497  C "C1'" . DA  B 1 6  ? 81.610  71.439  22.978  1.00 17.87 ? 306 DA  G "C1'" 1 
ATOM   498  N N9    . DA  B 1 6  ? 82.098  72.601  22.227  1.00 18.16 ? 306 DA  G N9    1 
ATOM   499  C C8    . DA  B 1 6  ? 81.694  73.021  20.981  1.00 18.52 ? 306 DA  G C8    1 
ATOM   500  N N7    . DA  B 1 6  ? 82.379  74.037  20.518  1.00 18.70 ? 306 DA  G N7    1 
ATOM   501  C C5    . DA  B 1 6  ? 83.279  74.326  21.535  1.00 16.67 ? 306 DA  G C5    1 
ATOM   502  C C6    . DA  B 1 6  ? 84.287  75.303  21.657  1.00 17.80 ? 306 DA  G C6    1 
ATOM   503  N N6    . DA  B 1 6  ? 84.577  76.193  20.708  1.00 17.35 ? 306 DA  G N6    1 
ATOM   504  N N1    . DA  B 1 6  ? 85.000  75.330  22.803  1.00 15.16 ? 306 DA  G N1    1 
ATOM   505  C C2    . DA  B 1 6  ? 84.706  74.436  23.755  1.00 17.41 ? 306 DA  G C2    1 
ATOM   506  N N3    . DA  B 1 6  ? 83.786  73.472  23.758  1.00 17.66 ? 306 DA  G N3    1 
ATOM   507  C C4    . DA  B 1 6  ? 83.101  73.468  22.602  1.00 17.16 ? 306 DA  G C4    1 
ATOM   508  P P     . DG  B 1 7  ? 78.876  69.536  25.611  1.00 22.32 ? 307 DG  G P     1 
ATOM   509  O OP1   . DG  B 1 7  ? 79.080  68.450  26.596  1.00 16.21 ? 307 DG  G OP1   1 
ATOM   510  O OP2   . DG  B 1 7  ? 77.533  69.750  25.007  1.00 19.18 ? 307 DG  G OP2   1 
ATOM   511  O "O5'" . DG  B 1 7  ? 79.347  70.883  26.304  1.00 17.73 ? 307 DG  G "O5'" 1 
ATOM   512  C "C5'" . DG  B 1 7  ? 80.589  70.900  26.991  1.00 18.73 ? 307 DG  G "C5'" 1 
ATOM   513  C "C4'" . DG  B 1 7  ? 80.895  72.281  27.508  1.00 15.16 ? 307 DG  G "C4'" 1 
ATOM   514  O "O4'" . DG  B 1 7  ? 81.403  73.128  26.448  1.00 15.81 ? 307 DG  G "O4'" 1 
ATOM   515  C "C3'" . DG  B 1 7  ? 79.719  73.020  28.153  1.00 18.01 ? 307 DG  G "C3'" 1 
ATOM   516  O "O3'" . DG  B 1 7  ? 80.061  73.323  29.510  1.00 19.76 ? 307 DG  G "O3'" 1 
ATOM   517  C "C2'" . DG  B 1 7  ? 79.542  74.266  27.286  1.00 16.67 ? 307 DG  G "C2'" 1 
ATOM   518  C "C1'" . DG  B 1 7  ? 80.914  74.449  26.655  1.00 16.04 ? 307 DG  G "C1'" 1 
ATOM   519  N N9    . DG  B 1 7  ? 80.977  75.159  25.375  1.00 15.97 ? 307 DG  G N9    1 
ATOM   520  C C8    . DG  B 1 7  ? 80.207  74.938  24.260  1.00 15.87 ? 307 DG  G C8    1 
ATOM   521  N N7    . DG  B 1 7  ? 80.519  75.713  23.258  1.00 15.16 ? 307 DG  G N7    1 
ATOM   522  C C5    . DG  B 1 7  ? 81.557  76.498  23.737  1.00 15.38 ? 307 DG  G C5    1 
ATOM   523  C C6    . DG  B 1 7  ? 82.309  77.518  23.096  1.00 15.16 ? 307 DG  G C6    1 
ATOM   524  O O6    . DG  B 1 7  ? 82.219  77.925  21.924  1.00 15.69 ? 307 DG  G O6    1 
ATOM   525  N N1    . DG  B 1 7  ? 83.256  78.077  23.956  1.00 15.16 ? 307 DG  G N1    1 
ATOM   526  C C2    . DG  B 1 7  ? 83.460  77.690  25.260  1.00 17.97 ? 307 DG  G C2    1 
ATOM   527  N N2    . DG  B 1 7  ? 84.405  78.367  25.942  1.00 18.46 ? 307 DG  G N2    1 
ATOM   528  N N3    . DG  B 1 7  ? 82.783  76.718  25.859  1.00 16.87 ? 307 DG  G N3    1 
ATOM   529  C C4    . DG  B 1 7  ? 81.849  76.176  25.046  1.00 15.78 ? 307 DG  G C4    1 
ATOM   530  P P     . DC  B 1 8  ? 78.979  74.006  30.488  1.00 21.55 ? 308 DC  G P     1 
ATOM   531  O OP1   . DC  B 1 8  ? 79.239  73.495  31.859  1.00 22.89 ? 308 DC  G OP1   1 
ATOM   532  O OP2   . DC  B 1 8  ? 77.607  73.943  29.921  1.00 21.17 ? 308 DC  G OP2   1 
ATOM   533  O "O5'" . DC  B 1 8  ? 79.462  75.509  30.469  1.00 18.78 ? 308 DC  G "O5'" 1 
ATOM   534  C "C5'" . DC  B 1 8  ? 80.841  75.777  30.594  1.00 20.30 ? 308 DC  G "C5'" 1 
ATOM   535  C "C4'" . DC  B 1 8  ? 81.108  77.242  30.384  1.00 19.81 ? 308 DC  G "C4'" 1 
ATOM   536  O "O4'" . DC  B 1 8  ? 81.203  77.554  28.976  1.00 17.82 ? 308 DC  G "O4'" 1 
ATOM   537  C "C3'" . DC  B 1 8  ? 80.033  78.154  30.973  1.00 20.09 ? 308 DC  G "C3'" 1 
ATOM   538  O "O3'" . DC  B 1 8  ? 80.624  78.985  31.964  1.00 23.50 ? 308 DC  G "O3'" 1 
ATOM   539  C "C2'" . DC  B 1 8  ? 79.520  78.948  29.776  1.00 19.52 ? 308 DC  G "C2'" 1 
ATOM   540  C "C1'" . DC  B 1 8  ? 80.636  78.830  28.741  1.00 18.52 ? 308 DC  G "C1'" 1 
ATOM   541  N N1    . DC  B 1 8  ? 80.206  78.875  27.320  1.00 15.56 ? 308 DC  G N1    1 
ATOM   542  C C2    . DC  B 1 8  ? 80.850  79.759  26.431  1.00 15.60 ? 308 DC  G C2    1 
ATOM   543  O O2    . DC  B 1 8  ? 81.714  80.528  26.862  1.00 15.16 ? 308 DC  G O2    1 
ATOM   544  N N3    . DC  B 1 8  ? 80.498  79.759  25.118  1.00 15.24 ? 308 DC  G N3    1 
ATOM   545  C C4    . DC  B 1 8  ? 79.536  78.943  24.688  1.00 15.16 ? 308 DC  G C4    1 
ATOM   546  N N4    . DC  B 1 8  ? 79.236  78.971  23.388  1.00 16.22 ? 308 DC  G N4    1 
ATOM   547  C C5    . DC  B 1 8  ? 78.842  78.060  25.572  1.00 15.22 ? 308 DC  G C5    1 
ATOM   548  C C6    . DC  B 1 8  ? 79.206  78.058  26.868  1.00 15.79 ? 308 DC  G C6    1 
ATOM   549  P P     . DA  B 1 9  ? 79.699  79.714  33.053  1.00 24.16 ? 309 DA  G P     1 
ATOM   550  O OP1   . DA  B 1 9  ? 80.439  79.690  34.345  1.00 27.83 ? 309 DA  G OP1   1 
ATOM   551  O OP2   . DA  B 1 9  ? 78.302  79.225  33.004  1.00 24.78 ? 309 DA  G OP2   1 
ATOM   552  O "O5'" . DA  B 1 9  ? 79.689  81.203  32.520  1.00 25.21 ? 309 DA  G "O5'" 1 
ATOM   553  C "C5'" . DA  B 1 9  ? 80.900  81.906  32.318  1.00 23.75 ? 309 DA  G "C5'" 1 
ATOM   554  C "C4'" . DA  B 1 9  ? 80.601  83.214  31.633  1.00 22.53 ? 309 DA  G "C4'" 1 
ATOM   555  O "O4'" . DA  B 1 9  ? 80.314  82.983  30.233  1.00 21.28 ? 309 DA  G "O4'" 1 
ATOM   556  C "C3'" . DA  B 1 9  ? 79.362  83.904  32.206  1.00 22.50 ? 309 DA  G "C3'" 1 
ATOM   557  O "O3'" . DA  B 1 9  ? 79.556  85.301  32.081  1.00 25.44 ? 309 DA  G "O3'" 1 
ATOM   558  C "C2'" . DA  B 1 9  ? 78.268  83.490  31.239  1.00 21.46 ? 309 DA  G "C2'" 1 
ATOM   559  C "C1'" . DA  B 1 9  ? 79.032  83.512  29.928  1.00 20.18 ? 309 DA  G "C1'" 1 
ATOM   560  N N9    . DA  B 1 9  ? 78.444  82.716  28.850  1.00 17.31 ? 309 DA  G N9    1 
ATOM   561  C C8    . DA  B 1 9  ? 77.608  81.637  28.940  1.00 17.25 ? 309 DA  G C8    1 
ATOM   562  N N7    . DA  B 1 9  ? 77.242  81.153  27.777  1.00 18.46 ? 309 DA  G N7    1 
ATOM   563  C C5    . DA  B 1 9  ? 77.885  81.973  26.858  1.00 16.53 ? 309 DA  G C5    1 
ATOM   564  C C6    . DA  B 1 9  ? 77.904  81.988  25.447  1.00 16.26 ? 309 DA  G C6    1 
ATOM   565  N N6    . DA  B 1 9  ? 77.233  81.117  24.684  1.00 15.16 ? 309 DA  G N6    1 
ATOM   566  N N1    . DA  B 1 9  ? 78.645  82.939  24.841  1.00 15.97 ? 309 DA  G N1    1 
ATOM   567  C C2    . DA  B 1 9  ? 79.323  83.811  25.604  1.00 17.49 ? 309 DA  G C2    1 
ATOM   568  N N3    . DA  B 1 9  ? 79.382  83.897  26.934  1.00 16.18 ? 309 DA  G N3    1 
ATOM   569  C C4    . DA  B 1 9  ? 78.631  82.938  27.506  1.00 16.16 ? 309 DA  G C4    1 
ATOM   570  P P     . DC  B 1 10 ? 78.928  86.311  33.158  1.00 26.53 ? 310 DC  G P     1 
ATOM   571  O OP1   . DC  B 1 10 ? 79.946  86.489  34.226  1.00 27.15 ? 310 DC  G OP1   1 
ATOM   572  O OP2   . DC  B 1 10 ? 77.532  85.957  33.518  1.00 27.40 ? 310 DC  G OP2   1 
ATOM   573  O "O5'" . DC  B 1 10 ? 78.953  87.652  32.321  1.00 23.78 ? 310 DC  G "O5'" 1 
ATOM   574  C "C5'" . DC  B 1 10 ? 80.118  87.972  31.584  1.00 22.44 ? 310 DC  G "C5'" 1 
ATOM   575  C "C4'" . DC  B 1 10 ? 79.745  88.526  30.235  1.00 21.63 ? 310 DC  G "C4'" 1 
ATOM   576  O "O4'" . DC  B 1 10 ? 79.262  87.474  29.354  1.00 20.58 ? 310 DC  G "O4'" 1 
ATOM   577  C "C3'" . DC  B 1 10 ? 78.620  89.551  30.332  1.00 21.21 ? 310 DC  G "C3'" 1 
ATOM   578  O "O3'" . DC  B 1 10 ? 79.082  90.844  29.991  1.00 19.46 ? 310 DC  G "O3'" 1 
ATOM   579  C "C2'" . DC  B 1 10 ? 77.547  89.052  29.369  1.00 20.32 ? 310 DC  G "C2'" 1 
ATOM   580  C "C1'" . DC  B 1 10 ? 78.265  88.016  28.505  1.00 19.51 ? 310 DC  G "C1'" 1 
ATOM   581  N N1    . DC  B 1 10 ? 77.403  86.904  28.041  1.00 18.28 ? 310 DC  G N1    1 
ATOM   582  C C2    . DC  B 1 10 ? 77.292  86.650  26.656  1.00 18.66 ? 310 DC  G C2    1 
ATOM   583  O O2    . DC  B 1 10 ? 77.903  87.368  25.855  1.00 18.90 ? 310 DC  G O2    1 
ATOM   584  N N3    . DC  B 1 10 ? 76.519  85.624  26.233  1.00 16.89 ? 310 DC  G N3    1 
ATOM   585  C C4    . DC  B 1 10 ? 75.874  84.867  27.116  1.00 15.16 ? 310 DC  G C4    1 
ATOM   586  N N4    . DC  B 1 10 ? 75.140  83.853  26.651  1.00 15.16 ? 310 DC  G N4    1 
ATOM   587  C C5    . DC  B 1 10 ? 75.957  85.107  28.523  1.00 17.05 ? 310 DC  G C5    1 
ATOM   588  C C6    . DC  B 1 10 ? 76.724  86.126  28.935  1.00 16.48 ? 310 DC  G C6    1 
ATOM   589  P P     . DG  B 1 11 ? 78.203  92.119  30.401  1.00 18.87 ? 311 DG  G P     1 
ATOM   590  O OP1   . DG  B 1 11 ? 79.139  93.247  30.683  1.00 21.03 ? 311 DG  G OP1   1 
ATOM   591  O OP2   . DG  B 1 11 ? 77.208  91.710  31.411  1.00 18.90 ? 311 DG  G OP2   1 
ATOM   592  O "O5'" . DG  B 1 11 ? 77.493  92.470  29.023  1.00 19.88 ? 311 DG  G "O5'" 1 
ATOM   593  C "C5'" . DG  B 1 11 ? 78.291  92.657  27.864  1.00 17.62 ? 311 DG  G "C5'" 1 
ATOM   594  C "C4'" . DG  B 1 11 ? 77.425  92.763  26.632  1.00 17.26 ? 311 DG  G "C4'" 1 
ATOM   595  O "O4'" . DG  B 1 11 ? 76.828  91.482  26.319  1.00 17.87 ? 311 DG  G "O4'" 1 
ATOM   596  C "C3'" . DG  B 1 11 ? 76.279  93.767  26.735  1.00 16.66 ? 311 DG  G "C3'" 1 
ATOM   597  O "O3'" . DG  B 1 11 ? 76.262  94.531  25.527  1.00 18.16 ? 311 DG  G "O3'" 1 
ATOM   598  C "C2'" . DG  B 1 11 ? 75.046  92.890  26.900  1.00 16.19 ? 311 DG  G "C2'" 1 
ATOM   599  C "C1'" . DG  B 1 11 ? 75.428  91.624  26.139  1.00 16.97 ? 311 DG  G "C1'" 1 
ATOM   600  N N9    . DG  B 1 11 ? 74.788  90.402  26.621  1.00 17.22 ? 311 DG  G N9    1 
ATOM   601  C C8    . DG  B 1 11 ? 74.550  90.051  27.927  1.00 15.16 ? 311 DG  G C8    1 
ATOM   602  N N7    . DG  B 1 11 ? 73.947  88.899  28.045  1.00 16.06 ? 311 DG  G N7    1 
ATOM   603  C C5    . DG  B 1 11 ? 73.788  88.455  26.739  1.00 15.37 ? 311 DG  G C5    1 
ATOM   604  C C6    . DG  B 1 11 ? 73.194  87.260  26.235  1.00 15.16 ? 311 DG  G C6    1 
ATOM   605  O O6    . DG  B 1 11 ? 72.692  86.325  26.860  1.00 15.16 ? 311 DG  G O6    1 
ATOM   606  N N1    . DG  B 1 11 ? 73.219  87.223  24.848  1.00 15.16 ? 311 DG  G N1    1 
ATOM   607  C C2    . DG  B 1 11 ? 73.740  88.200  24.045  1.00 15.71 ? 311 DG  G C2    1 
ATOM   608  N N2    . DG  B 1 11 ? 73.631  87.988  22.725  1.00 15.16 ? 311 DG  G N2    1 
ATOM   609  N N3    . DG  B 1 11 ? 74.314  89.311  24.499  1.00 16.36 ? 311 DG  G N3    1 
ATOM   610  C C4    . DG  B 1 11 ? 74.295  89.371  25.847  1.00 15.94 ? 311 DG  G C4    1 
ATOM   611  P P     . DT  B 1 12 ? 75.193  95.708  25.325  1.00 18.92 ? 312 DT  G P     1 
ATOM   612  O OP1   . DT  B 1 12 ? 75.817  96.619  24.332  1.00 17.55 ? 312 DT  G OP1   1 
ATOM   613  O OP2   . DT  B 1 12 ? 74.691  96.238  26.616  1.00 20.24 ? 312 DT  G OP2   1 
ATOM   614  O "O5'" . DT  B 1 12 ? 74.018  94.938  24.588  1.00 18.65 ? 312 DT  G "O5'" 1 
ATOM   615  C "C5'" . DT  B 1 12 ? 74.345  94.131  23.470  1.00 18.05 ? 312 DT  G "C5'" 1 
ATOM   616  C "C4'" . DT  B 1 12 ? 73.144  93.351  22.997  1.00 19.74 ? 312 DT  G "C4'" 1 
ATOM   617  O "O4'" . DT  B 1 12 ? 72.923  92.200  23.841  1.00 19.01 ? 312 DT  G "O4'" 1 
ATOM   618  C "C3'" . DT  B 1 12 ? 71.810  94.101  22.910  1.00 21.76 ? 312 DT  G "C3'" 1 
ATOM   619  O "O3'" . DT  B 1 12 ? 71.362  94.054  21.550  1.00 25.26 ? 312 DT  G "O3'" 1 
ATOM   620  C "C2'" . DT  B 1 12 ? 70.889  93.305  23.831  1.00 20.29 ? 312 DT  G "C2'" 1 
ATOM   621  C "C1'" . DT  B 1 12 ? 71.541  91.929  23.839  1.00 19.41 ? 312 DT  G "C1'" 1 
ATOM   622  N N1    . DT  B 1 12 ? 71.239  91.034  24.984  1.00 18.47 ? 312 DT  G N1    1 
ATOM   623  C C2    . DT  B 1 12 ? 70.728  89.786  24.689  1.00 17.44 ? 312 DT  G C2    1 
ATOM   624  O O2    . DT  B 1 12 ? 70.541  89.395  23.550  1.00 17.81 ? 312 DT  G O2    1 
ATOM   625  N N3    . DT  B 1 12 ? 70.446  89.007  25.775  1.00 17.20 ? 312 DT  G N3    1 
ATOM   626  C C4    . DT  B 1 12 ? 70.619  89.330  27.105  1.00 15.70 ? 312 DT  G C4    1 
ATOM   627  O O4    . DT  B 1 12 ? 70.312  88.514  27.970  1.00 15.16 ? 312 DT  G O4    1 
ATOM   628  C C5    . DT  B 1 12 ? 71.164  90.651  27.354  1.00 17.22 ? 312 DT  G C5    1 
ATOM   629  C C7    . DT  B 1 12 ? 71.376  91.091  28.768  1.00 16.07 ? 312 DT  G C7    1 
ATOM   630  C C6    . DT  B 1 12 ? 71.450  91.427  26.293  1.00 18.41 ? 312 DT  G C6    1 
ATOM   631  P P     . DG  B 1 13 ? 69.981  94.748  21.119  1.00 26.41 ? 313 DG  G P     1 
ATOM   632  O OP1   . DG  B 1 13 ? 70.255  95.376  19.797  1.00 27.72 ? 313 DG  G OP1   1 
ATOM   633  O OP2   . DG  B 1 13 ? 69.403  95.571  22.209  1.00 26.41 ? 313 DG  G OP2   1 
ATOM   634  O "O5'" . DG  B 1 13 ? 69.064  93.472  20.867  1.00 27.19 ? 313 DG  G "O5'" 1 
ATOM   635  C "C5'" . DG  B 1 13 ? 69.587  92.377  20.115  1.00 25.80 ? 313 DG  G "C5'" 1 
ATOM   636  C "C4'" . DG  B 1 13 ? 68.550  91.293  19.958  1.00 26.73 ? 313 DG  G "C4'" 1 
ATOM   637  O "O4'" . DG  B 1 13 ? 68.451  90.462  21.139  1.00 24.77 ? 313 DG  G "O4'" 1 
ATOM   638  C "C3'" . DG  B 1 13 ? 67.141  91.791  19.666  1.00 27.20 ? 313 DG  G "C3'" 1 
ATOM   639  O "O3'" . DG  B 1 13 ? 66.573  90.918  18.697  1.00 29.47 ? 313 DG  G "O3'" 1 
ATOM   640  C "C2'" . DG  B 1 13 ? 66.438  91.660  21.009  1.00 25.05 ? 313 DG  G "C2'" 1 
ATOM   641  C "C1'" . DG  B 1 13 ? 67.103  90.419  21.587  1.00 24.39 ? 313 DG  G "C1'" 1 
ATOM   642  N N9    . DG  B 1 13 ? 67.131  90.336  23.044  1.00 22.20 ? 313 DG  G N9    1 
ATOM   643  C C8    . DG  B 1 13 ? 67.663  91.260  23.912  1.00 21.00 ? 313 DG  G C8    1 
ATOM   644  N N7    . DG  B 1 13 ? 67.622  90.873  25.160  1.00 20.10 ? 313 DG  G N7    1 
ATOM   645  C C5    . DG  B 1 13 ? 67.008  89.627  25.114  1.00 20.03 ? 313 DG  G C5    1 
ATOM   646  C C6    . DG  B 1 13 ? 66.694  88.718  26.156  1.00 19.57 ? 313 DG  G C6    1 
ATOM   647  O O6    . DG  B 1 13 ? 66.924  88.826  27.361  1.00 18.07 ? 313 DG  G O6    1 
ATOM   648  N N1    . DG  B 1 13 ? 66.049  87.585  25.670  1.00 18.30 ? 313 DG  G N1    1 
ATOM   649  C C2    . DG  B 1 13 ? 65.744  87.360  24.349  1.00 17.73 ? 313 DG  G C2    1 
ATOM   650  N N2    . DG  B 1 13 ? 65.104  86.221  24.076  1.00 17.91 ? 313 DG  G N2    1 
ATOM   651  N N3    . DG  B 1 13 ? 66.044  88.188  23.371  1.00 17.85 ? 313 DG  G N3    1 
ATOM   652  C C4    . DG  B 1 13 ? 66.673  89.294  23.819  1.00 20.72 ? 313 DG  G C4    1 
ATOM   653  P P     . DC  B 1 14 ? 65.104  91.204  18.127  1.00 30.74 ? 314 DC  G P     1 
ATOM   654  O OP1   . DC  B 1 14 ? 65.065  90.521  16.802  1.00 30.91 ? 314 DC  G OP1   1 
ATOM   655  O OP2   . DC  B 1 14 ? 64.789  92.649  18.228  1.00 30.40 ? 314 DC  G OP2   1 
ATOM   656  O "O5'" . DC  B 1 14 ? 64.153  90.422  19.136  1.00 31.37 ? 314 DC  G "O5'" 1 
ATOM   657  C "C5'" . DC  B 1 14 ? 64.187  89.001  19.206  1.00 31.74 ? 314 DC  G "C5'" 1 
ATOM   658  C "C4'" . DC  B 1 14 ? 63.052  88.493  20.063  1.00 33.01 ? 314 DC  G "C4'" 1 
ATOM   659  O "O4'" . DC  B 1 14 ? 63.403  88.534  21.469  1.00 32.01 ? 314 DC  G "O4'" 1 
ATOM   660  C "C3'" . DC  B 1 14 ? 61.739  89.265  19.918  1.00 33.63 ? 314 DC  G "C3'" 1 
ATOM   661  O "O3'" . DC  B 1 14 ? 60.665  88.344  19.734  1.00 37.79 ? 314 DC  G "O3'" 1 
ATOM   662  C "C2'" . DC  B 1 14 ? 61.609  90.007  21.242  1.00 32.46 ? 314 DC  G "C2'" 1 
ATOM   663  C "C1'" . DC  B 1 14 ? 62.323  89.075  22.208  1.00 29.73 ? 314 DC  G "C1'" 1 
ATOM   664  N N1    . DC  B 1 14 ? 62.876  89.684  23.438  1.00 27.53 ? 314 DC  G N1    1 
ATOM   665  C C2    . DC  B 1 14 ? 62.697  89.011  24.652  1.00 24.43 ? 314 DC  G C2    1 
ATOM   666  O O2    . DC  B 1 14 ? 62.058  87.955  24.660  1.00 22.99 ? 314 DC  G O2    1 
ATOM   667  N N3    . DC  B 1 14 ? 63.221  89.528  25.785  1.00 24.41 ? 314 DC  G N3    1 
ATOM   668  C C4    . DC  B 1 14 ? 63.892  90.677  25.744  1.00 24.85 ? 314 DC  G C4    1 
ATOM   669  N N4    . DC  B 1 14 ? 64.401  91.141  26.892  1.00 22.16 ? 314 DC  G N4    1 
ATOM   670  C C5    . DC  B 1 14 ? 64.076  91.401  24.524  1.00 25.29 ? 314 DC  G C5    1 
ATOM   671  C C6    . DC  B 1 14 ? 63.557  90.870  23.404  1.00 26.22 ? 314 DC  G C6    1 
ATOM   672  P P     . DT  B 1 15 ? 59.230  88.874  19.241  1.00 39.27 ? 315 DT  G P     1 
ATOM   673  O OP1   . DT  B 1 15 ? 58.753  87.914  18.218  1.00 40.41 ? 315 DT  G OP1   1 
ATOM   674  O OP2   . DT  B 1 15 ? 59.332  90.312  18.906  1.00 39.78 ? 315 DT  G OP2   1 
ATOM   675  O "O5'" . DT  B 1 15 ? 58.326  88.727  20.543  1.00 38.87 ? 315 DT  G "O5'" 1 
ATOM   676  C "C5'" . DT  B 1 15 ? 58.189  87.465  21.188  1.00 37.23 ? 315 DT  G "C5'" 1 
ATOM   677  C "C4'" . DT  B 1 15 ? 57.459  87.621  22.502  1.00 36.83 ? 315 DT  G "C4'" 1 
ATOM   678  O "O4'" . DT  B 1 15 ? 58.329  88.150  23.533  1.00 35.47 ? 315 DT  G "O4'" 1 
ATOM   679  C "C3'" . DT  B 1 15 ? 56.238  88.542  22.465  1.00 36.03 ? 315 DT  G "C3'" 1 
ATOM   680  O "O3'" . DT  B 1 15 ? 55.226  87.980  23.292  1.00 37.76 ? 315 DT  G "O3'" 1 
ATOM   681  C "C2'" . DT  B 1 15 ? 56.744  89.803  23.140  1.00 35.38 ? 315 DT  G "C2'" 1 
ATOM   682  C "C1'" . DT  B 1 15 ? 57.652  89.203  24.195  1.00 34.34 ? 315 DT  G "C1'" 1 
ATOM   683  N N1    . DT  B 1 15 ? 58.656  90.105  24.784  1.00 33.04 ? 315 DT  G N1    1 
ATOM   684  C C2    . DT  B 1 15 ? 58.988  89.910  26.110  1.00 31.89 ? 315 DT  G C2    1 
ATOM   685  O O2    . DT  B 1 15 ? 58.497  89.036  26.802  1.00 31.56 ? 315 DT  G O2    1 
ATOM   686  N N3    . DT  B 1 15 ? 59.923  90.780  26.598  1.00 31.73 ? 315 DT  G N3    1 
ATOM   687  C C4    . DT  B 1 15 ? 60.554  91.798  25.917  1.00 31.19 ? 315 DT  G C4    1 
ATOM   688  O O4    . DT  B 1 15 ? 61.382  92.492  26.493  1.00 30.73 ? 315 DT  G O4    1 
ATOM   689  C C5    . DT  B 1 15 ? 60.160  91.950  24.531  1.00 32.90 ? 315 DT  G C5    1 
ATOM   690  C C7    . DT  B 1 15 ? 60.795  93.028  23.711  1.00 32.83 ? 315 DT  G C7    1 
ATOM   691  C C6    . DT  B 1 15 ? 59.239  91.107  24.041  1.00 32.20 ? 315 DT  G C6    1 
ATOM   692  P P     . DA  B 1 16 ? 53.768  87.686  22.691  1.00 37.60 ? 316 DA  G P     1 
ATOM   693  O OP1   . DA  B 1 16 ? 53.918  86.855  21.469  1.00 38.29 ? 316 DA  G OP1   1 
ATOM   694  O OP2   . DA  B 1 16 ? 53.037  88.977  22.618  1.00 39.51 ? 316 DA  G OP2   1 
ATOM   695  O "O5'" . DA  B 1 16 ? 53.110  86.796  23.826  1.00 39.29 ? 316 DA  G "O5'" 1 
ATOM   696  C "C5'" . DA  B 1 16 ? 53.777  85.637  24.313  1.00 39.06 ? 316 DA  G "C5'" 1 
ATOM   697  C "C4'" . DA  B 1 16 ? 53.707  85.602  25.819  1.00 39.04 ? 316 DA  G "C4'" 1 
ATOM   698  O "O4'" . DA  B 1 16 ? 54.613  86.580  26.385  1.00 38.71 ? 316 DA  G "O4'" 1 
ATOM   699  C "C3'" . DA  B 1 16 ? 52.324  85.939  26.368  1.00 39.92 ? 316 DA  G "C3'" 1 
ATOM   700  O "O3'" . DA  B 1 16 ? 52.044  85.111  27.494  1.00 40.93 ? 316 DA  G "O3'" 1 
ATOM   701  C "C2'" . DA  B 1 16 ? 52.443  87.402  26.761  1.00 38.62 ? 316 DA  G "C2'" 1 
ATOM   702  C "C1'" . DA  B 1 16 ? 53.899  87.518  27.179  1.00 38.88 ? 316 DA  G "C1'" 1 
ATOM   703  N N9    . DA  B 1 16 ? 54.501  88.832  26.950  1.00 38.11 ? 316 DA  G N9    1 
ATOM   704  C C8    . DA  B 1 16 ? 54.351  89.651  25.860  1.00 38.05 ? 316 DA  G C8    1 
ATOM   705  N N7    . DA  B 1 16 ? 55.063  90.751  25.922  1.00 38.16 ? 316 DA  G N7    1 
ATOM   706  C C5    . DA  B 1 16 ? 55.722  90.653  27.140  1.00 37.58 ? 316 DA  G C5    1 
ATOM   707  C C6    . DA  B 1 16 ? 56.645  91.495  27.788  1.00 37.76 ? 316 DA  G C6    1 
ATOM   708  N N6    . DA  B 1 16 ? 57.099  92.637  27.265  1.00 37.68 ? 316 DA  G N6    1 
ATOM   709  N N1    . DA  B 1 16 ? 57.100  91.113  29.000  1.00 37.06 ? 316 DA  G N1    1 
ATOM   710  C C2    . DA  B 1 16 ? 56.664  89.953  29.511  1.00 37.82 ? 316 DA  G C2    1 
ATOM   711  N N3    . DA  B 1 16 ? 55.812  89.070  28.992  1.00 37.63 ? 316 DA  G N3    1 
ATOM   712  C C4    . DA  B 1 16 ? 55.372  89.485  27.792  1.00 37.68 ? 316 DA  G C4    1 
ATOM   713  P P     . DC  B 1 17 ? 50.598  85.172  28.186  1.00 42.55 ? 317 DC  G P     1 
ATOM   714  O OP1   . DC  B 1 17 ? 50.328  83.814  28.712  1.00 41.52 ? 317 DC  G OP1   1 
ATOM   715  O OP2   . DC  B 1 17 ? 49.629  85.812  27.256  1.00 41.75 ? 317 DC  G OP2   1 
ATOM   716  O "O5'" . DC  B 1 17 ? 50.850  86.145  29.417  1.00 43.87 ? 317 DC  G "O5'" 1 
ATOM   717  C "C5'" . DC  B 1 17 ? 51.922  85.883  30.313  1.00 45.42 ? 317 DC  G "C5'" 1 
ATOM   718  C "C4'" . DC  B 1 17 ? 52.035  86.983  31.341  1.00 46.97 ? 317 DC  G "C4'" 1 
ATOM   719  O "O4'" . DC  B 1 17 ? 52.756  88.128  30.820  1.00 46.34 ? 317 DC  G "O4'" 1 
ATOM   720  C "C3'" . DC  B 1 17 ? 50.709  87.511  31.889  1.00 47.58 ? 317 DC  G "C3'" 1 
ATOM   721  O "O3'" . DC  B 1 17 ? 50.776  87.516  33.315  1.00 49.65 ? 317 DC  G "O3'" 1 
ATOM   722  C "C2'" . DC  B 1 17 ? 50.632  88.929  31.340  1.00 47.20 ? 317 DC  G "C2'" 1 
ATOM   723  C "C1'" . DC  B 1 17 ? 52.100  89.310  31.244  1.00 46.48 ? 317 DC  G "C1'" 1 
ATOM   724  N N1    . DC  B 1 17 ? 52.426  90.384  30.288  1.00 45.39 ? 317 DC  G N1    1 
ATOM   725  C C2    . DC  B 1 17 ? 53.379  91.345  30.654  1.00 44.78 ? 317 DC  G C2    1 
ATOM   726  O O2    . DC  B 1 17 ? 53.912  91.267  31.769  1.00 43.49 ? 317 DC  G O2    1 
ATOM   727  N N3    . DC  B 1 17 ? 53.693  92.333  29.783  1.00 44.24 ? 317 DC  G N3    1 
ATOM   728  C C4    . DC  B 1 17 ? 53.095  92.384  28.592  1.00 44.44 ? 317 DC  G C4    1 
ATOM   729  N N4    . DC  B 1 17 ? 53.436  93.374  27.765  1.00 43.69 ? 317 DC  G N4    1 
ATOM   730  C C5    . DC  B 1 17 ? 52.119  91.422  28.195  1.00 44.68 ? 317 DC  G C5    1 
ATOM   731  C C6    . DC  B 1 17 ? 51.818  90.449  29.065  1.00 45.21 ? 317 DC  G C6    1 
ATOM   732  P P     . DT  B 1 18 ? 49.556  88.105  34.176  1.00 50.58 ? 318 DT  G P     1 
ATOM   733  O OP1   . DT  B 1 18 ? 49.267  87.124  35.255  1.00 50.24 ? 318 DT  G OP1   1 
ATOM   734  O OP2   . DT  B 1 18 ? 48.466  88.544  33.262  1.00 50.67 ? 318 DT  G OP2   1 
ATOM   735  O "O5'" . DT  B 1 18 ? 50.219  89.387  34.848  1.00 49.98 ? 318 DT  G "O5'" 1 
ATOM   736  C "C5'" . DT  B 1 18 ? 51.570  89.330  35.303  1.00 48.13 ? 318 DT  G "C5'" 1 
ATOM   737  C "C4'" . DT  B 1 18 ? 52.043  90.699  35.726  1.00 46.72 ? 318 DT  G "C4'" 1 
ATOM   738  O "O4'" . DT  B 1 18 ? 52.302  91.526  34.567  1.00 45.64 ? 318 DT  G "O4'" 1 
ATOM   739  C "C3'" . DT  B 1 18 ? 51.055  91.473  36.599  1.00 46.31 ? 318 DT  G "C3'" 1 
ATOM   740  O "O3'" . DT  B 1 18 ? 51.750  92.078  37.690  1.00 46.60 ? 318 DT  G "O3'" 1 
ATOM   741  C "C2'" . DT  B 1 18 ? 50.497  92.529  35.657  1.00 45.69 ? 318 DT  G "C2'" 1 
ATOM   742  C "C1'" . DT  B 1 18 ? 51.670  92.785  34.727  1.00 44.64 ? 318 DT  G "C1'" 1 
ATOM   743  N N1    . DT  B 1 18 ? 51.316  93.286  33.382  1.00 43.50 ? 318 DT  G N1    1 
ATOM   744  C C2    . DT  B 1 18 ? 51.963  94.412  32.920  1.00 42.84 ? 318 DT  G C2    1 
ATOM   745  O O2    . DT  B 1 18 ? 52.773  95.036  33.584  1.00 42.79 ? 318 DT  G O2    1 
ATOM   746  N N3    . DT  B 1 18 ? 51.618  94.787  31.646  1.00 42.35 ? 318 DT  G N3    1 
ATOM   747  C C4    . DT  B 1 18 ? 50.703  94.173  30.813  1.00 42.18 ? 318 DT  G C4    1 
ATOM   748  O O4    . DT  B 1 18 ? 50.513  94.612  29.685  1.00 41.74 ? 318 DT  G O4    1 
ATOM   749  C C5    . DT  B 1 18 ? 50.036  93.020  31.373  1.00 42.23 ? 318 DT  G C5    1 
ATOM   750  C C7    . DT  B 1 18 ? 49.002  92.314  30.555  1.00 41.72 ? 318 DT  G C7    1 
ATOM   751  C C6    . DT  B 1 18 ? 50.376  92.636  32.611  1.00 43.18 ? 318 DT  G C6    1 
ATOM   752  P P     . DC  B 1 19 ? 50.949  92.474  39.024  1.00 46.66 ? 319 DC  G P     1 
ATOM   753  O OP1   . DC  B 1 19 ? 51.789  92.069  40.180  1.00 46.86 ? 319 DC  G OP1   1 
ATOM   754  O OP2   . DC  B 1 19 ? 49.549  91.978  38.922  1.00 45.36 ? 319 DC  G OP2   1 
ATOM   755  O "O5'" . DC  B 1 19 ? 50.917  94.063  38.964  1.00 45.25 ? 319 DC  G "O5'" 1 
ATOM   756  C "C5'" . DC  B 1 19 ? 52.118  94.821  39.068  1.00 44.64 ? 319 DC  G "C5'" 1 
ATOM   757  C "C4'" . DC  B 1 19 ? 51.836  96.276  38.775  1.00 44.00 ? 319 DC  G "C4'" 1 
ATOM   758  O "O4'" . DC  B 1 19 ? 51.552  96.433  37.363  1.00 43.80 ? 319 DC  G "O4'" 1 
ATOM   759  C "C3'" . DC  B 1 19 ? 50.618  96.838  39.514  1.00 43.59 ? 319 DC  G "C3'" 1 
ATOM   760  O "O3'" . DC  B 1 19 ? 50.785  98.233  39.762  1.00 43.48 ? 319 DC  G "O3'" 1 
ATOM   761  C "C2'" . DC  B 1 19 ? 49.518  96.736  38.474  1.00 43.48 ? 319 DC  G "C2'" 1 
ATOM   762  C "C1'" . DC  B 1 19 ? 50.290  97.060  37.207  1.00 43.00 ? 319 DC  G "C1'" 1 
ATOM   763  N N1    . DC  B 1 19 ? 49.687  96.597  35.943  1.00 41.29 ? 319 DC  G N1    1 
ATOM   764  C C2    . DC  B 1 19 ? 50.131  97.164  34.742  1.00 40.81 ? 319 DC  G C2    1 
ATOM   765  O O2    . DC  B 1 19 ? 51.052  97.992  34.774  1.00 41.14 ? 319 DC  G O2    1 
ATOM   766  N N3    . DC  B 1 19 ? 49.548  96.794  33.580  1.00 40.15 ? 319 DC  G N3    1 
ATOM   767  C C4    . DC  B 1 19 ? 48.568  95.887  33.585  1.00 40.67 ? 319 DC  G C4    1 
ATOM   768  N N4    . DC  B 1 19 ? 48.007  95.563  32.415  1.00 40.13 ? 319 DC  G N4    1 
ATOM   769  C C5    . DC  B 1 19 ? 48.116  95.275  34.790  1.00 40.57 ? 319 DC  G C5    1 
ATOM   770  C C6    . DC  B 1 19 ? 48.699  95.654  35.934  1.00 41.08 ? 319 DC  G C6    1 
ATOM   771  O "O5'" . DC  C 1 1  ? 10.950  17.420  110.369 1.00 52.43 ? 601 DC  H "O5'" 1 
ATOM   772  C "C5'" . DC  C 1 1  ? 12.285  17.252  110.845 1.00 53.11 ? 601 DC  H "C5'" 1 
ATOM   773  C "C4'" . DC  C 1 1  ? 13.276  18.025  110.006 1.00 53.38 ? 601 DC  H "C4'" 1 
ATOM   774  O "O4'" . DC  C 1 1  ? 14.618  17.612  110.361 1.00 54.45 ? 601 DC  H "O4'" 1 
ATOM   775  C "C3'" . DC  C 1 1  ? 13.146  17.783  108.501 1.00 52.21 ? 601 DC  H "C3'" 1 
ATOM   776  O "O3'" . DC  C 1 1  ? 13.531  18.964  107.784 1.00 48.52 ? 601 DC  H "O3'" 1 
ATOM   777  C "C2'" . DC  C 1 1  ? 14.165  16.684  108.254 1.00 54.27 ? 601 DC  H "C2'" 1 
ATOM   778  C "C1'" . DC  C 1 1  ? 15.273  17.070  109.222 1.00 55.69 ? 601 DC  H "C1'" 1 
ATOM   779  N N1    . DC  C 1 1  ? 16.134  15.965  109.680 1.00 57.98 ? 601 DC  H N1    1 
ATOM   780  C C2    . DC  C 1 1  ? 16.722  15.116  108.728 1.00 58.75 ? 601 DC  H C2    1 
ATOM   781  O O2    . DC  C 1 1  ? 16.494  15.309  107.523 1.00 59.21 ? 601 DC  H O2    1 
ATOM   782  N N3    . DC  C 1 1  ? 17.524  14.109  109.149 1.00 59.29 ? 601 DC  H N3    1 
ATOM   783  C C4    . DC  C 1 1  ? 17.747  13.933  110.455 1.00 59.65 ? 601 DC  H C4    1 
ATOM   784  N N4    . DC  C 1 1  ? 18.543  12.923  110.824 1.00 59.66 ? 601 DC  H N4    1 
ATOM   785  C C5    . DC  C 1 1  ? 17.162  14.781  111.442 1.00 59.44 ? 601 DC  H C5    1 
ATOM   786  C C6    . DC  C 1 1  ? 16.368  15.772  111.014 1.00 58.61 ? 601 DC  H C6    1 
ATOM   787  P P     . DG  C 1 2  ? 12.409  19.977  107.231 1.00 44.32 ? 602 DG  H P     1 
ATOM   788  O OP1   . DG  C 1 2  ? 13.099  21.227  106.844 1.00 44.90 ? 602 DG  H OP1   1 
ATOM   789  O OP2   . DG  C 1 2  ? 11.330  20.022  108.252 1.00 45.02 ? 602 DG  H OP2   1 
ATOM   790  O "O5'" . DG  C 1 2  ? 11.832  19.270  105.925 1.00 41.34 ? 602 DG  H "O5'" 1 
ATOM   791  C "C5'" . DG  C 1 2  ? 10.467  18.866  105.867 1.00 37.85 ? 602 DG  H "C5'" 1 
ATOM   792  C "C4'" . DG  C 1 2  ? 10.010  18.739  104.433 1.00 35.02 ? 602 DG  H "C4'" 1 
ATOM   793  O "O4'" . DG  C 1 2  ? 10.085  20.028  103.779 1.00 34.29 ? 602 DG  H "O4'" 1 
ATOM   794  C "C3'" . DG  C 1 2  ? 10.824  17.781  103.567 1.00 34.42 ? 602 DG  H "C3'" 1 
ATOM   795  O "O3'" . DG  C 1 2  ? 9.940   17.125  102.654 1.00 34.38 ? 602 DG  H "O3'" 1 
ATOM   796  C "C2'" . DG  C 1 2  ? 11.795  18.697  102.843 1.00 33.29 ? 602 DG  H "C2'" 1 
ATOM   797  C "C1'" . DG  C 1 2  ? 11.002  19.991  102.693 1.00 33.09 ? 602 DG  H "C1'" 1 
ATOM   798  N N9    . DG  C 1 2  ? 11.816  21.201  102.769 1.00 31.85 ? 602 DG  H N9    1 
ATOM   799  C C8    . DG  C 1 2  ? 12.720  21.527  103.752 1.00 31.94 ? 602 DG  H C8    1 
ATOM   800  N N7    . DG  C 1 2  ? 13.282  22.690  103.565 1.00 32.13 ? 602 DG  H N7    1 
ATOM   801  C C5    . DG  C 1 2  ? 12.718  23.159  102.386 1.00 31.11 ? 602 DG  H C5    1 
ATOM   802  C C6    . DG  C 1 2  ? 12.930  24.375  101.684 1.00 30.80 ? 602 DG  H C6    1 
ATOM   803  O O6    . DG  C 1 2  ? 13.669  25.320  101.983 1.00 29.55 ? 602 DG  H O6    1 
ATOM   804  N N1    . DG  C 1 2  ? 12.162  24.436  100.527 1.00 29.49 ? 602 DG  H N1    1 
ATOM   805  C C2    . DG  C 1 2  ? 11.295  23.462  100.104 1.00 30.53 ? 602 DG  H C2    1 
ATOM   806  N N2    . DG  C 1 2  ? 10.650  23.701  98.956  1.00 30.43 ? 602 DG  H N2    1 
ATOM   807  N N3    . DG  C 1 2  ? 11.077  22.334  100.757 1.00 30.65 ? 602 DG  H N3    1 
ATOM   808  C C4    . DG  C 1 2  ? 11.817  22.248  101.879 1.00 31.64 ? 602 DG  H C4    1 
ATOM   809  P P     . DA  C 1 3  ? 10.534  16.158  101.523 1.00 34.38 ? 603 DA  H P     1 
ATOM   810  O OP1   . DA  C 1 3  ? 9.546   15.068  101.351 1.00 35.89 ? 603 DA  H OP1   1 
ATOM   811  O OP2   . DA  C 1 3  ? 11.943  15.834  101.857 1.00 35.08 ? 603 DA  H OP2   1 
ATOM   812  O "O5'" . DA  C 1 3  ? 10.513  17.058  100.210 1.00 33.67 ? 603 DA  H "O5'" 1 
ATOM   813  C "C5'" . DA  C 1 3  ? 9.275   17.466  99.634  1.00 31.51 ? 603 DA  H "C5'" 1 
ATOM   814  C "C4'" . DA  C 1 3  ? 9.495   18.037  98.252  1.00 30.98 ? 603 DA  H "C4'" 1 
ATOM   815  O "O4'" . DA  C 1 3  ? 10.232  19.277  98.334  1.00 30.22 ? 603 DA  H "O4'" 1 
ATOM   816  C "C3'" . DA  C 1 3  ? 10.275  17.147  97.288  1.00 30.69 ? 603 DA  H "C3'" 1 
ATOM   817  O "O3'" . DA  C 1 3  ? 9.704   17.299  95.989  1.00 30.57 ? 603 DA  H "O3'" 1 
ATOM   818  C "C2'" . DA  C 1 3  ? 11.683  17.716  97.342  1.00 30.30 ? 603 DA  H "C2'" 1 
ATOM   819  C "C1'" . DA  C 1 3  ? 11.430  19.201  97.572  1.00 29.56 ? 603 DA  H "C1'" 1 
ATOM   820  N N9    . DA  C 1 3  ? 12.462  19.909  98.329  1.00 27.97 ? 603 DA  H N9    1 
ATOM   821  C C8    . DA  C 1 3  ? 13.013  19.550  99.537  1.00 28.57 ? 603 DA  H C8    1 
ATOM   822  N N7    . DA  C 1 3  ? 13.864  20.428  100.013 1.00 27.43 ? 603 DA  H N7    1 
ATOM   823  C C5    . DA  C 1 3  ? 13.890  21.423  99.047  1.00 27.87 ? 603 DA  H C5    1 
ATOM   824  C C6    . DA  C 1 3  ? 14.599  22.641  98.958  1.00 28.64 ? 603 DA  H C6    1 
ATOM   825  N N6    . DA  C 1 3  ? 15.451  23.078  99.890  1.00 26.69 ? 603 DA  H N6    1 
ATOM   826  N N1    . DA  C 1 3  ? 14.397  23.404  97.861  1.00 27.66 ? 603 DA  H N1    1 
ATOM   827  C C2    . DA  C 1 3  ? 13.548  22.964  96.922  1.00 28.20 ? 603 DA  H C2    1 
ATOM   828  N N3    . DA  C 1 3  ? 12.827  21.842  96.891  1.00 28.47 ? 603 DA  H N3    1 
ATOM   829  C C4    . DA  C 1 3  ? 13.044  21.108  97.996  1.00 28.35 ? 603 DA  H C4    1 
ATOM   830  P P     . DG  C 1 4  ? 10.145  16.323  94.804  1.00 30.68 ? 604 DG  H P     1 
ATOM   831  O OP1   . DG  C 1 4  ? 8.957   16.145  93.931  1.00 30.43 ? 604 DG  H OP1   1 
ATOM   832  O OP2   . DG  C 1 4  ? 10.843  15.131  95.360  1.00 30.34 ? 604 DG  H OP2   1 
ATOM   833  O "O5'" . DG  C 1 4  ? 11.212  17.194  94.008  1.00 31.30 ? 604 DG  H "O5'" 1 
ATOM   834  C "C5'" . DG  C 1 4  ? 10.808  18.384  93.346  1.00 30.45 ? 604 DG  H "C5'" 1 
ATOM   835  C "C4'" . DG  C 1 4  ? 11.995  19.052  92.697  1.00 29.90 ? 604 DG  H "C4'" 1 
ATOM   836  O "O4'" . DG  C 1 4  ? 12.789  19.765  93.679  1.00 30.20 ? 604 DG  H "O4'" 1 
ATOM   837  C "C3'" . DG  C 1 4  ? 12.949  18.102  91.975  1.00 29.35 ? 604 DG  H "C3'" 1 
ATOM   838  O "O3'" . DG  C 1 4  ? 13.267  18.650  90.699  1.00 30.07 ? 604 DG  H "O3'" 1 
ATOM   839  C "C2'" . DG  C 1 4  ? 14.172  18.068  92.878  1.00 28.86 ? 604 DG  H "C2'" 1 
ATOM   840  C "C1'" . DG  C 1 4  ? 14.157  19.462  93.484  1.00 29.12 ? 604 DG  H "C1'" 1 
ATOM   841  N N9    . DG  C 1 4  ? 14.845  19.620  94.766  1.00 26.68 ? 604 DG  H N9    1 
ATOM   842  C C8    . DG  C 1 4  ? 14.796  18.783  95.855  1.00 26.99 ? 604 DG  H C8    1 
ATOM   843  N N7    . DG  C 1 4  ? 15.529  19.198  96.855  1.00 25.18 ? 604 DG  H N7    1 
ATOM   844  C C5    . DG  C 1 4  ? 16.095  20.383  96.400  1.00 25.24 ? 604 DG  H C5    1 
ATOM   845  C C6    . DG  C 1 4  ? 16.988  21.289  97.041  1.00 24.81 ? 604 DG  H C6    1 
ATOM   846  O O6    . DG  C 1 4  ? 17.468  21.226  98.176  1.00 26.28 ? 604 DG  H O6    1 
ATOM   847  N N1    . DG  C 1 4  ? 17.314  22.357  96.217  1.00 23.56 ? 604 DG  H N1    1 
ATOM   848  C C2    . DG  C 1 4  ? 16.840  22.543  94.946  1.00 25.31 ? 604 DG  H C2    1 
ATOM   849  N N2    . DG  C 1 4  ? 17.269  23.644  94.314  1.00 23.16 ? 604 DG  H N2    1 
ATOM   850  N N3    . DG  C 1 4  ? 16.004  21.709  94.335  1.00 25.52 ? 604 DG  H N3    1 
ATOM   851  C C4    . DG  C 1 4  ? 15.681  20.658  95.114  1.00 26.27 ? 604 DG  H C4    1 
ATOM   852  P P     . DT  C 1 5  ? 14.203  17.827  89.691  1.00 33.16 ? 605 DT  H P     1 
ATOM   853  O OP1   . DT  C 1 5  ? 13.657  18.019  88.320  1.00 31.79 ? 605 DT  H OP1   1 
ATOM   854  O OP2   . DT  C 1 5  ? 14.420  16.463  90.210  1.00 30.11 ? 605 DT  H OP2   1 
ATOM   855  O "O5'" . DT  C 1 5  ? 15.563  18.640  89.780  1.00 30.30 ? 605 DT  H "O5'" 1 
ATOM   856  C "C5'" . DT  C 1 5  ? 15.570  20.026  89.492  1.00 30.05 ? 605 DT  H "C5'" 1 
ATOM   857  C "C4'" . DT  C 1 5  ? 16.967  20.570  89.633  1.00 29.88 ? 605 DT  H "C4'" 1 
ATOM   858  O "O4'" . DT  C 1 5  ? 17.325  20.698  91.030  1.00 30.01 ? 605 DT  H "O4'" 1 
ATOM   859  C "C3'" . DT  C 1 5  ? 18.039  19.679  89.008  1.00 29.05 ? 605 DT  H "C3'" 1 
ATOM   860  O "O3'" . DT  C 1 5  ? 19.073  20.533  88.555  1.00 29.24 ? 605 DT  H "O3'" 1 
ATOM   861  C "C2'" . DT  C 1 5  ? 18.571  18.920  90.207  1.00 29.13 ? 605 DT  H "C2'" 1 
ATOM   862  C "C1'" . DT  C 1 5  ? 18.562  20.040  91.225  1.00 28.69 ? 605 DT  H "C1'" 1 
ATOM   863  N N1    . DT  C 1 5  ? 18.660  19.644  92.633  1.00 28.46 ? 605 DT  H N1    1 
ATOM   864  C C2    . DT  C 1 5  ? 19.350  20.491  93.472  1.00 28.48 ? 605 DT  H C2    1 
ATOM   865  O O2    . DT  C 1 5  ? 19.860  21.534  93.090  1.00 27.55 ? 605 DT  H O2    1 
ATOM   866  N N3    . DT  C 1 5  ? 19.424  20.070  94.775  1.00 28.68 ? 605 DT  H N3    1 
ATOM   867  C C4    . DT  C 1 5  ? 18.894  18.911  95.306  1.00 28.46 ? 605 DT  H C4    1 
ATOM   868  O O4    . DT  C 1 5  ? 19.048  18.660  96.498  1.00 30.27 ? 605 DT  H O4    1 
ATOM   869  C C5    . DT  C 1 5  ? 18.180  18.068  94.365  1.00 28.27 ? 605 DT  H C5    1 
ATOM   870  C C7    . DT  C 1 5  ? 17.577  16.788  94.847  1.00 28.51 ? 605 DT  H C7    1 
ATOM   871  C C6    . DT  C 1 5  ? 18.098  18.476  93.094  1.00 28.72 ? 605 DT  H C6    1 
ATOM   872  P P     . DA  C 1 6  ? 19.737  20.308  87.119  1.00 29.74 ? 606 DA  H P     1 
ATOM   873  O OP1   . DA  C 1 6  ? 18.787  20.831  86.112  1.00 29.48 ? 606 DA  H OP1   1 
ATOM   874  O OP2   . DA  C 1 6  ? 20.241  18.913  87.005  1.00 25.79 ? 606 DA  H OP2   1 
ATOM   875  O "O5'" . DA  C 1 6  ? 20.957  21.319  87.177  1.00 27.87 ? 606 DA  H "O5'" 1 
ATOM   876  C "C5'" . DA  C 1 6  ? 20.733  22.687  87.501  1.00 24.22 ? 606 DA  H "C5'" 1 
ATOM   877  C "C4'" . DA  C 1 6  ? 21.946  23.257  88.193  1.00 23.28 ? 606 DA  H "C4'" 1 
ATOM   878  O "O4'" . DA  C 1 6  ? 22.000  22.811  89.568  1.00 23.21 ? 606 DA  H "O4'" 1 
ATOM   879  C "C3'" . DA  C 1 6  ? 23.263  22.830  87.559  1.00 21.94 ? 606 DA  H "C3'" 1 
ATOM   880  O "O3'" . DA  C 1 6  ? 24.152  23.935  87.562  1.00 21.73 ? 606 DA  H "O3'" 1 
ATOM   881  C "C2'" . DA  C 1 6  ? 23.754  21.713  88.466  1.00 22.48 ? 606 DA  H "C2'" 1 
ATOM   882  C "C1'" . DA  C 1 6  ? 23.217  22.130  89.824  1.00 21.21 ? 606 DA  H "C1'" 1 
ATOM   883  N N9    . DA  C 1 6  ? 22.900  21.028  90.727  1.00 22.13 ? 606 DA  H N9    1 
ATOM   884  C C8    . DA  C 1 6  ? 22.110  19.933  90.468  1.00 21.31 ? 606 DA  H C8    1 
ATOM   885  N N7    . DA  C 1 6  ? 21.925  19.158  91.505  1.00 21.68 ? 606 DA  H N7    1 
ATOM   886  C C5    . DA  C 1 6  ? 22.660  19.769  92.512  1.00 21.22 ? 606 DA  H C5    1 
ATOM   887  C C6    . DA  C 1 6  ? 22.864  19.441  93.862  1.00 21.04 ? 606 DA  H C6    1 
ATOM   888  N N6    . DA  C 1 6  ? 22.303  18.385  94.463  1.00 21.40 ? 606 DA  H N6    1 
ATOM   889  N N1    . DA  C 1 6  ? 23.668  20.247  94.587  1.00 19.58 ? 606 DA  H N1    1 
ATOM   890  C C2    . DA  C 1 6  ? 24.214  21.314  93.992  1.00 20.87 ? 606 DA  H C2    1 
ATOM   891  N N3    . DA  C 1 6  ? 24.086  21.737  92.734  1.00 21.70 ? 606 DA  H N3    1 
ATOM   892  C C4    . DA  C 1 6  ? 23.286  20.908  92.039  1.00 21.70 ? 606 DA  H C4    1 
ATOM   893  P P     . DG  C 1 7  ? 25.518  23.848  86.744  1.00 22.93 ? 607 DG  H P     1 
ATOM   894  O OP1   . DG  C 1 7  ? 25.882  25.224  86.347  1.00 20.96 ? 607 DG  H OP1   1 
ATOM   895  O OP2   . DG  C 1 7  ? 25.421  22.777  85.720  1.00 21.94 ? 607 DG  H OP2   1 
ATOM   896  O "O5'" . DG  C 1 7  ? 26.542  23.389  87.867  1.00 21.87 ? 607 DG  H "O5'" 1 
ATOM   897  C "C5'" . DG  C 1 7  ? 26.754  24.217  88.997  1.00 22.40 ? 607 DG  H "C5'" 1 
ATOM   898  C "C4'" . DG  C 1 7  ? 27.713  23.557  89.955  1.00 21.64 ? 607 DG  H "C4'" 1 
ATOM   899  O "O4'" . DG  C 1 7  ? 27.040  22.571  90.768  1.00 20.44 ? 607 DG  H "O4'" 1 
ATOM   900  C "C3'" . DG  C 1 7  ? 28.893  22.851  89.289  1.00 21.76 ? 607 DG  H "C3'" 1 
ATOM   901  O "O3'" . DG  C 1 7  ? 30.092  23.435  89.792  1.00 22.42 ? 607 DG  H "O3'" 1 
ATOM   902  C "C2'" . DG  C 1 7  ? 28.721  21.383  89.676  1.00 22.31 ? 607 DG  H "C2'" 1 
ATOM   903  C "C1'" . DG  C 1 7  ? 27.885  21.442  90.946  1.00 19.59 ? 607 DG  H "C1'" 1 
ATOM   904  N N9    . DG  C 1 7  ? 27.033  20.280  91.222  1.00 19.39 ? 607 DG  H N9    1 
ATOM   905  C C8    . DG  C 1 7  ? 26.226  19.614  90.330  1.00 16.71 ? 607 DG  H C8    1 
ATOM   906  N N7    . DG  C 1 7  ? 25.576  18.617  90.866  1.00 16.33 ? 607 DG  H N7    1 
ATOM   907  C C5    . DG  C 1 7  ? 25.971  18.620  92.199  1.00 19.30 ? 607 DG  H C5    1 
ATOM   908  C C6    . DG  C 1 7  ? 25.603  17.755  93.284  1.00 19.52 ? 607 DG  H C6    1 
ATOM   909  O O6    . DG  C 1 7  ? 24.824  16.785  93.285  1.00 20.23 ? 607 DG  H O6    1 
ATOM   910  N N1    . DG  C 1 7  ? 26.249  18.112  94.464  1.00 20.50 ? 607 DG  H N1    1 
ATOM   911  C C2    . DG  C 1 7  ? 27.130  19.149  94.594  1.00 19.62 ? 607 DG  H C2    1 
ATOM   912  N N2    . DG  C 1 7  ? 27.635  19.323  95.821  1.00 21.36 ? 607 DG  H N2    1 
ATOM   913  N N3    . DG  C 1 7  ? 27.489  19.957  93.600  1.00 20.34 ? 607 DG  H N3    1 
ATOM   914  C C4    . DG  C 1 7  ? 26.872  19.637  92.439  1.00 18.68 ? 607 DG  H C4    1 
ATOM   915  P P     . DC  C 1 8  ? 31.514  22.908  89.287  1.00 23.75 ? 608 DC  H P     1 
ATOM   916  O OP1   . DC  C 1 8  ? 32.433  24.065  89.344  1.00 24.26 ? 608 DC  H OP1   1 
ATOM   917  O OP2   . DC  C 1 8  ? 31.398  22.111  88.030  1.00 18.95 ? 608 DC  H OP2   1 
ATOM   918  O "O5'" . DC  C 1 8  ? 31.916  21.918  90.457  1.00 19.92 ? 608 DC  H "O5'" 1 
ATOM   919  C "C5'" . DC  C 1 8  ? 31.736  22.320  91.803  1.00 21.21 ? 608 DC  H "C5'" 1 
ATOM   920  C "C4'" . DC  C 1 8  ? 32.048  21.178  92.738  1.00 19.98 ? 608 DC  H "C4'" 1 
ATOM   921  O "O4'" . DC  C 1 8  ? 30.924  20.276  92.869  1.00 19.07 ? 608 DC  H "O4'" 1 
ATOM   922  C "C3'" . DC  C 1 8  ? 33.251  20.331  92.328  1.00 20.75 ? 608 DC  H "C3'" 1 
ATOM   923  O "O3'" . DC  C 1 8  ? 34.228  20.405  93.361  1.00 21.87 ? 608 DC  H "O3'" 1 
ATOM   924  C "C2'" . DC  C 1 8  ? 32.679  18.925  92.158  1.00 21.00 ? 608 DC  H "C2'" 1 
ATOM   925  C "C1'" . DC  C 1 8  ? 31.393  18.944  92.978  1.00 19.09 ? 608 DC  H "C1'" 1 
ATOM   926  N N1    . DC  C 1 8  ? 30.315  18.043  92.496  1.00 18.31 ? 608 DC  H N1    1 
ATOM   927  C C2    . DC  C 1 8  ? 29.705  17.144  93.395  1.00 18.62 ? 608 DC  H C2    1 
ATOM   928  O O2    . DC  C 1 8  ? 30.099  17.096  94.570  1.00 20.25 ? 608 DC  H O2    1 
ATOM   929  N N3    . DC  C 1 8  ? 28.705  16.341  92.957  1.00 17.84 ? 608 DC  H N3    1 
ATOM   930  C C4    . DC  C 1 8  ? 28.319  16.396  91.680  1.00 19.29 ? 608 DC  H C4    1 
ATOM   931  N N4    . DC  C 1 8  ? 27.325  15.586  91.292  1.00 17.35 ? 608 DC  H N4    1 
ATOM   932  C C5    . DC  C 1 8  ? 28.930  17.283  90.744  1.00 17.38 ? 608 DC  H C5    1 
ATOM   933  C C6    . DC  C 1 8  ? 29.912  18.083  91.190  1.00 19.19 ? 608 DC  H C6    1 
ATOM   934  P P     . DA  C 1 9  ? 35.774  20.141  93.027  1.00 24.53 ? 609 DA  H P     1 
ATOM   935  O OP1   . DA  C 1 9  ? 36.550  21.168  93.769  1.00 23.99 ? 609 DA  H OP1   1 
ATOM   936  O OP2   . DA  C 1 9  ? 35.987  19.980  91.571  1.00 24.65 ? 609 DA  H OP2   1 
ATOM   937  O "O5'" . DA  C 1 9  ? 36.003  18.747  93.746  1.00 24.07 ? 609 DA  H "O5'" 1 
ATOM   938  C "C5'" . DA  C 1 9  ? 35.666  18.617  95.121  1.00 23.84 ? 609 DA  H "C5'" 1 
ATOM   939  C "C4'" . DA  C 1 9  ? 35.631  17.164  95.512  1.00 22.82 ? 609 DA  H "C4'" 1 
ATOM   940  O "O4'" . DA  C 1 9  ? 34.405  16.546  95.052  1.00 22.23 ? 609 DA  H "O4'" 1 
ATOM   941  C "C3'" . DA  C 1 9  ? 36.785  16.355  94.929  1.00 22.71 ? 609 DA  H "C3'" 1 
ATOM   942  O "O3'" . DA  C 1 9  ? 37.346  15.579  95.972  1.00 24.54 ? 609 DA  H "O3'" 1 
ATOM   943  C "C2'" . DA  C 1 9  ? 36.123  15.497  93.860  1.00 21.74 ? 609 DA  H "C2'" 1 
ATOM   944  C "C1'" . DA  C 1 9  ? 34.701  15.331  94.382  1.00 20.64 ? 609 DA  H "C1'" 1 
ATOM   945  N N9    . DA  C 1 9  ? 33.691  15.136  93.335  1.00 17.84 ? 609 DA  H N9    1 
ATOM   946  C C8    . DA  C 1 9  ? 33.658  15.694  92.081  1.00 16.53 ? 609 DA  H C8    1 
ATOM   947  N N7    . DA  C 1 9  ? 32.636  15.309  91.355  1.00 17.20 ? 609 DA  H N7    1 
ATOM   948  C C5    . DA  C 1 9  ? 31.943  14.442  92.186  1.00 17.21 ? 609 DA  H C5    1 
ATOM   949  C C6    . DA  C 1 9  ? 30.763  13.691  92.001  1.00 18.93 ? 609 DA  H C6    1 
ATOM   950  N N6    . DA  C 1 9  ? 30.054  13.687  90.865  1.00 17.38 ? 609 DA  H N6    1 
ATOM   951  N N1    . DA  C 1 9  ? 30.331  12.933  93.035  1.00 19.29 ? 609 DA  H N1    1 
ATOM   952  C C2    . DA  C 1 9  ? 31.051  12.930  94.171  1.00 20.13 ? 609 DA  H C2    1 
ATOM   953  N N3    . DA  C 1 9  ? 32.180  13.585  94.459  1.00 18.27 ? 609 DA  H N3    1 
ATOM   954  C C4    . DA  C 1 9  ? 32.576  14.330  93.413  1.00 17.91 ? 609 DA  H C4    1 
ATOM   955  P P     . DC  C 1 10 ? 38.671  14.715  95.715  1.00 23.81 ? 610 DC  H P     1 
ATOM   956  O OP1   . DC  C 1 10 ? 39.633  15.177  96.741  1.00 24.74 ? 610 DC  H OP1   1 
ATOM   957  O OP2   . DC  C 1 10 ? 39.062  14.715  94.278  1.00 23.55 ? 610 DC  H OP2   1 
ATOM   958  O "O5'" . DC  C 1 10 ? 38.172  13.276  96.149  1.00 23.70 ? 610 DC  H "O5'" 1 
ATOM   959  C "C5'" . DC  C 1 10 ? 37.309  13.165  97.269  1.00 21.69 ? 610 DC  H "C5'" 1 
ATOM   960  C "C4'" . DC  C 1 10 ? 36.528  11.879  97.206  1.00 21.78 ? 610 DC  H "C4'" 1 
ATOM   961  O "O4'" . DC  C 1 10 ? 35.444  11.978  96.247  1.00 21.23 ? 610 DC  H "O4'" 1 
ATOM   962  C "C3'" . DC  C 1 10 ? 37.374  10.680  96.798  1.00 20.90 ? 610 DC  H "C3'" 1 
ATOM   963  O "O3'" . DC  C 1 10 ? 37.430  9.739   97.862  1.00 21.83 ? 610 DC  H "O3'" 1 
ATOM   964  C "C2'" . DC  C 1 10 ? 36.688  10.123  95.557  1.00 20.12 ? 610 DC  H "C2'" 1 
ATOM   965  C "C1'" . DC  C 1 10 ? 35.297  10.747  95.560  1.00 20.07 ? 610 DC  H "C1'" 1 
ATOM   966  N N1    . DC  C 1 10 ? 34.797  11.052  94.201  1.00 19.44 ? 610 DC  H N1    1 
ATOM   967  C C2    . DC  C 1 10 ? 33.641  10.415  93.741  1.00 19.20 ? 610 DC  H C2    1 
ATOM   968  O O2    . DC  C 1 10 ? 33.045  9.632   94.495  1.00 19.47 ? 610 DC  H O2    1 
ATOM   969  N N3    . DC  C 1 10 ? 33.199  10.666  92.486  1.00 18.91 ? 610 DC  H N3    1 
ATOM   970  C C4    . DC  C 1 10 ? 33.852  11.526  91.705  1.00 19.57 ? 610 DC  H C4    1 
ATOM   971  N N4    . DC  C 1 10 ? 33.370  11.742  90.473  1.00 20.13 ? 610 DC  H N4    1 
ATOM   972  C C5    . DC  C 1 10 ? 35.026  12.203  92.150  1.00 20.03 ? 610 DC  H C5    1 
ATOM   973  C C6    . DC  C 1 10 ? 35.460  11.937  93.395  1.00 19.15 ? 610 DC  H C6    1 
ATOM   974  P P     . DG  C 1 11 ? 38.528  8.584   97.825  1.00 19.23 ? 611 DG  H P     1 
ATOM   975  O OP1   . DG  C 1 11 ? 38.925  8.282   99.230  1.00 21.46 ? 611 DG  H OP1   1 
ATOM   976  O OP2   . DG  C 1 11 ? 39.564  8.952   96.832  1.00 21.83 ? 611 DG  H OP2   1 
ATOM   977  O "O5'" . DG  C 1 11 ? 37.687  7.362   97.267  1.00 21.69 ? 611 DG  H "O5'" 1 
ATOM   978  C "C5'" . DG  C 1 11 ? 36.451  7.011   97.870  1.00 21.37 ? 611 DG  H "C5'" 1 
ATOM   979  C "C4'" . DG  C 1 11 ? 35.783  5.922   97.070  1.00 21.31 ? 611 DG  H "C4'" 1 
ATOM   980  O "O4'" . DG  C 1 11 ? 35.285  6.471   95.826  1.00 20.33 ? 611 DG  H "O4'" 1 
ATOM   981  C "C3'" . DG  C 1 11 ? 36.706  4.766   96.686  1.00 21.24 ? 611 DG  H "C3'" 1 
ATOM   982  O "O3'" . DG  C 1 11 ? 35.965  3.554   96.814  1.00 20.92 ? 611 DG  H "O3'" 1 
ATOM   983  C "C2'" . DG  C 1 11 ? 37.062  5.065   95.237  1.00 20.77 ? 611 DG  H "C2'" 1 
ATOM   984  C "C1'" . DG  C 1 11 ? 35.801  5.740   94.727  1.00 20.02 ? 611 DG  H "C1'" 1 
ATOM   985  N N9    . DG  C 1 11 ? 35.969  6.675   93.615  1.00 18.79 ? 611 DG  H N9    1 
ATOM   986  C C8    . DG  C 1 11 ? 36.973  7.596   93.432  1.00 18.71 ? 611 DG  H C8    1 
ATOM   987  N N7    . DG  C 1 11 ? 36.822  8.310   92.346  1.00 18.40 ? 611 DG  H N7    1 
ATOM   988  C C5    . DG  C 1 11 ? 35.652  7.823   91.775  1.00 18.37 ? 611 DG  H C5    1 
ATOM   989  C C6    . DG  C 1 11 ? 34.975  8.207   90.580  1.00 18.62 ? 611 DG  H C6    1 
ATOM   990  O O6    . DG  C 1 11 ? 35.287  9.083   89.766  1.00 17.13 ? 611 DG  H O6    1 
ATOM   991  N N1    . DG  C 1 11 ? 33.821  7.447   90.378  1.00 19.38 ? 611 DG  H N1    1 
ATOM   992  C C2    . DG  C 1 11 ? 33.380  6.442   91.213  1.00 18.18 ? 611 DG  H C2    1 
ATOM   993  N N2    . DG  C 1 11 ? 32.253  5.795   90.846  1.00 15.87 ? 611 DG  H N2    1 
ATOM   994  N N3    . DG  C 1 11 ? 34.000  6.087   92.328  1.00 18.08 ? 611 DG  H N3    1 
ATOM   995  C C4    . DG  C 1 11 ? 35.118  6.812   92.544  1.00 18.96 ? 611 DG  H C4    1 
ATOM   996  P P     . DT  C 1 12 ? 36.685  2.135   96.605  1.00 26.07 ? 612 DT  H P     1 
ATOM   997  O OP1   . DT  C 1 12 ? 35.978  1.212   97.532  1.00 19.68 ? 612 DT  H OP1   1 
ATOM   998  O OP2   . DT  C 1 12 ? 38.165  2.229   96.639  1.00 20.04 ? 612 DT  H OP2   1 
ATOM   999  O "O5'" . DT  C 1 12 ? 36.245  1.751   95.131  1.00 23.91 ? 612 DT  H "O5'" 1 
ATOM   1000 C "C5'" . DT  C 1 12 ? 34.867  1.748   94.810  1.00 23.72 ? 612 DT  H "C5'" 1 
ATOM   1001 C "C4'" . DT  C 1 12 ? 34.666  1.579   93.325  1.00 26.04 ? 612 DT  H "C4'" 1 
ATOM   1002 O "O4'" . DT  C 1 12 ? 34.941  2.812   92.617  1.00 24.82 ? 612 DT  H "O4'" 1 
ATOM   1003 C "C3'" . DT  C 1 12 ? 35.501  0.484   92.655  1.00 26.87 ? 612 DT  H "C3'" 1 
ATOM   1004 O "O3'" . DT  C 1 12 ? 34.600  -0.462  92.068  1.00 28.64 ? 612 DT  H "O3'" 1 
ATOM   1005 C "C2'" . DT  C 1 12 ? 36.329  1.237   91.614  1.00 25.15 ? 612 DT  H "C2'" 1 
ATOM   1006 C "C1'" . DT  C 1 12 ? 35.485  2.480   91.357  1.00 24.06 ? 612 DT  H "C1'" 1 
ATOM   1007 N N1    . DT  C 1 12 ? 36.153  3.689   90.788  1.00 22.39 ? 612 DT  H N1    1 
ATOM   1008 C C2    . DT  C 1 12 ? 35.541  4.279   89.699  1.00 21.43 ? 612 DT  H C2    1 
ATOM   1009 O O2    . DT  C 1 12 ? 34.473  3.894   89.251  1.00 21.39 ? 612 DT  H O2    1 
ATOM   1010 N N3    . DT  C 1 12 ? 36.221  5.349   89.159  1.00 19.53 ? 612 DT  H N3    1 
ATOM   1011 C C4    . DT  C 1 12 ? 37.410  5.887   89.604  1.00 18.84 ? 612 DT  H C4    1 
ATOM   1012 O O4    . DT  C 1 12 ? 37.919  6.833   89.004  1.00 18.63 ? 612 DT  H O4    1 
ATOM   1013 C C5    . DT  C 1 12 ? 37.970  5.256   90.781  1.00 19.12 ? 612 DT  H C5    1 
ATOM   1014 C C7    . DT  C 1 12 ? 39.224  5.824   91.371  1.00 20.33 ? 612 DT  H C7    1 
ATOM   1015 C C6    . DT  C 1 12 ? 37.329  4.195   91.300  1.00 20.07 ? 612 DT  H C6    1 
ATOM   1016 P P     . DG  C 1 13 ? 35.146  -1.864  91.515  1.00 32.19 ? 613 DG  H P     1 
ATOM   1017 O OP1   . DG  C 1 13 ? 34.249  -2.931  92.015  1.00 31.08 ? 613 DG  H OP1   1 
ATOM   1018 O OP2   . DG  C 1 13 ? 36.608  -1.972  91.734  1.00 29.71 ? 613 DG  H OP2   1 
ATOM   1019 O "O5'" . DG  C 1 13 ? 34.870  -1.710  89.957  1.00 30.52 ? 613 DG  H "O5'" 1 
ATOM   1020 C "C5'" . DG  C 1 13 ? 33.560  -1.391  89.507  1.00 30.24 ? 613 DG  H "C5'" 1 
ATOM   1021 C "C4'" . DG  C 1 13 ? 33.553  -1.198  88.012  1.00 30.58 ? 613 DG  H "C4'" 1 
ATOM   1022 O "O4'" . DG  C 1 13 ? 34.121  0.087   87.667  1.00 29.46 ? 613 DG  H "O4'" 1 
ATOM   1023 C "C3'" . DG  C 1 13 ? 34.346  -2.246  87.238  1.00 31.28 ? 613 DG  H "C3'" 1 
ATOM   1024 O "O3'" . DG  C 1 13 ? 33.569  -2.663  86.115  1.00 33.51 ? 613 DG  H "O3'" 1 
ATOM   1025 C "C2'" . DG  C 1 13 ? 35.620  -1.512  86.840  1.00 29.89 ? 613 DG  H "C2'" 1 
ATOM   1026 C "C1'" . DG  C 1 13 ? 35.149  -0.071  86.705  1.00 28.14 ? 613 DG  H "C1'" 1 
ATOM   1027 N N9    . DG  C 1 13 ? 36.158  0.957   86.965  1.00 27.24 ? 613 DG  H N9    1 
ATOM   1028 C C8    . DG  C 1 13 ? 37.055  0.999   88.008  1.00 26.84 ? 613 DG  H C8    1 
ATOM   1029 N N7    . DG  C 1 13 ? 37.812  2.062   87.990  1.00 26.49 ? 613 DG  H N7    1 
ATOM   1030 C C5    . DG  C 1 13 ? 37.399  2.763   86.863  1.00 23.82 ? 613 DG  H C5    1 
ATOM   1031 C C6    . DG  C 1 13 ? 37.853  4.002   86.327  1.00 23.35 ? 613 DG  H C6    1 
ATOM   1032 O O6    . DG  C 1 13 ? 38.748  4.748   86.750  1.00 22.73 ? 613 DG  H O6    1 
ATOM   1033 N N1    . DG  C 1 13 ? 37.149  4.351   85.177  1.00 20.51 ? 613 DG  H N1    1 
ATOM   1034 C C2    . DG  C 1 13 ? 36.139  3.609   84.616  1.00 21.64 ? 613 DG  H C2    1 
ATOM   1035 N N2    . DG  C 1 13 ? 35.565  4.124   83.521  1.00 20.09 ? 613 DG  H N2    1 
ATOM   1036 N N3    . DG  C 1 13 ? 35.718  2.451   85.097  1.00 23.24 ? 613 DG  H N3    1 
ATOM   1037 C C4    . DG  C 1 13 ? 36.385  2.092   86.216  1.00 24.25 ? 613 DG  H C4    1 
ATOM   1038 P P     . DC  C 1 14 ? 34.205  -3.653  85.027  1.00 35.21 ? 614 DC  H P     1 
ATOM   1039 O OP1   . DC  C 1 14 ? 33.112  -4.550  84.567  1.00 34.98 ? 614 DC  H OP1   1 
ATOM   1040 O OP2   . DC  C 1 14 ? 35.469  -4.237  85.541  1.00 34.95 ? 614 DC  H OP2   1 
ATOM   1041 O "O5'" . DC  C 1 14 ? 34.555  -2.666  83.836  1.00 35.21 ? 614 DC  H "O5'" 1 
ATOM   1042 C "C5'" . DC  C 1 14 ? 33.576  -1.747  83.371  1.00 32.86 ? 614 DC  H "C5'" 1 
ATOM   1043 C "C4'" . DC  C 1 14 ? 34.115  -0.956  82.207  1.00 31.59 ? 614 DC  H "C4'" 1 
ATOM   1044 O "O4'" . DC  C 1 14 ? 35.035  0.060   82.662  1.00 30.97 ? 614 DC  H "O4'" 1 
ATOM   1045 C "C3'" . DC  C 1 14 ? 34.864  -1.781  81.164  1.00 31.66 ? 614 DC  H "C3'" 1 
ATOM   1046 O "O3'" . DC  C 1 14 ? 34.466  -1.323  79.876  1.00 33.03 ? 614 DC  H "O3'" 1 
ATOM   1047 C "C2'" . DC  C 1 14 ? 36.325  -1.454  81.434  1.00 30.49 ? 614 DC  H "C2'" 1 
ATOM   1048 C "C1'" . DC  C 1 14 ? 36.240  -0.016  81.925  1.00 29.28 ? 614 DC  H "C1'" 1 
ATOM   1049 N N1    . DC  C 1 14 ? 37.332  0.439   82.805  1.00 27.77 ? 614 DC  H N1    1 
ATOM   1050 C C2    . DC  C 1 14 ? 38.020  1.611   82.471  1.00 27.91 ? 614 DC  H C2    1 
ATOM   1051 O O2    . DC  C 1 14 ? 37.710  2.214   81.434  1.00 28.15 ? 614 DC  H O2    1 
ATOM   1052 N N3    . DC  C 1 14 ? 39.006  2.055   83.284  1.00 27.26 ? 614 DC  H N3    1 
ATOM   1053 C C4    . DC  C 1 14 ? 39.317  1.378   84.392  1.00 27.40 ? 614 DC  H C4    1 
ATOM   1054 N N4    . DC  C 1 14 ? 40.290  1.867   85.176  1.00 25.98 ? 614 DC  H N4    1 
ATOM   1055 C C5    . DC  C 1 14 ? 38.643  0.172   84.751  1.00 26.60 ? 614 DC  H C5    1 
ATOM   1056 C C6    . DC  C 1 14 ? 37.666  -0.257  83.936  1.00 28.25 ? 614 DC  H C6    1 
ATOM   1057 P P     . DT  C 1 15 ? 34.575  -2.301  78.615  1.00 33.18 ? 615 DT  H P     1 
ATOM   1058 O OP1   . DT  C 1 15 ? 33.283  -2.243  77.888  1.00 31.88 ? 615 DT  H OP1   1 
ATOM   1059 O OP2   . DT  C 1 15 ? 35.112  -3.610  79.074  1.00 32.89 ? 615 DT  H OP2   1 
ATOM   1060 O "O5'" . DT  C 1 15 ? 35.662  -1.570  77.717  1.00 34.70 ? 615 DT  H "O5'" 1 
ATOM   1061 C "C5'" . DT  C 1 15 ? 35.456  -0.218  77.317  1.00 37.25 ? 615 DT  H "C5'" 1 
ATOM   1062 C "C4'" . DT  C 1 15 ? 36.750  0.391   76.837  1.00 38.72 ? 615 DT  H "C4'" 1 
ATOM   1063 O "O4'" . DT  C 1 15 ? 37.604  0.751   77.953  1.00 38.38 ? 615 DT  H "O4'" 1 
ATOM   1064 C "C3'" . DT  C 1 15 ? 37.582  -0.532  75.946  1.00 40.41 ? 615 DT  H "C3'" 1 
ATOM   1065 O "O3'" . DT  C 1 15 ? 38.092  0.211   74.842  1.00 42.51 ? 615 DT  H "O3'" 1 
ATOM   1066 C "C2'" . DT  C 1 15 ? 38.733  -0.948  76.848  1.00 39.20 ? 615 DT  H "C2'" 1 
ATOM   1067 C "C1'" . DT  C 1 15 ? 38.917  0.315   77.665  1.00 37.57 ? 615 DT  H "C1'" 1 
ATOM   1068 N N1    . DT  C 1 15 ? 39.653  0.181   78.936  1.00 36.43 ? 615 DT  H N1    1 
ATOM   1069 C C2    . DT  C 1 15 ? 40.542  1.183   79.256  1.00 35.62 ? 615 DT  H C2    1 
ATOM   1070 O O2    . DT  C 1 15 ? 40.764  2.135   78.527  1.00 35.10 ? 615 DT  H O2    1 
ATOM   1071 N N3    . DT  C 1 15 ? 41.168  1.028   80.464  1.00 34.63 ? 615 DT  H N3    1 
ATOM   1072 C C4    . DT  C 1 15 ? 41.004  -0.005  81.360  1.00 34.19 ? 615 DT  H C4    1 
ATOM   1073 O O4    . DT  C 1 15 ? 41.613  0.010   82.421  1.00 34.17 ? 615 DT  H O4    1 
ATOM   1074 C C5    . DT  C 1 15 ? 40.083  -1.040  80.947  1.00 34.60 ? 615 DT  H C5    1 
ATOM   1075 C C7    . DT  C 1 15 ? 39.873  -2.220  81.842  1.00 34.14 ? 615 DT  H C7    1 
ATOM   1076 C C6    . DT  C 1 15 ? 39.458  -0.895  79.771  1.00 35.08 ? 615 DT  H C6    1 
ATOM   1077 P P     . DA  C 1 16 ? 38.377  -0.532  73.452  1.00 44.68 ? 616 DA  H P     1 
ATOM   1078 O OP1   . DA  C 1 16 ? 37.180  -0.320  72.597  1.00 44.25 ? 616 DA  H OP1   1 
ATOM   1079 O OP2   . DA  C 1 16 ? 38.861  -1.918  73.724  1.00 42.72 ? 616 DA  H OP2   1 
ATOM   1080 O "O5'" . DA  C 1 16 ? 39.583  0.308   72.850  1.00 43.47 ? 616 DA  H "O5'" 1 
ATOM   1081 C "C5'" . DA  C 1 16 ? 39.583  1.724   72.943  1.00 43.86 ? 616 DA  H "C5'" 1 
ATOM   1082 C "C4'" . DA  C 1 16 ? 40.992  2.228   73.130  1.00 44.31 ? 616 DA  H "C4'" 1 
ATOM   1083 O "O4'" . DA  C 1 16 ? 41.444  1.998   74.488  1.00 43.66 ? 616 DA  H "O4'" 1 
ATOM   1084 C "C3'" . DA  C 1 16 ? 42.017  1.560   72.217  1.00 44.41 ? 616 DA  H "C3'" 1 
ATOM   1085 O "O3'" . DA  C 1 16 ? 42.881  2.561   71.684  1.00 46.18 ? 616 DA  H "O3'" 1 
ATOM   1086 C "C2'" . DA  C 1 16 ? 42.760  0.611   73.144  1.00 44.22 ? 616 DA  H "C2'" 1 
ATOM   1087 C "C1'" . DA  C 1 16 ? 42.701  1.344   74.473  1.00 43.55 ? 616 DA  H "C1'" 1 
ATOM   1088 N N9    . DA  C 1 16 ? 42.777  0.498   75.666  1.00 42.88 ? 616 DA  H N9    1 
ATOM   1089 C C8    . DA  C 1 16 ? 42.158  -0.705  75.901  1.00 42.88 ? 616 DA  H C8    1 
ATOM   1090 N N7    . DA  C 1 16 ? 42.387  -1.193  77.098  1.00 42.82 ? 616 DA  H N7    1 
ATOM   1091 C C5    . DA  C 1 16 ? 43.221  -0.253  77.687  1.00 41.61 ? 616 DA  H C5    1 
ATOM   1092 C C6    . DA  C 1 16 ? 43.812  -0.176  78.961  1.00 41.07 ? 616 DA  H C6    1 
ATOM   1093 N N6    . DA  C 1 16 ? 43.636  -1.091  79.918  1.00 40.65 ? 616 DA  H N6    1 
ATOM   1094 N N1    . DA  C 1 16 ? 44.596  0.891   79.226  1.00 40.63 ? 616 DA  H N1    1 
ATOM   1095 C C2    . DA  C 1 16 ? 44.767  1.813   78.271  1.00 41.01 ? 616 DA  H C2    1 
ATOM   1096 N N3    . DA  C 1 16 ? 44.260  1.857   77.041  1.00 41.74 ? 616 DA  H N3    1 
ATOM   1097 C C4    . DA  C 1 16 ? 43.485  0.783   76.810  1.00 42.00 ? 616 DA  H C4    1 
ATOM   1098 P P     . DC  C 1 17 ? 44.090  2.142   70.720  1.00 46.75 ? 617 DC  H P     1 
ATOM   1099 O OP1   . DC  C 1 17 ? 44.176  3.177   69.657  1.00 47.44 ? 617 DC  H OP1   1 
ATOM   1100 O OP2   . DC  C 1 17 ? 43.959  0.711   70.349  1.00 46.67 ? 617 DC  H OP2   1 
ATOM   1101 O "O5'" . DC  C 1 17 ? 45.351  2.314   71.669  1.00 46.92 ? 617 DC  H "O5'" 1 
ATOM   1102 C "C5'" . DC  C 1 17 ? 45.509  3.506   72.427  1.00 46.59 ? 617 DC  H "C5'" 1 
ATOM   1103 C "C4'" . DC  C 1 17 ? 46.746  3.413   73.284  1.00 46.85 ? 617 DC  H "C4'" 1 
ATOM   1104 O "O4'" . DC  C 1 17 ? 46.502  2.551   74.423  1.00 46.44 ? 617 DC  H "O4'" 1 
ATOM   1105 C "C3'" . DC  C 1 17 ? 47.954  2.830   72.553  1.00 46.78 ? 617 DC  H "C3'" 1 
ATOM   1106 O "O3'" . DC  C 1 17 ? 49.118  3.601   72.853  1.00 47.51 ? 617 DC  H "O3'" 1 
ATOM   1107 C "C2'" . DC  C 1 17 ? 48.061  1.418   73.107  1.00 46.54 ? 617 DC  H "C2'" 1 
ATOM   1108 C "C1'" . DC  C 1 17 ? 47.542  1.592   74.522  1.00 46.23 ? 617 DC  H "C1'" 1 
ATOM   1109 N N1    . DC  C 1 17 ? 46.985  0.379   75.147  1.00 45.34 ? 617 DC  H N1    1 
ATOM   1110 C C2    . DC  C 1 17 ? 47.325  0.093   76.474  1.00 44.61 ? 617 DC  H C2    1 
ATOM   1111 O O2    . DC  C 1 17 ? 48.085  0.864   77.076  1.00 43.92 ? 617 DC  H O2    1 
ATOM   1112 N N3    . DC  C 1 17 ? 46.817  -1.016  77.065  1.00 44.71 ? 617 DC  H N3    1 
ATOM   1113 C C4    . DC  C 1 17 ? 46.003  -1.823  76.379  1.00 44.99 ? 617 DC  H C4    1 
ATOM   1114 N N4    . DC  C 1 17 ? 45.526  -2.907  77.000  1.00 44.32 ? 617 DC  H N4    1 
ATOM   1115 C C5    . DC  C 1 17 ? 45.641  -1.555  75.026  1.00 44.95 ? 617 DC  H C5    1 
ATOM   1116 C C6    . DC  C 1 17 ? 46.151  -0.454  74.455  1.00 45.03 ? 617 DC  H C6    1 
ATOM   1117 P P     . DT  C 1 18 ? 50.549  3.117   72.318  1.00 48.52 ? 618 DT  H P     1 
ATOM   1118 O OP1   . DT  C 1 18 ? 51.352  4.328   72.014  1.00 48.71 ? 618 DT  H OP1   1 
ATOM   1119 O OP2   . DT  C 1 18 ? 50.342  2.089   71.262  1.00 47.59 ? 618 DT  H OP2   1 
ATOM   1120 O "O5'" . DT  C 1 18 ? 51.173  2.421   73.604  1.00 46.72 ? 618 DT  H "O5'" 1 
ATOM   1121 C "C5'" . DT  C 1 18 ? 51.118  3.081   74.862  1.00 45.68 ? 618 DT  H "C5'" 1 
ATOM   1122 C "C4'" . DT  C 1 18 ? 51.943  2.335   75.880  1.00 43.90 ? 618 DT  H "C4'" 1 
ATOM   1123 O "O4'" . DT  C 1 18 ? 51.223  1.166   76.334  1.00 43.39 ? 618 DT  H "O4'" 1 
ATOM   1124 C "C3'" . DT  C 1 18 ? 53.283  1.839   75.342  1.00 43.03 ? 618 DT  H "C3'" 1 
ATOM   1125 O "O3'" . DT  C 1 18 ? 54.315  2.091   76.295  1.00 41.79 ? 618 DT  H "O3'" 1 
ATOM   1126 C "C2'" . DT  C 1 18 ? 53.062  0.348   75.137  1.00 43.02 ? 618 DT  H "C2'" 1 
ATOM   1127 C "C1'" . DT  C 1 18 ? 52.037  0.011   76.210  1.00 42.66 ? 618 DT  H "C1'" 1 
ATOM   1128 N N1    . DT  C 1 18 ? 51.147  -1.123  75.894  1.00 41.60 ? 618 DT  H N1    1 
ATOM   1129 C C2    . DT  C 1 18 ? 50.815  -1.994  76.909  1.00 41.08 ? 618 DT  H C2    1 
ATOM   1130 O O2    . DT  C 1 18 ? 51.256  -1.896  78.043  1.00 40.28 ? 618 DT  H O2    1 
ATOM   1131 N N3    . DT  C 1 18 ? 49.947  -2.993  76.543  1.00 39.93 ? 618 DT  H N3    1 
ATOM   1132 C C4    . DT  C 1 18 ? 49.402  -3.209  75.291  1.00 40.36 ? 618 DT  H C4    1 
ATOM   1133 O O4    . DT  C 1 18 ? 48.627  -4.142  75.114  1.00 39.66 ? 618 DT  H O4    1 
ATOM   1134 C C5    . DT  C 1 18 ? 49.814  -2.275  74.271  1.00 41.03 ? 618 DT  H C5    1 
ATOM   1135 C C7    . DT  C 1 18 ? 49.295  -2.445  72.878  1.00 41.52 ? 618 DT  H C7    1 
ATOM   1136 C C6    . DT  C 1 18 ? 50.652  -1.291  74.619  1.00 41.59 ? 618 DT  H C6    1 
ATOM   1137 P P     . DC  C 1 19 ? 55.853  1.994   75.839  1.00 40.78 ? 619 DC  H P     1 
ATOM   1138 O OP1   . DC  C 1 19 ? 56.603  3.055   76.564  1.00 39.34 ? 619 DC  H OP1   1 
ATOM   1139 O OP2   . DC  C 1 19 ? 55.909  1.934   74.355  1.00 38.69 ? 619 DC  H OP2   1 
ATOM   1140 O "O5'" . DC  C 1 19 ? 56.296  0.573   76.399  1.00 38.47 ? 619 DC  H "O5'" 1 
ATOM   1141 C "C5'" . DC  C 1 19 ? 56.224  0.285   77.794  1.00 37.64 ? 619 DC  H "C5'" 1 
ATOM   1142 C "C4'" . DC  C 1 19 ? 56.563  -1.165  78.041  1.00 36.03 ? 619 DC  H "C4'" 1 
ATOM   1143 O "O4'" . DC  C 1 19 ? 55.438  -2.008  77.682  1.00 35.89 ? 619 DC  H "O4'" 1 
ATOM   1144 C "C3'" . DC  C 1 19 ? 57.750  -1.670  77.218  1.00 35.50 ? 619 DC  H "C3'" 1 
ATOM   1145 O "O3'" . DC  C 1 19 ? 58.472  -2.654  77.959  1.00 35.76 ? 619 DC  H "O3'" 1 
ATOM   1146 C "C2'" . DC  C 1 19 ? 57.077  -2.396  76.065  1.00 35.88 ? 619 DC  H "C2'" 1 
ATOM   1147 C "C1'" . DC  C 1 19 ? 55.876  -3.002  76.770  1.00 35.31 ? 619 DC  H "C1'" 1 
ATOM   1148 N N1    . DC  C 1 19 ? 54.739  -3.389  75.914  1.00 34.53 ? 619 DC  H N1    1 
ATOM   1149 C C2    . DC  C 1 19 ? 53.736  -4.202  76.459  1.00 34.75 ? 619 DC  H C2    1 
ATOM   1150 O O2    . DC  C 1 19 ? 53.804  -4.523  77.654  1.00 33.91 ? 619 DC  H O2    1 
ATOM   1151 N N3    . DC  C 1 19 ? 52.716  -4.609  75.676  1.00 34.89 ? 619 DC  H N3    1 
ATOM   1152 C C4    . DC  C 1 19 ? 52.657  -4.220  74.402  1.00 35.94 ? 619 DC  H C4    1 
ATOM   1153 N N4    . DC  C 1 19 ? 51.627  -4.648  73.668  1.00 36.79 ? 619 DC  H N4    1 
ATOM   1154 C C5    . DC  C 1 19 ? 53.651  -3.374  73.825  1.00 35.20 ? 619 DC  H C5    1 
ATOM   1155 C C6    . DC  C 1 19 ? 54.664  -2.986  74.611  1.00 35.49 ? 619 DC  H C6    1 
ATOM   1156 O "O5'" . DC  D 1 1  ? 51.273  -12.318 73.339  1.00 38.53 ? 801 DC  J "O5'" 1 
ATOM   1157 C "C5'" . DC  D 1 1  ? 51.509  -13.706 73.575  1.00 36.19 ? 801 DC  J "C5'" 1 
ATOM   1158 C "C4'" . DC  D 1 1  ? 51.492  -14.016 75.055  1.00 34.87 ? 801 DC  J "C4'" 1 
ATOM   1159 O "O4'" . DC  D 1 1  ? 52.518  -13.233 75.711  1.00 33.38 ? 801 DC  J "O4'" 1 
ATOM   1160 C "C3'" . DC  D 1 1  ? 50.180  -13.670 75.761  1.00 34.33 ? 801 DC  J "C3'" 1 
ATOM   1161 O "O3'" . DC  D 1 1  ? 49.920  -14.630 76.791  1.00 35.50 ? 801 DC  J "O3'" 1 
ATOM   1162 C "C2'" . DC  D 1 1  ? 50.462  -12.305 76.364  1.00 33.85 ? 801 DC  J "C2'" 1 
ATOM   1163 C "C1'" . DC  D 1 1  ? 51.938  -12.407 76.712  1.00 32.59 ? 801 DC  J "C1'" 1 
ATOM   1164 N N1    . DC  D 1 1  ? 52.660  -11.122 76.712  1.00 31.47 ? 801 DC  J N1    1 
ATOM   1165 C C2    . DC  D 1 1  ? 53.210  -10.661 77.912  1.00 31.27 ? 801 DC  J C2    1 
ATOM   1166 O O2    . DC  D 1 1  ? 53.085  -11.356 78.938  1.00 30.35 ? 801 DC  J O2    1 
ATOM   1167 N N3    . DC  D 1 1  ? 53.869  -9.476  77.926  1.00 30.44 ? 801 DC  J N3    1 
ATOM   1168 C C4    . DC  D 1 1  ? 53.997  -8.770  76.800  1.00 30.24 ? 801 DC  J C4    1 
ATOM   1169 N N4    . DC  D 1 1  ? 54.660  -7.611  76.861  1.00 28.37 ? 801 DC  J N4    1 
ATOM   1170 C C5    . DC  D 1 1  ? 53.451  -9.220  75.561  1.00 29.93 ? 801 DC  J C5    1 
ATOM   1171 C C6    . DC  D 1 1  ? 52.794  -10.389 75.563  1.00 31.54 ? 801 DC  J C6    1 
ATOM   1172 P P     . DG  D 1 2  ? 48.474  -14.687 77.491  1.00 35.52 ? 802 DG  J P     1 
ATOM   1173 O OP1   . DG  D 1 2  ? 48.441  -15.934 78.286  1.00 36.31 ? 802 DG  J OP1   1 
ATOM   1174 O OP2   . DG  D 1 2  ? 47.427  -14.442 76.468  1.00 36.05 ? 802 DG  J OP2   1 
ATOM   1175 O "O5'" . DG  D 1 2  ? 48.480  -13.446 78.491  1.00 35.86 ? 802 DG  J "O5'" 1 
ATOM   1176 C "C5'" . DG  D 1 2  ? 49.318  -13.429 79.645  1.00 34.30 ? 802 DG  J "C5'" 1 
ATOM   1177 C "C4'" . DG  D 1 2  ? 49.155  -12.121 80.387  1.00 34.29 ? 802 DG  J "C4'" 1 
ATOM   1178 O "O4'" . DG  D 1 2  ? 49.595  -11.025 79.553  1.00 32.97 ? 802 DG  J "O4'" 1 
ATOM   1179 C "C3'" . DG  D 1 2  ? 47.720  -11.774 80.779  1.00 34.30 ? 802 DG  J "C3'" 1 
ATOM   1180 O "O3'" . DG  D 1 2  ? 47.767  -10.947 81.943  1.00 36.32 ? 802 DG  J "O3'" 1 
ATOM   1181 C "C2'" . DG  D 1 2  ? 47.260  -10.918 79.616  1.00 33.28 ? 802 DG  J "C2'" 1 
ATOM   1182 C "C1'" . DG  D 1 2  ? 48.519  -10.110 79.372  1.00 32.69 ? 802 DG  J "C1'" 1 
ATOM   1183 N N9    . DG  D 1 2  ? 48.657  -9.523  78.045  1.00 31.29 ? 802 DG  J N9    1 
ATOM   1184 C C8    . DG  D 1 2  ? 47.947  -9.829  76.908  1.00 31.17 ? 802 DG  J C8    1 
ATOM   1185 N N7    . DG  D 1 2  ? 48.354  -9.164  75.859  1.00 30.75 ? 802 DG  J N7    1 
ATOM   1186 C C5    . DG  D 1 2  ? 49.383  -8.365  76.339  1.00 30.36 ? 802 DG  J C5    1 
ATOM   1187 C C6    . DG  D 1 2  ? 50.217  -7.443  75.666  1.00 30.87 ? 802 DG  J C6    1 
ATOM   1188 O O6    . DG  D 1 2  ? 50.223  -7.146  74.463  1.00 31.32 ? 802 DG  J O6    1 
ATOM   1189 N N1    . DG  D 1 2  ? 51.126  -6.843  76.538  1.00 30.86 ? 802 DG  J N1    1 
ATOM   1190 C C2    . DG  D 1 2  ? 51.219  -7.105  77.886  1.00 30.53 ? 802 DG  J C2    1 
ATOM   1191 N N2    . DG  D 1 2  ? 52.150  -6.419  78.571  1.00 30.58 ? 802 DG  J N2    1 
ATOM   1192 N N3    . DG  D 1 2  ? 50.453  -7.975  78.519  1.00 30.90 ? 802 DG  J N3    1 
ATOM   1193 C C4    . DG  D 1 2  ? 49.566  -8.563  77.690  1.00 30.16 ? 802 DG  J C4    1 
ATOM   1194 P P     . DA  D 1 3  ? 47.052  -11.424 83.292  1.00 38.03 ? 803 DA  J P     1 
ATOM   1195 O OP1   . DA  D 1 3  ? 47.646  -12.743 83.643  1.00 38.52 ? 803 DA  J OP1   1 
ATOM   1196 O OP2   . DA  D 1 3  ? 45.581  -11.304 83.115  1.00 37.86 ? 803 DA  J OP2   1 
ATOM   1197 O "O5'" . DA  D 1 3  ? 47.527  -10.346 84.363  1.00 37.63 ? 803 DA  J "O5'" 1 
ATOM   1198 C "C5'" . DA  D 1 3  ? 48.901  -10.243 84.731  1.00 38.36 ? 803 DA  J "C5'" 1 
ATOM   1199 C "C4'" . DA  D 1 3  ? 49.356  -8.801  84.700  1.00 38.68 ? 803 DA  J "C4'" 1 
ATOM   1200 O "O4'" . DA  D 1 3  ? 49.343  -8.290  83.342  1.00 38.01 ? 803 DA  J "O4'" 1 
ATOM   1201 C "C3'" . DA  D 1 3  ? 48.528  -7.814  85.528  1.00 39.17 ? 803 DA  J "C3'" 1 
ATOM   1202 O "O3'" . DA  D 1 3  ? 49.422  -6.868  86.125  1.00 40.74 ? 803 DA  J "O3'" 1 
ATOM   1203 C "C2'" . DA  D 1 3  ? 47.669  -7.122  84.482  1.00 37.96 ? 803 DA  J "C2'" 1 
ATOM   1204 C "C1'" . DA  D 1 3  ? 48.630  -7.059  83.309  1.00 37.29 ? 803 DA  J "C1'" 1 
ATOM   1205 N N9    . DA  D 1 3  ? 48.026  -6.924  81.983  1.00 35.41 ? 803 DA  J N9    1 
ATOM   1206 C C8    . DA  D 1 3  ? 46.936  -7.577  81.465  1.00 35.55 ? 803 DA  J C8    1 
ATOM   1207 N N7    . DA  D 1 3  ? 46.676  -7.266  80.217  1.00 34.76 ? 803 DA  J N7    1 
ATOM   1208 C C5    . DA  D 1 3  ? 47.657  -6.339  79.894  1.00 34.79 ? 803 DA  J C5    1 
ATOM   1209 C C6    . DA  D 1 3  ? 47.943  -5.636  78.709  1.00 34.70 ? 803 DA  J C6    1 
ATOM   1210 N N6    . DA  D 1 3  ? 47.256  -5.785  77.575  1.00 35.19 ? 803 DA  J N6    1 
ATOM   1211 N N1    . DA  D 1 3  ? 48.980  -4.774  78.726  1.00 34.99 ? 803 DA  J N1    1 
ATOM   1212 C C2    . DA  D 1 3  ? 49.690  -4.650  79.854  1.00 34.84 ? 803 DA  J C2    1 
ATOM   1213 N N3    . DA  D 1 3  ? 49.533  -5.266  81.022  1.00 34.54 ? 803 DA  J N3    1 
ATOM   1214 C C4    . DA  D 1 3  ? 48.484  -6.106  80.977  1.00 35.00 ? 803 DA  J C4    1 
ATOM   1215 P P     . DG  D 1 4  ? 48.923  -5.936  87.336  1.00 42.49 ? 804 DG  J P     1 
ATOM   1216 O OP1   . DG  D 1 4  ? 49.557  -6.434  88.582  1.00 43.52 ? 804 DG  J OP1   1 
ATOM   1217 O OP2   . DG  D 1 4  ? 47.447  -5.790  87.273  1.00 43.69 ? 804 DG  J OP2   1 
ATOM   1218 O "O5'" . DG  D 1 4  ? 49.586  -4.530  86.996  1.00 42.27 ? 804 DG  J "O5'" 1 
ATOM   1219 C "C5'" . DG  D 1 4  ? 50.985  -4.438  86.747  1.00 41.90 ? 804 DG  J "C5'" 1 
ATOM   1220 C "C4'" . DG  D 1 4  ? 51.298  -3.176  85.981  1.00 41.27 ? 804 DG  J "C4'" 1 
ATOM   1221 O "O4'" . DG  D 1 4  ? 50.718  -3.254  84.656  1.00 40.51 ? 804 DG  J "O4'" 1 
ATOM   1222 C "C3'" . DG  D 1 4  ? 50.743  -1.901  86.612  1.00 41.57 ? 804 DG  J "C3'" 1 
ATOM   1223 O "O3'" . DG  D 1 4  ? 51.708  -0.852  86.508  1.00 41.55 ? 804 DG  J "O3'" 1 
ATOM   1224 C "C2'" . DG  D 1 4  ? 49.502  -1.604  85.786  1.00 41.01 ? 804 DG  J "C2'" 1 
ATOM   1225 C "C1'" . DG  D 1 4  ? 49.885  -2.129  84.415  1.00 39.39 ? 804 DG  J "C1'" 1 
ATOM   1226 N N9    . DG  D 1 4  ? 48.765  -2.576  83.590  1.00 38.24 ? 804 DG  J N9    1 
ATOM   1227 C C8    . DG  D 1 4  ? 47.799  -3.491  83.931  1.00 37.85 ? 804 DG  J C8    1 
ATOM   1228 N N7    . DG  D 1 4  ? 46.945  -3.718  82.970  1.00 37.47 ? 804 DG  J N7    1 
ATOM   1229 C C5    . DG  D 1 4  ? 47.364  -2.895  81.935  1.00 37.21 ? 804 DG  J C5    1 
ATOM   1230 C C6    . DG  D 1 4  ? 46.830  -2.712  80.630  1.00 37.11 ? 804 DG  J C6    1 
ATOM   1231 O O6    . DG  D 1 4  ? 45.853  -3.264  80.110  1.00 37.05 ? 804 DG  J O6    1 
ATOM   1232 N N1    . DG  D 1 4  ? 47.562  -1.780  79.905  1.00 37.11 ? 804 DG  J N1    1 
ATOM   1233 C C2    . DG  D 1 4  ? 48.664  -1.110  80.369  1.00 36.52 ? 804 DG  J C2    1 
ATOM   1234 N N2    . DG  D 1 4  ? 49.226  -0.245  79.515  1.00 36.10 ? 804 DG  J N2    1 
ATOM   1235 N N3    . DG  D 1 4  ? 49.177  -1.276  81.579  1.00 36.68 ? 804 DG  J N3    1 
ATOM   1236 C C4    . DG  D 1 4  ? 48.481  -2.176  82.303  1.00 37.19 ? 804 DG  J C4    1 
ATOM   1237 P P     . DT  D 1 5  ? 51.373  0.597   87.107  1.00 43.08 ? 805 DT  J P     1 
ATOM   1238 O OP1   . DT  D 1 5  ? 52.651  1.193   87.576  1.00 43.90 ? 805 DT  J OP1   1 
ATOM   1239 O OP2   . DT  D 1 5  ? 50.226  0.491   88.041  1.00 43.04 ? 805 DT  J OP2   1 
ATOM   1240 O "O5'" . DT  D 1 5  ? 50.915  1.414   85.823  1.00 43.41 ? 805 DT  J "O5'" 1 
ATOM   1241 C "C5'" . DT  D 1 5  ? 51.825  1.612   84.746  1.00 44.01 ? 805 DT  J "C5'" 1 
ATOM   1242 C "C4'" . DT  D 1 5  ? 51.262  2.604   83.759  1.00 44.24 ? 805 DT  J "C4'" 1 
ATOM   1243 O "O4'" . DT  D 1 5  ? 50.181  1.997   83.014  1.00 44.26 ? 805 DT  J "O4'" 1 
ATOM   1244 C "C3'" . DT  D 1 5  ? 50.690  3.877   84.380  1.00 44.40 ? 805 DT  J "C3'" 1 
ATOM   1245 O "O3'" . DT  D 1 5  ? 51.044  4.998   83.564  1.00 45.57 ? 805 DT  J "O3'" 1 
ATOM   1246 C "C2'" . DT  D 1 5  ? 49.190  3.637   84.348  1.00 43.56 ? 805 DT  J "C2'" 1 
ATOM   1247 C "C1'" . DT  D 1 5  ? 49.030  2.821   83.079  1.00 42.65 ? 805 DT  J "C1'" 1 
ATOM   1248 N N1    . DT  D 1 5  ? 47.854  1.936   83.029  1.00 41.09 ? 805 DT  J N1    1 
ATOM   1249 C C2    . DT  D 1 5  ? 47.199  1.805   81.826  1.00 40.54 ? 805 DT  J C2    1 
ATOM   1250 O O2    . DT  D 1 5  ? 47.515  2.426   80.824  1.00 39.35 ? 805 DT  J O2    1 
ATOM   1251 N N3    . DT  D 1 5  ? 46.150  0.917   81.839  1.00 39.63 ? 805 DT  J N3    1 
ATOM   1252 C C4    . DT  D 1 5  ? 45.697  0.176   82.911  1.00 40.07 ? 805 DT  J C4    1 
ATOM   1253 O O4    . DT  D 1 5  ? 44.754  -0.598  82.764  1.00 39.68 ? 805 DT  J O4    1 
ATOM   1254 C C5    . DT  D 1 5  ? 46.412  0.389   84.152  1.00 39.42 ? 805 DT  J C5    1 
ATOM   1255 C C7    . DT  D 1 5  ? 45.976  -0.351  85.376  1.00 39.37 ? 805 DT  J C7    1 
ATOM   1256 C C6    . DT  D 1 5  ? 47.440  1.245   84.148  1.00 40.55 ? 805 DT  J C6    1 
ATOM   1257 P P     . DA  D 1 6  ? 50.628  6.479   84.020  1.00 46.37 ? 806 DA  J P     1 
ATOM   1258 O OP1   . DA  D 1 6  ? 51.822  7.352   83.849  1.00 46.52 ? 806 DA  J OP1   1 
ATOM   1259 O OP2   . DA  D 1 6  ? 49.955  6.410   85.344  1.00 46.66 ? 806 DA  J OP2   1 
ATOM   1260 O "O5'" . DA  D 1 6  ? 49.543  6.894   82.933  1.00 44.22 ? 806 DA  J "O5'" 1 
ATOM   1261 C "C5'" . DA  D 1 6  ? 49.842  6.813   81.543  1.00 40.93 ? 806 DA  J "C5'" 1 
ATOM   1262 C "C4'" . DA  D 1 6  ? 48.649  7.260   80.734  1.00 39.48 ? 806 DA  J "C4'" 1 
ATOM   1263 O "O4'" . DA  D 1 6  ? 47.605  6.260   80.801  1.00 37.13 ? 806 DA  J "O4'" 1 
ATOM   1264 C "C3'" . DA  D 1 6  ? 48.023  8.559   81.232  1.00 38.49 ? 806 DA  J "C3'" 1 
ATOM   1265 O "O3'" . DA  D 1 6  ? 47.586  9.343   80.121  1.00 39.57 ? 806 DA  J "O3'" 1 
ATOM   1266 C "C2'" . DA  D 1 6  ? 46.849  8.087   82.069  1.00 37.90 ? 806 DA  J "C2'" 1 
ATOM   1267 C "C1'" . DA  D 1 6  ? 46.420  6.827   81.336  1.00 37.28 ? 806 DA  J "C1'" 1 
ATOM   1268 N N9    . DA  D 1 6  ? 45.789  5.810   82.174  1.00 35.94 ? 806 DA  J N9    1 
ATOM   1269 C C8    . DA  D 1 6  ? 46.008  5.533   83.500  1.00 35.44 ? 806 DA  J C8    1 
ATOM   1270 N N7    . DA  D 1 6  ? 45.298  4.527   83.952  1.00 35.81 ? 806 DA  J N7    1 
ATOM   1271 C C5    . DA  D 1 6  ? 44.559  4.118   82.850  1.00 34.96 ? 806 DA  J C5    1 
ATOM   1272 C C6    . DA  D 1 6  ? 43.616  3.089   82.668  1.00 34.94 ? 806 DA  J C6    1 
ATOM   1273 N N6    . DA  D 1 6  ? 43.250  2.236   83.627  1.00 34.63 ? 806 DA  J N6    1 
ATOM   1274 N N1    . DA  D 1 6  ? 43.056  2.963   81.447  1.00 34.75 ? 806 DA  J N1    1 
ATOM   1275 C C2    . DA  D 1 6  ? 43.428  3.810   80.479  1.00 34.54 ? 806 DA  J C2    1 
ATOM   1276 N N3    . DA  D 1 6  ? 44.308  4.808   80.525  1.00 35.01 ? 806 DA  J N3    1 
ATOM   1277 C C4    . DA  D 1 6  ? 44.843  4.909   81.753  1.00 35.47 ? 806 DA  J C4    1 
ATOM   1278 P P     . DG  D 1 7  ? 47.023  10.825  80.366  1.00 38.92 ? 807 DG  J P     1 
ATOM   1279 O OP1   . DG  D 1 7  ? 47.534  11.676  79.260  1.00 40.91 ? 807 DG  J OP1   1 
ATOM   1280 O OP2   . DG  D 1 7  ? 47.285  11.212  81.773  1.00 39.76 ? 807 DG  J OP2   1 
ATOM   1281 O "O5'" . DG  D 1 7  ? 45.454  10.655  80.162  1.00 37.88 ? 807 DG  J "O5'" 1 
ATOM   1282 C "C5'" . DG  D 1 7  ? 44.949  10.168  78.924  1.00 32.63 ? 807 DG  J "C5'" 1 
ATOM   1283 C "C4'" . DG  D 1 7  ? 43.467  9.887   79.019  1.00 30.81 ? 807 DG  J "C4'" 1 
ATOM   1284 O "O4'" . DG  D 1 7  ? 43.208  8.674   79.770  1.00 29.13 ? 807 DG  J "O4'" 1 
ATOM   1285 C "C3'" . DG  D 1 7  ? 42.597  10.984  79.641  1.00 29.38 ? 807 DG  J "C3'" 1 
ATOM   1286 O "O3'" . DG  D 1 7  ? 41.476  11.201  78.784  1.00 30.56 ? 807 DG  J "O3'" 1 
ATOM   1287 C "C2'" . DG  D 1 7  ? 42.140  10.371  80.954  1.00 28.45 ? 807 DG  J "C2'" 1 
ATOM   1288 C "C1'" . DG  D 1 7  ? 42.100  8.887   80.623  1.00 28.69 ? 807 DG  J "C1'" 1 
ATOM   1289 N N9    . DG  D 1 7  ? 42.214  7.975   81.761  1.00 28.34 ? 807 DG  J N9    1 
ATOM   1290 C C8    . DG  D 1 7  ? 43.038  8.105   82.854  1.00 27.83 ? 807 DG  J C8    1 
ATOM   1291 N N7    . DG  D 1 7  ? 42.904  7.135   83.718  1.00 28.29 ? 807 DG  J N7    1 
ATOM   1292 C C5    . DG  D 1 7  ? 41.934  6.308   83.163  1.00 27.61 ? 807 DG  J C5    1 
ATOM   1293 C C6    . DG  D 1 7  ? 41.360  5.096   83.653  1.00 26.96 ? 807 DG  J C6    1 
ATOM   1294 O O6    . DG  D 1 7  ? 41.607  4.489   84.711  1.00 25.78 ? 807 DG  J O6    1 
ATOM   1295 N N1    . DG  D 1 7  ? 40.407  4.592   82.775  1.00 25.72 ? 807 DG  J N1    1 
ATOM   1296 C C2    . DG  D 1 7  ? 40.048  5.169   81.584  1.00 26.37 ? 807 DG  J C2    1 
ATOM   1297 N N2    . DG  D 1 7  ? 39.108  4.531   80.884  1.00 24.39 ? 807 DG  J N2    1 
ATOM   1298 N N3    . DG  D 1 7  ? 40.572  6.294   81.115  1.00 26.87 ? 807 DG  J N3    1 
ATOM   1299 C C4    . DG  D 1 7  ? 41.501  6.807   81.953  1.00 27.46 ? 807 DG  J C4    1 
ATOM   1300 P P     . DC  D 1 8  ? 40.491  12.448  79.027  1.00 29.37 ? 808 DC  J P     1 
ATOM   1301 O OP1   . DC  D 1 8  ? 40.531  13.252  77.784  1.00 31.67 ? 808 DC  J OP1   1 
ATOM   1302 O OP2   . DC  D 1 8  ? 40.754  13.100  80.332  1.00 30.58 ? 808 DC  J OP2   1 
ATOM   1303 O "O5'" . DC  D 1 8  ? 39.079  11.730  79.093  1.00 30.56 ? 808 DC  J "O5'" 1 
ATOM   1304 C "C5'" . DC  D 1 8  ? 38.780  10.704  78.152  1.00 31.07 ? 808 DC  J "C5'" 1 
ATOM   1305 C "C4'" . DC  D 1 8  ? 37.706  9.785   78.681  1.00 30.24 ? 808 DC  J "C4'" 1 
ATOM   1306 O "O4'" . DC  D 1 8  ? 38.201  8.916   79.729  1.00 29.94 ? 808 DC  J "O4'" 1 
ATOM   1307 C "C3'" . DC  D 1 8  ? 36.472  10.482  79.248  1.00 31.59 ? 808 DC  J "C3'" 1 
ATOM   1308 O "O3'" . DC  D 1 8  ? 35.322  9.848   78.709  1.00 33.59 ? 808 DC  J "O3'" 1 
ATOM   1309 C "C2'" . DC  D 1 8  ? 36.551  10.201  80.740  1.00 30.47 ? 808 DC  J "C2'" 1 
ATOM   1310 C "C1'" . DC  D 1 8  ? 37.216  8.840   80.745  1.00 27.94 ? 808 DC  J "C1'" 1 
ATOM   1311 N N1    . DC  D 1 8  ? 37.875  8.451   82.002  1.00 26.66 ? 808 DC  J N1    1 
ATOM   1312 C C2    . DC  D 1 8  ? 37.484  7.256   82.618  1.00 26.40 ? 808 DC  J C2    1 
ATOM   1313 O O2    . DC  D 1 8  ? 36.585  6.575   82.089  1.00 24.98 ? 808 DC  J O2    1 
ATOM   1314 N N3    . DC  D 1 8  ? 38.091  6.875   83.772  1.00 25.19 ? 808 DC  J N3    1 
ATOM   1315 C C4    . DC  D 1 8  ? 39.043  7.642   84.309  1.00 25.08 ? 808 DC  J C4    1 
ATOM   1316 N N4    . DC  D 1 8  ? 39.617  7.230   85.449  1.00 23.53 ? 808 DC  J N4    1 
ATOM   1317 C C5    . DC  D 1 8  ? 39.453  8.868   83.703  1.00 24.55 ? 808 DC  J C5    1 
ATOM   1318 C C6    . DC  D 1 8  ? 38.850  9.228   82.562  1.00 25.64 ? 808 DC  J C6    1 
ATOM   1319 P P     . DA  D 1 9  ? 33.916  10.600  78.745  1.00 34.52 ? 809 DA  J P     1 
ATOM   1320 O OP1   . DA  D 1 9  ? 33.398  10.602  77.353  1.00 35.16 ? 809 DA  J OP1   1 
ATOM   1321 O OP2   . DA  D 1 9  ? 34.048  11.874  79.488  1.00 35.36 ? 809 DA  J OP2   1 
ATOM   1322 O "O5'" . DA  D 1 9  ? 33.018  9.613   79.606  1.00 33.01 ? 809 DA  J "O5'" 1 
ATOM   1323 C "C5'" . DA  D 1 9  ? 32.846  8.266   79.190  1.00 30.18 ? 809 DA  J "C5'" 1 
ATOM   1324 C "C4'" . DA  D 1 9  ? 32.019  7.516   80.203  1.00 28.78 ? 809 DA  J "C4'" 1 
ATOM   1325 O "O4'" . DA  D 1 9  ? 32.835  7.172   81.344  1.00 28.23 ? 809 DA  J "O4'" 1 
ATOM   1326 C "C3'" . DA  D 1 9  ? 30.830  8.309   80.740  1.00 29.04 ? 809 DA  J "C3'" 1 
ATOM   1327 O "O3'" . DA  D 1 9  ? 29.673  7.479   80.763  1.00 28.63 ? 809 DA  J "O3'" 1 
ATOM   1328 C "C2'" . DA  D 1 9  ? 31.267  8.731   82.136  1.00 27.82 ? 809 DA  J "C2'" 1 
ATOM   1329 C "C1'" . DA  D 1 9  ? 32.244  7.637   82.548  1.00 26.89 ? 809 DA  J "C1'" 1 
ATOM   1330 N N9    . DA  D 1 9  ? 33.334  8.079   83.425  1.00 25.79 ? 809 DA  J N9    1 
ATOM   1331 C C8    . DA  D 1 9  ? 34.090  9.219   83.311  1.00 25.30 ? 809 DA  J C8    1 
ATOM   1332 N N7    . DA  D 1 9  ? 35.025  9.328   84.227  1.00 23.53 ? 809 DA  J N7    1 
ATOM   1333 C C5    . DA  D 1 9  ? 34.869  8.191   85.002  1.00 23.56 ? 809 DA  J C5    1 
ATOM   1334 C C6    . DA  D 1 9  ? 35.560  7.713   86.138  1.00 22.41 ? 809 DA  J C6    1 
ATOM   1335 N N6    . DA  D 1 9  ? 36.594  8.344   86.698  1.00 21.66 ? 809 DA  J N6    1 
ATOM   1336 N N1    . DA  D 1 9  ? 35.147  6.548   86.678  1.00 21.88 ? 809 DA  J N1    1 
ATOM   1337 C C2    . DA  D 1 9  ? 34.119  5.909   86.110  1.00 22.67 ? 809 DA  J C2    1 
ATOM   1338 N N3    . DA  D 1 9  ? 33.396  6.252   85.041  1.00 23.49 ? 809 DA  J N3    1 
ATOM   1339 C C4    . DA  D 1 9  ? 33.826  7.415   84.527  1.00 23.67 ? 809 DA  J C4    1 
ATOM   1340 P P     . DC  D 1 10 ? 28.252  8.110   81.149  1.00 29.55 ? 810 DC  J P     1 
ATOM   1341 O OP1   . DC  D 1 10 ? 27.281  7.639   80.131  1.00 30.89 ? 810 DC  J OP1   1 
ATOM   1342 O OP2   . DC  D 1 10 ? 28.369  9.559   81.440  1.00 30.36 ? 810 DC  J OP2   1 
ATOM   1343 O "O5'" . DC  D 1 10 ? 27.935  7.355   82.508  1.00 29.31 ? 810 DC  J "O5'" 1 
ATOM   1344 C "C5'" . DC  D 1 10 ? 28.317  5.996   82.638  1.00 27.54 ? 810 DC  J "C5'" 1 
ATOM   1345 C "C4'" . DC  D 1 10 ? 28.390  5.601   84.090  1.00 26.02 ? 810 DC  J "C4'" 1 
ATOM   1346 O "O4'" . DC  D 1 10 ? 29.628  6.050   84.694  1.00 25.43 ? 810 DC  J "O4'" 1 
ATOM   1347 C "C3'" . DC  D 1 10 ? 27.255  6.154   84.946  1.00 25.56 ? 810 DC  J "C3'" 1 
ATOM   1348 O "O3'" . DC  D 1 10 ? 26.514  5.070   85.468  1.00 25.84 ? 810 DC  J "O3'" 1 
ATOM   1349 C "C2'" . DC  D 1 10 ? 27.959  6.940   86.049  1.00 25.04 ? 810 DC  J "C2'" 1 
ATOM   1350 C "C1'" . DC  D 1 10 ? 29.384  6.401   86.041  1.00 23.90 ? 810 DC  J "C1'" 1 
ATOM   1351 N N1    . DC  D 1 10 ? 30.422  7.374   86.453  1.00 22.25 ? 810 DC  J N1    1 
ATOM   1352 C C2    . DC  D 1 10 ? 31.232  7.084   87.571  1.00 22.10 ? 810 DC  J C2    1 
ATOM   1353 O O2    . DC  D 1 10 ? 31.081  6.008   88.165  1.00 23.11 ? 810 DC  J O2    1 
ATOM   1354 N N3    . DC  D 1 10 ? 32.168  7.985   87.965  1.00 20.80 ? 810 DC  J N3    1 
ATOM   1355 C C4    . DC  D 1 10 ? 32.330  9.121   87.284  1.00 20.03 ? 810 DC  J C4    1 
ATOM   1356 N N4    . DC  D 1 10 ? 33.277  9.966   87.700  1.00 17.70 ? 810 DC  J N4    1 
ATOM   1357 C C5    . DC  D 1 10 ? 31.533  9.438   86.144  1.00 21.19 ? 810 DC  J C5    1 
ATOM   1358 C C6    . DC  D 1 10 ? 30.596  8.544   85.767  1.00 21.43 ? 810 DC  J C6    1 
ATOM   1359 P P     . DG  D 1 11 ? 25.044  5.312   86.045  1.00 22.00 ? 811 DG  J P     1 
ATOM   1360 O OP1   . DG  D 1 11 ? 24.212  4.161   85.603  1.00 24.93 ? 811 DG  J OP1   1 
ATOM   1361 O OP2   . DG  D 1 11 ? 24.565  6.701   85.810  1.00 24.85 ? 811 DG  J OP2   1 
ATOM   1362 O "O5'" . DG  D 1 11 ? 25.288  5.117   87.602  1.00 23.57 ? 811 DG  J "O5'" 1 
ATOM   1363 C "C5'" . DG  D 1 11 ? 25.936  3.947   88.064  1.00 21.79 ? 811 DG  J "C5'" 1 
ATOM   1364 C "C4'" . DG  D 1 11 ? 26.206  4.056   89.543  1.00 21.14 ? 811 DG  J "C4'" 1 
ATOM   1365 O "O4'" . DG  D 1 11 ? 27.298  4.975   89.781  1.00 20.91 ? 811 DG  J "O4'" 1 
ATOM   1366 C "C3'" . DG  D 1 11 ? 25.031  4.554   90.377  1.00 20.69 ? 811 DG  J "C3'" 1 
ATOM   1367 O "O3'" . DG  D 1 11 ? 24.993  3.766   91.570  1.00 20.34 ? 811 DG  J "O3'" 1 
ATOM   1368 C "C2'" . DG  D 1 11 ? 25.381  6.014   90.636  1.00 19.44 ? 811 DG  J "C2'" 1 
ATOM   1369 C "C1'" . DG  D 1 11 ? 26.904  5.989   90.684  1.00 19.84 ? 811 DG  J "C1'" 1 
ATOM   1370 N N9    . DG  D 1 11 ? 27.587  7.216   90.278  1.00 18.93 ? 811 DG  J N9    1 
ATOM   1371 C C8    . DG  D 1 11 ? 27.272  8.024   89.213  1.00 17.48 ? 811 DG  J C8    1 
ATOM   1372 N N7    . DG  D 1 11 ? 28.099  9.026   89.068  1.00 18.65 ? 811 DG  J N7    1 
ATOM   1373 C C5    . DG  D 1 11 ? 29.009  8.879   90.107  1.00 17.13 ? 811 DG  J C5    1 
ATOM   1374 C C6    . DG  D 1 11 ? 30.141  9.666   90.453  1.00 15.91 ? 811 DG  J C6    1 
ATOM   1375 O O6    . DG  D 1 11 ? 30.567  10.677  89.896  1.00 15.16 ? 811 DG  J O6    1 
ATOM   1376 N N1    . DG  D 1 11 ? 30.794  9.163   91.578  1.00 16.93 ? 811 DG  J N1    1 
ATOM   1377 C C2    . DG  D 1 11 ? 30.404  8.053   92.283  1.00 17.23 ? 811 DG  J C2    1 
ATOM   1378 N N2    . DG  D 1 11 ? 31.151  7.741   93.352  1.00 17.06 ? 811 DG  J N2    1 
ATOM   1379 N N3    . DG  D 1 11 ? 29.348  7.303   91.966  1.00 18.54 ? 811 DG  J N3    1 
ATOM   1380 C C4    . DG  D 1 11 ? 28.702  7.776   90.873  1.00 17.40 ? 811 DG  J C4    1 
ATOM   1381 P P     . DT  D 1 12 ? 23.859  4.022   92.673  1.00 18.43 ? 812 DT  J P     1 
ATOM   1382 O OP1   . DT  D 1 12 ? 23.756  2.761   93.439  1.00 21.17 ? 812 DT  J OP1   1 
ATOM   1383 O OP2   . DT  D 1 12 ? 22.650  4.608   92.055  1.00 21.43 ? 812 DT  J OP2   1 
ATOM   1384 O "O5'" . DT  D 1 12 ? 24.552  5.094   93.624  1.00 21.41 ? 812 DT  J "O5'" 1 
ATOM   1385 C "C5'" . DT  D 1 12 ? 25.881  4.860   94.062  1.00 23.11 ? 812 DT  J "C5'" 1 
ATOM   1386 C "C4'" . DT  D 1 12 ? 26.371  5.992   94.930  1.00 24.18 ? 812 DT  J "C4'" 1 
ATOM   1387 O "O4'" . DT  D 1 12 ? 27.033  7.017   94.151  1.00 24.54 ? 812 DT  J "O4'" 1 
ATOM   1388 C "C3'" . DT  D 1 12 ? 25.305  6.692   95.772  1.00 24.52 ? 812 DT  J "C3'" 1 
ATOM   1389 O "O3'" . DT  D 1 12 ? 25.628  6.542   97.148  1.00 26.00 ? 812 DT  J "O3'" 1 
ATOM   1390 C "C2'" . DT  D 1 12 ? 25.379  8.152   95.331  1.00 23.91 ? 812 DT  J "C2'" 1 
ATOM   1391 C "C1'" . DT  D 1 12 ? 26.779  8.275   94.745  1.00 23.29 ? 812 DT  J "C1'" 1 
ATOM   1392 N N1    . DT  D 1 12 ? 26.963  9.316   93.702  1.00 22.41 ? 812 DT  J N1    1 
ATOM   1393 C C2    . DT  D 1 12 ? 28.074  10.144  93.781  1.00 21.46 ? 812 DT  J C2    1 
ATOM   1394 O O2    . DT  D 1 12 ? 28.917  10.062  94.658  1.00 22.18 ? 812 DT  J O2    1 
ATOM   1395 N N3    . DT  D 1 12 ? 28.164  11.073  92.782  1.00 19.79 ? 812 DT  J N3    1 
ATOM   1396 C C4    . DT  D 1 12 ? 27.291  11.261  91.731  1.00 19.63 ? 812 DT  J C4    1 
ATOM   1397 O O4    . DT  D 1 12 ? 27.524  12.135  90.893  1.00 20.45 ? 812 DT  J O4    1 
ATOM   1398 C C5    . DT  D 1 12 ? 26.150  10.370  91.709  1.00 19.52 ? 812 DT  J C5    1 
ATOM   1399 C C7    . DT  D 1 12 ? 25.140  10.510  90.614  1.00 21.86 ? 812 DT  J C7    1 
ATOM   1400 C C6    . DT  D 1 12 ? 26.047  9.453   92.680  1.00 21.86 ? 812 DT  J C6    1 
ATOM   1401 P P     . DG  D 1 13 ? 24.490  6.741   98.261  1.00 27.57 ? 813 DG  J P     1 
ATOM   1402 O OP1   . DG  D 1 13 ? 24.603  5.567   99.167  1.00 27.78 ? 813 DG  J OP1   1 
ATOM   1403 O OP2   . DG  D 1 13 ? 23.181  7.079   97.650  1.00 26.80 ? 813 DG  J OP2   1 
ATOM   1404 O "O5'" . DG  D 1 13 ? 25.031  8.014   99.039  1.00 26.62 ? 813 DG  J "O5'" 1 
ATOM   1405 C "C5'" . DG  D 1 13 ? 26.349  7.989   99.565  1.00 26.93 ? 813 DG  J "C5'" 1 
ATOM   1406 C "C4'" . DG  D 1 13 ? 26.810  9.384   99.899  1.00 27.21 ? 813 DG  J "C4'" 1 
ATOM   1407 O "O4'" . DG  D 1 13 ? 27.050  10.153  98.695  1.00 25.31 ? 813 DG  J "O4'" 1 
ATOM   1408 C "C3'" . DG  D 1 13 ? 25.829  10.192  100.742 1.00 28.37 ? 813 DG  J "C3'" 1 
ATOM   1409 O "O3'" . DG  D 1 13 ? 26.595  10.865  101.741 1.00 32.72 ? 813 DG  J "O3'" 1 
ATOM   1410 C "C2'" . DG  D 1 13 ? 25.212  11.154  99.736  1.00 26.42 ? 813 DG  J "C2'" 1 
ATOM   1411 C "C1'" . DG  D 1 13 ? 26.362  11.388  98.771  1.00 24.92 ? 813 DG  J "C1'" 1 
ATOM   1412 N N9    . DG  D 1 13 ? 26.012  11.788  97.409  1.00 23.60 ? 813 DG  J N9    1 
ATOM   1413 C C8    . DG  D 1 13 ? 24.932  11.380  96.658  1.00 23.15 ? 813 DG  J C8    1 
ATOM   1414 N N7    . DG  D 1 13 ? 24.912  11.905  95.461  1.00 22.57 ? 813 DG  J N7    1 
ATOM   1415 C C5    . DG  D 1 13 ? 26.042  12.712  95.418  1.00 20.71 ? 813 DG  J C5    1 
ATOM   1416 C C6    . DG  D 1 13 ? 26.552  13.533  94.378  1.00 20.29 ? 813 DG  J C6    1 
ATOM   1417 O O6    . DG  D 1 13 ? 26.110  13.697  93.236  1.00 20.40 ? 813 DG  J O6    1 
ATOM   1418 N N1    . DG  D 1 13 ? 27.714  14.198  94.772  1.00 20.37 ? 813 DG  J N1    1 
ATOM   1419 C C2    . DG  D 1 13 ? 28.317  14.074  96.004  1.00 21.19 ? 813 DG  J C2    1 
ATOM   1420 N N2    . DG  D 1 13 ? 29.424  14.803  96.205  1.00 19.35 ? 813 DG  J N2    1 
ATOM   1421 N N3    . DG  D 1 13 ? 27.864  13.295  96.969  1.00 20.49 ? 813 DG  J N3    1 
ATOM   1422 C C4    . DG  D 1 13 ? 26.729  12.654  96.615  1.00 23.21 ? 813 DG  J C4    1 
ATOM   1423 P P     . DC  D 1 14 ? 25.902  11.347  103.101 1.00 34.41 ? 814 DC  J P     1 
ATOM   1424 O OP1   . DC  D 1 14 ? 26.742  10.879  104.224 1.00 36.58 ? 814 DC  J OP1   1 
ATOM   1425 O OP2   . DC  D 1 14 ? 24.449  11.024  103.073 1.00 34.78 ? 814 DC  J OP2   1 
ATOM   1426 O "O5'" . DC  D 1 14 ? 26.073  12.916  102.974 1.00 34.62 ? 814 DC  J "O5'" 1 
ATOM   1427 C "C5'" . DC  D 1 14 ? 26.460  13.447  101.720 1.00 35.03 ? 814 DC  J "C5'" 1 
ATOM   1428 C "C4'" . DC  D 1 14 ? 27.187  14.751  101.902 1.00 33.23 ? 814 DC  J "C4'" 1 
ATOM   1429 O "O4'" . DC  D 1 14 ? 27.508  15.198  100.567 1.00 32.18 ? 814 DC  J "O4'" 1 
ATOM   1430 C "C3'" . DC  D 1 14 ? 26.283  15.815  102.511 1.00 33.66 ? 814 DC  J "C3'" 1 
ATOM   1431 O "O3'" . DC  D 1 14 ? 26.989  16.728  103.341 1.00 33.50 ? 814 DC  J "O3'" 1 
ATOM   1432 C "C2'" . DC  D 1 14 ? 25.680  16.515  101.312 1.00 31.30 ? 814 DC  J "C2'" 1 
ATOM   1433 C "C1'" . DC  D 1 14 ? 26.682  16.287  100.193 1.00 30.05 ? 814 DC  J "C1'" 1 
ATOM   1434 N N1    . DC  D 1 14 ? 25.994  15.920  98.951  1.00 26.08 ? 814 DC  J N1    1 
ATOM   1435 C C2    . DC  D 1 14 ? 26.358  16.564  97.782  1.00 22.63 ? 814 DC  J C2    1 
ATOM   1436 O O2    . DC  D 1 14 ? 27.313  17.340  97.817  1.00 22.11 ? 814 DC  J O2    1 
ATOM   1437 N N3    . DC  D 1 14 ? 25.661  16.325  96.651  1.00 20.59 ? 814 DC  J N3    1 
ATOM   1438 C C4    . DC  D 1 14 ? 24.635  15.469  96.668  1.00 21.25 ? 814 DC  J C4    1 
ATOM   1439 N N4    . DC  D 1 14 ? 23.925  15.309  95.542  1.00 19.97 ? 814 DC  J N4    1 
ATOM   1440 C C5    . DC  D 1 14 ? 24.278  14.749  97.844  1.00 22.78 ? 814 DC  J C5    1 
ATOM   1441 C C6    . DC  D 1 14 ? 24.983  14.998  98.951  1.00 24.61 ? 814 DC  J C6    1 
ATOM   1442 P P     . DT  D 1 15 ? 26.201  17.975  103.978 1.00 34.41 ? 815 DT  J P     1 
ATOM   1443 O OP1   . DT  D 1 15 ? 26.765  18.208  105.339 1.00 35.68 ? 815 DT  J OP1   1 
ATOM   1444 O OP2   . DT  D 1 15 ? 24.744  17.760  103.806 1.00 32.01 ? 815 DT  J OP2   1 
ATOM   1445 O "O5'" . DT  D 1 15 ? 26.602  19.201  103.044 1.00 33.06 ? 815 DT  J "O5'" 1 
ATOM   1446 C "C5'" . DT  D 1 15 ? 27.960  19.470  102.717 1.00 28.57 ? 815 DT  J "C5'" 1 
ATOM   1447 C "C4'" . DT  D 1 15 ? 28.040  20.658  101.788 1.00 27.46 ? 815 DT  J "C4'" 1 
ATOM   1448 O "O4'" . DT  D 1 15 ? 27.486  20.294  100.497 1.00 25.65 ? 815 DT  J "O4'" 1 
ATOM   1449 C "C3'" . DT  D 1 15 ? 27.261  21.887  102.265 1.00 26.11 ? 815 DT  J "C3'" 1 
ATOM   1450 O "O3'" . DT  D 1 15 ? 28.052  23.067  102.103 1.00 25.51 ? 815 DT  J "O3'" 1 
ATOM   1451 C "C2'" . DT  D 1 15 ? 26.019  21.904  101.384 1.00 26.07 ? 815 DT  J "C2'" 1 
ATOM   1452 C "C1'" . DT  D 1 15 ? 26.471  21.212  100.104 1.00 26.51 ? 815 DT  J "C1'" 1 
ATOM   1453 N N1    . DT  D 1 15 ? 25.404  20.445  99.404  1.00 24.40 ? 815 DT  J N1    1 
ATOM   1454 C C2    . DT  D 1 15 ? 25.205  20.657  98.049  1.00 26.16 ? 815 DT  J C2    1 
ATOM   1455 O O2    . DT  D 1 15 ? 25.825  21.482  97.403  1.00 25.73 ? 815 DT  J O2    1 
ATOM   1456 N N3    . DT  D 1 15 ? 24.229  19.868  97.479  1.00 25.96 ? 815 DT  J N3    1 
ATOM   1457 C C4    . DT  D 1 15 ? 23.440  18.927  98.116  1.00 26.15 ? 815 DT  J C4    1 
ATOM   1458 O O4    . DT  D 1 15 ? 22.620  18.271  97.470  1.00 25.57 ? 815 DT  J O4    1 
ATOM   1459 C C5    . DT  D 1 15 ? 23.672  18.793  99.541  1.00 25.89 ? 815 DT  J C5    1 
ATOM   1460 C C7    . DT  D 1 15 ? 22.825  17.842  100.328 1.00 24.31 ? 815 DT  J C7    1 
ATOM   1461 C C6    . DT  D 1 15 ? 24.636  19.539  100.099 1.00 25.28 ? 815 DT  J C6    1 
ATOM   1462 P P     . DA  D 1 16 ? 27.469  24.496  102.557 1.00 23.67 ? 816 DA  J P     1 
ATOM   1463 O OP1   . DA  D 1 16 ? 28.641  25.375  102.837 1.00 25.87 ? 816 DA  J OP1   1 
ATOM   1464 O OP2   . DA  D 1 16 ? 26.420  24.314  103.591 1.00 25.53 ? 816 DA  J OP2   1 
ATOM   1465 O "O5'" . DA  D 1 16 ? 26.782  25.049  101.235 1.00 23.99 ? 816 DA  J "O5'" 1 
ATOM   1466 C "C5'" . DA  D 1 16 ? 27.545  25.198  100.050 1.00 25.20 ? 816 DA  J "C5'" 1 
ATOM   1467 C "C4'" . DA  D 1 16 ? 26.693  25.768  98.942  1.00 26.12 ? 816 DA  J "C4'" 1 
ATOM   1468 O "O4'" . DA  D 1 16 ? 25.758  24.773  98.459  1.00 26.13 ? 816 DA  J "O4'" 1 
ATOM   1469 C "C3'" . DA  D 1 16 ? 25.865  26.996  99.323  1.00 25.56 ? 816 DA  J "C3'" 1 
ATOM   1470 O "O3'" . DA  D 1 16 ? 26.014  27.974  98.294  1.00 27.86 ? 816 DA  J "O3'" 1 
ATOM   1471 C "C2'" . DA  D 1 16 ? 24.445  26.456  99.424  1.00 26.02 ? 816 DA  J "C2'" 1 
ATOM   1472 C "C1'" . DA  D 1 16 ? 24.440  25.306  98.426  1.00 25.61 ? 816 DA  J "C1'" 1 
ATOM   1473 N N9    . DA  D 1 16 ? 23.520  24.202  98.720  1.00 24.51 ? 816 DA  J N9    1 
ATOM   1474 C C8    . DA  D 1 16 ? 23.276  23.611  99.938  1.00 24.51 ? 816 DA  J C8    1 
ATOM   1475 N N7    . DA  D 1 16 ? 22.455  22.593  99.877  1.00 23.81 ? 816 DA  J N7    1 
ATOM   1476 C C5    . DA  D 1 16 ? 22.119  22.513  98.531  1.00 23.67 ? 816 DA  J C5    1 
ATOM   1477 C C6    . DA  D 1 16 ? 21.289  21.626  97.814  1.00 22.89 ? 816 DA  J C6    1 
ATOM   1478 N N6    . DA  D 1 16 ? 20.637  20.613  98.377  1.00 23.09 ? 816 DA  J N6    1 
ATOM   1479 N N1    . DA  D 1 16 ? 21.163  21.818  96.481  1.00 23.63 ? 816 DA  J N1    1 
ATOM   1480 C C2    . DA  D 1 16 ? 21.840  22.833  95.915  1.00 22.65 ? 816 DA  J C2    1 
ATOM   1481 N N3    . DA  D 1 16 ? 22.656  23.728  96.484  1.00 23.27 ? 816 DA  J N3    1 
ATOM   1482 C C4    . DA  D 1 16 ? 22.753  23.508  97.809  1.00 23.42 ? 816 DA  J C4    1 
ATOM   1483 P P     . DC  D 1 17 ? 25.385  29.437  98.477  1.00 30.38 ? 817 DC  J P     1 
ATOM   1484 O OP1   . DC  D 1 17 ? 26.251  30.352  97.695  1.00 30.19 ? 817 DC  J OP1   1 
ATOM   1485 O OP2   . DC  D 1 17 ? 25.144  29.689  99.918  1.00 29.09 ? 817 DC  J OP2   1 
ATOM   1486 O "O5'" . DC  D 1 17 ? 24.005  29.305  97.701  1.00 30.57 ? 817 DC  J "O5'" 1 
ATOM   1487 C "C5'" . DC  D 1 17 ? 24.015  28.764  96.382  1.00 32.12 ? 817 DC  J "C5'" 1 
ATOM   1488 C "C4'" . DC  D 1 17 ? 22.616  28.637  95.834  1.00 31.73 ? 817 DC  J "C4'" 1 
ATOM   1489 O "O4'" . DC  D 1 17 ? 22.028  27.353  96.155  1.00 31.69 ? 817 DC  J "O4'" 1 
ATOM   1490 C "C3'" . DC  D 1 17 ? 21.632  29.708  96.297  1.00 32.32 ? 817 DC  J "C3'" 1 
ATOM   1491 O "O3'" . DC  D 1 17 ? 21.105  30.360  95.148  1.00 33.43 ? 817 DC  J "O3'" 1 
ATOM   1492 C "C2'" . DC  D 1 17 ? 20.569  28.927  97.060  1.00 31.43 ? 817 DC  J "C2'" 1 
ATOM   1493 C "C1'" . DC  D 1 17 ? 20.661  27.526  96.461  1.00 30.37 ? 817 DC  J "C1'" 1 
ATOM   1494 N N1    . DC  D 1 17 ? 20.253  26.413  97.347  1.00 29.45 ? 817 DC  J N1    1 
ATOM   1495 C C2    . DC  D 1 17 ? 19.490  25.364  96.813  1.00 28.46 ? 817 DC  J C2    1 
ATOM   1496 O O2    . DC  D 1 17 ? 19.167  25.400  95.618  1.00 29.80 ? 817 DC  J O2    1 
ATOM   1497 N N3    . DC  D 1 17 ? 19.118  24.342  97.616  1.00 27.65 ? 817 DC  J N3    1 
ATOM   1498 C C4    . DC  D 1 17 ? 19.463  24.344  98.904  1.00 27.36 ? 817 DC  J C4    1 
ATOM   1499 N N4    . DC  D 1 17 ? 19.054  23.321  99.663  1.00 27.98 ? 817 DC  J N4    1 
ATOM   1500 C C5    . DC  D 1 17 ? 20.239  25.396  99.474  1.00 26.78 ? 817 DC  J C5    1 
ATOM   1501 C C6    . DC  D 1 17 ? 20.610  26.398  98.668  1.00 27.12 ? 817 DC  J C6    1 
ATOM   1502 P P     . DT  D 1 18 ? 20.152  31.638  95.318  1.00 34.83 ? 818 DT  J P     1 
ATOM   1503 O OP1   . DT  D 1 18 ? 20.579  32.623  94.288  1.00 34.90 ? 818 DT  J OP1   1 
ATOM   1504 O OP2   . DT  D 1 18 ? 20.065  32.050  96.740  1.00 35.04 ? 818 DT  J OP2   1 
ATOM   1505 O "O5'" . DT  D 1 18 ? 18.757  31.033  94.864  1.00 33.91 ? 818 DT  J "O5'" 1 
ATOM   1506 C "C5'" . DT  D 1 18 ? 18.690  30.291  93.656  1.00 32.14 ? 818 DT  J "C5'" 1 
ATOM   1507 C "C4'" . DT  D 1 18 ? 17.304  29.737  93.462  1.00 32.82 ? 818 DT  J "C4'" 1 
ATOM   1508 O "O4'" . DT  D 1 18 ? 17.113  28.547  94.263  1.00 32.10 ? 818 DT  J "O4'" 1 
ATOM   1509 C "C3'" . DT  D 1 18 ? 16.199  30.715  93.854  1.00 32.82 ? 818 DT  J "C3'" 1 
ATOM   1510 O "O3'" . DT  D 1 18 ? 15.217  30.722  92.825  1.00 33.83 ? 818 DT  J "O3'" 1 
ATOM   1511 C "C2'" . DT  D 1 18 ? 15.659  30.149  95.159  1.00 32.86 ? 818 DT  J "C2'" 1 
ATOM   1512 C "C1'" . DT  D 1 18 ? 15.913  28.655  95.009  1.00 32.34 ? 818 DT  J "C1'" 1 
ATOM   1513 N N1    . DT  D 1 18 ? 16.107  27.913  96.273  1.00 31.55 ? 818 DT  J N1    1 
ATOM   1514 C C2    . DT  D 1 18 ? 15.516  26.674  96.396  1.00 31.06 ? 818 DT  J C2    1 
ATOM   1515 O O2    . DT  D 1 18 ? 14.829  26.176  95.525  1.00 31.12 ? 818 DT  J O2    1 
ATOM   1516 N N3    . DT  D 1 18 ? 15.763  26.036  97.585  1.00 30.13 ? 818 DT  J N3    1 
ATOM   1517 C C4    . DT  D 1 18 ? 16.518  26.506  98.640  1.00 30.29 ? 818 DT  J C4    1 
ATOM   1518 O O4    . DT  D 1 18 ? 16.659  25.822  99.640  1.00 30.29 ? 818 DT  J O4    1 
ATOM   1519 C C5    . DT  D 1 18 ? 17.097  27.812  98.453  1.00 30.49 ? 818 DT  J C5    1 
ATOM   1520 C C7    . DT  D 1 18 ? 17.921  28.401  99.557  1.00 30.28 ? 818 DT  J C7    1 
ATOM   1521 C C6    . DT  D 1 18 ? 16.868  28.443  97.293  1.00 31.55 ? 818 DT  J C6    1 
ATOM   1522 P P     . DC  D 1 19 ? 13.977  31.730  92.913  1.00 34.40 ? 819 DC  J P     1 
ATOM   1523 O OP1   . DC  D 1 19 ? 13.716  32.193  91.526  1.00 34.30 ? 819 DC  J OP1   1 
ATOM   1524 O OP2   . DC  D 1 19 ? 14.212  32.724  93.994  1.00 32.25 ? 819 DC  J OP2   1 
ATOM   1525 O "O5'" . DC  D 1 19 ? 12.788  30.766  93.350  1.00 33.72 ? 819 DC  J "O5'" 1 
ATOM   1526 C "C5'" . DC  D 1 19 ? 12.502  29.594  92.594  1.00 34.09 ? 819 DC  J "C5'" 1 
ATOM   1527 C "C4'" . DC  D 1 19 ? 11.493  28.733  93.317  1.00 35.09 ? 819 DC  J "C4'" 1 
ATOM   1528 O "O4'" . DC  D 1 19 ? 12.110  28.040  94.435  1.00 34.63 ? 819 DC  J "O4'" 1 
ATOM   1529 C "C3'" . DC  D 1 19 ? 10.290  29.495  93.886  1.00 34.91 ? 819 DC  J "C3'" 1 
ATOM   1530 O "O3'" . DC  D 1 19 ? 9.055   28.847  93.574  1.00 36.18 ? 819 DC  J "O3'" 1 
ATOM   1531 C "C2'" . DC  D 1 19 ? 10.501  29.426  95.389  1.00 35.26 ? 819 DC  J "C2'" 1 
ATOM   1532 C "C1'" . DC  D 1 19 ? 11.230  28.101  95.545  1.00 34.89 ? 819 DC  J "C1'" 1 
ATOM   1533 N N1    . DC  D 1 19 ? 12.020  27.985  96.785  1.00 34.15 ? 819 DC  J N1    1 
ATOM   1534 C C2    . DC  D 1 19 ? 11.917  26.809  97.552  1.00 34.10 ? 819 DC  J C2    1 
ATOM   1535 O O2    . DC  D 1 19 ? 11.217  25.871  97.132  1.00 33.16 ? 819 DC  J O2    1 
ATOM   1536 N N3    . DC  D 1 19 ? 12.584  26.727  98.727  1.00 33.31 ? 819 DC  J N3    1 
ATOM   1537 C C4    . DC  D 1 19 ? 13.338  27.748  99.138  1.00 33.96 ? 819 DC  J C4    1 
ATOM   1538 N N4    . DC  D 1 19 ? 13.958  27.633  100.313 1.00 33.91 ? 819 DC  J N4    1 
ATOM   1539 C C5    . DC  D 1 19 ? 13.486  28.939  98.364  1.00 34.13 ? 819 DC  J C5    1 
ATOM   1540 C C6    . DC  D 1 19 ? 12.819  29.011  97.204  1.00 33.69 ? 819 DC  J C6    1 
ATOM   1541 N N     . GLY E 2 1  ? 70.716  108.507 28.441  1.00 27.99 ? 897 GLY A N     1 
ATOM   1542 C CA    . GLY E 2 1  ? 69.231  108.575 28.363  1.00 26.63 ? 897 GLY A CA    1 
ATOM   1543 C C     . GLY E 2 1  ? 68.586  107.337 28.951  1.00 27.74 ? 897 GLY A C     1 
ATOM   1544 O O     . GLY E 2 1  ? 69.274  106.395 29.341  1.00 25.85 ? 897 GLY A O     1 
ATOM   1545 N N     . HIS E 2 2  ? 67.261  107.333 29.009  1.00 27.46 ? 898 HIS A N     1 
ATOM   1546 C CA    . HIS E 2 2  ? 66.537  106.206 29.572  1.00 28.34 ? 898 HIS A CA    1 
ATOM   1547 C C     . HIS E 2 2  ? 66.864  104.882 28.891  1.00 27.94 ? 898 HIS A C     1 
ATOM   1548 O O     . HIS E 2 2  ? 66.995  103.849 29.556  1.00 27.05 ? 898 HIS A O     1 
ATOM   1549 C CB    . HIS E 2 2  ? 65.039  106.448 29.491  1.00 31.33 ? 898 HIS A CB    1 
ATOM   1550 C CG    . HIS E 2 2  ? 64.250  105.573 30.406  1.00 34.00 ? 898 HIS A CG    1 
ATOM   1551 N ND1   . HIS E 2 2  ? 62.978  105.139 30.107  1.00 35.79 ? 898 HIS A ND1   1 
ATOM   1552 C CD2   . HIS E 2 2  ? 64.553  105.052 31.619  1.00 34.36 ? 898 HIS A CD2   1 
ATOM   1553 C CE1   . HIS E 2 2  ? 62.532  104.384 31.094  1.00 36.26 ? 898 HIS A CE1   1 
ATOM   1554 N NE2   . HIS E 2 2  ? 63.468  104.315 32.024  1.00 35.64 ? 898 HIS A NE2   1 
ATOM   1555 N N     . MET E 2 3  ? 66.981  104.903 27.569  1.00 26.71 ? 899 MET A N     1 
ATOM   1556 C CA    . MET E 2 3  ? 67.298  103.682 26.843  1.00 27.00 ? 899 MET A CA    1 
ATOM   1557 C C     . MET E 2 3  ? 68.610  103.089 27.341  1.00 25.53 ? 899 MET A C     1 
ATOM   1558 O O     . MET E 2 3  ? 68.737  101.874 27.454  1.00 25.35 ? 899 MET A O     1 
ATOM   1559 C CB    . MET E 2 3  ? 67.390  103.951 25.339  1.00 27.69 ? 899 MET A CB    1 
ATOM   1560 C CG    . MET E 2 3  ? 66.049  104.139 24.650  1.00 30.45 ? 899 MET A CG    1 
ATOM   1561 S SD    . MET E 2 3  ? 64.978  102.684 24.759  1.00 34.92 ? 899 MET A SD    1 
ATOM   1562 C CE    . MET E 2 3  ? 65.618  101.674 23.415  1.00 32.87 ? 899 MET A CE    1 
ATOM   1563 N N     . ASN E 2 4  ? 69.584  103.945 27.640  1.00 24.44 ? 900 ASN A N     1 
ATOM   1564 C CA    . ASN E 2 4  ? 70.883  103.469 28.125  1.00 22.96 ? 900 ASN A CA    1 
ATOM   1565 C C     . ASN E 2 4  ? 70.748  102.911 29.542  1.00 22.29 ? 900 ASN A C     1 
ATOM   1566 O O     . ASN E 2 4  ? 71.387  101.923 29.887  1.00 21.49 ? 900 ASN A O     1 
ATOM   1567 C CB    . ASN E 2 4  ? 71.912  104.607 28.097  1.00 22.81 ? 900 ASN A CB    1 
ATOM   1568 C CG    . ASN E 2 4  ? 73.295  104.157 28.542  1.00 23.44 ? 900 ASN A CG    1 
ATOM   1569 O OD1   . ASN E 2 4  ? 73.838  103.179 28.022  1.00 21.11 ? 900 ASN A OD1   1 
ATOM   1570 N ND2   . ASN E 2 4  ? 73.879  104.880 29.498  1.00 21.69 ? 900 ASN A ND2   1 
ATOM   1571 N N     . VAL E 2 5  ? 69.912  103.545 30.364  1.00 23.10 ? 901 VAL A N     1 
ATOM   1572 C CA    . VAL E 2 5  ? 69.701  103.067 31.729  1.00 20.92 ? 901 VAL A CA    1 
ATOM   1573 C C     . VAL E 2 5  ? 69.027  101.696 31.658  1.00 22.22 ? 901 VAL A C     1 
ATOM   1574 O O     . VAL E 2 5  ? 69.433  100.758 32.350  1.00 23.33 ? 901 VAL A O     1 
ATOM   1575 C CB    . VAL E 2 5  ? 68.807  104.034 32.544  1.00 19.65 ? 901 VAL A CB    1 
ATOM   1576 C CG1   . VAL E 2 5  ? 68.490  103.427 33.906  1.00 20.07 ? 901 VAL A CG1   1 
ATOM   1577 C CG2   . VAL E 2 5  ? 69.525  105.375 32.733  1.00 20.38 ? 901 VAL A CG2   1 
ATOM   1578 N N     . LYS E 2 6  ? 68.012  101.573 30.804  1.00 21.51 ? 902 LYS A N     1 
ATOM   1579 C CA    . LYS E 2 6  ? 67.301  100.303 30.652  1.00 22.29 ? 902 LYS A CA    1 
ATOM   1580 C C     . LYS E 2 6  ? 68.234  99.197  30.176  1.00 20.52 ? 902 LYS A C     1 
ATOM   1581 O O     . LYS E 2 6  ? 68.143  98.062  30.645  1.00 20.01 ? 902 LYS A O     1 
ATOM   1582 C CB    . LYS E 2 6  ? 66.137  100.434 29.662  1.00 23.29 ? 902 LYS A CB    1 
ATOM   1583 C CG    . LYS E 2 6  ? 64.977  101.269 30.183  1.00 25.42 ? 902 LYS A CG    1 
ATOM   1584 C CD    . LYS E 2 6  ? 64.478  100.734 31.522  1.00 27.12 ? 902 LYS A CD    1 
ATOM   1585 C CE    . LYS E 2 6  ? 64.019  99.281  31.413  1.00 27.40 ? 902 LYS A CE    1 
ATOM   1586 N NZ    . LYS E 2 6  ? 63.766  98.665  32.742  1.00 26.01 ? 902 LYS A NZ    1 
ATOM   1587 N N     . ARG E 2 7  ? 69.114  99.533  29.239  1.00 20.28 ? 903 ARG A N     1 
ATOM   1588 C CA    . ARG E 2 7  ? 70.079  98.567  28.705  1.00 19.23 ? 903 ARG A CA    1 
ATOM   1589 C C     . ARG E 2 7  ? 70.949  98.047  29.846  1.00 19.61 ? 903 ARG A C     1 
ATOM   1590 O O     . ARG E 2 7  ? 71.137  96.840  30.008  1.00 18.80 ? 903 ARG A O     1 
ATOM   1591 C CB    . ARG E 2 7  ? 70.966  99.246  27.656  1.00 19.67 ? 903 ARG A CB    1 
ATOM   1592 C CG    . ARG E 2 7  ? 72.094  98.386  27.097  1.00 20.06 ? 903 ARG A CG    1 
ATOM   1593 C CD    . ARG E 2 7  ? 73.083  99.237  26.287  1.00 21.52 ? 903 ARG A CD    1 
ATOM   1594 N NE    . ARG E 2 7  ? 73.789  100.196 27.139  1.00 21.71 ? 903 ARG A NE    1 
ATOM   1595 C CZ    . ARG E 2 7  ? 74.845  99.896  27.888  1.00 23.60 ? 903 ARG A CZ    1 
ATOM   1596 N NH1   . ARG E 2 7  ? 75.336  98.659  27.888  1.00 23.44 ? 903 ARG A NH1   1 
ATOM   1597 N NH2   . ARG E 2 7  ? 75.406  100.830 28.647  1.00 23.54 ? 903 ARG A NH2   1 
ATOM   1598 N N     . ARG E 2 8  ? 71.473  98.973  30.644  1.00 18.37 ? 904 ARG A N     1 
ATOM   1599 C CA    . ARG E 2 8  ? 72.329  98.612  31.762  1.00 20.54 ? 904 ARG A CA    1 
ATOM   1600 C C     . ARG E 2 8  ? 71.583  97.787  32.809  1.00 19.74 ? 904 ARG A C     1 
ATOM   1601 O O     . ARG E 2 8  ? 72.137  96.857  33.386  1.00 17.64 ? 904 ARG A O     1 
ATOM   1602 C CB    . ARG E 2 8  ? 72.913  99.876  32.395  1.00 23.57 ? 904 ARG A CB    1 
ATOM   1603 C CG    . ARG E 2 8  ? 74.415  99.827  32.540  1.00 29.78 ? 904 ARG A CG    1 
ATOM   1604 C CD    . ARG E 2 8  ? 75.065  101.149 32.148  1.00 33.88 ? 904 ARG A CD    1 
ATOM   1605 N NE    . ARG E 2 8  ? 74.654  102.257 33.007  1.00 37.25 ? 904 ARG A NE    1 
ATOM   1606 C CZ    . ARG E 2 8  ? 75.174  103.480 32.940  1.00 38.40 ? 904 ARG A CZ    1 
ATOM   1607 N NH1   . ARG E 2 8  ? 76.127  103.753 32.055  1.00 38.78 ? 904 ARG A NH1   1 
ATOM   1608 N NH2   . ARG E 2 8  ? 74.744  104.431 33.758  1.00 39.04 ? 904 ARG A NH2   1 
ATOM   1609 N N     . THR E 2 9  ? 70.320  98.113  33.048  1.00 19.52 ? 905 THR A N     1 
ATOM   1610 C CA    . THR E 2 9  ? 69.556  97.363  34.027  1.00 19.41 ? 905 THR A CA    1 
ATOM   1611 C C     . THR E 2 9  ? 69.377  95.934  33.529  1.00 19.49 ? 905 THR A C     1 
ATOM   1612 O O     . THR E 2 9  ? 69.517  94.973  34.291  1.00 18.03 ? 905 THR A O     1 
ATOM   1613 C CB    . THR E 2 9  ? 68.181  97.991  34.263  1.00 21.35 ? 905 THR A CB    1 
ATOM   1614 O OG1   . THR E 2 9  ? 68.357  99.315  34.781  1.00 23.85 ? 905 THR A OG1   1 
ATOM   1615 C CG2   . THR E 2 9  ? 67.378  97.162  35.257  1.00 20.87 ? 905 THR A CG2   1 
ATOM   1616 N N     . HIS E 2 10 ? 69.085  95.806  32.239  1.00 19.00 ? 906 HIS A N     1 
ATOM   1617 C CA    . HIS E 2 10 ? 68.891  94.498  31.627  1.00 19.18 ? 906 HIS A CA    1 
ATOM   1618 C C     . HIS E 2 10 ? 70.137  93.630  31.767  1.00 19.65 ? 906 HIS A C     1 
ATOM   1619 O O     . HIS E 2 10 ? 70.051  92.441  32.095  1.00 20.25 ? 906 HIS A O     1 
ATOM   1620 C CB    . HIS E 2 10 ? 68.585  94.653  30.140  1.00 19.02 ? 906 HIS A CB    1 
ATOM   1621 C CG    . HIS E 2 10 ? 68.179  93.374  29.477  1.00 18.89 ? 906 HIS A CG    1 
ATOM   1622 N ND1   . HIS E 2 10 ? 68.352  93.143  28.130  1.00 19.87 ? 906 HIS A ND1   1 
ATOM   1623 C CD2   . HIS E 2 10 ? 67.580  92.267  29.975  1.00 18.84 ? 906 HIS A CD2   1 
ATOM   1624 C CE1   . HIS E 2 10 ? 67.879  91.947  27.826  1.00 16.75 ? 906 HIS A CE1   1 
ATOM   1625 N NE2   . HIS E 2 10 ? 67.405  91.394  28.927  1.00 19.97 ? 906 HIS A NE2   1 
ATOM   1626 N N     . ASN E 2 11 ? 71.293  94.225  31.495  1.00 18.54 ? 907 ASN A N     1 
ATOM   1627 C CA    . ASN E 2 11 ? 72.561  93.508  31.574  1.00 19.37 ? 907 ASN A CA    1 
ATOM   1628 C C     . ASN E 2 11 ? 72.840  93.004  32.989  1.00 20.69 ? 907 ASN A C     1 
ATOM   1629 O O     . ASN E 2 11 ? 73.206  91.837  33.194  1.00 19.99 ? 907 ASN A O     1 
ATOM   1630 C CB    . ASN E 2 11 ? 73.703  94.428  31.130  1.00 18.40 ? 907 ASN A CB    1 
ATOM   1631 C CG    . ASN E 2 11 ? 73.629  94.791  29.660  1.00 17.91 ? 907 ASN A CG    1 
ATOM   1632 O OD1   . ASN E 2 11 ? 74.356  95.676  29.186  1.00 19.55 ? 907 ASN A OD1   1 
ATOM   1633 N ND2   . ASN E 2 11 ? 72.767  94.108  28.926  1.00 15.16 ? 907 ASN A ND2   1 
ATOM   1634 N N     . VAL E 2 12 ? 72.673  93.889  33.966  1.00 21.02 ? 908 VAL A N     1 
ATOM   1635 C CA    . VAL E 2 12 ? 72.920  93.526  35.354  1.00 23.51 ? 908 VAL A CA    1 
ATOM   1636 C C     . VAL E 2 12 ? 71.922  92.519  35.933  1.00 23.32 ? 908 VAL A C     1 
ATOM   1637 O O     . VAL E 2 12 ? 72.309  91.621  36.682  1.00 23.94 ? 908 VAL A O     1 
ATOM   1638 C CB    . VAL E 2 12 ? 72.970  94.790  36.255  1.00 25.08 ? 908 VAL A CB    1 
ATOM   1639 C CG1   . VAL E 2 12 ? 74.204  95.614  35.931  1.00 25.64 ? 908 VAL A CG1   1 
ATOM   1640 C CG2   . VAL E 2 12 ? 71.724  95.614  36.077  1.00 27.21 ? 908 VAL A CG2   1 
ATOM   1641 N N     . LEU E 2 13 ? 70.644  92.646  35.589  1.00 22.98 ? 909 LEU A N     1 
ATOM   1642 C CA    . LEU E 2 13 ? 69.646  91.717  36.112  1.00 23.40 ? 909 LEU A CA    1 
ATOM   1643 C C     . LEU E 2 13 ? 69.806  90.324  35.514  1.00 21.38 ? 909 LEU A C     1 
ATOM   1644 O O     . LEU E 2 13 ? 69.661  89.321  36.211  1.00 21.10 ? 909 LEU A O     1 
ATOM   1645 C CB    . LEU E 2 13 ? 68.224  92.223  35.844  1.00 24.85 ? 909 LEU A CB    1 
ATOM   1646 C CG    . LEU E 2 13 ? 67.795  93.482  36.611  1.00 27.01 ? 909 LEU A CG    1 
ATOM   1647 C CD1   . LEU E 2 13 ? 66.290  93.664  36.458  1.00 28.23 ? 909 LEU A CD1   1 
ATOM   1648 C CD2   . LEU E 2 13 ? 68.161  93.352  38.091  1.00 28.77 ? 909 LEU A CD2   1 
ATOM   1649 N N     . GLU E 2 14 ? 70.095  90.276  34.219  1.00 20.27 ? 910 GLU A N     1 
ATOM   1650 C CA    . GLU E 2 14 ? 70.284  89.009  33.515  1.00 18.84 ? 910 GLU A CA    1 
ATOM   1651 C C     . GLU E 2 14 ? 71.562  88.322  34.014  1.00 19.34 ? 910 GLU A C     1 
ATOM   1652 O O     . GLU E 2 14 ? 71.603  87.103  34.160  1.00 17.17 ? 910 GLU A O     1 
ATOM   1653 C CB    . GLU E 2 14 ? 70.372  89.280  32.008  1.00 20.09 ? 910 GLU A CB    1 
ATOM   1654 C CG    . GLU E 2 14 ? 70.638  88.060  31.136  1.00 20.36 ? 910 GLU A CG    1 
ATOM   1655 C CD    . GLU E 2 14 ? 69.487  87.064  31.104  1.00 20.39 ? 910 GLU A CD    1 
ATOM   1656 O OE1   . GLU E 2 14 ? 68.410  87.345  31.677  1.00 22.16 ? 910 GLU A OE1   1 
ATOM   1657 O OE2   . GLU E 2 14 ? 69.667  85.991  30.493  1.00 21.41 ? 910 GLU A OE2   1 
ATOM   1658 N N     . ARG E 2 15 ? 72.602  89.107  34.276  1.00 18.51 ? 911 ARG A N     1 
ATOM   1659 C CA    . ARG E 2 15 ? 73.860  88.557  34.768  1.00 22.02 ? 911 ARG A CA    1 
ATOM   1660 C C     . ARG E 2 15 ? 73.618  87.885  36.115  1.00 22.61 ? 911 ARG A C     1 
ATOM   1661 O O     . ARG E 2 15 ? 74.101  86.776  36.377  1.00 21.75 ? 911 ARG A O     1 
ATOM   1662 C CB    . ARG E 2 15 ? 74.901  89.669  34.921  1.00 24.67 ? 911 ARG A CB    1 
ATOM   1663 C CG    . ARG E 2 15 ? 76.268  89.162  35.344  1.00 29.79 ? 911 ARG A CG    1 
ATOM   1664 C CD    . ARG E 2 15 ? 77.324  90.250  35.230  1.00 33.41 ? 911 ARG A CD    1 
ATOM   1665 N NE    . ARG E 2 15 ? 78.668  89.700  35.372  1.00 36.90 ? 911 ARG A NE    1 
ATOM   1666 C CZ    . ARG E 2 15 ? 79.780  90.345  35.034  1.00 38.35 ? 911 ARG A CZ    1 
ATOM   1667 N NH1   . ARG E 2 15 ? 79.715  91.571  34.531  1.00 38.17 ? 911 ARG A NH1   1 
ATOM   1668 N NH2   . ARG E 2 15 ? 80.961  89.760  35.188  1.00 39.67 ? 911 ARG A NH2   1 
ATOM   1669 N N     . GLN E 2 16 ? 72.866  88.564  36.973  1.00 21.98 ? 912 GLN A N     1 
ATOM   1670 C CA    . GLN E 2 16 ? 72.544  88.023  38.284  1.00 22.72 ? 912 GLN A CA    1 
ATOM   1671 C C     . GLN E 2 16 ? 71.705  86.768  38.132  1.00 22.21 ? 912 GLN A C     1 
ATOM   1672 O O     . GLN E 2 16 ? 71.894  85.791  38.864  1.00 19.84 ? 912 GLN A O     1 
ATOM   1673 C CB    . GLN E 2 16 ? 71.759  89.042  39.108  1.00 25.88 ? 912 GLN A CB    1 
ATOM   1674 C CG    . GLN E 2 16 ? 72.606  89.830  40.086  1.00 30.12 ? 912 GLN A CG    1 
ATOM   1675 C CD    . GLN E 2 16 ? 73.149  88.965  41.210  1.00 31.27 ? 912 GLN A CD    1 
ATOM   1676 O OE1   . GLN E 2 16 ? 72.389  88.343  41.955  1.00 32.60 ? 912 GLN A OE1   1 
ATOM   1677 N NE2   . GLN E 2 16 ? 74.469  88.926  41.341  1.00 31.81 ? 912 GLN A NE2   1 
ATOM   1678 N N     . ARG E 2 17 ? 70.766  86.797  37.189  1.00 19.78 ? 913 ARG A N     1 
ATOM   1679 C CA    . ARG E 2 17 ? 69.905  85.645  36.979  1.00 19.00 ? 913 ARG A CA    1 
ATOM   1680 C C     . ARG E 2 17 ? 70.758  84.445  36.578  1.00 18.48 ? 913 ARG A C     1 
ATOM   1681 O O     . ARG E 2 17 ? 70.538  83.342  37.079  1.00 18.81 ? 913 ARG A O     1 
ATOM   1682 C CB    . ARG E 2 17 ? 68.865  85.927  35.902  1.00 19.52 ? 913 ARG A CB    1 
ATOM   1683 C CG    . ARG E 2 17 ? 67.828  84.826  35.776  1.00 22.46 ? 913 ARG A CG    1 
ATOM   1684 C CD    . ARG E 2 17 ? 66.939  85.058  34.573  1.00 23.93 ? 913 ARG A CD    1 
ATOM   1685 N NE    . ARG E 2 17 ? 67.676  84.885  33.323  1.00 25.36 ? 913 ARG A NE    1 
ATOM   1686 C CZ    . ARG E 2 17 ? 68.127  83.714  32.877  1.00 26.05 ? 913 ARG A CZ    1 
ATOM   1687 N NH1   . ARG E 2 17 ? 67.920  82.606  33.577  1.00 25.29 ? 913 ARG A NH1   1 
ATOM   1688 N NH2   . ARG E 2 17 ? 68.776  83.650  31.726  1.00 25.39 ? 913 ARG A NH2   1 
ATOM   1689 N N     . ARG E 2 18 ? 71.716  84.661  35.675  1.00 18.07 ? 914 ARG A N     1 
ATOM   1690 C CA    . ARG E 2 18 ? 72.609  83.580  35.249  1.00 17.79 ? 914 ARG A CA    1 
ATOM   1691 C C     . ARG E 2 18 ? 73.287  83.027  36.482  1.00 18.93 ? 914 ARG A C     1 
ATOM   1692 O O     . ARG E 2 18 ? 73.330  81.819  36.682  1.00 18.41 ? 914 ARG A O     1 
ATOM   1693 C CB    . ARG E 2 18 ? 73.713  84.080  34.320  1.00 19.06 ? 914 ARG A CB    1 
ATOM   1694 C CG    . ARG E 2 18 ? 73.319  84.320  32.887  1.00 22.26 ? 914 ARG A CG    1 
ATOM   1695 C CD    . ARG E 2 18 ? 74.509  84.888  32.121  1.00 22.57 ? 914 ARG A CD    1 
ATOM   1696 N NE    . ARG E 2 18 ? 74.026  85.821  31.131  1.00 28.63 ? 914 ARG A NE    1 
ATOM   1697 C CZ    . ARG E 2 18 ? 74.397  87.087  31.045  1.00 26.56 ? 914 ARG A CZ    1 
ATOM   1698 N NH1   . ARG E 2 18 ? 75.285  87.596  31.891  1.00 28.26 ? 914 ARG A NH1   1 
ATOM   1699 N NH2   . ARG E 2 18 ? 73.848  87.850  30.125  1.00 29.87 ? 914 ARG A NH2   1 
ATOM   1700 N N     . ASN E 2 19 ? 73.841  83.923  37.297  1.00 19.75 ? 915 ASN A N     1 
ATOM   1701 C CA    . ASN E 2 19 ? 74.539  83.507  38.505  1.00 22.33 ? 915 ASN A CA    1 
ATOM   1702 C C     . ASN E 2 19 ? 73.688  82.648  39.419  1.00 22.11 ? 915 ASN A C     1 
ATOM   1703 O O     . ASN E 2 19 ? 74.159  81.644  39.942  1.00 23.01 ? 915 ASN A O     1 
ATOM   1704 C CB    . ASN E 2 19 ? 75.074  84.722  39.269  1.00 24.48 ? 915 ASN A CB    1 
ATOM   1705 C CG    . ASN E 2 19 ? 76.310  85.305  38.621  1.00 26.64 ? 915 ASN A CG    1 
ATOM   1706 O OD1   . ASN E 2 19 ? 77.057  84.595  37.948  1.00 28.70 ? 915 ASN A OD1   1 
ATOM   1707 N ND2   . ASN E 2 19 ? 76.547  86.592  38.835  1.00 28.27 ? 915 ASN A ND2   1 
ATOM   1708 N N     . GLU E 2 20 ? 72.434  83.032  39.616  1.00 21.01 ? 916 GLU A N     1 
ATOM   1709 C CA    . GLU E 2 20 ? 71.557  82.252  40.469  1.00 21.08 ? 916 GLU A CA    1 
ATOM   1710 C C     . GLU E 2 20 ? 71.275  80.893  39.816  1.00 20.15 ? 916 GLU A C     1 
ATOM   1711 O O     . GLU E 2 20 ? 71.246  79.860  40.489  1.00 16.83 ? 916 GLU A O     1 
ATOM   1712 C CB    . GLU E 2 20 ? 70.269  83.031  40.725  1.00 23.35 ? 916 GLU A CB    1 
ATOM   1713 C CG    . GLU E 2 20 ? 70.559  84.466  41.145  1.00 27.31 ? 916 GLU A CG    1 
ATOM   1714 C CD    . GLU E 2 20 ? 69.309  85.288  41.417  1.00 30.33 ? 916 GLU A CD    1 
ATOM   1715 O OE1   . GLU E 2 20 ? 68.272  85.040  40.754  1.00 30.65 ? 916 GLU A OE1   1 
ATOM   1716 O OE2   . GLU E 2 20 ? 69.382  86.197  42.283  1.00 30.70 ? 916 GLU A OE2   1 
ATOM   1717 N N     . LEU E 2 21 ? 71.092  80.881  38.499  1.00 18.84 ? 917 LEU A N     1 
ATOM   1718 C CA    . LEU E 2 21 ? 70.839  79.613  37.822  1.00 18.05 ? 917 LEU A CA    1 
ATOM   1719 C C     . LEU E 2 21 ? 72.043  78.673  38.009  1.00 17.04 ? 917 LEU A C     1 
ATOM   1720 O O     . LEU E 2 21 ? 71.873  77.480  38.233  1.00 16.65 ? 917 LEU A O     1 
ATOM   1721 C CB    . LEU E 2 21 ? 70.579  79.857  36.334  1.00 19.31 ? 917 LEU A CB    1 
ATOM   1722 C CG    . LEU E 2 21 ? 69.982  78.699  35.537  1.00 19.52 ? 917 LEU A CG    1 
ATOM   1723 C CD1   . LEU E 2 21 ? 68.608  78.324  36.100  1.00 21.32 ? 917 LEU A CD1   1 
ATOM   1724 C CD2   . LEU E 2 21 ? 69.862  79.131  34.072  1.00 20.94 ? 917 LEU A CD2   1 
ATOM   1725 N N     . LYS E 2 22 ? 73.255  79.209  37.933  1.00 17.88 ? 918 LYS A N     1 
ATOM   1726 C CA    . LYS E 2 22 ? 74.441  78.379  38.114  1.00 20.34 ? 918 LYS A CA    1 
ATOM   1727 C C     . LYS E 2 22 ? 74.433  77.780  39.526  1.00 20.62 ? 918 LYS A C     1 
ATOM   1728 O O     . LYS E 2 22 ? 74.833  76.637  39.727  1.00 19.54 ? 918 LYS A O     1 
ATOM   1729 C CB    . LYS E 2 22 ? 75.709  79.209  37.882  1.00 23.26 ? 918 LYS A CB    1 
ATOM   1730 C CG    . LYS E 2 22 ? 77.005  78.487  38.219  1.00 26.44 ? 918 LYS A CG    1 
ATOM   1731 C CD    . LYS E 2 22 ? 78.205  79.142  37.542  1.00 29.59 ? 918 LYS A CD    1 
ATOM   1732 C CE    . LYS E 2 22 ? 78.315  80.617  37.867  1.00 31.01 ? 918 LYS A CE    1 
ATOM   1733 N NZ    . LYS E 2 22 ? 79.506  81.223  37.199  1.00 33.98 ? 918 LYS A NZ    1 
ATOM   1734 N N     . ARG E 2 23 ? 73.964  78.562  40.495  1.00 22.85 ? 919 ARG A N     1 
ATOM   1735 C CA    . ARG E 2 23 ? 73.876  78.118  41.883  1.00 23.43 ? 919 ARG A CA    1 
ATOM   1736 C C     . ARG E 2 23 ? 72.950  76.921  41.952  1.00 22.61 ? 919 ARG A C     1 
ATOM   1737 O O     . ARG E 2 23 ? 73.260  75.906  42.589  1.00 22.78 ? 919 ARG A O     1 
ATOM   1738 C CB    . ARG E 2 23 ? 73.309  79.238  42.759  1.00 27.25 ? 919 ARG A CB    1 
ATOM   1739 C CG    . ARG E 2 23 ? 74.325  79.907  43.669  1.00 31.14 ? 919 ARG A CG    1 
ATOM   1740 C CD    . ARG E 2 23 ? 74.502  79.106  44.956  1.00 33.95 ? 919 ARG A CD    1 
ATOM   1741 N NE    . ARG E 2 23 ? 74.832  77.712  44.677  1.00 37.20 ? 919 ARG A NE    1 
ATOM   1742 C CZ    . ARG E 2 23 ? 74.731  76.723  45.559  1.00 37.58 ? 919 ARG A CZ    1 
ATOM   1743 N NH1   . ARG E 2 23 ? 74.308  76.968  46.794  1.00 38.02 ? 919 ARG A NH1   1 
ATOM   1744 N NH2   . ARG E 2 23 ? 75.036  75.486  45.202  1.00 37.02 ? 919 ARG A NH2   1 
ATOM   1745 N N     . SER E 2 24 ? 71.797  77.046  41.306  1.00 20.50 ? 920 SER A N     1 
ATOM   1746 C CA    . SER E 2 24 ? 70.828  75.963  41.288  1.00 19.47 ? 920 SER A CA    1 
ATOM   1747 C C     . SER E 2 24 ? 71.438  74.728  40.623  1.00 18.86 ? 920 SER A C     1 
ATOM   1748 O O     . SER E 2 24 ? 71.237  73.611  41.097  1.00 18.65 ? 920 SER A O     1 
ATOM   1749 C CB    . SER E 2 24 ? 69.556  76.382  40.550  1.00 19.76 ? 920 SER A CB    1 
ATOM   1750 O OG    . SER E 2 24 ? 68.871  77.414  41.242  1.00 19.89 ? 920 SER A OG    1 
ATOM   1751 N N     . PHE E 2 25 ? 72.179  74.913  39.533  1.00 18.04 ? 921 PHE A N     1 
ATOM   1752 C CA    . PHE E 2 25 ? 72.800  73.753  38.880  1.00 18.74 ? 921 PHE A CA    1 
ATOM   1753 C C     . PHE E 2 25 ? 73.752  73.039  39.846  1.00 19.73 ? 921 PHE A C     1 
ATOM   1754 O O     . PHE E 2 25 ? 73.693  71.813  39.993  1.00 18.24 ? 921 PHE A O     1 
ATOM   1755 C CB    . PHE E 2 25 ? 73.580  74.164  37.622  1.00 18.60 ? 921 PHE A CB    1 
ATOM   1756 C CG    . PHE E 2 25 ? 72.767  74.112  36.349  1.00 19.03 ? 921 PHE A CG    1 
ATOM   1757 C CD1   . PHE E 2 25 ? 72.425  75.283  35.676  1.00 17.88 ? 921 PHE A CD1   1 
ATOM   1758 C CD2   . PHE E 2 25 ? 72.381  72.887  35.804  1.00 19.25 ? 921 PHE A CD2   1 
ATOM   1759 C CE1   . PHE E 2 25 ? 71.714  75.237  34.475  1.00 17.90 ? 921 PHE A CE1   1 
ATOM   1760 C CE2   . PHE E 2 25 ? 71.671  72.831  34.603  1.00 18.86 ? 921 PHE A CE2   1 
ATOM   1761 C CZ    . PHE E 2 25 ? 71.338  74.004  33.937  1.00 17.56 ? 921 PHE A CZ    1 
ATOM   1762 N N     . PHE E 2 26 ? 74.636  73.798  40.497  1.00 19.44 ? 922 PHE A N     1 
ATOM   1763 C CA    . PHE E 2 26 ? 75.587  73.202  41.439  1.00 20.14 ? 922 PHE A CA    1 
ATOM   1764 C C     . PHE E 2 26 ? 74.887  72.464  42.577  1.00 20.27 ? 922 PHE A C     1 
ATOM   1765 O O     . PHE E 2 26 ? 75.328  71.386  43.001  1.00 19.45 ? 922 PHE A O     1 
ATOM   1766 C CB    . PHE E 2 26 ? 76.509  74.265  42.041  1.00 22.52 ? 922 PHE A CB    1 
ATOM   1767 C CG    . PHE E 2 26 ? 77.477  74.876  41.060  1.00 25.88 ? 922 PHE A CG    1 
ATOM   1768 C CD1   . PHE E 2 26 ? 77.759  74.256  39.847  1.00 27.10 ? 922 PHE A CD1   1 
ATOM   1769 C CD2   . PHE E 2 26 ? 78.139  76.063  41.376  1.00 27.82 ? 922 PHE A CD2   1 
ATOM   1770 C CE1   . PHE E 2 26 ? 78.689  74.811  38.964  1.00 28.02 ? 922 PHE A CE1   1 
ATOM   1771 C CE2   . PHE E 2 26 ? 79.072  76.626  40.499  1.00 28.10 ? 922 PHE A CE2   1 
ATOM   1772 C CZ    . PHE E 2 26 ? 79.347  76.000  39.294  1.00 28.41 ? 922 PHE A CZ    1 
ATOM   1773 N N     . ALA E 2 27 ? 73.810  73.051  43.083  1.00 20.25 ? 923 ALA A N     1 
ATOM   1774 C CA    . ALA E 2 27 ? 73.062  72.440  44.172  1.00 21.46 ? 923 ALA A CA    1 
ATOM   1775 C C     . ALA E 2 27 ? 72.519  71.081  43.742  1.00 21.29 ? 923 ALA A C     1 
ATOM   1776 O O     . ALA E 2 27 ? 72.596  70.116  44.496  1.00 22.16 ? 923 ALA A O     1 
ATOM   1777 C CB    . ALA E 2 27 ? 71.922  73.358  44.613  1.00 21.75 ? 923 ALA A CB    1 
ATOM   1778 N N     . LEU E 2 28 ? 71.990  71.005  42.522  1.00 21.03 ? 924 LEU A N     1 
ATOM   1779 C CA    . LEU E 2 28 ? 71.445  69.756  42.002  1.00 19.24 ? 924 LEU A CA    1 
ATOM   1780 C C     . LEU E 2 28 ? 72.572  68.758  41.769  1.00 19.94 ? 924 LEU A C     1 
ATOM   1781 O O     . LEU E 2 28 ? 72.465  67.597  42.142  1.00 20.09 ? 924 LEU A O     1 
ATOM   1782 C CB    . LEU E 2 28 ? 70.681  69.997  40.692  1.00 19.73 ? 924 LEU A CB    1 
ATOM   1783 C CG    . LEU E 2 28 ? 70.168  68.749  39.959  1.00 18.20 ? 924 LEU A CG    1 
ATOM   1784 C CD1   . LEU E 2 28 ? 69.355  67.875  40.896  1.00 17.32 ? 924 LEU A CD1   1 
ATOM   1785 C CD2   . LEU E 2 28 ? 69.333  69.173  38.764  1.00 18.70 ? 924 LEU A CD2   1 
ATOM   1786 N N     . ARG E 2 29 ? 73.660  69.217  41.166  1.00 19.76 ? 925 ARG A N     1 
ATOM   1787 C CA    . ARG E 2 29 ? 74.801  68.342  40.909  1.00 21.90 ? 925 ARG A CA    1 
ATOM   1788 C C     . ARG E 2 29 ? 75.270  67.651  42.201  1.00 22.44 ? 925 ARG A C     1 
ATOM   1789 O O     . ARG E 2 29 ? 75.643  66.473  42.194  1.00 21.39 ? 925 ARG A O     1 
ATOM   1790 C CB    . ARG E 2 29 ? 75.953  69.164  40.328  1.00 23.10 ? 925 ARG A CB    1 
ATOM   1791 C CG    . ARG E 2 29 ? 77.258  68.408  40.181  1.00 26.48 ? 925 ARG A CG    1 
ATOM   1792 C CD    . ARG E 2 29 ? 78.413  69.372  40.321  1.00 29.64 ? 925 ARG A CD    1 
ATOM   1793 N NE    . ARG E 2 29 ? 78.334  70.075  41.600  1.00 33.14 ? 925 ARG A NE    1 
ATOM   1794 C CZ    . ARG E 2 29 ? 79.034  71.164  41.904  1.00 34.34 ? 925 ARG A CZ    1 
ATOM   1795 N NH1   . ARG E 2 29 ? 79.874  71.682  41.021  1.00 35.39 ? 925 ARG A NH1   1 
ATOM   1796 N NH2   . ARG E 2 29 ? 78.887  71.740  43.087  1.00 35.29 ? 925 ARG A NH2   1 
ATOM   1797 N N     . ASP E 2 30 ? 75.252  68.402  43.299  1.00 22.44 ? 926 ASP A N     1 
ATOM   1798 C CA    . ASP E 2 30 ? 75.689  67.901  44.600  1.00 23.46 ? 926 ASP A CA    1 
ATOM   1799 C C     . ASP E 2 30 ? 74.794  66.811  45.163  1.00 23.38 ? 926 ASP A C     1 
ATOM   1800 O O     . ASP E 2 30 ? 75.148  66.161  46.146  1.00 23.10 ? 926 ASP A O     1 
ATOM   1801 C CB    . ASP E 2 30 ? 75.755  69.047  45.608  1.00 24.85 ? 926 ASP A CB    1 
ATOM   1802 C CG    . ASP E 2 30 ? 76.803  70.066  45.257  1.00 26.93 ? 926 ASP A CG    1 
ATOM   1803 O OD1   . ASP E 2 30 ? 76.737  71.190  45.795  1.00 28.60 ? 926 ASP A OD1   1 
ATOM   1804 O OD2   . ASP E 2 30 ? 77.699  69.749  44.445  1.00 27.52 ? 926 ASP A OD2   1 
ATOM   1805 N N     . GLN E 2 31 ? 73.637  66.603  44.546  1.00 22.75 ? 927 GLN A N     1 
ATOM   1806 C CA    . GLN E 2 31 ? 72.713  65.594  45.032  1.00 23.76 ? 927 GLN A CA    1 
ATOM   1807 C C     . GLN E 2 31 ? 72.787  64.299  44.223  1.00 23.51 ? 927 GLN A C     1 
ATOM   1808 O O     . GLN E 2 31 ? 72.105  63.323  44.538  1.00 22.72 ? 927 GLN A O     1 
ATOM   1809 C CB    . GLN E 2 31 ? 71.285  66.147  45.010  1.00 24.99 ? 927 GLN A CB    1 
ATOM   1810 C CG    . GLN E 2 31 ? 70.471  65.798  46.244  1.00 29.66 ? 927 GLN A CG    1 
ATOM   1811 C CD    . GLN E 2 31 ? 71.088  66.345  47.524  1.00 29.12 ? 927 GLN A CD    1 
ATOM   1812 O OE1   . GLN E 2 31 ? 71.211  67.551  47.702  1.00 33.03 ? 927 GLN A OE1   1 
ATOM   1813 N NE2   . GLN E 2 31 ? 71.485  65.454  48.413  1.00 32.57 ? 927 GLN A NE2   1 
ATOM   1814 N N     . ILE E 2 32 ? 73.629  64.287  43.193  1.00 23.03 ? 928 ILE A N     1 
ATOM   1815 C CA    . ILE E 2 32 ? 73.763  63.106  42.344  1.00 22.62 ? 928 ILE A CA    1 
ATOM   1816 C C     . ILE E 2 32 ? 75.044  62.337  42.661  1.00 22.70 ? 928 ILE A C     1 
ATOM   1817 O O     . ILE E 2 32 ? 76.146  62.817  42.406  1.00 22.96 ? 928 ILE A O     1 
ATOM   1818 C CB    . ILE E 2 32 ? 73.776  63.504  40.852  1.00 21.96 ? 928 ILE A CB    1 
ATOM   1819 C CG1   . ILE E 2 32 ? 72.660  64.511  40.577  1.00 21.67 ? 928 ILE A CG1   1 
ATOM   1820 C CG2   . ILE E 2 32 ? 73.568  62.279  39.980  1.00 22.97 ? 928 ILE A CG2   1 
ATOM   1821 C CD1   . ILE E 2 32 ? 72.596  64.947  39.123  1.00 22.91 ? 928 ILE A CD1   1 
ATOM   1822 N N     . PRO E 2 33 ? 74.913  61.125  43.219  1.00 23.44 ? 929 PRO A N     1 
ATOM   1823 C CA    . PRO E 2 33 ? 76.084  60.309  43.564  1.00 24.66 ? 929 PRO A CA    1 
ATOM   1824 C C     . PRO E 2 33 ? 77.122  60.231  42.442  1.00 25.97 ? 929 PRO A C     1 
ATOM   1825 O O     . PRO E 2 33 ? 78.312  60.464  42.656  1.00 25.39 ? 929 PRO A O     1 
ATOM   1826 C CB    . PRO E 2 33 ? 75.471  58.941  43.870  1.00 24.55 ? 929 PRO A CB    1 
ATOM   1827 C CG    . PRO E 2 33 ? 74.116  59.292  44.413  1.00 23.86 ? 929 PRO A CG    1 
ATOM   1828 C CD    . PRO E 2 33 ? 73.665  60.379  43.455  1.00 23.22 ? 929 PRO A CD    1 
ATOM   1829 N N     . GLU E 2 34 ? 76.651  59.908  41.244  1.00 27.48 ? 930 GLU A N     1 
ATOM   1830 C CA    . GLU E 2 34 ? 77.503  59.768  40.072  1.00 30.22 ? 930 GLU A CA    1 
ATOM   1831 C C     . GLU E 2 34 ? 78.364  60.987  39.734  1.00 31.28 ? 930 GLU A C     1 
ATOM   1832 O O     . GLU E 2 34 ? 79.347  60.864  39.005  1.00 31.10 ? 930 GLU A O     1 
ATOM   1833 C CB    . GLU E 2 34 ? 76.633  59.370  38.871  1.00 31.29 ? 930 GLU A CB    1 
ATOM   1834 C CG    . GLU E 2 34 ? 77.237  59.648  37.510  1.00 32.66 ? 930 GLU A CG    1 
ATOM   1835 C CD    . GLU E 2 34 ? 76.532  58.900  36.393  1.00 31.62 ? 930 GLU A CD    1 
ATOM   1836 O OE1   . GLU E 2 34 ? 75.279  58.861  36.372  1.00 31.56 ? 930 GLU A OE1   1 
ATOM   1837 O OE2   . GLU E 2 34 ? 77.242  58.357  35.528  1.00 32.45 ? 930 GLU A OE2   1 
ATOM   1838 N N     . LEU E 2 35 ? 78.011  62.153  40.273  1.00 32.63 ? 931 LEU A N     1 
ATOM   1839 C CA    . LEU E 2 35 ? 78.758  63.384  40.005  1.00 33.69 ? 931 LEU A CA    1 
ATOM   1840 C C     . LEU E 2 35 ? 79.622  63.819  41.188  1.00 34.34 ? 931 LEU A C     1 
ATOM   1841 O O     . LEU E 2 35 ? 80.069  64.964  41.251  1.00 33.30 ? 931 LEU A O     1 
ATOM   1842 C CB    . LEU E 2 35 ? 77.789  64.516  39.641  1.00 33.80 ? 931 LEU A CB    1 
ATOM   1843 C CG    . LEU E 2 35 ? 77.034  64.409  38.307  1.00 34.39 ? 931 LEU A CG    1 
ATOM   1844 C CD1   . LEU E 2 35 ? 76.214  63.139  38.252  1.00 35.60 ? 931 LEU A CD1   1 
ATOM   1845 C CD2   . LEU E 2 35 ? 76.130  65.613  38.144  1.00 34.99 ? 931 LEU A CD2   1 
ATOM   1846 N N     . GLU E 2 36 ? 79.864  62.890  42.108  1.00 35.87 ? 932 GLU A N     1 
ATOM   1847 C CA    . GLU E 2 36 ? 80.653  63.148  43.315  1.00 37.50 ? 932 GLU A CA    1 
ATOM   1848 C C     . GLU E 2 36 ? 81.915  64.000  43.138  1.00 37.41 ? 932 GLU A C     1 
ATOM   1849 O O     . GLU E 2 36 ? 82.080  65.017  43.814  1.00 37.85 ? 932 GLU A O     1 
ATOM   1850 C CB    . GLU E 2 36 ? 81.027  61.818  43.967  1.00 40.14 ? 932 GLU A CB    1 
ATOM   1851 C CG    . GLU E 2 36 ? 81.481  61.937  45.412  1.00 43.70 ? 932 GLU A CG    1 
ATOM   1852 C CD    . GLU E 2 36 ? 81.650  60.580  46.067  1.00 45.30 ? 932 GLU A CD    1 
ATOM   1853 O OE1   . GLU E 2 36 ? 80.724  59.748  45.938  1.00 46.13 ? 932 GLU A OE1   1 
ATOM   1854 O OE2   . GLU E 2 36 ? 82.698  60.350  46.714  1.00 46.29 ? 932 GLU A OE2   1 
ATOM   1855 N N     . ASN E 2 37 ? 82.808  63.586  42.245  1.00 36.83 ? 933 ASN A N     1 
ATOM   1856 C CA    . ASN E 2 37 ? 84.048  64.325  42.004  1.00 37.35 ? 933 ASN A CA    1 
ATOM   1857 C C     . ASN E 2 37 ? 84.084  64.897  40.596  1.00 37.93 ? 933 ASN A C     1 
ATOM   1858 O O     . ASN E 2 37 ? 85.094  64.789  39.894  1.00 37.50 ? 933 ASN A O     1 
ATOM   1859 C CB    . ASN E 2 37 ? 85.259  63.414  42.194  1.00 37.46 ? 933 ASN A CB    1 
ATOM   1860 C CG    . ASN E 2 37 ? 85.422  62.954  43.622  1.00 37.88 ? 933 ASN A CG    1 
ATOM   1861 O OD1   . ASN E 2 37 ? 85.661  63.761  44.522  1.00 38.14 ? 933 ASN A OD1   1 
ATOM   1862 N ND2   . ASN E 2 37 ? 85.289  61.651  43.841  1.00 37.64 ? 933 ASN A ND2   1 
ATOM   1863 N N     . ASN E 2 38 ? 82.978  65.503  40.189  1.00 37.96 ? 934 ASN A N     1 
ATOM   1864 C CA    . ASN E 2 38 ? 82.875  66.085  38.860  1.00 38.52 ? 934 ASN A CA    1 
ATOM   1865 C C     . ASN E 2 38 ? 82.158  67.425  38.979  1.00 38.54 ? 934 ASN A C     1 
ATOM   1866 O O     . ASN E 2 38 ? 81.076  67.619  38.426  1.00 39.52 ? 934 ASN A O     1 
ATOM   1867 C CB    . ASN E 2 38 ? 82.097  65.134  37.945  1.00 38.73 ? 934 ASN A CB    1 
ATOM   1868 C CG    . ASN E 2 38 ? 82.204  65.511  36.477  1.00 39.39 ? 934 ASN A CG    1 
ATOM   1869 O OD1   . ASN E 2 38 ? 81.719  64.786  35.604  1.00 39.40 ? 934 ASN A OD1   1 
ATOM   1870 N ND2   . ASN E 2 38 ? 82.841  66.643  36.197  1.00 37.96 ? 934 ASN A ND2   1 
ATOM   1871 N N     . GLU E 2 39 ? 82.778  68.349  39.705  1.00 37.30 ? 935 GLU A N     1 
ATOM   1872 C CA    . GLU E 2 39 ? 82.203  69.670  39.923  1.00 37.01 ? 935 GLU A CA    1 
ATOM   1873 C C     . GLU E 2 39 ? 82.118  70.489  38.638  1.00 35.36 ? 935 GLU A C     1 
ATOM   1874 O O     . GLU E 2 39 ? 81.375  71.466  38.567  1.00 36.09 ? 935 GLU A O     1 
ATOM   1875 C CB    . GLU E 2 39 ? 83.023  70.427  40.968  1.00 38.58 ? 935 GLU A CB    1 
ATOM   1876 C CG    . GLU E 2 39 ? 84.381  70.876  40.473  1.00 44.74 ? 935 GLU A CG    1 
ATOM   1877 C CD    . GLU E 2 39 ? 85.324  71.234  41.602  1.00 49.17 ? 935 GLU A CD    1 
ATOM   1878 O OE1   . GLU E 2 39 ? 84.964  72.100  42.433  1.00 49.87 ? 935 GLU A OE1   1 
ATOM   1879 O OE2   . GLU E 2 39 ? 86.429  70.646  41.655  1.00 49.88 ? 935 GLU A OE2   1 
ATOM   1880 N N     . LYS E 2 40 ? 82.882  70.094  37.623  1.00 32.45 ? 936 LYS A N     1 
ATOM   1881 C CA    . LYS E 2 40 ? 82.871  70.808  36.350  1.00 30.69 ? 936 LYS A CA    1 
ATOM   1882 C C     . LYS E 2 40 ? 81.935  70.179  35.323  1.00 27.96 ? 936 LYS A C     1 
ATOM   1883 O O     . LYS E 2 40 ? 81.952  70.555  34.155  1.00 28.33 ? 936 LYS A O     1 
ATOM   1884 C CB    . LYS E 2 40 ? 84.280  70.875  35.760  1.00 32.08 ? 936 LYS A CB    1 
ATOM   1885 C CG    . LYS E 2 40 ? 85.190  71.882  36.422  1.00 35.55 ? 936 LYS A CG    1 
ATOM   1886 C CD    . LYS E 2 40 ? 86.536  71.912  35.719  1.00 37.77 ? 936 LYS A CD    1 
ATOM   1887 C CE    . LYS E 2 40 ? 87.476  72.915  36.362  1.00 38.94 ? 936 LYS A CE    1 
ATOM   1888 N NZ    . LYS E 2 40 ? 88.826  72.890  35.729  1.00 41.30 ? 936 LYS A NZ    1 
ATOM   1889 N N     . ALA E 2 41 ? 81.125  69.217  35.753  1.00 25.78 ? 937 ALA A N     1 
ATOM   1890 C CA    . ALA E 2 41 ? 80.192  68.564  34.844  1.00 23.71 ? 937 ALA A CA    1 
ATOM   1891 C C     . ALA E 2 41 ? 79.377  69.626  34.097  1.00 22.47 ? 937 ALA A C     1 
ATOM   1892 O O     . ALA E 2 41 ? 78.807  70.532  34.706  1.00 22.30 ? 937 ALA A O     1 
ATOM   1893 C CB    . ALA E 2 41 ? 79.261  67.645  35.628  1.00 22.45 ? 937 ALA A CB    1 
ATOM   1894 N N     . PRO E 2 42 ? 79.328  69.547  32.764  1.00 21.79 ? 938 PRO A N     1 
ATOM   1895 C CA    . PRO E 2 42 ? 78.541  70.565  32.058  1.00 20.75 ? 938 PRO A CA    1 
ATOM   1896 C C     . PRO E 2 42 ? 77.055  70.547  32.443  1.00 19.20 ? 938 PRO A C     1 
ATOM   1897 O O     . PRO E 2 42 ? 76.563  69.580  33.006  1.00 17.67 ? 938 PRO A O     1 
ATOM   1898 C CB    . PRO E 2 42 ? 78.780  70.228  30.584  1.00 21.91 ? 938 PRO A CB    1 
ATOM   1899 C CG    . PRO E 2 42 ? 79.151  68.763  30.605  1.00 23.48 ? 938 PRO A CG    1 
ATOM   1900 C CD    . PRO E 2 42 ? 80.043  68.677  31.816  1.00 22.72 ? 938 PRO A CD    1 
ATOM   1901 N N     . LYS E 2 43 ? 76.343  71.627  32.140  1.00 19.23 ? 939 LYS A N     1 
ATOM   1902 C CA    . LYS E 2 43 ? 74.923  71.704  32.466  1.00 17.99 ? 939 LYS A CA    1 
ATOM   1903 C C     . LYS E 2 43 ? 74.106  70.534  31.933  1.00 16.26 ? 939 LYS A C     1 
ATOM   1904 O O     . LYS E 2 43 ? 73.282  69.965  32.652  1.00 15.16 ? 939 LYS A O     1 
ATOM   1905 C CB    . LYS E 2 43 ? 74.324  73.009  31.928  1.00 18.54 ? 939 LYS A CB    1 
ATOM   1906 C CG    . LYS E 2 43 ? 74.836  74.244  32.612  1.00 22.10 ? 939 LYS A CG    1 
ATOM   1907 C CD    . LYS E 2 43 ? 74.147  75.499  32.058  1.00 23.94 ? 939 LYS A CD    1 
ATOM   1908 C CE    . LYS E 2 43 ? 74.696  76.749  32.721  1.00 26.09 ? 939 LYS A CE    1 
ATOM   1909 N NZ    . LYS E 2 43 ? 76.152  76.908  32.453  1.00 28.04 ? 939 LYS A NZ    1 
ATOM   1910 N N     . VAL E 2 44 ? 74.331  70.167  30.677  1.00 16.33 ? 940 VAL A N     1 
ATOM   1911 C CA    . VAL E 2 44 ? 73.565  69.083  30.088  1.00 15.16 ? 940 VAL A CA    1 
ATOM   1912 C C     . VAL E 2 44 ? 73.809  67.725  30.751  1.00 17.06 ? 940 VAL A C     1 
ATOM   1913 O O     . VAL E 2 44 ? 72.903  66.883  30.816  1.00 15.16 ? 940 VAL A O     1 
ATOM   1914 C CB    . VAL E 2 44 ? 73.810  68.987  28.565  1.00 16.35 ? 940 VAL A CB    1 
ATOM   1915 C CG1   . VAL E 2 44 ? 75.243  68.520  28.281  1.00 15.16 ? 940 VAL A CG1   1 
ATOM   1916 C CG2   . VAL E 2 44 ? 72.779  68.046  27.945  1.00 18.46 ? 940 VAL A CG2   1 
ATOM   1917 N N     . VAL E 2 45 ? 75.021  67.509  31.255  1.00 15.16 ? 941 VAL A N     1 
ATOM   1918 C CA    . VAL E 2 45 ? 75.324  66.253  31.922  1.00 15.66 ? 941 VAL A CA    1 
ATOM   1919 C C     . VAL E 2 45 ? 74.638  66.253  33.295  1.00 15.17 ? 941 VAL A C     1 
ATOM   1920 O O     . VAL E 2 45 ? 74.156  65.217  33.757  1.00 15.16 ? 941 VAL A O     1 
ATOM   1921 C CB    . VAL E 2 45 ? 76.846  66.057  32.051  1.00 15.16 ? 941 VAL A CB    1 
ATOM   1922 C CG1   . VAL E 2 45 ? 77.157  64.847  32.902  1.00 16.90 ? 941 VAL A CG1   1 
ATOM   1923 C CG2   . VAL E 2 45 ? 77.452  65.883  30.658  1.00 17.25 ? 941 VAL A CG2   1 
ATOM   1924 N N     . ILE E 2 46 ? 74.566  67.412  33.946  1.00 15.16 ? 942 ILE A N     1 
ATOM   1925 C CA    . ILE E 2 46 ? 73.888  67.450  35.239  1.00 15.16 ? 942 ILE A CA    1 
ATOM   1926 C C     . ILE E 2 46 ? 72.416  67.112  35.022  1.00 15.16 ? 942 ILE A C     1 
ATOM   1927 O O     . ILE E 2 46 ? 71.827  66.348  35.782  1.00 15.16 ? 942 ILE A O     1 
ATOM   1928 C CB    . ILE E 2 46 ? 73.967  68.830  35.920  1.00 15.16 ? 942 ILE A CB    1 
ATOM   1929 C CG1   . ILE E 2 46 ? 75.412  69.146  36.324  1.00 15.16 ? 942 ILE A CG1   1 
ATOM   1930 C CG2   . ILE E 2 46 ? 73.059  68.832  37.157  1.00 16.97 ? 942 ILE A CG2   1 
ATOM   1931 C CD1   . ILE E 2 46 ? 75.610  70.554  36.875  1.00 15.92 ? 942 ILE A CD1   1 
ATOM   1932 N N     . LEU E 2 47 ? 71.824  67.685  33.977  1.00 15.16 ? 943 LEU A N     1 
ATOM   1933 C CA    . LEU E 2 47 ? 70.424  67.421  33.687  1.00 15.83 ? 943 LEU A CA    1 
ATOM   1934 C C     . LEU E 2 47 ? 70.170  65.939  33.434  1.00 16.38 ? 943 LEU A C     1 
ATOM   1935 O O     . LEU E 2 47 ? 69.381  65.316  34.133  1.00 16.62 ? 943 LEU A O     1 
ATOM   1936 C CB    . LEU E 2 47 ? 69.972  68.235  32.475  1.00 15.16 ? 943 LEU A CB    1 
ATOM   1937 C CG    . LEU E 2 47 ? 69.906  69.750  32.725  1.00 15.16 ? 943 LEU A CG    1 
ATOM   1938 C CD1   . LEU E 2 47 ? 69.694  70.504  31.415  1.00 15.16 ? 943 LEU A CD1   1 
ATOM   1939 C CD2   . LEU E 2 47 ? 68.785  70.036  33.702  1.00 15.16 ? 943 LEU A CD2   1 
ATOM   1940 N N     . LYS E 2 48 ? 70.839  65.382  32.428  1.00 15.98 ? 944 LYS A N     1 
ATOM   1941 C CA    . LYS E 2 48 ? 70.667  63.973  32.073  1.00 16.48 ? 944 LYS A CA    1 
ATOM   1942 C C     . LYS E 2 48 ? 70.908  62.998  33.222  1.00 15.16 ? 944 LYS A C     1 
ATOM   1943 O O     . LYS E 2 48 ? 70.187  62.011  33.382  1.00 15.16 ? 944 LYS A O     1 
ATOM   1944 C CB    . LYS E 2 48 ? 71.598  63.624  30.912  1.00 16.24 ? 944 LYS A CB    1 
ATOM   1945 C CG    . LYS E 2 48 ? 71.231  64.296  29.595  1.00 16.71 ? 944 LYS A CG    1 
ATOM   1946 C CD    . LYS E 2 48 ? 72.314  64.023  28.546  1.00 15.32 ? 944 LYS A CD    1 
ATOM   1947 C CE    . LYS E 2 48 ? 72.007  64.727  27.243  1.00 16.39 ? 944 LYS A CE    1 
ATOM   1948 N NZ    . LYS E 2 48 ? 73.135  64.582  26.272  1.00 17.89 ? 944 LYS A NZ    1 
ATOM   1949 N N     . LYS E 2 49 ? 71.927  63.270  34.028  1.00 17.06 ? 945 LYS A N     1 
ATOM   1950 C CA    . LYS E 2 49 ? 72.247  62.389  35.140  1.00 15.52 ? 945 LYS A CA    1 
ATOM   1951 C C     . LYS E 2 49 ? 71.305  62.584  36.326  1.00 15.85 ? 945 LYS A C     1 
ATOM   1952 O O     . LYS E 2 49 ? 71.052  61.647  37.072  1.00 16.90 ? 945 LYS A O     1 
ATOM   1953 C CB    . LYS E 2 49 ? 73.717  62.578  35.554  1.00 17.17 ? 945 LYS A CB    1 
ATOM   1954 C CG    . LYS E 2 49 ? 74.690  62.085  34.472  1.00 18.00 ? 945 LYS A CG    1 
ATOM   1955 C CD    . LYS E 2 49 ? 76.148  62.189  34.891  1.00 19.25 ? 945 LYS A CD    1 
ATOM   1956 C CE    . LYS E 2 49 ? 77.061  61.581  33.821  1.00 19.31 ? 945 LYS A CE    1 
ATOM   1957 N NZ    . LYS E 2 49 ? 76.696  60.157  33.487  1.00 20.43 ? 945 LYS A NZ    1 
ATOM   1958 N N     . ALA E 2 50 ? 70.781  63.793  36.508  1.00 15.92 ? 946 ALA A N     1 
ATOM   1959 C CA    . ALA E 2 50 ? 69.842  64.018  37.607  1.00 15.25 ? 946 ALA A CA    1 
ATOM   1960 C C     . ALA E 2 50 ? 68.597  63.225  37.256  1.00 15.76 ? 946 ALA A C     1 
ATOM   1961 O O     . ALA E 2 50 ? 67.978  62.606  38.109  1.00 15.27 ? 946 ALA A O     1 
ATOM   1962 C CB    . ALA E 2 50 ? 69.495  65.516  37.747  1.00 15.77 ? 946 ALA A CB    1 
ATOM   1963 N N     . THR E 2 51 ? 68.251  63.237  35.975  1.00 17.40 ? 947 THR A N     1 
ATOM   1964 C CA    . THR E 2 51 ? 67.072  62.539  35.487  1.00 17.38 ? 947 THR A CA    1 
ATOM   1965 C C     . THR E 2 51 ? 67.253  61.030  35.668  1.00 18.87 ? 947 THR A C     1 
ATOM   1966 O O     . THR E 2 51 ? 66.382  60.344  36.206  1.00 18.30 ? 947 THR A O     1 
ATOM   1967 C CB    . THR E 2 51 ? 66.837  62.894  33.999  1.00 17.68 ? 947 THR A CB    1 
ATOM   1968 O OG1   . THR E 2 51 ? 66.484  64.279  33.906  1.00 19.22 ? 947 THR A OG1   1 
ATOM   1969 C CG2   . THR E 2 51 ? 65.715  62.057  33.388  1.00 18.99 ? 947 THR A CG2   1 
ATOM   1970 N N     . ALA E 2 52 ? 68.395  60.520  35.225  1.00 18.47 ? 948 ALA A N     1 
ATOM   1971 C CA    . ALA E 2 52 ? 68.679  59.095  35.362  1.00 17.04 ? 948 ALA A CA    1 
ATOM   1972 C C     . ALA E 2 52 ? 68.593  58.698  36.835  1.00 18.04 ? 948 ALA A C     1 
ATOM   1973 O O     . ALA E 2 52 ? 67.945  57.716  37.187  1.00 18.73 ? 948 ALA A O     1 
ATOM   1974 C CB    . ALA E 2 52 ? 70.059  58.798  34.832  1.00 17.44 ? 948 ALA A CB    1 
ATOM   1975 N N     . TYR E 2 53 ? 69.232  59.479  37.699  1.00 19.72 ? 949 TYR A N     1 
ATOM   1976 C CA    . TYR E 2 53 ? 69.236  59.178  39.132  1.00 20.61 ? 949 TYR A CA    1 
ATOM   1977 C C     . TYR E 2 53 ? 67.838  59.166  39.743  1.00 21.33 ? 949 TYR A C     1 
ATOM   1978 O O     . TYR E 2 53 ? 67.521  58.287  40.558  1.00 21.47 ? 949 TYR A O     1 
ATOM   1979 C CB    . TYR E 2 53 ? 70.130  60.180  39.879  1.00 22.24 ? 949 TYR A CB    1 
ATOM   1980 C CG    . TYR E 2 53 ? 70.285  59.884  41.358  1.00 25.09 ? 949 TYR A CG    1 
ATOM   1981 C CD1   . TYR E 2 53 ? 70.842  58.680  41.798  1.00 24.68 ? 949 TYR A CD1   1 
ATOM   1982 C CD2   . TYR E 2 53 ? 69.859  60.801  42.321  1.00 26.00 ? 949 TYR A CD2   1 
ATOM   1983 C CE1   . TYR E 2 53 ? 70.965  58.398  43.155  1.00 25.83 ? 949 TYR A CE1   1 
ATOM   1984 C CE2   . TYR E 2 53 ? 69.981  60.528  43.678  1.00 26.97 ? 949 TYR A CE2   1 
ATOM   1985 C CZ    . TYR E 2 53 ? 70.533  59.324  44.089  1.00 26.83 ? 949 TYR A CZ    1 
ATOM   1986 O OH    . TYR E 2 53 ? 70.635  59.046  45.432  1.00 26.42 ? 949 TYR A OH    1 
ATOM   1987 N N     . ILE E 2 54 ? 66.996  60.122  39.348  1.00 21.89 ? 950 ILE A N     1 
ATOM   1988 C CA    . ILE E 2 54 ? 65.633  60.200  39.874  1.00 22.02 ? 950 ILE A CA    1 
ATOM   1989 C C     . ILE E 2 54 ? 64.838  58.965  39.474  1.00 23.11 ? 950 ILE A C     1 
ATOM   1990 O O     . ILE E 2 54 ? 64.131  58.373  40.295  1.00 23.89 ? 950 ILE A O     1 
ATOM   1991 C CB    . ILE E 2 54 ? 64.887  61.472  39.362  1.00 21.69 ? 950 ILE A CB    1 
ATOM   1992 C CG1   . ILE E 2 54 ? 65.466  62.726  40.019  1.00 21.07 ? 950 ILE A CG1   1 
ATOM   1993 C CG2   . ILE E 2 54 ? 63.406  61.377  39.689  1.00 23.69 ? 950 ILE A CG2   1 
ATOM   1994 C CD1   . ILE E 2 54 ? 64.989  64.039  39.366  1.00 17.56 ? 950 ILE A CD1   1 
ATOM   1995 N N     . LEU E 2 55 ? 64.948  58.570  38.211  1.00 23.48 ? 951 LEU A N     1 
ATOM   1996 C CA    . LEU E 2 55 ? 64.236  57.390  37.742  1.00 24.09 ? 951 LEU A CA    1 
ATOM   1997 C C     . LEU E 2 55 ? 64.677  56.149  38.525  1.00 25.05 ? 951 LEU A C     1 
ATOM   1998 O O     . LEU E 2 55 ? 63.864  55.272  38.817  1.00 24.70 ? 951 LEU A O     1 
ATOM   1999 C CB    . LEU E 2 55 ? 64.487  57.176  36.243  1.00 25.74 ? 951 LEU A CB    1 
ATOM   2000 C CG    . LEU E 2 55 ? 63.707  58.065  35.257  1.00 26.87 ? 951 LEU A CG    1 
ATOM   2001 C CD1   . LEU E 2 55 ? 63.607  59.489  35.773  1.00 27.67 ? 951 LEU A CD1   1 
ATOM   2002 C CD2   . LEU E 2 55 ? 64.396  58.031  33.900  1.00 28.24 ? 951 LEU A CD2   1 
ATOM   2003 N N     . SER E 2 56 ? 65.958  56.080  38.881  1.00 24.67 ? 952 SER A N     1 
ATOM   2004 C CA    . SER E 2 56 ? 66.450  54.921  39.612  1.00 24.44 ? 952 SER A CA    1 
ATOM   2005 C C     . SER E 2 56 ? 65.897  54.899  41.033  1.00 26.31 ? 952 SER A C     1 
ATOM   2006 O O     . SER E 2 56 ? 65.636  53.834  41.586  1.00 26.64 ? 952 SER A O     1 
ATOM   2007 C CB    . SER E 2 56 ? 67.976  54.913  39.661  1.00 23.26 ? 952 SER A CB    1 
ATOM   2008 O OG    . SER E 2 56 ? 68.462  55.895  40.555  1.00 24.80 ? 952 SER A OG    1 
ATOM   2009 N N     . VAL E 2 57 ? 65.716  56.075  41.621  1.00 25.97 ? 953 VAL A N     1 
ATOM   2010 C CA    . VAL E 2 57 ? 65.190  56.165  42.974  1.00 27.30 ? 953 VAL A CA    1 
ATOM   2011 C C     . VAL E 2 57 ? 63.714  55.774  43.017  1.00 28.03 ? 953 VAL A C     1 
ATOM   2012 O O     . VAL E 2 57 ? 63.264  55.135  43.968  1.00 26.85 ? 953 VAL A O     1 
ATOM   2013 C CB    . VAL E 2 57 ? 65.416  57.590  43.538  1.00 28.05 ? 953 VAL A CB    1 
ATOM   2014 C CG1   . VAL E 2 57 ? 64.541  57.844  44.753  1.00 28.94 ? 953 VAL A CG1   1 
ATOM   2015 C CG2   . VAL E 2 57 ? 66.884  57.746  43.918  1.00 28.11 ? 953 VAL A CG2   1 
ATOM   2016 N N     . GLN E 2 58 ? 62.962  56.132  41.980  1.00 28.15 ? 954 GLN A N     1 
ATOM   2017 C CA    . GLN E 2 58 ? 61.550  55.787  41.935  1.00 29.61 ? 954 GLN A CA    1 
ATOM   2018 C C     . GLN E 2 58 ? 61.384  54.277  41.739  1.00 30.83 ? 954 GLN A C     1 
ATOM   2019 O O     . GLN E 2 58 ? 60.601  53.634  42.441  1.00 30.97 ? 954 GLN A O     1 
ATOM   2020 C CB    . GLN E 2 58 ? 60.856  56.559  40.813  1.00 29.47 ? 954 GLN A CB    1 
ATOM   2021 C CG    . GLN E 2 58 ? 61.026  58.066  40.946  1.00 28.22 ? 954 GLN A CG    1 
ATOM   2022 C CD    . GLN E 2 58 ? 60.450  58.825  39.770  1.00 27.52 ? 954 GLN A CD    1 
ATOM   2023 O OE1   . GLN E 2 58 ? 60.534  58.371  38.626  1.00 26.68 ? 954 GLN A OE1   1 
ATOM   2024 N NE2   . GLN E 2 58 ? 59.867  59.995  40.043  1.00 25.51 ? 954 GLN A NE2   1 
ATOM   2025 N N     . ALA E 2 59 ? 62.125  53.708  40.794  1.00 31.30 ? 955 ALA A N     1 
ATOM   2026 C CA    . ALA E 2 59 ? 62.057  52.268  40.549  1.00 31.65 ? 955 ALA A CA    1 
ATOM   2027 C C     . ALA E 2 59 ? 62.498  51.556  41.822  1.00 32.63 ? 955 ALA A C     1 
ATOM   2028 O O     . ALA E 2 59 ? 61.971  50.502  42.189  1.00 30.94 ? 955 ALA A O     1 
ATOM   2029 C CB    . ALA E 2 59 ? 62.975  51.887  39.402  1.00 32.05 ? 955 ALA A CB    1 
ATOM   2030 N N     . GLU E 2 60 ? 63.474  52.156  42.492  1.00 34.55 ? 956 GLU A N     1 
ATOM   2031 C CA    . GLU E 2 60 ? 64.024  51.622  43.728  1.00 36.89 ? 956 GLU A CA    1 
ATOM   2032 C C     . GLU E 2 60 ? 62.964  51.601  44.833  1.00 37.86 ? 956 GLU A C     1 
ATOM   2033 O O     . GLU E 2 60 ? 63.018  50.761  45.737  1.00 37.62 ? 956 GLU A O     1 
ATOM   2034 C CB    . GLU E 2 60 ? 65.217  52.477  44.143  1.00 39.11 ? 956 GLU A CB    1 
ATOM   2035 C CG    . GLU E 2 60 ? 66.194  51.820  45.084  1.00 42.15 ? 956 GLU A CG    1 
ATOM   2036 C CD    . GLU E 2 60 ? 67.479  52.623  45.211  1.00 44.18 ? 956 GLU A CD    1 
ATOM   2037 O OE1   . GLU E 2 60 ? 67.409  53.800  45.637  1.00 44.67 ? 956 GLU A OE1   1 
ATOM   2038 O OE2   . GLU E 2 60 ? 68.560  52.082  44.876  1.00 44.87 ? 956 GLU A OE2   1 
ATOM   2039 N N     . GLU E 2 61 ? 62.003  52.521  44.762  1.00 38.06 ? 957 GLU A N     1 
ATOM   2040 C CA    . GLU E 2 61 ? 60.935  52.572  45.756  1.00 38.84 ? 957 GLU A CA    1 
ATOM   2041 C C     . GLU E 2 61 ? 59.925  51.482  45.445  1.00 39.14 ? 957 GLU A C     1 
ATOM   2042 O O     . GLU E 2 61 ? 59.400  50.834  46.351  1.00 38.44 ? 957 GLU A O     1 
ATOM   2043 C CB    . GLU E 2 61 ? 60.220  53.928  45.747  1.00 40.17 ? 957 GLU A CB    1 
ATOM   2044 C CG    . GLU E 2 61 ? 59.030  53.973  46.704  1.00 41.42 ? 957 GLU A CG    1 
ATOM   2045 C CD    . GLU E 2 61 ? 58.213  55.249  46.603  1.00 42.54 ? 957 GLU A CD    1 
ATOM   2046 O OE1   . GLU E 2 61 ? 57.669  55.526  45.514  1.00 42.39 ? 957 GLU A OE1   1 
ATOM   2047 O OE2   . GLU E 2 61 ? 58.109  55.970  47.618  1.00 42.75 ? 957 GLU A OE2   1 
ATOM   2048 N N     . GLN E 2 62 ? 59.648  51.291  44.158  1.00 38.98 ? 958 GLN A N     1 
ATOM   2049 C CA    . GLN E 2 62 ? 58.700  50.274  43.727  1.00 39.91 ? 958 GLN A CA    1 
ATOM   2050 C C     . GLN E 2 62 ? 59.176  48.892  44.150  1.00 39.94 ? 958 GLN A C     1 
ATOM   2051 O O     . GLN E 2 62 ? 58.367  48.010  44.426  1.00 40.64 ? 958 GLN A O     1 
ATOM   2052 C CB    . GLN E 2 62 ? 58.521  50.308  42.206  1.00 40.24 ? 958 GLN A CB    1 
ATOM   2053 C CG    . GLN E 2 62 ? 57.829  51.549  41.694  1.00 40.95 ? 958 GLN A CG    1 
ATOM   2054 C CD    . GLN E 2 62 ? 56.423  51.688  42.241  1.00 41.15 ? 958 GLN A CD    1 
ATOM   2055 O OE1   . GLN E 2 62 ? 55.539  50.888  41.928  1.00 42.06 ? 958 GLN A OE1   1 
ATOM   2056 N NE2   . GLN E 2 62 ? 56.209  52.703  43.068  1.00 41.55 ? 958 GLN A NE2   1 
ATOM   2057 N N     . LYS E 2 63 ? 60.489  48.704  44.198  1.00 39.78 ? 959 LYS A N     1 
ATOM   2058 C CA    . LYS E 2 63 ? 61.043  47.418  44.595  1.00 40.43 ? 959 LYS A CA    1 
ATOM   2059 C C     . LYS E 2 63 ? 60.921  47.245  46.106  1.00 40.44 ? 959 LYS A C     1 
ATOM   2060 O O     . LYS E 2 63 ? 60.565  46.169  46.589  1.00 39.72 ? 959 LYS A O     1 
ATOM   2061 C CB    . LYS E 2 63 ? 62.514  47.323  44.196  1.00 40.72 ? 959 LYS A CB    1 
ATOM   2062 C CG    . LYS E 2 63 ? 63.107  45.941  44.404  1.00 41.45 ? 959 LYS A CG    1 
ATOM   2063 C CD    . LYS E 2 63 ? 64.622  45.991  44.515  1.00 41.99 ? 959 LYS A CD    1 
ATOM   2064 C CE    . LYS E 2 63 ? 65.050  46.585  45.854  1.00 42.28 ? 959 LYS A CE    1 
ATOM   2065 N NZ    . LYS E 2 63 ? 64.531  45.782  47.009  1.00 41.16 ? 959 LYS A NZ    1 
ATOM   2066 N N     . LEU E 2 64 ? 61.224  48.310  46.846  1.00 40.39 ? 960 LEU A N     1 
ATOM   2067 C CA    . LEU E 2 64 ? 61.154  48.278  48.303  1.00 40.42 ? 960 LEU A CA    1 
ATOM   2068 C C     . LEU E 2 64 ? 59.734  48.077  48.809  1.00 40.52 ? 960 LEU A C     1 
ATOM   2069 O O     . LEU E 2 64 ? 59.526  47.439  49.840  1.00 41.13 ? 960 LEU A O     1 
ATOM   2070 C CB    . LEU E 2 64 ? 61.717  49.568  48.894  1.00 40.32 ? 960 LEU A CB    1 
ATOM   2071 C CG    . LEU E 2 64 ? 63.192  49.856  48.640  1.00 40.86 ? 960 LEU A CG    1 
ATOM   2072 C CD1   . LEU E 2 64 ? 63.576  51.141  49.360  1.00 41.24 ? 960 LEU A CD1   1 
ATOM   2073 C CD2   . LEU E 2 64 ? 64.037  48.695  49.132  1.00 40.92 ? 960 LEU A CD2   1 
ATOM   2074 N N     . ILE E 2 65 ? 58.761  48.629  48.092  1.00 39.95 ? 961 ILE A N     1 
ATOM   2075 C CA    . ILE E 2 65 ? 57.365  48.484  48.480  1.00 39.97 ? 961 ILE A CA    1 
ATOM   2076 C C     . ILE E 2 65 ? 56.924  47.043  48.222  1.00 39.90 ? 961 ILE A C     1 
ATOM   2077 O O     . ILE E 2 65 ? 56.144  46.472  48.987  1.00 39.55 ? 961 ILE A O     1 
ATOM   2078 C CB    . ILE E 2 65 ? 56.453  49.455  47.685  1.00 40.60 ? 961 ILE A CB    1 
ATOM   2079 C CG1   . ILE E 2 65 ? 54.992  49.273  48.106  1.00 41.11 ? 961 ILE A CG1   1 
ATOM   2080 C CG2   . ILE E 2 65 ? 56.589  49.207  46.194  1.00 41.33 ? 961 ILE A CG2   1 
ATOM   2081 C CD1   . ILE E 2 65 ? 54.673  49.796  49.501  1.00 42.84 ? 961 ILE A CD1   1 
ATOM   2082 N N     . SER E 2 66 ? 57.431  46.455  47.145  1.00 39.09 ? 962 SER A N     1 
ATOM   2083 C CA    . SER E 2 66 ? 57.090  45.079  46.801  1.00 39.40 ? 962 SER A CA    1 
ATOM   2084 C C     . SER E 2 66 ? 57.679  44.127  47.840  1.00 39.21 ? 962 SER A C     1 
ATOM   2085 O O     . SER E 2 66 ? 57.044  43.145  48.229  1.00 38.69 ? 962 SER A O     1 
ATOM   2086 C CB    . SER E 2 66 ? 57.629  44.730  45.409  1.00 39.51 ? 962 SER A CB    1 
ATOM   2087 O OG    . SER E 2 66 ? 57.299  43.398  45.048  1.00 40.27 ? 962 SER A OG    1 
ATOM   2088 N N     . GLU E 2 67 ? 58.890  44.433  48.299  1.00 39.09 ? 963 GLU A N     1 
ATOM   2089 C CA    . GLU E 2 67 ? 59.560  43.600  49.290  1.00 39.73 ? 963 GLU A CA    1 
ATOM   2090 C C     . GLU E 2 67 ? 58.892  43.662  50.663  1.00 39.28 ? 963 GLU A C     1 
ATOM   2091 O O     . GLU E 2 67 ? 58.683  42.628  51.302  1.00 38.11 ? 963 GLU A O     1 
ATOM   2092 C CB    . GLU E 2 67 ? 61.034  43.998  49.411  1.00 40.77 ? 963 GLU A CB    1 
ATOM   2093 C CG    . GLU E 2 67 ? 61.790  43.209  50.469  1.00 43.20 ? 963 GLU A CG    1 
ATOM   2094 C CD    . GLU E 2 67 ? 63.284  43.470  50.455  1.00 44.24 ? 963 GLU A CD    1 
ATOM   2095 O OE1   . GLU E 2 67 ? 63.690  44.646  50.338  1.00 45.17 ? 963 GLU A OE1   1 
ATOM   2096 O OE2   . GLU E 2 67 ? 64.055  42.492  50.575  1.00 45.62 ? 963 GLU A OE2   1 
ATOM   2097 N N     . GLU E 2 68 ? 58.561  44.870  51.119  1.00 38.62 ? 964 GLU A N     1 
ATOM   2098 C CA    . GLU E 2 68 ? 57.910  45.036  52.416  1.00 37.98 ? 964 GLU A CA    1 
ATOM   2099 C C     . GLU E 2 68 ? 56.572  44.306  52.439  1.00 37.84 ? 964 GLU A C     1 
ATOM   2100 O O     . GLU E 2 68 ? 56.214  43.685  53.443  1.00 37.03 ? 964 GLU A O     1 
ATOM   2101 C CB    . GLU E 2 68 ? 57.694  46.523  52.735  1.00 38.34 ? 964 GLU A CB    1 
ATOM   2102 C CG    . GLU E 2 68 ? 56.988  46.763  54.068  1.00 38.21 ? 964 GLU A CG    1 
ATOM   2103 C CD    . GLU E 2 68 ? 56.948  48.227  54.478  1.00 39.27 ? 964 GLU A CD    1 
ATOM   2104 O OE1   . GLU E 2 68 ? 56.312  48.537  55.508  1.00 38.54 ? 964 GLU A OE1   1 
ATOM   2105 O OE2   . GLU E 2 68 ? 57.553  49.068  53.780  1.00 39.81 ? 964 GLU A OE2   1 
ATOM   2106 N N     . ASP E 2 69 ? 55.835  44.380  51.333  1.00 37.29 ? 965 ASP A N     1 
ATOM   2107 C CA    . ASP E 2 69 ? 54.545  43.714  51.235  1.00 37.38 ? 965 ASP A CA    1 
ATOM   2108 C C     . ASP E 2 69 ? 54.728  42.206  51.370  1.00 37.00 ? 965 ASP A C     1 
ATOM   2109 O O     . ASP E 2 69 ? 53.906  41.528  51.990  1.00 36.68 ? 965 ASP A O     1 
ATOM   2110 C CB    . ASP E 2 69 ? 53.879  44.022  49.895  1.00 40.52 ? 965 ASP A CB    1 
ATOM   2111 C CG    . ASP E 2 69 ? 52.532  43.334  49.741  1.00 42.16 ? 965 ASP A CG    1 
ATOM   2112 O OD1   . ASP E 2 69 ? 51.561  43.753  50.414  1.00 42.95 ? 965 ASP A OD1   1 
ATOM   2113 O OD2   . ASP E 2 69 ? 52.445  42.365  48.955  1.00 43.72 ? 965 ASP A OD2   1 
ATOM   2114 N N     . LEU E 2 70 ? 55.805  41.692  50.782  1.00 35.88 ? 966 LEU A N     1 
ATOM   2115 C CA    . LEU E 2 70 ? 56.128  40.265  50.832  1.00 35.41 ? 966 LEU A CA    1 
ATOM   2116 C C     . LEU E 2 70 ? 56.543  39.846  52.238  1.00 34.56 ? 966 LEU A C     1 
ATOM   2117 O O     . LEU E 2 70 ? 56.118  38.804  52.737  1.00 34.20 ? 966 LEU A O     1 
ATOM   2118 C CB    . LEU E 2 70 ? 57.269  39.946  49.860  1.00 35.94 ? 966 LEU A CB    1 
ATOM   2119 C CG    . LEU E 2 70 ? 56.951  39.806  48.367  1.00 37.04 ? 966 LEU A CG    1 
ATOM   2120 C CD1   . LEU E 2 70 ? 58.246  39.793  47.572  1.00 38.30 ? 966 LEU A CD1   1 
ATOM   2121 C CD2   . LEU E 2 70 ? 56.167  38.526  48.121  1.00 37.26 ? 966 LEU A CD2   1 
ATOM   2122 N N     . LEU E 2 71 ? 57.387  40.656  52.868  1.00 34.47 ? 967 LEU A N     1 
ATOM   2123 C CA    . LEU E 2 71 ? 57.850  40.369  54.220  1.00 35.04 ? 967 LEU A CA    1 
ATOM   2124 C C     . LEU E 2 71 ? 56.679  40.357  55.194  1.00 35.03 ? 967 LEU A C     1 
ATOM   2125 O O     . LEU E 2 71 ? 56.637  39.535  56.107  1.00 35.33 ? 967 LEU A O     1 
ATOM   2126 C CB    . LEU E 2 71 ? 58.888  41.405  54.666  1.00 35.42 ? 967 LEU A CB    1 
ATOM   2127 C CG    . LEU E 2 71 ? 60.242  41.358  53.947  1.00 37.09 ? 967 LEU A CG    1 
ATOM   2128 C CD1   . LEU E 2 71 ? 61.177  42.406  54.535  1.00 37.63 ? 967 LEU A CD1   1 
ATOM   2129 C CD2   . LEU E 2 71 ? 60.851  39.972  54.099  1.00 37.50 ? 967 LEU A CD2   1 
ATOM   2130 N N     . ARG E 2 72 ? 55.728  41.267  54.996  1.00 35.16 ? 968 ARG A N     1 
ATOM   2131 C CA    . ARG E 2 72 ? 54.560  41.338  55.868  1.00 36.31 ? 968 ARG A CA    1 
ATOM   2132 C C     . ARG E 2 72 ? 53.702  40.091  55.753  1.00 36.49 ? 968 ARG A C     1 
ATOM   2133 O O     . ARG E 2 72 ? 53.320  39.498  56.762  1.00 35.41 ? 968 ARG A O     1 
ATOM   2134 C CB    . ARG E 2 72 ? 53.716  42.573  55.547  1.00 37.20 ? 968 ARG A CB    1 
ATOM   2135 C CG    . ARG E 2 72 ? 54.329  43.866  56.040  1.00 37.95 ? 968 ARG A CG    1 
ATOM   2136 C CD    . ARG E 2 72 ? 53.439  45.069  55.735  1.00 39.73 ? 968 ARG A CD    1 
ATOM   2137 N NE    . ARG E 2 72 ? 54.031  46.287  56.275  1.00 39.65 ? 968 ARG A NE    1 
ATOM   2138 C CZ    . ARG E 2 72 ? 54.188  46.512  57.574  1.00 40.72 ? 968 ARG A CZ    1 
ATOM   2139 N NH1   . ARG E 2 72 ? 53.782  45.603  58.452  1.00 40.70 ? 968 ARG A NH1   1 
ATOM   2140 N NH2   . ARG E 2 72 ? 54.770  47.627  57.996  1.00 41.00 ? 968 ARG A NH2   1 
ATOM   2141 N N     . LYS E 2 73 ? 53.393  39.686  54.526  1.00 36.97 ? 969 LYS A N     1 
ATOM   2142 C CA    . LYS E 2 73 ? 52.584  38.494  54.340  1.00 37.82 ? 969 LYS A CA    1 
ATOM   2143 C C     . LYS E 2 73 ? 53.345  37.297  54.915  1.00 38.21 ? 969 LYS A C     1 
ATOM   2144 O O     . LYS E 2 73 ? 52.745  36.357  55.437  1.00 37.46 ? 969 LYS A O     1 
ATOM   2145 C CB    . LYS E 2 73 ? 52.289  38.267  52.857  1.00 38.80 ? 969 LYS A CB    1 
ATOM   2146 C CG    . LYS E 2 73 ? 51.249  37.186  52.603  1.00 39.77 ? 969 LYS A CG    1 
ATOM   2147 C CD    . LYS E 2 73 ? 51.032  36.950  51.116  1.00 41.65 ? 969 LYS A CD    1 
ATOM   2148 C CE    . LYS E 2 73 ? 50.035  35.820  50.868  1.00 42.30 ? 969 LYS A CE    1 
ATOM   2149 N NZ    . LYS E 2 73 ? 49.949  35.447  49.422  1.00 41.93 ? 969 LYS A NZ    1 
ATOM   2150 N N     . ARG E 2 74 ? 54.669  37.341  54.820  1.00 37.94 ? 970 ARG A N     1 
ATOM   2151 C CA    . ARG E 2 74 ? 55.503  36.261  55.338  1.00 38.58 ? 970 ARG A CA    1 
ATOM   2152 C C     . ARG E 2 74 ? 55.386  36.190  56.855  1.00 37.42 ? 970 ARG A C     1 
ATOM   2153 O O     . ARG E 2 74 ? 55.235  35.109  57.427  1.00 36.46 ? 970 ARG A O     1 
ATOM   2154 C CB    . ARG E 2 74 ? 56.967  36.487  54.962  1.00 40.03 ? 970 ARG A CB    1 
ATOM   2155 C CG    . ARG E 2 74 ? 57.932  35.488  55.589  1.00 41.78 ? 970 ARG A CG    1 
ATOM   2156 C CD    . ARG E 2 74 ? 57.791  34.097  54.975  1.00 43.65 ? 970 ARG A CD    1 
ATOM   2157 N NE    . ARG E 2 74 ? 58.703  33.126  55.579  1.00 45.73 ? 970 ARG A NE    1 
ATOM   2158 C CZ    . ARG E 2 74 ? 60.024  33.279  55.661  1.00 47.17 ? 970 ARG A CZ    1 
ATOM   2159 N NH1   . ARG E 2 74 ? 60.605  34.371  55.178  1.00 48.43 ? 970 ARG A NH1   1 
ATOM   2160 N NH2   . ARG E 2 74 ? 60.770  32.336  56.226  1.00 48.14 ? 970 ARG A NH2   1 
ATOM   2161 N N     . ARG E 2 75 ? 55.457  37.350  57.500  1.00 35.91 ? 971 ARG A N     1 
ATOM   2162 C CA    . ARG E 2 75 ? 55.368  37.417  58.950  1.00 34.92 ? 971 ARG A CA    1 
ATOM   2163 C C     . ARG E 2 75 ? 54.079  36.784  59.466  1.00 35.77 ? 971 ARG A C     1 
ATOM   2164 O O     . ARG E 2 75 ? 54.123  35.905  60.326  1.00 35.35 ? 971 ARG A O     1 
ATOM   2165 C CB    . ARG E 2 75 ? 55.457  38.866  59.422  1.00 32.58 ? 971 ARG A CB    1 
ATOM   2166 C CG    . ARG E 2 75 ? 55.512  39.003  60.927  1.00 30.45 ? 971 ARG A CG    1 
ATOM   2167 C CD    . ARG E 2 75 ? 55.578  40.454  61.348  1.00 29.82 ? 971 ARG A CD    1 
ATOM   2168 N NE    . ARG E 2 75 ? 54.382  41.190  60.957  1.00 28.19 ? 971 ARG A NE    1 
ATOM   2169 C CZ    . ARG E 2 75 ? 54.212  42.490  61.170  1.00 27.50 ? 971 ARG A CZ    1 
ATOM   2170 N NH1   . ARG E 2 75 ? 55.166  43.187  61.769  1.00 27.48 ? 971 ARG A NH1   1 
ATOM   2171 N NH2   . ARG E 2 75 ? 53.090  43.091  60.793  1.00 25.55 ? 971 ARG A NH2   1 
ATOM   2172 N N     . GLU E 2 76 ? 52.937  37.228  58.947  1.00 37.07 ? 972 GLU A N     1 
ATOM   2173 C CA    . GLU E 2 76 ? 51.655  36.672  59.376  1.00 38.50 ? 972 GLU A CA    1 
ATOM   2174 C C     . GLU E 2 76 ? 51.616  35.166  59.146  1.00 38.19 ? 972 GLU A C     1 
ATOM   2175 O O     . GLU E 2 76 ? 51.008  34.434  59.925  1.00 37.82 ? 972 GLU A O     1 
ATOM   2176 C CB    . GLU E 2 76 ? 50.486  37.329  58.634  1.00 39.48 ? 972 GLU A CB    1 
ATOM   2177 C CG    . GLU E 2 76 ? 50.266  38.787  58.988  1.00 41.78 ? 972 GLU A CG    1 
ATOM   2178 C CD    . GLU E 2 76 ? 50.199  39.031  60.488  1.00 43.59 ? 972 GLU A CD    1 
ATOM   2179 O OE1   . GLU E 2 76 ? 49.260  38.520  61.140  1.00 44.00 ? 972 GLU A OE1   1 
ATOM   2180 O OE2   . GLU E 2 76 ? 51.090  39.733  61.015  1.00 43.26 ? 972 GLU A OE2   1 
ATOM   2181 N N     . GLN E 2 77 ? 52.255  34.709  58.072  1.00 38.07 ? 973 GLN A N     1 
ATOM   2182 C CA    . GLN E 2 77 ? 52.302  33.281  57.770  1.00 38.36 ? 973 GLN A CA    1 
ATOM   2183 C C     . GLN E 2 77 ? 53.067  32.549  58.873  1.00 37.62 ? 973 GLN A C     1 
ATOM   2184 O O     . GLN E 2 77 ? 52.628  31.505  59.356  1.00 37.07 ? 973 GLN A O     1 
ATOM   2185 C CB    . GLN E 2 77 ? 52.978  33.033  56.414  1.00 40.04 ? 973 GLN A CB    1 
ATOM   2186 C CG    . GLN E 2 77 ? 52.135  33.432  55.203  1.00 42.43 ? 973 GLN A CG    1 
ATOM   2187 C CD    . GLN E 2 77 ? 52.865  33.234  53.876  1.00 44.05 ? 973 GLN A CD    1 
ATOM   2188 O OE1   . GLN E 2 77 ? 53.336  32.135  53.568  1.00 44.66 ? 973 GLN A OE1   1 
ATOM   2189 N NE2   . GLN E 2 77 ? 52.954  34.299  53.083  1.00 44.35 ? 973 GLN A NE2   1 
ATOM   2190 N N     . LEU E 2 78 ? 54.210  33.099  59.272  1.00 36.29 ? 974 LEU A N     1 
ATOM   2191 C CA    . LEU E 2 78 ? 55.009  32.489  60.329  1.00 35.44 ? 974 LEU A CA    1 
ATOM   2192 C C     . LEU E 2 78 ? 54.202  32.428  61.617  1.00 34.62 ? 974 LEU A C     1 
ATOM   2193 O O     . LEU E 2 78 ? 54.219  31.425  62.323  1.00 34.91 ? 974 LEU A O     1 
ATOM   2194 C CB    . LEU E 2 78 ? 56.297  33.282  60.570  1.00 35.30 ? 974 LEU A CB    1 
ATOM   2195 C CG    . LEU E 2 78 ? 57.489  33.024  59.641  1.00 36.12 ? 974 LEU A CG    1 
ATOM   2196 C CD1   . LEU E 2 78 ? 57.924  31.573  59.757  1.00 35.99 ? 974 LEU A CD1   1 
ATOM   2197 C CD2   . LEU E 2 78 ? 57.112  33.333  58.215  1.00 35.67 ? 974 LEU A CD2   1 
ATOM   2198 N N     . LYS E 2 79 ? 53.489  33.503  61.926  1.00 33.92 ? 975 LYS A N     1 
ATOM   2199 C CA    . LYS E 2 79 ? 52.681  33.519  63.137  1.00 32.94 ? 975 LYS A CA    1 
ATOM   2200 C C     . LYS E 2 79 ? 51.568  32.485  63.028  1.00 33.23 ? 975 LYS A C     1 
ATOM   2201 O O     . LYS E 2 79 ? 51.258  31.797  63.996  1.00 31.71 ? 975 LYS A O     1 
ATOM   2202 C CB    . LYS E 2 79 ? 52.094  34.910  63.377  1.00 32.33 ? 975 LYS A CB    1 
ATOM   2203 C CG    . LYS E 2 79 ? 53.129  35.946  63.776  1.00 32.09 ? 975 LYS A CG    1 
ATOM   2204 C CD    . LYS E 2 79 ? 52.460  37.214  64.273  1.00 32.62 ? 975 LYS A CD    1 
ATOM   2205 C CE    . LYS E 2 79 ? 53.473  38.196  64.839  1.00 32.46 ? 975 LYS A CE    1 
ATOM   2206 N NZ    . LYS E 2 79 ? 52.797  39.447  65.280  1.00 34.82 ? 975 LYS A NZ    1 
ATOM   2207 N N     . HIS E 2 80 ? 50.977  32.371  61.842  1.00 34.11 ? 976 HIS A N     1 
ATOM   2208 C CA    . HIS E 2 80 ? 49.904  31.409  61.610  1.00 35.90 ? 976 HIS A CA    1 
ATOM   2209 C C     . HIS E 2 80 ? 50.412  29.992  61.869  1.00 36.91 ? 976 HIS A C     1 
ATOM   2210 O O     . HIS E 2 80 ? 49.671  29.138  62.356  1.00 37.00 ? 976 HIS A O     1 
ATOM   2211 C CB    . HIS E 2 80 ? 49.394  31.526  60.170  1.00 37.58 ? 976 HIS A CB    1 
ATOM   2212 C CG    . HIS E 2 80 ? 48.259  30.603  59.846  1.00 38.28 ? 976 HIS A CG    1 
ATOM   2213 N ND1   . HIS E 2 80 ? 47.030  30.684  60.467  1.00 39.03 ? 976 HIS A ND1   1 
ATOM   2214 C CD2   . HIS E 2 80 ? 48.158  29.598  58.944  1.00 39.29 ? 976 HIS A CD2   1 
ATOM   2215 C CE1   . HIS E 2 80 ? 46.221  29.771  59.958  1.00 38.73 ? 976 HIS A CE1   1 
ATOM   2216 N NE2   . HIS E 2 80 ? 46.881  29.098  59.033  1.00 39.17 ? 976 HIS A NE2   1 
ATOM   2217 N N     . LYS E 2 81 ? 51.680  29.755  61.542  1.00 36.51 ? 977 LYS A N     1 
ATOM   2218 C CA    . LYS E 2 81 ? 52.309  28.451  61.737  1.00 36.53 ? 977 LYS A CA    1 
ATOM   2219 C C     . LYS E 2 81 ? 52.500  28.166  63.224  1.00 36.66 ? 977 LYS A C     1 
ATOM   2220 O O     . LYS E 2 81 ? 52.266  27.048  63.690  1.00 36.50 ? 977 LYS A O     1 
ATOM   2221 C CB    . LYS E 2 81 ? 53.670  28.423  61.035  1.00 37.55 ? 977 LYS A CB    1 
ATOM   2222 C CG    . LYS E 2 81 ? 54.424  27.109  61.142  1.00 37.58 ? 977 LYS A CG    1 
ATOM   2223 C CD    . LYS E 2 81 ? 53.745  26.001  60.360  1.00 38.48 ? 977 LYS A CD    1 
ATOM   2224 C CE    . LYS E 2 81 ? 54.605  24.737  60.356  1.00 39.20 ? 977 LYS A CE    1 
ATOM   2225 N NZ    . LYS E 2 81 ? 53.968  23.602  59.626  1.00 39.23 ? 977 LYS A NZ    1 
ATOM   2226 N N     . LEU E 2 82 ? 52.931  29.184  63.964  1.00 36.19 ? 978 LEU A N     1 
ATOM   2227 C CA    . LEU E 2 82 ? 53.155  29.043  65.396  1.00 35.17 ? 978 LEU A CA    1 
ATOM   2228 C C     . LEU E 2 82 ? 51.875  28.625  66.104  1.00 34.63 ? 978 LEU A C     1 
ATOM   2229 O O     . LEU E 2 82 ? 51.900  27.784  67.007  1.00 34.69 ? 978 LEU A O     1 
ATOM   2230 C CB    . LEU E 2 82 ? 53.667  30.359  65.983  1.00 35.65 ? 978 LEU A CB    1 
ATOM   2231 C CG    . LEU E 2 82 ? 55.069  30.803  65.560  1.00 36.31 ? 978 LEU A CG    1 
ATOM   2232 C CD1   . LEU E 2 82 ? 55.402  32.127  66.222  1.00 36.95 ? 978 LEU A CD1   1 
ATOM   2233 C CD2   . LEU E 2 82 ? 56.084  29.740  65.957  1.00 36.45 ? 978 LEU A CD2   1 
ATOM   2234 N N     . GLU E 2 83 ? 50.760  29.213  65.681  1.00 33.57 ? 979 GLU A N     1 
ATOM   2235 C CA    . GLU E 2 83 ? 49.452  28.923  66.259  1.00 32.46 ? 979 GLU A CA    1 
ATOM   2236 C C     . GLU E 2 83 ? 48.999  27.489  65.998  1.00 33.14 ? 979 GLU A C     1 
ATOM   2237 O O     . GLU E 2 83 ? 48.310  26.886  66.821  1.00 31.33 ? 979 GLU A O     1 
ATOM   2238 C CB    . GLU E 2 83 ? 48.424  29.901  65.693  1.00 32.35 ? 979 GLU A CB    1 
ATOM   2239 C CG    . GLU E 2 83 ? 48.797  31.353  65.949  1.00 32.84 ? 979 GLU A CG    1 
ATOM   2240 C CD    . GLU E 2 83 ? 48.009  32.338  65.110  1.00 32.03 ? 979 GLU A CD    1 
ATOM   2241 O OE1   . GLU E 2 83 ? 48.351  33.539  65.145  1.00 33.80 ? 979 GLU A OE1   1 
ATOM   2242 O OE2   . GLU E 2 83 ? 47.058  31.922  64.417  1.00 33.91 ? 979 GLU A OE2   1 
ATOM   2243 N N     . GLN E 2 84 ? 49.388  26.946  64.849  1.00 33.89 ? 980 GLN A N     1 
ATOM   2244 C CA    . GLN E 2 84 ? 49.018  25.587  64.483  1.00 35.34 ? 980 GLN A CA    1 
ATOM   2245 C C     . GLN E 2 84 ? 49.847  24.574  65.256  1.00 35.55 ? 980 GLN A C     1 
ATOM   2246 O O     . GLN E 2 84 ? 49.351  23.518  65.645  1.00 34.54 ? 980 GLN A O     1 
ATOM   2247 C CB    . GLN E 2 84 ? 49.226  25.365  62.983  1.00 36.70 ? 980 GLN A CB    1 
ATOM   2248 C CG    . GLN E 2 84 ? 48.544  26.392  62.097  1.00 39.60 ? 980 GLN A CG    1 
ATOM   2249 C CD    . GLN E 2 84 ? 48.788  26.143  60.616  1.00 41.30 ? 980 GLN A CD    1 
ATOM   2250 O OE1   . GLN E 2 84 ? 48.313  25.153  60.050  1.00 41.40 ? 980 GLN A OE1   1 
ATOM   2251 N NE2   . GLN E 2 84 ? 49.537  27.041  59.982  1.00 42.09 ? 980 GLN A NE2   1 
ATOM   2252 N N     . LEU E 2 85 ? 51.117  24.903  65.471  1.00 35.99 ? 981 LEU A N     1 
ATOM   2253 C CA    . LEU E 2 85 ? 52.033  24.018  66.179  1.00 36.27 ? 981 LEU A CA    1 
ATOM   2254 C C     . LEU E 2 85 ? 51.777  23.933  67.680  1.00 37.03 ? 981 LEU A C     1 
ATOM   2255 O O     . LEU E 2 85 ? 52.009  22.887  68.293  1.00 36.59 ? 981 LEU A O     1 
ATOM   2256 C CB    . LEU E 2 85 ? 53.473  24.470  65.937  1.00 36.12 ? 981 LEU A CB    1 
ATOM   2257 C CG    . LEU E 2 85 ? 53.924  24.443  64.474  1.00 36.03 ? 981 LEU A CG    1 
ATOM   2258 C CD1   . LEU E 2 85 ? 55.305  25.049  64.347  1.00 35.03 ? 981 LEU A CD1   1 
ATOM   2259 C CD2   . LEU E 2 85 ? 53.917  23.009  63.968  1.00 36.98 ? 981 LEU A CD2   1 
ATOM   2260 N N     . GLY E 2 86 ? 51.303  25.026  68.271  1.00 37.72 ? 982 GLY A N     1 
ATOM   2261 C CA    . GLY E 2 86 ? 51.055  25.033  69.702  1.00 39.63 ? 982 GLY A CA    1 
ATOM   2262 C C     . GLY E 2 86 ? 52.367  24.951  70.467  1.00 40.90 ? 982 GLY A C     1 
ATOM   2263 O O     . GLY E 2 86 ? 53.420  24.729  69.867  1.00 42.03 ? 982 GLY A O     1 
ATOM   2264 N N     . GLY E 2 87 ? 52.314  25.129  71.784  1.00 41.23 ? 983 GLY A N     1 
ATOM   2265 C CA    . GLY E 2 87 ? 53.526  25.071  72.588  1.00 42.61 ? 983 GLY A CA    1 
ATOM   2266 C C     . GLY E 2 87 ? 54.019  23.653  72.822  1.00 43.72 ? 983 GLY A C     1 
ATOM   2267 O O     . GLY E 2 87 ? 53.374  22.690  72.407  1.00 43.57 ? 983 GLY A O     1 
ATOM   2268 N N     . CYS E 2 88 ? 55.165  23.522  73.486  1.00 45.75 ? 984 CYS A N     1 
ATOM   2269 C CA    . CYS E 2 88 ? 55.738  22.209  73.773  1.00 47.41 ? 984 CYS A CA    1 
ATOM   2270 C C     . CYS E 2 88 ? 55.058  21.559  74.973  1.00 47.44 ? 984 CYS A C     1 
ATOM   2271 O O     . CYS E 2 88 ? 55.212  22.117  76.080  1.00 44.69 ? 984 CYS A O     1 
ATOM   2272 C CB    . CYS E 2 88 ? 57.239  22.328  74.044  1.00 51.17 ? 984 CYS A CB    1 
ATOM   2273 S SG    . CYS E 2 88 ? 58.205  22.933  72.642  1.00 47.79 ? 984 CYS A SG    1 
ATOM   2274 N N     . ASP F 3 1  ? 81.058  82.601  7.180   1.00 47.33 ? 202 ASP B N     1 
ATOM   2275 C CA    . ASP F 3 1  ? 80.996  81.163  6.788   1.00 46.49 ? 202 ASP B CA    1 
ATOM   2276 C C     . ASP F 3 1  ? 80.987  80.304  8.049   1.00 43.35 ? 202 ASP B C     1 
ATOM   2277 O O     . ASP F 3 1  ? 79.974  79.700  8.403   1.00 42.68 ? 202 ASP B O     1 
ATOM   2278 C CB    . ASP F 3 1  ? 82.207  80.811  5.917   1.00 50.16 ? 202 ASP B CB    1 
ATOM   2279 C CG    . ASP F 3 1  ? 82.026  79.508  5.176   1.00 53.26 ? 202 ASP B CG    1 
ATOM   2280 O OD1   . ASP F 3 1  ? 80.968  79.351  4.536   1.00 53.34 ? 202 ASP B OD1   1 
ATOM   2281 O OD2   . ASP F 3 1  ? 82.934  78.649  5.225   1.00 53.90 ? 202 ASP B OD2   1 
ATOM   2282 N N     . LYS F 3 2  ? 82.129  80.262  8.724   1.00 39.48 ? 203 LYS B N     1 
ATOM   2283 C CA    . LYS F 3 2  ? 82.276  79.501  9.953   1.00 35.69 ? 203 LYS B CA    1 
ATOM   2284 C C     . LYS F 3 2  ? 81.472  80.176  11.059  1.00 32.46 ? 203 LYS B C     1 
ATOM   2285 O O     . LYS F 3 2  ? 81.193  79.579  12.093  1.00 30.82 ? 203 LYS B O     1 
ATOM   2286 C CB    . LYS F 3 2  ? 83.753  79.440  10.349  1.00 36.96 ? 203 LYS B CB    1 
ATOM   2287 C CG    . LYS F 3 2  ? 84.620  78.653  9.383   1.00 36.96 ? 203 LYS B CG    1 
ATOM   2288 C CD    . LYS F 3 2  ? 86.079  79.062  9.475   1.00 37.98 ? 203 LYS B CD    1 
ATOM   2289 C CE    . LYS F 3 2  ? 86.625  78.958  10.887  1.00 38.22 ? 203 LYS B CE    1 
ATOM   2290 N NZ    . LYS F 3 2  ? 88.083  79.302  10.922  1.00 37.96 ? 203 LYS B NZ    1 
ATOM   2291 N N     . ARG F 3 3  ? 81.101  81.428  10.822  1.00 29.99 ? 204 ARG B N     1 
ATOM   2292 C CA    . ARG F 3 3  ? 80.336  82.203  11.788  1.00 27.48 ? 204 ARG B CA    1 
ATOM   2293 C C     . ARG F 3 3  ? 78.899  81.676  11.886  1.00 25.24 ? 204 ARG B C     1 
ATOM   2294 O O     . ARG F 3 3  ? 78.417  81.376  12.975  1.00 23.11 ? 204 ARG B O     1 
ATOM   2295 C CB    . ARG F 3 3  ? 80.354  83.679  11.370  1.00 29.16 ? 204 ARG B CB    1 
ATOM   2296 C CG    . ARG F 3 3  ? 80.015  84.667  12.461  1.00 29.84 ? 204 ARG B CG    1 
ATOM   2297 C CD    . ARG F 3 3  ? 80.025  86.114  11.935  1.00 29.57 ? 204 ARG B CD    1 
ATOM   2298 N NE    . ARG F 3 3  ? 81.373  86.648  11.734  1.00 30.80 ? 204 ARG B NE    1 
ATOM   2299 C CZ    . ARG F 3 3  ? 81.970  86.818  10.554  1.00 30.48 ? 204 ARG B CZ    1 
ATOM   2300 N NH1   . ARG F 3 3  ? 81.350  86.499  9.423   1.00 29.72 ? 204 ARG B NH1   1 
ATOM   2301 N NH2   . ARG F 3 3  ? 83.197  87.315  10.508  1.00 29.45 ? 204 ARG B NH2   1 
ATOM   2302 N N     . ALA F 3 4  ? 78.222  81.552  10.745  1.00 22.84 ? 205 ALA B N     1 
ATOM   2303 C CA    . ALA F 3 4  ? 76.850  81.053  10.726  1.00 20.35 ? 205 ALA B CA    1 
ATOM   2304 C C     . ALA F 3 4  ? 76.802  79.603  11.202  1.00 19.33 ? 205 ALA B C     1 
ATOM   2305 O O     . ALA F 3 4  ? 75.843  79.193  11.849  1.00 17.67 ? 205 ALA B O     1 
ATOM   2306 C CB    . ALA F 3 4  ? 76.261  81.167  9.316   1.00 20.57 ? 205 ALA B CB    1 
ATOM   2307 N N     . HIS F 3 5  ? 77.840  78.833  10.882  1.00 17.90 ? 206 HIS B N     1 
ATOM   2308 C CA    . HIS F 3 5  ? 77.912  77.438  11.299  1.00 18.06 ? 206 HIS B CA    1 
ATOM   2309 C C     . HIS F 3 5  ? 78.010  77.380  12.821  1.00 16.84 ? 206 HIS B C     1 
ATOM   2310 O O     . HIS F 3 5  ? 77.222  76.697  13.473  1.00 17.42 ? 206 HIS B O     1 
ATOM   2311 C CB    . HIS F 3 5  ? 79.127  76.757  10.662  1.00 18.07 ? 206 HIS B CB    1 
ATOM   2312 C CG    . HIS F 3 5  ? 79.238  75.296  10.981  1.00 18.10 ? 206 HIS B CG    1 
ATOM   2313 N ND1   . HIS F 3 5  ? 78.210  74.405  10.752  1.00 19.00 ? 206 HIS B ND1   1 
ATOM   2314 C CD2   . HIS F 3 5  ? 80.253  74.572  11.509  1.00 19.28 ? 206 HIS B CD2   1 
ATOM   2315 C CE1   . HIS F 3 5  ? 78.589  73.193  11.128  1.00 19.37 ? 206 HIS B CE1   1 
ATOM   2316 N NE2   . HIS F 3 5  ? 79.824  73.268  11.590  1.00 18.18 ? 206 HIS B NE2   1 
ATOM   2317 N N     . HIS F 3 6  ? 78.974  78.103  13.385  1.00 17.05 ? 207 HIS B N     1 
ATOM   2318 C CA    . HIS F 3 6  ? 79.139  78.137  14.842  1.00 17.02 ? 207 HIS B CA    1 
ATOM   2319 C C     . HIS F 3 6  ? 77.806  78.520  15.491  1.00 16.33 ? 207 HIS B C     1 
ATOM   2320 O O     . HIS F 3 6  ? 77.384  77.896  16.468  1.00 16.12 ? 207 HIS B O     1 
ATOM   2321 C CB    . HIS F 3 6  ? 80.230  79.149  15.234  1.00 17.04 ? 207 HIS B CB    1 
ATOM   2322 C CG    . HIS F 3 6  ? 80.394  79.328  16.715  1.00 17.56 ? 207 HIS B CG    1 
ATOM   2323 N ND1   . HIS F 3 6  ? 80.532  78.268  17.585  1.00 19.51 ? 207 HIS B ND1   1 
ATOM   2324 C CD2   . HIS F 3 6  ? 80.451  80.446  17.476  1.00 18.71 ? 207 HIS B CD2   1 
ATOM   2325 C CE1   . HIS F 3 6  ? 80.662  78.725  18.819  1.00 20.64 ? 207 HIS B CE1   1 
ATOM   2326 N NE2   . HIS F 3 6  ? 80.615  80.044  18.781  1.00 17.71 ? 207 HIS B NE2   1 
ATOM   2327 N N     . ASN F 3 7  ? 77.128  79.526  14.944  1.00 16.08 ? 208 ASN B N     1 
ATOM   2328 C CA    . ASN F 3 7  ? 75.849  79.926  15.519  1.00 15.99 ? 208 ASN B CA    1 
ATOM   2329 C C     . ASN F 3 7  ? 74.834  78.788  15.505  1.00 15.16 ? 208 ASN B C     1 
ATOM   2330 O O     . ASN F 3 7  ? 74.098  78.606  16.470  1.00 15.16 ? 208 ASN B O     1 
ATOM   2331 C CB    . ASN F 3 7  ? 75.287  81.162  14.804  1.00 15.32 ? 208 ASN B CB    1 
ATOM   2332 C CG    . ASN F 3 7  ? 76.216  82.357  14.900  1.00 16.24 ? 208 ASN B CG    1 
ATOM   2333 O OD1   . ASN F 3 7  ? 77.067  82.422  15.784  1.00 16.79 ? 208 ASN B OD1   1 
ATOM   2334 N ND2   . ASN F 3 7  ? 76.053  83.318  13.993  1.00 15.53 ? 208 ASN B ND2   1 
ATOM   2335 N N     . ALA F 3 8  ? 74.806  78.003  14.431  1.00 15.16 ? 209 ALA B N     1 
ATOM   2336 C CA    . ALA F 3 8  ? 73.875  76.875  14.346  1.00 15.16 ? 209 ALA B CA    1 
ATOM   2337 C C     . ALA F 3 8  ? 74.223  75.774  15.352  1.00 15.16 ? 209 ALA B C     1 
ATOM   2338 O O     . ALA F 3 8  ? 73.339  75.161  15.955  1.00 15.16 ? 209 ALA B O     1 
ATOM   2339 C CB    . ALA F 3 8  ? 73.863  76.295  12.923  1.00 15.57 ? 209 ALA B CB    1 
ATOM   2340 N N     . LEU F 3 9  ? 75.511  75.515  15.530  1.00 15.16 ? 210 LEU B N     1 
ATOM   2341 C CA    . LEU F 3 9  ? 75.931  74.496  16.475  1.00 15.16 ? 210 LEU B CA    1 
ATOM   2342 C C     . LEU F 3 9  ? 75.562  74.904  17.904  1.00 15.16 ? 210 LEU B C     1 
ATOM   2343 O O     . LEU F 3 9  ? 75.171  74.069  18.716  1.00 15.16 ? 210 LEU B O     1 
ATOM   2344 C CB    . LEU F 3 9  ? 77.439  74.270  16.360  1.00 16.54 ? 210 LEU B CB    1 
ATOM   2345 C CG    . LEU F 3 9  ? 77.908  73.545  15.095  1.00 18.55 ? 210 LEU B CG    1 
ATOM   2346 C CD1   . LEU F 3 9  ? 79.421  73.478  15.085  1.00 17.33 ? 210 LEU B CD1   1 
ATOM   2347 C CD2   . LEU F 3 9  ? 77.305  72.145  15.039  1.00 18.01 ? 210 LEU B CD2   1 
ATOM   2348 N N     . GLU F 3 10 ? 75.687  76.194  18.208  1.00 15.16 ? 211 GLU B N     1 
ATOM   2349 C CA    . GLU F 3 10 ? 75.356  76.679  19.551  1.00 15.16 ? 211 GLU B CA    1 
ATOM   2350 C C     . GLU F 3 10 ? 73.851  76.598  19.770  1.00 15.16 ? 211 GLU B C     1 
ATOM   2351 O O     . GLU F 3 10 ? 73.400  76.234  20.852  1.00 15.16 ? 211 GLU B O     1 
ATOM   2352 C CB    . GLU F 3 10 ? 75.859  78.116  19.740  1.00 17.33 ? 211 GLU B CB    1 
ATOM   2353 C CG    . GLU F 3 10 ? 75.394  78.797  21.039  1.00 16.78 ? 211 GLU B CG    1 
ATOM   2354 C CD    . GLU F 3 10 ? 75.947  78.149  22.309  1.00 17.68 ? 211 GLU B CD    1 
ATOM   2355 O OE1   . GLU F 3 10 ? 76.811  77.248  22.212  1.00 17.95 ? 211 GLU B OE1   1 
ATOM   2356 O OE2   . GLU F 3 10 ? 75.516  78.560  23.410  1.00 18.52 ? 211 GLU B OE2   1 
ATOM   2357 N N     . ARG F 3 11 ? 73.061  76.940  18.753  1.00 15.16 ? 212 ARG B N     1 
ATOM   2358 C CA    . ARG F 3 11 ? 71.616  76.830  18.899  1.00 15.83 ? 212 ARG B CA    1 
ATOM   2359 C C     . ARG F 3 11 ? 71.241  75.371  19.143  1.00 15.97 ? 212 ARG B C     1 
ATOM   2360 O O     . ARG F 3 11 ? 70.372  75.072  19.966  1.00 15.16 ? 212 ARG B O     1 
ATOM   2361 C CB    . ARG F 3 11 ? 70.876  77.346  17.653  1.00 16.94 ? 212 ARG B CB    1 
ATOM   2362 C CG    . ARG F 3 11 ? 70.963  78.849  17.437  1.00 16.66 ? 212 ARG B CG    1 
ATOM   2363 C CD    . ARG F 3 11 ? 69.876  79.343  16.466  1.00 19.37 ? 212 ARG B CD    1 
ATOM   2364 N NE    . ARG F 3 11 ? 69.934  78.653  15.178  1.00 19.85 ? 212 ARG B NE    1 
ATOM   2365 C CZ    . ARG F 3 11 ? 70.791  78.941  14.201  1.00 16.77 ? 212 ARG B CZ    1 
ATOM   2366 N NH1   . ARG F 3 11 ? 71.679  79.923  14.338  1.00 17.27 ? 212 ARG B NH1   1 
ATOM   2367 N NH2   . ARG F 3 11 ? 70.773  78.219  13.088  1.00 17.01 ? 212 ARG B NH2   1 
ATOM   2368 N N     . LYS F 3 12 ? 71.887  74.455  18.420  1.00 16.00 ? 213 LYS B N     1 
ATOM   2369 C CA    . LYS F 3 12 ? 71.597  73.029  18.583  1.00 17.05 ? 213 LYS B CA    1 
ATOM   2370 C C     . LYS F 3 12 ? 71.943  72.565  19.996  1.00 15.16 ? 213 LYS B C     1 
ATOM   2371 O O     . LYS F 3 12 ? 71.203  71.792  20.616  1.00 15.16 ? 213 LYS B O     1 
ATOM   2372 C CB    . LYS F 3 12 ? 72.402  72.206  17.572  1.00 19.45 ? 213 LYS B CB    1 
ATOM   2373 C CG    . LYS F 3 12 ? 72.336  70.706  17.801  1.00 23.25 ? 213 LYS B CG    1 
ATOM   2374 C CD    . LYS F 3 12 ? 71.136  70.082  17.119  1.00 26.39 ? 213 LYS B CD    1 
ATOM   2375 C CE    . LYS F 3 12 ? 69.826  70.562  17.692  1.00 26.58 ? 213 LYS B CE    1 
ATOM   2376 N NZ    . LYS F 3 12 ? 68.723  70.356  16.707  1.00 29.96 ? 213 LYS B NZ    1 
ATOM   2377 N N     . ARG F 3 13 ? 73.085  73.032  20.492  1.00 15.16 ? 214 ARG B N     1 
ATOM   2378 C CA    . ARG F 3 13 ? 73.531  72.684  21.833  1.00 15.16 ? 214 ARG B CA    1 
ATOM   2379 C C     . ARG F 3 13 ? 72.498  73.144  22.865  1.00 15.16 ? 214 ARG B C     1 
ATOM   2380 O O     . ARG F 3 13 ? 72.160  72.396  23.780  1.00 15.16 ? 214 ARG B O     1 
ATOM   2381 C CB    . ARG F 3 13 ? 74.887  73.344  22.124  1.00 15.16 ? 214 ARG B CB    1 
ATOM   2382 C CG    . ARG F 3 13 ? 75.580  72.833  23.395  1.00 15.16 ? 214 ARG B CG    1 
ATOM   2383 C CD    . ARG F 3 13 ? 76.831  73.652  23.703  1.00 15.16 ? 214 ARG B CD    1 
ATOM   2384 N NE    . ARG F 3 13 ? 76.483  75.015  24.098  1.00 15.16 ? 214 ARG B NE    1 
ATOM   2385 C CZ    . ARG F 3 13 ? 76.004  75.359  25.292  1.00 15.16 ? 214 ARG B CZ    1 
ATOM   2386 N NH1   . ARG F 3 13 ? 75.818  74.442  26.229  1.00 16.89 ? 214 ARG B NH1   1 
ATOM   2387 N NH2   . ARG F 3 13 ? 75.693  76.631  25.546  1.00 16.61 ? 214 ARG B NH2   1 
ATOM   2388 N N     . ARG F 3 14 ? 71.996  74.372  22.715  1.00 15.16 ? 215 ARG B N     1 
ATOM   2389 C CA    . ARG F 3 14 ? 71.007  74.905  23.661  1.00 15.85 ? 215 ARG B CA    1 
ATOM   2390 C C     . ARG F 3 14 ? 69.711  74.103  23.568  1.00 16.11 ? 215 ARG B C     1 
ATOM   2391 O O     . ARG F 3 14 ? 69.053  73.858  24.578  1.00 15.16 ? 215 ARG B O     1 
ATOM   2392 C CB    . ARG F 3 14 ? 70.719  76.388  23.387  1.00 17.30 ? 215 ARG B CB    1 
ATOM   2393 C CG    . ARG F 3 14 ? 71.919  77.336  23.579  1.00 18.96 ? 215 ARG B CG    1 
ATOM   2394 C CD    . ARG F 3 14 ? 71.536  78.838  23.453  1.00 19.95 ? 215 ARG B CD    1 
ATOM   2395 N NE    . ARG F 3 14 ? 70.755  79.154  22.248  1.00 24.43 ? 215 ARG B NE    1 
ATOM   2396 C CZ    . ARG F 3 14 ? 71.181  79.895  21.224  1.00 25.59 ? 215 ARG B CZ    1 
ATOM   2397 N NH1   . ARG F 3 14 ? 72.403  80.435  21.215  1.00 27.12 ? 215 ARG B NH1   1 
ATOM   2398 N NH2   . ARG F 3 14 ? 70.381  80.090  20.187  1.00 30.18 ? 215 ARG B NH2   1 
ATOM   2399 N N     . ASP F 3 15 ? 69.355  73.693  22.352  1.00 16.41 ? 216 ASP B N     1 
ATOM   2400 C CA    . ASP F 3 15 ? 68.145  72.902  22.130  1.00 17.56 ? 216 ASP B CA    1 
ATOM   2401 C C     . ASP F 3 15 ? 68.228  71.584  22.907  1.00 16.60 ? 216 ASP B C     1 
ATOM   2402 O O     . ASP F 3 15 ? 67.250  71.156  23.513  1.00 15.16 ? 216 ASP B O     1 
ATOM   2403 C CB    . ASP F 3 15 ? 67.973  72.619  20.632  1.00 21.26 ? 216 ASP B CB    1 
ATOM   2404 C CG    . ASP F 3 15 ? 66.591  72.085  20.287  1.00 24.19 ? 216 ASP B CG    1 
ATOM   2405 O OD1   . ASP F 3 15 ? 65.579  72.706  20.686  1.00 26.91 ? 216 ASP B OD1   1 
ATOM   2406 O OD2   . ASP F 3 15 ? 66.522  71.048  19.598  1.00 27.30 ? 216 ASP B OD2   1 
ATOM   2407 N N     . HIS F 3 16 ? 69.389  70.930  22.874  1.00 15.16 ? 217 HIS B N     1 
ATOM   2408 C CA    . HIS F 3 16 ? 69.549  69.686  23.618  1.00 15.73 ? 217 HIS B CA    1 
ATOM   2409 C C     . HIS F 3 16 ? 69.337  69.940  25.108  1.00 15.55 ? 217 HIS B C     1 
ATOM   2410 O O     . HIS F 3 16 ? 68.742  69.121  25.810  1.00 15.16 ? 217 HIS B O     1 
ATOM   2411 C CB    . HIS F 3 16 ? 70.932  69.078  23.370  1.00 18.23 ? 217 HIS B CB    1 
ATOM   2412 C CG    . HIS F 3 16 ? 71.061  68.416  22.032  1.00 18.76 ? 217 HIS B CG    1 
ATOM   2413 N ND1   . HIS F 3 16 ? 70.163  67.467  21.589  1.00 20.19 ? 217 HIS B ND1   1 
ATOM   2414 C CD2   . HIS F 3 16 ? 71.959  68.581  21.031  1.00 17.58 ? 217 HIS B CD2   1 
ATOM   2415 C CE1   . HIS F 3 16 ? 70.501  67.079  20.371  1.00 20.01 ? 217 HIS B CE1   1 
ATOM   2416 N NE2   . HIS F 3 16 ? 71.586  67.740  20.009  1.00 18.99 ? 217 HIS B NE2   1 
ATOM   2417 N N     . ILE F 3 17 ? 69.817  71.078  25.594  1.00 15.16 ? 218 ILE B N     1 
ATOM   2418 C CA    . ILE F 3 17 ? 69.640  71.404  27.005  1.00 15.31 ? 218 ILE B CA    1 
ATOM   2419 C C     . ILE F 3 17 ? 68.155  71.643  27.290  1.00 15.16 ? 218 ILE B C     1 
ATOM   2420 O O     . ILE F 3 17 ? 67.660  71.285  28.350  1.00 16.26 ? 218 ILE B O     1 
ATOM   2421 C CB    . ILE F 3 17 ? 70.496  72.637  27.399  1.00 15.16 ? 218 ILE B CB    1 
ATOM   2422 C CG1   . ILE F 3 17 ? 71.947  72.190  27.615  1.00 15.93 ? 218 ILE B CG1   1 
ATOM   2423 C CG2   . ILE F 3 17 ? 69.939  73.298  28.680  1.00 16.38 ? 218 ILE B CG2   1 
ATOM   2424 C CD1   . ILE F 3 17 ? 72.941  73.346  27.679  1.00 15.16 ? 218 ILE B CD1   1 
ATOM   2425 N N     . LYS F 3 18 ? 67.442  72.221  26.327  1.00 16.76 ? 219 LYS B N     1 
ATOM   2426 C CA    . LYS F 3 18 ? 66.009  72.470  26.485  1.00 16.72 ? 219 LYS B CA    1 
ATOM   2427 C C     . LYS F 3 18 ? 65.259  71.134  26.623  1.00 16.47 ? 219 LYS B C     1 
ATOM   2428 O O     . LYS F 3 18 ? 64.376  70.979  27.483  1.00 15.16 ? 219 LYS B O     1 
ATOM   2429 C CB    . LYS F 3 18 ? 65.461  73.236  25.276  1.00 18.91 ? 219 LYS B CB    1 
ATOM   2430 C CG    . LYS F 3 18 ? 64.028  73.694  25.503  1.00 21.74 ? 219 LYS B CG    1 
ATOM   2431 C CD    . LYS F 3 18 ? 63.264  73.943  24.228  1.00 25.41 ? 219 LYS B CD    1 
ATOM   2432 C CE    . LYS F 3 18 ? 63.712  75.199  23.524  1.00 27.45 ? 219 LYS B CE    1 
ATOM   2433 N NZ    . LYS F 3 18 ? 62.734  75.570  22.460  1.00 31.63 ? 219 LYS B NZ    1 
ATOM   2434 N N     . ASP F 3 19 ? 65.613  70.175  25.766  1.00 15.16 ? 220 ASP B N     1 
ATOM   2435 C CA    . ASP F 3 19 ? 65.000  68.850  25.800  1.00 15.16 ? 220 ASP B CA    1 
ATOM   2436 C C     . ASP F 3 19 ? 65.305  68.195  27.142  1.00 15.33 ? 220 ASP B C     1 
ATOM   2437 O O     . ASP F 3 19 ? 64.453  67.559  27.758  1.00 15.16 ? 220 ASP B O     1 
ATOM   2438 C CB    . ASP F 3 19 ? 65.571  67.943  24.697  1.00 17.86 ? 220 ASP B CB    1 
ATOM   2439 C CG    . ASP F 3 19 ? 65.147  68.365  23.311  1.00 20.41 ? 220 ASP B CG    1 
ATOM   2440 O OD1   . ASP F 3 19 ? 64.195  69.163  23.214  1.00 22.50 ? 220 ASP B OD1   1 
ATOM   2441 O OD2   . ASP F 3 19 ? 65.761  67.889  22.326  1.00 20.89 ? 220 ASP B OD2   1 
ATOM   2442 N N     . SER F 3 20 ? 66.541  68.343  27.592  1.00 15.16 ? 221 SER B N     1 
ATOM   2443 C CA    . SER F 3 20 ? 66.924  67.721  28.850  1.00 15.18 ? 221 SER B CA    1 
ATOM   2444 C C     . SER F 3 20 ? 66.172  68.300  30.034  1.00 15.18 ? 221 SER B C     1 
ATOM   2445 O O     . SER F 3 20 ? 65.848  67.576  30.987  1.00 15.16 ? 221 SER B O     1 
ATOM   2446 C CB    . SER F 3 20 ? 68.434  67.825  29.056  1.00 15.88 ? 221 SER B CB    1 
ATOM   2447 O OG    . SER F 3 20 ? 69.106  66.973  28.146  1.00 17.55 ? 221 SER B OG    1 
ATOM   2448 N N     . PHE F 3 21 ? 65.880  69.597  29.984  1.00 16.89 ? 222 PHE B N     1 
ATOM   2449 C CA    . PHE F 3 21 ? 65.134  70.215  31.076  1.00 15.55 ? 222 PHE B CA    1 
ATOM   2450 C C     . PHE F 3 21 ? 63.744  69.604  31.089  1.00 17.48 ? 222 PHE B C     1 
ATOM   2451 O O     . PHE F 3 21 ? 63.209  69.295  32.153  1.00 16.33 ? 222 PHE B O     1 
ATOM   2452 C CB    . PHE F 3 21 ? 64.999  71.726  30.884  1.00 15.16 ? 222 PHE B CB    1 
ATOM   2453 C CG    . PHE F 3 21 ? 66.000  72.533  31.663  1.00 15.16 ? 222 PHE B CG    1 
ATOM   2454 C CD1   . PHE F 3 21 ? 67.089  73.106  31.032  1.00 15.16 ? 222 PHE B CD1   1 
ATOM   2455 C CD2   . PHE F 3 21 ? 65.849  72.710  33.032  1.00 15.16 ? 222 PHE B CD2   1 
ATOM   2456 C CE1   . PHE F 3 21 ? 68.025  73.852  31.755  1.00 17.48 ? 222 PHE B CE1   1 
ATOM   2457 C CE2   . PHE F 3 21 ? 66.772  73.450  33.763  1.00 15.16 ? 222 PHE B CE2   1 
ATOM   2458 C CZ    . PHE F 3 21 ? 67.865  74.021  33.120  1.00 15.16 ? 222 PHE B CZ    1 
ATOM   2459 N N     . HIS F 3 22 ? 63.161  69.439  29.901  1.00 17.53 ? 223 HIS B N     1 
ATOM   2460 C CA    . HIS F 3 22 ? 61.818  68.871  29.779  1.00 19.46 ? 223 HIS B CA    1 
ATOM   2461 C C     . HIS F 3 22 ? 61.754  67.431  30.321  1.00 19.07 ? 223 HIS B C     1 
ATOM   2462 O O     . HIS F 3 22 ? 60.776  67.033  30.966  1.00 19.55 ? 223 HIS B O     1 
ATOM   2463 C CB    . HIS F 3 22 ? 61.373  68.912  28.313  1.00 22.37 ? 223 HIS B CB    1 
ATOM   2464 C CG    . HIS F 3 22 ? 59.886  68.928  28.130  1.00 26.44 ? 223 HIS B CG    1 
ATOM   2465 N ND1   . HIS F 3 22 ? 59.052  67.999  28.717  1.00 27.93 ? 223 HIS B ND1   1 
ATOM   2466 C CD2   . HIS F 3 22 ? 59.083  69.757  27.421  1.00 26.98 ? 223 HIS B CD2   1 
ATOM   2467 C CE1   . HIS F 3 22 ? 57.801  68.257  28.378  1.00 28.41 ? 223 HIS B CE1   1 
ATOM   2468 N NE2   . HIS F 3 22 ? 57.793  69.319  27.592  1.00 29.58 ? 223 HIS B NE2   1 
ATOM   2469 N N     . SER F 3 23 ? 62.795  66.645  30.064  1.00 18.55 ? 224 SER B N     1 
ATOM   2470 C CA    . SER F 3 23 ? 62.829  65.271  30.552  1.00 17.49 ? 224 SER B CA    1 
ATOM   2471 C C     . SER F 3 23 ? 63.002  65.232  32.069  1.00 17.42 ? 224 SER B C     1 
ATOM   2472 O O     . SER F 3 23 ? 62.513  64.313  32.729  1.00 17.01 ? 224 SER B O     1 
ATOM   2473 C CB    . SER F 3 23 ? 63.963  64.494  29.884  1.00 18.94 ? 224 SER B CB    1 
ATOM   2474 O OG    . SER F 3 23 ? 63.694  64.350  28.507  1.00 19.95 ? 224 SER B OG    1 
ATOM   2475 N N     . LEU F 3 24 ? 63.710  66.223  32.609  1.00 16.20 ? 225 LEU B N     1 
ATOM   2476 C CA    . LEU F 3 24 ? 63.928  66.320  34.058  1.00 17.14 ? 225 LEU B CA    1 
ATOM   2477 C C     . LEU F 3 24 ? 62.578  66.688  34.688  1.00 17.39 ? 225 LEU B C     1 
ATOM   2478 O O     . LEU F 3 24 ? 62.121  66.073  35.659  1.00 16.01 ? 225 LEU B O     1 
ATOM   2479 C CB    . LEU F 3 24 ? 64.941  67.430  34.375  1.00 16.43 ? 225 LEU B CB    1 
ATOM   2480 C CG    . LEU F 3 24 ? 65.789  67.261  35.640  1.00 19.67 ? 225 LEU B CG    1 
ATOM   2481 C CD1   . LEU F 3 24 ? 66.300  68.615  36.107  1.00 15.16 ? 225 LEU B CD1   1 
ATOM   2482 C CD2   . LEU F 3 24 ? 65.007  66.562  36.721  1.00 18.96 ? 225 LEU B CD2   1 
ATOM   2483 N N     . ARG F 3 25 ? 61.955  67.714  34.119  1.00 18.09 ? 226 ARG B N     1 
ATOM   2484 C CA    . ARG F 3 25 ? 60.650  68.196  34.561  1.00 20.13 ? 226 ARG B CA    1 
ATOM   2485 C C     . ARG F 3 25 ? 59.665  67.034  34.630  1.00 20.54 ? 226 ARG B C     1 
ATOM   2486 O O     . ARG F 3 25 ? 58.895  66.919  35.587  1.00 19.46 ? 226 ARG B O     1 
ATOM   2487 C CB    . ARG F 3 25 ? 60.147  69.264  33.573  1.00 22.58 ? 226 ARG B CB    1 
ATOM   2488 C CG    . ARG F 3 25 ? 58.646  69.575  33.618  1.00 26.34 ? 226 ARG B CG    1 
ATOM   2489 C CD    . ARG F 3 25 ? 58.265  70.546  32.498  1.00 30.47 ? 226 ARG B CD    1 
ATOM   2490 N NE    . ARG F 3 25 ? 56.821  70.783  32.394  1.00 33.50 ? 226 ARG B NE    1 
ATOM   2491 C CZ    . ARG F 3 25 ? 55.968  69.988  31.748  1.00 34.79 ? 226 ARG B CZ    1 
ATOM   2492 N NH1   . ARG F 3 25 ? 56.403  68.895  31.134  1.00 34.67 ? 226 ARG B NH1   1 
ATOM   2493 N NH2   . ARG F 3 25 ? 54.674  70.282  31.715  1.00 36.25 ? 226 ARG B NH2   1 
ATOM   2494 N N     . ASP F 3 26 ? 59.697  66.167  33.619  1.00 19.97 ? 227 ASP B N     1 
ATOM   2495 C CA    . ASP F 3 26 ? 58.797  65.018  33.584  1.00 20.98 ? 227 ASP B CA    1 
ATOM   2496 C C     . ASP F 3 26 ? 59.085  63.994  34.681  1.00 21.08 ? 227 ASP B C     1 
ATOM   2497 O O     . ASP F 3 26 ? 58.241  63.153  34.979  1.00 22.77 ? 227 ASP B O     1 
ATOM   2498 C CB    . ASP F 3 26 ? 58.873  64.317  32.222  1.00 21.61 ? 227 ASP B CB    1 
ATOM   2499 C CG    . ASP F 3 26 ? 58.134  65.067  31.130  1.00 22.74 ? 227 ASP B CG    1 
ATOM   2500 O OD1   . ASP F 3 26 ? 57.510  66.111  31.424  1.00 23.76 ? 227 ASP B OD1   1 
ATOM   2501 O OD2   . ASP F 3 26 ? 58.172  64.608  29.969  1.00 22.72 ? 227 ASP B OD2   1 
ATOM   2502 N N     . SER F 3 27 ? 60.264  64.065  35.294  1.00 21.12 ? 228 SER B N     1 
ATOM   2503 C CA    . SER F 3 27 ? 60.625  63.094  36.323  1.00 21.69 ? 228 SER B CA    1 
ATOM   2504 C C     . SER F 3 27 ? 60.196  63.438  37.745  1.00 21.06 ? 228 SER B C     1 
ATOM   2505 O O     . SER F 3 27 ? 60.164  62.560  38.608  1.00 21.60 ? 228 SER B O     1 
ATOM   2506 C CB    . SER F 3 27 ? 62.135  62.859  36.301  1.00 21.23 ? 228 SER B CB    1 
ATOM   2507 O OG    . SER F 3 27 ? 62.587  62.728  34.967  1.00 23.83 ? 228 SER B OG    1 
ATOM   2508 N N     . VAL F 3 28 ? 59.876  64.702  37.992  1.00 22.29 ? 229 VAL B N     1 
ATOM   2509 C CA    . VAL F 3 28 ? 59.467  65.136  39.324  1.00 22.79 ? 229 VAL B CA    1 
ATOM   2510 C C     . VAL F 3 28 ? 57.952  65.281  39.407  1.00 22.77 ? 229 VAL B C     1 
ATOM   2511 O O     . VAL F 3 28 ? 57.364  66.147  38.750  1.00 22.07 ? 229 VAL B O     1 
ATOM   2512 C CB    . VAL F 3 28 ? 60.148  66.473  39.693  1.00 23.57 ? 229 VAL B CB    1 
ATOM   2513 C CG1   . VAL F 3 28 ? 61.641  66.281  39.802  1.00 24.58 ? 229 VAL B CG1   1 
ATOM   2514 C CG2   . VAL F 3 28 ? 59.876  67.494  38.632  1.00 26.39 ? 229 VAL B CG2   1 
ATOM   2515 N N     . PRO F 3 29 ? 57.297  64.435  40.231  1.00 23.52 ? 230 PRO B N     1 
ATOM   2516 C CA    . PRO F 3 29 ? 55.845  64.451  40.406  1.00 23.75 ? 230 PRO B CA    1 
ATOM   2517 C C     . PRO F 3 29 ? 55.214  65.838  40.490  1.00 23.61 ? 230 PRO B C     1 
ATOM   2518 O O     . PRO F 3 29 ? 54.233  66.119  39.796  1.00 24.19 ? 230 PRO B O     1 
ATOM   2519 C CB    . PRO F 3 29 ? 55.648  63.632  41.679  1.00 24.12 ? 230 PRO B CB    1 
ATOM   2520 C CG    . PRO F 3 29 ? 56.725  62.600  41.562  1.00 23.47 ? 230 PRO B CG    1 
ATOM   2521 C CD    . PRO F 3 29 ? 57.912  63.445  41.139  1.00 23.41 ? 230 PRO B CD    1 
ATOM   2522 N N     . SER F 3 30 ? 55.785  66.703  41.319  1.00 24.09 ? 231 SER B N     1 
ATOM   2523 C CA    . SER F 3 30 ? 55.254  68.058  41.490  1.00 26.64 ? 231 SER B CA    1 
ATOM   2524 C C     . SER F 3 30 ? 55.343  68.978  40.281  1.00 26.80 ? 231 SER B C     1 
ATOM   2525 O O     . SER F 3 30 ? 54.669  70.010  40.248  1.00 26.00 ? 231 SER B O     1 
ATOM   2526 C CB    . SER F 3 30 ? 55.929  68.753  42.673  1.00 25.58 ? 231 SER B CB    1 
ATOM   2527 O OG    . SER F 3 30 ? 55.254  68.432  43.868  1.00 31.29 ? 231 SER B OG    1 
ATOM   2528 N N     . LEU F 3 31 ? 56.169  68.624  39.299  1.00 26.71 ? 232 LEU B N     1 
ATOM   2529 C CA    . LEU F 3 31 ? 56.311  69.465  38.115  1.00 28.14 ? 232 LEU B CA    1 
ATOM   2530 C C     . LEU F 3 31 ? 55.574  68.921  36.907  1.00 30.22 ? 232 LEU B C     1 
ATOM   2531 O O     . LEU F 3 31 ? 55.361  69.638  35.933  1.00 29.88 ? 232 LEU B O     1 
ATOM   2532 C CB    . LEU F 3 31 ? 57.785  69.655  37.760  1.00 27.78 ? 232 LEU B CB    1 
ATOM   2533 C CG    . LEU F 3 31 ? 58.637  70.499  38.708  1.00 26.82 ? 232 LEU B CG    1 
ATOM   2534 C CD1   . LEU F 3 31 ? 60.054  70.616  38.168  1.00 27.99 ? 232 LEU B CD1   1 
ATOM   2535 C CD2   . LEU F 3 31 ? 58.010  71.878  38.845  1.00 27.41 ? 232 LEU B CD2   1 
ATOM   2536 N N     . GLN F 3 32 ? 55.182  67.654  36.975  1.00 32.08 ? 233 GLN B N     1 
ATOM   2537 C CA    . GLN F 3 32 ? 54.475  67.014  35.875  1.00 34.84 ? 233 GLN B CA    1 
ATOM   2538 C C     . GLN F 3 32 ? 53.202  67.757  35.481  1.00 35.67 ? 233 GLN B C     1 
ATOM   2539 O O     . GLN F 3 32 ? 52.373  68.090  36.326  1.00 35.47 ? 233 GLN B O     1 
ATOM   2540 C CB    . GLN F 3 32 ? 54.166  65.554  36.234  1.00 35.15 ? 233 GLN B CB    1 
ATOM   2541 C CG    . GLN F 3 32 ? 55.381  64.637  36.101  1.00 36.36 ? 233 GLN B CG    1 
ATOM   2542 C CD    . GLN F 3 32 ? 55.173  63.256  36.700  1.00 37.16 ? 233 GLN B CD    1 
ATOM   2543 O OE1   . GLN F 3 32 ? 54.075  62.702  36.659  1.00 37.46 ? 233 GLN B OE1   1 
ATOM   2544 N NE2   . GLN F 3 32 ? 56.239  62.688  37.249  1.00 35.99 ? 233 GLN B NE2   1 
ATOM   2545 N N     . GLY F 3 33 ? 53.069  68.029  34.186  1.00 37.41 ? 234 GLY B N     1 
ATOM   2546 C CA    . GLY F 3 33 ? 51.901  68.735  33.690  1.00 39.30 ? 234 GLY B CA    1 
ATOM   2547 C C     . GLY F 3 33 ? 51.736  70.122  34.286  1.00 40.36 ? 234 GLY B C     1 
ATOM   2548 O O     . GLY F 3 33 ? 50.624  70.649  34.346  1.00 40.78 ? 234 GLY B O     1 
ATOM   2549 N N     . GLU F 3 34 ? 52.842  70.721  34.719  1.00 40.53 ? 235 GLU B N     1 
ATOM   2550 C CA    . GLU F 3 34 ? 52.814  72.053  35.321  1.00 39.97 ? 235 GLU B CA    1 
ATOM   2551 C C     . GLU F 3 34 ? 53.728  73.025  34.581  1.00 38.41 ? 235 GLU B C     1 
ATOM   2552 O O     . GLU F 3 34 ? 54.472  72.632  33.681  1.00 39.82 ? 235 GLU B O     1 
ATOM   2553 C CB    . GLU F 3 34 ? 53.265  71.977  36.782  1.00 42.27 ? 235 GLU B CB    1 
ATOM   2554 C CG    . GLU F 3 34 ? 52.290  71.298  37.739  1.00 44.34 ? 235 GLU B CG    1 
ATOM   2555 C CD    . GLU F 3 34 ? 51.328  72.281  38.380  1.00 45.19 ? 235 GLU B CD    1 
ATOM   2556 O OE1   . GLU F 3 34 ? 51.797  73.311  38.908  1.00 47.11 ? 235 GLU B OE1   1 
ATOM   2557 O OE2   . GLU F 3 34 ? 50.107  72.023  38.368  1.00 45.88 ? 235 GLU B OE2   1 
ATOM   2558 N N     . LYS F 3 35 ? 53.664  74.296  34.967  1.00 34.07 ? 236 LYS B N     1 
ATOM   2559 C CA    . LYS F 3 35 ? 54.509  75.325  34.371  1.00 32.63 ? 236 LYS B CA    1 
ATOM   2560 C C     . LYS F 3 35 ? 55.555  75.742  35.402  1.00 30.20 ? 236 LYS B C     1 
ATOM   2561 O O     . LYS F 3 35 ? 55.210  76.067  36.541  1.00 31.74 ? 236 LYS B O     1 
ATOM   2562 C CB    . LYS F 3 35 ? 53.681  76.550  33.976  1.00 32.72 ? 236 LYS B CB    1 
ATOM   2563 C CG    . LYS F 3 35 ? 52.726  76.344  32.815  1.00 38.92 ? 236 LYS B CG    1 
ATOM   2564 C CD    . LYS F 3 35 ? 51.976  77.644  32.528  1.00 42.92 ? 236 LYS B CD    1 
ATOM   2565 C CE    . LYS F 3 35 ? 51.047  77.514  31.336  1.00 41.89 ? 236 LYS B CE    1 
ATOM   2566 N NZ    . LYS F 3 35 ? 50.311  78.789  31.091  1.00 46.19 ? 236 LYS B NZ    1 
ATOM   2567 N N     . ALA F 3 36 ? 56.826  75.726  35.005  1.00 28.71 ? 237 ALA B N     1 
ATOM   2568 C CA    . ALA F 3 36 ? 57.916  76.104  35.901  1.00 26.38 ? 237 ALA B CA    1 
ATOM   2569 C C     . ALA F 3 36 ? 59.122  76.634  35.125  1.00 24.63 ? 237 ALA B C     1 
ATOM   2570 O O     . ALA F 3 36 ? 59.391  76.189  34.016  1.00 24.99 ? 237 ALA B O     1 
ATOM   2571 C CB    . ALA F 3 36 ? 58.335  74.903  36.741  1.00 27.42 ? 237 ALA B CB    1 
ATOM   2572 N N     . SER F 3 37 ? 59.836  77.587  35.719  1.00 20.86 ? 238 SER B N     1 
ATOM   2573 C CA    . SER F 3 37 ? 61.021  78.161  35.097  1.00 18.21 ? 238 SER B CA    1 
ATOM   2574 C C     . SER F 3 37 ? 62.116  77.125  35.263  1.00 17.06 ? 238 SER B C     1 
ATOM   2575 O O     . SER F 3 37 ? 61.924  76.132  35.961  1.00 16.09 ? 238 SER B O     1 
ATOM   2576 C CB    . SER F 3 37 ? 61.448  79.442  35.809  1.00 18.20 ? 238 SER B CB    1 
ATOM   2577 O OG    . SER F 3 37 ? 61.906  79.169  37.126  1.00 17.15 ? 238 SER B OG    1 
ATOM   2578 N N     . ARG F 3 38 ? 63.255  77.354  34.625  1.00 16.45 ? 239 ARG B N     1 
ATOM   2579 C CA    . ARG F 3 38 ? 64.368  76.422  34.731  1.00 16.26 ? 239 ARG B CA    1 
ATOM   2580 C C     . ARG F 3 38 ? 64.938  76.416  36.138  1.00 17.27 ? 239 ARG B C     1 
ATOM   2581 O O     . ARG F 3 38 ? 65.412  75.388  36.616  1.00 15.16 ? 239 ARG B O     1 
ATOM   2582 C CB    . ARG F 3 38 ? 65.443  76.784  33.709  1.00 17.55 ? 239 ARG B CB    1 
ATOM   2583 C CG    . ARG F 3 38 ? 64.973  76.478  32.304  1.00 16.92 ? 239 ARG B CG    1 
ATOM   2584 C CD    . ARG F 3 38 ? 66.001  76.743  31.231  1.00 20.30 ? 239 ARG B CD    1 
ATOM   2585 N NE    . ARG F 3 38 ? 65.471  76.339  29.933  1.00 19.44 ? 239 ARG B NE    1 
ATOM   2586 C CZ    . ARG F 3 38 ? 66.193  76.268  28.821  1.00 20.44 ? 239 ARG B CZ    1 
ATOM   2587 N NH1   . ARG F 3 38 ? 67.478  76.573  28.855  1.00 19.21 ? 239 ARG B NH1   1 
ATOM   2588 N NH2   . ARG F 3 38 ? 65.623  75.895  27.679  1.00 19.67 ? 239 ARG B NH2   1 
ATOM   2589 N N     . ALA F 3 39 ? 64.888  77.567  36.801  1.00 16.21 ? 240 ALA B N     1 
ATOM   2590 C CA    . ALA F 3 39 ? 65.396  77.656  38.161  1.00 18.91 ? 240 ALA B CA    1 
ATOM   2591 C C     . ALA F 3 39 ? 64.514  76.799  39.064  1.00 18.65 ? 240 ALA B C     1 
ATOM   2592 O O     . ALA F 3 39 ? 65.015  76.050  39.899  1.00 17.87 ? 240 ALA B O     1 
ATOM   2593 C CB    . ALA F 3 39 ? 65.393  79.131  38.643  1.00 19.50 ? 240 ALA B CB    1 
ATOM   2594 N N     . GLN F 3 40 ? 63.199  76.899  38.885  1.00 18.88 ? 241 GLN B N     1 
ATOM   2595 C CA    . GLN F 3 40 ? 62.283  76.116  39.707  1.00 20.24 ? 241 GLN B CA    1 
ATOM   2596 C C     . GLN F 3 40 ? 62.467  74.627  39.438  1.00 18.91 ? 241 GLN B C     1 
ATOM   2597 O O     . GLN F 3 40 ? 62.396  73.812  40.361  1.00 18.57 ? 241 GLN B O     1 
ATOM   2598 C CB    . GLN F 3 40 ? 60.822  76.506  39.436  1.00 22.93 ? 241 GLN B CB    1 
ATOM   2599 C CG    . GLN F 3 40 ? 60.469  77.940  39.793  1.00 27.58 ? 241 GLN B CG    1 
ATOM   2600 C CD    . GLN F 3 40 ? 59.026  78.281  39.455  1.00 30.51 ? 241 GLN B CD    1 
ATOM   2601 O OE1   . GLN F 3 40 ? 58.601  78.170  38.303  1.00 32.14 ? 241 GLN B OE1   1 
ATOM   2602 N NE2   . GLN F 3 40 ? 58.265  78.700  40.462  1.00 33.13 ? 241 GLN B NE2   1 
ATOM   2603 N N     . ILE F 3 41 ? 62.720  74.266  38.181  1.00 18.09 ? 242 ILE B N     1 
ATOM   2604 C CA    . ILE F 3 41 ? 62.890  72.857  37.852  1.00 17.74 ? 242 ILE B CA    1 
ATOM   2605 C C     . ILE F 3 41 ? 64.105  72.264  38.558  1.00 18.06 ? 242 ILE B C     1 
ATOM   2606 O O     . ILE F 3 41 ? 64.027  71.163  39.111  1.00 17.72 ? 242 ILE B O     1 
ATOM   2607 C CB    . ILE F 3 41 ? 63.042  72.617  36.341  1.00 18.56 ? 242 ILE B CB    1 
ATOM   2608 C CG1   . ILE F 3 41 ? 61.774  73.052  35.599  1.00 18.79 ? 242 ILE B CG1   1 
ATOM   2609 C CG2   . ILE F 3 41 ? 63.299  71.122  36.087  1.00 16.22 ? 242 ILE B CG2   1 
ATOM   2610 C CD1   . ILE F 3 41 ? 61.899  72.972  34.066  1.00 19.49 ? 242 ILE B CD1   1 
ATOM   2611 N N     . LEU F 3 42 ? 65.218  72.986  38.532  1.00 17.01 ? 243 LEU B N     1 
ATOM   2612 C CA    . LEU F 3 42 ? 66.432  72.519  39.186  1.00 17.01 ? 243 LEU B CA    1 
ATOM   2613 C C     . LEU F 3 42 ? 66.189  72.452  40.699  1.00 18.62 ? 243 LEU B C     1 
ATOM   2614 O O     . LEU F 3 42 ? 66.496  71.442  41.338  1.00 18.47 ? 243 LEU B O     1 
ATOM   2615 C CB    . LEU F 3 42 ? 67.605  73.458  38.878  1.00 16.41 ? 243 LEU B CB    1 
ATOM   2616 C CG    . LEU F 3 42 ? 68.055  73.570  37.412  1.00 15.16 ? 243 LEU B CG    1 
ATOM   2617 C CD1   . LEU F 3 42 ? 69.109  74.649  37.244  1.00 16.51 ? 243 LEU B CD1   1 
ATOM   2618 C CD2   . LEU F 3 42 ? 68.620  72.222  36.963  1.00 17.96 ? 243 LEU B CD2   1 
ATOM   2619 N N     . ASP F 3 43 ? 65.620  73.515  41.265  1.00 18.63 ? 244 ASP B N     1 
ATOM   2620 C CA    . ASP F 3 43 ? 65.366  73.553  42.705  1.00 20.73 ? 244 ASP B CA    1 
ATOM   2621 C C     . ASP F 3 43 ? 64.414  72.463  43.195  1.00 20.09 ? 244 ASP B C     1 
ATOM   2622 O O     . ASP F 3 43 ? 64.649  71.845  44.237  1.00 21.25 ? 244 ASP B O     1 
ATOM   2623 C CB    . ASP F 3 43 ? 64.820  74.924  43.127  1.00 21.28 ? 244 ASP B CB    1 
ATOM   2624 C CG    . ASP F 3 43 ? 65.835  76.045  42.948  1.00 24.16 ? 244 ASP B CG    1 
ATOM   2625 O OD1   . ASP F 3 43 ? 67.058  75.783  42.984  1.00 25.40 ? 244 ASP B OD1   1 
ATOM   2626 O OD2   . ASP F 3 43 ? 65.408  77.203  42.785  1.00 26.42 ? 244 ASP B OD2   1 
ATOM   2627 N N     . LYS F 3 44 ? 63.336  72.226  42.457  1.00 20.21 ? 245 LYS B N     1 
ATOM   2628 C CA    . LYS F 3 44 ? 62.376  71.209  42.854  1.00 20.54 ? 245 LYS B CA    1 
ATOM   2629 C C     . LYS F 3 44 ? 62.979  69.813  42.675  1.00 20.42 ? 245 LYS B C     1 
ATOM   2630 O O     . LYS F 3 44 ? 62.703  68.899  43.456  1.00 19.35 ? 245 LYS B O     1 
ATOM   2631 C CB    . LYS F 3 44 ? 61.098  71.343  42.028  1.00 22.63 ? 245 LYS B CB    1 
ATOM   2632 C CG    . LYS F 3 44 ? 60.322  72.634  42.300  1.00 24.90 ? 245 LYS B CG    1 
ATOM   2633 C CD    . LYS F 3 44 ? 59.810  72.682  43.729  1.00 27.86 ? 245 LYS B CD    1 
ATOM   2634 C CE    . LYS F 3 44 ? 58.980  73.936  43.990  1.00 30.40 ? 245 LYS B CE    1 
ATOM   2635 N NZ    . LYS F 3 44 ? 58.434  73.934  45.382  1.00 31.08 ? 245 LYS B NZ    1 
ATOM   2636 N N     . ALA F 3 45 ? 63.801  69.645  41.642  1.00 19.59 ? 246 ALA B N     1 
ATOM   2637 C CA    . ALA F 3 45 ? 64.443  68.349  41.418  1.00 19.11 ? 246 ALA B CA    1 
ATOM   2638 C C     . ALA F 3 45 ? 65.343  68.043  42.606  1.00 20.51 ? 246 ALA B C     1 
ATOM   2639 O O     . ALA F 3 45 ? 65.381  66.909  43.103  1.00 20.87 ? 246 ALA B O     1 
ATOM   2640 C CB    . ALA F 3 45 ? 65.278  68.377  40.139  1.00 19.94 ? 246 ALA B CB    1 
ATOM   2641 N N     . THR F 3 46 ? 66.081  69.056  43.047  1.00 20.01 ? 247 THR B N     1 
ATOM   2642 C CA    . THR F 3 46 ? 66.982  68.912  44.178  1.00 20.98 ? 247 THR B CA    1 
ATOM   2643 C C     . THR F 3 46 ? 66.229  68.550  45.456  1.00 22.61 ? 247 THR B C     1 
ATOM   2644 O O     . THR F 3 46 ? 66.599  67.606  46.159  1.00 23.08 ? 247 THR B O     1 
ATOM   2645 C CB    . THR F 3 46 ? 67.787  70.209  44.415  1.00 21.01 ? 247 THR B CB    1 
ATOM   2646 O OG1   . THR F 3 46 ? 68.649  70.456  43.293  1.00 21.22 ? 247 THR B OG1   1 
ATOM   2647 C CG2   . THR F 3 46 ? 68.639  70.086  45.666  1.00 21.47 ? 247 THR B CG2   1 
ATOM   2648 N N     . GLU F 3 47 ? 65.164  69.278  45.764  1.00 23.49 ? 248 GLU B N     1 
ATOM   2649 C CA    . GLU F 3 47 ? 64.411  68.973  46.977  1.00 25.26 ? 248 GLU B CA    1 
ATOM   2650 C C     . GLU F 3 47 ? 63.784  67.580  46.908  1.00 25.15 ? 248 GLU B C     1 
ATOM   2651 O O     . GLU F 3 47 ? 63.736  66.861  47.908  1.00 24.83 ? 248 GLU B O     1 
ATOM   2652 C CB    . GLU F 3 47 ? 63.314  70.013  47.211  1.00 27.86 ? 248 GLU B CB    1 
ATOM   2653 C CG    . GLU F 3 47 ? 62.067  69.796  46.373  1.00 31.55 ? 248 GLU B CG    1 
ATOM   2654 C CD    . GLU F 3 47 ? 60.890  70.625  46.857  1.00 33.11 ? 248 GLU B CD    1 
ATOM   2655 O OE1   . GLU F 3 47 ? 59.806  70.509  46.248  1.00 34.57 ? 248 GLU B OE1   1 
ATOM   2656 O OE2   . GLU F 3 47 ? 61.051  71.386  47.840  1.00 32.73 ? 248 GLU B OE2   1 
ATOM   2657 N N     . TYR F 3 48 ? 63.310  67.200  45.726  1.00 23.62 ? 249 TYR B N     1 
ATOM   2658 C CA    . TYR F 3 48 ? 62.683  65.901  45.537  1.00 23.52 ? 249 TYR B CA    1 
ATOM   2659 C C     . TYR F 3 48 ? 63.679  64.749  45.704  1.00 23.79 ? 249 TYR B C     1 
ATOM   2660 O O     . TYR F 3 48 ? 63.306  63.664  46.161  1.00 24.89 ? 249 TYR B O     1 
ATOM   2661 C CB    . TYR F 3 48 ? 62.037  65.822  44.153  1.00 22.82 ? 249 TYR B CB    1 
ATOM   2662 C CG    . TYR F 3 48 ? 61.391  64.489  43.857  1.00 22.30 ? 249 TYR B CG    1 
ATOM   2663 C CD1   . TYR F 3 48 ? 60.235  64.086  44.531  1.00 22.20 ? 249 TYR B CD1   1 
ATOM   2664 C CD2   . TYR F 3 48 ? 61.936  63.623  42.912  1.00 21.73 ? 249 TYR B CD2   1 
ATOM   2665 C CE1   . TYR F 3 48 ? 59.641  62.854  44.269  1.00 22.47 ? 249 TYR B CE1   1 
ATOM   2666 C CE2   . TYR F 3 48 ? 61.350  62.391  42.644  1.00 21.30 ? 249 TYR B CE2   1 
ATOM   2667 C CZ    . TYR F 3 48 ? 60.206  62.012  43.323  1.00 21.94 ? 249 TYR B CZ    1 
ATOM   2668 O OH    . TYR F 3 48 ? 59.622  60.794  43.056  1.00 23.62 ? 249 TYR B OH    1 
ATOM   2669 N N     . ILE F 3 49 ? 64.938  64.973  45.336  1.00 23.66 ? 250 ILE B N     1 
ATOM   2670 C CA    . ILE F 3 49 ? 65.942  63.925  45.471  1.00 24.11 ? 250 ILE B CA    1 
ATOM   2671 C C     . ILE F 3 49 ? 66.299  63.712  46.938  1.00 24.49 ? 250 ILE B C     1 
ATOM   2672 O O     . ILE F 3 49 ? 66.528  62.587  47.366  1.00 23.61 ? 250 ILE B O     1 
ATOM   2673 C CB    . ILE F 3 49 ? 67.223  64.250  44.685  1.00 24.00 ? 250 ILE B CB    1 
ATOM   2674 C CG1   . ILE F 3 49 ? 66.962  64.108  43.185  1.00 22.94 ? 250 ILE B CG1   1 
ATOM   2675 C CG2   . ILE F 3 49 ? 68.341  63.308  45.100  1.00 24.20 ? 250 ILE B CG2   1 
ATOM   2676 C CD1   . ILE F 3 49 ? 68.172  64.450  42.314  1.00 23.32 ? 250 ILE B CD1   1 
ATOM   2677 N N     . GLN F 3 50 ? 66.347  64.790  47.709  1.00 24.70 ? 251 GLN B N     1 
ATOM   2678 C CA    . GLN F 3 50 ? 66.660  64.663  49.127  1.00 26.31 ? 251 GLN B CA    1 
ATOM   2679 C C     . GLN F 3 50 ? 65.494  63.933  49.769  1.00 25.93 ? 251 GLN B C     1 
ATOM   2680 O O     . GLN F 3 50 ? 65.680  62.958  50.492  1.00 26.08 ? 251 GLN B O     1 
ATOM   2681 C CB    . GLN F 3 50 ? 66.834  66.039  49.771  1.00 27.76 ? 251 GLN B CB    1 
ATOM   2682 C CG    . GLN F 3 50 ? 67.914  66.887  49.125  1.00 29.17 ? 251 GLN B CG    1 
ATOM   2683 C CD    . GLN F 3 50 ? 68.072  68.238  49.792  1.00 30.41 ? 251 GLN B CD    1 
ATOM   2684 O OE1   . GLN F 3 50 ? 68.669  68.350  50.865  1.00 31.94 ? 251 GLN B OE1   1 
ATOM   2685 N NE2   . GLN F 3 50 ? 67.525  69.269  49.169  1.00 30.27 ? 251 GLN B NE2   1 
ATOM   2686 N N     . TYR F 3 51 ? 64.287  64.411  49.486  1.00 26.27 ? 252 TYR B N     1 
ATOM   2687 C CA    . TYR F 3 51 ? 63.069  63.807  50.015  1.00 27.54 ? 252 TYR B CA    1 
ATOM   2688 C C     . TYR F 3 51 ? 62.981  62.304  49.722  1.00 27.72 ? 252 TYR B C     1 
ATOM   2689 O O     . TYR F 3 51 ? 62.656  61.512  50.608  1.00 27.48 ? 252 TYR B O     1 
ATOM   2690 C CB    . TYR F 3 51 ? 61.845  64.503  49.418  1.00 27.12 ? 252 TYR B CB    1 
ATOM   2691 C CG    . TYR F 3 51 ? 60.562  63.722  49.585  1.00 28.53 ? 252 TYR B CG    1 
ATOM   2692 C CD1   . TYR F 3 51 ? 59.888  63.697  50.808  1.00 29.17 ? 252 TYR B CD1   1 
ATOM   2693 C CD2   . TYR F 3 51 ? 60.023  63.003  48.520  1.00 28.79 ? 252 TYR B CD2   1 
ATOM   2694 C CE1   . TYR F 3 51 ? 58.707  62.974  50.960  1.00 28.74 ? 252 TYR B CE1   1 
ATOM   2695 C CE2   . TYR F 3 51 ? 58.848  62.280  48.659  1.00 28.61 ? 252 TYR B CE2   1 
ATOM   2696 C CZ    . TYR F 3 51 ? 58.194  62.269  49.880  1.00 28.99 ? 252 TYR B CZ    1 
ATOM   2697 O OH    . TYR F 3 51 ? 57.028  61.556  50.019  1.00 29.77 ? 252 TYR B OH    1 
ATOM   2698 N N     . MET F 3 52 ? 63.253  61.916  48.480  1.00 28.65 ? 253 MET B N     1 
ATOM   2699 C CA    . MET F 3 52 ? 63.185  60.507  48.094  1.00 30.39 ? 253 MET B CA    1 
ATOM   2700 C C     . MET F 3 52 ? 64.246  59.634  48.753  1.00 32.29 ? 253 MET B C     1 
ATOM   2701 O O     . MET F 3 52 ? 63.991  58.473  49.073  1.00 32.27 ? 253 MET B O     1 
ATOM   2702 C CB    . MET F 3 52 ? 63.281  60.359  46.572  1.00 29.46 ? 253 MET B CB    1 
ATOM   2703 C CG    . MET F 3 52 ? 62.011  60.727  45.829  1.00 29.11 ? 253 MET B CG    1 
ATOM   2704 S SD    . MET F 3 52 ? 60.570  59.784  46.383  1.00 29.05 ? 253 MET B SD    1 
ATOM   2705 C CE    . MET F 3 52 ? 60.747  58.282  45.408  1.00 28.33 ? 253 MET B CE    1 
ATOM   2706 N N     . ARG F 3 53 ? 65.436  60.185  48.962  1.00 34.68 ? 254 ARG B N     1 
ATOM   2707 C CA    . ARG F 3 53 ? 66.500  59.411  49.582  1.00 36.90 ? 254 ARG B CA    1 
ATOM   2708 C C     . ARG F 3 53 ? 66.205  59.165  51.055  1.00 37.42 ? 254 ARG B C     1 
ATOM   2709 O O     . ARG F 3 53 ? 66.679  58.189  51.627  1.00 37.65 ? 254 ARG B O     1 
ATOM   2710 C CB    . ARG F 3 53 ? 67.848  60.116  49.415  1.00 36.64 ? 254 ARG B CB    1 
ATOM   2711 C CG    . ARG F 3 53 ? 69.040  59.227  49.738  1.00 38.54 ? 254 ARG B CG    1 
ATOM   2712 C CD    . ARG F 3 53 ? 70.261  59.607  48.913  1.00 38.10 ? 254 ARG B CD    1 
ATOM   2713 N NE    . ARG F 3 53 ? 70.610  61.011  49.093  1.00 38.37 ? 254 ARG B NE    1 
ATOM   2714 C CZ    . ARG F 3 53 ? 70.620  61.912  48.115  1.00 38.83 ? 254 ARG B CZ    1 
ATOM   2715 N NH1   . ARG F 3 53 ? 70.301  61.562  46.874  1.00 38.72 ? 254 ARG B NH1   1 
ATOM   2716 N NH2   . ARG F 3 53 ? 70.949  63.165  48.378  1.00 38.26 ? 254 ARG B NH2   1 
ATOM   2717 N N     . ARG F 3 54 ? 65.418  60.043  51.669  1.00 38.54 ? 255 ARG B N     1 
ATOM   2718 C CA    . ARG F 3 54 ? 65.062  59.877  53.077  1.00 39.86 ? 255 ARG B CA    1 
ATOM   2719 C C     . ARG F 3 54 ? 63.799  59.017  53.164  1.00 38.98 ? 255 ARG B C     1 
ATOM   2720 O O     . ARG F 3 54 ? 63.511  58.417  54.197  1.00 39.63 ? 255 ARG B O     1 
ATOM   2721 C CB    . ARG F 3 54 ? 64.829  61.239  53.747  1.00 41.81 ? 255 ARG B CB    1 
ATOM   2722 C CG    . ARG F 3 54 ? 63.466  61.847  53.493  1.00 45.50 ? 255 ARG B CG    1 
ATOM   2723 C CD    . ARG F 3 54 ? 63.426  63.316  53.888  1.00 47.79 ? 255 ARG B CD    1 
ATOM   2724 N NE    . ARG F 3 54 ? 62.108  63.898  53.652  1.00 50.25 ? 255 ARG B NE    1 
ATOM   2725 C CZ    . ARG F 3 54 ? 61.894  65.181  53.375  1.00 51.72 ? 255 ARG B CZ    1 
ATOM   2726 N NH1   . ARG F 3 54 ? 62.915  66.024  53.295  1.00 52.27 ? 255 ARG B NH1   1 
ATOM   2727 N NH2   . ARG F 3 54 ? 60.658  65.619  53.171  1.00 52.27 ? 255 ARG B NH2   1 
ATOM   2728 N N     . LYS F 3 55 ? 63.055  58.950  52.065  1.00 37.36 ? 256 LYS B N     1 
ATOM   2729 C CA    . LYS F 3 55 ? 61.840  58.151  52.020  1.00 36.19 ? 256 LYS B CA    1 
ATOM   2730 C C     . LYS F 3 55 ? 62.199  56.675  51.840  1.00 35.88 ? 256 LYS B C     1 
ATOM   2731 O O     . LYS F 3 55 ? 61.647  55.802  52.513  1.00 34.41 ? 256 LYS B O     1 
ATOM   2732 C CB    . LYS F 3 55 ? 60.950  58.615  50.865  1.00 35.94 ? 256 LYS B CB    1 
ATOM   2733 C CG    . LYS F 3 55 ? 59.598  57.925  50.795  1.00 36.15 ? 256 LYS B CG    1 
ATOM   2734 C CD    . LYS F 3 55 ? 58.740  58.528  49.698  1.00 36.26 ? 256 LYS B CD    1 
ATOM   2735 C CE    . LYS F 3 55 ? 57.358  57.895  49.652  1.00 37.47 ? 256 LYS B CE    1 
ATOM   2736 N NZ    . LYS F 3 55 ? 56.551  58.455  48.537  1.00 38.51 ? 256 LYS B NZ    1 
ATOM   2737 N N     . ASN F 3 56 ? 63.126  56.398  50.928  1.00 35.41 ? 257 ASN B N     1 
ATOM   2738 C CA    . ASN F 3 56 ? 63.543  55.025  50.682  1.00 35.82 ? 257 ASN B CA    1 
ATOM   2739 C C     . ASN F 3 56 ? 64.343  54.492  51.860  1.00 36.07 ? 257 ASN B C     1 
ATOM   2740 O O     . ASN F 3 56 ? 64.244  53.313  52.201  1.00 35.88 ? 257 ASN B O     1 
ATOM   2741 C CB    . ASN F 3 56 ? 64.362  54.924  49.391  1.00 33.62 ? 257 ASN B CB    1 
ATOM   2742 C CG    . ASN F 3 56 ? 63.493  54.997  48.148  1.00 33.19 ? 257 ASN B CG    1 
ATOM   2743 O OD1   . ASN F 3 56 ? 62.312  54.647  48.187  1.00 32.16 ? 257 ASN B OD1   1 
ATOM   2744 N ND2   . ASN F 3 56 ? 64.078  55.433  47.031  1.00 33.37 ? 257 ASN B ND2   1 
ATOM   2745 N N     . HIS F 3 57 ? 65.129  55.362  52.483  1.00 37.02 ? 258 HIS B N     1 
ATOM   2746 C CA    . HIS F 3 57 ? 65.920  54.961  53.639  1.00 38.36 ? 258 HIS B CA    1 
ATOM   2747 C C     . HIS F 3 57 ? 64.968  54.455  54.719  1.00 38.37 ? 258 HIS B C     1 
ATOM   2748 O O     . HIS F 3 57 ? 65.253  53.466  55.396  1.00 38.37 ? 258 HIS B O     1 
ATOM   2749 C CB    . HIS F 3 57 ? 66.729  56.140  54.181  1.00 39.56 ? 258 HIS B CB    1 
ATOM   2750 C CG    . HIS F 3 57 ? 67.633  55.774  55.317  1.00 41.61 ? 258 HIS B CG    1 
ATOM   2751 N ND1   . HIS F 3 57 ? 68.645  54.846  55.192  1.00 41.38 ? 258 HIS B ND1   1 
ATOM   2752 C CD2   . HIS F 3 57 ? 67.670  56.200  56.603  1.00 41.75 ? 258 HIS B CD2   1 
ATOM   2753 C CE1   . HIS F 3 57 ? 69.265  54.715  56.351  1.00 42.54 ? 258 HIS B CE1   1 
ATOM   2754 N NE2   . HIS F 3 57 ? 68.693  55.526  57.224  1.00 41.88 ? 258 HIS B NE2   1 
ATOM   2755 N N     . THR F 3 58 ? 63.839  55.140  54.876  1.00 38.04 ? 259 THR B N     1 
ATOM   2756 C CA    . THR F 3 58 ? 62.836  54.746  55.862  1.00 38.01 ? 259 THR B CA    1 
ATOM   2757 C C     . THR F 3 58 ? 62.183  53.433  55.431  1.00 38.49 ? 259 THR B C     1 
ATOM   2758 O O     . THR F 3 58 ? 61.779  52.619  56.266  1.00 37.95 ? 259 THR B O     1 
ATOM   2759 C CB    . THR F 3 58 ? 61.744  55.832  56.016  1.00 38.07 ? 259 THR B CB    1 
ATOM   2760 O OG1   . THR F 3 58 ? 62.326  57.014  56.579  1.00 37.53 ? 259 THR B OG1   1 
ATOM   2761 C CG2   . THR F 3 58 ? 60.624  55.343  56.924  1.00 38.53 ? 259 THR B CG2   1 
ATOM   2762 N N     . HIS F 3 59 ? 62.079  53.235  54.122  1.00 38.72 ? 260 HIS B N     1 
ATOM   2763 C CA    . HIS F 3 59 ? 61.495  52.016  53.578  1.00 39.48 ? 260 HIS B CA    1 
ATOM   2764 C C     . HIS F 3 59 ? 62.370  50.820  53.935  1.00 39.60 ? 260 HIS B C     1 
ATOM   2765 O O     . HIS F 3 59 ? 61.877  49.777  54.371  1.00 39.07 ? 260 HIS B O     1 
ATOM   2766 C CB    . HIS F 3 59 ? 61.382  52.116  52.060  1.00 41.10 ? 260 HIS B CB    1 
ATOM   2767 C CG    . HIS F 3 59 ? 60.000  52.403  51.575  1.00 41.97 ? 260 HIS B CG    1 
ATOM   2768 N ND1   . HIS F 3 59 ? 58.945  51.544  51.790  1.00 42.36 ? 260 HIS B ND1   1 
ATOM   2769 C CD2   . HIS F 3 59 ? 59.498  53.452  50.882  1.00 42.77 ? 260 HIS B CD2   1 
ATOM   2770 C CE1   . HIS F 3 59 ? 57.852  52.050  51.250  1.00 43.47 ? 260 HIS B CE1   1 
ATOM   2771 N NE2   . HIS F 3 59 ? 58.160  53.208  50.692  1.00 43.67 ? 260 HIS B NE2   1 
ATOM   2772 N N     . GLN F 3 60 ? 63.674  50.982  53.738  1.00 39.17 ? 261 GLN B N     1 
ATOM   2773 C CA    . GLN F 3 60 ? 64.638  49.931  54.036  1.00 39.91 ? 261 GLN B CA    1 
ATOM   2774 C C     . GLN F 3 60 ? 64.638  49.677  55.543  1.00 40.19 ? 261 GLN B C     1 
ATOM   2775 O O     . GLN F 3 60 ? 64.761  48.542  55.996  1.00 40.15 ? 261 GLN B O     1 
ATOM   2776 C CB    . GLN F 3 60 ? 66.036  50.362  53.573  1.00 40.29 ? 261 GLN B CB    1 
ATOM   2777 C CG    . GLN F 3 60 ? 67.089  49.261  53.625  1.00 39.85 ? 261 GLN B CG    1 
ATOM   2778 C CD    . GLN F 3 60 ? 66.740  48.086  52.736  1.00 40.71 ? 261 GLN B CD    1 
ATOM   2779 O OE1   . GLN F 3 60 ? 66.563  48.237  51.525  1.00 41.28 ? 261 GLN B OE1   1 
ATOM   2780 N NE2   . GLN F 3 60 ? 66.637  46.904  53.333  1.00 41.22 ? 261 GLN B NE2   1 
ATOM   2781 N N     . GLN F 3 61 ? 64.484  50.753  56.307  1.00 40.13 ? 262 GLN B N     1 
ATOM   2782 C CA    . GLN F 3 61 ? 64.460  50.683  57.762  1.00 40.51 ? 262 GLN B CA    1 
ATOM   2783 C C     . GLN F 3 61 ? 63.305  49.805  58.249  1.00 39.98 ? 262 GLN B C     1 
ATOM   2784 O O     . GLN F 3 61 ? 63.463  49.018  59.186  1.00 39.16 ? 262 GLN B O     1 
ATOM   2785 C CB    . GLN F 3 61 ? 64.332  52.096  58.328  1.00 42.15 ? 262 GLN B CB    1 
ATOM   2786 C CG    . GLN F 3 61 ? 64.436  52.194  59.832  1.00 45.59 ? 262 GLN B CG    1 
ATOM   2787 C CD    . GLN F 3 61 ? 64.647  53.625  60.281  1.00 47.13 ? 262 GLN B CD    1 
ATOM   2788 O OE1   . GLN F 3 61 ? 65.665  54.243  59.958  1.00 47.75 ? 262 GLN B OE1   1 
ATOM   2789 N NE2   . GLN F 3 61 ? 63.683  54.165  61.021  1.00 47.85 ? 262 GLN B NE2   1 
ATOM   2790 N N     . ASP F 3 62 ? 62.149  49.937  57.606  1.00 39.33 ? 263 ASP B N     1 
ATOM   2791 C CA    . ASP F 3 62 ? 60.985  49.141  57.974  1.00 38.97 ? 263 ASP B CA    1 
ATOM   2792 C C     . ASP F 3 62 ? 61.173  47.706  57.497  1.00 38.71 ? 263 ASP B C     1 
ATOM   2793 O O     . ASP F 3 62 ? 60.706  46.765  58.137  1.00 38.07 ? 263 ASP B O     1 
ATOM   2794 C CB    . ASP F 3 62 ? 59.706  49.717  57.357  1.00 39.52 ? 263 ASP B CB    1 
ATOM   2795 C CG    . ASP F 3 62 ? 59.420  51.136  57.812  1.00 40.25 ? 263 ASP B CG    1 
ATOM   2796 O OD1   . ASP F 3 62 ? 59.661  51.447  58.995  1.00 40.80 ? 263 ASP B OD1   1 
ATOM   2797 O OD2   . ASP F 3 62 ? 58.934  51.939  56.989  1.00 41.17 ? 263 ASP B OD2   1 
ATOM   2798 N N     . ILE F 3 63 ? 61.865  47.548  56.372  1.00 38.33 ? 264 ILE B N     1 
ATOM   2799 C CA    . ILE F 3 63 ? 62.126  46.230  55.802  1.00 38.49 ? 264 ILE B CA    1 
ATOM   2800 C C     . ILE F 3 63 ? 63.064  45.404  56.670  1.00 38.90 ? 264 ILE B C     1 
ATOM   2801 O O     . ILE F 3 63 ? 62.815  44.222  56.917  1.00 38.27 ? 264 ILE B O     1 
ATOM   2802 C CB    . ILE F 3 63 ? 62.737  46.343  54.381  1.00 38.29 ? 264 ILE B CB    1 
ATOM   2803 C CG1   . ILE F 3 63 ? 61.633  46.673  53.371  1.00 38.05 ? 264 ILE B CG1   1 
ATOM   2804 C CG2   . ILE F 3 63 ? 63.447  45.046  54.004  1.00 37.35 ? 264 ILE B CG2   1 
ATOM   2805 C CD1   . ILE F 3 63 ? 62.124  46.825  51.945  1.00 39.81 ? 264 ILE B CD1   1 
ATOM   2806 N N     . ASP F 3 64 ? 64.148  46.021  57.127  1.00 38.83 ? 265 ASP B N     1 
ATOM   2807 C CA    . ASP F 3 64 ? 65.108  45.311  57.958  1.00 39.18 ? 265 ASP B CA    1 
ATOM   2808 C C     . ASP F 3 64 ? 64.481  44.901  59.284  1.00 39.48 ? 265 ASP B C     1 
ATOM   2809 O O     . ASP F 3 64 ? 64.842  43.870  59.855  1.00 38.67 ? 265 ASP B O     1 
ATOM   2810 C CB    . ASP F 3 64 ? 66.349  46.173  58.207  1.00 40.39 ? 265 ASP B CB    1 
ATOM   2811 C CG    . ASP F 3 64 ? 67.078  46.531  56.924  1.00 40.69 ? 265 ASP B CG    1 
ATOM   2812 O OD1   . ASP F 3 64 ? 67.131  45.682  56.009  1.00 41.09 ? 265 ASP B OD1   1 
ATOM   2813 O OD2   . ASP F 3 64 ? 67.610  47.659  56.834  1.00 42.09 ? 265 ASP B OD2   1 
ATOM   2814 N N     . ASP F 3 65 ? 63.546  45.706  59.779  1.00 38.98 ? 266 ASP B N     1 
ATOM   2815 C CA    . ASP F 3 65 ? 62.884  45.374  61.029  1.00 38.97 ? 266 ASP B CA    1 
ATOM   2816 C C     . ASP F 3 65 ? 62.086  44.096  60.808  1.00 38.11 ? 266 ASP B C     1 
ATOM   2817 O O     . ASP F 3 65 ? 62.186  43.148  61.584  1.00 37.27 ? 266 ASP B O     1 
ATOM   2818 C CB    . ASP F 3 65 ? 61.941  46.488  61.466  1.00 41.06 ? 266 ASP B CB    1 
ATOM   2819 C CG    . ASP F 3 65 ? 61.334  46.218  62.826  1.00 43.53 ? 266 ASP B CG    1 
ATOM   2820 O OD1   . ASP F 3 65 ? 62.072  46.290  63.834  1.00 44.66 ? 266 ASP B OD1   1 
ATOM   2821 O OD2   . ASP F 3 65 ? 60.124  45.919  62.888  1.00 44.96 ? 266 ASP B OD2   1 
ATOM   2822 N N     . LEU F 3 66 ? 61.292  44.077  59.743  1.00 37.41 ? 267 LEU B N     1 
ATOM   2823 C CA    . LEU F 3 66 ? 60.500  42.901  59.415  1.00 37.23 ? 267 LEU B CA    1 
ATOM   2824 C C     . LEU F 3 66 ? 61.456  41.725  59.239  1.00 37.86 ? 267 LEU B C     1 
ATOM   2825 O O     . LEU F 3 66 ? 61.137  40.588  59.591  1.00 37.26 ? 267 LEU B O     1 
ATOM   2826 C CB    . LEU F 3 66 ? 59.713  43.134  58.123  1.00 36.20 ? 267 LEU B CB    1 
ATOM   2827 C CG    . LEU F 3 66 ? 58.484  44.038  58.237  1.00 36.20 ? 267 LEU B CG    1 
ATOM   2828 C CD1   . LEU F 3 66 ? 57.960  44.372  56.857  1.00 34.98 ? 267 LEU B CD1   1 
ATOM   2829 C CD2   . LEU F 3 66 ? 57.408  43.338  59.057  1.00 34.27 ? 267 LEU B CD2   1 
ATOM   2830 N N     . LYS F 3 67 ? 62.632  42.011  58.688  1.00 37.60 ? 268 LYS B N     1 
ATOM   2831 C CA    . LYS F 3 67 ? 63.641  40.984  58.477  1.00 38.68 ? 268 LYS B CA    1 
ATOM   2832 C C     . LYS F 3 67 ? 64.045  40.350  59.804  1.00 38.64 ? 268 LYS B C     1 
ATOM   2833 O O     . LYS F 3 67 ? 64.163  39.129  59.907  1.00 38.69 ? 268 LYS B O     1 
ATOM   2834 C CB    . LYS F 3 67 ? 64.876  41.583  57.792  1.00 38.90 ? 268 LYS B CB    1 
ATOM   2835 C CG    . LYS F 3 67 ? 64.711  41.834  56.295  1.00 40.63 ? 268 LYS B CG    1 
ATOM   2836 C CD    . LYS F 3 67 ? 64.439  40.534  55.561  1.00 41.87 ? 268 LYS B CD    1 
ATOM   2837 C CE    . LYS F 3 67 ? 64.533  40.696  54.053  1.00 43.76 ? 268 LYS B CE    1 
ATOM   2838 N NZ    . LYS F 3 67 ? 64.278  39.396  53.356  1.00 43.47 ? 268 LYS B NZ    1 
ATOM   2839 N N     . ARG F 3 68 ? 64.261  41.184  60.816  1.00 39.01 ? 269 ARG B N     1 
ATOM   2840 C CA    . ARG F 3 68 ? 64.651  40.693  62.131  1.00 40.11 ? 269 ARG B CA    1 
ATOM   2841 C C     . ARG F 3 68 ? 63.498  39.932  62.777  1.00 39.55 ? 269 ARG B C     1 
ATOM   2842 O O     . ARG F 3 68 ? 63.714  38.986  63.533  1.00 37.83 ? 269 ARG B O     1 
ATOM   2843 C CB    . ARG F 3 68 ? 65.074  41.856  63.031  1.00 42.27 ? 269 ARG B CB    1 
ATOM   2844 C CG    . ARG F 3 68 ? 66.308  42.596  62.541  1.00 45.57 ? 269 ARG B CG    1 
ATOM   2845 C CD    . ARG F 3 68 ? 66.609  43.812  63.403  1.00 47.96 ? 269 ARG B CD    1 
ATOM   2846 N NE    . ARG F 3 68 ? 67.759  44.562  62.901  1.00 50.81 ? 269 ARG B NE    1 
ATOM   2847 C CZ    . ARG F 3 68 ? 68.218  45.686  63.445  1.00 51.86 ? 269 ARG B CZ    1 
ATOM   2848 N NH1   . ARG F 3 68 ? 67.628  46.200  64.514  1.00 52.49 ? 269 ARG B NH1   1 
ATOM   2849 N NH2   . ARG F 3 68 ? 69.272  46.298  62.920  1.00 53.56 ? 269 ARG B NH2   1 
ATOM   2850 N N     . GLN F 3 69 ? 62.274  40.352  62.477  1.00 38.37 ? 270 GLN B N     1 
ATOM   2851 C CA    . GLN F 3 69 ? 61.092  39.703  63.027  1.00 38.00 ? 270 GLN B CA    1 
ATOM   2852 C C     . GLN F 3 69 ? 60.885  38.306  62.462  1.00 36.50 ? 270 GLN B C     1 
ATOM   2853 O O     . GLN F 3 69 ? 60.676  37.355  63.213  1.00 36.11 ? 270 GLN B O     1 
ATOM   2854 C CB    . GLN F 3 69 ? 59.845  40.540  62.746  1.00 38.49 ? 270 GLN B CB    1 
ATOM   2855 C CG    . GLN F 3 69 ? 59.730  41.783  63.586  1.00 39.41 ? 270 GLN B CG    1 
ATOM   2856 C CD    . GLN F 3 69 ? 58.450  42.527  63.300  1.00 39.84 ? 270 GLN B CD    1 
ATOM   2857 O OE1   . GLN F 3 69 ? 57.361  41.960  63.367  1.00 40.54 ? 270 GLN B OE1   1 
ATOM   2858 N NE2   . GLN F 3 69 ? 58.571  43.803  62.974  1.00 40.33 ? 270 GLN B NE2   1 
ATOM   2859 N N     . ASN F 3 70 ? 60.926  38.189  61.139  1.00 35.15 ? 271 ASN B N     1 
ATOM   2860 C CA    . ASN F 3 70 ? 60.734  36.902  60.485  1.00 34.95 ? 271 ASN B CA    1 
ATOM   2861 C C     . ASN F 3 70 ? 61.822  35.901  60.834  1.00 35.65 ? 271 ASN B C     1 
ATOM   2862 O O     . ASN F 3 70 ? 61.557  34.701  60.922  1.00 36.64 ? 271 ASN B O     1 
ATOM   2863 C CB    . ASN F 3 70 ? 60.670  37.069  58.970  1.00 33.89 ? 271 ASN B CB    1 
ATOM   2864 C CG    . ASN F 3 70 ? 59.381  37.704  58.514  1.00 33.10 ? 271 ASN B CG    1 
ATOM   2865 O OD1   . ASN F 3 70 ? 58.450  37.883  59.303  1.00 32.35 ? 271 ASN B OD1   1 
ATOM   2866 N ND2   . ASN F 3 70 ? 59.309  38.042  57.232  1.00 32.90 ? 271 ASN B ND2   1 
ATOM   2867 N N     . ALA F 3 71 ? 63.042  36.389  61.038  1.00 35.28 ? 272 ALA B N     1 
ATOM   2868 C CA    . ALA F 3 71 ? 64.147  35.503  61.380  1.00 36.32 ? 272 ALA B CA    1 
ATOM   2869 C C     . ALA F 3 71 ? 63.923  34.860  62.748  1.00 36.52 ? 272 ALA B C     1 
ATOM   2870 O O     . ALA F 3 71 ? 64.200  33.673  62.929  1.00 36.51 ? 272 ALA B O     1 
ATOM   2871 C CB    . ALA F 3 71 ? 65.468  36.266  61.358  1.00 36.58 ? 272 ALA B CB    1 
ATOM   2872 N N     . LEU F 3 72 ? 63.421  35.644  63.702  1.00 37.22 ? 273 LEU B N     1 
ATOM   2873 C CA    . LEU F 3 72 ? 63.139  35.142  65.045  1.00 37.69 ? 273 LEU B CA    1 
ATOM   2874 C C     . LEU F 3 72 ? 62.001  34.135  64.989  1.00 39.00 ? 273 LEU B C     1 
ATOM   2875 O O     . LEU F 3 72 ? 62.096  33.044  65.552  1.00 38.87 ? 273 LEU B O     1 
ATOM   2876 C CB    . LEU F 3 72 ? 62.745  36.285  65.986  1.00 37.90 ? 273 LEU B CB    1 
ATOM   2877 C CG    . LEU F 3 72 ? 63.840  37.249  66.452  1.00 38.69 ? 273 LEU B CG    1 
ATOM   2878 C CD1   . LEU F 3 72 ? 63.262  38.231  67.465  1.00 36.80 ? 273 LEU B CD1   1 
ATOM   2879 C CD2   . LEU F 3 72 ? 64.981  36.457  67.079  1.00 37.99 ? 273 LEU B CD2   1 
ATOM   2880 N N     . LEU F 3 73 ? 60.917  34.510  64.315  1.00 39.68 ? 274 LEU B N     1 
ATOM   2881 C CA    . LEU F 3 73 ? 59.765  33.630  64.177  1.00 41.17 ? 274 LEU B CA    1 
ATOM   2882 C C     . LEU F 3 73 ? 60.224  32.300  63.582  1.00 42.50 ? 274 LEU B C     1 
ATOM   2883 O O     . LEU F 3 73 ? 59.791  31.231  64.018  1.00 42.63 ? 274 LEU B O     1 
ATOM   2884 C CB    . LEU F 3 73 ? 58.706  34.279  63.280  1.00 39.74 ? 274 LEU B CB    1 
ATOM   2885 C CG    . LEU F 3 73 ? 58.121  35.593  63.804  1.00 39.70 ? 274 LEU B CG    1 
ATOM   2886 C CD1   . LEU F 3 73 ? 57.123  36.162  62.800  1.00 39.06 ? 274 LEU B CD1   1 
ATOM   2887 C CD2   . LEU F 3 73 ? 57.445  35.347  65.144  1.00 39.22 ? 274 LEU B CD2   1 
ATOM   2888 N N     . GLU F 3 74 ? 61.103  32.373  62.586  1.00 44.07 ? 275 GLU B N     1 
ATOM   2889 C CA    . GLU F 3 74 ? 61.640  31.177  61.944  1.00 45.59 ? 275 GLU B CA    1 
ATOM   2890 C C     . GLU F 3 74 ? 62.344  30.317  62.991  1.00 46.30 ? 275 GLU B C     1 
ATOM   2891 O O     . GLU F 3 74 ? 62.319  29.088  62.921  1.00 46.56 ? 275 GLU B O     1 
ATOM   2892 C CB    . GLU F 3 74 ? 62.638  31.558  60.845  1.00 46.74 ? 275 GLU B CB    1 
ATOM   2893 C CG    . GLU F 3 74 ? 62.005  32.028  59.546  1.00 49.10 ? 275 GLU B CG    1 
ATOM   2894 C CD    . GLU F 3 74 ? 63.039  32.421  58.501  1.00 50.11 ? 275 GLU B CD    1 
ATOM   2895 O OE1   . GLU F 3 74 ? 64.009  31.657  58.308  1.00 50.81 ? 275 GLU B OE1   1 
ATOM   2896 O OE2   . GLU F 3 74 ? 62.876  33.487  57.867  1.00 52.00 ? 275 GLU B OE2   1 
ATOM   2897 N N     . GLN F 3 75 ? 62.976  30.975  63.959  1.00 46.58 ? 276 GLN B N     1 
ATOM   2898 C CA    . GLN F 3 75 ? 63.680  30.273  65.024  1.00 47.00 ? 276 GLN B CA    1 
ATOM   2899 C C     . GLN F 3 75 ? 62.665  29.493  65.846  1.00 46.38 ? 276 GLN B C     1 
ATOM   2900 O O     . GLN F 3 75 ? 62.849  28.306  66.116  1.00 46.47 ? 276 GLN B O     1 
ATOM   2901 C CB    . GLN F 3 75 ? 64.407  31.270  65.929  1.00 48.28 ? 276 GLN B CB    1 
ATOM   2902 C CG    . GLN F 3 75 ? 65.265  30.626  67.010  1.00 49.91 ? 276 GLN B CG    1 
ATOM   2903 C CD    . GLN F 3 75 ? 65.733  31.623  68.059  1.00 50.59 ? 276 GLN B CD    1 
ATOM   2904 O OE1   . GLN F 3 75 ? 66.272  32.682  67.735  1.00 51.21 ? 276 GLN B OE1   1 
ATOM   2905 N NE2   . GLN F 3 75 ? 65.533  31.281  69.328  1.00 51.35 ? 276 GLN B NE2   1 
ATOM   2906 N N     . GLN F 3 76 ? 61.593  30.173  66.240  1.00 45.24 ? 277 GLN B N     1 
ATOM   2907 C CA    . GLN F 3 76 ? 60.533  29.563  67.036  1.00 44.60 ? 277 GLN B CA    1 
ATOM   2908 C C     . GLN F 3 76 ? 59.907  28.367  66.324  1.00 44.71 ? 277 GLN B C     1 
ATOM   2909 O O     . GLN F 3 76 ? 59.863  27.264  66.867  1.00 44.67 ? 277 GLN B O     1 
ATOM   2910 C CB    . GLN F 3 76 ? 59.450  30.598  67.345  1.00 44.81 ? 277 GLN B CB    1 
ATOM   2911 C CG    . GLN F 3 76 ? 59.888  31.713  68.278  1.00 44.67 ? 277 GLN B CG    1 
ATOM   2912 C CD    . GLN F 3 76 ? 58.851  32.818  68.386  1.00 45.61 ? 277 GLN B CD    1 
ATOM   2913 O OE1   . GLN F 3 76 ? 58.595  33.539  67.421  1.00 45.83 ? 277 GLN B OE1   1 
ATOM   2914 N NE2   . GLN F 3 76 ? 58.247  32.954  69.562  1.00 44.88 ? 277 GLN B NE2   1 
ATOM   2915 N N     . VAL F 3 77 ? 59.417  28.590  65.110  1.00 44.67 ? 278 VAL B N     1 
ATOM   2916 C CA    . VAL F 3 77 ? 58.797  27.527  64.331  1.00 44.45 ? 278 VAL B CA    1 
ATOM   2917 C C     . VAL F 3 77 ? 59.712  26.316  64.276  1.00 45.37 ? 278 VAL B C     1 
ATOM   2918 O O     . VAL F 3 77 ? 59.249  25.176  64.238  1.00 45.77 ? 278 VAL B O     1 
ATOM   2919 C CB    . VAL F 3 77 ? 58.503  27.991  62.895  1.00 44.27 ? 278 VAL B CB    1 
ATOM   2920 C CG1   . VAL F 3 77 ? 58.006  26.824  62.063  1.00 42.99 ? 278 VAL B CG1   1 
ATOM   2921 C CG2   . VAL F 3 77 ? 57.467  29.110  62.916  1.00 43.33 ? 278 VAL B CG2   1 
ATOM   2922 N N     . ARG F 3 78 ? 61.015  26.575  64.274  1.00 45.85 ? 279 ARG B N     1 
ATOM   2923 C CA    . ARG F 3 78 ? 62.019  25.520  64.232  1.00 46.80 ? 279 ARG B CA    1 
ATOM   2924 C C     . ARG F 3 78 ? 61.932  24.745  65.544  1.00 46.60 ? 279 ARG B C     1 
ATOM   2925 O O     . ARG F 3 78 ? 61.580  23.566  65.568  1.00 46.85 ? 279 ARG B O     1 
ATOM   2926 C CB    . ARG F 3 78 ? 63.416  26.138  64.098  1.00 47.70 ? 279 ARG B CB    1 
ATOM   2927 C CG    . ARG F 3 78 ? 64.461  25.236  63.461  1.00 49.10 ? 279 ARG B CG    1 
ATOM   2928 C CD    . ARG F 3 78 ? 64.431  25.369  61.946  1.00 49.82 ? 279 ARG B CD    1 
ATOM   2929 N NE    . ARG F 3 78 ? 63.101  25.096  61.410  1.00 50.78 ? 279 ARG B NE    1 
ATOM   2930 C CZ    . ARG F 3 78 ? 62.760  25.253  60.135  1.00 51.25 ? 279 ARG B CZ    1 
ATOM   2931 N NH1   . ARG F 3 78 ? 63.654  25.688  59.255  1.00 51.46 ? 279 ARG B NH1   1 
ATOM   2932 N NH2   . ARG F 3 78 ? 61.527  24.969  59.740  1.00 51.68 ? 279 ARG B NH2   1 
ATOM   2933 N N     . ALA F 3 79 ? 62.249  25.437  66.634  1.00 46.57 ? 280 ALA B N     1 
ATOM   2934 C CA    . ALA F 3 79 ? 62.227  24.858  67.970  1.00 46.72 ? 280 ALA B CA    1 
ATOM   2935 C C     . ALA F 3 79 ? 60.809  24.727  68.507  1.00 46.77 ? 280 ALA B C     1 
ATOM   2936 O O     . ALA F 3 79 ? 60.519  25.167  69.621  1.00 47.44 ? 280 ALA B O     1 
ATOM   2937 C CB    . ALA F 3 79 ? 63.058  25.718  68.916  1.00 47.23 ? 280 ALA B CB    1 
ATOM   2938 N N     . LEU F 3 80 ? 59.926  24.131  67.714  1.00 46.24 ? 281 LEU B N     1 
ATOM   2939 C CA    . LEU F 3 80 ? 58.541  23.940  68.123  1.00 46.89 ? 281 LEU B CA    1 
ATOM   2940 C C     . LEU F 3 80 ? 57.930  22.866  67.228  1.00 48.38 ? 281 LEU B C     1 
ATOM   2941 O O     . LEU F 3 80 ? 58.354  22.690  66.085  1.00 45.91 ? 281 LEU B O     1 
ATOM   2942 C CB    . LEU F 3 80 ? 57.763  25.252  67.981  1.00 46.50 ? 281 LEU B CB    1 
ATOM   2943 C CG    . LEU F 3 80 ? 56.636  25.524  68.983  1.00 47.14 ? 281 LEU B CG    1 
ATOM   2944 C CD1   . LEU F 3 80 ? 57.229  25.685  70.376  1.00 47.61 ? 281 LEU B CD1   1 
ATOM   2945 C CD2   . LEU F 3 80 ? 55.876  26.785  68.590  1.00 48.47 ? 281 LEU B CD2   1 
ATOM   2946 N N     . GLY F 3 81 ? 56.948  22.141  67.753  1.00 49.18 ? 282 GLY B N     1 
ATOM   2947 C CA    . GLY F 3 81 ? 56.307  21.094  66.974  1.00 50.82 ? 282 GLY B CA    1 
ATOM   2948 C C     . GLY F 3 81 ? 55.620  20.031  67.816  1.00 50.37 ? 282 GLY B C     1 
ATOM   2949 O O     . GLY F 3 81 ? 54.660  20.314  68.540  1.00 48.98 ? 282 GLY B O     1 
ATOM   2950 N N     . GLY F 3 82 ? 56.103  18.798  67.712  1.00 49.04 ? 283 GLY B N     1 
ATOM   2951 C CA    . GLY F 3 82 ? 55.521  17.713  68.482  1.00 48.97 ? 283 GLY B CA    1 
ATOM   2952 C C     . GLY F 3 82 ? 56.522  17.152  69.477  1.00 49.36 ? 283 GLY B C     1 
ATOM   2953 O O     . GLY F 3 82 ? 56.689  15.935  69.592  1.00 49.63 ? 283 GLY B O     1 
ATOM   2954 N N     . CYS F 3 83 ? 57.187  18.054  70.194  1.00 50.29 ? 284 CYS B N     1 
ATOM   2955 C CA    . CYS F 3 83 ? 58.191  17.691  71.189  1.00 50.37 ? 284 CYS B CA    1 
ATOM   2956 C C     . CYS F 3 83 ? 57.739  16.523  72.063  1.00 49.34 ? 284 CYS B C     1 
ATOM   2957 O O     . CYS F 3 83 ? 56.511  16.286  72.132  1.00 44.52 ? 284 CYS B O     1 
ATOM   2958 C CB    . CYS F 3 83 ? 58.505  18.905  72.071  1.00 54.38 ? 284 CYS B CB    1 
ATOM   2959 S SG    . CYS F 3 83 ? 58.978  20.395  71.151  1.00 51.14 ? 284 CYS B SG    1 
ATOM   2960 N N     . MET G 2 3  ? 44.717  -7.030  95.519  1.00 41.76 ? 499 MET D N     1 
ATOM   2961 C CA    . MET G 2 3  ? 43.638  -6.178  94.942  1.00 40.30 ? 499 MET D CA    1 
ATOM   2962 C C     . MET G 2 3  ? 43.501  -4.859  95.694  1.00 38.92 ? 499 MET D C     1 
ATOM   2963 O O     . MET G 2 3  ? 43.337  -3.800  95.084  1.00 38.24 ? 499 MET D O     1 
ATOM   2964 C CB    . MET G 2 3  ? 42.298  -6.913  94.983  1.00 42.35 ? 499 MET D CB    1 
ATOM   2965 C CG    . MET G 2 3  ? 42.321  -8.293  94.364  1.00 43.83 ? 499 MET D CG    1 
ATOM   2966 S SD    . MET G 2 3  ? 43.199  -8.336  92.802  1.00 47.42 ? 499 MET D SD    1 
ATOM   2967 C CE    . MET G 2 3  ? 42.103  -7.380  91.751  1.00 46.02 ? 499 MET D CE    1 
ATOM   2968 N N     . ASN G 2 4  ? 43.561  -4.927  97.019  1.00 36.53 ? 500 ASN D N     1 
ATOM   2969 C CA    . ASN G 2 4  ? 43.432  -3.737  97.849  1.00 35.02 ? 500 ASN D CA    1 
ATOM   2970 C C     . ASN G 2 4  ? 44.520  -2.715  97.528  1.00 33.65 ? 500 ASN D C     1 
ATOM   2971 O O     . ASN G 2 4  ? 44.266  -1.509  97.516  1.00 32.31 ? 500 ASN D O     1 
ATOM   2972 C CB    . ASN G 2 4  ? 43.490  -4.124  99.329  1.00 36.14 ? 500 ASN D CB    1 
ATOM   2973 C CG    . ASN G 2 4  ? 43.076  -2.993  100.244 1.00 36.40 ? 500 ASN D CG    1 
ATOM   2974 O OD1   . ASN G 2 4  ? 41.974  -2.448  100.118 1.00 37.25 ? 500 ASN D OD1   1 
ATOM   2975 N ND2   . ASN G 2 4  ? 43.952  -2.631  101.174 1.00 37.34 ? 500 ASN D ND2   1 
ATOM   2976 N N     . VAL G 2 5  ? 45.727  -3.204  97.264  1.00 32.40 ? 501 VAL D N     1 
ATOM   2977 C CA    . VAL G 2 5  ? 46.859  -2.345  96.930  1.00 31.87 ? 501 VAL D CA    1 
ATOM   2978 C C     . VAL G 2 5  ? 46.573  -1.560  95.658  1.00 31.55 ? 501 VAL D C     1 
ATOM   2979 O O     . VAL G 2 5  ? 46.669  -0.332  95.646  1.00 30.32 ? 501 VAL D O     1 
ATOM   2980 C CB    . VAL G 2 5  ? 48.157  -3.169  96.719  1.00 32.09 ? 501 VAL D CB    1 
ATOM   2981 C CG1   . VAL G 2 5  ? 49.241  -2.294  96.095  1.00 32.10 ? 501 VAL D CG1   1 
ATOM   2982 C CG2   . VAL G 2 5  ? 48.639  -3.722  98.050  1.00 32.48 ? 501 VAL D CG2   1 
ATOM   2983 N N     . LYS G 2 6  ? 46.238  -2.280  94.590  1.00 30.70 ? 502 LYS D N     1 
ATOM   2984 C CA    . LYS G 2 6  ? 45.929  -1.664  93.303  1.00 30.55 ? 502 LYS D CA    1 
ATOM   2985 C C     . LYS G 2 6  ? 44.822  -0.637  93.474  1.00 30.14 ? 502 LYS D C     1 
ATOM   2986 O O     . LYS G 2 6  ? 44.907  0.472   92.945  1.00 28.57 ? 502 LYS D O     1 
ATOM   2987 C CB    . LYS G 2 6  ? 45.464  -2.722  92.301  1.00 32.58 ? 502 LYS D CB    1 
ATOM   2988 C CG    . LYS G 2 6  ? 46.543  -3.681  91.843  1.00 33.51 ? 502 LYS D CG    1 
ATOM   2989 C CD    . LYS G 2 6  ? 45.934  -4.796  91.003  1.00 35.48 ? 502 LYS D CD    1 
ATOM   2990 C CE    . LYS G 2 6  ? 46.962  -5.875  90.689  1.00 35.27 ? 502 LYS D CE    1 
ATOM   2991 N NZ    . LYS G 2 6  ? 46.342  -7.078  90.063  1.00 35.60 ? 502 LYS D NZ    1 
ATOM   2992 N N     . ARG G 2 7  ? 43.787  -1.024  94.217  1.00 29.38 ? 503 ARG D N     1 
ATOM   2993 C CA    . ARG G 2 7  ? 42.638  -0.161  94.475  1.00 29.00 ? 503 ARG D CA    1 
ATOM   2994 C C     . ARG G 2 7  ? 43.063  1.156   95.102  1.00 28.98 ? 503 ARG D C     1 
ATOM   2995 O O     . ARG G 2 7  ? 42.586  2.221   94.707  1.00 27.55 ? 503 ARG D O     1 
ATOM   2996 C CB    . ARG G 2 7  ? 41.640  -0.862  95.407  1.00 28.37 ? 503 ARG D CB    1 
ATOM   2997 C CG    . ARG G 2 7  ? 40.403  -0.024  95.740  1.00 28.62 ? 503 ARG D CG    1 
ATOM   2998 C CD    . ARG G 2 7  ? 39.468  -0.726  96.718  1.00 29.23 ? 503 ARG D CD    1 
ATOM   2999 N NE    . ARG G 2 7  ? 40.043  -0.846  98.056  1.00 28.97 ? 503 ARG D NE    1 
ATOM   3000 C CZ    . ARG G 2 7  ? 40.261  0.179   98.874  1.00 29.26 ? 503 ARG D CZ    1 
ATOM   3001 N NH1   . ARG G 2 7  ? 39.953  1.410   98.499  1.00 29.77 ? 503 ARG D NH1   1 
ATOM   3002 N NH2   . ARG G 2 7  ? 40.788  -0.028  100.075 1.00 29.91 ? 503 ARG D NH2   1 
ATOM   3003 N N     . ARG G 2 8  ? 43.947  1.077   96.093  1.00 29.00 ? 504 ARG D N     1 
ATOM   3004 C CA    . ARG G 2 8  ? 44.424  2.278   96.775  1.00 31.31 ? 504 ARG D CA    1 
ATOM   3005 C C     . ARG G 2 8  ? 45.229  3.142   95.813  1.00 30.27 ? 504 ARG D C     1 
ATOM   3006 O O     . ARG G 2 8  ? 45.047  4.363   95.751  1.00 30.21 ? 504 ARG D O     1 
ATOM   3007 C CB    . ARG G 2 8  ? 45.292  1.905   97.987  1.00 33.79 ? 504 ARG D CB    1 
ATOM   3008 C CG    . ARG G 2 8  ? 45.794  3.115   98.774  1.00 38.06 ? 504 ARG D CG    1 
ATOM   3009 C CD    . ARG G 2 8  ? 46.712  2.725   99.934  1.00 40.07 ? 504 ARG D CD    1 
ATOM   3010 N NE    . ARG G 2 8  ? 46.006  2.038   101.013 1.00 42.66 ? 504 ARG D NE    1 
ATOM   3011 C CZ    . ARG G 2 8  ? 46.585  1.622   102.137 1.00 43.63 ? 504 ARG D CZ    1 
ATOM   3012 N NH1   . ARG G 2 8  ? 47.882  1.819   102.333 1.00 44.22 ? 504 ARG D NH1   1 
ATOM   3013 N NH2   . ARG G 2 8  ? 45.867  1.010   103.072 1.00 45.41 ? 504 ARG D NH2   1 
ATOM   3014 N N     . THR G 2 9  ? 46.116  2.505   95.060  1.00 29.06 ? 505 THR D N     1 
ATOM   3015 C CA    . THR G 2 9  ? 46.940  3.227   94.100  1.00 28.67 ? 505 THR D CA    1 
ATOM   3016 C C     . THR G 2 9  ? 46.041  3.925   93.083  1.00 27.56 ? 505 THR D C     1 
ATOM   3017 O O     . THR G 2 9  ? 46.292  5.067   92.697  1.00 27.63 ? 505 THR D O     1 
ATOM   3018 C CB    . THR G 2 9  ? 47.887  2.276   93.345  1.00 29.72 ? 505 THR D CB    1 
ATOM   3019 O OG1   . THR G 2 9  ? 48.718  1.584   94.284  1.00 30.95 ? 505 THR D OG1   1 
ATOM   3020 C CG2   . THR G 2 9  ? 48.765  3.061   92.375  1.00 29.50 ? 505 THR D CG2   1 
ATOM   3021 N N     . HIS G 2 10 ? 44.994  3.228   92.655  1.00 26.18 ? 506 HIS D N     1 
ATOM   3022 C CA    . HIS G 2 10 ? 44.047  3.775   91.690  1.00 24.52 ? 506 HIS D CA    1 
ATOM   3023 C C     . HIS G 2 10 ? 43.327  5.014   92.226  1.00 23.98 ? 506 HIS D C     1 
ATOM   3024 O O     . HIS G 2 10 ? 43.160  5.999   91.507  1.00 23.95 ? 506 HIS D O     1 
ATOM   3025 C CB    . HIS G 2 10 ? 43.008  2.720   91.317  1.00 25.25 ? 506 HIS D CB    1 
ATOM   3026 C CG    . HIS G 2 10 ? 42.098  3.139   90.203  1.00 24.97 ? 506 HIS D CG    1 
ATOM   3027 N ND1   . HIS G 2 10 ? 40.812  2.664   90.076  1.00 24.11 ? 506 HIS D ND1   1 
ATOM   3028 C CD2   . HIS G 2 10 ? 42.300  3.966   89.150  1.00 23.55 ? 506 HIS D CD2   1 
ATOM   3029 C CE1   . HIS G 2 10 ? 40.258  3.182   88.994  1.00 24.08 ? 506 HIS D CE1   1 
ATOM   3030 N NE2   . HIS G 2 10 ? 41.141  3.975   88.413  1.00 25.23 ? 506 HIS D NE2   1 
ATOM   3031 N N     . ASN G 2 11 ? 42.892  4.966   93.484  1.00 22.29 ? 507 ASN D N     1 
ATOM   3032 C CA    . ASN G 2 11 ? 42.182  6.096   94.076  1.00 21.16 ? 507 ASN D CA    1 
ATOM   3033 C C     . ASN G 2 11 ? 43.084  7.330   94.188  1.00 21.88 ? 507 ASN D C     1 
ATOM   3034 O O     . ASN G 2 11 ? 42.662  8.457   93.923  1.00 20.05 ? 507 ASN D O     1 
ATOM   3035 C CB    . ASN G 2 11 ? 41.639  5.718   95.467  1.00 20.81 ? 507 ASN D CB    1 
ATOM   3036 C CG    . ASN G 2 11 ? 40.599  4.612   95.412  1.00 22.18 ? 507 ASN D CG    1 
ATOM   3037 O OD1   . ASN G 2 11 ? 40.175  4.077   96.453  1.00 22.86 ? 507 ASN D OD1   1 
ATOM   3038 N ND2   . ASN G 2 11 ? 40.176  4.261   94.203  1.00 19.86 ? 507 ASN D ND2   1 
ATOM   3039 N N     . VAL G 2 12 ? 44.331  7.111   94.582  1.00 21.86 ? 508 VAL D N     1 
ATOM   3040 C CA    . VAL G 2 12 ? 45.282  8.206   94.729  1.00 22.27 ? 508 VAL D CA    1 
ATOM   3041 C C     . VAL G 2 12 ? 45.641  8.855   93.398  1.00 22.57 ? 508 VAL D C     1 
ATOM   3042 O O     . VAL G 2 12 ? 45.669  10.082  93.291  1.00 21.31 ? 508 VAL D O     1 
ATOM   3043 C CB    . VAL G 2 12 ? 46.570  7.721   95.416  1.00 21.98 ? 508 VAL D CB    1 
ATOM   3044 C CG1   . VAL G 2 12 ? 47.690  8.745   95.213  1.00 23.72 ? 508 VAL D CG1   1 
ATOM   3045 C CG2   . VAL G 2 12 ? 46.302  7.503   96.892  1.00 22.41 ? 508 VAL D CG2   1 
ATOM   3046 N N     . LEU G 2 13 ? 45.923  8.041   92.387  1.00 22.19 ? 509 LEU D N     1 
ATOM   3047 C CA    . LEU G 2 13 ? 46.275  8.590   91.079  1.00 23.59 ? 509 LEU D CA    1 
ATOM   3048 C C     . LEU G 2 13 ? 45.103  9.361   90.504  1.00 23.40 ? 509 LEU D C     1 
ATOM   3049 O O     . LEU G 2 13 ? 45.283  10.439  89.933  1.00 23.05 ? 509 LEU D O     1 
ATOM   3050 C CB    . LEU G 2 13 ? 46.654  7.482   90.097  1.00 24.66 ? 509 LEU D CB    1 
ATOM   3051 C CG    . LEU G 2 13 ? 47.990  6.754   90.246  1.00 26.81 ? 509 LEU D CG    1 
ATOM   3052 C CD1   . LEU G 2 13 ? 48.065  5.655   89.188  1.00 28.07 ? 509 LEU D CD1   1 
ATOM   3053 C CD2   . LEU G 2 13 ? 49.154  7.726   90.078  1.00 27.34 ? 509 LEU D CD2   1 
ATOM   3054 N N     . GLU G 2 14 ? 43.902  8.799   90.646  1.00 23.13 ? 510 GLU D N     1 
ATOM   3055 C CA    . GLU G 2 14 ? 42.699  9.446   90.122  1.00 23.56 ? 510 GLU D CA    1 
ATOM   3056 C C     . GLU G 2 14 ? 42.476  10.771  90.843  1.00 22.47 ? 510 GLU D C     1 
ATOM   3057 O O     . GLU G 2 14 ? 42.097  11.763  90.227  1.00 21.59 ? 510 GLU D O     1 
ATOM   3058 C CB    . GLU G 2 14 ? 41.488  8.515   90.281  1.00 24.71 ? 510 GLU D CB    1 
ATOM   3059 C CG    . GLU G 2 14 ? 40.199  8.970   89.589  1.00 26.36 ? 510 GLU D CG    1 
ATOM   3060 C CD    . GLU G 2 14 ? 40.370  9.331   88.110  1.00 28.14 ? 510 GLU D CD    1 
ATOM   3061 O OE1   . GLU G 2 14 ? 41.326  8.865   87.452  1.00 30.08 ? 510 GLU D OE1   1 
ATOM   3062 O OE2   . GLU G 2 14 ? 39.521  10.080  87.594  1.00 29.19 ? 510 GLU D OE2   1 
ATOM   3063 N N     . ARG G 2 15 ? 42.726  10.802  92.146  1.00 23.36 ? 511 ARG D N     1 
ATOM   3064 C CA    . ARG G 2 15 ? 42.561  12.048  92.886  1.00 22.77 ? 511 ARG D CA    1 
ATOM   3065 C C     . ARG G 2 15 ? 43.563  13.094  92.403  1.00 22.94 ? 511 ARG D C     1 
ATOM   3066 O O     . ARG G 2 15 ? 43.236  14.276  92.295  1.00 20.13 ? 511 ARG D O     1 
ATOM   3067 C CB    . ARG G 2 15 ? 42.735  11.817  94.390  1.00 26.86 ? 511 ARG D CB    1 
ATOM   3068 C CG    . ARG G 2 15 ? 42.533  13.072  95.220  1.00 31.01 ? 511 ARG D CG    1 
ATOM   3069 C CD    . ARG G 2 15 ? 42.003  12.730  96.612  1.00 35.98 ? 511 ARG D CD    1 
ATOM   3070 N NE    . ARG G 2 15 ? 42.965  11.969  97.402  1.00 38.80 ? 511 ARG D NE    1 
ATOM   3071 C CZ    . ARG G 2 15 ? 44.098  12.473  97.882  1.00 40.53 ? 511 ARG D CZ    1 
ATOM   3072 N NH1   . ARG G 2 15 ? 44.409  13.743  97.652  1.00 41.02 ? 511 ARG D NH1   1 
ATOM   3073 N NH2   . ARG G 2 15 ? 44.922  11.705  98.589  1.00 42.04 ? 511 ARG D NH2   1 
ATOM   3074 N N     . GLN G 2 16 ? 44.789  12.670  92.111  1.00 22.17 ? 512 GLN D N     1 
ATOM   3075 C CA    . GLN G 2 16 ? 45.787  13.617  91.631  1.00 23.02 ? 512 GLN D CA    1 
ATOM   3076 C C     . GLN G 2 16 ? 45.356  14.109  90.261  1.00 21.56 ? 512 GLN D C     1 
ATOM   3077 O O     . GLN G 2 16 ? 45.496  15.287  89.940  1.00 21.07 ? 512 GLN D O     1 
ATOM   3078 C CB    . GLN G 2 16 ? 47.165  12.958  91.555  1.00 24.86 ? 512 GLN D CB    1 
ATOM   3079 C CG    . GLN G 2 16 ? 47.731  12.615  92.925  1.00 28.02 ? 512 GLN D CG    1 
ATOM   3080 C CD    . GLN G 2 16 ? 49.103  11.985  92.852  1.00 29.10 ? 512 GLN D CD    1 
ATOM   3081 O OE1   . GLN G 2 16 ? 49.303  10.980  92.170  1.00 30.50 ? 512 GLN D OE1   1 
ATOM   3082 N NE2   . GLN G 2 16 ? 50.059  12.574  93.561  1.00 29.78 ? 512 GLN D NE2   1 
ATOM   3083 N N     . ARG G 2 17 ? 44.820  13.204  89.449  1.00 20.94 ? 513 ARG D N     1 
ATOM   3084 C CA    . ARG G 2 17 ? 44.363  13.594  88.119  1.00 20.33 ? 513 ARG D CA    1 
ATOM   3085 C C     . ARG G 2 17 ? 43.289  14.686  88.210  1.00 18.09 ? 513 ARG D C     1 
ATOM   3086 O O     . ARG G 2 17 ? 43.364  15.697  87.507  1.00 17.06 ? 513 ARG D O     1 
ATOM   3087 C CB    . ARG G 2 17 ? 43.807  12.381  87.363  1.00 23.03 ? 513 ARG D CB    1 
ATOM   3088 C CG    . ARG G 2 17 ? 42.990  12.777  86.140  1.00 26.73 ? 513 ARG D CG    1 
ATOM   3089 C CD    . ARG G 2 17 ? 42.456  11.579  85.378  1.00 28.79 ? 513 ARG D CD    1 
ATOM   3090 N NE    . ARG G 2 17 ? 41.607  12.022  84.278  1.00 32.24 ? 513 ARG D NE    1 
ATOM   3091 C CZ    . ARG G 2 17 ? 40.303  12.266  84.383  1.00 32.76 ? 513 ARG D CZ    1 
ATOM   3092 N NH1   . ARG G 2 17 ? 39.684  12.099  85.544  1.00 34.41 ? 513 ARG D NH1   1 
ATOM   3093 N NH2   . ARG G 2 17 ? 39.622  12.693  83.323  1.00 34.22 ? 513 ARG D NH2   1 
ATOM   3094 N N     . ARG G 2 18 ? 42.300  14.484  89.077  1.00 15.84 ? 514 ARG D N     1 
ATOM   3095 C CA    . ARG G 2 18 ? 41.230  15.465  89.243  1.00 16.60 ? 514 ARG D CA    1 
ATOM   3096 C C     . ARG G 2 18 ? 41.781  16.799  89.718  1.00 16.39 ? 514 ARG D C     1 
ATOM   3097 O O     . ARG G 2 18 ? 41.341  17.850  89.270  1.00 16.96 ? 514 ARG D O     1 
ATOM   3098 C CB    . ARG G 2 18 ? 40.190  14.990  90.255  1.00 16.14 ? 514 ARG D CB    1 
ATOM   3099 C CG    . ARG G 2 18 ? 39.372  13.794  89.792  1.00 16.26 ? 514 ARG D CG    1 
ATOM   3100 C CD    . ARG G 2 18 ? 38.185  13.536  90.728  1.00 18.02 ? 514 ARG D CD    1 
ATOM   3101 N NE    . ARG G 2 18 ? 38.560  13.043  92.051  1.00 18.68 ? 514 ARG D NE    1 
ATOM   3102 C CZ    . ARG G 2 18 ? 38.677  11.753  92.366  1.00 19.98 ? 514 ARG D CZ    1 
ATOM   3103 N NH1   . ARG G 2 18 ? 38.448  10.818  91.456  1.00 19.80 ? 514 ARG D NH1   1 
ATOM   3104 N NH2   . ARG G 2 18 ? 39.024  11.394  93.593  1.00 20.04 ? 514 ARG D NH2   1 
ATOM   3105 N N     . ASN G 2 19 ? 42.746  16.749  90.630  1.00 17.65 ? 515 ASN D N     1 
ATOM   3106 C CA    . ASN G 2 19 ? 43.345  17.973  91.161  1.00 18.16 ? 515 ASN D CA    1 
ATOM   3107 C C     . ASN G 2 19 ? 44.155  18.738  90.128  1.00 17.34 ? 515 ASN D C     1 
ATOM   3108 O O     . ASN G 2 19 ? 44.203  19.964  90.153  1.00 19.95 ? 515 ASN D O     1 
ATOM   3109 C CB    . ASN G 2 19 ? 44.185  17.628  92.393  1.00 19.29 ? 515 ASN D CB    1 
ATOM   3110 C CG    . ASN G 2 19 ? 43.326  17.401  93.623  1.00 20.26 ? 515 ASN D CG    1 
ATOM   3111 O OD1   . ASN G 2 19 ? 43.706  16.668  94.548  1.00 22.44 ? 515 ASN D OD1   1 
ATOM   3112 N ND2   . ASN G 2 19 ? 42.157  18.047  93.651  1.00 20.84 ? 515 ASN D ND2   1 
ATOM   3113 N N     . GLU G 2 20 ? 44.793  18.019  89.215  1.00 18.80 ? 516 GLU D N     1 
ATOM   3114 C CA    . GLU G 2 20 ? 45.565  18.656  88.153  1.00 18.93 ? 516 GLU D CA    1 
ATOM   3115 C C     . GLU G 2 20 ? 44.581  19.327  87.193  1.00 18.12 ? 516 GLU D C     1 
ATOM   3116 O O     . GLU G 2 20 ? 44.849  20.395  86.656  1.00 17.07 ? 516 GLU D O     1 
ATOM   3117 C CB    . GLU G 2 20 ? 46.375  17.618  87.385  1.00 22.29 ? 516 GLU D CB    1 
ATOM   3118 C CG    . GLU G 2 20 ? 47.195  18.202  86.240  1.00 27.06 ? 516 GLU D CG    1 
ATOM   3119 C CD    . GLU G 2 20 ? 47.898  17.133  85.431  1.00 30.85 ? 516 GLU D CD    1 
ATOM   3120 O OE1   . GLU G 2 20 ? 48.526  16.238  86.039  1.00 34.91 ? 516 GLU D OE1   1 
ATOM   3121 O OE2   . GLU G 2 20 ? 47.831  17.186  84.185  1.00 33.56 ? 516 GLU D OE2   1 
ATOM   3122 N N     . LEU G 2 21 ? 43.449  18.668  86.967  1.00 17.86 ? 517 LEU D N     1 
ATOM   3123 C CA    . LEU G 2 21 ? 42.415  19.187  86.073  1.00 18.94 ? 517 LEU D CA    1 
ATOM   3124 C C     . LEU G 2 21 ? 41.843  20.458  86.696  1.00 19.42 ? 517 LEU D C     1 
ATOM   3125 O O     . LEU G 2 21 ? 41.533  21.439  86.009  1.00 20.26 ? 517 LEU D O     1 
ATOM   3126 C CB    . LEU G 2 21 ? 41.325  18.123  85.904  1.00 20.59 ? 517 LEU D CB    1 
ATOM   3127 C CG    . LEU G 2 21 ? 40.588  18.030  84.569  1.00 23.68 ? 517 LEU D CG    1 
ATOM   3128 C CD1   . LEU G 2 21 ? 41.581  17.949  83.415  1.00 23.72 ? 517 LEU D CD1   1 
ATOM   3129 C CD2   . LEU G 2 21 ? 39.687  16.807  84.595  1.00 23.70 ? 517 LEU D CD2   1 
ATOM   3130 N N     . LYS G 2 22 ? 41.715  20.440  88.012  1.00 18.97 ? 518 LYS D N     1 
ATOM   3131 C CA    . LYS G 2 22 ? 41.197  21.583  88.739  1.00 21.27 ? 518 LYS D CA    1 
ATOM   3132 C C     . LYS G 2 22 ? 42.126  22.779  88.541  1.00 19.81 ? 518 LYS D C     1 
ATOM   3133 O O     . LYS G 2 22 ? 41.667  23.901  88.323  1.00 20.73 ? 518 LYS D O     1 
ATOM   3134 C CB    . LYS G 2 22 ? 41.085  21.227  90.227  1.00 23.56 ? 518 LYS D CB    1 
ATOM   3135 C CG    . LYS G 2 22 ? 40.530  22.322  91.108  1.00 27.00 ? 518 LYS D CG    1 
ATOM   3136 C CD    . LYS G 2 22 ? 40.317  21.794  92.526  1.00 29.93 ? 518 LYS D CD    1 
ATOM   3137 C CE    . LYS G 2 22 ? 39.720  22.851  93.442  1.00 31.50 ? 518 LYS D CE    1 
ATOM   3138 N NZ    . LYS G 2 22 ? 39.358  22.269  94.769  1.00 31.90 ? 518 LYS D NZ    1 
ATOM   3139 N N     . ARG G 2 23 ? 43.432  22.539  88.602  1.00 20.26 ? 519 ARG D N     1 
ATOM   3140 C CA    . ARG G 2 23 ? 44.402  23.609  88.428  1.00 19.96 ? 519 ARG D CA    1 
ATOM   3141 C C     . ARG G 2 23 ? 44.347  24.142  87.009  1.00 19.56 ? 519 ARG D C     1 
ATOM   3142 O O     . ARG G 2 23 ? 44.508  25.337  86.778  1.00 19.86 ? 519 ARG D O     1 
ATOM   3143 C CB    . ARG G 2 23 ? 45.818  23.117  88.758  1.00 22.68 ? 519 ARG D CB    1 
ATOM   3144 C CG    . ARG G 2 23 ? 46.019  22.826  90.251  1.00 24.78 ? 519 ARG D CG    1 
ATOM   3145 C CD    . ARG G 2 23 ? 47.486  22.642  90.625  1.00 26.36 ? 519 ARG D CD    1 
ATOM   3146 N NE    . ARG G 2 23 ? 47.801  21.235  90.826  1.00 29.04 ? 519 ARG D NE    1 
ATOM   3147 C CZ    . ARG G 2 23 ? 48.224  20.404  89.882  1.00 30.09 ? 519 ARG D CZ    1 
ATOM   3148 N NH1   . ARG G 2 23 ? 48.408  20.834  88.638  1.00 31.24 ? 519 ARG D NH1   1 
ATOM   3149 N NH2   . ARG G 2 23 ? 48.435  19.130  90.180  1.00 29.79 ? 519 ARG D NH2   1 
ATOM   3150 N N     . SER G 2 24 ? 44.122  23.249  86.055  1.00 19.20 ? 520 SER D N     1 
ATOM   3151 C CA    . SER G 2 24 ? 44.038  23.653  84.664  1.00 18.30 ? 520 SER D CA    1 
ATOM   3152 C C     . SER G 2 24 ? 42.802  24.509  84.453  1.00 16.58 ? 520 SER D C     1 
ATOM   3153 O O     . SER G 2 24 ? 42.860  25.495  83.729  1.00 18.14 ? 520 SER D O     1 
ATOM   3154 C CB    . SER G 2 24 ? 43.995  22.427  83.753  1.00 18.66 ? 520 SER D CB    1 
ATOM   3155 O OG    . SER G 2 24 ? 45.199  21.699  83.856  1.00 19.40 ? 520 SER D OG    1 
ATOM   3156 N N     . PHE G 2 25 ? 41.682  24.133  85.071  1.00 16.19 ? 521 PHE D N     1 
ATOM   3157 C CA    . PHE G 2 25 ? 40.465  24.928  84.938  1.00 16.60 ? 521 PHE D CA    1 
ATOM   3158 C C     . PHE G 2 25 ? 40.720  26.318  85.487  1.00 17.91 ? 521 PHE D C     1 
ATOM   3159 O O     . PHE G 2 25 ? 40.300  27.303  84.899  1.00 17.37 ? 521 PHE D O     1 
ATOM   3160 C CB    . PHE G 2 25 ? 39.298  24.308  85.709  1.00 16.45 ? 521 PHE D CB    1 
ATOM   3161 C CG    . PHE G 2 25 ? 38.479  23.345  84.905  1.00 16.99 ? 521 PHE D CG    1 
ATOM   3162 C CD1   . PHE G 2 25 ? 38.588  21.980  85.111  1.00 16.63 ? 521 PHE D CD1   1 
ATOM   3163 C CD2   . PHE G 2 25 ? 37.575  23.813  83.953  1.00 17.83 ? 521 PHE D CD2   1 
ATOM   3164 C CE1   . PHE G 2 25 ? 37.805  21.082  84.387  1.00 18.36 ? 521 PHE D CE1   1 
ATOM   3165 C CE2   . PHE G 2 25 ? 36.786  22.927  83.223  1.00 17.23 ? 521 PHE D CE2   1 
ATOM   3166 C CZ    . PHE G 2 25 ? 36.900  21.563  83.440  1.00 16.51 ? 521 PHE D CZ    1 
ATOM   3167 N N     . PHE G 2 26 ? 41.402  26.391  86.626  1.00 18.44 ? 522 PHE D N     1 
ATOM   3168 C CA    . PHE G 2 26 ? 41.698  27.679  87.246  1.00 21.57 ? 522 PHE D CA    1 
ATOM   3169 C C     . PHE G 2 26 ? 42.517  28.582  86.322  1.00 20.77 ? 522 PHE D C     1 
ATOM   3170 O O     . PHE G 2 26 ? 42.218  29.777  86.171  1.00 21.26 ? 522 PHE D O     1 
ATOM   3171 C CB    . PHE G 2 26 ? 42.456  27.456  88.562  1.00 23.48 ? 522 PHE D CB    1 
ATOM   3172 C CG    . PHE G 2 26 ? 41.629  26.820  89.647  1.00 27.88 ? 522 PHE D CG    1 
ATOM   3173 C CD1   . PHE G 2 26 ? 40.397  26.227  89.361  1.00 29.24 ? 522 PHE D CD1   1 
ATOM   3174 C CD2   . PHE G 2 26 ? 42.081  26.819  90.965  1.00 29.16 ? 522 PHE D CD2   1 
ATOM   3175 C CE1   . PHE G 2 26 ? 39.628  25.647  90.370  1.00 30.23 ? 522 PHE D CE1   1 
ATOM   3176 C CE2   . PHE G 2 26 ? 41.323  26.243  91.983  1.00 29.90 ? 522 PHE D CE2   1 
ATOM   3177 C CZ    . PHE G 2 26 ? 40.094  25.658  91.687  1.00 30.27 ? 522 PHE D CZ    1 
ATOM   3178 N N     . ALA G 2 27 ? 43.547  28.012  85.705  1.00 20.31 ? 523 ALA D N     1 
ATOM   3179 C CA    . ALA G 2 27 ? 44.412  28.763  84.805  1.00 19.35 ? 523 ALA D CA    1 
ATOM   3180 C C     . ALA G 2 27 ? 43.633  29.317  83.623  1.00 19.89 ? 523 ALA D C     1 
ATOM   3181 O O     . ALA G 2 27 ? 43.853  30.453  83.211  1.00 18.74 ? 523 ALA D O     1 
ATOM   3182 C CB    . ALA G 2 27 ? 45.542  27.882  84.309  1.00 20.26 ? 523 ALA D CB    1 
ATOM   3183 N N     . LEU G 2 28 ? 42.727  28.506  83.081  1.00 19.66 ? 524 LEU D N     1 
ATOM   3184 C CA    . LEU G 2 28 ? 41.914  28.918  81.942  1.00 18.61 ? 524 LEU D CA    1 
ATOM   3185 C C     . LEU G 2 28 ? 40.956  30.029  82.371  1.00 18.90 ? 524 LEU D C     1 
ATOM   3186 O O     . LEU G 2 28 ? 40.838  31.063  81.705  1.00 16.44 ? 524 LEU D O     1 
ATOM   3187 C CB    . LEU G 2 28 ? 41.116  27.719  81.404  1.00 17.88 ? 524 LEU D CB    1 
ATOM   3188 C CG    . LEU G 2 28 ? 40.178  28.015  80.219  1.00 17.65 ? 524 LEU D CG    1 
ATOM   3189 C CD1   . LEU G 2 28 ? 40.978  28.642  79.071  1.00 17.00 ? 524 LEU D CD1   1 
ATOM   3190 C CD2   . LEU G 2 28 ? 39.479  26.737  79.765  1.00 15.47 ? 524 LEU D CD2   1 
ATOM   3191 N N     . ARG G 2 29 ? 40.273  29.812  83.490  1.00 18.70 ? 525 ARG D N     1 
ATOM   3192 C CA    . ARG G 2 29 ? 39.335  30.803  84.004  1.00 20.47 ? 525 ARG D CA    1 
ATOM   3193 C C     . ARG G 2 29 ? 39.989  32.173  84.159  1.00 21.84 ? 525 ARG D C     1 
ATOM   3194 O O     . ARG G 2 29 ? 39.398  33.194  83.810  1.00 20.09 ? 525 ARG D O     1 
ATOM   3195 C CB    . ARG G 2 29 ? 38.791  30.356  85.360  1.00 21.88 ? 525 ARG D CB    1 
ATOM   3196 C CG    . ARG G 2 29 ? 37.943  31.394  86.065  1.00 23.21 ? 525 ARG D CG    1 
ATOM   3197 C CD    . ARG G 2 29 ? 37.834  31.041  87.533  1.00 28.31 ? 525 ARG D CD    1 
ATOM   3198 N NE    . ARG G 2 29 ? 39.161  31.016  88.142  1.00 31.41 ? 525 ARG D NE    1 
ATOM   3199 C CZ    . ARG G 2 29 ? 39.443  30.436  89.305  1.00 33.87 ? 525 ARG D CZ    1 
ATOM   3200 N NH1   . ARG G 2 29 ? 38.489  29.828  89.991  1.00 34.29 ? 525 ARG D NH1   1 
ATOM   3201 N NH2   . ARG G 2 29 ? 40.685  30.465  89.779  1.00 35.22 ? 525 ARG D NH2   1 
ATOM   3202 N N     . ASP G 2 30 ? 41.205  32.193  84.692  1.00 22.73 ? 526 ASP D N     1 
ATOM   3203 C CA    . ASP G 2 30 ? 41.911  33.453  84.906  1.00 25.13 ? 526 ASP D CA    1 
ATOM   3204 C C     . ASP G 2 30 ? 42.293  34.234  83.652  1.00 24.53 ? 526 ASP D C     1 
ATOM   3205 O O     . ASP G 2 30 ? 42.674  35.399  83.741  1.00 24.72 ? 526 ASP D O     1 
ATOM   3206 C CB    . ASP G 2 30 ? 43.160  33.221  85.757  1.00 26.46 ? 526 ASP D CB    1 
ATOM   3207 C CG    . ASP G 2 30 ? 42.880  33.372  87.236  1.00 29.70 ? 526 ASP D CG    1 
ATOM   3208 O OD1   . ASP G 2 30 ? 42.303  32.439  87.838  1.00 29.49 ? 526 ASP D OD1   1 
ATOM   3209 O OD2   . ASP G 2 30 ? 43.213  34.448  87.789  1.00 30.33 ? 526 ASP D OD2   1 
ATOM   3210 N N     . GLN G 2 31 ? 42.194  33.604  82.488  1.00 24.38 ? 527 GLN D N     1 
ATOM   3211 C CA    . GLN G 2 31 ? 42.539  34.284  81.245  1.00 24.44 ? 527 GLN D CA    1 
ATOM   3212 C C     . GLN G 2 31 ? 41.298  34.751  80.474  1.00 25.04 ? 527 GLN D C     1 
ATOM   3213 O O     . GLN G 2 31 ? 41.404  35.320  79.390  1.00 24.92 ? 527 GLN D O     1 
ATOM   3214 C CB    . GLN G 2 31 ? 43.398  33.372  80.370  1.00 26.71 ? 527 GLN D CB    1 
ATOM   3215 C CG    . GLN G 2 31 ? 44.679  32.921  81.052  1.00 29.46 ? 527 GLN D CG    1 
ATOM   3216 C CD    . GLN G 2 31 ? 45.535  34.089  81.539  1.00 31.26 ? 527 GLN D CD    1 
ATOM   3217 O OE1   . GLN G 2 31 ? 46.335  33.939  82.461  1.00 32.18 ? 527 GLN D OE1   1 
ATOM   3218 N NE2   . GLN G 2 31 ? 45.372  35.251  80.916  1.00 31.44 ? 527 GLN D NE2   1 
ATOM   3219 N N     . ILE G 2 32 ? 40.125  34.521  81.052  1.00 23.84 ? 528 ILE D N     1 
ATOM   3220 C CA    . ILE G 2 32 ? 38.865  34.923  80.436  1.00 23.67 ? 528 ILE D CA    1 
ATOM   3221 C C     . ILE G 2 32 ? 38.410  36.208  81.125  1.00 24.61 ? 528 ILE D C     1 
ATOM   3222 O O     . ILE G 2 32 ? 37.865  36.169  82.227  1.00 23.34 ? 528 ILE D O     1 
ATOM   3223 C CB    . ILE G 2 32 ? 37.791  33.831  80.633  1.00 23.08 ? 528 ILE D CB    1 
ATOM   3224 C CG1   . ILE G 2 32 ? 38.291  32.510  80.038  1.00 23.94 ? 528 ILE D CG1   1 
ATOM   3225 C CG2   . ILE G 2 32 ? 36.466  34.264  80.000  1.00 20.94 ? 528 ILE D CG2   1 
ATOM   3226 C CD1   . ILE G 2 32 ? 37.365  31.335  80.304  1.00 23.91 ? 528 ILE D CD1   1 
ATOM   3227 N N     . PRO G 2 33 ? 38.622  37.366  80.481  1.00 26.44 ? 529 PRO D N     1 
ATOM   3228 C CA    . PRO G 2 33 ? 38.213  38.636  81.098  1.00 27.74 ? 529 PRO D CA    1 
ATOM   3229 C C     . PRO G 2 33 ? 36.797  38.652  81.673  1.00 29.06 ? 529 PRO D C     1 
ATOM   3230 O O     . PRO G 2 33 ? 36.568  39.142  82.779  1.00 28.39 ? 529 PRO D O     1 
ATOM   3231 C CB    . PRO G 2 33 ? 38.412  39.657  79.970  1.00 28.24 ? 529 PRO D CB    1 
ATOM   3232 C CG    . PRO G 2 33 ? 38.345  38.833  78.719  1.00 28.07 ? 529 PRO D CG    1 
ATOM   3233 C CD    . PRO G 2 33 ? 39.078  37.577  79.098  1.00 26.98 ? 529 PRO D CD    1 
ATOM   3234 N N     . GLU G 2 34 ? 35.858  38.095  80.925  1.00 30.11 ? 530 GLU D N     1 
ATOM   3235 C CA    . GLU G 2 34 ? 34.465  38.049  81.335  1.00 31.97 ? 530 GLU D CA    1 
ATOM   3236 C C     . GLU G 2 34 ? 34.265  37.512  82.758  1.00 33.24 ? 530 GLU D C     1 
ATOM   3237 O O     . GLU G 2 34 ? 33.352  37.936  83.467  1.00 33.98 ? 530 GLU D O     1 
ATOM   3238 C CB    . GLU G 2 34 ? 33.691  37.167  80.360  1.00 33.16 ? 530 GLU D CB    1 
ATOM   3239 C CG    . GLU G 2 34 ? 32.238  37.525  80.214  1.00 34.15 ? 530 GLU D CG    1 
ATOM   3240 C CD    . GLU G 2 34 ? 31.396  36.348  79.759  1.00 34.18 ? 530 GLU D CD    1 
ATOM   3241 O OE1   . GLU G 2 34 ? 31.723  35.725  78.719  1.00 33.84 ? 530 GLU D OE1   1 
ATOM   3242 O OE2   . GLU G 2 34 ? 30.403  36.050  80.448  1.00 33.54 ? 530 GLU D OE2   1 
ATOM   3243 N N     . LEU G 2 35 ? 35.114  36.577  83.171  1.00 33.76 ? 531 LEU D N     1 
ATOM   3244 C CA    . LEU G 2 35 ? 34.989  35.962  84.494  1.00 34.90 ? 531 LEU D CA    1 
ATOM   3245 C C     . LEU G 2 35 ? 35.717  36.698  85.605  1.00 37.08 ? 531 LEU D C     1 
ATOM   3246 O O     . LEU G 2 35 ? 35.832  36.187  86.722  1.00 37.13 ? 531 LEU D O     1 
ATOM   3247 C CB    . LEU G 2 35 ? 35.481  34.509  84.444  1.00 33.37 ? 531 LEU D CB    1 
ATOM   3248 C CG    . LEU G 2 35 ? 34.674  33.562  83.553  1.00 32.32 ? 531 LEU D CG    1 
ATOM   3249 C CD1   . LEU G 2 35 ? 35.298  32.170  83.569  1.00 33.10 ? 531 LEU D CD1   1 
ATOM   3250 C CD2   . LEU G 2 35 ? 33.234  33.516  84.042  1.00 32.15 ? 531 LEU D CD2   1 
ATOM   3251 N N     . GLU G 2 36 ? 36.199  37.898  85.299  1.00 39.45 ? 532 GLU D N     1 
ATOM   3252 C CA    . GLU G 2 36 ? 36.924  38.714  86.263  1.00 42.02 ? 532 GLU D CA    1 
ATOM   3253 C C     . GLU G 2 36 ? 36.078  38.989  87.503  1.00 42.90 ? 532 GLU D C     1 
ATOM   3254 O O     . GLU G 2 36 ? 36.482  38.677  88.620  1.00 42.24 ? 532 GLU D O     1 
ATOM   3255 C CB    . GLU G 2 36 ? 37.327  40.040  85.624  1.00 43.84 ? 532 GLU D CB    1 
ATOM   3256 C CG    . GLU G 2 36 ? 38.554  40.659  86.246  1.00 46.66 ? 532 GLU D CG    1 
ATOM   3257 C CD    . GLU G 2 36 ? 39.755  39.753  86.115  1.00 47.90 ? 532 GLU D CD    1 
ATOM   3258 O OE1   . GLU G 2 36 ? 40.022  39.295  84.983  1.00 49.17 ? 532 GLU D OE1   1 
ATOM   3259 O OE2   . GLU G 2 36 ? 40.430  39.498  87.135  1.00 49.37 ? 532 GLU D OE2   1 
ATOM   3260 N N     . ASN G 2 37 ? 34.910  39.589  87.297  1.00 44.49 ? 533 ASN D N     1 
ATOM   3261 C CA    . ASN G 2 37 ? 34.003  39.896  88.395  1.00 46.53 ? 533 ASN D CA    1 
ATOM   3262 C C     . ASN G 2 37 ? 33.007  38.757  88.536  1.00 46.86 ? 533 ASN D C     1 
ATOM   3263 O O     . ASN G 2 37 ? 31.794  38.971  88.580  1.00 47.56 ? 533 ASN D O     1 
ATOM   3264 C CB    . ASN G 2 37 ? 33.260  41.210  88.136  1.00 47.59 ? 533 ASN D CB    1 
ATOM   3265 C CG    . ASN G 2 37 ? 34.166  42.420  88.224  1.00 48.86 ? 533 ASN D CG    1 
ATOM   3266 O OD1   . ASN G 2 37 ? 34.935  42.564  89.177  1.00 50.10 ? 533 ASN D OD1   1 
ATOM   3267 N ND2   . ASN G 2 37 ? 34.074  43.305  87.236  1.00 49.44 ? 533 ASN D ND2   1 
ATOM   3268 N N     . ASN G 2 38 ? 33.538  37.544  88.610  1.00 46.82 ? 534 ASN D N     1 
ATOM   3269 C CA    . ASN G 2 38 ? 32.724  36.345  88.733  1.00 46.76 ? 534 ASN D CA    1 
ATOM   3270 C C     . ASN G 2 38 ? 32.773  35.774  90.146  1.00 45.66 ? 534 ASN D C     1 
ATOM   3271 O O     . ASN G 2 38 ? 33.825  35.337  90.607  1.00 45.47 ? 534 ASN D O     1 
ATOM   3272 C CB    . ASN G 2 38 ? 33.220  35.298  87.737  1.00 48.66 ? 534 ASN D CB    1 
ATOM   3273 C CG    . ASN G 2 38 ? 32.424  34.018  87.791  1.00 50.05 ? 534 ASN D CG    1 
ATOM   3274 O OD1   . ASN G 2 38 ? 31.225  33.995  87.504  1.00 51.24 ? 534 ASN D OD1   1 
ATOM   3275 N ND2   . ASN G 2 38 ? 33.091  32.938  88.159  1.00 52.01 ? 534 ASN D ND2   1 
ATOM   3276 N N     . GLU G 2 39 ? 31.628  35.773  90.822  1.00 44.24 ? 535 GLU D N     1 
ATOM   3277 C CA    . GLU G 2 39 ? 31.537  35.250  92.181  1.00 42.54 ? 535 GLU D CA    1 
ATOM   3278 C C     . GLU G 2 39 ? 31.955  33.781  92.204  1.00 39.91 ? 535 GLU D C     1 
ATOM   3279 O O     . GLU G 2 39 ? 32.717  33.353  93.072  1.00 39.45 ? 535 GLU D O     1 
ATOM   3280 C CB    . GLU G 2 39 ? 30.103  35.385  92.700  1.00 44.94 ? 535 GLU D CB    1 
ATOM   3281 C CG    . GLU G 2 39 ? 29.988  35.400  94.218  1.00 47.26 ? 535 GLU D CG    1 
ATOM   3282 C CD    . GLU G 2 39 ? 28.546  35.389  94.690  1.00 48.73 ? 535 GLU D CD    1 
ATOM   3283 O OE1   . GLU G 2 39 ? 28.048  34.298  95.035  1.00 49.66 ? 535 GLU D OE1   1 
ATOM   3284 O OE2   . GLU G 2 39 ? 27.909  36.468  94.703  1.00 49.53 ? 535 GLU D OE2   1 
ATOM   3285 N N     . LYS G 2 40 ? 31.438  33.012  91.249  1.00 35.32 ? 536 LYS D N     1 
ATOM   3286 C CA    . LYS G 2 40 ? 31.764  31.590  91.141  1.00 33.78 ? 536 LYS D CA    1 
ATOM   3287 C C     . LYS G 2 40 ? 31.752  31.216  89.664  1.00 30.35 ? 536 LYS D C     1 
ATOM   3288 O O     . LYS G 2 40 ? 31.006  31.805  88.884  1.00 31.37 ? 536 LYS D O     1 
ATOM   3289 C CB    . LYS G 2 40 ? 30.736  30.740  91.898  1.00 33.88 ? 536 LYS D CB    1 
ATOM   3290 C CG    . LYS G 2 40 ? 30.477  31.200  93.325  1.00 41.72 ? 536 LYS D CG    1 
ATOM   3291 C CD    . LYS G 2 40 ? 29.582  30.232  94.080  1.00 41.67 ? 536 LYS D CD    1 
ATOM   3292 C CE    . LYS G 2 40 ? 30.299  28.921  94.366  1.00 41.18 ? 536 LYS D CE    1 
ATOM   3293 N NZ    . LYS G 2 40 ? 29.424  27.969  95.111  1.00 41.06 ? 536 LYS D NZ    1 
ATOM   3294 N N     . ALA G 2 41 ? 32.577  30.253  89.270  1.00 28.41 ? 537 ALA D N     1 
ATOM   3295 C CA    . ALA G 2 41 ? 32.616  29.857  87.868  1.00 25.85 ? 537 ALA D CA    1 
ATOM   3296 C C     . ALA G 2 41 ? 32.653  28.349  87.713  1.00 24.47 ? 537 ALA D C     1 
ATOM   3297 O O     . ALA G 2 41 ? 33.723  27.747  87.729  1.00 22.28 ? 537 ALA D O     1 
ATOM   3298 C CB    . ALA G 2 41 ? 33.823  30.468  87.185  1.00 27.96 ? 537 ALA D CB    1 
ATOM   3299 N N     . PRO G 2 42 ? 31.482  27.716  87.554  1.00 22.19 ? 538 PRO D N     1 
ATOM   3300 C CA    . PRO G 2 42 ? 31.443  26.257  87.393  1.00 20.99 ? 538 PRO D CA    1 
ATOM   3301 C C     . PRO G 2 42 ? 32.307  25.846  86.197  1.00 19.86 ? 538 PRO D C     1 
ATOM   3302 O O     . PRO G 2 42 ? 32.594  26.665  85.333  1.00 19.26 ? 538 PRO D O     1 
ATOM   3303 C CB    . PRO G 2 42 ? 29.964  25.976  87.150  1.00 21.20 ? 538 PRO D CB    1 
ATOM   3304 C CG    . PRO G 2 42 ? 29.269  27.115  87.846  1.00 23.22 ? 538 PRO D CG    1 
ATOM   3305 C CD    . PRO G 2 42 ? 30.128  28.295  87.496  1.00 22.61 ? 538 PRO D CD    1 
ATOM   3306 N N     . LYS G 2 43 ? 32.707  24.578  86.137  1.00 19.00 ? 539 LYS D N     1 
ATOM   3307 C CA    . LYS G 2 43 ? 33.533  24.117  85.030  1.00 19.06 ? 539 LYS D CA    1 
ATOM   3308 C C     . LYS G 2 43 ? 32.839  24.350  83.692  1.00 17.94 ? 539 LYS D C     1 
ATOM   3309 O O     . LYS G 2 43 ? 33.468  24.796  82.732  1.00 16.66 ? 539 LYS D O     1 
ATOM   3310 C CB    . LYS G 2 43 ? 33.852  22.628  85.172  1.00 19.47 ? 539 LYS D CB    1 
ATOM   3311 C CG    . LYS G 2 43 ? 34.507  22.230  86.485  1.00 22.94 ? 539 LYS D CG    1 
ATOM   3312 C CD    . LYS G 2 43 ? 34.860  20.743  86.472  1.00 24.76 ? 539 LYS D CD    1 
ATOM   3313 C CE    . LYS G 2 43 ? 34.760  20.119  87.860  1.00 29.43 ? 539 LYS D CE    1 
ATOM   3314 N NZ    . LYS G 2 43 ? 35.469  20.906  88.900  1.00 29.18 ? 539 LYS D NZ    1 
ATOM   3315 N N     . VAL G 2 44 ? 31.540  24.061  83.630  1.00 17.12 ? 540 VAL D N     1 
ATOM   3316 C CA    . VAL G 2 44 ? 30.809  24.210  82.376  1.00 17.69 ? 540 VAL D CA    1 
ATOM   3317 C C     . VAL G 2 44 ? 30.782  25.663  81.871  1.00 18.02 ? 540 VAL D C     1 
ATOM   3318 O O     . VAL G 2 44 ? 30.831  25.918  80.663  1.00 16.17 ? 540 VAL D O     1 
ATOM   3319 C CB    . VAL G 2 44 ? 29.370  23.622  82.510  1.00 17.62 ? 540 VAL D CB    1 
ATOM   3320 C CG1   . VAL G 2 44 ? 28.467  24.575  83.273  1.00 19.43 ? 540 VAL D CG1   1 
ATOM   3321 C CG2   . VAL G 2 44 ? 28.808  23.311  81.129  1.00 19.92 ? 540 VAL D CG2   1 
ATOM   3322 N N     . VAL G 2 45 ? 30.721  26.607  82.803  1.00 16.69 ? 541 VAL D N     1 
ATOM   3323 C CA    . VAL G 2 45 ? 30.721  28.033  82.491  1.00 18.51 ? 541 VAL D CA    1 
ATOM   3324 C C     . VAL G 2 45 ? 32.103  28.440  81.957  1.00 16.37 ? 541 VAL D C     1 
ATOM   3325 O O     . VAL G 2 45 ? 32.213  29.193  80.984  1.00 17.44 ? 541 VAL D O     1 
ATOM   3326 C CB    . VAL G 2 45 ? 30.361  28.847  83.761  1.00 19.48 ? 541 VAL D CB    1 
ATOM   3327 C CG1   . VAL G 2 45 ? 30.517  30.332  83.515  1.00 19.39 ? 541 VAL D CG1   1 
ATOM   3328 C CG2   . VAL G 2 45 ? 28.918  28.539  84.166  1.00 20.85 ? 541 VAL D CG2   1 
ATOM   3329 N N     . ILE G 2 46 ? 33.158  27.920  82.580  1.00 16.41 ? 542 ILE D N     1 
ATOM   3330 C CA    . ILE G 2 46 ? 34.520  28.216  82.135  1.00 15.45 ? 542 ILE D CA    1 
ATOM   3331 C C     . ILE G 2 46 ? 34.724  27.732  80.689  1.00 15.49 ? 542 ILE D C     1 
ATOM   3332 O O     . ILE G 2 46 ? 35.286  28.439  79.857  1.00 15.16 ? 542 ILE D O     1 
ATOM   3333 C CB    . ILE G 2 46 ? 35.564  27.544  83.062  1.00 15.16 ? 542 ILE D CB    1 
ATOM   3334 C CG1   . ILE G 2 46 ? 35.467  28.159  84.472  1.00 15.75 ? 542 ILE D CG1   1 
ATOM   3335 C CG2   . ILE G 2 46 ? 36.966  27.754  82.505  1.00 15.16 ? 542 ILE D CG2   1 
ATOM   3336 C CD1   . ILE G 2 46 ? 36.174  27.353  85.577  1.00 15.16 ? 542 ILE D CD1   1 
ATOM   3337 N N     . LEU G 2 47 ? 34.250  26.526  80.388  1.00 16.36 ? 543 LEU D N     1 
ATOM   3338 C CA    . LEU G 2 47 ? 34.396  25.988  79.042  1.00 16.46 ? 543 LEU D CA    1 
ATOM   3339 C C     . LEU G 2 47 ? 33.626  26.827  78.028  1.00 17.34 ? 543 LEU D C     1 
ATOM   3340 O O     . LEU G 2 47 ? 34.162  27.201  76.977  1.00 15.94 ? 543 LEU D O     1 
ATOM   3341 C CB    . LEU G 2 47 ? 33.893  24.541  78.994  1.00 16.27 ? 543 LEU D CB    1 
ATOM   3342 C CG    . LEU G 2 47 ? 34.742  23.535  79.782  1.00 15.75 ? 543 LEU D CG    1 
ATOM   3343 C CD1   . LEU G 2 47 ? 34.023  22.185  79.827  1.00 16.55 ? 543 LEU D CD1   1 
ATOM   3344 C CD2   . LEU G 2 47 ? 36.112  23.404  79.132  1.00 15.16 ? 543 LEU D CD2   1 
ATOM   3345 N N     . LYS G 2 48 ? 32.376  27.138  78.353  1.00 16.95 ? 544 LYS D N     1 
ATOM   3346 C CA    . LYS G 2 48 ? 31.539  27.913  77.442  1.00 17.96 ? 544 LYS D CA    1 
ATOM   3347 C C     . LYS G 2 48 ? 32.045  29.321  77.208  1.00 17.94 ? 544 LYS D C     1 
ATOM   3348 O O     . LYS G 2 48 ? 32.004  29.819  76.084  1.00 18.71 ? 544 LYS D O     1 
ATOM   3349 C CB    . LYS G 2 48 ? 30.108  27.967  77.960  1.00 19.30 ? 544 LYS D CB    1 
ATOM   3350 C CG    . LYS G 2 48 ? 29.323  26.675  77.776  1.00 19.42 ? 544 LYS D CG    1 
ATOM   3351 C CD    . LYS G 2 48 ? 28.022  26.735  78.572  1.00 20.23 ? 544 LYS D CD    1 
ATOM   3352 C CE    . LYS G 2 48 ? 27.167  25.501  78.362  1.00 21.16 ? 544 LYS D CE    1 
ATOM   3353 N NZ    . LYS G 2 48 ? 25.934  25.559  79.219  1.00 21.40 ? 544 LYS D NZ    1 
ATOM   3354 N N     . LYS G 2 49 ? 32.526  29.966  78.265  1.00 17.61 ? 545 LYS D N     1 
ATOM   3355 C CA    . LYS G 2 49 ? 33.022  31.323  78.145  1.00 17.71 ? 545 LYS D CA    1 
ATOM   3356 C C     . LYS G 2 49 ? 34.405  31.403  77.523  1.00 17.10 ? 545 LYS D C     1 
ATOM   3357 O O     . LYS G 2 49 ? 34.778  32.432  76.971  1.00 17.22 ? 545 LYS D O     1 
ATOM   3358 C CB    . LYS G 2 49 ? 32.984  32.008  79.506  1.00 19.57 ? 545 LYS D CB    1 
ATOM   3359 C CG    . LYS G 2 49 ? 31.548  32.241  79.983  1.00 21.26 ? 545 LYS D CG    1 
ATOM   3360 C CD    . LYS G 2 49 ? 31.482  33.083  81.236  1.00 23.24 ? 545 LYS D CD    1 
ATOM   3361 C CE    . LYS G 2 49 ? 30.030  33.250  81.681  1.00 24.73 ? 545 LYS D CE    1 
ATOM   3362 N NZ    . LYS G 2 49 ? 29.161  33.804  80.601  1.00 24.48 ? 545 LYS D NZ    1 
ATOM   3363 N N     . ALA G 2 50 ? 35.167  30.320  77.604  1.00 16.63 ? 546 ALA D N     1 
ATOM   3364 C CA    . ALA G 2 50 ? 36.489  30.290  76.987  1.00 16.06 ? 546 ALA D CA    1 
ATOM   3365 C C     . ALA G 2 50 ? 36.272  30.160  75.485  1.00 16.82 ? 546 ALA D C     1 
ATOM   3366 O O     . ALA G 2 50 ? 36.961  30.781  74.685  1.00 17.46 ? 546 ALA D O     1 
ATOM   3367 C CB    . ALA G 2 50 ? 37.292  29.093  77.499  1.00 17.28 ? 546 ALA D CB    1 
ATOM   3368 N N     . THR G 2 51 ? 35.301  29.338  75.108  1.00 17.79 ? 547 THR D N     1 
ATOM   3369 C CA    . THR G 2 51 ? 35.001  29.123  73.701  1.00 19.64 ? 547 THR D CA    1 
ATOM   3370 C C     . THR G 2 51 ? 34.491  30.414  73.052  1.00 18.61 ? 547 THR D C     1 
ATOM   3371 O O     . THR G 2 51 ? 34.962  30.813  71.987  1.00 19.17 ? 547 THR D O     1 
ATOM   3372 C CB    . THR G 2 51 ? 33.952  28.016  73.544  1.00 19.52 ? 547 THR D CB    1 
ATOM   3373 O OG1   . THR G 2 51 ? 34.450  26.805  74.129  1.00 22.57 ? 547 THR D OG1   1 
ATOM   3374 C CG2   . THR G 2 51 ? 33.638  27.779  72.075  1.00 22.13 ? 547 THR D CG2   1 
ATOM   3375 N N     . ALA G 2 52 ? 33.534  31.070  73.702  1.00 19.91 ? 548 ALA D N     1 
ATOM   3376 C CA    . ALA G 2 52 ? 32.984  32.316  73.174  1.00 19.85 ? 548 ALA D CA    1 
ATOM   3377 C C     . ALA G 2 52 ? 34.073  33.391  73.070  1.00 20.10 ? 548 ALA D C     1 
ATOM   3378 O O     . ALA G 2 52 ? 34.090  34.191  72.126  1.00 19.98 ? 548 ALA D O     1 
ATOM   3379 C CB    . ALA G 2 52 ? 31.837  32.801  74.063  1.00 20.20 ? 548 ALA D CB    1 
ATOM   3380 N N     . TYR G 2 53 ? 34.985  33.415  74.034  1.00 19.58 ? 549 TYR D N     1 
ATOM   3381 C CA    . TYR G 2 53 ? 36.066  34.397  74.011  1.00 19.93 ? 549 TYR D CA    1 
ATOM   3382 C C     . TYR G 2 53 ? 37.017  34.121  72.842  1.00 20.20 ? 549 TYR D C     1 
ATOM   3383 O O     . TYR G 2 53 ? 37.452  35.042  72.144  1.00 20.43 ? 549 TYR D O     1 
ATOM   3384 C CB    . TYR G 2 53 ? 36.856  34.365  75.327  1.00 19.98 ? 549 TYR D CB    1 
ATOM   3385 C CG    . TYR G 2 53 ? 37.965  35.391  75.390  1.00 21.69 ? 549 TYR D CG    1 
ATOM   3386 C CD1   . TYR G 2 53 ? 37.678  36.757  75.368  1.00 22.48 ? 549 TYR D CD1   1 
ATOM   3387 C CD2   . TYR G 2 53 ? 39.303  35.003  75.463  1.00 23.23 ? 549 TYR D CD2   1 
ATOM   3388 C CE1   . TYR G 2 53 ? 38.695  37.712  75.415  1.00 24.00 ? 549 TYR D CE1   1 
ATOM   3389 C CE2   . TYR G 2 53 ? 40.329  35.958  75.511  1.00 25.40 ? 549 TYR D CE2   1 
ATOM   3390 C CZ    . TYR G 2 53 ? 40.010  37.308  75.485  1.00 24.46 ? 549 TYR D CZ    1 
ATOM   3391 O OH    . TYR G 2 53 ? 41.006  38.253  75.523  1.00 26.15 ? 549 TYR D OH    1 
ATOM   3392 N N     . ILE G 2 54 ? 37.343  32.851  72.629  1.00 19.57 ? 550 ILE D N     1 
ATOM   3393 C CA    . ILE G 2 54 ? 38.233  32.491  71.531  1.00 20.94 ? 550 ILE D CA    1 
ATOM   3394 C C     . ILE G 2 54 ? 37.590  32.910  70.217  1.00 21.84 ? 550 ILE D C     1 
ATOM   3395 O O     . ILE G 2 54 ? 38.241  33.508  69.366  1.00 22.63 ? 550 ILE D O     1 
ATOM   3396 C CB    . ILE G 2 54 ? 38.537  30.970  71.537  1.00 19.87 ? 550 ILE D CB    1 
ATOM   3397 C CG1   . ILE G 2 54 ? 39.501  30.659  72.688  1.00 19.90 ? 550 ILE D CG1   1 
ATOM   3398 C CG2   . ILE G 2 54 ? 39.145  30.539  70.206  1.00 18.80 ? 550 ILE D CG2   1 
ATOM   3399 C CD1   . ILE G 2 54 ? 39.753  29.179  72.912  1.00 21.48 ? 550 ILE D CD1   1 
ATOM   3400 N N     . LEU G 2 55 ? 36.305  32.616  70.055  1.00 23.35 ? 551 LEU D N     1 
ATOM   3401 C CA    . LEU G 2 55 ? 35.615  33.014  68.834  1.00 25.37 ? 551 LEU D CA    1 
ATOM   3402 C C     . LEU G 2 55 ? 35.675  34.537  68.703  1.00 25.64 ? 551 LEU D C     1 
ATOM   3403 O O     . LEU G 2 55 ? 35.820  35.069  67.602  1.00 24.82 ? 551 LEU D O     1 
ATOM   3404 C CB    . LEU G 2 55 ? 34.152  32.563  68.863  1.00 26.68 ? 551 LEU D CB    1 
ATOM   3405 C CG    . LEU G 2 55 ? 33.821  31.204  68.252  1.00 27.55 ? 551 LEU D CG    1 
ATOM   3406 C CD1   . LEU G 2 55 ? 34.645  30.108  68.909  1.00 28.83 ? 551 LEU D CD1   1 
ATOM   3407 C CD2   . LEU G 2 55 ? 32.334  30.947  68.420  1.00 28.78 ? 551 LEU D CD2   1 
ATOM   3408 N N     . SER G 2 56 ? 35.587  35.239  69.830  1.00 25.47 ? 552 SER D N     1 
ATOM   3409 C CA    . SER G 2 56 ? 35.624  36.696  69.792  1.00 25.69 ? 552 SER D CA    1 
ATOM   3410 C C     . SER G 2 56 ? 36.998  37.265  69.439  1.00 25.33 ? 552 SER D C     1 
ATOM   3411 O O     . SER G 2 56 ? 37.073  38.277  68.748  1.00 25.28 ? 552 SER D O     1 
ATOM   3412 C CB    . SER G 2 56 ? 35.139  37.291  71.117  1.00 25.82 ? 552 SER D CB    1 
ATOM   3413 O OG    . SER G 2 56 ? 36.192  37.396  72.055  1.00 28.01 ? 552 SER D OG    1 
ATOM   3414 N N     . VAL G 2 57 ? 38.086  36.644  69.894  1.00 25.19 ? 553 VAL D N     1 
ATOM   3415 C CA    . VAL G 2 57 ? 39.405  37.175  69.545  1.00 26.47 ? 553 VAL D CA    1 
ATOM   3416 C C     . VAL G 2 57 ? 39.813  36.837  68.115  1.00 26.59 ? 553 VAL D C     1 
ATOM   3417 O O     . VAL G 2 57 ? 40.608  37.560  67.506  1.00 27.90 ? 553 VAL D O     1 
ATOM   3418 C CB    . VAL G 2 57 ? 40.524  36.702  70.513  1.00 26.74 ? 553 VAL D CB    1 
ATOM   3419 C CG1   . VAL G 2 57 ? 40.201  37.156  71.924  1.00 27.50 ? 553 VAL D CG1   1 
ATOM   3420 C CG2   . VAL G 2 57 ? 40.705  35.189  70.437  1.00 27.01 ? 553 VAL D CG2   1 
ATOM   3421 N N     . GLN G 2 58 ? 39.285  35.741  67.578  1.00 25.44 ? 554 GLN D N     1 
ATOM   3422 C CA    . GLN G 2 58 ? 39.594  35.359  66.205  1.00 25.83 ? 554 GLN D CA    1 
ATOM   3423 C C     . GLN G 2 58 ? 38.882  36.352  65.285  1.00 26.33 ? 554 GLN D C     1 
ATOM   3424 O O     . GLN G 2 58 ? 39.424  36.777  64.259  1.00 26.52 ? 554 GLN D O     1 
ATOM   3425 C CB    . GLN G 2 58 ? 39.121  33.924  65.932  1.00 25.36 ? 554 GLN D CB    1 
ATOM   3426 C CG    . GLN G 2 58 ? 39.849  32.884  66.796  1.00 25.36 ? 554 GLN D CG    1 
ATOM   3427 C CD    . GLN G 2 58 ? 39.282  31.480  66.672  1.00 25.94 ? 554 GLN D CD    1 
ATOM   3428 O OE1   . GLN G 2 58 ? 38.071  31.294  66.528  1.00 26.21 ? 554 GLN D OE1   1 
ATOM   3429 N NE2   . GLN G 2 58 ? 40.155  30.482  66.751  1.00 24.15 ? 554 GLN D NE2   1 
ATOM   3430 N N     . ALA G 2 59 ? 37.676  36.745  65.677  1.00 26.30 ? 555 ALA D N     1 
ATOM   3431 C CA    . ALA G 2 59 ? 36.893  37.697  64.899  1.00 26.27 ? 555 ALA D CA    1 
ATOM   3432 C C     . ALA G 2 59 ? 37.538  39.078  64.961  1.00 26.79 ? 555 ALA D C     1 
ATOM   3433 O O     . ALA G 2 59 ? 37.572  39.810  63.969  1.00 26.50 ? 555 ALA D O     1 
ATOM   3434 C CB    . ALA G 2 59 ? 35.469  37.760  65.437  1.00 27.25 ? 555 ALA D CB    1 
ATOM   3435 N N     . GLU G 2 60 ? 38.036  39.438  66.138  1.00 27.01 ? 556 GLU D N     1 
ATOM   3436 C CA    . GLU G 2 60 ? 38.686  40.727  66.322  1.00 27.83 ? 556 GLU D CA    1 
ATOM   3437 C C     . GLU G 2 60 ? 39.895  40.768  65.400  1.00 27.95 ? 556 GLU D C     1 
ATOM   3438 O O     . GLU G 2 60 ? 40.111  41.754  64.690  1.00 27.53 ? 556 GLU D O     1 
ATOM   3439 C CB    . GLU G 2 60 ? 39.141  40.887  67.775  1.00 29.81 ? 556 GLU D CB    1 
ATOM   3440 C CG    . GLU G 2 60 ? 39.599  42.290  68.159  1.00 33.37 ? 556 GLU D CG    1 
ATOM   3441 C CD    . GLU G 2 60 ? 40.374  42.313  69.477  1.00 34.70 ? 556 GLU D CD    1 
ATOM   3442 O OE1   . GLU G 2 60 ? 40.227  41.364  70.280  1.00 36.40 ? 556 GLU D OE1   1 
ATOM   3443 O OE2   . GLU G 2 60 ? 41.127  43.283  69.717  1.00 36.50 ? 556 GLU D OE2   1 
ATOM   3444 N N     . GLU G 2 61 ? 40.682  39.692  65.396  1.00 28.02 ? 557 GLU D N     1 
ATOM   3445 C CA    . GLU G 2 61 ? 41.865  39.663  64.548  1.00 27.62 ? 557 GLU D CA    1 
ATOM   3446 C C     . GLU G 2 61 ? 41.489  39.986  63.112  1.00 27.73 ? 557 GLU D C     1 
ATOM   3447 O O     . GLU G 2 61 ? 42.161  40.771  62.460  1.00 26.96 ? 557 GLU D O     1 
ATOM   3448 C CB    . GLU G 2 61 ? 42.575  38.302  64.592  1.00 28.45 ? 557 GLU D CB    1 
ATOM   3449 C CG    . GLU G 2 61 ? 43.716  38.232  63.575  1.00 28.95 ? 557 GLU D CG    1 
ATOM   3450 C CD    . GLU G 2 61 ? 44.717  37.108  63.821  1.00 30.12 ? 557 GLU D CD    1 
ATOM   3451 O OE1   . GLU G 2 61 ? 44.324  35.919  63.816  1.00 27.58 ? 557 GLU D OE1   1 
ATOM   3452 O OE2   . GLU G 2 61 ? 45.915  37.434  64.007  1.00 30.68 ? 557 GLU D OE2   1 
ATOM   3453 N N     . GLN G 2 62 ? 40.415  39.373  62.627  1.00 27.87 ? 558 GLN D N     1 
ATOM   3454 C CA    . GLN G 2 62 ? 39.955  39.601  61.261  1.00 29.10 ? 558 GLN D CA    1 
ATOM   3455 C C     . GLN G 2 62 ? 39.636  41.075  61.061  1.00 28.14 ? 558 GLN D C     1 
ATOM   3456 O O     . GLN G 2 62 ? 40.037  41.673  60.068  1.00 27.40 ? 558 GLN D O     1 
ATOM   3457 C CB    . GLN G 2 62 ? 38.707  38.760  60.980  1.00 31.12 ? 558 GLN D CB    1 
ATOM   3458 C CG    . GLN G 2 62 ? 38.960  37.261  60.933  1.00 33.52 ? 558 GLN D CG    1 
ATOM   3459 C CD    . GLN G 2 62 ? 39.566  36.814  59.615  1.00 35.53 ? 558 GLN D CD    1 
ATOM   3460 O OE1   . GLN G 2 62 ? 40.678  37.212  59.256  1.00 34.83 ? 558 GLN D OE1   1 
ATOM   3461 N NE2   . GLN G 2 62 ? 38.827  35.982  58.878  1.00 35.98 ? 558 GLN D NE2   1 
ATOM   3462 N N     . LYS G 2 63 ? 38.912  41.655  62.012  1.00 27.61 ? 559 LYS D N     1 
ATOM   3463 C CA    . LYS G 2 63 ? 38.543  43.065  61.938  1.00 29.05 ? 559 LYS D CA    1 
ATOM   3464 C C     . LYS G 2 63 ? 39.774  43.973  61.930  1.00 28.37 ? 559 LYS D C     1 
ATOM   3465 O O     . LYS G 2 63 ? 39.808  44.985  61.224  1.00 28.41 ? 559 LYS D O     1 
ATOM   3466 C CB    . LYS G 2 63 ? 37.650  43.441  63.120  1.00 29.35 ? 559 LYS D CB    1 
ATOM   3467 C CG    . LYS G 2 63 ? 37.208  44.901  63.115  1.00 32.85 ? 559 LYS D CG    1 
ATOM   3468 C CD    . LYS G 2 63 ? 36.451  45.264  64.378  1.00 33.05 ? 559 LYS D CD    1 
ATOM   3469 C CE    . LYS G 2 63 ? 37.378  45.263  65.588  1.00 35.02 ? 559 LYS D CE    1 
ATOM   3470 N NZ    . LYS G 2 63 ? 36.629  45.441  66.864  1.00 35.44 ? 559 LYS D NZ    1 
ATOM   3471 N N     . LEU G 2 64 ? 40.780  43.611  62.719  1.00 28.03 ? 560 LEU D N     1 
ATOM   3472 C CA    . LEU G 2 64 ? 42.004  44.397  62.805  1.00 27.25 ? 560 LEU D CA    1 
ATOM   3473 C C     . LEU G 2 64 ? 42.899  44.198  61.588  1.00 26.87 ? 560 LEU D C     1 
ATOM   3474 O O     . LEU G 2 64 ? 43.618  45.107  61.185  1.00 25.73 ? 560 LEU D O     1 
ATOM   3475 C CB    . LEU G 2 64 ? 42.773  44.037  64.076  1.00 27.61 ? 560 LEU D CB    1 
ATOM   3476 C CG    . LEU G 2 64 ? 42.015  44.247  65.385  1.00 27.37 ? 560 LEU D CG    1 
ATOM   3477 C CD1   . LEU G 2 64 ? 42.830  43.669  66.540  1.00 28.01 ? 560 LEU D CD1   1 
ATOM   3478 C CD2   . LEU G 2 64 ? 41.747  45.735  65.596  1.00 28.70 ? 560 LEU D CD2   1 
ATOM   3479 N N     . ILE G 2 65 ? 42.873  43.008  61.002  1.00 26.90 ? 561 ILE D N     1 
ATOM   3480 C CA    . ILE G 2 65 ? 43.691  42.769  59.818  1.00 28.15 ? 561 ILE D CA    1 
ATOM   3481 C C     . ILE G 2 65 ? 43.182  43.667  58.694  1.00 28.33 ? 561 ILE D C     1 
ATOM   3482 O O     . ILE G 2 65 ? 43.961  44.294  57.975  1.00 27.29 ? 561 ILE D O     1 
ATOM   3483 C CB    . ILE G 2 65 ? 43.622  41.291  59.369  1.00 28.45 ? 561 ILE D CB    1 
ATOM   3484 C CG1   . ILE G 2 65 ? 44.359  40.415  60.384  1.00 28.87 ? 561 ILE D CG1   1 
ATOM   3485 C CG2   . ILE G 2 65 ? 44.253  41.128  57.984  1.00 29.68 ? 561 ILE D CG2   1 
ATOM   3486 C CD1   . ILE G 2 65 ? 44.318  38.936  60.064  1.00 28.41 ? 561 ILE D CD1   1 
ATOM   3487 N N     . SER G 2 66 ? 41.864  43.741  58.569  1.00 28.65 ? 562 SER D N     1 
ATOM   3488 C CA    . SER G 2 66 ? 41.243  44.557  57.540  1.00 29.83 ? 562 SER D CA    1 
ATOM   3489 C C     . SER G 2 66 ? 41.439  46.043  57.787  1.00 29.11 ? 562 SER D C     1 
ATOM   3490 O O     . SER G 2 66 ? 41.728  46.798  56.857  1.00 28.77 ? 562 SER D O     1 
ATOM   3491 C CB    . SER G 2 66 ? 39.752  44.255  57.463  1.00 30.02 ? 562 SER D CB    1 
ATOM   3492 O OG    . SER G 2 66 ? 39.549  42.895  57.134  1.00 31.10 ? 562 SER D OG    1 
ATOM   3493 N N     . GLU G 2 67 ? 41.272  46.468  59.034  1.00 28.85 ? 563 GLU D N     1 
ATOM   3494 C CA    . GLU G 2 67 ? 41.429  47.880  59.349  1.00 29.35 ? 563 GLU D CA    1 
ATOM   3495 C C     . GLU G 2 67 ? 42.851  48.333  59.050  1.00 28.82 ? 563 GLU D C     1 
ATOM   3496 O O     . GLU G 2 67 ? 43.048  49.391  58.455  1.00 28.07 ? 563 GLU D O     1 
ATOM   3497 C CB    . GLU G 2 67 ? 41.076  48.162  60.813  1.00 30.98 ? 563 GLU D CB    1 
ATOM   3498 C CG    . GLU G 2 67 ? 41.285  49.626  61.208  1.00 34.02 ? 563 GLU D CG    1 
ATOM   3499 C CD    . GLU G 2 67 ? 40.659  49.986  62.545  1.00 35.80 ? 563 GLU D CD    1 
ATOM   3500 O OE1   . GLU G 2 67 ? 40.796  49.195  63.506  1.00 36.29 ? 563 GLU D OE1   1 
ATOM   3501 O OE2   . GLU G 2 67 ? 40.037  51.069  62.637  1.00 37.12 ? 563 GLU D OE2   1 
ATOM   3502 N N     . GLU G 2 68 ? 43.841  47.531  59.443  1.00 28.17 ? 564 GLU D N     1 
ATOM   3503 C CA    . GLU G 2 68 ? 45.237  47.887  59.185  1.00 27.96 ? 564 GLU D CA    1 
ATOM   3504 C C     . GLU G 2 68 ? 45.518  47.954  57.682  1.00 28.05 ? 564 GLU D C     1 
ATOM   3505 O O     . GLU G 2 68 ? 46.244  48.832  57.221  1.00 27.34 ? 564 GLU D O     1 
ATOM   3506 C CB    . GLU G 2 68 ? 46.200  46.885  59.838  1.00 28.71 ? 564 GLU D CB    1 
ATOM   3507 C CG    . GLU G 2 68 ? 47.672  47.202  59.562  1.00 30.12 ? 564 GLU D CG    1 
ATOM   3508 C CD    . GLU G 2 68 ? 48.644  46.311  60.317  1.00 31.62 ? 564 GLU D CD    1 
ATOM   3509 O OE1   . GLU G 2 68 ? 49.861  46.434  60.077  1.00 31.84 ? 564 GLU D OE1   1 
ATOM   3510 O OE2   . GLU G 2 68 ? 48.204  45.492  61.149  1.00 33.07 ? 564 GLU D OE2   1 
ATOM   3511 N N     . ASP G 2 69 ? 44.951  47.025  56.920  1.00 28.44 ? 565 ASP D N     1 
ATOM   3512 C CA    . ASP G 2 69 ? 45.161  47.026  55.479  1.00 29.09 ? 565 ASP D CA    1 
ATOM   3513 C C     . ASP G 2 69 ? 44.683  48.345  54.890  1.00 28.56 ? 565 ASP D C     1 
ATOM   3514 O O     . ASP G 2 69 ? 45.407  48.990  54.129  1.00 28.51 ? 565 ASP D O     1 
ATOM   3515 C CB    . ASP G 2 69 ? 44.421  45.858  54.820  1.00 30.24 ? 565 ASP D CB    1 
ATOM   3516 C CG    . ASP G 2 69 ? 44.384  45.978  53.306  1.00 32.34 ? 565 ASP D CG    1 
ATOM   3517 O OD1   . ASP G 2 69 ? 43.430  46.590  52.776  1.00 33.05 ? 565 ASP D OD1   1 
ATOM   3518 O OD2   . ASP G 2 69 ? 45.321  45.481  52.645  1.00 32.12 ? 565 ASP D OD2   1 
ATOM   3519 N N     . LEU G 2 70 ? 43.469  48.748  55.259  1.00 28.52 ? 566 LEU D N     1 
ATOM   3520 C CA    . LEU G 2 70 ? 42.891  49.999  54.775  1.00 28.25 ? 566 LEU D CA    1 
ATOM   3521 C C     . LEU G 2 70 ? 43.707  51.212  55.206  1.00 27.60 ? 566 LEU D C     1 
ATOM   3522 O O     . LEU G 2 70 ? 43.866  52.167  54.444  1.00 26.90 ? 566 LEU D O     1 
ATOM   3523 C CB    . LEU G 2 70 ? 41.449  50.140  55.266  1.00 29.94 ? 566 LEU D CB    1 
ATOM   3524 C CG    . LEU G 2 70 ? 40.394  49.350  54.475  1.00 31.63 ? 566 LEU D CG    1 
ATOM   3525 C CD1   . LEU G 2 70 ? 40.852  47.909  54.270  1.00 32.58 ? 566 LEU D CD1   1 
ATOM   3526 C CD2   . LEU G 2 70 ? 39.059  49.397  55.209  1.00 32.20 ? 566 LEU D CD2   1 
ATOM   3527 N N     . LEU G 2 71 ? 44.233  51.177  56.425  1.00 25.60 ? 567 LEU D N     1 
ATOM   3528 C CA    . LEU G 2 71 ? 45.035  52.292  56.914  1.00 25.37 ? 567 LEU D CA    1 
ATOM   3529 C C     . LEU G 2 71 ? 46.352  52.445  56.157  1.00 26.01 ? 567 LEU D C     1 
ATOM   3530 O O     . LEU G 2 71 ? 46.756  53.566  55.824  1.00 25.23 ? 567 LEU D O     1 
ATOM   3531 C CB    . LEU G 2 71 ? 45.321  52.131  58.406  1.00 25.11 ? 567 LEU D CB    1 
ATOM   3532 C CG    . LEU G 2 71 ? 44.146  52.414  59.340  1.00 24.34 ? 567 LEU D CG    1 
ATOM   3533 C CD1   . LEU G 2 71 ? 44.541  52.049  60.759  1.00 24.66 ? 567 LEU D CD1   1 
ATOM   3534 C CD2   . LEU G 2 71 ? 43.756  53.884  59.250  1.00 25.03 ? 567 LEU D CD2   1 
ATOM   3535 N N     . ARG G 2 72 ? 47.028  51.333  55.885  1.00 25.00 ? 568 ARG D N     1 
ATOM   3536 C CA    . ARG G 2 72 ? 48.290  51.416  55.158  1.00 26.92 ? 568 ARG D CA    1 
ATOM   3537 C C     . ARG G 2 72 ? 48.026  51.953  53.760  1.00 27.33 ? 568 ARG D C     1 
ATOM   3538 O O     . ARG G 2 72 ? 48.793  52.767  53.247  1.00 26.81 ? 568 ARG D O     1 
ATOM   3539 C CB    . ARG G 2 72 ? 48.967  50.048  55.067  1.00 28.78 ? 568 ARG D CB    1 
ATOM   3540 C CG    . ARG G 2 72 ? 49.491  49.538  56.392  1.00 30.32 ? 568 ARG D CG    1 
ATOM   3541 C CD    . ARG G 2 72 ? 50.310  48.266  56.206  1.00 31.74 ? 568 ARG D CD    1 
ATOM   3542 N NE    . ARG G 2 72 ? 50.898  47.826  57.466  1.00 33.49 ? 568 ARG D NE    1 
ATOM   3543 C CZ    . ARG G 2 72 ? 51.757  48.543  58.181  1.00 34.54 ? 568 ARG D CZ    1 
ATOM   3544 N NH1   . ARG G 2 72 ? 52.137  49.744  57.762  1.00 35.95 ? 568 ARG D NH1   1 
ATOM   3545 N NH2   . ARG G 2 72 ? 52.235  48.062  59.319  1.00 35.32 ? 568 ARG D NH2   1 
ATOM   3546 N N     . LYS G 2 73 ? 46.937  51.494  53.151  1.00 27.65 ? 569 LYS D N     1 
ATOM   3547 C CA    . LYS G 2 73 ? 46.570  51.953  51.816  1.00 29.65 ? 569 LYS D CA    1 
ATOM   3548 C C     . LYS G 2 73 ? 46.395  53.462  51.850  1.00 29.53 ? 569 LYS D C     1 
ATOM   3549 O O     . LYS G 2 73 ? 46.970  54.184  51.034  1.00 29.41 ? 569 LYS D O     1 
ATOM   3550 C CB    . LYS G 2 73 ? 45.251  51.326  51.368  1.00 30.36 ? 569 LYS D CB    1 
ATOM   3551 C CG    . LYS G 2 73 ? 45.364  49.994  50.655  1.00 33.18 ? 569 LYS D CG    1 
ATOM   3552 C CD    . LYS G 2 73 ? 44.003  49.604  50.092  1.00 35.43 ? 569 LYS D CD    1 
ATOM   3553 C CE    . LYS G 2 73 ? 43.481  50.682  49.140  1.00 36.73 ? 569 LYS D CE    1 
ATOM   3554 N NZ    . LYS G 2 73 ? 42.059  50.461  48.732  1.00 37.00 ? 569 LYS D NZ    1 
ATOM   3555 N N     . ARG G 2 74 ? 45.592  53.922  52.805  1.00 30.24 ? 570 ARG D N     1 
ATOM   3556 C CA    . ARG G 2 74 ? 45.295  55.340  52.978  1.00 30.52 ? 570 ARG D CA    1 
ATOM   3557 C C     . ARG G 2 74 ? 46.563  56.163  53.223  1.00 30.77 ? 570 ARG D C     1 
ATOM   3558 O O     . ARG G 2 74 ? 46.676  57.291  52.747  1.00 29.91 ? 570 ARG D O     1 
ATOM   3559 C CB    . ARG G 2 74 ? 44.308  55.513  54.132  1.00 32.22 ? 570 ARG D CB    1 
ATOM   3560 C CG    . ARG G 2 74 ? 43.406  56.742  54.053  1.00 35.73 ? 570 ARG D CG    1 
ATOM   3561 C CD    . ARG G 2 74 ? 44.134  58.003  54.465  1.00 37.97 ? 570 ARG D CD    1 
ATOM   3562 N NE    . ARG G 2 74 ? 43.254  59.171  54.560  1.00 40.68 ? 570 ARG D NE    1 
ATOM   3563 C CZ    . ARG G 2 74 ? 42.693  59.786  53.522  1.00 40.66 ? 570 ARG D CZ    1 
ATOM   3564 N NH1   . ARG G 2 74 ? 42.909  59.353  52.289  1.00 42.31 ? 570 ARG D NH1   1 
ATOM   3565 N NH2   . ARG G 2 74 ? 41.928  60.850  53.719  1.00 40.28 ? 570 ARG D NH2   1 
ATOM   3566 N N     . ARG G 2 75 ? 47.523  55.600  53.950  1.00 29.80 ? 571 ARG D N     1 
ATOM   3567 C CA    . ARG G 2 75 ? 48.759  56.321  54.208  1.00 30.82 ? 571 ARG D CA    1 
ATOM   3568 C C     . ARG G 2 75 ? 49.516  56.477  52.892  1.00 31.97 ? 571 ARG D C     1 
ATOM   3569 O O     . ARG G 2 75 ? 50.152  57.504  52.649  1.00 31.04 ? 571 ARG D O     1 
ATOM   3570 C CB    . ARG G 2 75 ? 49.631  55.575  55.218  1.00 29.19 ? 571 ARG D CB    1 
ATOM   3571 C CG    . ARG G 2 75 ? 50.810  56.399  55.715  1.00 29.56 ? 571 ARG D CG    1 
ATOM   3572 C CD    . ARG G 2 75 ? 51.709  55.611  56.648  1.00 28.07 ? 571 ARG D CD    1 
ATOM   3573 N NE    . ARG G 2 75 ? 52.303  54.463  55.976  1.00 28.71 ? 571 ARG D NE    1 
ATOM   3574 C CZ    . ARG G 2 75 ? 53.133  53.603  56.557  1.00 30.45 ? 571 ARG D CZ    1 
ATOM   3575 N NH1   . ARG G 2 75 ? 53.476  53.762  57.831  1.00 30.30 ? 571 ARG D NH1   1 
ATOM   3576 N NH2   . ARG G 2 75 ? 53.611  52.576  55.868  1.00 29.46 ? 571 ARG D NH2   1 
ATOM   3577 N N     . GLU G 2 76 ? 49.444  55.450  52.048  1.00 33.95 ? 572 GLU D N     1 
ATOM   3578 C CA    . GLU G 2 76 ? 50.107  55.475  50.748  1.00 35.93 ? 572 GLU D CA    1 
ATOM   3579 C C     . GLU G 2 76 ? 49.448  56.565  49.907  1.00 35.41 ? 572 GLU D C     1 
ATOM   3580 O O     . GLU G 2 76 ? 50.123  57.350  49.242  1.00 34.90 ? 572 GLU D O     1 
ATOM   3581 C CB    . GLU G 2 76 ? 49.949  54.127  50.036  1.00 39.15 ? 572 GLU D CB    1 
ATOM   3582 C CG    . GLU G 2 76 ? 50.382  52.917  50.857  1.00 43.85 ? 572 GLU D CG    1 
ATOM   3583 C CD    . GLU G 2 76 ? 50.056  51.590  50.172  1.00 45.74 ? 572 GLU D CD    1 
ATOM   3584 O OE1   . GLU G 2 76 ? 50.695  51.273  49.143  1.00 47.47 ? 572 GLU D OE1   1 
ATOM   3585 O OE2   . GLU G 2 76 ? 49.155  50.867  50.660  1.00 46.84 ? 572 GLU D OE2   1 
ATOM   3586 N N     . GLN G 2 77 ? 48.120  56.597  49.945  1.00 34.40 ? 573 GLN D N     1 
ATOM   3587 C CA    . GLN G 2 77 ? 47.345  57.582  49.201  1.00 34.74 ? 573 GLN D CA    1 
ATOM   3588 C C     . GLN G 2 77 ? 47.683  59.002  49.627  1.00 33.00 ? 573 GLN D C     1 
ATOM   3589 O O     . GLN G 2 77 ? 47.782  59.894  48.792  1.00 32.11 ? 573 GLN D O     1 
ATOM   3590 C CB    . GLN G 2 77 ? 45.846  57.346  49.405  1.00 36.45 ? 573 GLN D CB    1 
ATOM   3591 C CG    . GLN G 2 77 ? 45.343  56.013  48.873  1.00 40.19 ? 573 GLN D CG    1 
ATOM   3592 C CD    . GLN G 2 77 ? 43.853  55.816  49.103  1.00 41.52 ? 573 GLN D CD    1 
ATOM   3593 O OE1   . GLN G 2 77 ? 43.289  54.783  48.731  1.00 43.33 ? 573 GLN D OE1   1 
ATOM   3594 N NE2   . GLN G 2 77 ? 43.208  56.805  49.720  1.00 42.62 ? 573 GLN D NE2   1 
ATOM   3595 N N     . LEU G 2 78 ? 47.859  59.205  50.930  1.00 32.18 ? 574 LEU D N     1 
ATOM   3596 C CA    . LEU G 2 78 ? 48.173  60.527  51.464  1.00 31.38 ? 574 LEU D CA    1 
ATOM   3597 C C     . LEU G 2 78 ? 49.553  61.005  51.048  1.00 31.64 ? 574 LEU D C     1 
ATOM   3598 O O     . LEU G 2 78 ? 49.705  62.140  50.592  1.00 31.58 ? 574 LEU D O     1 
ATOM   3599 C CB    . LEU G 2 78 ? 48.051  60.527  52.993  1.00 30.85 ? 574 LEU D CB    1 
ATOM   3600 C CG    . LEU G 2 78 ? 46.614  60.440  53.517  1.00 31.27 ? 574 LEU D CG    1 
ATOM   3601 C CD1   . LEU G 2 78 ? 46.618  60.196  55.018  1.00 29.37 ? 574 LEU D CD1   1 
ATOM   3602 C CD2   . LEU G 2 78 ? 45.864  61.725  53.177  1.00 29.64 ? 574 LEU D CD2   1 
ATOM   3603 N N     . LYS G 2 79 ? 50.559  60.147  51.209  1.00 32.03 ? 575 LYS D N     1 
ATOM   3604 C CA    . LYS G 2 79 ? 51.922  60.498  50.823  1.00 32.01 ? 575 LYS D CA    1 
ATOM   3605 C C     . LYS G 2 79 ? 51.926  60.832  49.339  1.00 31.94 ? 575 LYS D C     1 
ATOM   3606 O O     . LYS G 2 79 ? 52.491  61.837  48.920  1.00 31.58 ? 575 LYS D O     1 
ATOM   3607 C CB    . LYS G 2 79 ? 52.876  59.332  51.072  1.00 32.97 ? 575 LYS D CB    1 
ATOM   3608 C CG    . LYS G 2 79 ? 53.289  59.125  52.519  1.00 34.87 ? 575 LYS D CG    1 
ATOM   3609 C CD    . LYS G 2 79 ? 54.376  58.057  52.592  1.00 36.25 ? 575 LYS D CD    1 
ATOM   3610 C CE    . LYS G 2 79 ? 55.157  58.119  53.899  1.00 37.49 ? 575 LYS D CE    1 
ATOM   3611 N NZ    . LYS G 2 79 ? 54.314  57.866  55.093  1.00 37.88 ? 575 LYS D NZ    1 
ATOM   3612 N N     . HIS G 2 80 ? 51.292  59.973  48.549  1.00 31.83 ? 576 HIS D N     1 
ATOM   3613 C CA    . HIS G 2 80 ? 51.211  60.178  47.108  1.00 32.72 ? 576 HIS D CA    1 
ATOM   3614 C C     . HIS G 2 80 ? 50.650  61.566  46.832  1.00 32.29 ? 576 HIS D C     1 
ATOM   3615 O O     . HIS G 2 80 ? 51.219  62.329  46.053  1.00 32.15 ? 576 HIS D O     1 
ATOM   3616 C CB    . HIS G 2 80 ? 50.298  59.126  46.467  1.00 33.03 ? 576 HIS D CB    1 
ATOM   3617 C CG    . HIS G 2 80 ? 50.141  59.289  44.988  1.00 34.68 ? 576 HIS D CG    1 
ATOM   3618 N ND1   . HIS G 2 80 ? 51.193  59.148  44.110  1.00 35.36 ? 576 HIS D ND1   1 
ATOM   3619 C CD2   . HIS G 2 80 ? 49.061  59.604  44.233  1.00 35.31 ? 576 HIS D CD2   1 
ATOM   3620 C CE1   . HIS G 2 80 ? 50.769  59.368  42.877  1.00 36.06 ? 576 HIS D CE1   1 
ATOM   3621 N NE2   . HIS G 2 80 ? 49.478  59.647  42.925  1.00 35.39 ? 576 HIS D NE2   1 
ATOM   3622 N N     . LYS G 2 81 ? 49.536  61.883  47.486  1.00 32.25 ? 577 LYS D N     1 
ATOM   3623 C CA    . LYS G 2 81 ? 48.883  63.173  47.320  1.00 33.49 ? 577 LYS D CA    1 
ATOM   3624 C C     . LYS G 2 81 ? 49.844  64.314  47.638  1.00 33.22 ? 577 LYS D C     1 
ATOM   3625 O O     . LYS G 2 81 ? 49.906  65.303  46.910  1.00 33.33 ? 577 LYS D O     1 
ATOM   3626 C CB    . LYS G 2 81 ? 47.644  63.260  48.218  1.00 33.85 ? 577 LYS D CB    1 
ATOM   3627 C CG    . LYS G 2 81 ? 46.958  64.615  48.195  1.00 35.19 ? 577 LYS D CG    1 
ATOM   3628 C CD    . LYS G 2 81 ? 45.730  64.645  49.097  1.00 37.51 ? 577 LYS D CD    1 
ATOM   3629 C CE    . LYS G 2 81 ? 44.502  64.102  48.392  1.00 37.61 ? 577 LYS D CE    1 
ATOM   3630 N NZ    . LYS G 2 81 ? 44.063  65.009  47.290  1.00 40.27 ? 577 LYS D NZ    1 
ATOM   3631 N N     . LEU G 2 82 ? 50.606  64.166  48.717  1.00 32.99 ? 578 LEU D N     1 
ATOM   3632 C CA    . LEU G 2 82 ? 51.564  65.193  49.111  1.00 32.47 ? 578 LEU D CA    1 
ATOM   3633 C C     . LEU G 2 82 ? 52.691  65.436  48.105  1.00 33.12 ? 578 LEU D C     1 
ATOM   3634 O O     . LEU G 2 82 ? 52.997  66.583  47.782  1.00 31.86 ? 578 LEU D O     1 
ATOM   3635 C CB    . LEU G 2 82 ? 52.160  64.861  50.479  1.00 32.12 ? 578 LEU D CB    1 
ATOM   3636 C CG    . LEU G 2 82 ? 51.235  65.173  51.661  1.00 32.25 ? 578 LEU D CG    1 
ATOM   3637 C CD1   . LEU G 2 82 ? 51.879  64.694  52.957  1.00 31.57 ? 578 LEU D CD1   1 
ATOM   3638 C CD2   . LEU G 2 82 ? 50.954  66.678  51.716  1.00 31.19 ? 578 LEU D CD2   1 
ATOM   3639 N N     . GLU G 2 83 ? 53.326  64.379  47.609  1.00 33.83 ? 579 GLU D N     1 
ATOM   3640 C CA    . GLU G 2 83 ? 54.401  64.596  46.648  1.00 34.85 ? 579 GLU D CA    1 
ATOM   3641 C C     . GLU G 2 83 ? 53.861  65.135  45.327  1.00 34.54 ? 579 GLU D C     1 
ATOM   3642 O O     . GLU G 2 83 ? 54.588  65.762  44.561  1.00 35.06 ? 579 GLU D O     1 
ATOM   3643 C CB    . GLU G 2 83 ? 55.193  63.315  46.409  1.00 36.71 ? 579 GLU D CB    1 
ATOM   3644 C CG    . GLU G 2 83 ? 54.354  62.101  46.143  1.00 38.64 ? 579 GLU D CG    1 
ATOM   3645 C CD    . GLU G 2 83 ? 55.206  60.900  45.807  1.00 40.12 ? 579 GLU D CD    1 
ATOM   3646 O OE1   . GLU G 2 83 ? 55.417  60.645  44.599  1.00 40.86 ? 579 GLU D OE1   1 
ATOM   3647 O OE2   . GLU G 2 83 ? 55.674  60.227  46.751  1.00 39.74 ? 579 GLU D OE2   1 
ATOM   3648 N N     . GLN G 2 84 ? 52.579  64.901  45.076  1.00 35.71 ? 580 GLN D N     1 
ATOM   3649 C CA    . GLN G 2 84 ? 51.942  65.381  43.857  1.00 37.00 ? 580 GLN D CA    1 
ATOM   3650 C C     . GLN G 2 84 ? 51.791  66.902  43.925  1.00 37.41 ? 580 GLN D C     1 
ATOM   3651 O O     . GLN G 2 84 ? 51.976  67.599  42.926  1.00 36.36 ? 580 GLN D O     1 
ATOM   3652 C CB    . GLN G 2 84 ? 50.569  64.733  43.694  1.00 38.76 ? 580 GLN D CB    1 
ATOM   3653 C CG    . GLN G 2 84 ? 50.201  64.430  42.256  1.00 42.86 ? 580 GLN D CG    1 
ATOM   3654 C CD    . GLN G 2 84 ? 51.006  63.280  41.687  1.00 43.63 ? 580 GLN D CD    1 
ATOM   3655 O OE1   . GLN G 2 84 ? 52.226  63.230  41.835  1.00 44.20 ? 580 GLN D OE1   1 
ATOM   3656 N NE2   . GLN G 2 84 ? 50.327  62.352  41.027  1.00 45.47 ? 580 GLN D NE2   1 
ATOM   3657 N N     . LEU G 2 85 ? 51.459  67.417  45.109  1.00 37.65 ? 581 LEU D N     1 
ATOM   3658 C CA    . LEU G 2 85 ? 51.290  68.858  45.291  1.00 38.56 ? 581 LEU D CA    1 
ATOM   3659 C C     . LEU G 2 85 ? 52.620  69.583  45.118  1.00 38.85 ? 581 LEU D C     1 
ATOM   3660 O O     . LEU G 2 85 ? 53.497  69.359  45.982  1.00 39.58 ? 581 LEU D O     1 
ATOM   3661 C CB    . LEU G 2 85 ? 50.720  69.164  46.681  1.00 38.76 ? 581 LEU D CB    1 
ATOM   3662 C CG    . LEU G 2 85 ? 49.334  68.603  47.015  1.00 38.78 ? 581 LEU D CG    1 
ATOM   3663 C CD1   . LEU G 2 85 ? 48.986  68.938  48.456  1.00 39.55 ? 581 LEU D CD1   1 
ATOM   3664 C CD2   . LEU G 2 85 ? 48.295  69.179  46.068  1.00 39.36 ? 581 LEU D CD2   1 
ATOM   3665 N N     . ARG H 3 3  ? 17.227  6.803   93.511  1.00 29.15 ? 704 ARG E N     1 
ATOM   3666 C CA    . ARG H 3 3  ? 18.549  7.373   93.108  1.00 28.37 ? 704 ARG E CA    1 
ATOM   3667 C C     . ARG H 3 3  ? 18.669  7.480   91.585  1.00 28.34 ? 704 ARG E C     1 
ATOM   3668 O O     . ARG H 3 3  ? 19.421  8.309   91.067  1.00 26.33 ? 704 ARG E O     1 
ATOM   3669 C CB    . ARG H 3 3  ? 19.686  6.503   93.646  1.00 27.51 ? 704 ARG E CB    1 
ATOM   3670 C CG    . ARG H 3 3  ? 19.701  6.347   95.163  1.00 27.59 ? 704 ARG E CG    1 
ATOM   3671 C CD    . ARG H 3 3  ? 20.828  5.417   95.592  1.00 28.01 ? 704 ARG E CD    1 
ATOM   3672 N NE    . ARG H 3 3  ? 20.960  5.288   97.045  1.00 26.80 ? 704 ARG E NE    1 
ATOM   3673 C CZ    . ARG H 3 3  ? 20.048  4.749   97.851  1.00 27.88 ? 704 ARG E CZ    1 
ATOM   3674 N NH1   . ARG H 3 3  ? 18.907  4.277   97.365  1.00 25.67 ? 704 ARG E NH1   1 
ATOM   3675 N NH2   . ARG H 3 3  ? 20.291  4.663   99.153  1.00 27.16 ? 704 ARG E NH2   1 
ATOM   3676 N N     . ALA H 3 4  ? 17.917  6.646   90.871  1.00 27.88 ? 705 ALA E N     1 
ATOM   3677 C CA    . ALA H 3 4  ? 17.953  6.648   89.409  1.00 28.13 ? 705 ALA E CA    1 
ATOM   3678 C C     . ALA H 3 4  ? 17.802  8.040   88.795  1.00 27.80 ? 705 ALA E C     1 
ATOM   3679 O O     . ALA H 3 4  ? 18.500  8.390   87.838  1.00 26.88 ? 705 ALA E O     1 
ATOM   3680 C CB    . ALA H 3 4  ? 16.874  5.723   88.864  1.00 29.03 ? 705 ALA E CB    1 
ATOM   3681 N N     . HIS H 3 5  ? 16.889  8.831   89.348  1.00 27.43 ? 706 HIS E N     1 
ATOM   3682 C CA    . HIS H 3 5  ? 16.636  10.173  88.848  1.00 26.47 ? 706 HIS E CA    1 
ATOM   3683 C C     . HIS H 3 5  ? 17.885  11.053  88.944  1.00 25.11 ? 706 HIS E C     1 
ATOM   3684 O O     . HIS H 3 5  ? 18.307  11.651  87.954  1.00 23.07 ? 706 HIS E O     1 
ATOM   3685 C CB    . HIS H 3 5  ? 15.483  10.795  89.633  1.00 29.00 ? 706 HIS E CB    1 
ATOM   3686 C CG    . HIS H 3 5  ? 14.919  12.030  89.005  1.00 31.98 ? 706 HIS E CG    1 
ATOM   3687 N ND1   . HIS H 3 5  ? 15.643  13.195  88.870  1.00 34.16 ? 706 HIS E ND1   1 
ATOM   3688 C CD2   . HIS H 3 5  ? 13.687  12.293  88.509  1.00 33.96 ? 706 HIS E CD2   1 
ATOM   3689 C CE1   . HIS H 3 5  ? 14.881  14.125  88.320  1.00 34.52 ? 706 HIS E CE1   1 
ATOM   3690 N NE2   . HIS H 3 5  ? 13.689  13.603  88.092  1.00 35.16 ? 706 HIS E NE2   1 
ATOM   3691 N N     . HIS H 3 6  ? 18.469  11.125  90.139  1.00 23.67 ? 707 HIS E N     1 
ATOM   3692 C CA    . HIS H 3 6  ? 19.672  11.918  90.359  1.00 22.17 ? 707 HIS E CA    1 
ATOM   3693 C C     . HIS H 3 6  ? 20.775  11.449  89.416  1.00 21.85 ? 707 HIS E C     1 
ATOM   3694 O O     . HIS H 3 6  ? 21.525  12.264  88.877  1.00 22.47 ? 707 HIS E O     1 
ATOM   3695 C CB    . HIS H 3 6  ? 20.137  11.785  91.815  1.00 22.13 ? 707 HIS E CB    1 
ATOM   3696 C CG    . HIS H 3 6  ? 21.455  12.444  92.097  1.00 22.52 ? 707 HIS E CG    1 
ATOM   3697 N ND1   . HIS H 3 6  ? 21.732  13.746  91.740  1.00 23.47 ? 707 HIS E ND1   1 
ATOM   3698 C CD2   . HIS H 3 6  ? 22.555  11.991  92.745  1.00 23.32 ? 707 HIS E CD2   1 
ATOM   3699 C CE1   . HIS H 3 6  ? 22.943  14.069  92.160  1.00 22.67 ? 707 HIS E CE1   1 
ATOM   3700 N NE2   . HIS H 3 6  ? 23.463  13.021  92.773  1.00 23.00 ? 707 HIS E NE2   1 
ATOM   3701 N N     . ASN H 3 7  ? 20.864  10.137  89.212  1.00 21.52 ? 708 ASN E N     1 
ATOM   3702 C CA    . ASN H 3 7  ? 21.878  9.568   88.323  1.00 21.56 ? 708 ASN E CA    1 
ATOM   3703 C C     . ASN H 3 7  ? 21.685  10.080  86.889  1.00 21.07 ? 708 ASN E C     1 
ATOM   3704 O O     . ASN H 3 7  ? 22.630  10.551  86.251  1.00 20.74 ? 708 ASN E O     1 
ATOM   3705 C CB    . ASN H 3 7  ? 21.800  8.033   88.348  1.00 21.97 ? 708 ASN E CB    1 
ATOM   3706 C CG    . ASN H 3 7  ? 22.125  7.446   89.725  1.00 23.44 ? 708 ASN E CG    1 
ATOM   3707 O OD1   . ASN H 3 7  ? 21.936  6.246   89.969  1.00 25.46 ? 708 ASN E OD1   1 
ATOM   3708 N ND2   . ASN H 3 7  ? 22.623  8.286   90.624  1.00 19.93 ? 708 ASN E ND2   1 
ATOM   3709 N N     . ALA H 3 8  ? 20.459  9.980   86.387  1.00 20.53 ? 709 ALA E N     1 
ATOM   3710 C CA    . ALA H 3 8  ? 20.140  10.440  85.035  1.00 20.27 ? 709 ALA E CA    1 
ATOM   3711 C C     . ALA H 3 8  ? 20.532  11.904  84.846  1.00 20.85 ? 709 ALA E C     1 
ATOM   3712 O O     . ALA H 3 8  ? 21.121  12.271  83.830  1.00 22.05 ? 709 ALA E O     1 
ATOM   3713 C CB    . ALA H 3 8  ? 18.653  10.264  84.767  1.00 19.82 ? 709 ALA E CB    1 
ATOM   3714 N N     . LEU H 3 9  ? 20.197  12.744  85.822  1.00 20.56 ? 710 LEU E N     1 
ATOM   3715 C CA    . LEU H 3 9  ? 20.527  14.165  85.745  1.00 18.83 ? 710 LEU E CA    1 
ATOM   3716 C C     . LEU H 3 9  ? 22.025  14.432  85.778  1.00 17.50 ? 710 LEU E C     1 
ATOM   3717 O O     . LEU H 3 9  ? 22.508  15.290  85.059  1.00 18.16 ? 710 LEU E O     1 
ATOM   3718 C CB    . LEU H 3 9  ? 19.831  14.941  86.868  1.00 20.70 ? 710 LEU E CB    1 
ATOM   3719 C CG    . LEU H 3 9  ? 18.315  15.092  86.690  1.00 20.63 ? 710 LEU E CG    1 
ATOM   3720 C CD1   . LEU H 3 9  ? 17.745  15.849  87.876  1.00 23.86 ? 710 LEU E CD1   1 
ATOM   3721 C CD2   . LEU H 3 9  ? 18.008  15.825  85.380  1.00 21.75 ? 710 LEU E CD2   1 
ATOM   3722 N N     . GLU H 3 10 ? 22.765  13.699  86.605  1.00 20.03 ? 711 GLU E N     1 
ATOM   3723 C CA    . GLU H 3 10 ? 24.218  13.885  86.668  1.00 19.01 ? 711 GLU E CA    1 
ATOM   3724 C C     . GLU H 3 10 ? 24.820  13.473  85.317  1.00 19.85 ? 711 GLU E C     1 
ATOM   3725 O O     . GLU H 3 10 ? 25.727  14.114  84.798  1.00 18.95 ? 711 GLU E O     1 
ATOM   3726 C CB    . GLU H 3 10 ? 24.807  13.034  87.805  1.00 19.60 ? 711 GLU E CB    1 
ATOM   3727 C CG    . GLU H 3 10 ? 26.330  12.993  87.850  1.00 17.80 ? 711 GLU E CG    1 
ATOM   3728 C CD    . GLU H 3 10 ? 26.980  14.351  88.109  1.00 17.75 ? 711 GLU E CD    1 
ATOM   3729 O OE1   . GLU H 3 10 ? 26.263  15.350  88.357  1.00 18.30 ? 711 GLU E OE1   1 
ATOM   3730 O OE2   . GLU H 3 10 ? 28.228  14.414  88.069  1.00 19.74 ? 711 GLU E OE2   1 
ATOM   3731 N N     . ARG H 3 11 ? 24.289  12.397  84.751  1.00 21.55 ? 712 ARG E N     1 
ATOM   3732 C CA    . ARG H 3 11 ? 24.721  11.887  83.459  1.00 22.18 ? 712 ARG E CA    1 
ATOM   3733 C C     . ARG H 3 11 ? 24.547  12.972  82.384  1.00 21.34 ? 712 ARG E C     1 
ATOM   3734 O O     . ARG H 3 11 ? 25.434  13.204  81.566  1.00 21.82 ? 712 ARG E O     1 
ATOM   3735 C CB    . ARG H 3 11 ? 23.875  10.656  83.127  1.00 24.77 ? 712 ARG E CB    1 
ATOM   3736 C CG    . ARG H 3 11 ? 24.111  10.014  81.788  1.00 28.48 ? 712 ARG E CG    1 
ATOM   3737 C CD    . ARG H 3 11 ? 23.087  8.886   81.610  1.00 31.21 ? 712 ARG E CD    1 
ATOM   3738 N NE    . ARG H 3 11 ? 23.036  8.045   82.806  1.00 33.17 ? 712 ARG E NE    1 
ATOM   3739 C CZ    . ARG H 3 11 ? 21.941  7.447   83.272  1.00 34.06 ? 712 ARG E CZ    1 
ATOM   3740 N NH1   . ARG H 3 11 ? 20.777  7.584   82.648  1.00 35.05 ? 712 ARG E NH1   1 
ATOM   3741 N NH2   . ARG H 3 11 ? 22.011  6.721   84.380  1.00 35.20 ? 712 ARG E NH2   1 
ATOM   3742 N N     . LYS H 3 12 ? 23.397  13.633  82.389  1.00 21.27 ? 713 LYS E N     1 
ATOM   3743 C CA    . LYS H 3 12 ? 23.120  14.690  81.418  1.00 21.20 ? 713 LYS E CA    1 
ATOM   3744 C C     . LYS H 3 12 ? 24.056  15.887  81.644  1.00 19.83 ? 713 LYS E C     1 
ATOM   3745 O O     . LYS H 3 12 ? 24.559  16.489  80.704  1.00 17.90 ? 713 LYS E O     1 
ATOM   3746 C CB    . LYS H 3 12 ? 21.662  15.137  81.554  1.00 24.66 ? 713 LYS E CB    1 
ATOM   3747 C CG    . LYS H 3 12 ? 21.237  16.246  80.602  1.00 28.48 ? 713 LYS E CG    1 
ATOM   3748 C CD    . LYS H 3 12 ? 21.203  15.769  79.153  1.00 30.55 ? 713 LYS E CD    1 
ATOM   3749 C CE    . LYS H 3 12 ? 20.740  16.895  78.231  1.00 34.09 ? 713 LYS E CE    1 
ATOM   3750 N NZ    . LYS H 3 12 ? 20.609  16.472  76.806  1.00 33.04 ? 713 LYS E NZ    1 
ATOM   3751 N N     . ARG H 3 13 ? 24.299  16.219  82.905  1.00 19.65 ? 714 ARG E N     1 
ATOM   3752 C CA    . ARG H 3 13 ? 25.168  17.348  83.209  1.00 18.54 ? 714 ARG E CA    1 
ATOM   3753 C C     . ARG H 3 13 ? 26.579  17.059  82.684  1.00 17.92 ? 714 ARG E C     1 
ATOM   3754 O O     . ARG H 3 13 ? 27.222  17.933  82.104  1.00 18.45 ? 714 ARG E O     1 
ATOM   3755 C CB    . ARG H 3 13 ? 25.186  17.601  84.715  1.00 18.87 ? 714 ARG E CB    1 
ATOM   3756 C CG    . ARG H 3 13 ? 25.962  18.836  85.113  1.00 20.68 ? 714 ARG E CG    1 
ATOM   3757 C CD    . ARG H 3 13 ? 26.414  18.763  86.560  1.00 24.54 ? 714 ARG E CD    1 
ATOM   3758 N NE    . ARG H 3 13 ? 27.755  19.334  86.686  1.00 30.88 ? 714 ARG E NE    1 
ATOM   3759 C CZ    . ARG H 3 13 ? 28.847  18.635  86.963  1.00 28.87 ? 714 ARG E CZ    1 
ATOM   3760 N NH1   . ARG H 3 13 ? 28.779  17.318  87.157  1.00 29.46 ? 714 ARG E NH1   1 
ATOM   3761 N NH2   . ARG H 3 13 ? 30.014  19.255  87.046  1.00 31.43 ? 714 ARG E NH2   1 
ATOM   3762 N N     . ARG H 3 14 ? 27.053  15.829  82.876  1.00 18.13 ? 715 ARG E N     1 
ATOM   3763 C CA    . ARG H 3 14 ? 28.379  15.442  82.389  1.00 19.27 ? 715 ARG E CA    1 
ATOM   3764 C C     . ARG H 3 14 ? 28.398  15.523  80.863  1.00 19.72 ? 715 ARG E C     1 
ATOM   3765 O O     . ARG H 3 14 ? 29.400  15.897  80.254  1.00 17.23 ? 715 ARG E O     1 
ATOM   3766 C CB    . ARG H 3 14 ? 28.719  14.004  82.784  1.00 20.75 ? 715 ARG E CB    1 
ATOM   3767 C CG    . ARG H 3 14 ? 28.788  13.695  84.271  1.00 23.07 ? 715 ARG E CG    1 
ATOM   3768 C CD    . ARG H 3 14 ? 29.142  12.218  84.468  1.00 24.55 ? 715 ARG E CD    1 
ATOM   3769 N NE    . ARG H 3 14 ? 28.605  11.690  85.719  1.00 28.06 ? 715 ARG E NE    1 
ATOM   3770 C CZ    . ARG H 3 14 ? 27.808  10.630  85.804  1.00 27.44 ? 715 ARG E CZ    1 
ATOM   3771 N NH1   . ARG H 3 14 ? 27.449  9.969   84.708  1.00 26.58 ? 715 ARG E NH1   1 
ATOM   3772 N NH2   . ARG H 3 14 ? 27.359  10.240  86.983  1.00 27.28 ? 715 ARG E NH2   1 
ATOM   3773 N N     . ASP H 3 15 ? 27.281  15.147  80.250  1.00 21.07 ? 716 ASP E N     1 
ATOM   3774 C CA    . ASP H 3 15 ? 27.175  15.170  78.796  1.00 22.75 ? 716 ASP E CA    1 
ATOM   3775 C C     . ASP H 3 15 ? 27.303  16.600  78.263  1.00 22.51 ? 716 ASP E C     1 
ATOM   3776 O O     . ASP H 3 15 ? 27.870  16.816  77.193  1.00 22.34 ? 716 ASP E O     1 
ATOM   3777 C CB    . ASP H 3 15 ? 25.844  14.557  78.355  1.00 25.14 ? 716 ASP E CB    1 
ATOM   3778 C CG    . ASP H 3 15 ? 25.823  14.212  76.882  1.00 28.30 ? 716 ASP E CG    1 
ATOM   3779 O OD1   . ASP H 3 15 ? 26.671  13.405  76.448  1.00 30.58 ? 716 ASP E OD1   1 
ATOM   3780 O OD2   . ASP H 3 15 ? 24.959  14.749  76.156  1.00 31.38 ? 716 ASP E OD2   1 
ATOM   3781 N N     . HIS H 3 16 ? 26.785  17.575  79.005  1.00 21.64 ? 717 HIS E N     1 
ATOM   3782 C CA    . HIS H 3 16 ? 26.881  18.965  78.576  1.00 21.80 ? 717 HIS E CA    1 
ATOM   3783 C C     . HIS H 3 16 ? 28.341  19.418  78.666  1.00 20.81 ? 717 HIS E C     1 
ATOM   3784 O O     . HIS H 3 16 ? 28.815  20.200  77.835  1.00 19.64 ? 717 HIS E O     1 
ATOM   3785 C CB    . HIS H 3 16 ? 26.007  19.875  79.446  1.00 24.36 ? 717 HIS E CB    1 
ATOM   3786 C CG    . HIS H 3 16 ? 24.538  19.727  79.197  1.00 27.12 ? 717 HIS E CG    1 
ATOM   3787 N ND1   . HIS H 3 16 ? 23.998  19.689  77.928  1.00 28.80 ? 717 HIS E ND1   1 
ATOM   3788 C CD2   . HIS H 3 16 ? 23.491  19.646  80.054  1.00 28.13 ? 717 HIS E CD2   1 
ATOM   3789 C CE1   . HIS H 3 16 ? 22.683  19.590  78.015  1.00 29.11 ? 717 HIS E CE1   1 
ATOM   3790 N NE2   . HIS H 3 16 ? 22.349  19.563  79.293  1.00 29.39 ? 717 HIS E NE2   1 
ATOM   3791 N N     . ILE H 3 17 ? 29.047  18.920  79.678  1.00 19.31 ? 718 ILE E N     1 
ATOM   3792 C CA    . ILE H 3 17 ? 30.453  19.265  79.869  1.00 19.00 ? 718 ILE E CA    1 
ATOM   3793 C C     . ILE H 3 17 ? 31.273  18.633  78.765  1.00 18.03 ? 718 ILE E C     1 
ATOM   3794 O O     . ILE H 3 17 ? 32.189  19.258  78.245  1.00 18.80 ? 718 ILE E O     1 
ATOM   3795 C CB    . ILE H 3 17 ? 30.959  18.803  81.259  1.00 18.77 ? 718 ILE E CB    1 
ATOM   3796 C CG1   . ILE H 3 17 ? 30.460  19.787  82.321  1.00 19.79 ? 718 ILE E CG1   1 
ATOM   3797 C CG2   . ILE H 3 17 ? 32.479  18.690  81.271  1.00 18.95 ? 718 ILE E CG2   1 
ATOM   3798 C CD1   . ILE H 3 17 ? 30.554  19.264  83.747  1.00 19.57 ? 718 ILE E CD1   1 
ATOM   3799 N N     . LYS H 3 18 ? 30.940  17.402  78.386  1.00 17.79 ? 719 LYS E N     1 
ATOM   3800 C CA    . LYS H 3 18 ? 31.669  16.755  77.297  1.00 19.80 ? 719 LYS E CA    1 
ATOM   3801 C C     . LYS H 3 18 ? 31.480  17.552  75.998  1.00 19.19 ? 719 LYS E C     1 
ATOM   3802 O O     . LYS H 3 18 ? 32.437  17.769  75.249  1.00 20.24 ? 719 LYS E O     1 
ATOM   3803 C CB    . LYS H 3 18 ? 31.181  15.320  77.078  1.00 20.02 ? 719 LYS E CB    1 
ATOM   3804 C CG    . LYS H 3 18 ? 32.033  14.577  76.055  1.00 22.90 ? 719 LYS E CG    1 
ATOM   3805 C CD    . LYS H 3 18 ? 31.475  13.217  75.685  1.00 23.14 ? 719 LYS E CD    1 
ATOM   3806 C CE    . LYS H 3 18 ? 32.473  12.473  74.804  1.00 25.18 ? 719 LYS E CE    1 
ATOM   3807 N NZ    . LYS H 3 18 ? 31.964  11.136  74.381  1.00 25.76 ? 719 LYS E NZ    1 
ATOM   3808 N N     . ASP H 3 19 ? 30.254  17.987  75.725  1.00 20.51 ? 720 ASP E N     1 
ATOM   3809 C CA    . ASP H 3 19 ? 30.000  18.761  74.507  1.00 21.96 ? 720 ASP E CA    1 
ATOM   3810 C C     . ASP H 3 19 ? 30.776  20.066  74.515  1.00 21.25 ? 720 ASP E C     1 
ATOM   3811 O O     . ASP H 3 19 ? 31.341  20.471  73.507  1.00 20.50 ? 720 ASP E O     1 
ATOM   3812 C CB    . ASP H 3 19 ? 28.518  19.086  74.344  1.00 23.74 ? 720 ASP E CB    1 
ATOM   3813 C CG    . ASP H 3 19 ? 27.685  17.864  74.083  1.00 25.25 ? 720 ASP E CG    1 
ATOM   3814 O OD1   . ASP H 3 19 ? 28.237  16.877  73.559  1.00 25.29 ? 720 ASP E OD1   1 
ATOM   3815 O OD2   . ASP H 3 19 ? 26.479  17.899  74.392  1.00 28.63 ? 720 ASP E OD2   1 
ATOM   3816 N N     . SER H 3 20 ? 30.795  20.726  75.663  1.00 20.40 ? 721 SER E N     1 
ATOM   3817 C CA    . SER H 3 20 ? 31.508  21.989  75.791  1.00 20.30 ? 721 SER E CA    1 
ATOM   3818 C C     . SER H 3 20 ? 32.999  21.805  75.612  1.00 18.46 ? 721 SER E C     1 
ATOM   3819 O O     . SER H 3 20 ? 33.674  22.677  75.061  1.00 18.16 ? 721 SER E O     1 
ATOM   3820 C CB    . SER H 3 20 ? 31.212  22.616  77.147  1.00 21.02 ? 721 SER E CB    1 
ATOM   3821 O OG    . SER H 3 20 ? 29.861  23.020  77.199  1.00 22.93 ? 721 SER E OG    1 
ATOM   3822 N N     . PHE H 3 21 ? 33.520  20.678  76.087  1.00 18.66 ? 722 PHE E N     1 
ATOM   3823 C CA    . PHE H 3 21 ? 34.943  20.385  75.940  1.00 18.73 ? 722 PHE E CA    1 
ATOM   3824 C C     . PHE H 3 21 ? 35.283  20.254  74.452  1.00 21.38 ? 722 PHE E C     1 
ATOM   3825 O O     . PHE H 3 21 ? 36.321  20.728  73.990  1.00 17.51 ? 722 PHE E O     1 
ATOM   3826 C CB    . PHE H 3 21 ? 35.296  19.071  76.659  1.00 18.79 ? 722 PHE E CB    1 
ATOM   3827 C CG    . PHE H 3 21 ? 36.102  19.260  77.923  1.00 18.09 ? 722 PHE E CG    1 
ATOM   3828 C CD1   . PHE H 3 21 ? 35.554  18.958  79.160  1.00 16.95 ? 722 PHE E CD1   1 
ATOM   3829 C CD2   . PHE H 3 21 ? 37.402  19.755  77.870  1.00 18.22 ? 722 PHE E CD2   1 
ATOM   3830 C CE1   . PHE H 3 21 ? 36.281  19.144  80.330  1.00 16.95 ? 722 PHE E CE1   1 
ATOM   3831 C CE2   . PHE H 3 21 ? 38.144  19.950  79.043  1.00 17.47 ? 722 PHE E CE2   1 
ATOM   3832 C CZ    . PHE H 3 21 ? 37.579  19.642  80.270  1.00 15.99 ? 722 PHE E CZ    1 
ATOM   3833 N N     . HIS H 3 22 ? 34.410  19.592  73.701  1.00 21.89 ? 723 HIS E N     1 
ATOM   3834 C CA    . HIS H 3 22 ? 34.651  19.407  72.277  1.00 24.85 ? 723 HIS E CA    1 
ATOM   3835 C C     . HIS H 3 22 ? 34.500  20.727  71.529  1.00 24.07 ? 723 HIS E C     1 
ATOM   3836 O O     . HIS H 3 22 ? 35.205  20.989  70.555  1.00 25.67 ? 723 HIS E O     1 
ATOM   3837 C CB    . HIS H 3 22 ? 33.686  18.357  71.720  1.00 26.67 ? 723 HIS E CB    1 
ATOM   3838 C CG    . HIS H 3 22 ? 34.000  16.955  72.153  1.00 29.89 ? 723 HIS E CG    1 
ATOM   3839 N ND1   . HIS H 3 22 ? 34.424  16.644  73.428  1.00 30.70 ? 723 HIS E ND1   1 
ATOM   3840 C CD2   . HIS H 3 22 ? 33.908  15.777  71.492  1.00 31.72 ? 723 HIS E CD2   1 
ATOM   3841 C CE1   . HIS H 3 22 ? 34.577  15.336  73.533  1.00 31.92 ? 723 HIS E CE1   1 
ATOM   3842 N NE2   . HIS H 3 22 ? 34.270  14.786  72.372  1.00 31.53 ? 723 HIS E NE2   1 
ATOM   3843 N N     . SER H 3 23 ? 33.579  21.562  71.985  1.00 23.66 ? 724 SER E N     1 
ATOM   3844 C CA    . SER H 3 23 ? 33.372  22.849  71.344  1.00 23.59 ? 724 SER E CA    1 
ATOM   3845 C C     . SER H 3 23 ? 34.609  23.718  71.548  1.00 22.66 ? 724 SER E C     1 
ATOM   3846 O O     . SER H 3 23 ? 34.997  24.471  70.653  1.00 21.56 ? 724 SER E O     1 
ATOM   3847 C CB    . SER H 3 23 ? 32.137  23.536  71.924  1.00 24.74 ? 724 SER E CB    1 
ATOM   3848 O OG    . SER H 3 23 ? 30.955  22.850  71.539  1.00 27.66 ? 724 SER E OG    1 
ATOM   3849 N N     . LEU H 3 24 ? 35.234  23.600  72.719  1.00 20.38 ? 725 LEU E N     1 
ATOM   3850 C CA    . LEU H 3 24 ? 36.445  24.371  73.024  1.00 19.85 ? 725 LEU E CA    1 
ATOM   3851 C C     . LEU H 3 24 ? 37.619  23.807  72.230  1.00 20.58 ? 725 LEU E C     1 
ATOM   3852 O O     . LEU H 3 24 ? 38.384  24.547  71.608  1.00 19.70 ? 725 LEU E O     1 
ATOM   3853 C CB    . LEU H 3 24 ? 36.763  24.300  74.527  1.00 18.52 ? 725 LEU E CB    1 
ATOM   3854 C CG    . LEU H 3 24 ? 38.057  24.994  74.978  1.00 19.05 ? 725 LEU E CG    1 
ATOM   3855 C CD1   . LEU H 3 24 ? 37.987  26.483  74.627  1.00 17.08 ? 725 LEU E CD1   1 
ATOM   3856 C CD2   . LEU H 3 24 ? 38.248  24.813  76.488  1.00 16.63 ? 725 LEU E CD2   1 
ATOM   3857 N N     . ARG H 3 25 ? 37.743  22.483  72.254  1.00 21.08 ? 726 ARG E N     1 
ATOM   3858 C CA    . ARG H 3 25 ? 38.812  21.796  71.548  1.00 22.40 ? 726 ARG E CA    1 
ATOM   3859 C C     . ARG H 3 25 ? 38.896  22.217  70.082  1.00 23.01 ? 726 ARG E C     1 
ATOM   3860 O O     . ARG H 3 25 ? 39.966  22.574  69.585  1.00 20.02 ? 726 ARG E O     1 
ATOM   3861 C CB    . ARG H 3 25 ? 38.596  20.279  71.611  1.00 24.43 ? 726 ARG E CB    1 
ATOM   3862 C CG    . ARG H 3 25 ? 39.704  19.468  70.936  1.00 27.47 ? 726 ARG E CG    1 
ATOM   3863 C CD    . ARG H 3 25 ? 39.408  17.964  70.936  1.00 30.83 ? 726 ARG E CD    1 
ATOM   3864 N NE    . ARG H 3 25 ? 38.675  17.500  69.751  1.00 33.58 ? 726 ARG E NE    1 
ATOM   3865 C CZ    . ARG H 3 25 ? 39.184  17.457  68.517  1.00 35.67 ? 726 ARG E CZ    1 
ATOM   3866 N NH1   . ARG H 3 25 ? 40.432  17.855  68.289  1.00 35.36 ? 726 ARG E NH1   1 
ATOM   3867 N NH2   . ARG H 3 25 ? 38.450  17.005  67.504  1.00 35.57 ? 726 ARG E NH2   1 
ATOM   3868 N N     . ASP H 3 26 ? 37.758  22.169  69.399  1.00 24.13 ? 727 ASP E N     1 
ATOM   3869 C CA    . ASP H 3 26 ? 37.708  22.501  67.986  1.00 25.27 ? 727 ASP E CA    1 
ATOM   3870 C C     . ASP H 3 26 ? 37.915  23.975  67.671  1.00 25.41 ? 727 ASP E C     1 
ATOM   3871 O O     . ASP H 3 26 ? 38.006  24.346  66.501  1.00 25.15 ? 727 ASP E O     1 
ATOM   3872 C CB    . ASP H 3 26 ? 36.383  22.030  67.378  1.00 27.99 ? 727 ASP E CB    1 
ATOM   3873 C CG    . ASP H 3 26 ? 36.151  20.536  67.562  1.00 28.64 ? 727 ASP E CG    1 
ATOM   3874 O OD1   . ASP H 3 26 ? 37.139  19.773  67.613  1.00 30.68 ? 727 ASP E OD1   1 
ATOM   3875 O OD2   . ASP H 3 26 ? 34.976  20.123  67.638  1.00 30.30 ? 727 ASP E OD2   1 
ATOM   3876 N N     . SER H 3 27 ? 38.003  24.816  68.700  1.00 23.62 ? 728 SER E N     1 
ATOM   3877 C CA    . SER H 3 27 ? 38.207  26.239  68.475  1.00 23.33 ? 728 SER E CA    1 
ATOM   3878 C C     . SER H 3 27 ? 39.681  26.600  68.566  1.00 21.76 ? 728 SER E C     1 
ATOM   3879 O O     . SER H 3 27 ? 40.075  27.693  68.168  1.00 20.82 ? 728 SER E O     1 
ATOM   3880 C CB    . SER H 3 27 ? 37.398  27.076  69.484  1.00 24.34 ? 728 SER E CB    1 
ATOM   3881 O OG    . SER H 3 27 ? 38.019  27.113  70.758  1.00 27.48 ? 728 SER E OG    1 
ATOM   3882 N N     . VAL H 3 28 ? 40.486  25.671  69.083  1.00 21.15 ? 729 VAL E N     1 
ATOM   3883 C CA    . VAL H 3 28 ? 41.926  25.868  69.260  1.00 21.10 ? 729 VAL E CA    1 
ATOM   3884 C C     . VAL H 3 28 ? 42.735  25.259  68.107  1.00 21.32 ? 729 VAL E C     1 
ATOM   3885 O O     . VAL H 3 28 ? 42.805  24.037  67.959  1.00 21.50 ? 729 VAL E O     1 
ATOM   3886 C CB    . VAL H 3 28 ? 42.394  25.233  70.588  1.00 21.40 ? 729 VAL E CB    1 
ATOM   3887 C CG1   . VAL H 3 28 ? 43.870  25.488  70.803  1.00 20.96 ? 729 VAL E CG1   1 
ATOM   3888 C CG2   . VAL H 3 28 ? 41.578  25.787  71.744  1.00 21.24 ? 729 VAL E CG2   1 
ATOM   3889 N N     . PRO H 3 29 ? 43.391  26.107  67.299  1.00 21.93 ? 730 PRO E N     1 
ATOM   3890 C CA    . PRO H 3 29 ? 44.190  25.656  66.155  1.00 22.28 ? 730 PRO E CA    1 
ATOM   3891 C C     . PRO H 3 29 ? 45.209  24.542  66.425  1.00 23.40 ? 730 PRO E C     1 
ATOM   3892 O O     . PRO H 3 29 ? 45.337  23.622  65.624  1.00 24.46 ? 730 PRO E O     1 
ATOM   3893 C CB    . PRO H 3 29 ? 44.855  26.948  65.670  1.00 22.58 ? 730 PRO E CB    1 
ATOM   3894 C CG    . PRO H 3 29 ? 43.872  28.000  66.053  1.00 22.73 ? 730 PRO E CG    1 
ATOM   3895 C CD    . PRO H 3 29 ? 43.481  27.568  67.450  1.00 20.82 ? 730 PRO E CD    1 
ATOM   3896 N N     . SER H 3 30 ? 45.933  24.617  67.539  1.00 24.10 ? 731 SER E N     1 
ATOM   3897 C CA    . SER H 3 30 ? 46.937  23.597  67.854  1.00 25.29 ? 731 SER E CA    1 
ATOM   3898 C C     . SER H 3 30 ? 46.355  22.220  68.191  1.00 26.55 ? 731 SER E C     1 
ATOM   3899 O O     . SER H 3 30 ? 47.090  21.232  68.248  1.00 26.93 ? 731 SER E O     1 
ATOM   3900 C CB    . SER H 3 30 ? 47.811  24.054  69.018  1.00 25.66 ? 731 SER E CB    1 
ATOM   3901 O OG    . SER H 3 30 ? 47.054  24.143  70.211  1.00 26.58 ? 731 SER E OG    1 
ATOM   3902 N N     . LEU H 3 31 ? 45.048  22.151  68.419  1.00 27.54 ? 732 LEU E N     1 
ATOM   3903 C CA    . LEU H 3 31 ? 44.411  20.881  68.756  1.00 31.36 ? 732 LEU E CA    1 
ATOM   3904 C C     . LEU H 3 31 ? 43.732  20.213  67.562  1.00 34.12 ? 732 LEU E C     1 
ATOM   3905 O O     . LEU H 3 31 ? 43.271  19.075  67.662  1.00 34.50 ? 732 LEU E O     1 
ATOM   3906 C CB    . LEU H 3 31 ? 43.395  21.081  69.887  1.00 29.80 ? 732 LEU E CB    1 
ATOM   3907 C CG    . LEU H 3 31 ? 43.960  21.546  71.235  1.00 29.97 ? 732 LEU E CG    1 
ATOM   3908 C CD1   . LEU H 3 31 ? 42.823  21.878  72.196  1.00 28.45 ? 732 LEU E CD1   1 
ATOM   3909 C CD2   . LEU H 3 31 ? 44.862  20.467  71.810  1.00 29.73 ? 732 LEU E CD2   1 
ATOM   3910 N N     . GLN H 3 32 ? 43.673  20.914  66.434  1.00 37.62 ? 733 GLN E N     1 
ATOM   3911 C CA    . GLN H 3 32 ? 43.049  20.367  65.233  1.00 40.94 ? 733 GLN E CA    1 
ATOM   3912 C C     . GLN H 3 32 ? 43.801  19.135  64.748  1.00 42.31 ? 733 GLN E C     1 
ATOM   3913 O O     . GLN H 3 32 ? 45.032  19.120  64.716  1.00 42.37 ? 733 GLN E O     1 
ATOM   3914 C CB    . GLN H 3 32 ? 43.030  21.413  64.116  1.00 42.52 ? 733 GLN E CB    1 
ATOM   3915 C CG    . GLN H 3 32 ? 42.218  22.663  64.428  1.00 44.86 ? 733 GLN E CG    1 
ATOM   3916 C CD    . GLN H 3 32 ? 42.245  23.668  63.289  1.00 45.70 ? 733 GLN E CD    1 
ATOM   3917 O OE1   . GLN H 3 32 ? 43.313  24.121  62.865  1.00 46.50 ? 733 GLN E OE1   1 
ATOM   3918 N NE2   . GLN H 3 32 ? 41.067  24.025  62.789  1.00 46.97 ? 733 GLN E NE2   1 
ATOM   3919 N N     . GLY H 3 33 ? 43.053  18.105  64.369  1.00 44.05 ? 734 GLY E N     1 
ATOM   3920 C CA    . GLY H 3 33 ? 43.665  16.880  63.887  1.00 45.49 ? 734 GLY E CA    1 
ATOM   3921 C C     . GLY H 3 33 ? 44.621  16.248  64.882  1.00 46.45 ? 734 GLY E C     1 
ATOM   3922 O O     . GLY H 3 33 ? 45.708  15.804  64.508  1.00 47.63 ? 734 GLY E O     1 
ATOM   3923 N N     . GLU H 3 34 ? 44.223  16.208  66.151  1.00 46.51 ? 735 GLU E N     1 
ATOM   3924 C CA    . GLU H 3 34 ? 45.056  15.619  67.194  1.00 45.76 ? 735 GLU E CA    1 
ATOM   3925 C C     . GLU H 3 34 ? 44.217  15.158  68.384  1.00 45.69 ? 735 GLU E C     1 
ATOM   3926 O O     . GLU H 3 34 ? 43.261  15.829  68.779  1.00 45.69 ? 735 GLU E O     1 
ATOM   3927 C CB    . GLU H 3 34 ? 46.104  16.625  67.653  1.00 45.88 ? 735 GLU E CB    1 
ATOM   3928 N N     . LYS H 3 35 ? 44.571  14.003  68.942  1.00 44.91 ? 736 LYS E N     1 
ATOM   3929 C CA    . LYS H 3 35 ? 43.863  13.462  70.096  1.00 43.37 ? 736 LYS E CA    1 
ATOM   3930 C C     . LYS H 3 35 ? 44.343  14.245  71.307  1.00 42.31 ? 736 LYS E C     1 
ATOM   3931 O O     . LYS H 3 35 ? 45.540  14.263  71.602  1.00 43.02 ? 736 LYS E O     1 
ATOM   3932 C CB    . LYS H 3 35 ? 44.180  11.981  70.266  1.00 43.96 ? 736 LYS E CB    1 
ATOM   3933 N N     . ALA H 3 36 ? 43.415  14.897  72.001  1.00 39.50 ? 737 ALA E N     1 
ATOM   3934 C CA    . ALA H 3 36 ? 43.774  15.699  73.162  1.00 36.55 ? 737 ALA E CA    1 
ATOM   3935 C C     . ALA H 3 36 ? 42.984  15.323  74.410  1.00 34.26 ? 737 ALA E C     1 
ATOM   3936 O O     . ALA H 3 36 ? 41.759  15.228  74.372  1.00 34.23 ? 737 ALA E O     1 
ATOM   3937 C CB    . ALA H 3 36 ? 43.570  17.170  72.843  1.00 36.98 ? 737 ALA E CB    1 
ATOM   3938 N N     . SER H 3 37 ? 43.692  15.109  75.513  1.00 30.92 ? 738 SER E N     1 
ATOM   3939 C CA    . SER H 3 37 ? 43.045  14.760  76.772  1.00 29.01 ? 738 SER E CA    1 
ATOM   3940 C C     . SER H 3 37 ? 42.337  16.016  77.257  1.00 26.83 ? 738 SER E C     1 
ATOM   3941 O O     . SER H 3 37 ? 42.444  17.063  76.622  1.00 25.95 ? 738 SER E O     1 
ATOM   3942 C CB    . SER H 3 37 ? 44.086  14.329  77.801  1.00 29.18 ? 738 SER E CB    1 
ATOM   3943 O OG    . SER H 3 37 ? 44.981  15.390  78.080  1.00 29.98 ? 738 SER E OG    1 
ATOM   3944 N N     . ARG H 3 38 ? 41.613  15.924  78.369  1.00 24.50 ? 739 ARG E N     1 
ATOM   3945 C CA    . ARG H 3 38 ? 40.918  17.102  78.888  1.00 23.69 ? 739 ARG E CA    1 
ATOM   3946 C C     . ARG H 3 38 ? 41.908  18.131  79.403  1.00 23.87 ? 739 ARG E C     1 
ATOM   3947 O O     . ARG H 3 38 ? 41.757  19.327  79.158  1.00 22.57 ? 739 ARG E O     1 
ATOM   3948 C CB    . ARG H 3 38 ? 39.944  16.707  79.993  1.00 24.53 ? 739 ARG E CB    1 
ATOM   3949 C CG    . ARG H 3 38 ? 38.725  15.992  79.446  1.00 25.91 ? 739 ARG E CG    1 
ATOM   3950 C CD    . ARG H 3 38 ? 37.653  15.784  80.490  1.00 28.03 ? 739 ARG E CD    1 
ATOM   3951 N NE    . ARG H 3 38 ? 36.391  15.416  79.849  1.00 29.53 ? 739 ARG E NE    1 
ATOM   3952 C CZ    . ARG H 3 38 ? 35.201  15.486  80.436  1.00 29.39 ? 739 ARG E CZ    1 
ATOM   3953 N NH1   . ARG H 3 38 ? 35.091  15.913  81.692  1.00 31.19 ? 739 ARG E NH1   1 
ATOM   3954 N NH2   . ARG H 3 38 ? 34.119  15.136  79.759  1.00 30.37 ? 739 ARG E NH2   1 
ATOM   3955 N N     . ALA H 3 39 ? 42.932  17.661  80.108  1.00 23.66 ? 740 ALA E N     1 
ATOM   3956 C CA    . ALA H 3 39 ? 43.951  18.557  80.636  1.00 23.98 ? 740 ALA E CA    1 
ATOM   3957 C C     . ALA H 3 39 ? 44.622  19.292  79.474  1.00 23.79 ? 740 ALA E C     1 
ATOM   3958 O O     . ALA H 3 39 ? 44.908  20.488  79.565  1.00 23.08 ? 740 ALA E O     1 
ATOM   3959 C CB    . ALA H 3 39 ? 44.991  17.759  81.426  1.00 25.03 ? 740 ALA E CB    1 
ATOM   3960 N N     . GLN H 3 40 ? 44.866  18.577  78.383  1.00 23.42 ? 741 GLN E N     1 
ATOM   3961 C CA    . GLN H 3 40 ? 45.501  19.176  77.210  1.00 24.69 ? 741 GLN E CA    1 
ATOM   3962 C C     . GLN H 3 40 ? 44.601  20.220  76.560  1.00 23.23 ? 741 GLN E C     1 
ATOM   3963 O O     . GLN H 3 40 ? 45.074  21.256  76.095  1.00 23.27 ? 741 GLN E O     1 
ATOM   3964 C CB    . GLN H 3 40 ? 45.855  18.103  76.166  1.00 26.76 ? 741 GLN E CB    1 
ATOM   3965 C CG    . GLN H 3 40 ? 46.908  17.091  76.612  1.00 29.35 ? 741 GLN E CG    1 
ATOM   3966 C CD    . GLN H 3 40 ? 47.230  16.069  75.531  1.00 31.47 ? 741 GLN E CD    1 
ATOM   3967 O OE1   . GLN H 3 40 ? 46.330  15.446  74.959  1.00 33.59 ? 741 GLN E OE1   1 
ATOM   3968 N NE2   . GLN H 3 40 ? 48.516  15.888  75.250  1.00 33.30 ? 741 GLN E NE2   1 
ATOM   3969 N N     . ILE H 3 41 ? 43.303  19.949  76.501  1.00 20.95 ? 742 ILE E N     1 
ATOM   3970 C CA    . ILE H 3 41 ? 42.409  20.916  75.886  1.00 19.79 ? 742 ILE E CA    1 
ATOM   3971 C C     . ILE H 3 41 ? 42.449  22.203  76.695  1.00 18.33 ? 742 ILE E C     1 
ATOM   3972 O O     . ILE H 3 41 ? 42.575  23.288  76.142  1.00 18.13 ? 742 ILE E O     1 
ATOM   3973 C CB    . ILE H 3 41 ? 40.962  20.396  75.822  1.00 20.68 ? 742 ILE E CB    1 
ATOM   3974 C CG1   . ILE H 3 41 ? 40.891  19.212  74.852  1.00 21.86 ? 742 ILE E CG1   1 
ATOM   3975 C CG2   . ILE H 3 41 ? 40.026  21.515  75.399  1.00 20.44 ? 742 ILE E CG2   1 
ATOM   3976 C CD1   . ILE H 3 41 ? 39.566  18.475  74.868  1.00 23.45 ? 742 ILE E CD1   1 
ATOM   3977 N N     . LEU H 3 42 ? 42.375  22.079  78.012  1.00 16.82 ? 743 LEU E N     1 
ATOM   3978 C CA    . LEU H 3 42 ? 42.389  23.269  78.857  1.00 15.80 ? 743 LEU E CA    1 
ATOM   3979 C C     . LEU H 3 42 ? 43.710  24.011  78.777  1.00 15.50 ? 743 LEU E C     1 
ATOM   3980 O O     . LEU H 3 42 ? 43.732  25.235  78.653  1.00 16.76 ? 743 LEU E O     1 
ATOM   3981 C CB    . LEU H 3 42 ? 42.103  22.896  80.311  1.00 15.16 ? 743 LEU E CB    1 
ATOM   3982 C CG    . LEU H 3 42 ? 40.765  22.245  80.636  1.00 15.16 ? 743 LEU E CG    1 
ATOM   3983 C CD1   . LEU H 3 42 ? 40.782  21.787  82.094  1.00 16.90 ? 743 LEU E CD1   1 
ATOM   3984 C CD2   . LEU H 3 42 ? 39.634  23.242  80.399  1.00 16.43 ? 743 LEU E CD2   1 
ATOM   3985 N N     . ASP H 3 43 ? 44.817  23.280  78.835  1.00 16.05 ? 744 ASP E N     1 
ATOM   3986 C CA    . ASP H 3 43 ? 46.122  23.930  78.798  1.00 17.87 ? 744 ASP E CA    1 
ATOM   3987 C C     . ASP H 3 43 ? 46.448  24.575  77.456  1.00 17.39 ? 744 ASP E C     1 
ATOM   3988 O O     . ASP H 3 43 ? 47.053  25.639  77.411  1.00 17.20 ? 744 ASP E O     1 
ATOM   3989 C CB    . ASP H 3 43 ? 47.222  22.942  79.186  1.00 20.24 ? 744 ASP E CB    1 
ATOM   3990 C CG    . ASP H 3 43 ? 47.130  22.504  80.645  1.00 23.47 ? 744 ASP E CG    1 
ATOM   3991 O OD1   . ASP H 3 43 ? 46.389  23.142  81.429  1.00 24.14 ? 744 ASP E OD1   1 
ATOM   3992 O OD2   . ASP H 3 43 ? 47.815  21.525  81.009  1.00 23.33 ? 744 ASP E OD2   1 
ATOM   3993 N N     . LYS H 3 44 ? 46.047  23.940  76.362  1.00 17.51 ? 745 LYS E N     1 
ATOM   3994 C CA    . LYS H 3 44 ? 46.307  24.501  75.047  1.00 18.87 ? 745 LYS E CA    1 
ATOM   3995 C C     . LYS H 3 44 ? 45.388  25.694  74.789  1.00 17.98 ? 745 LYS E C     1 
ATOM   3996 O O     . LYS H 3 44 ? 45.769  26.642  74.100  1.00 17.38 ? 745 LYS E O     1 
ATOM   3997 C CB    . LYS H 3 44 ? 46.110  23.435  73.966  1.00 22.07 ? 745 LYS E CB    1 
ATOM   3998 C CG    . LYS H 3 44 ? 47.148  22.330  74.017  1.00 24.69 ? 745 LYS E CG    1 
ATOM   3999 C CD    . LYS H 3 44 ? 48.552  22.896  73.894  1.00 28.30 ? 745 LYS E CD    1 
ATOM   4000 C CE    . LYS H 3 44 ? 49.591  21.791  73.874  1.00 31.16 ? 745 LYS E CE    1 
ATOM   4001 N NZ    . LYS H 3 44 ? 50.962  22.344  73.694  1.00 32.23 ? 745 LYS E NZ    1 
ATOM   4002 N N     . ALA H 3 45 ? 44.182  25.651  75.345  1.00 16.77 ? 746 ALA E N     1 
ATOM   4003 C CA    . ALA H 3 45 ? 43.241  26.759  75.179  1.00 15.58 ? 746 ALA E CA    1 
ATOM   4004 C C     . ALA H 3 45 ? 43.783  27.992  75.898  1.00 16.50 ? 746 ALA E C     1 
ATOM   4005 O O     . ALA H 3 45 ? 43.770  29.097  75.359  1.00 15.78 ? 746 ALA E O     1 
ATOM   4006 C CB    . ALA H 3 45 ? 41.879  26.392  75.755  1.00 16.21 ? 746 ALA E CB    1 
ATOM   4007 N N     . THR H 3 46 ? 44.252  27.790  77.125  1.00 15.16 ? 747 THR E N     1 
ATOM   4008 C CA    . THR H 3 46 ? 44.794  28.882  77.936  1.00 15.93 ? 747 THR E CA    1 
ATOM   4009 C C     . THR H 3 46 ? 45.977  29.543  77.225  1.00 15.77 ? 747 THR E C     1 
ATOM   4010 O O     . THR H 3 46 ? 46.073  30.763  77.145  1.00 16.05 ? 747 THR E O     1 
ATOM   4011 C CB    . THR H 3 46 ? 45.249  28.340  79.316  1.00 15.87 ? 747 THR E CB    1 
ATOM   4012 O OG1   . THR H 3 46 ? 44.141  27.695  79.948  1.00 17.43 ? 747 THR E OG1   1 
ATOM   4013 C CG2   . THR H 3 46 ? 45.737  29.458  80.217  1.00 16.71 ? 747 THR E CG2   1 
ATOM   4014 N N     . GLU H 3 47 ? 46.868  28.718  76.701  1.00 16.68 ? 748 GLU E N     1 
ATOM   4015 C CA    . GLU H 3 47 ? 48.040  29.188  75.978  1.00 18.16 ? 748 GLU E CA    1 
ATOM   4016 C C     . GLU H 3 47 ? 47.614  30.006  74.751  1.00 17.20 ? 748 GLU E C     1 
ATOM   4017 O O     . GLU H 3 47 ? 48.110  31.113  74.522  1.00 15.16 ? 748 GLU E O     1 
ATOM   4018 C CB    . GLU H 3 47 ? 48.864  27.970  75.551  1.00 19.55 ? 748 GLU E CB    1 
ATOM   4019 C CG    . GLU H 3 47 ? 49.861  28.200  74.443  1.00 23.59 ? 748 GLU E CG    1 
ATOM   4020 C CD    . GLU H 3 47 ? 50.452  26.888  73.957  1.00 25.47 ? 748 GLU E CD    1 
ATOM   4021 O OE1   . GLU H 3 47 ? 49.970  26.348  72.935  1.00 24.83 ? 748 GLU E OE1   1 
ATOM   4022 O OE2   . GLU H 3 47 ? 51.386  26.381  74.616  1.00 26.19 ? 748 GLU E OE2   1 
ATOM   4023 N N     . TYR H 3 48 ? 46.682  29.461  73.975  1.00 16.24 ? 749 TYR E N     1 
ATOM   4024 C CA    . TYR H 3 48 ? 46.197  30.133  72.771  1.00 16.98 ? 749 TYR E CA    1 
ATOM   4025 C C     . TYR H 3 48 ? 45.476  31.449  73.096  1.00 16.90 ? 749 TYR E C     1 
ATOM   4026 O O     . TYR H 3 48 ? 45.624  32.445  72.387  1.00 18.71 ? 749 TYR E O     1 
ATOM   4027 C CB    . TYR H 3 48 ? 45.262  29.199  71.997  1.00 16.71 ? 749 TYR E CB    1 
ATOM   4028 C CG    . TYR H 3 48 ? 44.684  29.804  70.730  1.00 16.89 ? 749 TYR E CG    1 
ATOM   4029 C CD1   . TYR H 3 48 ? 45.507  30.191  69.676  1.00 17.74 ? 749 TYR E CD1   1 
ATOM   4030 C CD2   . TYR H 3 48 ? 43.308  29.972  70.585  1.00 18.68 ? 749 TYR E CD2   1 
ATOM   4031 C CE1   . TYR H 3 48 ? 44.969  30.734  68.496  1.00 17.88 ? 749 TYR E CE1   1 
ATOM   4032 C CE2   . TYR H 3 48 ? 42.759  30.506  69.424  1.00 17.34 ? 749 TYR E CE2   1 
ATOM   4033 C CZ    . TYR H 3 48 ? 43.588  30.884  68.383  1.00 18.19 ? 749 TYR E CZ    1 
ATOM   4034 O OH    . TYR H 3 48 ? 43.031  31.402  67.232  1.00 17.22 ? 749 TYR E OH    1 
ATOM   4035 N N     . ILE H 3 49 ? 44.706  31.459  74.175  1.00 16.96 ? 750 ILE E N     1 
ATOM   4036 C CA    . ILE H 3 49 ? 44.001  32.670  74.562  1.00 16.59 ? 750 ILE E CA    1 
ATOM   4037 C C     . ILE H 3 49 ? 44.989  33.790  74.902  1.00 17.38 ? 750 ILE E C     1 
ATOM   4038 O O     . ILE H 3 49 ? 44.836  34.920  74.450  1.00 15.37 ? 750 ILE E O     1 
ATOM   4039 C CB    . ILE H 3 49 ? 43.078  32.401  75.772  1.00 17.02 ? 750 ILE E CB    1 
ATOM   4040 C CG1   . ILE H 3 49 ? 41.833  31.644  75.293  1.00 15.26 ? 750 ILE E CG1   1 
ATOM   4041 C CG2   . ILE H 3 49 ? 42.742  33.725  76.482  1.00 17.02 ? 750 ILE E CG2   1 
ATOM   4042 C CD1   . ILE H 3 49 ? 40.974  31.047  76.416  1.00 16.00 ? 750 ILE E CD1   1 
ATOM   4043 N N     . GLN H 3 50 ? 46.006  33.488  75.697  1.00 16.61 ? 751 GLN E N     1 
ATOM   4044 C CA    . GLN H 3 50 ? 46.970  34.526  76.047  1.00 20.31 ? 751 GLN E CA    1 
ATOM   4045 C C     . GLN H 3 50 ? 47.697  35.039  74.809  1.00 20.59 ? 751 GLN E C     1 
ATOM   4046 O O     . GLN H 3 50 ? 47.938  36.244  74.654  1.00 20.40 ? 751 GLN E O     1 
ATOM   4047 C CB    . GLN H 3 50 ? 47.988  34.006  77.052  1.00 21.94 ? 751 GLN E CB    1 
ATOM   4048 C CG    . GLN H 3 50 ? 48.997  35.070  77.443  1.00 25.85 ? 751 GLN E CG    1 
ATOM   4049 C CD    . GLN H 3 50 ? 49.777  34.708  78.681  1.00 29.04 ? 751 GLN E CD    1 
ATOM   4050 O OE1   . GLN H 3 50 ? 49.198  34.511  79.754  1.00 30.01 ? 751 GLN E OE1   1 
ATOM   4051 N NE2   . GLN H 3 50 ? 51.100  34.619  78.546  1.00 30.12 ? 751 GLN E NE2   1 
ATOM   4052 N N     . TYR H 3 51 ? 48.056  34.107  73.936  1.00 21.24 ? 752 TYR E N     1 
ATOM   4053 C CA    . TYR H 3 51 ? 48.746  34.437  72.707  1.00 21.40 ? 752 TYR E CA    1 
ATOM   4054 C C     . TYR H 3 51 ? 47.922  35.399  71.853  1.00 21.80 ? 752 TYR E C     1 
ATOM   4055 O O     . TYR H 3 51 ? 48.428  36.428  71.403  1.00 22.28 ? 752 TYR E O     1 
ATOM   4056 C CB    . TYR H 3 51 ? 49.014  33.159  71.917  1.00 23.75 ? 752 TYR E CB    1 
ATOM   4057 C CG    . TYR H 3 51 ? 49.640  33.409  70.579  1.00 25.27 ? 752 TYR E CG    1 
ATOM   4058 C CD1   . TYR H 3 51 ? 51.004  33.669  70.465  1.00 25.79 ? 752 TYR E CD1   1 
ATOM   4059 C CD2   . TYR H 3 51 ? 48.865  33.397  69.419  1.00 25.91 ? 752 TYR E CD2   1 
ATOM   4060 C CE1   . TYR H 3 51 ? 51.587  33.910  69.221  1.00 27.50 ? 752 TYR E CE1   1 
ATOM   4061 C CE2   . TYR H 3 51 ? 49.435  33.637  68.174  1.00 26.33 ? 752 TYR E CE2   1 
ATOM   4062 C CZ    . TYR H 3 51 ? 50.796  33.890  68.081  1.00 27.08 ? 752 TYR E CZ    1 
ATOM   4063 O OH    . TYR H 3 51 ? 51.365  34.105  66.846  1.00 30.11 ? 752 TYR E OH    1 
ATOM   4064 N N     . MET H 3 52 ? 46.656  35.057  71.626  1.00 21.30 ? 753 MET E N     1 
ATOM   4065 C CA    . MET H 3 52 ? 45.771  35.883  70.801  1.00 21.04 ? 753 MET E CA    1 
ATOM   4066 C C     . MET H 3 52 ? 45.470  37.253  71.399  1.00 20.92 ? 753 MET E C     1 
ATOM   4067 O O     . MET H 3 52 ? 45.379  38.251  70.676  1.00 18.75 ? 753 MET E O     1 
ATOM   4068 C CB    . MET H 3 52 ? 44.459  35.146  70.532  1.00 21.31 ? 753 MET E CB    1 
ATOM   4069 C CG    . MET H 3 52 ? 44.618  33.920  69.660  1.00 21.03 ? 753 MET E CG    1 
ATOM   4070 S SD    . MET H 3 52 ? 45.231  34.324  68.017  1.00 24.03 ? 753 MET E SD    1 
ATOM   4071 C CE    . MET H 3 52 ? 43.773  34.981  67.308  1.00 20.44 ? 753 MET E CE    1 
ATOM   4072 N N     . ARG H 3 53 ? 45.299  37.312  72.712  1.00 20.46 ? 754 ARG E N     1 
ATOM   4073 C CA    . ARG H 3 53 ? 45.023  38.599  73.348  1.00 21.51 ? 754 ARG E CA    1 
ATOM   4074 C C     . ARG H 3 53 ? 46.192  39.540  73.082  1.00 22.12 ? 754 ARG E C     1 
ATOM   4075 O O     . ARG H 3 53 ? 45.999  40.706  72.735  1.00 23.14 ? 754 ARG E O     1 
ATOM   4076 C CB    . ARG H 3 53 ? 44.826  38.430  74.861  1.00 20.86 ? 754 ARG E CB    1 
ATOM   4077 C CG    . ARG H 3 53 ? 44.563  39.734  75.618  1.00 21.56 ? 754 ARG E CG    1 
ATOM   4078 C CD    . ARG H 3 53 ? 44.339  39.477  77.110  1.00 22.47 ? 754 ARG E CD    1 
ATOM   4079 N NE    . ARG H 3 53 ? 45.556  38.978  77.746  1.00 22.31 ? 754 ARG E NE    1 
ATOM   4080 C CZ    . ARG H 3 53 ? 45.664  37.796  78.344  1.00 22.75 ? 754 ARG E CZ    1 
ATOM   4081 N NH1   . ARG H 3 53 ? 44.626  36.977  78.400  1.00 22.33 ? 754 ARG E NH1   1 
ATOM   4082 N NH2   . ARG H 3 53 ? 46.820  37.427  78.873  1.00 22.12 ? 754 ARG E NH2   1 
ATOM   4083 N N     . ARG H 3 54 ? 47.407  39.023  73.236  1.00 22.77 ? 755 ARG E N     1 
ATOM   4084 C CA    . ARG H 3 54 ? 48.603  39.823  73.030  1.00 23.61 ? 755 ARG E CA    1 
ATOM   4085 C C     . ARG H 3 54 ? 48.804  40.153  71.558  1.00 22.82 ? 755 ARG E C     1 
ATOM   4086 O O     . ARG H 3 54 ? 49.209  41.259  71.221  1.00 21.64 ? 755 ARG E O     1 
ATOM   4087 C CB    . ARG H 3 54 ? 49.823  39.093  73.600  1.00 25.35 ? 755 ARG E CB    1 
ATOM   4088 C CG    . ARG H 3 54 ? 49.775  38.977  75.108  1.00 27.55 ? 755 ARG E CG    1 
ATOM   4089 C CD    . ARG H 3 54 ? 51.037  38.365  75.690  1.00 32.28 ? 755 ARG E CD    1 
ATOM   4090 N NE    . ARG H 3 54 ? 51.017  38.416  77.153  1.00 34.64 ? 755 ARG E NE    1 
ATOM   4091 C CZ    . ARG H 3 54 ? 52.084  38.230  77.923  1.00 35.22 ? 755 ARG E CZ    1 
ATOM   4092 N NH1   . ARG H 3 54 ? 53.264  37.974  77.374  1.00 37.07 ? 755 ARG E NH1   1 
ATOM   4093 N NH2   . ARG H 3 54 ? 51.976  38.320  79.244  1.00 35.82 ? 755 ARG E NH2   1 
ATOM   4094 N N     . LYS H 3 55 ? 48.512  39.194  70.684  1.00 22.84 ? 756 LYS E N     1 
ATOM   4095 C CA    . LYS H 3 55 ? 48.645  39.416  69.246  1.00 23.56 ? 756 LYS E CA    1 
ATOM   4096 C C     . LYS H 3 55 ? 47.733  40.567  68.819  1.00 22.48 ? 756 LYS E C     1 
ATOM   4097 O O     . LYS H 3 55 ? 48.159  41.460  68.095  1.00 22.53 ? 756 LYS E O     1 
ATOM   4098 C CB    . LYS H 3 55 ? 48.271  38.148  68.469  1.00 23.85 ? 756 LYS E CB    1 
ATOM   4099 C CG    . LYS H 3 55 ? 48.720  38.166  67.010  1.00 24.70 ? 756 LYS E CG    1 
ATOM   4100 C CD    . LYS H 3 55 ? 48.211  36.943  66.252  1.00 25.70 ? 756 LYS E CD    1 
ATOM   4101 C CE    . LYS H 3 55 ? 48.705  36.930  64.805  1.00 26.63 ? 756 LYS E CE    1 
ATOM   4102 N NZ    . LYS H 3 55 ? 48.100  35.813  64.005  1.00 25.68 ? 756 LYS E NZ    1 
ATOM   4103 N N     . ASN H 3 56 ? 46.476  40.545  69.262  1.00 23.80 ? 757 ASN E N     1 
ATOM   4104 C CA    . ASN H 3 56 ? 45.554  41.622  68.912  1.00 23.34 ? 757 ASN E CA    1 
ATOM   4105 C C     . ASN H 3 56 ? 46.000  42.921  69.595  1.00 23.78 ? 757 ASN E C     1 
ATOM   4106 O O     . ASN H 3 56 ? 45.823  44.009  69.048  1.00 22.61 ? 757 ASN E O     1 
ATOM   4107 C CB    . ASN H 3 56 ? 44.120  41.281  69.325  1.00 23.80 ? 757 ASN E CB    1 
ATOM   4108 C CG    . ASN H 3 56 ? 43.468  40.261  68.401  1.00 25.13 ? 757 ASN E CG    1 
ATOM   4109 O OD1   . ASN H 3 56 ? 43.814  40.157  67.221  1.00 26.12 ? 757 ASN E OD1   1 
ATOM   4110 N ND2   . ASN H 3 56 ? 42.500  39.520  68.927  1.00 25.48 ? 757 ASN E ND2   1 
ATOM   4111 N N     . HIS H 3 57 ? 46.580  42.804  70.787  1.00 23.79 ? 758 HIS E N     1 
ATOM   4112 C CA    . HIS H 3 57 ? 47.069  43.980  71.510  1.00 24.86 ? 758 HIS E CA    1 
ATOM   4113 C C     . HIS H 3 57 ? 48.051  44.693  70.587  1.00 24.96 ? 758 HIS E C     1 
ATOM   4114 O O     . HIS H 3 57 ? 47.943  45.903  70.369  1.00 24.55 ? 758 HIS E O     1 
ATOM   4115 C CB    . HIS H 3 57 ? 47.784  43.566  72.810  1.00 26.85 ? 758 HIS E CB    1 
ATOM   4116 C CG    . HIS H 3 57 ? 48.557  44.675  73.461  1.00 29.11 ? 758 HIS E CG    1 
ATOM   4117 N ND1   . HIS H 3 57 ? 47.951  45.767  74.046  1.00 31.11 ? 758 HIS E ND1   1 
ATOM   4118 C CD2   . HIS H 3 57 ? 49.890  44.862  73.613  1.00 30.13 ? 758 HIS E CD2   1 
ATOM   4119 C CE1   . HIS H 3 57 ? 48.876  46.577  74.532  1.00 30.49 ? 758 HIS E CE1   1 
ATOM   4120 N NE2   . HIS H 3 57 ? 50.061  46.050  74.283  1.00 31.83 ? 758 HIS E NE2   1 
ATOM   4121 N N     . THR H 3 58 ? 48.996  43.928  70.042  1.00 24.60 ? 759 THR E N     1 
ATOM   4122 C CA    . THR H 3 58 ? 50.002  44.454  69.125  1.00 26.32 ? 759 THR E CA    1 
ATOM   4123 C C     . THR H 3 58 ? 49.382  44.991  67.827  1.00 27.58 ? 759 THR E C     1 
ATOM   4124 O O     . THR H 3 58 ? 49.810  46.030  67.307  1.00 24.90 ? 759 THR E O     1 
ATOM   4125 C CB    . THR H 3 58 ? 51.040  43.372  68.782  1.00 27.03 ? 759 THR E CB    1 
ATOM   4126 O OG1   . THR H 3 58 ? 51.823  43.084  69.948  1.00 27.75 ? 759 THR E OG1   1 
ATOM   4127 C CG2   . THR H 3 58 ? 51.956  43.839  67.665  1.00 26.81 ? 759 THR E CG2   1 
ATOM   4128 N N     . HIS H 3 59 ? 48.388  44.280  67.297  1.00 27.44 ? 760 HIS E N     1 
ATOM   4129 C CA    . HIS H 3 59 ? 47.722  44.736  66.083  1.00 28.22 ? 760 HIS E CA    1 
ATOM   4130 C C     . HIS H 3 59 ? 47.161  46.126  66.362  1.00 28.53 ? 760 HIS E C     1 
ATOM   4131 O O     . HIS H 3 59 ? 47.360  47.055  65.581  1.00 27.06 ? 760 HIS E O     1 
ATOM   4132 C CB    . HIS H 3 59 ? 46.570  43.803  65.705  1.00 29.36 ? 760 HIS E CB    1 
ATOM   4133 C CG    . HIS H 3 59 ? 46.978  42.635  64.861  1.00 30.28 ? 760 HIS E CG    1 
ATOM   4134 N ND1   . HIS H 3 59 ? 46.173  41.530  64.685  1.00 31.02 ? 760 HIS E ND1   1 
ATOM   4135 C CD2   . HIS H 3 59 ? 48.106  42.395  64.152  1.00 29.92 ? 760 HIS E CD2   1 
ATOM   4136 C CE1   . HIS H 3 59 ? 46.790  40.657  63.907  1.00 30.47 ? 760 HIS E CE1   1 
ATOM   4137 N NE2   . HIS H 3 59 ? 47.965  41.158  63.569  1.00 29.99 ? 760 HIS E NE2   1 
ATOM   4138 N N     . GLN H 3 60 ? 46.470  46.261  67.492  1.00 28.99 ? 761 GLN E N     1 
ATOM   4139 C CA    . GLN H 3 60 ? 45.874  47.536  67.865  1.00 29.37 ? 761 GLN E CA    1 
ATOM   4140 C C     . GLN H 3 60 ? 46.888  48.662  67.948  1.00 29.89 ? 761 GLN E C     1 
ATOM   4141 O O     . GLN H 3 60 ? 46.604  49.784  67.540  1.00 30.46 ? 761 GLN E O     1 
ATOM   4142 C CB    . GLN H 3 60 ? 45.146  47.433  69.202  1.00 30.43 ? 761 GLN E CB    1 
ATOM   4143 C CG    . GLN H 3 60 ? 44.336  48.683  69.513  1.00 31.63 ? 761 GLN E CG    1 
ATOM   4144 C CD    . GLN H 3 60 ? 43.184  48.869  68.543  1.00 32.43 ? 761 GLN E CD    1 
ATOM   4145 O OE1   . GLN H 3 60 ? 42.225  48.105  68.561  1.00 33.48 ? 761 GLN E OE1   1 
ATOM   4146 N NE2   . GLN H 3 60 ? 43.281  49.873  67.681  1.00 31.61 ? 761 GLN E NE2   1 
ATOM   4147 N N     . GLN H 3 61 ? 48.072  48.381  68.477  1.00 31.50 ? 762 GLN E N     1 
ATOM   4148 C CA    . GLN H 3 61 ? 49.079  49.428  68.577  1.00 32.43 ? 762 GLN E CA    1 
ATOM   4149 C C     . GLN H 3 61 ? 49.581  49.831  67.192  1.00 31.43 ? 762 GLN E C     1 
ATOM   4150 O O     . GLN H 3 61 ? 49.828  51.006  66.945  1.00 30.98 ? 762 GLN E O     1 
ATOM   4151 C CB    . GLN H 3 61 ? 50.251  48.982  69.451  1.00 34.48 ? 762 GLN E CB    1 
ATOM   4152 C CG    . GLN H 3 61 ? 51.371  50.025  69.570  1.00 37.37 ? 762 GLN E CG    1 
ATOM   4153 C CD    . GLN H 3 61 ? 50.876  51.405  70.012  1.00 39.88 ? 762 GLN E CD    1 
ATOM   4154 O OE1   . GLN H 3 61 ? 50.240  52.134  69.243  1.00 40.23 ? 762 GLN E OE1   1 
ATOM   4155 N NE2   . GLN H 3 61 ? 51.169  51.765  71.259  1.00 40.79 ? 762 GLN E NE2   1 
ATOM   4156 N N     . ASP H 3 62 ? 49.730  48.861  66.292  1.00 30.41 ? 763 ASP E N     1 
ATOM   4157 C CA    . ASP H 3 62 ? 50.191  49.164  64.941  1.00 29.46 ? 763 ASP E CA    1 
ATOM   4158 C C     . ASP H 3 62 ? 49.152  50.013  64.221  1.00 29.25 ? 763 ASP E C     1 
ATOM   4159 O O     . ASP H 3 62 ? 49.496  50.884  63.427  1.00 28.65 ? 763 ASP E O     1 
ATOM   4160 C CB    . ASP H 3 62 ? 50.432  47.886  64.140  1.00 29.45 ? 763 ASP E CB    1 
ATOM   4161 C CG    . ASP H 3 62 ? 51.555  47.048  64.705  1.00 28.72 ? 763 ASP E CG    1 
ATOM   4162 O OD1   . ASP H 3 62 ? 52.431  47.610  65.394  1.00 28.96 ? 763 ASP E OD1   1 
ATOM   4163 O OD2   . ASP H 3 62 ? 51.569  45.828  64.442  1.00 28.47 ? 763 ASP E OD2   1 
ATOM   4164 N N     . ILE H 3 63 ? 47.881  49.741  64.507  1.00 28.73 ? 764 ILE E N     1 
ATOM   4165 C CA    . ILE H 3 63 ? 46.770  50.471  63.911  1.00 29.52 ? 764 ILE E CA    1 
ATOM   4166 C C     . ILE H 3 63 ? 46.697  51.901  64.452  1.00 31.35 ? 764 ILE E C     1 
ATOM   4167 O O     . ILE H 3 63 ? 46.472  52.846  63.692  1.00 30.32 ? 764 ILE E O     1 
ATOM   4168 C CB    . ILE H 3 63 ? 45.431  49.747  64.177  1.00 27.98 ? 764 ILE E CB    1 
ATOM   4169 C CG1   . ILE H 3 63 ? 45.328  48.518  63.268  1.00 26.76 ? 764 ILE E CG1   1 
ATOM   4170 C CG2   . ILE H 3 63 ? 44.258  50.693  63.956  1.00 27.38 ? 764 ILE E CG2   1 
ATOM   4171 C CD1   . ILE H 3 63 ? 44.112  47.660  63.520  1.00 26.34 ? 764 ILE E CD1   1 
ATOM   4172 N N     . ASP H 3 64 ? 46.880  52.064  65.759  1.00 32.35 ? 765 ASP E N     1 
ATOM   4173 C CA    . ASP H 3 64 ? 46.843  53.398  66.349  1.00 34.61 ? 765 ASP E CA    1 
ATOM   4174 C C     . ASP H 3 64 ? 48.006  54.207  65.790  1.00 34.79 ? 765 ASP E C     1 
ATOM   4175 O O     . ASP H 3 64 ? 47.895  55.415  65.580  1.00 35.37 ? 765 ASP E O     1 
ATOM   4176 C CB    . ASP H 3 64 ? 46.947  53.323  67.875  1.00 35.14 ? 765 ASP E CB    1 
ATOM   4177 C CG    . ASP H 3 64 ? 45.797  52.570  68.496  1.00 36.43 ? 765 ASP E CG    1 
ATOM   4178 O OD1   . ASP H 3 64 ? 44.740  52.461  67.838  1.00 36.91 ? 765 ASP E OD1   1 
ATOM   4179 O OD2   . ASP H 3 64 ? 45.943  52.094  69.644  1.00 37.22 ? 765 ASP E OD2   1 
ATOM   4180 N N     . ASP H 3 65 ? 49.118  53.519  65.552  1.00 35.47 ? 766 ASP E N     1 
ATOM   4181 C CA    . ASP H 3 65 ? 50.323  54.124  65.007  1.00 35.12 ? 766 ASP E CA    1 
ATOM   4182 C C     . ASP H 3 65 ? 49.970  54.720  63.641  1.00 34.97 ? 766 ASP E C     1 
ATOM   4183 O O     . ASP H 3 65 ? 50.305  55.868  63.345  1.00 32.87 ? 766 ASP E O     1 
ATOM   4184 C CB    . ASP H 3 65 ? 51.401  53.053  64.846  1.00 38.37 ? 766 ASP E CB    1 
ATOM   4185 C CG    . ASP H 3 65 ? 52.803  53.614  64.931  1.00 40.80 ? 766 ASP E CG    1 
ATOM   4186 O OD1   . ASP H 3 65 ? 53.133  54.538  64.153  1.00 42.93 ? 766 ASP E OD1   1 
ATOM   4187 O OD2   . ASP H 3 65 ? 53.579  53.124  65.782  1.00 41.96 ? 766 ASP E OD2   1 
ATOM   4188 N N     . LEU H 3 66 ? 49.284  53.926  62.820  1.00 32.43 ? 767 LEU E N     1 
ATOM   4189 C CA    . LEU H 3 66 ? 48.868  54.357  61.491  1.00 31.16 ? 767 LEU E CA    1 
ATOM   4190 C C     . LEU H 3 66 ? 47.881  55.516  61.553  1.00 32.15 ? 767 LEU E C     1 
ATOM   4191 O O     . LEU H 3 66 ? 47.973  56.462  60.768  1.00 31.92 ? 767 LEU E O     1 
ATOM   4192 C CB    . LEU H 3 66 ? 48.224  53.194  60.736  1.00 29.17 ? 767 LEU E CB    1 
ATOM   4193 C CG    . LEU H 3 66 ? 49.129  52.022  60.342  1.00 28.77 ? 767 LEU E CG    1 
ATOM   4194 C CD1   . LEU H 3 66 ? 48.268  50.866  59.861  1.00 28.92 ? 767 LEU E CD1   1 
ATOM   4195 C CD2   . LEU H 3 66 ? 50.107  52.453  59.257  1.00 28.01 ? 767 LEU E CD2   1 
ATOM   4196 N N     . LYS H 3 67 ? 46.927  55.436  62.475  1.00 33.21 ? 768 LYS E N     1 
ATOM   4197 C CA    . LYS H 3 67 ? 45.923  56.485  62.613  1.00 34.98 ? 768 LYS E CA    1 
ATOM   4198 C C     . LYS H 3 67 ? 46.559  57.830  62.943  1.00 36.70 ? 768 LYS E C     1 
ATOM   4199 O O     . LYS H 3 67 ? 46.118  58.871  62.457  1.00 36.56 ? 768 LYS E O     1 
ATOM   4200 C CB    . LYS H 3 67 ? 44.906  56.120  63.698  1.00 34.71 ? 768 LYS E CB    1 
ATOM   4201 C CG    . LYS H 3 67 ? 43.968  54.985  63.337  1.00 33.53 ? 768 LYS E CG    1 
ATOM   4202 C CD    . LYS H 3 67 ? 42.956  54.749  64.445  1.00 33.27 ? 768 LYS E CD    1 
ATOM   4203 C CE    . LYS H 3 67 ? 41.930  53.699  64.054  1.00 34.69 ? 768 LYS E CE    1 
ATOM   4204 N NZ    . LYS H 3 67 ? 40.921  53.464  65.132  1.00 33.98 ? 768 LYS E NZ    1 
ATOM   4205 N N     . ARG H 3 68 ? 47.594  57.805  63.774  1.00 38.11 ? 769 ARG E N     1 
ATOM   4206 C CA    . ARG H 3 68 ? 48.270  59.035  64.157  1.00 39.35 ? 769 ARG E CA    1 
ATOM   4207 C C     . ARG H 3 68 ? 49.135  59.542  63.016  1.00 38.78 ? 769 ARG E C     1 
ATOM   4208 O O     . ARG H 3 68 ? 49.361  60.745  62.889  1.00 38.34 ? 769 ARG E O     1 
ATOM   4209 C CB    . ARG H 3 68 ? 49.113  58.817  65.417  1.00 41.32 ? 769 ARG E CB    1 
ATOM   4210 C CG    . ARG H 3 68 ? 48.303  58.929  66.709  1.00 43.73 ? 769 ARG E CG    1 
ATOM   4211 C CD    . ARG H 3 68 ? 49.185  58.798  67.943  1.00 46.15 ? 769 ARG E CD    1 
ATOM   4212 N NE    . ARG H 3 68 ? 49.449  57.404  68.296  1.00 47.05 ? 769 ARG E NE    1 
ATOM   4213 C CZ    . ARG H 3 68 ? 48.529  56.565  68.765  1.00 47.80 ? 769 ARG E CZ    1 
ATOM   4214 N NH1   . ARG H 3 68 ? 47.278  56.974  68.941  1.00 48.76 ? 769 ARG E NH1   1 
ATOM   4215 N NH2   . ARG H 3 68 ? 48.859  55.315  69.058  1.00 48.66 ? 769 ARG E NH2   1 
ATOM   4216 N N     . GLN H 3 69 ? 49.621  58.627  62.186  1.00 37.31 ? 770 GLN E N     1 
ATOM   4217 C CA    . GLN H 3 69 ? 50.429  59.027  61.041  1.00 36.08 ? 770 GLN E CA    1 
ATOM   4218 C C     . GLN H 3 69 ? 49.533  59.647  59.968  1.00 34.49 ? 770 GLN E C     1 
ATOM   4219 O O     . GLN H 3 69 ? 49.883  60.671  59.379  1.00 33.34 ? 770 GLN E O     1 
ATOM   4220 C CB    . GLN H 3 69 ? 51.170  57.827  60.457  1.00 37.61 ? 770 GLN E CB    1 
ATOM   4221 C CG    . GLN H 3 69 ? 52.413  57.438  61.208  1.00 38.98 ? 770 GLN E CG    1 
ATOM   4222 C CD    . GLN H 3 69 ? 53.048  56.184  60.652  1.00 40.79 ? 770 GLN E CD    1 
ATOM   4223 O OE1   . GLN H 3 69 ? 54.233  55.930  60.864  1.00 41.58 ? 770 GLN E OE1   1 
ATOM   4224 N NE2   . GLN H 3 69 ? 52.258  55.380  59.945  1.00 40.74 ? 770 GLN E NE2   1 
ATOM   4225 N N     . ASN H 3 70 ? 48.376  59.034  59.725  1.00 32.38 ? 771 ASN E N     1 
ATOM   4226 C CA    . ASN H 3 70 ? 47.448  59.531  58.715  1.00 31.82 ? 771 ASN E CA    1 
ATOM   4227 C C     . ASN H 3 70 ? 46.880  60.883  59.120  1.00 33.01 ? 771 ASN E C     1 
ATOM   4228 O O     . ASN H 3 70 ? 46.616  61.736  58.269  1.00 32.58 ? 771 ASN E O     1 
ATOM   4229 C CB    . ASN H 3 70 ? 46.296  58.544  58.485  1.00 30.10 ? 771 ASN E CB    1 
ATOM   4230 C CG    . ASN H 3 70 ? 46.732  57.303  57.725  1.00 28.37 ? 771 ASN E CG    1 
ATOM   4231 O OD1   . ASN H 3 70 ? 47.665  57.352  56.936  1.00 26.86 ? 771 ASN E OD1   1 
ATOM   4232 N ND2   . ASN H 3 70 ? 46.044  56.192  57.948  1.00 27.39 ? 771 ASN E ND2   1 
ATOM   4233 N N     . ALA H 3 71 ? 46.706  61.075  60.423  1.00 33.40 ? 772 ALA E N     1 
ATOM   4234 C CA    . ALA H 3 71 ? 46.169  62.330  60.946  1.00 34.60 ? 772 ALA E CA    1 
ATOM   4235 C C     . ALA H 3 71 ? 47.130  63.486  60.695  1.00 35.07 ? 772 ALA E C     1 
ATOM   4236 O O     . ALA H 3 71 ? 46.701  64.610  60.421  1.00 36.00 ? 772 ALA E O     1 
ATOM   4237 C CB    . ALA H 3 71 ? 45.886  62.200  62.445  1.00 34.07 ? 772 ALA E CB    1 
ATOM   4238 N N     . LEU H 3 72 ? 48.428  63.216  60.795  1.00 35.02 ? 773 LEU E N     1 
ATOM   4239 C CA    . LEU H 3 72 ? 49.422  64.251  60.569  1.00 35.49 ? 773 LEU E CA    1 
ATOM   4240 C C     . LEU H 3 72 ? 49.564  64.496  59.070  1.00 36.10 ? 773 LEU E C     1 
ATOM   4241 O O     . LEU H 3 72 ? 49.723  65.637  58.626  1.00 35.42 ? 773 LEU E O     1 
ATOM   4242 C CB    . LEU H 3 72 ? 50.764  63.842  61.170  1.00 35.49 ? 773 LEU E CB    1 
ATOM   4243 C CG    . LEU H 3 72 ? 50.738  63.603  62.683  1.00 36.00 ? 773 LEU E CG    1 
ATOM   4244 C CD1   . LEU H 3 72 ? 52.142  63.290  63.171  1.00 34.64 ? 773 LEU E CD1   1 
ATOM   4245 C CD2   . LEU H 3 72 ? 50.184  64.838  63.392  1.00 35.00 ? 773 LEU E CD2   1 
ATOM   4246 N N     . LEU H 3 73 ? 49.498  63.421  58.292  1.00 35.91 ? 774 LEU E N     1 
ATOM   4247 C CA    . LEU H 3 73 ? 49.593  63.532  56.842  1.00 36.87 ? 774 LEU E CA    1 
ATOM   4248 C C     . LEU H 3 73 ? 48.446  64.406  56.339  1.00 37.69 ? 774 LEU E C     1 
ATOM   4249 O O     . LEU H 3 73 ? 48.612  65.177  55.393  1.00 37.84 ? 774 LEU E O     1 
ATOM   4250 C CB    . LEU H 3 73 ? 49.532  62.141  56.206  1.00 36.17 ? 774 LEU E CB    1 
ATOM   4251 C CG    . LEU H 3 73 ? 50.758  61.603  55.457  1.00 35.47 ? 774 LEU E CG    1 
ATOM   4252 C CD1   . LEU H 3 73 ? 52.051  62.170  56.011  1.00 36.17 ? 774 LEU E CD1   1 
ATOM   4253 C CD2   . LEU H 3 73 ? 50.746  60.085  55.555  1.00 34.46 ? 774 LEU E CD2   1 
ATOM   4254 N N     . GLU H 3 74 ? 47.285  64.295  56.978  1.00 39.41 ? 775 GLU E N     1 
ATOM   4255 C CA    . GLU H 3 74 ? 46.135  65.105  56.589  1.00 41.04 ? 775 GLU E CA    1 
ATOM   4256 C C     . GLU H 3 74 ? 46.360  66.552  57.023  1.00 42.41 ? 775 GLU E C     1 
ATOM   4257 O O     . GLU H 3 74 ? 45.846  67.481  56.406  1.00 42.34 ? 775 GLU E O     1 
ATOM   4258 C CB    . GLU H 3 74 ? 44.849  64.578  57.231  1.00 41.36 ? 775 GLU E CB    1 
ATOM   4259 C CG    . GLU H 3 74 ? 44.422  63.203  56.755  1.00 41.79 ? 775 GLU E CG    1 
ATOM   4260 C CD    . GLU H 3 74 ? 43.155  62.716  57.437  1.00 42.47 ? 775 GLU E CD    1 
ATOM   4261 O OE1   . GLU H 3 74 ? 43.078  62.803  58.682  1.00 42.16 ? 775 GLU E OE1   1 
ATOM   4262 O OE2   . GLU H 3 74 ? 42.242  62.237  56.729  1.00 42.56 ? 775 GLU E OE2   1 
ATOM   4263 N N     . GLN H 3 75 ? 47.134  66.743  58.086  1.00 44.16 ? 776 GLN E N     1 
ATOM   4264 C CA    . GLN H 3 75 ? 47.410  68.087  58.570  1.00 45.69 ? 776 GLN E CA    1 
ATOM   4265 C C     . GLN H 3 75 ? 48.289  68.830  57.574  1.00 46.42 ? 776 GLN E C     1 
ATOM   4266 O O     . GLN H 3 75 ? 48.076  70.016  57.311  1.00 46.26 ? 776 GLN E O     1 
ATOM   4267 C CB    . GLN H 3 75 ? 48.094  68.037  59.941  1.00 46.54 ? 776 GLN E CB    1 
ATOM   4268 C CG    . GLN H 3 75 ? 48.478  69.409  60.495  1.00 47.32 ? 776 GLN E CG    1 
ATOM   4269 C CD    . GLN H 3 75 ? 48.774  69.384  61.988  1.00 47.92 ? 776 GLN E CD    1 
ATOM   4270 O OE1   . GLN H 3 75 ? 49.655  68.656  62.454  1.00 47.14 ? 776 GLN E OE1   1 
ATOM   4271 N NE2   . GLN H 3 75 ? 48.033  70.186  62.746  1.00 48.09 ? 776 GLN E NE2   1 
ATOM   4272 N N     . GLN H 3 76 ? 49.273  68.129  57.020  1.00 47.14 ? 777 GLN E N     1 
ATOM   4273 C CA    . GLN H 3 76 ? 50.178  68.726  56.045  1.00 48.05 ? 777 GLN E CA    1 
ATOM   4274 C C     . GLN H 3 76 ? 49.406  69.085  54.784  1.00 48.23 ? 777 GLN E C     1 
ATOM   4275 O O     . GLN H 3 76 ? 49.591  70.159  54.220  1.00 48.82 ? 777 GLN E O     1 
ATOM   4276 C CB    . GLN H 3 76 ? 51.304  67.755  55.687  1.00 48.42 ? 777 GLN E CB    1 
ATOM   4277 C CG    . GLN H 3 76 ? 52.203  67.382  56.847  1.00 49.00 ? 777 GLN E CG    1 
ATOM   4278 C CD    . GLN H 3 76 ? 53.240  66.352  56.455  1.00 49.05 ? 777 GLN E CD    1 
ATOM   4279 O OE1   . GLN H 3 76 ? 54.081  66.598  55.589  1.00 50.39 ? 777 GLN E OE1   1 
ATOM   4280 N NE2   . GLN H 3 76 ? 53.184  65.187  57.086  1.00 49.07 ? 777 GLN E NE2   1 
ATOM   4281 N N     . VAL H 3 77 ? 48.547  68.175  54.338  1.00 48.04 ? 778 VAL E N     1 
ATOM   4282 C CA    . VAL H 3 77 ? 47.748  68.424  53.148  1.00 48.75 ? 778 VAL E CA    1 
ATOM   4283 C C     . VAL H 3 77 ? 46.892  69.672  53.367  1.00 49.45 ? 778 VAL E C     1 
ATOM   4284 O O     . VAL H 3 77 ? 46.919  70.597  52.558  1.00 49.31 ? 778 VAL E O     1 
ATOM   4285 C CB    . VAL H 3 77 ? 46.832  67.222  52.823  1.00 48.31 ? 778 VAL E CB    1 
ATOM   4286 C CG1   . VAL H 3 77 ? 45.930  67.556  51.645  1.00 47.98 ? 778 VAL E CG1   1 
ATOM   4287 C CG2   . VAL H 3 77 ? 47.680  65.995  52.503  1.00 47.59 ? 778 VAL E CG2   1 
ATOM   4288 N N     . ARG H 3 78 ? 46.138  69.698  54.464  1.00 50.06 ? 779 ARG E N     1 
ATOM   4289 C CA    . ARG H 3 78 ? 45.296  70.849  54.777  1.00 51.68 ? 779 ARG E CA    1 
ATOM   4290 C C     . ARG H 3 78 ? 46.130  72.126  54.748  1.00 52.78 ? 779 ARG E C     1 
ATOM   4291 O O     . ARG H 3 78 ? 45.604  73.224  54.556  1.00 53.00 ? 779 ARG E O     1 
ATOM   4292 C CB    . ARG H 3 78 ? 44.651  70.672  56.155  1.00 51.68 ? 779 ARG E CB    1 
ATOM   4293 C CG    . ARG H 3 78 ? 43.385  69.822  56.139  1.00 52.73 ? 779 ARG E CG    1 
ATOM   4294 C CD    . ARG H 3 78 ? 43.309  68.903  57.345  1.00 53.62 ? 779 ARG E CD    1 
ATOM   4295 N NE    . ARG H 3 78 ? 43.539  69.608  58.600  1.00 53.67 ? 779 ARG E NE    1 
ATOM   4296 C CZ    . ARG H 3 78 ? 43.668  69.002  59.775  1.00 54.26 ? 779 ARG E CZ    1 
ATOM   4297 N NH1   . ARG H 3 78 ? 43.587  67.681  59.847  1.00 54.71 ? 779 ARG E NH1   1 
ATOM   4298 N NH2   . ARG H 3 78 ? 43.887  69.711  60.876  1.00 54.76 ? 779 ARG E NH2   1 
ATOM   4299 N N     . ALA H 3 79 ? 47.437  71.967  54.935  1.00 54.03 ? 780 ALA E N     1 
ATOM   4300 C CA    . ALA H 3 79 ? 48.366  73.088  54.931  1.00 55.49 ? 780 ALA E CA    1 
ATOM   4301 C C     . ALA H 3 79 ? 49.422  72.864  53.854  1.00 56.39 ? 780 ALA E C     1 
ATOM   4302 O O     . ALA H 3 79 ? 50.586  72.602  54.163  1.00 57.21 ? 780 ALA E O     1 
ATOM   4303 C CB    . ALA H 3 79 ? 49.027  73.214  56.297  1.00 55.58 ? 780 ALA E CB    1 
ATOM   4304 N N     . LEU H 3 80 ? 49.010  72.965  52.592  1.00 57.03 ? 781 LEU E N     1 
ATOM   4305 C CA    . LEU H 3 80 ? 49.911  72.761  51.458  1.00 57.67 ? 781 LEU E CA    1 
ATOM   4306 C C     . LEU H 3 80 ? 51.234  73.497  51.631  1.00 58.76 ? 781 LEU E C     1 
ATOM   4307 O O     . LEU H 3 80 ? 51.325  74.456  52.403  1.00 58.23 ? 781 LEU E O     1 
ATOM   4308 C CB    . LEU H 3 80 ? 49.248  73.215  50.152  1.00 57.12 ? 781 LEU E CB    1 
ATOM   4309 C CG    . LEU H 3 80 ? 47.955  72.518  49.723  1.00 56.31 ? 781 LEU E CG    1 
ATOM   4310 C CD1   . LEU H 3 80 ? 46.829  72.915  50.658  1.00 55.91 ? 781 LEU E CD1   1 
ATOM   4311 C CD2   . LEU H 3 80 ? 47.608  72.915  48.298  1.00 58.00 ? 781 LEU E CD2   1 
ATOM   4312 N N     . GLY H 3 81 ? 52.252  73.048  50.899  1.00 60.39 ? 782 GLY E N     1 
ATOM   4313 C CA    . GLY H 3 81 ? 53.569  73.661  50.981  1.00 61.58 ? 782 GLY E CA    1 
ATOM   4314 C C     . GLY H 3 81 ? 53.680  75.068  50.415  1.00 61.76 ? 782 GLY E C     1 
ATOM   4315 O O     . GLY H 3 81 ? 54.434  75.891  50.938  1.00 61.24 ? 782 GLY E O     1 
ATOM   4316 N N     . GLY H 3 82 ? 52.940  75.347  49.346  1.00 61.80 ? 783 GLY E N     1 
ATOM   4317 C CA    . GLY H 3 82 ? 52.984  76.667  48.741  1.00 61.95 ? 783 GLY E CA    1 
ATOM   4318 C C     . GLY H 3 82 ? 53.011  76.624  47.225  1.00 62.28 ? 783 GLY E C     1 
ATOM   4319 O O     . GLY H 3 82 ? 53.675  77.441  46.584  1.00 62.18 ? 783 GLY E O     1 
ATOM   4320 N N     . CYS H 3 83 ? 52.283  75.669  46.652  1.00 63.74 ? 784 CYS E N     1 
ATOM   4321 C CA    . CYS H 3 83 ? 52.209  75.501  45.202  1.00 63.65 ? 784 CYS E CA    1 
ATOM   4322 C C     . CYS H 3 83 ? 51.644  76.746  44.523  1.00 63.89 ? 784 CYS E C     1 
ATOM   4323 O O     . CYS H 3 83 ? 51.833  76.864  43.293  1.00 59.70 ? 784 CYS E O     1 
ATOM   4324 C CB    . CYS H 3 83 ? 51.335  74.288  44.865  1.00 67.62 ? 784 CYS E CB    1 
ATOM   4325 S SG    . CYS H 3 83 ? 51.100  73.979  43.101  1.00 58.79 ? 784 CYS E SG    1 
HETATM 4326 O O     . HOH I 4 .  ? 70.548  88.512  20.880  1.00 18.64 ? 120 HOH F O     1 
HETATM 4327 O O     . HOH I 4 .  ? 66.882  80.994  31.572  1.00 27.83 ? 121 HOH F O     1 
HETATM 4328 O O     . HOH I 4 .  ? 54.033  106.682 28.004  1.00 20.92 ? 122 HOH F O     1 
HETATM 4329 O O     . HOH I 4 .  ? 73.582  80.920  18.021  1.00 18.45 ? 123 HOH F O     1 
HETATM 4330 O O     . HOH I 4 .  ? 64.753  80.107  35.289  1.00 16.65 ? 124 HOH F O     1 
HETATM 4331 O O     . HOH I 4 .  ? 94.090  69.808  25.525  1.00 38.38 ? 125 HOH F O     1 
HETATM 4332 O O     . HOH I 4 .  ? 68.846  82.394  28.468  1.00 30.77 ? 126 HOH F O     1 
HETATM 4333 O O     . HOH I 4 .  ? 86.759  79.020  18.472  1.00 25.20 ? 127 HOH F O     1 
HETATM 4334 O O     . HOH I 4 .  ? 69.852  85.576  12.812  1.00 36.22 ? 128 HOH F O     1 
HETATM 4335 O O     . HOH I 4 .  ? 73.123  82.905  12.655  1.00 28.93 ? 129 HOH F O     1 
HETATM 4336 O O     . HOH I 4 .  ? 66.814  86.342  21.133  1.00 22.86 ? 130 HOH F O     1 
HETATM 4337 O O     . HOH I 4 .  ? 76.205  89.085  19.910  1.00 23.80 ? 131 HOH F O     1 
HETATM 4338 O O     . HOH I 4 .  ? 83.420  89.462  24.749  1.00 54.18 ? 132 HOH F O     1 
HETATM 4339 O O     . HOH I 4 .  ? 93.222  65.278  24.336  1.00 35.61 ? 133 HOH F O     1 
HETATM 4340 O O     . HOH I 4 .  ? 82.732  86.180  24.014  1.00 40.43 ? 134 HOH F O     1 
HETATM 4341 O O     . HOH I 4 .  ? 81.095  87.579  22.769  1.00 37.35 ? 135 HOH F O     1 
HETATM 4342 O O     . HOH I 4 .  ? 46.126  105.087 23.483  1.00 51.92 ? 136 HOH F O     1 
HETATM 4343 O O     . HOH I 4 .  ? 65.621  88.743  35.841  1.00 32.74 ? 137 HOH F O     1 
HETATM 4344 O O     . HOH I 4 .  ? 43.605  105.508 26.692  1.00 46.56 ? 138 HOH F O     1 
HETATM 4345 O O     . HOH I 4 .  ? 63.160  91.672  41.731  1.00 49.42 ? 139 HOH F O     1 
HETATM 4346 O O     . HOH I 4 .  ? 59.337  79.724  32.056  1.00 40.63 ? 140 HOH F O     1 
HETATM 4347 O O     . HOH I 4 .  ? 88.880  83.011  19.560  1.00 35.39 ? 141 HOH F O     1 
HETATM 4348 O O     . HOH I 4 .  ? 94.630  67.081  25.609  1.00 24.44 ? 142 HOH F O     1 
HETATM 4349 O O     . HOH I 4 .  ? 59.148  81.967  30.184  1.00 30.84 ? 143 HOH F O     1 
HETATM 4350 O O     . HOH I 4 .  ? 61.293  83.614  28.613  1.00 30.05 ? 144 HOH F O     1 
HETATM 4351 O O     . HOH I 4 .  ? 85.900  86.824  24.192  1.00 42.00 ? 145 HOH F O     1 
HETATM 4352 O O     . HOH I 4 .  ? 66.405  75.784  22.197  1.00 34.01 ? 146 HOH F O     1 
HETATM 4353 O O     . HOH I 4 .  ? 91.916  82.363  20.566  1.00 37.92 ? 147 HOH F O     1 
HETATM 4354 O O     . HOH I 4 .  ? 53.319  102.299 30.938  1.00 30.98 ? 148 HOH F O     1 
HETATM 4355 O O     . HOH I 4 .  ? 46.987  98.246  34.962  1.00 37.81 ? 149 HOH F O     1 
HETATM 4356 O O     . HOH I 4 .  ? 76.501  86.220  11.614  1.00 36.83 ? 150 HOH F O     1 
HETATM 4357 O O     . HOH I 4 .  ? 56.131  96.534  26.021  1.00 36.98 ? 151 HOH F O     1 
HETATM 4358 O O     . HOH I 4 .  ? 84.203  79.130  17.548  1.00 32.36 ? 152 HOH F O     1 
HETATM 4359 O O     . HOH I 4 .  ? 67.944  83.568  14.300  1.00 50.56 ? 153 HOH F O     1 
HETATM 4360 O O     . HOH I 4 .  ? 55.288  100.613 24.176  1.00 49.16 ? 154 HOH F O     1 
HETATM 4361 O O     . HOH I 4 .  ? 61.189  80.216  25.075  1.00 46.15 ? 155 HOH F O     1 
HETATM 4362 O O     . HOH I 4 .  ? 86.842  71.356  25.290  1.00 31.90 ? 156 HOH F O     1 
HETATM 4363 O O     . HOH I 4 .  ? 87.185  65.383  27.873  1.00 46.42 ? 157 HOH F O     1 
HETATM 4364 O O     . HOH I 4 .  ? 70.571  81.382  26.848  1.00 35.06 ? 158 HOH F O     1 
HETATM 4365 O O     . HOH I 4 .  ? 83.208  81.420  17.464  1.00 45.95 ? 159 HOH F O     1 
HETATM 4366 O O     . HOH I 4 .  ? 60.224  93.012  41.088  1.00 48.28 ? 160 HOH F O     1 
HETATM 4367 O O     . HOH I 4 .  ? 95.745  71.924  25.531  1.00 50.02 ? 161 HOH F O     1 
HETATM 4368 O O     . HOH I 4 .  ? 95.221  72.652  28.633  1.00 43.69 ? 162 HOH F O     1 
HETATM 4369 O O     . HOH I 4 .  ? 87.492  71.664  27.894  1.00 40.72 ? 163 HOH F O     1 
HETATM 4370 O O     . HOH I 4 .  ? 88.357  66.251  16.798  1.00 47.79 ? 164 HOH F O     1 
HETATM 4371 O O     . HOH I 4 .  ? 82.104  83.538  16.091  1.00 35.24 ? 165 HOH F O     1 
HETATM 4372 O O     . HOH I 4 .  ? 56.224  105.468 23.306  1.00 41.40 ? 166 HOH F O     1 
HETATM 4373 O O     . HOH I 4 .  ? 57.225  89.468  34.122  1.00 43.73 ? 167 HOH F O     1 
HETATM 4374 O O     . HOH I 4 .  ? 58.335  97.950  27.057  1.00 39.57 ? 168 HOH F O     1 
HETATM 4375 O O     . HOH I 4 .  ? 64.339  84.539  36.262  1.00 49.64 ? 169 HOH F O     1 
HETATM 4376 O O     . HOH I 4 .  ? 94.827  81.457  26.996  1.00 38.86 ? 170 HOH F O     1 
HETATM 4377 O O     . HOH I 4 .  ? 52.741  97.765  25.283  1.00 50.52 ? 171 HOH F O     1 
HETATM 4378 O O     . HOH I 4 .  ? 84.018  84.602  26.526  1.00 38.48 ? 172 HOH F O     1 
HETATM 4379 O O     . HOH I 4 .  ? 57.000  83.360  30.755  1.00 38.81 ? 173 HOH F O     1 
HETATM 4380 O O     . HOH I 4 .  ? 62.113  83.389  24.720  1.00 37.76 ? 174 HOH F O     1 
HETATM 4381 O O     . HOH I 4 .  ? 77.398  90.747  15.301  1.00 44.40 ? 175 HOH F O     1 
HETATM 4382 O O     . HOH I 4 .  ? 88.285  81.282  17.635  1.00 43.22 ? 176 HOH F O     1 
HETATM 4383 O O     . HOH I 4 .  ? 72.394  89.140  14.329  1.00 38.87 ? 177 HOH F O     1 
HETATM 4384 O O     . HOH I 4 .  ? 59.967  83.278  26.342  1.00 51.47 ? 178 HOH F O     1 
HETATM 4385 O O     . HOH I 4 .  ? 54.727  100.518 33.273  1.00 50.72 ? 179 HOH F O     1 
HETATM 4386 O O     . HOH I 4 .  ? 56.275  95.978  35.281  1.00 45.61 ? 180 HOH F O     1 
HETATM 4387 O O     . HOH I 4 .  ? 56.856  86.603  34.289  1.00 45.61 ? 181 HOH F O     1 
HETATM 4388 O O     . HOH J 4 .  ? 82.510  73.866  13.843  1.00 28.86 ? 320 HOH G O     1 
HETATM 4389 O O     . HOH J 4 .  ? 48.530  99.125  41.144  1.00 26.27 ? 321 HOH G O     1 
HETATM 4390 O O     . HOH J 4 .  ? 74.835  90.592  31.237  1.00 25.25 ? 322 HOH G O     1 
HETATM 4391 O O     . HOH J 4 .  ? 76.792  93.686  33.934  1.00 44.33 ? 323 HOH G O     1 
HETATM 4392 O O     . HOH J 4 .  ? 71.460  82.999  29.113  1.00 30.74 ? 324 HOH G O     1 
HETATM 4393 O O     . HOH J 4 .  ? 80.872  75.354  18.476  1.00 30.05 ? 325 HOH G O     1 
HETATM 4394 O O     . HOH J 4 .  ? 78.862  75.794  21.203  1.00 17.63 ? 326 HOH G O     1 
HETATM 4395 O O     . HOH J 4 .  ? 78.117  75.293  33.677  1.00 38.21 ? 327 HOH G O     1 
HETATM 4396 O O     . HOH J 4 .  ? 73.868  82.282  28.788  1.00 25.18 ? 328 HOH G O     1 
HETATM 4397 O O     . HOH J 4 .  ? 75.284  68.611  23.553  1.00 39.54 ? 329 HOH G O     1 
HETATM 4398 O O     . HOH J 4 .  ? 69.413  95.989  26.022  1.00 23.46 ? 330 HOH G O     1 
HETATM 4399 O O     . HOH J 4 .  ? 83.306  79.467  33.017  1.00 48.34 ? 331 HOH G O     1 
HETATM 4400 O O     . HOH J 4 .  ? 77.145  83.536  34.954  1.00 36.33 ? 332 HOH G O     1 
HETATM 4401 O O     . HOH J 4 .  ? 60.715  90.774  16.712  1.00 31.88 ? 333 HOH G O     1 
HETATM 4402 O O     . HOH J 4 .  ? 77.071  76.554  29.567  1.00 49.26 ? 334 HOH G O     1 
HETATM 4403 O O     . HOH J 4 .  ? 83.749  80.130  30.446  1.00 35.65 ? 335 HOH G O     1 
HETATM 4404 O O     . HOH J 4 .  ? 75.975  90.842  22.645  1.00 27.27 ? 336 HOH G O     1 
HETATM 4405 O O     . HOH J 4 .  ? 53.520  96.818  35.878  1.00 20.92 ? 337 HOH G O     1 
HETATM 4406 O O     . HOH J 4 .  ? 65.202  93.996  27.487  1.00 34.11 ? 338 HOH G O     1 
HETATM 4407 O O     . HOH J 4 .  ? 77.743  66.046  27.172  1.00 27.98 ? 339 HOH G O     1 
HETATM 4408 O O     . HOH J 4 .  ? 82.995  81.978  28.689  1.00 37.69 ? 340 HOH G O     1 
HETATM 4409 O O     . HOH J 4 .  ? 75.019  79.514  27.048  1.00 41.92 ? 341 HOH G O     1 
HETATM 4410 O O     . HOH J 4 .  ? 84.184  75.745  28.053  1.00 28.40 ? 342 HOH G O     1 
HETATM 4411 O O     . HOH J 4 .  ? 81.123  85.613  27.995  1.00 30.30 ? 343 HOH G O     1 
HETATM 4412 O O     . HOH J 4 .  ? 77.927  68.747  15.973  1.00 30.68 ? 344 HOH G O     1 
HETATM 4413 O O     . HOH J 4 .  ? 49.250  94.221  27.470  1.00 29.99 ? 345 HOH G O     1 
HETATM 4414 O O     . HOH J 4 .  ? 49.080  97.927  43.560  1.00 42.00 ? 346 HOH G O     1 
HETATM 4415 O O     . HOH J 4 .  ? 79.379  73.738  19.276  1.00 40.60 ? 347 HOH G O     1 
HETATM 4416 O O     . HOH J 4 .  ? 76.292  81.275  33.465  1.00 32.23 ? 348 HOH G O     1 
HETATM 4417 O O     . HOH J 4 .  ? 81.433  67.641  27.547  1.00 33.18 ? 349 HOH G O     1 
HETATM 4418 O O     . HOH J 4 .  ? 78.890  89.973  24.826  1.00 34.12 ? 350 HOH G O     1 
HETATM 4419 O O     . HOH J 4 .  ? 82.734  67.176  11.439  1.00 42.94 ? 351 HOH G O     1 
HETATM 4420 O O     . HOH J 4 .  ? 79.550  65.802  23.451  1.00 36.42 ? 352 HOH G O     1 
HETATM 4421 O O     . HOH J 4 .  ? 82.415  72.514  9.320   1.00 41.93 ? 353 HOH G O     1 
HETATM 4422 O O     . HOH J 4 .  ? 83.467  68.641  25.459  1.00 39.29 ? 354 HOH G O     1 
HETATM 4423 O O     . HOH J 4 .  ? 68.076  94.894  17.347  1.00 47.40 ? 355 HOH G O     1 
HETATM 4424 O O     . HOH J 4 .  ? 91.699  69.597  10.182  1.00 42.41 ? 356 HOH G O     1 
HETATM 4425 O O     . HOH J 4 .  ? 47.217  85.002  30.548  1.00 48.81 ? 357 HOH G O     1 
HETATM 4426 O O     . HOH J 4 .  ? 84.750  69.859  21.893  1.00 40.34 ? 358 HOH G O     1 
HETATM 4427 O O     . HOH J 4 .  ? 57.439  86.312  26.693  1.00 31.56 ? 359 HOH G O     1 
HETATM 4428 O O     . HOH J 4 .  ? 91.606  75.891  17.718  1.00 36.04 ? 360 HOH G O     1 
HETATM 4429 O O     . HOH J 4 .  ? 69.891  97.565  24.033  1.00 31.14 ? 361 HOH G O     1 
HETATM 4430 O O     . HOH J 4 .  ? 47.422  87.759  37.458  1.00 41.19 ? 362 HOH G O     1 
HETATM 4431 O O     . HOH J 4 .  ? 80.898  67.033  17.664  1.00 25.02 ? 363 HOH G O     1 
HETATM 4432 O O     . HOH J 4 .  ? 60.557  85.403  18.338  1.00 43.48 ? 364 HOH G O     1 
HETATM 4433 O O     . HOH J 4 .  ? 84.231  71.586  25.780  1.00 24.56 ? 365 HOH G O     1 
HETATM 4434 O O     . HOH J 4 .  ? 60.892  86.136  23.197  1.00 41.18 ? 366 HOH G O     1 
HETATM 4435 O O     . HOH J 4 .  ? 52.980  99.000  41.450  1.00 44.82 ? 367 HOH G O     1 
HETATM 4436 O O     . HOH J 4 .  ? 83.293  76.616  17.951  1.00 37.29 ? 368 HOH G O     1 
HETATM 4437 O O     . HOH J 4 .  ? 89.534  68.809  12.619  1.00 49.67 ? 369 HOH G O     1 
HETATM 4438 O O     . HOH J 4 .  ? 94.719  75.457  6.568   1.00 43.85 ? 370 HOH G O     1 
HETATM 4439 O O     . HOH J 4 .  ? 58.218  85.159  24.142  1.00 51.80 ? 371 HOH G O     1 
HETATM 4440 O O     . HOH J 4 .  ? 82.891  69.278  29.200  1.00 47.74 ? 372 HOH G O     1 
HETATM 4441 O O     . HOH J 4 .  ? 63.051  94.705  26.054  1.00 34.19 ? 373 HOH G O     1 
HETATM 4442 O O     . HOH J 4 .  ? 63.072  89.129  15.440  1.00 37.85 ? 374 HOH G O     1 
HETATM 4443 O O     . HOH J 4 .  ? 55.908  86.521  30.841  1.00 50.87 ? 375 HOH G O     1 
HETATM 4444 O O     . HOH J 4 .  ? 58.936  84.853  28.353  1.00 35.29 ? 376 HOH G O     1 
HETATM 4445 O O     . HOH J 4 .  ? 101.721 77.822  12.110  1.00 48.78 ? 377 HOH G O     1 
HETATM 4446 O O     . HOH J 4 .  ? 75.002  81.052  31.041  1.00 39.66 ? 378 HOH G O     1 
HETATM 4447 O O     . HOH J 4 .  ? 81.740  93.140  29.207  1.00 39.96 ? 379 HOH G O     1 
HETATM 4448 O O     . HOH J 4 .  ? 65.894  91.471  14.447  1.00 41.68 ? 380 HOH G O     1 
HETATM 4449 O O     . HOH J 4 .  ? 74.269  98.055  22.629  1.00 38.20 ? 381 HOH G O     1 
HETATM 4450 O O     . HOH J 4 .  ? 47.464  82.930  28.973  1.00 45.63 ? 382 HOH G O     1 
HETATM 4451 O O     . HOH J 4 .  ? 74.210  90.726  20.636  1.00 49.64 ? 383 HOH G O     1 
HETATM 4452 O O     . HOH J 4 .  ? 92.048  79.142  7.807   1.00 43.44 ? 384 HOH G O     1 
HETATM 4453 O O     . HOH J 4 .  ? 89.672  76.199  14.864  1.00 43.24 ? 385 HOH G O     1 
HETATM 4454 O O     . HOH J 4 .  ? 83.070  68.325  8.974   1.00 45.56 ? 386 HOH G O     1 
HETATM 4455 O O     . HOH K 4 .  ? 40.082  8.892   94.305  1.00 18.69 ? 4   HOH H O     1 
HETATM 4456 O O     . HOH K 4 .  ? 53.483  -2.636  79.519  1.00 21.40 ? 5   HOH H O     1 
HETATM 4457 O O     . HOH K 4 .  ? 20.195  24.497  92.109  1.00 43.37 ? 16  HOH H O     1 
HETATM 4458 O O     . HOH K 4 .  ? 30.181  22.703  85.816  1.00 15.16 ? 23  HOH H O     1 
HETATM 4459 O O     . HOH K 4 .  ? 25.029  24.293  92.483  1.00 29.73 ? 36  HOH H O     1 
HETATM 4460 O O     . HOH K 4 .  ? 60.596  -3.391  76.623  1.00 21.57 ? 58  HOH H O     1 
HETATM 4461 O O     . HOH K 4 .  ? 31.767  26.325  91.043  1.00 29.47 ? 76  HOH H O     1 
HETATM 4462 O O     . HOH K 4 .  ? 39.534  -0.063  91.973  1.00 32.08 ? 77  HOH H O     1 
HETATM 4463 O O     . HOH K 4 .  ? 35.328  23.892  89.534  1.00 37.80 ? 89  HOH H O     1 
HETATM 4464 O O     . HOH K 4 .  ? 21.425  17.393  88.648  1.00 31.98 ? 90  HOH H O     1 
HETATM 4465 O O     . HOH K 4 .  ? 24.408  21.835  83.489  1.00 35.80 ? 93  HOH H O     1 
HETATM 4466 O O     . HOH K 4 .  ? 34.980  13.826  88.720  1.00 30.92 ? 97  HOH H O     1 
HETATM 4467 O O     . HOH K 4 .  ? 28.711  22.561  94.516  1.00 21.05 ? 101 HOH H O     1 
HETATM 4468 O O     . HOH K 4 .  ? 22.705  20.061  83.105  1.00 32.84 ? 103 HOH H O     1 
HETATM 4469 O O     . HOH K 4 .  ? 37.160  10.600  89.113  1.00 24.86 ? 109 HOH H O     1 
HETATM 4470 O O     . HOH K 4 .  ? 36.164  -5.097  87.741  1.00 52.88 ? 133 HOH H O     1 
HETATM 4471 O O     . HOH K 4 .  ? 16.692  14.742  97.164  1.00 53.64 ? 137 HOH H O     1 
HETATM 4472 O O     . HOH K 4 .  ? 50.730  5.741   73.807  1.00 41.38 ? 144 HOH H O     1 
HETATM 4473 O O     . HOH K 4 .  ? 32.242  4.634   94.187  1.00 42.27 ? 153 HOH H O     1 
HETATM 4474 O O     . HOH K 4 .  ? 47.492  -5.621  73.444  1.00 42.94 ? 156 HOH H O     1 
HETATM 4475 O O     . HOH K 4 .  ? 31.492  21.120  96.142  1.00 39.80 ? 162 HOH H O     1 
HETATM 4476 O O     . HOH K 4 .  ? 37.878  -0.915  90.152  1.00 48.11 ? 170 HOH H O     1 
HETATM 4477 O O     . HOH K 4 .  ? 16.397  18.676  111.896 1.00 37.38 ? 178 HOH H O     1 
HETATM 4478 O O     . HOH K 4 .  ? 32.816  13.377  97.057  1.00 25.85 ? 196 HOH H O     1 
HETATM 4479 O O     . HOH K 4 .  ? 41.818  16.244  96.925  1.00 25.77 ? 200 HOH H O     1 
HETATM 4480 O O     . HOH K 4 .  ? 51.260  -0.055  72.053  1.00 44.54 ? 206 HOH H O     1 
HETATM 4481 O O     . HOH K 4 .  ? 18.446  16.566  98.409  1.00 38.72 ? 225 HOH H O     1 
HETATM 4482 O O     . HOH K 4 .  ? 32.384  2.516   88.297  1.00 28.75 ? 237 HOH H O     1 
HETATM 4483 O O     . HOH K 4 .  ? 31.786  17.498  96.498  1.00 29.86 ? 238 HOH H O     1 
HETATM 4484 O O     . HOH K 4 .  ? 36.096  2.968   79.390  1.00 39.81 ? 244 HOH H O     1 
HETATM 4485 O O     . HOH K 4 .  ? 31.790  0.246   96.277  1.00 40.67 ? 252 HOH H O     1 
HETATM 4486 O O     . HOH K 4 .  ? 36.197  16.194  89.572  1.00 36.79 ? 262 HOH H O     1 
HETATM 4487 O O     . HOH K 4 .  ? 20.148  21.965  84.285  1.00 39.00 ? 268 HOH H O     1 
HETATM 4488 O O     . HOH K 4 .  ? 37.540  8.681   101.149 1.00 41.01 ? 311 HOH H O     1 
HETATM 4489 O O     . HOH K 4 .  ? 43.555  -0.425  67.584  1.00 46.44 ? 312 HOH H O     1 
HETATM 4490 O O     . HOH K 4 .  ? 27.787  25.186  92.836  1.00 42.20 ? 313 HOH H O     1 
HETATM 4491 O O     . HOH K 4 .  ? 27.189  28.068  90.508  1.00 34.86 ? 327 HOH H O     1 
HETATM 4492 O O     . HOH K 4 .  ? 50.120  -2.090  69.870  1.00 40.47 ? 357 HOH H O     1 
HETATM 4493 O O     . HOH K 4 .  ? 40.602  4.032   76.411  1.00 39.00 ? 370 HOH H O     1 
HETATM 4494 O O     . HOH K 4 .  ? 33.092  19.435  96.608  1.00 38.49 ? 375 HOH H O     1 
HETATM 4495 O O     . HOH K 4 .  ? 31.513  2.628   92.090  1.00 32.81 ? 388 HOH H O     1 
HETATM 4496 O O     . HOH K 4 .  ? 14.622  14.414  93.197  1.00 27.99 ? 393 HOH H O     1 
HETATM 4497 O O     . HOH K 4 .  ? 37.797  -3.731  84.478  1.00 33.83 ? 399 HOH H O     1 
HETATM 4498 O O     . HOH K 4 .  ? 53.378  5.336   73.158  1.00 51.82 ? 403 HOH H O     1 
HETATM 4499 O O     . HOH K 4 .  ? 16.120  17.930  99.269  1.00 37.91 ? 426 HOH H O     1 
HETATM 4500 O O     . HOH K 4 .  ? 11.382  15.146  106.134 1.00 43.97 ? 429 HOH H O     1 
HETATM 4501 O O     . HOH K 4 .  ? 32.010  15.516  88.709  1.00 39.52 ? 437 HOH H O     1 
HETATM 4502 O O     . HOH K 4 .  ? 8.629   21.901  97.637  1.00 44.85 ? 441 HOH H O     1 
HETATM 4503 O O     . HOH K 4 .  ? 12.123  22.163  91.924  1.00 42.69 ? 448 HOH H O     1 
HETATM 4504 O O     . HOH K 4 .  ? 32.511  -5.435  81.987  1.00 42.77 ? 468 HOH H O     1 
HETATM 4505 O O     . HOH K 4 .  ? 23.770  25.908  90.627  1.00 44.62 ? 476 HOH H O     1 
HETATM 4506 O O     . HOH K 4 .  ? 33.779  -3.173  94.620  1.00 46.97 ? 478 HOH H O     1 
HETATM 4507 O O     . HOH K 4 .  ? 46.306  -1.988  67.487  1.00 48.40 ? 481 HOH H O     1 
HETATM 4508 O O     . HOH K 4 .  ? 37.824  17.813  90.968  1.00 40.22 ? 482 HOH H O     1 
HETATM 4509 O O     . HOH K 4 .  ? 33.294  15.802  98.144  1.00 35.37 ? 499 HOH H O     1 
HETATM 4510 O O     . HOH K 4 .  ? 14.618  18.850  105.152 1.00 50.58 ? 528 HOH H O     1 
HETATM 4511 O O     . HOH K 4 .  ? 15.748  11.382  97.413  1.00 44.83 ? 538 HOH H O     1 
HETATM 4512 O O     . HOH K 4 .  ? 16.474  15.992  91.736  1.00 39.09 ? 552 HOH H O     1 
HETATM 4513 O O     . HOH K 4 .  ? 56.758  -3.740  71.931  1.00 44.88 ? 553 HOH H O     1 
HETATM 4514 O O     . HOH K 4 .  ? 33.094  1.753   84.539  1.00 47.04 ? 556 HOH H O     1 
HETATM 4515 O O     . HOH L 4 .  ? 51.857  -11.155 82.651  1.00 27.68 ? 6   HOH J O     1 
HETATM 4516 O O     . HOH L 4 .  ? 29.907  27.859  102.490 1.00 20.64 ? 18  HOH J O     1 
HETATM 4517 O O     . HOH L 4 .  ? 32.325  13.200  87.407  1.00 31.98 ? 30  HOH J O     1 
HETATM 4518 O O     . HOH L 4 .  ? 36.086  6.845   77.397  1.00 49.81 ? 46  HOH J O     1 
HETATM 4519 O O     . HOH L 4 .  ? 29.754  3.647   89.044  1.00 28.38 ? 67  HOH J O     1 
HETATM 4520 O O     . HOH L 4 .  ? 50.085  -13.278 84.181  1.00 27.49 ? 78  HOH J O     1 
HETATM 4521 O O     . HOH L 4 .  ? 45.038  -7.759  76.599  1.00 41.72 ? 87  HOH J O     1 
HETATM 4522 O O     . HOH L 4 .  ? 36.318  12.323  87.055  1.00 40.19 ? 88  HOH J O     1 
HETATM 4523 O O     . HOH L 4 .  ? 28.614  22.683  98.440  1.00 56.54 ? 94  HOH J O     1 
HETATM 4524 O O     . HOH L 4 .  ? 21.205  14.601  94.963  1.00 42.19 ? 96  HOH J O     1 
HETATM 4525 O O     . HOH L 4 .  ? 27.246  23.486  96.383  1.00 23.30 ? 102 HOH J O     1 
HETATM 4526 O O     . HOH L 4 .  ? 28.644  30.862  98.088  1.00 36.70 ? 107 HOH J O     1 
HETATM 4527 O O     . HOH L 4 .  ? 25.597  32.951  96.310  1.00 30.22 ? 128 HOH J O     1 
HETATM 4528 O O     . HOH L 4 .  ? 44.187  -9.803  81.791  1.00 41.89 ? 143 HOH J O     1 
HETATM 4529 O O     . HOH L 4 .  ? 47.888  -15.919 73.593  1.00 40.59 ? 146 HOH J O     1 
HETATM 4530 O O     . HOH L 4 .  ? 55.067  -13.585 74.309  1.00 21.34 ? 149 HOH J O     1 
HETATM 4531 O O     . HOH L 4 .  ? 31.348  23.910  102.294 1.00 29.17 ? 172 HOH J O     1 
HETATM 4532 O O     . HOH L 4 .  ? 29.730  18.354  98.455  1.00 31.86 ? 173 HOH J O     1 
HETATM 4533 O O     . HOH L 4 .  ? 55.600  -6.489  73.841  1.00 27.57 ? 184 HOH J O     1 
HETATM 4534 O O     . HOH L 4 .  ? 44.012  9.034   75.405  1.00 44.10 ? 197 HOH J O     1 
HETATM 4535 O O     . HOH L 4 .  ? 23.829  21.566  105.334 1.00 41.94 ? 199 HOH J O     1 
HETATM 4536 O O     . HOH L 4 .  ? 42.079  6.474   78.872  1.00 48.99 ? 202 HOH J O     1 
HETATM 4537 O O     . HOH L 4 .  ? 29.941  9.429   97.125  1.00 26.27 ? 211 HOH J O     1 
HETATM 4538 O O     . HOH L 4 .  ? 29.842  11.934  98.351  1.00 35.41 ? 219 HOH J O     1 
HETATM 4539 O O     . HOH L 4 .  ? 29.466  25.226  105.342 1.00 28.20 ? 221 HOH J O     1 
HETATM 4540 O O     . HOH L 4 .  ? 17.298  31.357  97.971  1.00 34.84 ? 228 HOH J O     1 
HETATM 4541 O O     . HOH L 4 .  ? 19.775  23.795  102.867 1.00 37.50 ? 251 HOH J O     1 
HETATM 4542 O O     . HOH L 4 .  ? 44.790  -5.191  83.416  1.00 36.47 ? 255 HOH J O     1 
HETATM 4543 O O     . HOH L 4 .  ? 51.088  -9.057  81.206  1.00 43.39 ? 256 HOH J O     1 
HETATM 4544 O O     . HOH L 4 .  ? 42.859  14.935  81.067  1.00 44.39 ? 257 HOH J O     1 
HETATM 4545 O O     . HOH L 4 .  ? 29.238  4.845   93.179  1.00 29.34 ? 263 HOH J O     1 
HETATM 4546 O O     . HOH L 4 .  ? 23.080  13.995  101.397 1.00 39.95 ? 272 HOH J O     1 
HETATM 4547 O O     . HOH L 4 .  ? 31.305  12.509  80.297  1.00 25.25 ? 279 HOH J O     1 
HETATM 4548 O O     . HOH L 4 .  ? 52.716  -13.161 80.697  1.00 34.12 ? 282 HOH J O     1 
HETATM 4549 O O     . HOH L 4 .  ? 43.323  -11.785 80.012  1.00 37.05 ? 284 HOH J O     1 
HETATM 4550 O O     . HOH L 4 .  ? 39.300  14.560  75.713  1.00 29.61 ? 285 HOH J O     1 
HETATM 4551 O O     . HOH L 4 .  ? 50.615  -16.084 84.041  1.00 29.40 ? 288 HOH J O     1 
HETATM 4552 O O     . HOH L 4 .  ? 20.952  16.142  97.802  1.00 25.25 ? 289 HOH J O     1 
HETATM 4553 O O     . HOH L 4 .  ? 29.343  12.161  78.450  1.00 33.87 ? 316 HOH J O     1 
HETATM 4554 O O     . HOH L 4 .  ? 31.582  4.106   81.867  1.00 36.81 ? 333 HOH J O     1 
HETATM 4555 O O     . HOH L 4 .  ? 15.490  29.846  101.942 1.00 38.22 ? 335 HOH J O     1 
HETATM 4556 O O     . HOH L 4 .  ? 22.522  29.600  91.711  1.00 49.04 ? 353 HOH J O     1 
HETATM 4557 O O     . HOH L 4 .  ? 35.187  5.682   79.998  1.00 29.70 ? 369 HOH J O     1 
HETATM 4558 O O     . HOH L 4 .  ? 52.866  8.554   81.668  1.00 44.09 ? 372 HOH J O     1 
HETATM 4559 O O     . HOH L 4 .  ? 23.904  25.534  94.731  1.00 40.57 ? 376 HOH J O     1 
HETATM 4560 O O     . HOH L 4 .  ? 46.792  -3.271  87.669  1.00 42.30 ? 408 HOH J O     1 
HETATM 4561 O O     . HOH L 4 .  ? 52.004  -5.751  82.156  1.00 41.95 ? 424 HOH J O     1 
HETATM 4562 O O     . HOH L 4 .  ? 33.435  12.385  85.184  1.00 45.54 ? 435 HOH J O     1 
HETATM 4563 O O     . HOH L 4 .  ? 20.887  14.752  100.139 1.00 43.41 ? 445 HOH J O     1 
HETATM 4564 O O     . HOH L 4 .  ? 13.698  25.531  93.275  1.00 37.07 ? 460 HOH J O     1 
HETATM 4565 O O     . HOH L 4 .  ? 20.697  2.698   91.665  1.00 41.22 ? 475 HOH J O     1 
HETATM 4566 O O     . HOH L 4 .  ? 20.882  32.541  99.502  1.00 48.09 ? 485 HOH J O     1 
HETATM 4567 O O     . HOH L 4 .  ? 18.950  13.213  94.814  1.00 38.79 ? 493 HOH J O     1 
HETATM 4568 O O     . HOH L 4 .  ? 53.823  -2.596  83.855  1.00 48.00 ? 496 HOH J O     1 
HETATM 4569 O O     . HOH L 4 .  ? 55.719  -12.736 71.835  1.00 43.15 ? 501 HOH J O     1 
HETATM 4570 O O     . HOH L 4 .  ? 21.787  11.627  98.627  1.00 51.29 ? 508 HOH J O     1 
HETATM 4571 O O     . HOH L 4 .  ? 36.838  11.232  84.746  1.00 41.83 ? 513 HOH J O     1 
HETATM 4572 O O     . HOH L 4 .  ? 30.353  14.962  98.868  1.00 44.59 ? 522 HOH J O     1 
HETATM 4573 O O     . HOH L 4 .  ? 27.230  1.769   84.817  1.00 49.75 ? 523 HOH J O     1 
HETATM 4574 O O     . HOH L 4 .  ? 44.497  13.719  82.794  1.00 51.43 ? 525 HOH J O     1 
HETATM 4575 O O     . HOH L 4 .  ? 32.435  12.244  82.673  1.00 39.86 ? 537 HOH J O     1 
HETATM 4576 O O     . HOH L 4 .  ? 46.848  -8.861  73.595  1.00 51.71 ? 543 HOH J O     1 
HETATM 4577 O O     . HOH L 4 .  ? 23.841  24.117  102.990 1.00 38.41 ? 557 HOH J O     1 
HETATM 4578 O O     . HOH L 4 .  ? 55.110  -16.175 73.635  1.00 38.12 ? 567 HOH J O     1 
HETATM 4579 O O     . HOH L 4 .  ? 28.724  2.474   80.858  1.00 47.85 ? 580 HOH J O     1 
HETATM 4580 O O     . HOH M 4 .  ? 67.958  82.185  38.052  1.00 22.96 ? 2   HOH A O     1 
HETATM 4581 O O     . HOH M 4 .  ? 46.655  27.068  69.017  1.00 28.41 ? 19  HOH A O     1 
HETATM 4582 O O     . HOH M 4 .  ? 66.706  88.979  32.881  1.00 18.02 ? 21  HOH A O     1 
HETATM 4583 O O     . HOH M 4 .  ? 76.068  71.691  29.016  1.00 17.85 ? 24  HOH A O     1 
HETATM 4584 O O     . HOH M 4 .  ? 67.260  97.310  27.387  1.00 35.43 ? 33  HOH A O     1 
HETATM 4585 O O     . HOH M 4 .  ? 69.053  60.888  31.419  1.00 19.53 ? 38  HOH A O     1 
HETATM 4586 O O     . HOH M 4 .  ? 71.791  94.767  26.648  1.00 21.20 ? 40  HOH A O     1 
HETATM 4587 O O     . HOH M 4 .  ? 65.767  97.016  31.100  1.00 27.14 ? 43  HOH A O     1 
HETATM 4588 O O     . HOH M 4 .  ? 75.416  64.768  28.035  1.00 25.25 ? 47  HOH A O     1 
HETATM 4589 O O     . HOH M 4 .  ? 83.068  90.588  33.710  1.00 33.32 ? 51  HOH A O     1 
HETATM 4590 O O     . HOH M 4 .  ? 74.179  59.231  40.634  1.00 24.13 ? 53  HOH A O     1 
HETATM 4591 O O     . HOH M 4 .  ? 71.933  85.561  29.264  1.00 24.01 ? 60  HOH A O     1 
HETATM 4592 O O     . HOH M 4 .  ? 66.387  91.539  32.377  1.00 32.67 ? 63  HOH A O     1 
HETATM 4593 O O     . HOH M 4 .  ? 66.062  100.576 34.977  1.00 34.33 ? 65  HOH A O     1 
HETATM 4594 O O     . HOH M 4 .  ? 80.133  62.723  32.215  1.00 26.23 ? 66  HOH A O     1 
HETATM 4595 O O     . HOH M 4 .  ? 67.594  65.219  31.347  1.00 17.11 ? 69  HOH A O     1 
HETATM 4596 O O     . HOH M 4 .  ? 74.848  71.674  47.629  1.00 43.16 ? 73  HOH A O     1 
HETATM 4597 O O     . HOH M 4 .  ? 67.986  55.560  35.849  1.00 25.76 ? 80  HOH A O     1 
HETATM 4598 O O     . HOH M 4 .  ? 73.995  80.218  34.637  1.00 24.33 ? 81  HOH A O     1 
HETATM 4599 O O     . HOH M 4 .  ? 69.936  106.547 26.174  1.00 22.94 ? 82  HOH A O     1 
HETATM 4600 O O     . HOH M 4 .  ? 81.759  72.424  32.354  1.00 33.47 ? 86  HOH A O     1 
HETATM 4601 O O     . HOH M 4 .  ? 68.850  79.575  30.327  1.00 22.44 ? 91  HOH A O     1 
HETATM 4602 O O     . HOH M 4 .  ? 63.063  102.814 28.738  1.00 46.91 ? 108 HOH A O     1 
HETATM 4603 O O     . HOH M 4 .  ? 52.279  45.670  61.366  1.00 31.95 ? 110 HOH A O     1 
HETATM 4604 O O     . HOH M 4 .  ? 67.434  62.741  30.117  1.00 22.96 ? 111 HOH A O     1 
HETATM 4605 O O     . HOH M 4 .  ? 68.876  73.395  42.874  1.00 21.74 ? 132 HOH A O     1 
HETATM 4606 O O     . HOH M 4 .  ? 67.317  99.810  25.886  1.00 31.95 ? 169 HOH A O     1 
HETATM 4607 O O     . HOH M 4 .  ? 75.473  63.042  29.879  1.00 27.92 ? 180 HOH A O     1 
HETATM 4608 O O     . HOH M 4 .  ? 66.494  42.497  52.736  1.00 49.80 ? 181 HOH A O     1 
HETATM 4609 O O     . HOH M 4 .  ? 81.512  65.391  32.812  1.00 29.52 ? 182 HOH A O     1 
HETATM 4610 O O     . HOH M 4 .  ? 66.656  49.299  46.313  1.00 44.30 ? 187 HOH A O     1 
HETATM 4611 O O     . HOH M 4 .  ? 77.151  73.790  45.080  1.00 45.40 ? 188 HOH A O     1 
HETATM 4612 O O     . HOH M 4 .  ? 66.182  85.963  42.185  1.00 47.09 ? 191 HOH A O     1 
HETATM 4613 O O     . HOH M 4 .  ? 71.523  56.870  37.897  1.00 29.51 ? 204 HOH A O     1 
HETATM 4614 O O     . HOH M 4 .  ? 67.341  58.705  32.061  1.00 27.07 ? 205 HOH A O     1 
HETATM 4615 O O     . HOH M 4 .  ? 76.377  97.034  31.220  1.00 41.87 ? 217 HOH A O     1 
HETATM 4616 O O     . HOH M 4 .  ? 51.682  20.563  66.688  1.00 63.86 ? 218 HOH A O     1 
HETATM 4617 O O     . HOH M 4 .  ? 78.090  62.179  30.369  1.00 29.47 ? 231 HOH A O     1 
HETATM 4618 O O     . HOH M 4 .  ? 55.300  48.057  40.917  1.00 40.92 ? 245 HOH A O     1 
HETATM 4619 O O     . HOH M 4 .  ? 52.051  40.747  58.752  1.00 44.58 ? 249 HOH A O     1 
HETATM 4620 O O     . HOH M 4 .  ? 77.569  65.125  43.714  1.00 38.51 ? 264 HOH A O     1 
HETATM 4621 O O     . HOH M 4 .  ? 81.933  61.864  40.806  1.00 49.02 ? 271 HOH A O     1 
HETATM 4622 O O     . HOH M 4 .  ? 60.809  48.234  39.859  1.00 41.24 ? 283 HOH A O     1 
HETATM 4623 O O     . HOH M 4 .  ? 72.842  94.416  38.683  1.00 51.91 ? 287 HOH A O     1 
HETATM 4624 O O     . HOH M 4 .  ? 46.645  28.771  56.058  1.00 38.69 ? 293 HOH A O     1 
HETATM 4625 O O     . HOH M 4 .  ? 62.330  54.243  37.381  1.00 38.05 ? 295 HOH A O     1 
HETATM 4626 O O     . HOH M 4 .  ? 72.375  103.214 34.801  1.00 45.25 ? 297 HOH A O     1 
HETATM 4627 O O     . HOH M 4 .  ? 66.777  51.552  40.585  1.00 44.02 ? 298 HOH A O     1 
HETATM 4628 O O     . HOH M 4 .  ? 82.772  77.890  38.533  1.00 45.66 ? 306 HOH A O     1 
HETATM 4629 O O     . HOH M 4 .  ? 80.720  74.737  35.970  1.00 36.87 ? 308 HOH A O     1 
HETATM 4630 O O     . HOH M 4 .  ? 78.874  59.564  49.424  1.00 43.39 ? 320 HOH A O     1 
HETATM 4631 O O     . HOH M 4 .  ? 54.815  46.237  60.670  1.00 50.91 ? 321 HOH A O     1 
HETATM 4632 O O     . HOH M 4 .  ? 72.546  98.825  37.494  1.00 41.54 ? 322 HOH A O     1 
HETATM 4633 O O     . HOH M 4 .  ? 77.844  79.190  41.837  1.00 43.71 ? 324 HOH A O     1 
HETATM 4634 O O     . HOH M 4 .  ? 67.682  56.428  33.286  1.00 48.10 ? 325 HOH A O     1 
HETATM 4635 O O     . HOH M 4 .  ? 85.621  71.618  32.469  1.00 53.67 ? 328 HOH A O     1 
HETATM 4636 O O     . HOH M 4 .  ? 55.929  50.753  56.791  1.00 35.50 ? 329 HOH A O     1 
HETATM 4637 O O     . HOH M 4 .  ? 77.017  81.493  40.944  1.00 45.87 ? 341 HOH A O     1 
HETATM 4638 O O     . HOH M 4 .  ? 65.113  88.144  40.889  1.00 54.77 ? 342 HOH A O     1 
HETATM 4639 O O     . HOH M 4 .  ? 63.644  47.994  40.342  1.00 44.74 ? 344 HOH A O     1 
HETATM 4640 O O     . HOH M 4 .  ? 67.271  94.182  25.161  1.00 46.89 ? 349 HOH A O     1 
HETATM 4641 O O     . HOH M 4 .  ? 69.958  53.391  43.230  1.00 58.93 ? 380 HOH A O     1 
HETATM 4642 O O     . HOH M 4 .  ? 51.536  28.994  57.266  1.00 39.73 ? 386 HOH A O     1 
HETATM 4643 O O     . HOH M 4 .  ? 75.140  62.774  47.025  1.00 43.02 ? 391 HOH A O     1 
HETATM 4644 O O     . HOH M 4 .  ? 54.881  42.192  46.615  1.00 35.03 ? 394 HOH A O     1 
HETATM 4645 O O     . HOH M 4 .  ? 65.659  109.669 29.638  1.00 36.89 ? 397 HOH A O     1 
HETATM 4646 O O     . HOH M 4 .  ? 79.043  72.936  48.454  1.00 45.50 ? 407 HOH A O     1 
HETATM 4647 O O     . HOH M 4 .  ? 80.223  67.754  42.402  1.00 48.13 ? 410 HOH A O     1 
HETATM 4648 O O     . HOH M 4 .  ? 50.084  40.953  55.125  1.00 33.52 ? 412 HOH A O     1 
HETATM 4649 O O     . HOH M 4 .  ? 84.972  68.151  37.151  1.00 37.90 ? 417 HOH A O     1 
HETATM 4650 O O     . HOH M 4 .  ? 72.913  59.371  37.722  1.00 30.44 ? 420 HOH A O     1 
HETATM 4651 O O     . HOH M 4 .  ? 72.374  65.981  24.042  1.00 32.84 ? 421 HOH A O     1 
HETATM 4652 O O     . HOH M 4 .  ? 53.879  46.984  53.426  1.00 41.30 ? 433 HOH A O     1 
HETATM 4653 O O     . HOH M 4 .  ? 66.265  53.331  36.379  1.00 44.02 ? 436 HOH A O     1 
HETATM 4654 O O     . HOH M 4 .  ? 58.516  40.261  43.565  1.00 49.59 ? 438 HOH A O     1 
HETATM 4655 O O     . HOH M 4 .  ? 58.168  54.935  42.714  1.00 33.99 ? 439 HOH A O     1 
HETATM 4656 O O     . HOH M 4 .  ? 61.645  37.088  55.481  1.00 35.83 ? 440 HOH A O     1 
HETATM 4657 O O     . HOH M 4 .  ? 70.638  81.375  31.278  1.00 37.72 ? 444 HOH A O     1 
HETATM 4658 O O     . HOH M 4 .  ? 67.774  51.679  37.916  1.00 45.59 ? 454 HOH A O     1 
HETATM 4659 O O     . HOH M 4 .  ? 55.233  36.017  51.230  1.00 39.96 ? 457 HOH A O     1 
HETATM 4660 O O     . HOH M 4 .  ? 75.474  86.048  43.371  1.00 44.55 ? 473 HOH A O     1 
HETATM 4661 O O     . HOH M 4 .  ? 65.968  82.296  36.282  1.00 33.60 ? 484 HOH A O     1 
HETATM 4662 O O     . HOH M 4 .  ? 72.952  107.156 25.826  1.00 48.75 ? 487 HOH A O     1 
HETATM 4663 O O     . HOH M 4 .  ? 79.250  71.816  37.042  1.00 38.72 ? 498 HOH A O     1 
HETATM 4664 O O     . HOH M 4 .  ? 55.149  48.294  43.718  1.00 45.00 ? 500 HOH A O     1 
HETATM 4665 O O     . HOH M 4 .  ? 80.274  83.150  35.418  1.00 49.30 ? 515 HOH A O     1 
HETATM 4666 O O     . HOH M 4 .  ? 68.935  73.989  45.599  1.00 41.29 ? 535 HOH A O     1 
HETATM 4667 O O     . HOH M 4 .  ? 55.948  28.086  73.445  1.00 43.08 ? 536 HOH A O     1 
HETATM 4668 O O     . HOH M 4 .  ? 80.847  60.068  33.342  1.00 36.98 ? 542 HOH A O     1 
HETATM 4669 O O     . HOH M 4 .  ? 60.577  28.415  55.237  1.00 48.48 ? 555 HOH A O     1 
HETATM 4670 O O     . HOH M 4 .  ? 48.998  35.855  61.043  1.00 42.18 ? 566 HOH A O     1 
HETATM 4671 O O     . HOH N 4 .  ? 70.183  76.677  30.835  1.00 15.16 ? 285 HOH B O     1 
HETATM 4672 O O     . HOH N 4 .  ? 73.629  70.486  25.268  1.00 15.16 ? 286 HOH B O     1 
HETATM 4673 O O     . HOH N 4 .  ? 79.207  84.082  15.849  1.00 23.44 ? 287 HOH B O     1 
HETATM 4674 O O     . HOH N 4 .  ? 73.421  80.223  11.784  1.00 19.38 ? 288 HOH B O     1 
HETATM 4675 O O     . HOH N 4 .  ? 74.114  80.695  23.612  1.00 19.45 ? 289 HOH B O     1 
HETATM 4676 O O     . HOH N 4 .  ? 75.806  71.378  18.550  1.00 16.08 ? 290 HOH B O     1 
HETATM 4677 O O     . HOH N 4 .  ? 66.084  64.842  26.645  1.00 29.09 ? 291 HOH B O     1 
HETATM 4678 O O     . HOH N 4 .  ? 73.872  77.135  28.274  1.00 29.64 ? 292 HOH B O     1 
HETATM 4679 O O     . HOH N 4 .  ? 68.372  75.939  26.156  1.00 20.72 ? 293 HOH B O     1 
HETATM 4680 O O     . HOH N 4 .  ? 55.153  66.400  32.728  1.00 32.11 ? 294 HOH B O     1 
HETATM 4681 O O     . HOH N 4 .  ? 75.554  74.954  9.951   1.00 30.34 ? 295 HOH B O     1 
HETATM 4682 O O     . HOH N 4 .  ? 57.083  75.375  32.207  1.00 39.73 ? 296 HOH B O     1 
HETATM 4683 O O     . HOH N 4 .  ? 78.550  82.666  7.619   1.00 22.97 ? 297 HOH B O     1 
HETATM 4684 O O     . HOH N 4 .  ? 62.357  72.650  28.519  1.00 23.05 ? 298 HOH B O     1 
HETATM 4685 O O     . HOH N 4 .  ? 60.620  71.811  26.537  1.00 40.52 ? 299 HOH B O     1 
HETATM 4686 O O     . HOH N 4 .  ? 75.974  71.694  26.252  1.00 15.16 ? 300 HOH B O     1 
HETATM 4687 O O     . HOH N 4 .  ? 57.419  23.281  62.163  1.00 43.31 ? 301 HOH B O     1 
HETATM 4688 O O     . HOH N 4 .  ? 70.746  77.617  27.542  1.00 42.15 ? 302 HOH B O     1 
HETATM 4689 O O     . HOH N 4 .  ? 61.422  53.284  59.466  1.00 49.88 ? 303 HOH B O     1 
HETATM 4690 O O     . HOH N 4 .  ? 61.940  81.268  38.487  1.00 38.27 ? 304 HOH B O     1 
HETATM 4691 O O     . HOH N 4 .  ? 70.971  74.352  14.890  1.00 24.72 ? 305 HOH B O     1 
HETATM 4692 O O     . HOH N 4 .  ? 58.026  45.837  61.952  1.00 42.51 ? 306 HOH B O     1 
HETATM 4693 O O     . HOH N 4 .  ? 72.430  77.711  31.224  1.00 43.82 ? 307 HOH B O     1 
HETATM 4694 O O     . HOH N 4 .  ? 67.354  68.824  20.430  1.00 44.16 ? 308 HOH B O     1 
HETATM 4695 O O     . HOH N 4 .  ? 49.596  67.604  39.019  1.00 16.14 ? 309 HOH B O     1 
HETATM 4696 O O     . HOH N 4 .  ? 57.608  66.348  43.604  1.00 31.02 ? 310 HOH B O     1 
HETATM 4697 O O     . HOH N 4 .  ? 75.116  69.749  20.647  1.00 20.98 ? 311 HOH B O     1 
HETATM 4698 O O     . HOH N 4 .  ? 67.706  66.152  22.994  1.00 33.75 ? 312 HOH B O     1 
HETATM 4699 O O     . HOH N 4 .  ? 59.607  68.595  44.429  1.00 44.78 ? 313 HOH B O     1 
HETATM 4700 O O     . HOH N 4 .  ? 65.885  73.022  46.148  1.00 29.56 ? 314 HOH B O     1 
HETATM 4701 O O     . HOH N 4 .  ? 58.540  47.421  59.968  1.00 35.76 ? 315 HOH B O     1 
HETATM 4702 O O     . HOH N 4 .  ? 88.525  81.953  9.257   1.00 63.94 ? 316 HOH B O     1 
HETATM 4703 O O     . HOH N 4 .  ? 87.361  76.372  12.239  1.00 44.85 ? 317 HOH B O     1 
HETATM 4704 O O     . HOH N 4 .  ? 63.611  70.251  20.770  1.00 46.87 ? 318 HOH B O     1 
HETATM 4705 O O     . HOH N 4 .  ? 67.607  68.015  17.958  1.00 49.32 ? 319 HOH B O     1 
HETATM 4706 O O     . HOH N 4 .  ? 62.551  78.984  20.006  1.00 48.12 ? 320 HOH B O     1 
HETATM 4707 O O     . HOH N 4 .  ? 61.714  70.602  24.169  1.00 36.31 ? 321 HOH B O     1 
HETATM 4708 O O     . HOH N 4 .  ? 62.488  61.982  28.440  1.00 31.29 ? 322 HOH B O     1 
HETATM 4709 O O     . HOH N 4 .  ? 68.766  74.097  16.307  1.00 38.18 ? 323 HOH B O     1 
HETATM 4710 O O     . HOH N 4 .  ? 64.049  77.079  21.127  1.00 49.76 ? 324 HOH B O     1 
HETATM 4711 O O     . HOH N 4 .  ? 60.319  20.871  65.940  1.00 49.88 ? 325 HOH B O     1 
HETATM 4712 O O     . HOH N 4 .  ? 62.746  75.790  28.687  1.00 35.97 ? 326 HOH B O     1 
HETATM 4713 O O     . HOH N 4 .  ? 69.933  52.563  52.882  1.00 46.88 ? 327 HOH B O     1 
HETATM 4714 O O     . HOH N 4 .  ? 61.313  76.259  31.722  1.00 48.38 ? 328 HOH B O     1 
HETATM 4715 O O     . HOH N 4 .  ? 83.893  75.607  12.122  1.00 30.31 ? 329 HOH B O     1 
HETATM 4716 O O     . HOH N 4 .  ? 65.703  37.544  63.709  1.00 41.10 ? 330 HOH B O     1 
HETATM 4717 O O     . HOH N 4 .  ? 77.945  70.354  11.655  1.00 51.24 ? 331 HOH B O     1 
HETATM 4718 O O     . HOH N 4 .  ? 59.315  75.868  47.065  1.00 51.62 ? 332 HOH B O     1 
HETATM 4719 O O     . HOH N 4 .  ? 61.626  67.057  19.345  1.00 27.96 ? 333 HOH B O     1 
HETATM 4720 O O     . HOH N 4 .  ? 52.616  19.181  69.714  1.00 41.83 ? 334 HOH B O     1 
HETATM 4721 O O     . HOH N 4 .  ? 78.213  88.608  8.507   1.00 46.73 ? 335 HOH B O     1 
HETATM 4722 O O     . HOH N 4 .  ? 57.561  67.965  47.327  1.00 43.85 ? 336 HOH B O     1 
HETATM 4723 O O     . HOH N 4 .  ? 68.013  76.272  20.133  1.00 48.71 ? 337 HOH B O     1 
HETATM 4724 O O     . HOH N 4 .  ? 82.803  77.778  13.326  1.00 27.76 ? 338 HOH B O     1 
HETATM 4725 O O     . HOH N 4 .  ? 69.782  66.215  24.725  1.00 44.75 ? 339 HOH B O     1 
HETATM 4726 O O     . HOH N 4 .  ? 82.126  76.236  15.480  1.00 35.47 ? 340 HOH B O     1 
HETATM 4727 O O     . HOH N 4 .  ? 63.392  67.553  50.666  1.00 38.43 ? 341 HOH B O     1 
HETATM 4728 O O     . HOH N 4 .  ? 60.493  65.004  27.930  1.00 43.57 ? 342 HOH B O     1 
HETATM 4729 O O     . HOH N 4 .  ? 67.063  76.085  17.445  1.00 50.45 ? 343 HOH B O     1 
HETATM 4730 O O     . HOH N 4 .  ? 65.633  65.498  53.169  1.00 40.70 ? 344 HOH B O     1 
HETATM 4731 O O     . HOH N 4 .  ? 55.142  22.395  69.782  1.00 44.55 ? 345 HOH B O     1 
HETATM 4732 O O     . HOH N 4 .  ? 52.052  70.748  41.946  1.00 43.81 ? 346 HOH B O     1 
HETATM 4733 O O     . HOH N 4 .  ? 82.878  83.585  8.747   1.00 44.87 ? 347 HOH B O     1 
HETATM 4734 O O     . HOH N 4 .  ? 62.568  41.830  65.899  1.00 47.69 ? 348 HOH B O     1 
HETATM 4735 O O     . HOH N 4 .  ? 66.582  79.610  42.489  1.00 42.59 ? 349 HOH B O     1 
HETATM 4736 O O     . HOH N 4 .  ? 65.588  26.991  66.380  1.00 39.69 ? 350 HOH B O     1 
HETATM 4737 O O     . HOH N 4 .  ? 60.936  59.192  55.740  1.00 47.43 ? 351 HOH B O     1 
HETATM 4738 O O     . HOH N 4 .  ? 57.921  53.310  54.477  1.00 45.37 ? 352 HOH B O     1 
HETATM 4739 O O     . HOH N 4 .  ? 64.100  69.094  54.238  1.00 50.49 ? 353 HOH B O     1 
HETATM 4740 O O     . HOH N 4 .  ? 69.474  41.100  64.697  1.00 41.10 ? 354 HOH B O     1 
HETATM 4741 O O     . HOH N 4 .  ? 69.670  42.865  61.658  1.00 49.02 ? 355 HOH B O     1 
HETATM 4742 O O     . HOH N 4 .  ? 64.881  28.089  60.114  1.00 42.17 ? 356 HOH B O     1 
HETATM 4743 O O     . HOH N 4 .  ? 53.842  31.104  70.827  1.00 46.72 ? 357 HOH B O     1 
HETATM 4744 O O     . HOH N 4 .  ? 59.421  29.696  70.599  1.00 47.18 ? 358 HOH B O     1 
HETATM 4745 O O     . HOH N 4 .  ? 64.817  60.344  57.317  1.00 49.83 ? 359 HOH B O     1 
HETATM 4746 O O     . HOH O 4 .  ? 33.933  35.141  77.222  1.00 23.00 ? 585 HOH D O     1 
HETATM 4747 O O     . HOH O 4 .  ? 44.541  15.971  84.734  1.00 33.15 ? 586 HOH D O     1 
HETATM 4748 O O     . HOH O 4 .  ? 44.694  25.693  81.828  1.00 24.02 ? 587 HOH D O     1 
HETATM 4749 O O     . HOH O 4 .  ? 32.172  25.248  74.937  1.00 22.85 ? 588 HOH D O     1 
HETATM 4750 O O     . HOH O 4 .  ? 38.925  1.972   93.504  1.00 26.59 ? 589 HOH D O     1 
HETATM 4751 O O     . HOH O 4 .  ? 37.458  46.227  60.163  1.00 28.94 ? 590 HOH D O     1 
HETATM 4752 O O     . HOH O 4 .  ? 38.863  18.013  88.425  1.00 24.13 ? 591 HOH D O     1 
HETATM 4753 O O     . HOH O 4 .  ? 46.371  -5.432  94.960  1.00 30.75 ? 592 HOH D O     1 
HETATM 4754 O O     . HOH O 4 .  ? 35.301  44.681  60.149  1.00 40.89 ? 593 HOH D O     1 
HETATM 4755 O O     . HOH O 4 .  ? 35.084  39.885  68.165  1.00 35.24 ? 594 HOH D O     1 
HETATM 4756 O O     . HOH O 4 .  ? 50.081  8.759   93.195  1.00 43.77 ? 595 HOH D O     1 
HETATM 4757 O O     . HOH O 4 .  ? 33.471  36.386  74.799  1.00 22.79 ? 596 HOH D O     1 
HETATM 4758 O O     . HOH O 4 .  ? 45.765  0.495   90.548  1.00 39.03 ? 597 HOH D O     1 
HETATM 4759 O O     . HOH O 4 .  ? 35.624  37.037  78.132  1.00 22.34 ? 598 HOH D O     1 
HETATM 4760 O O     . HOH O 4 .  ? 46.192  31.428  83.506  1.00 18.49 ? 599 HOH D O     1 
HETATM 4761 O O     . HOH O 4 .  ? 39.531  17.904  93.360  1.00 51.76 ? 600 HOH D O     1 
HETATM 4762 O O     . HOH O 4 .  ? 28.059  32.817  84.847  1.00 28.37 ? 601 HOH D O     1 
HETATM 4763 O O     . HOH O 4 .  ? 45.725  34.246  78.797  1.00 58.62 ? 602 HOH D O     1 
HETATM 4764 O O     . HOH O 4 .  ? 25.162  22.734  79.461  1.00 42.53 ? 603 HOH D O     1 
HETATM 4765 O O     . HOH O 4 .  ? 47.371  21.422  85.542  1.00 44.73 ? 604 HOH D O     1 
HETATM 4766 O O     . HOH O 4 .  ? 43.654  39.018  85.816  1.00 40.74 ? 605 HOH D O     1 
HETATM 4767 O O     . HOH O 4 .  ? 40.894  35.214  63.037  1.00 27.84 ? 606 HOH D O     1 
HETATM 4768 O O     . HOH O 4 .  ? 47.995  2.642   105.441 1.00 36.75 ? 607 HOH D O     1 
HETATM 4769 O O     . HOH O 4 .  ? 46.339  43.779  62.023  1.00 37.34 ? 608 HOH D O     1 
HETATM 4770 O O     . HOH O 4 .  ? 26.625  27.073  81.383  1.00 33.51 ? 609 HOH D O     1 
HETATM 4771 O O     . HOH O 4 .  ? 34.746  33.061  89.979  1.00 31.28 ? 610 HOH D O     1 
HETATM 4772 O O     . HOH O 4 .  ? 42.080  40.013  71.988  1.00 44.08 ? 611 HOH D O     1 
HETATM 4773 O O     . HOH O 4 .  ? 46.873  20.073  92.358  1.00 40.01 ? 612 HOH D O     1 
HETATM 4774 O O     . HOH O 4 .  ? 40.549  34.399  88.347  1.00 54.92 ? 613 HOH D O     1 
HETATM 4775 O O     . HOH O 4 .  ? 45.195  26.422  90.722  1.00 47.69 ? 614 HOH D O     1 
HETATM 4776 O O     . HOH O 4 .  ? 37.337  13.880  82.925  1.00 38.28 ? 615 HOH D O     1 
HETATM 4777 O O     . HOH O 4 .  ? 35.192  33.972  65.264  1.00 30.75 ? 616 HOH D O     1 
HETATM 4778 O O     . HOH O 4 .  ? 57.506  59.768  43.863  1.00 33.42 ? 617 HOH D O     1 
HETATM 4779 O O     . HOH O 4 .  ? 31.235  36.168  86.307  1.00 39.11 ? 618 HOH D O     1 
HETATM 4780 O O     . HOH O 4 .  ? 46.865  18.680  94.239  1.00 25.23 ? 619 HOH D O     1 
HETATM 4781 O O     . HOH O 4 .  ? 47.934  5.656   99.924  1.00 38.03 ? 620 HOH D O     1 
HETATM 4782 O O     . HOH O 4 .  ? 40.251  40.720  74.851  1.00 37.69 ? 621 HOH D O     1 
HETATM 4783 O O     . HOH O 4 .  ? 37.828  27.423  88.251  1.00 41.37 ? 622 HOH D O     1 
HETATM 4784 O O     . HOH O 4 .  ? 41.455  52.962  52.664  1.00 29.23 ? 623 HOH D O     1 
HETATM 4785 O O     . HOH O 4 .  ? 46.161  -6.377  99.495  1.00 32.78 ? 624 HOH D O     1 
HETATM 4786 O O     . HOH O 4 .  ? 34.171  41.624  64.050  1.00 40.42 ? 625 HOH D O     1 
HETATM 4787 O O     . HOH O 4 .  ? 36.653  43.124  84.957  1.00 41.61 ? 626 HOH D O     1 
HETATM 4788 O O     . HOH O 4 .  ? 40.643  12.333  100.120 1.00 45.31 ? 627 HOH D O     1 
HETATM 4789 O O     . HOH O 4 .  ? 46.548  60.284  46.446  1.00 36.23 ? 628 HOH D O     1 
HETATM 4790 O O     . HOH O 4 .  ? 33.384  28.580  91.281  1.00 27.33 ? 629 HOH D O     1 
HETATM 4791 O O     . HOH O 4 .  ? 42.129  9.335   98.038  1.00 47.55 ? 630 HOH D O     1 
HETATM 4792 O O     . HOH O 4 .  ? 36.914  47.886  62.023  1.00 39.68 ? 631 HOH D O     1 
HETATM 4793 O O     . HOH O 4 .  ? 46.625  43.845  57.724  1.00 38.74 ? 632 HOH D O     1 
HETATM 4794 O O     . HOH O 4 .  ? 46.271  26.959  88.187  1.00 25.43 ? 633 HOH D O     1 
HETATM 4795 O O     . HOH O 4 .  ? 48.274  23.768  85.058  1.00 60.42 ? 634 HOH D O     1 
HETATM 4796 O O     . HOH O 4 .  ? 28.244  35.607  84.153  1.00 37.53 ? 635 HOH D O     1 
HETATM 4797 O O     . HOH O 4 .  ? 43.425  44.816  71.649  1.00 36.08 ? 636 HOH D O     1 
HETATM 4798 O O     . HOH O 4 .  ? 31.320  36.514  82.661  1.00 48.93 ? 637 HOH D O     1 
HETATM 4799 O O     . HOH O 4 .  ? 31.876  34.603  70.546  1.00 38.16 ? 638 HOH D O     1 
HETATM 4800 O O     . HOH O 4 .  ? 46.658  31.883  86.547  1.00 43.38 ? 639 HOH D O     1 
HETATM 4801 O O     . HOH O 4 .  ? 40.355  33.855  91.691  1.00 51.50 ? 640 HOH D O     1 
HETATM 4802 O O     . HOH O 4 .  ? 49.687  44.337  63.066  1.00 40.40 ? 641 HOH D O     1 
HETATM 4803 O O     . HOH O 4 .  ? 41.815  -1.312  91.607  1.00 42.91 ? 642 HOH D O     1 
HETATM 4804 O O     . HOH O 4 .  ? 47.593  16.601  91.133  1.00 31.59 ? 643 HOH D O     1 
HETATM 4805 O O     . HOH O 4 .  ? 48.776  55.514  46.242  1.00 45.25 ? 644 HOH D O     1 
HETATM 4806 O O     . HOH O 4 .  ? 53.909  58.896  57.506  1.00 41.45 ? 645 HOH D O     1 
HETATM 4807 O O     . HOH O 4 .  ? 48.773  46.188  54.007  1.00 43.66 ? 646 HOH D O     1 
HETATM 4808 O O     . HOH O 4 .  ? 36.449  33.904  87.870  1.00 38.00 ? 647 HOH D O     1 
HETATM 4809 O O     . HOH O 4 .  ? 46.082  -8.205  97.552  1.00 49.39 ? 648 HOH D O     1 
HETATM 4810 O O     . HOH O 4 .  ? 44.730  46.490  49.940  1.00 44.38 ? 649 HOH D O     1 
HETATM 4811 O O     . HOH O 4 .  ? 36.876  44.591  89.372  1.00 47.89 ? 650 HOH D O     1 
HETATM 4812 O O     . HOH O 4 .  ? 41.844  -3.740  92.588  1.00 47.17 ? 651 HOH D O     1 
HETATM 4813 O O     . HOH O 4 .  ? 40.866  45.039  73.710  1.00 41.68 ? 652 HOH D O     1 
HETATM 4814 O O     . HOH O 4 .  ? 43.648  7.809   86.794  1.00 34.04 ? 653 HOH D O     1 
HETATM 4815 O O     . HOH O 4 .  ? 39.106  35.726  84.854  1.00 32.48 ? 654 HOH D O     1 
HETATM 4816 O O     . HOH O 4 .  ? 41.932  4.731   98.941  1.00 33.58 ? 655 HOH D O     1 
HETATM 4817 O O     . HOH O 4 .  ? 54.820  51.321  53.712  1.00 46.68 ? 656 HOH D O     1 
HETATM 4818 O O     . HOH O 4 .  ? 38.116  14.275  86.091  1.00 49.65 ? 657 HOH D O     1 
HETATM 4819 O O     . HOH O 4 .  ? 54.453  50.623  58.978  1.00 47.55 ? 658 HOH D O     1 
HETATM 4820 O O     . HOH O 4 .  ? 36.093  35.155  62.654  1.00 48.74 ? 659 HOH D O     1 
HETATM 4821 O O     . HOH O 4 .  ? 28.902  37.187  90.033  1.00 51.42 ? 660 HOH D O     1 
HETATM 4822 O O     . HOH O 4 .  ? 46.045  12.403  95.721  1.00 40.40 ? 661 HOH D O     1 
HETATM 4823 O O     . HOH O 4 .  ? 45.872  15.139  94.798  1.00 47.70 ? 662 HOH D O     1 
HETATM 4824 O O     . HOH O 4 .  ? 47.507  53.013  48.596  1.00 48.94 ? 663 HOH D O     1 
HETATM 4825 O O     . HOH O 4 .  ? 38.589  40.312  72.152  1.00 52.00 ? 664 HOH D O     1 
HETATM 4826 O O     . HOH O 4 .  ? 44.444  -0.145  105.115 1.00 46.28 ? 665 HOH D O     1 
HETATM 4827 O O     . HOH O 4 .  ? 46.644  3.980   103.384 1.00 50.80 ? 666 HOH D O     1 
HETATM 4828 O O     . HOH P 4 .  ? 27.183  20.743  82.648  1.00 18.85 ? 12  HOH E O     1 
HETATM 4829 O O     . HOH P 4 .  ? 23.136  7.735   93.281  1.00 25.16 ? 26  HOH E O     1 
HETATM 4830 O O     . HOH P 4 .  ? 51.029  37.069  70.826  1.00 23.92 ? 28  HOH E O     1 
HETATM 4831 O O     . HOH P 4 .  ? 20.547  11.218  81.378  1.00 28.84 ? 29  HOH E O     1 
HETATM 4832 O O     . HOH P 4 .  ? 50.713  31.996  75.302  1.00 24.61 ? 34  HOH E O     1 
HETATM 4833 O O     . HOH P 4 .  ? 27.820  21.398  85.187  1.00 15.16 ? 35  HOH E O     1 
HETATM 4834 O O     . HOH P 4 .  ? 25.617  20.595  75.201  1.00 26.99 ? 45  HOH E O     1 
HETATM 4835 O O     . HOH P 4 .  ? 21.287  17.729  84.451  1.00 21.26 ? 48  HOH E O     1 
HETATM 4836 O O     . HOH P 4 .  ? 32.712  15.753  83.791  1.00 26.12 ? 54  HOH E O     1 
HETATM 4837 O O     . HOH P 4 .  ? 49.253  57.315  58.355  1.00 50.70 ? 57  HOH E O     1 
HETATM 4838 O O     . HOH P 4 .  ? 25.081  9.057   86.930  1.00 22.12 ? 59  HOH E O     1 
HETATM 4839 O O     . HOH P 4 .  ? 36.176  17.899  84.077  1.00 22.07 ? 79  HOH E O     1 
HETATM 4840 O O     . HOH P 4 .  ? 29.330  23.407  68.289  1.00 58.52 ? 83  HOH E O     1 
HETATM 4841 O O     . HOH P 4 .  ? 43.811  42.116  73.060  1.00 20.80 ? 95  HOH E O     1 
HETATM 4842 O O     . HOH P 4 .  ? 43.871  11.562  75.252  1.00 42.61 ? 104 HOH E O     1 
HETATM 4843 O O     . HOH P 4 .  ? 29.795  12.203  87.903  1.00 23.98 ? 115 HOH E O     1 
HETATM 4844 O O     . HOH P 4 .  ? 31.750  15.198  81.330  1.00 23.06 ? 117 HOH E O     1 
HETATM 4845 O O     . HOH P 4 .  ? 43.998  66.865  54.873  1.00 40.65 ? 126 HOH E O     1 
HETATM 4846 O O     . HOH P 4 .  ? 35.257  26.594  66.514  1.00 41.11 ? 141 HOH E O     1 
HETATM 4847 O O     . HOH P 4 .  ? 42.301  37.004  77.991  1.00 23.69 ? 150 HOH E O     1 
HETATM 4848 O O     . HOH P 4 .  ? 40.431  14.877  67.247  1.00 35.10 ? 151 HOH E O     1 
HETATM 4849 O O     . HOH P 4 .  ? 52.707  35.796  72.780  1.00 33.43 ? 154 HOH E O     1 
HETATM 4850 O O     . HOH P 4 .  ? 42.803  53.844  67.841  1.00 45.91 ? 157 HOH E O     1 
HETATM 4851 O O     . HOH P 4 .  ? 48.940  19.968  76.306  1.00 43.39 ? 160 HOH E O     1 
HETATM 4852 O O     . HOH P 4 .  ? 24.222  16.838  89.203  1.00 26.27 ? 166 HOH E O     1 
HETATM 4853 O O     . HOH P 4 .  ? 42.362  65.275  59.528  1.00 33.41 ? 186 HOH E O     1 
HETATM 4854 O O     . HOH P 4 .  ? 56.325  51.498  65.248  1.00 40.41 ? 189 HOH E O     1 
HETATM 4855 O O     . HOH P 4 .  ? 43.706  58.929  61.442  1.00 33.07 ? 198 HOH E O     1 
HETATM 4856 O O     . HOH P 4 .  ? 20.533  4.551   87.744  1.00 39.53 ? 216 HOH E O     1 
HETATM 4857 O O     . HOH P 4 .  ? 32.364  19.816  68.992  1.00 35.47 ? 220 HOH E O     1 
HETATM 4858 O O     . HOH P 4 .  ? 18.775  3.273   89.398  1.00 35.71 ? 222 HOH E O     1 
HETATM 4859 O O     . HOH P 4 .  ? 51.488  29.051  70.749  1.00 41.21 ? 227 HOH E O     1 
HETATM 4860 O O     . HOH P 4 .  ? 30.235  26.301  70.426  1.00 47.80 ? 229 HOH E O     1 
HETATM 4861 O O     . HOH P 4 .  ? 54.091  44.626  64.451  1.00 40.49 ? 241 HOH E O     1 
HETATM 4862 O O     . HOH P 4 .  ? 43.484  57.605  58.855  1.00 37.06 ? 253 HOH E O     1 
HETATM 4863 O O     . HOH P 4 .  ? 47.800  26.332  71.813  1.00 36.45 ? 259 HOH E O     1 
HETATM 4864 O O     . HOH P 4 .  ? 51.858  34.333  75.046  1.00 40.44 ? 261 HOH E O     1 
HETATM 4865 O O     . HOH P 4 .  ? 36.863  18.271  86.509  1.00 39.64 ? 265 HOH E O     1 
HETATM 4866 O O     . HOH P 4 .  ? 22.023  9.532   95.273  1.00 29.27 ? 269 HOH E O     1 
HETATM 4867 O O     . HOH P 4 .  ? 44.189  43.236  75.580  1.00 35.90 ? 273 HOH E O     1 
HETATM 4868 O O     . HOH P 4 .  ? 26.710  22.100  77.032  1.00 37.10 ? 274 HOH E O     1 
HETATM 4869 O O     . HOH P 4 .  ? 52.030  39.582  70.673  1.00 29.84 ? 275 HOH E O     1 
HETATM 4870 O O     . HOH P 4 .  ? 18.938  15.404  91.199  1.00 38.70 ? 281 HOH E O     1 
HETATM 4871 O O     . HOH P 4 .  ? 28.336  24.241  74.925  1.00 36.22 ? 323 HOH E O     1 
HETATM 4872 O O     . HOH P 4 .  ? 51.756  51.047  62.714  1.00 34.70 ? 326 HOH E O     1 
HETATM 4873 O O     . HOH P 4 .  ? 42.778  11.615  67.640  1.00 44.63 ? 336 HOH E O     1 
HETATM 4874 O O     . HOH P 4 .  ? 16.981  10.459  92.443  1.00 31.91 ? 337 HOH E O     1 
HETATM 4875 O O     . HOH P 4 .  ? 52.640  60.485  59.139  1.00 43.88 ? 339 HOH E O     1 
HETATM 4876 O O     . HOH P 4 .  ? 48.495  26.501  79.402  1.00 33.62 ? 355 HOH E O     1 
HETATM 4877 O O     . HOH P 4 .  ? 52.430  47.294  70.905  1.00 44.39 ? 361 HOH E O     1 
HETATM 4878 O O     . HOH P 4 .  ? 14.796  10.133  85.758  1.00 37.36 ? 363 HOH E O     1 
HETATM 4879 O O     . HOH P 4 .  ? 54.677  64.246  54.614  1.00 43.26 ? 374 HOH E O     1 
HETATM 4880 O O     . HOH P 4 .  ? 46.424  12.976  65.664  1.00 47.26 ? 387 HOH E O     1 
HETATM 4881 O O     . HOH P 4 .  ? 19.153  6.523   85.846  1.00 24.69 ? 392 HOH E O     1 
HETATM 4882 O O     . HOH P 4 .  ? 50.283  41.397  66.449  1.00 37.70 ? 402 HOH E O     1 
HETATM 4883 O O     . HOH P 4 .  ? 45.695  46.003  74.239  1.00 50.52 ? 409 HOH E O     1 
HETATM 4884 O O     . HOH P 4 .  ? 30.528  27.990  66.981  1.00 44.48 ? 413 HOH E O     1 
HETATM 4885 O O     . HOH P 4 .  ? 32.123  17.713  86.677  1.00 33.75 ? 419 HOH E O     1 
HETATM 4886 O O     . HOH P 4 .  ? 48.902  32.013  79.603  1.00 44.46 ? 423 HOH E O     1 
HETATM 4887 O O     . HOH P 4 .  ? 15.012  7.583   90.966  1.00 39.94 ? 466 HOH E O     1 
HETATM 4888 O O     . HOH P 4 .  ? 49.922  49.647  72.715  1.00 48.54 ? 470 HOH E O     1 
HETATM 4889 O O     . HOH P 4 .  ? 33.809  25.211  68.464  1.00 41.28 ? 471 HOH E O     1 
HETATM 4890 O O     . HOH P 4 .  ? 41.877  71.934  61.927  1.00 45.91 ? 490 HOH E O     1 
HETATM 4891 O O     . HOH P 4 .  ? 30.362  19.861  70.833  1.00 40.15 ? 495 HOH E O     1 
HETATM 4892 O O     . HOH P 4 .  ? 41.101  22.189  67.162  1.00 46.47 ? 502 HOH E O     1 
HETATM 4893 O O     . HOH P 4 .  ? 26.809  11.417  80.162  1.00 38.99 ? 507 HOH E O     1 
HETATM 4894 O O     . HOH P 4 .  ? 15.470  4.391   92.698  1.00 49.45 ? 509 HOH E O     1 
HETATM 4895 O O     . HOH P 4 .  ? 48.675  16.821  79.848  1.00 46.74 ? 516 HOH E O     1 
HETATM 4896 O O     . HOH P 4 .  ? 12.437  9.460   88.320  1.00 42.10 ? 517 HOH E O     1 
HETATM 4897 O O     . HOH P 4 .  ? 22.293  5.398   100.776 1.00 43.35 ? 518 HOH E O     1 
HETATM 4898 O O     . HOH P 4 .  ? 51.638  37.241  67.923  1.00 39.83 ? 524 HOH E O     1 
HETATM 4899 O O     . HOH P 4 .  ? 50.980  25.281  78.408  1.00 42.52 ? 527 HOH E O     1 
HETATM 4900 O O     . HOH P 4 .  ? 54.124  52.505  68.332  1.00 51.22 ? 531 HOH E O     1 
HETATM 4901 O O     . HOH P 4 .  ? 26.209  24.777  70.410  1.00 42.72 ? 544 HOH E O     1 
HETATM 4902 O O     . HOH P 4 .  ? 52.041  46.732  76.541  1.00 40.32 ? 545 HOH E O     1 
HETATM 4903 O O     . HOH P 4 .  ? 19.109  18.027  82.808  1.00 44.19 ? 554 HOH E O     1 
HETATM 4904 O O     . HOH P 4 .  ? 45.117  48.303  77.320  1.00 43.97 ? 559 HOH E O     1 
HETATM 4905 O O     . HOH P 4 .  ? 46.472  22.031  63.610  1.00 50.82 ? 563 HOH E O     1 
HETATM 4906 O O     . HOH P 4 .  ? 55.092  42.682  69.698  1.00 47.25 ? 574 HOH E O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DC  1  101 101 DC  CYT F . n 
A 1 2  DG  2  102 102 DG  GUA F . n 
A 1 3  DA  3  103 103 DA  ADE F . n 
A 1 4  DG  4  104 104 DG  GUA F . n 
A 1 5  DT  5  105 105 DT  THY F . n 
A 1 6  DA  6  106 106 DA  ADE F . n 
A 1 7  DG  7  107 107 DG  GUA F . n 
A 1 8  DC  8  108 108 DC  CYT F . n 
A 1 9  DA  9  109 109 DA  ADE F . n 
A 1 10 DC  10 110 110 DC  CYT F . n 
A 1 11 DG  11 111 111 DG  GUA F . n 
A 1 12 DT  12 112 112 DT  THY F . n 
A 1 13 DG  13 113 113 DG  GUA F . n 
A 1 14 DC  14 114 114 DC  CYT F . n 
A 1 15 DT  15 115 115 DT  THY F . n 
A 1 16 DA  16 116 116 DA  ADE F . n 
A 1 17 DC  17 117 117 DC  CYT F . n 
A 1 18 DT  18 118 118 DT  THY F . n 
A 1 19 DC  19 119 119 DC  CYT F . n 
B 1 1  DC  1  301 301 DC  CYT G . n 
B 1 2  DG  2  302 302 DG  GUA G . n 
B 1 3  DA  3  303 303 DA  ADE G . n 
B 1 4  DG  4  304 304 DG  GUA G . n 
B 1 5  DT  5  305 305 DT  THY G . n 
B 1 6  DA  6  306 306 DA  ADE G . n 
B 1 7  DG  7  307 307 DG  GUA G . n 
B 1 8  DC  8  308 308 DC  CYT G . n 
B 1 9  DA  9  309 309 DA  ADE G . n 
B 1 10 DC  10 310 310 DC  CYT G . n 
B 1 11 DG  11 311 311 DG  GUA G . n 
B 1 12 DT  12 312 312 DT  THY G . n 
B 1 13 DG  13 313 313 DG  GUA G . n 
B 1 14 DC  14 314 314 DC  CYT G . n 
B 1 15 DT  15 315 315 DT  THY G . n 
B 1 16 DA  16 316 316 DA  ADE G . n 
B 1 17 DC  17 317 317 DC  CYT G . n 
B 1 18 DT  18 318 318 DT  THY G . n 
B 1 19 DC  19 319 319 DC  CYT G . n 
C 1 1  DC  1  601 601 DC  CYT H . n 
C 1 2  DG  2  602 602 DG  GUA H . n 
C 1 3  DA  3  603 603 DA  ADE H . n 
C 1 4  DG  4  604 604 DG  GUA H . n 
C 1 5  DT  5  605 605 DT  THY H . n 
C 1 6  DA  6  606 606 DA  ADE H . n 
C 1 7  DG  7  607 607 DG  GUA H . n 
C 1 8  DC  8  608 608 DC  CYT H . n 
C 1 9  DA  9  609 609 DA  ADE H . n 
C 1 10 DC  10 610 610 DC  CYT H . n 
C 1 11 DG  11 611 611 DG  GUA H . n 
C 1 12 DT  12 612 612 DT  THY H . n 
C 1 13 DG  13 613 613 DG  GUA H . n 
C 1 14 DC  14 614 614 DC  CYT H . n 
C 1 15 DT  15 615 615 DT  THY H . n 
C 1 16 DA  16 616 616 DA  ADE H . n 
C 1 17 DC  17 617 617 DC  CYT H . n 
C 1 18 DT  18 618 618 DT  THY H . n 
C 1 19 DC  19 619 619 DC  CYT H . n 
D 1 1  DC  1  801 801 DC  CYT J . n 
D 1 2  DG  2  802 802 DG  GUA J . n 
D 1 3  DA  3  803 803 DA  ADE J . n 
D 1 4  DG  4  804 804 DG  GUA J . n 
D 1 5  DT  5  805 805 DT  THY J . n 
D 1 6  DA  6  806 806 DA  ADE J . n 
D 1 7  DG  7  807 807 DG  GUA J . n 
D 1 8  DC  8  808 808 DC  CYT J . n 
D 1 9  DA  9  809 809 DA  ADE J . n 
D 1 10 DC  10 810 810 DC  CYT J . n 
D 1 11 DG  11 811 811 DG  GUA J . n 
D 1 12 DT  12 812 812 DT  THY J . n 
D 1 13 DG  13 813 813 DG  GUA J . n 
D 1 14 DC  14 814 814 DC  CYT J . n 
D 1 15 DT  15 815 815 DT  THY J . n 
D 1 16 DA  16 816 816 DA  ADE J . n 
D 1 17 DC  17 817 817 DC  CYT J . n 
D 1 18 DT  18 818 818 DT  THY J . n 
D 1 19 DC  19 819 819 DC  CYT J . n 
E 2 1  GLY 1  897 897 GLY GLY A . n 
E 2 2  HIS 2  898 898 HIS HIS A . n 
E 2 3  MET 3  899 899 MET MET A . n 
E 2 4  ASN 4  900 900 ASN ASN A . n 
E 2 5  VAL 5  901 901 VAL VAL A . n 
E 2 6  LYS 6  902 902 LYS LYS A . n 
E 2 7  ARG 7  903 903 ARG ARG A . n 
E 2 8  ARG 8  904 904 ARG ARG A . n 
E 2 9  THR 9  905 905 THR THR A . n 
E 2 10 HIS 10 906 906 HIS HIS A . n 
E 2 11 ASN 11 907 907 ASN ASN A . n 
E 2 12 VAL 12 908 908 VAL VAL A . n 
E 2 13 LEU 13 909 909 LEU LEU A . n 
E 2 14 GLU 14 910 910 GLU GLU A . n 
E 2 15 ARG 15 911 911 ARG ARG A . n 
E 2 16 GLN 16 912 912 GLN GLN A . n 
E 2 17 ARG 17 913 913 ARG ARG A . n 
E 2 18 ARG 18 914 914 ARG ARG A . n 
E 2 19 ASN 19 915 915 ASN ASN A . n 
E 2 20 GLU 20 916 916 GLU GLU A . n 
E 2 21 LEU 21 917 917 LEU LEU A . n 
E 2 22 LYS 22 918 918 LYS LYS A . n 
E 2 23 ARG 23 919 919 ARG ARG A . n 
E 2 24 SER 24 920 920 SER SER A . n 
E 2 25 PHE 25 921 921 PHE PHE A . n 
E 2 26 PHE 26 922 922 PHE PHE A . n 
E 2 27 ALA 27 923 923 ALA ALA A . n 
E 2 28 LEU 28 924 924 LEU LEU A . n 
E 2 29 ARG 29 925 925 ARG ARG A . n 
E 2 30 ASP 30 926 926 ASP ASP A . n 
E 2 31 GLN 31 927 927 GLN GLN A . n 
E 2 32 ILE 32 928 928 ILE ILE A . n 
E 2 33 PRO 33 929 929 PRO PRO A . n 
E 2 34 GLU 34 930 930 GLU GLU A . n 
E 2 35 LEU 35 931 931 LEU LEU A . n 
E 2 36 GLU 36 932 932 GLU GLU A . n 
E 2 37 ASN 37 933 933 ASN ASN A . n 
E 2 38 ASN 38 934 934 ASN ASN A . n 
E 2 39 GLU 39 935 935 GLU GLU A . n 
E 2 40 LYS 40 936 936 LYS LYS A . n 
E 2 41 ALA 41 937 937 ALA ALA A . n 
E 2 42 PRO 42 938 938 PRO PRO A . n 
E 2 43 LYS 43 939 939 LYS LYS A . n 
E 2 44 VAL 44 940 940 VAL VAL A . n 
E 2 45 VAL 45 941 941 VAL VAL A . n 
E 2 46 ILE 46 942 942 ILE ILE A . n 
E 2 47 LEU 47 943 943 LEU LEU A . n 
E 2 48 LYS 48 944 944 LYS LYS A . n 
E 2 49 LYS 49 945 945 LYS LYS A . n 
E 2 50 ALA 50 946 946 ALA ALA A . n 
E 2 51 THR 51 947 947 THR THR A . n 
E 2 52 ALA 52 948 948 ALA ALA A . n 
E 2 53 TYR 53 949 949 TYR TYR A . n 
E 2 54 ILE 54 950 950 ILE ILE A . n 
E 2 55 LEU 55 951 951 LEU LEU A . n 
E 2 56 SER 56 952 952 SER SER A . n 
E 2 57 VAL 57 953 953 VAL VAL A . n 
E 2 58 GLN 58 954 954 GLN GLN A . n 
E 2 59 ALA 59 955 955 ALA ALA A . n 
E 2 60 GLU 60 956 956 GLU GLU A . n 
E 2 61 GLU 61 957 957 GLU GLU A . n 
E 2 62 GLN 62 958 958 GLN GLN A . n 
E 2 63 LYS 63 959 959 LYS LYS A . n 
E 2 64 LEU 64 960 960 LEU LEU A . n 
E 2 65 ILE 65 961 961 ILE ILE A . n 
E 2 66 SER 66 962 962 SER SER A . n 
E 2 67 GLU 67 963 963 GLU GLU A . n 
E 2 68 GLU 68 964 964 GLU GLU A . n 
E 2 69 ASP 69 965 965 ASP ASP A . n 
E 2 70 LEU 70 966 966 LEU LEU A . n 
E 2 71 LEU 71 967 967 LEU LEU A . n 
E 2 72 ARG 72 968 968 ARG ARG A . n 
E 2 73 LYS 73 969 969 LYS LYS A . n 
E 2 74 ARG 74 970 970 ARG ARG A . n 
E 2 75 ARG 75 971 971 ARG ARG A . n 
E 2 76 GLU 76 972 972 GLU GLU A . n 
E 2 77 GLN 77 973 973 GLN GLN A . n 
E 2 78 LEU 78 974 974 LEU LEU A . n 
E 2 79 LYS 79 975 975 LYS LYS A . n 
E 2 80 HIS 80 976 976 HIS HIS A . n 
E 2 81 LYS 81 977 977 LYS LYS A . n 
E 2 82 LEU 82 978 978 LEU LEU A . n 
E 2 83 GLU 83 979 979 GLU GLU A . n 
E 2 84 GLN 84 980 980 GLN GLN A . n 
E 2 85 LEU 85 981 981 LEU LEU A . n 
E 2 86 GLY 86 982 982 GLY GLY A . n 
E 2 87 GLY 87 983 983 GLY GLY A . n 
E 2 88 CYS 88 984 984 CYS CYS A . n 
F 3 1  ASP 1  202 202 ASP ASP B . n 
F 3 2  LYS 2  203 203 LYS LYS B . n 
F 3 3  ARG 3  204 204 ARG ARG B . n 
F 3 4  ALA 4  205 205 ALA ALA B . n 
F 3 5  HIS 5  206 206 HIS HIS B . n 
F 3 6  HIS 6  207 207 HIS HIS B . n 
F 3 7  ASN 7  208 208 ASN ASN B . n 
F 3 8  ALA 8  209 209 ALA ALA B . n 
F 3 9  LEU 9  210 210 LEU LEU B . n 
F 3 10 GLU 10 211 211 GLU GLU B . n 
F 3 11 ARG 11 212 212 ARG ARG B . n 
F 3 12 LYS 12 213 213 LYS LYS B . n 
F 3 13 ARG 13 214 214 ARG ARG B . n 
F 3 14 ARG 14 215 215 ARG ARG B . n 
F 3 15 ASP 15 216 216 ASP ASP B . n 
F 3 16 HIS 16 217 217 HIS HIS B . n 
F 3 17 ILE 17 218 218 ILE ILE B . n 
F 3 18 LYS 18 219 219 LYS LYS B . n 
F 3 19 ASP 19 220 220 ASP ASP B . n 
F 3 20 SER 20 221 221 SER SER B . n 
F 3 21 PHE 21 222 222 PHE PHE B . n 
F 3 22 HIS 22 223 223 HIS HIS B . n 
F 3 23 SER 23 224 224 SER SER B . n 
F 3 24 LEU 24 225 225 LEU LEU B . n 
F 3 25 ARG 25 226 226 ARG ARG B . n 
F 3 26 ASP 26 227 227 ASP ASP B . n 
F 3 27 SER 27 228 228 SER SER B . n 
F 3 28 VAL 28 229 229 VAL VAL B . n 
F 3 29 PRO 29 230 230 PRO PRO B . n 
F 3 30 SER 30 231 231 SER SER B . n 
F 3 31 LEU 31 232 232 LEU LEU B . n 
F 3 32 GLN 32 233 233 GLN GLN B . n 
F 3 33 GLY 33 234 234 GLY GLY B . n 
F 3 34 GLU 34 235 235 GLU GLU B . n 
F 3 35 LYS 35 236 236 LYS LYS B . n 
F 3 36 ALA 36 237 237 ALA ALA B . n 
F 3 37 SER 37 238 238 SER SER B . n 
F 3 38 ARG 38 239 239 ARG ARG B . n 
F 3 39 ALA 39 240 240 ALA ALA B . n 
F 3 40 GLN 40 241 241 GLN GLN B . n 
F 3 41 ILE 41 242 242 ILE ILE B . n 
F 3 42 LEU 42 243 243 LEU LEU B . n 
F 3 43 ASP 43 244 244 ASP ASP B . n 
F 3 44 LYS 44 245 245 LYS LYS B . n 
F 3 45 ALA 45 246 246 ALA ALA B . n 
F 3 46 THR 46 247 247 THR THR B . n 
F 3 47 GLU 47 248 248 GLU GLU B . n 
F 3 48 TYR 48 249 249 TYR TYR B . n 
F 3 49 ILE 49 250 250 ILE ILE B . n 
F 3 50 GLN 50 251 251 GLN GLN B . n 
F 3 51 TYR 51 252 252 TYR TYR B . n 
F 3 52 MET 52 253 253 MET MET B . n 
F 3 53 ARG 53 254 254 ARG ARG B . n 
F 3 54 ARG 54 255 255 ARG ARG B . n 
F 3 55 LYS 55 256 256 LYS LYS B . n 
F 3 56 ASN 56 257 257 ASN ASN B . n 
F 3 57 HIS 57 258 258 HIS HIS B . n 
F 3 58 THR 58 259 259 THR THR B . n 
F 3 59 HIS 59 260 260 HIS HIS B . n 
F 3 60 GLN 60 261 261 GLN GLN B . n 
F 3 61 GLN 61 262 262 GLN GLN B . n 
F 3 62 ASP 62 263 263 ASP ASP B . n 
F 3 63 ILE 63 264 264 ILE ILE B . n 
F 3 64 ASP 64 265 265 ASP ASP B . n 
F 3 65 ASP 65 266 266 ASP ASP B . n 
F 3 66 LEU 66 267 267 LEU LEU B . n 
F 3 67 LYS 67 268 268 LYS LYS B . n 
F 3 68 ARG 68 269 269 ARG ARG B . n 
F 3 69 GLN 69 270 270 GLN GLN B . n 
F 3 70 ASN 70 271 271 ASN ASN B . n 
F 3 71 ALA 71 272 272 ALA ALA B . n 
F 3 72 LEU 72 273 273 LEU LEU B . n 
F 3 73 LEU 73 274 274 LEU LEU B . n 
F 3 74 GLU 74 275 275 GLU GLU B . n 
F 3 75 GLN 75 276 276 GLN GLN B . n 
F 3 76 GLN 76 277 277 GLN GLN B . n 
F 3 77 VAL 77 278 278 VAL VAL B . n 
F 3 78 ARG 78 279 279 ARG ARG B . n 
F 3 79 ALA 79 280 280 ALA ALA B . n 
F 3 80 LEU 80 281 281 LEU LEU B . n 
F 3 81 GLY 81 282 282 GLY GLY B . n 
F 3 82 GLY 82 283 283 GLY GLY B . n 
F 3 83 CYS 83 284 284 CYS CYS B . n 
G 2 1  GLY 1  497 ?   ?   ?   D . n 
G 2 2  HIS 2  498 ?   ?   ?   D . n 
G 2 3  MET 3  499 499 MET MET D . n 
G 2 4  ASN 4  500 500 ASN ASN D . n 
G 2 5  VAL 5  501 501 VAL VAL D . n 
G 2 6  LYS 6  502 502 LYS LYS D . n 
G 2 7  ARG 7  503 503 ARG ARG D . n 
G 2 8  ARG 8  504 504 ARG ARG D . n 
G 2 9  THR 9  505 505 THR THR D . n 
G 2 10 HIS 10 506 506 HIS HIS D . n 
G 2 11 ASN 11 507 507 ASN ASN D . n 
G 2 12 VAL 12 508 508 VAL VAL D . n 
G 2 13 LEU 13 509 509 LEU LEU D . n 
G 2 14 GLU 14 510 510 GLU GLU D . n 
G 2 15 ARG 15 511 511 ARG ARG D . n 
G 2 16 GLN 16 512 512 GLN GLN D . n 
G 2 17 ARG 17 513 513 ARG ARG D . n 
G 2 18 ARG 18 514 514 ARG ARG D . n 
G 2 19 ASN 19 515 515 ASN ASN D . n 
G 2 20 GLU 20 516 516 GLU GLU D . n 
G 2 21 LEU 21 517 517 LEU LEU D . n 
G 2 22 LYS 22 518 518 LYS LYS D . n 
G 2 23 ARG 23 519 519 ARG ARG D . n 
G 2 24 SER 24 520 520 SER SER D . n 
G 2 25 PHE 25 521 521 PHE PHE D . n 
G 2 26 PHE 26 522 522 PHE PHE D . n 
G 2 27 ALA 27 523 523 ALA ALA D . n 
G 2 28 LEU 28 524 524 LEU LEU D . n 
G 2 29 ARG 29 525 525 ARG ARG D . n 
G 2 30 ASP 30 526 526 ASP ASP D . n 
G 2 31 GLN 31 527 527 GLN GLN D . n 
G 2 32 ILE 32 528 528 ILE ILE D . n 
G 2 33 PRO 33 529 529 PRO PRO D . n 
G 2 34 GLU 34 530 530 GLU GLU D . n 
G 2 35 LEU 35 531 531 LEU LEU D . n 
G 2 36 GLU 36 532 532 GLU GLU D . n 
G 2 37 ASN 37 533 533 ASN ASN D . n 
G 2 38 ASN 38 534 534 ASN ASN D . n 
G 2 39 GLU 39 535 535 GLU GLU D . n 
G 2 40 LYS 40 536 536 LYS LYS D . n 
G 2 41 ALA 41 537 537 ALA ALA D . n 
G 2 42 PRO 42 538 538 PRO PRO D . n 
G 2 43 LYS 43 539 539 LYS LYS D . n 
G 2 44 VAL 44 540 540 VAL VAL D . n 
G 2 45 VAL 45 541 541 VAL VAL D . n 
G 2 46 ILE 46 542 542 ILE ILE D . n 
G 2 47 LEU 47 543 543 LEU LEU D . n 
G 2 48 LYS 48 544 544 LYS LYS D . n 
G 2 49 LYS 49 545 545 LYS LYS D . n 
G 2 50 ALA 50 546 546 ALA ALA D . n 
G 2 51 THR 51 547 547 THR THR D . n 
G 2 52 ALA 52 548 548 ALA ALA D . n 
G 2 53 TYR 53 549 549 TYR TYR D . n 
G 2 54 ILE 54 550 550 ILE ILE D . n 
G 2 55 LEU 55 551 551 LEU LEU D . n 
G 2 56 SER 56 552 552 SER SER D . n 
G 2 57 VAL 57 553 553 VAL VAL D . n 
G 2 58 GLN 58 554 554 GLN GLN D . n 
G 2 59 ALA 59 555 555 ALA ALA D . n 
G 2 60 GLU 60 556 556 GLU GLU D . n 
G 2 61 GLU 61 557 557 GLU GLU D . n 
G 2 62 GLN 62 558 558 GLN GLN D . n 
G 2 63 LYS 63 559 559 LYS LYS D . n 
G 2 64 LEU 64 560 560 LEU LEU D . n 
G 2 65 ILE 65 561 561 ILE ILE D . n 
G 2 66 SER 66 562 562 SER SER D . n 
G 2 67 GLU 67 563 563 GLU GLU D . n 
G 2 68 GLU 68 564 564 GLU GLU D . n 
G 2 69 ASP 69 565 565 ASP ASP D . n 
G 2 70 LEU 70 566 566 LEU LEU D . n 
G 2 71 LEU 71 567 567 LEU LEU D . n 
G 2 72 ARG 72 568 568 ARG ARG D . n 
G 2 73 LYS 73 569 569 LYS LYS D . n 
G 2 74 ARG 74 570 570 ARG ARG D . n 
G 2 75 ARG 75 571 571 ARG ARG D . n 
G 2 76 GLU 76 572 572 GLU GLU D . n 
G 2 77 GLN 77 573 573 GLN GLN D . n 
G 2 78 LEU 78 574 574 LEU LEU D . n 
G 2 79 LYS 79 575 575 LYS LYS D . n 
G 2 80 HIS 80 576 576 HIS HIS D . n 
G 2 81 LYS 81 577 577 LYS LYS D . n 
G 2 82 LEU 82 578 578 LEU LEU D . n 
G 2 83 GLU 83 579 579 GLU GLU D . n 
G 2 84 GLN 84 580 580 GLN GLN D . n 
G 2 85 LEU 85 581 581 LEU LEU D . n 
G 2 86 GLY 86 582 ?   ?   ?   D . n 
G 2 87 GLY 87 583 ?   ?   ?   D . n 
G 2 88 CYS 88 584 ?   ?   ?   D . n 
H 3 1  ASP 1  702 ?   ?   ?   E . n 
H 3 2  LYS 2  703 ?   ?   ?   E . n 
H 3 3  ARG 3  704 704 ARG ARG E . n 
H 3 4  ALA 4  705 705 ALA ALA E . n 
H 3 5  HIS 5  706 706 HIS HIS E . n 
H 3 6  HIS 6  707 707 HIS HIS E . n 
H 3 7  ASN 7  708 708 ASN ASN E . n 
H 3 8  ALA 8  709 709 ALA ALA E . n 
H 3 9  LEU 9  710 710 LEU LEU E . n 
H 3 10 GLU 10 711 711 GLU GLU E . n 
H 3 11 ARG 11 712 712 ARG ARG E . n 
H 3 12 LYS 12 713 713 LYS LYS E . n 
H 3 13 ARG 13 714 714 ARG ARG E . n 
H 3 14 ARG 14 715 715 ARG ARG E . n 
H 3 15 ASP 15 716 716 ASP ASP E . n 
H 3 16 HIS 16 717 717 HIS HIS E . n 
H 3 17 ILE 17 718 718 ILE ILE E . n 
H 3 18 LYS 18 719 719 LYS LYS E . n 
H 3 19 ASP 19 720 720 ASP ASP E . n 
H 3 20 SER 20 721 721 SER SER E . n 
H 3 21 PHE 21 722 722 PHE PHE E . n 
H 3 22 HIS 22 723 723 HIS HIS E . n 
H 3 23 SER 23 724 724 SER SER E . n 
H 3 24 LEU 24 725 725 LEU LEU E . n 
H 3 25 ARG 25 726 726 ARG ARG E . n 
H 3 26 ASP 26 727 727 ASP ASP E . n 
H 3 27 SER 27 728 728 SER SER E . n 
H 3 28 VAL 28 729 729 VAL VAL E . n 
H 3 29 PRO 29 730 730 PRO PRO E . n 
H 3 30 SER 30 731 731 SER SER E . n 
H 3 31 LEU 31 732 732 LEU LEU E . n 
H 3 32 GLN 32 733 733 GLN GLN E . n 
H 3 33 GLY 33 734 734 GLY GLY E . n 
H 3 34 GLU 34 735 735 GLU ALA E . n 
H 3 35 LYS 35 736 736 LYS ALA E . n 
H 3 36 ALA 36 737 737 ALA ALA E . n 
H 3 37 SER 37 738 738 SER SER E . n 
H 3 38 ARG 38 739 739 ARG ARG E . n 
H 3 39 ALA 39 740 740 ALA ALA E . n 
H 3 40 GLN 40 741 741 GLN GLN E . n 
H 3 41 ILE 41 742 742 ILE ILE E . n 
H 3 42 LEU 42 743 743 LEU LEU E . n 
H 3 43 ASP 43 744 744 ASP ASP E . n 
H 3 44 LYS 44 745 745 LYS LYS E . n 
H 3 45 ALA 45 746 746 ALA ALA E . n 
H 3 46 THR 46 747 747 THR THR E . n 
H 3 47 GLU 47 748 748 GLU GLU E . n 
H 3 48 TYR 48 749 749 TYR TYR E . n 
H 3 49 ILE 49 750 750 ILE ILE E . n 
H 3 50 GLN 50 751 751 GLN GLN E . n 
H 3 51 TYR 51 752 752 TYR TYR E . n 
H 3 52 MET 52 753 753 MET MET E . n 
H 3 53 ARG 53 754 754 ARG ARG E . n 
H 3 54 ARG 54 755 755 ARG ARG E . n 
H 3 55 LYS 55 756 756 LYS LYS E . n 
H 3 56 ASN 56 757 757 ASN ASN E . n 
H 3 57 HIS 57 758 758 HIS HIS E . n 
H 3 58 THR 58 759 759 THR THR E . n 
H 3 59 HIS 59 760 760 HIS HIS E . n 
H 3 60 GLN 60 761 761 GLN GLN E . n 
H 3 61 GLN 61 762 762 GLN GLN E . n 
H 3 62 ASP 62 763 763 ASP ASP E . n 
H 3 63 ILE 63 764 764 ILE ILE E . n 
H 3 64 ASP 64 765 765 ASP ASP E . n 
H 3 65 ASP 65 766 766 ASP ASP E . n 
H 3 66 LEU 66 767 767 LEU LEU E . n 
H 3 67 LYS 67 768 768 LYS LYS E . n 
H 3 68 ARG 68 769 769 ARG ARG E . n 
H 3 69 GLN 69 770 770 GLN GLN E . n 
H 3 70 ASN 70 771 771 ASN ASN E . n 
H 3 71 ALA 71 772 772 ALA ALA E . n 
H 3 72 LEU 72 773 773 LEU LEU E . n 
H 3 73 LEU 73 774 774 LEU LEU E . n 
H 3 74 GLU 74 775 775 GLU GLU E . n 
H 3 75 GLN 75 776 776 GLN GLN E . n 
H 3 76 GLN 76 777 777 GLN GLN E . n 
H 3 77 VAL 77 778 778 VAL VAL E . n 
H 3 78 ARG 78 779 779 ARG ARG E . n 
H 3 79 ALA 79 780 780 ALA ALA E . n 
H 3 80 LEU 80 781 781 LEU LEU E . n 
H 3 81 GLY 81 782 782 GLY GLY E . n 
H 3 82 GLY 82 783 783 GLY GLY E . n 
H 3 83 CYS 83 784 784 CYS CYS E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 4 HOH 1  120 14  HOH WAT F . 
I 4 HOH 2  121 20  HOH WAT F . 
I 4 HOH 3  122 37  HOH WAT F . 
I 4 HOH 4  123 50  HOH WAT F . 
I 4 HOH 5  124 52  HOH WAT F . 
I 4 HOH 6  125 105 HOH WAT F . 
I 4 HOH 7  126 114 HOH WAT F . 
I 4 HOH 8  127 116 HOH WAT F . 
I 4 HOH 9  128 122 HOH WAT F . 
I 4 HOH 10 129 125 HOH WAT F . 
I 4 HOH 11 130 130 HOH WAT F . 
I 4 HOH 12 131 155 HOH WAT F . 
I 4 HOH 13 132 158 HOH WAT F . 
I 4 HOH 14 133 165 HOH WAT F . 
I 4 HOH 15 134 168 HOH WAT F . 
I 4 HOH 16 135 171 HOH WAT F . 
I 4 HOH 17 136 174 HOH WAT F . 
I 4 HOH 18 137 175 HOH WAT F . 
I 4 HOH 19 138 176 HOH WAT F . 
I 4 HOH 20 139 190 HOH WAT F . 
I 4 HOH 21 140 193 HOH WAT F . 
I 4 HOH 22 141 201 HOH WAT F . 
I 4 HOH 23 142 212 HOH WAT F . 
I 4 HOH 24 143 223 HOH WAT F . 
I 4 HOH 25 144 226 HOH WAT F . 
I 4 HOH 26 145 230 HOH WAT F . 
I 4 HOH 27 146 232 HOH WAT F . 
I 4 HOH 28 147 234 HOH WAT F . 
I 4 HOH 29 148 235 HOH WAT F . 
I 4 HOH 30 149 246 HOH WAT F . 
I 4 HOH 31 150 250 HOH WAT F . 
I 4 HOH 32 151 277 HOH WAT F . 
I 4 HOH 33 152 290 HOH WAT F . 
I 4 HOH 34 153 331 HOH WAT F . 
I 4 HOH 35 154 338 HOH WAT F . 
I 4 HOH 36 155 340 HOH WAT F . 
I 4 HOH 37 156 345 HOH WAT F . 
I 4 HOH 38 157 358 HOH WAT F . 
I 4 HOH 39 158 373 HOH WAT F . 
I 4 HOH 40 159 377 HOH WAT F . 
I 4 HOH 41 160 389 HOH WAT F . 
I 4 HOH 42 161 401 HOH WAT F . 
I 4 HOH 43 162 404 HOH WAT F . 
I 4 HOH 44 163 428 HOH WAT F . 
I 4 HOH 45 164 443 HOH WAT F . 
I 4 HOH 46 165 450 HOH WAT F . 
I 4 HOH 47 166 461 HOH WAT F . 
I 4 HOH 48 167 463 HOH WAT F . 
I 4 HOH 49 168 474 HOH WAT F . 
I 4 HOH 50 169 486 HOH WAT F . 
I 4 HOH 51 170 492 HOH WAT F . 
I 4 HOH 52 171 506 HOH WAT F . 
I 4 HOH 53 172 510 HOH WAT F . 
I 4 HOH 54 173 511 HOH WAT F . 
I 4 HOH 55 174 519 HOH WAT F . 
I 4 HOH 56 175 546 HOH WAT F . 
I 4 HOH 57 176 547 HOH WAT F . 
I 4 HOH 58 177 558 HOH WAT F . 
I 4 HOH 59 178 562 HOH WAT F . 
I 4 HOH 60 179 564 HOH WAT F . 
I 4 HOH 61 180 569 HOH WAT F . 
I 4 HOH 62 181 571 HOH WAT F . 
J 4 HOH 1  320 15  HOH WAT G . 
J 4 HOH 2  321 22  HOH WAT G . 
J 4 HOH 3  322 31  HOH WAT G . 
J 4 HOH 4  323 55  HOH WAT G . 
J 4 HOH 5  324 61  HOH WAT G . 
J 4 HOH 6  325 68  HOH WAT G . 
J 4 HOH 7  326 72  HOH WAT G . 
J 4 HOH 8  327 74  HOH WAT G . 
J 4 HOH 9  328 75  HOH WAT G . 
J 4 HOH 10 329 98  HOH WAT G . 
J 4 HOH 11 330 113 HOH WAT G . 
J 4 HOH 12 331 120 HOH WAT G . 
J 4 HOH 13 332 131 HOH WAT G . 
J 4 HOH 14 333 134 HOH WAT G . 
J 4 HOH 15 334 140 HOH WAT G . 
J 4 HOH 16 335 142 HOH WAT G . 
J 4 HOH 17 336 148 HOH WAT G . 
J 4 HOH 18 337 213 HOH WAT G . 
J 4 HOH 19 338 214 HOH WAT G . 
J 4 HOH 20 339 236 HOH WAT G . 
J 4 HOH 21 340 243 HOH WAT G . 
J 4 HOH 22 341 247 HOH WAT G . 
J 4 HOH 23 342 254 HOH WAT G . 
J 4 HOH 24 343 260 HOH WAT G . 
J 4 HOH 25 344 276 HOH WAT G . 
J 4 HOH 26 345 278 HOH WAT G . 
J 4 HOH 27 346 292 HOH WAT G . 
J 4 HOH 28 347 296 HOH WAT G . 
J 4 HOH 29 348 299 HOH WAT G . 
J 4 HOH 30 349 300 HOH WAT G . 
J 4 HOH 31 350 304 HOH WAT G . 
J 4 HOH 32 351 314 HOH WAT G . 
J 4 HOH 33 352 319 HOH WAT G . 
J 4 HOH 34 353 332 HOH WAT G . 
J 4 HOH 35 354 343 HOH WAT G . 
J 4 HOH 36 355 346 HOH WAT G . 
J 4 HOH 37 356 347 HOH WAT G . 
J 4 HOH 38 357 348 HOH WAT G . 
J 4 HOH 39 358 352 HOH WAT G . 
J 4 HOH 40 359 360 HOH WAT G . 
J 4 HOH 41 360 365 HOH WAT G . 
J 4 HOH 42 361 366 HOH WAT G . 
J 4 HOH 43 362 368 HOH WAT G . 
J 4 HOH 44 363 379 HOH WAT G . 
J 4 HOH 45 364 381 HOH WAT G . 
J 4 HOH 46 365 384 HOH WAT G . 
J 4 HOH 47 366 398 HOH WAT G . 
J 4 HOH 48 367 411 HOH WAT G . 
J 4 HOH 49 368 425 HOH WAT G . 
J 4 HOH 50 369 432 HOH WAT G . 
J 4 HOH 51 370 459 HOH WAT G . 
J 4 HOH 52 371 462 HOH WAT G . 
J 4 HOH 53 372 477 HOH WAT G . 
J 4 HOH 54 373 488 HOH WAT G . 
J 4 HOH 55 374 489 HOH WAT G . 
J 4 HOH 56 375 497 HOH WAT G . 
J 4 HOH 57 376 505 HOH WAT G . 
J 4 HOH 58 377 512 HOH WAT G . 
J 4 HOH 59 378 529 HOH WAT G . 
J 4 HOH 60 379 530 HOH WAT G . 
J 4 HOH 61 380 533 HOH WAT G . 
J 4 HOH 62 381 534 HOH WAT G . 
J 4 HOH 63 382 541 HOH WAT G . 
J 4 HOH 64 383 550 HOH WAT G . 
J 4 HOH 65 384 561 HOH WAT G . 
J 4 HOH 66 385 565 HOH WAT G . 
J 4 HOH 67 386 575 HOH WAT G . 
K 4 HOH 1  4   4   HOH WAT H . 
K 4 HOH 2  5   5   HOH WAT H . 
K 4 HOH 3  16  16  HOH WAT H . 
K 4 HOH 4  23  23  HOH WAT H . 
K 4 HOH 5  36  36  HOH WAT H . 
K 4 HOH 6  58  58  HOH WAT H . 
K 4 HOH 7  76  76  HOH WAT H . 
K 4 HOH 8  77  77  HOH WAT H . 
K 4 HOH 9  89  89  HOH WAT H . 
K 4 HOH 10 90  90  HOH WAT H . 
K 4 HOH 11 93  93  HOH WAT H . 
K 4 HOH 12 97  97  HOH WAT H . 
K 4 HOH 13 101 101 HOH WAT H . 
K 4 HOH 14 103 103 HOH WAT H . 
K 4 HOH 15 109 109 HOH WAT H . 
K 4 HOH 16 133 133 HOH WAT H . 
K 4 HOH 17 137 137 HOH WAT H . 
K 4 HOH 18 144 144 HOH WAT H . 
K 4 HOH 19 153 153 HOH WAT H . 
K 4 HOH 20 156 156 HOH WAT H . 
K 4 HOH 21 162 162 HOH WAT H . 
K 4 HOH 22 170 170 HOH WAT H . 
K 4 HOH 23 178 178 HOH WAT H . 
K 4 HOH 24 196 196 HOH WAT H . 
K 4 HOH 25 200 200 HOH WAT H . 
K 4 HOH 26 206 206 HOH WAT H . 
K 4 HOH 27 225 225 HOH WAT H . 
K 4 HOH 28 237 237 HOH WAT H . 
K 4 HOH 29 238 238 HOH WAT H . 
K 4 HOH 30 244 244 HOH WAT H . 
K 4 HOH 31 252 252 HOH WAT H . 
K 4 HOH 32 262 262 HOH WAT H . 
K 4 HOH 33 268 268 HOH WAT H . 
K 4 HOH 34 311 311 HOH WAT H . 
K 4 HOH 35 312 312 HOH WAT H . 
K 4 HOH 36 313 313 HOH WAT H . 
K 4 HOH 37 327 327 HOH WAT H . 
K 4 HOH 38 357 357 HOH WAT H . 
K 4 HOH 39 370 370 HOH WAT H . 
K 4 HOH 40 375 375 HOH WAT H . 
K 4 HOH 41 388 388 HOH WAT H . 
K 4 HOH 42 393 393 HOH WAT H . 
K 4 HOH 43 399 399 HOH WAT H . 
K 4 HOH 44 403 403 HOH WAT H . 
K 4 HOH 45 426 426 HOH WAT H . 
K 4 HOH 46 429 429 HOH WAT H . 
K 4 HOH 47 437 437 HOH WAT H . 
K 4 HOH 48 441 441 HOH WAT H . 
K 4 HOH 49 448 448 HOH WAT H . 
K 4 HOH 50 468 468 HOH WAT H . 
K 4 HOH 51 476 476 HOH WAT H . 
K 4 HOH 52 478 478 HOH WAT H . 
K 4 HOH 53 481 481 HOH WAT H . 
K 4 HOH 54 482 482 HOH WAT H . 
K 4 HOH 55 499 499 HOH WAT H . 
K 4 HOH 56 528 528 HOH WAT H . 
K 4 HOH 57 538 538 HOH WAT H . 
K 4 HOH 58 552 552 HOH WAT H . 
K 4 HOH 59 553 553 HOH WAT H . 
K 4 HOH 60 556 556 HOH WAT H . 
L 4 HOH 1  6   6   HOH WAT J . 
L 4 HOH 2  18  18  HOH WAT J . 
L 4 HOH 3  30  30  HOH WAT J . 
L 4 HOH 4  46  46  HOH WAT J . 
L 4 HOH 5  67  67  HOH WAT J . 
L 4 HOH 6  78  78  HOH WAT J . 
L 4 HOH 7  87  87  HOH WAT J . 
L 4 HOH 8  88  88  HOH WAT J . 
L 4 HOH 9  94  94  HOH WAT J . 
L 4 HOH 10 96  96  HOH WAT J . 
L 4 HOH 11 102 102 HOH WAT J . 
L 4 HOH 12 107 107 HOH WAT J . 
L 4 HOH 13 128 128 HOH WAT J . 
L 4 HOH 14 143 143 HOH WAT J . 
L 4 HOH 15 146 146 HOH WAT J . 
L 4 HOH 16 149 149 HOH WAT J . 
L 4 HOH 17 172 172 HOH WAT J . 
L 4 HOH 18 173 173 HOH WAT J . 
L 4 HOH 19 184 184 HOH WAT J . 
L 4 HOH 20 197 197 HOH WAT J . 
L 4 HOH 21 199 199 HOH WAT J . 
L 4 HOH 22 202 202 HOH WAT J . 
L 4 HOH 23 211 211 HOH WAT J . 
L 4 HOH 24 219 219 HOH WAT J . 
L 4 HOH 25 221 221 HOH WAT J . 
L 4 HOH 26 228 228 HOH WAT J . 
L 4 HOH 27 251 251 HOH WAT J . 
L 4 HOH 28 255 255 HOH WAT J . 
L 4 HOH 29 256 256 HOH WAT J . 
L 4 HOH 30 257 257 HOH WAT J . 
L 4 HOH 31 263 263 HOH WAT J . 
L 4 HOH 32 272 272 HOH WAT J . 
L 4 HOH 33 279 279 HOH WAT J . 
L 4 HOH 34 282 282 HOH WAT J . 
L 4 HOH 35 284 284 HOH WAT J . 
L 4 HOH 36 285 285 HOH WAT J . 
L 4 HOH 37 288 288 HOH WAT J . 
L 4 HOH 38 289 289 HOH WAT J . 
L 4 HOH 39 316 316 HOH WAT J . 
L 4 HOH 40 333 333 HOH WAT J . 
L 4 HOH 41 335 335 HOH WAT J . 
L 4 HOH 42 353 353 HOH WAT J . 
L 4 HOH 43 369 369 HOH WAT J . 
L 4 HOH 44 372 372 HOH WAT J . 
L 4 HOH 45 376 376 HOH WAT J . 
L 4 HOH 46 408 408 HOH WAT J . 
L 4 HOH 47 424 424 HOH WAT J . 
L 4 HOH 48 435 435 HOH WAT J . 
L 4 HOH 49 445 445 HOH WAT J . 
L 4 HOH 50 460 460 HOH WAT J . 
L 4 HOH 51 475 475 HOH WAT J . 
L 4 HOH 52 485 485 HOH WAT J . 
L 4 HOH 53 493 493 HOH WAT J . 
L 4 HOH 54 496 496 HOH WAT J . 
L 4 HOH 55 501 501 HOH WAT J . 
L 4 HOH 56 508 508 HOH WAT J . 
L 4 HOH 57 513 513 HOH WAT J . 
L 4 HOH 58 522 522 HOH WAT J . 
L 4 HOH 59 523 523 HOH WAT J . 
L 4 HOH 60 525 525 HOH WAT J . 
L 4 HOH 61 537 537 HOH WAT J . 
L 4 HOH 62 543 543 HOH WAT J . 
L 4 HOH 63 557 557 HOH WAT J . 
L 4 HOH 64 567 567 HOH WAT J . 
L 4 HOH 65 580 580 HOH WAT J . 
M 4 HOH 1  2   2   HOH WAT A . 
M 4 HOH 2  19  19  HOH WAT A . 
M 4 HOH 3  21  21  HOH WAT A . 
M 4 HOH 4  24  24  HOH WAT A . 
M 4 HOH 5  33  33  HOH WAT A . 
M 4 HOH 6  38  38  HOH WAT A . 
M 4 HOH 7  40  40  HOH WAT A . 
M 4 HOH 8  43  43  HOH WAT A . 
M 4 HOH 9  47  47  HOH WAT A . 
M 4 HOH 10 51  51  HOH WAT A . 
M 4 HOH 11 53  53  HOH WAT A . 
M 4 HOH 12 60  60  HOH WAT A . 
M 4 HOH 13 63  63  HOH WAT A . 
M 4 HOH 14 65  65  HOH WAT A . 
M 4 HOH 15 66  66  HOH WAT A . 
M 4 HOH 16 69  69  HOH WAT A . 
M 4 HOH 17 73  73  HOH WAT A . 
M 4 HOH 18 80  80  HOH WAT A . 
M 4 HOH 19 81  81  HOH WAT A . 
M 4 HOH 20 82  82  HOH WAT A . 
M 4 HOH 21 86  86  HOH WAT A . 
M 4 HOH 22 91  91  HOH WAT A . 
M 4 HOH 23 108 108 HOH WAT A . 
M 4 HOH 24 110 110 HOH WAT A . 
M 4 HOH 25 111 111 HOH WAT A . 
M 4 HOH 26 132 132 HOH WAT A . 
M 4 HOH 27 169 169 HOH WAT A . 
M 4 HOH 28 180 180 HOH WAT A . 
M 4 HOH 29 181 181 HOH WAT A . 
M 4 HOH 30 182 182 HOH WAT A . 
M 4 HOH 31 187 187 HOH WAT A . 
M 4 HOH 32 188 188 HOH WAT A . 
M 4 HOH 33 191 191 HOH WAT A . 
M 4 HOH 34 204 204 HOH WAT A . 
M 4 HOH 35 205 205 HOH WAT A . 
M 4 HOH 36 217 217 HOH WAT A . 
M 4 HOH 37 218 218 HOH WAT A . 
M 4 HOH 38 231 231 HOH WAT A . 
M 4 HOH 39 245 245 HOH WAT A . 
M 4 HOH 40 249 249 HOH WAT A . 
M 4 HOH 41 264 264 HOH WAT A . 
M 4 HOH 42 271 271 HOH WAT A . 
M 4 HOH 43 283 283 HOH WAT A . 
M 4 HOH 44 287 287 HOH WAT A . 
M 4 HOH 45 293 293 HOH WAT A . 
M 4 HOH 46 295 295 HOH WAT A . 
M 4 HOH 47 297 297 HOH WAT A . 
M 4 HOH 48 298 298 HOH WAT A . 
M 4 HOH 49 306 306 HOH WAT A . 
M 4 HOH 50 308 308 HOH WAT A . 
M 4 HOH 51 320 320 HOH WAT A . 
M 4 HOH 52 321 321 HOH WAT A . 
M 4 HOH 53 322 322 HOH WAT A . 
M 4 HOH 54 324 324 HOH WAT A . 
M 4 HOH 55 325 325 HOH WAT A . 
M 4 HOH 56 328 328 HOH WAT A . 
M 4 HOH 57 329 329 HOH WAT A . 
M 4 HOH 58 341 341 HOH WAT A . 
M 4 HOH 59 342 342 HOH WAT A . 
M 4 HOH 60 344 344 HOH WAT A . 
M 4 HOH 61 349 349 HOH WAT A . 
M 4 HOH 62 380 380 HOH WAT A . 
M 4 HOH 63 386 386 HOH WAT A . 
M 4 HOH 64 391 391 HOH WAT A . 
M 4 HOH 65 394 394 HOH WAT A . 
M 4 HOH 66 397 397 HOH WAT A . 
M 4 HOH 67 407 407 HOH WAT A . 
M 4 HOH 68 410 410 HOH WAT A . 
M 4 HOH 69 412 412 HOH WAT A . 
M 4 HOH 70 417 417 HOH WAT A . 
M 4 HOH 71 420 420 HOH WAT A . 
M 4 HOH 72 421 421 HOH WAT A . 
M 4 HOH 73 433 433 HOH WAT A . 
M 4 HOH 74 436 436 HOH WAT A . 
M 4 HOH 75 438 438 HOH WAT A . 
M 4 HOH 76 439 439 HOH WAT A . 
M 4 HOH 77 440 440 HOH WAT A . 
M 4 HOH 78 444 444 HOH WAT A . 
M 4 HOH 79 454 454 HOH WAT A . 
M 4 HOH 80 457 457 HOH WAT A . 
M 4 HOH 81 473 473 HOH WAT A . 
M 4 HOH 82 484 484 HOH WAT A . 
M 4 HOH 83 487 487 HOH WAT A . 
M 4 HOH 84 498 498 HOH WAT A . 
M 4 HOH 85 500 500 HOH WAT A . 
M 4 HOH 86 515 515 HOH WAT A . 
M 4 HOH 87 535 535 HOH WAT A . 
M 4 HOH 88 536 536 HOH WAT A . 
M 4 HOH 89 542 542 HOH WAT A . 
M 4 HOH 90 555 555 HOH WAT A . 
M 4 HOH 91 566 566 HOH WAT A . 
N 4 HOH 1  285 1   HOH WAT B . 
N 4 HOH 2  286 3   HOH WAT B . 
N 4 HOH 3  287 7   HOH WAT B . 
N 4 HOH 4  288 9   HOH WAT B . 
N 4 HOH 5  289 13  HOH WAT B . 
N 4 HOH 6  290 27  HOH WAT B . 
N 4 HOH 7  291 41  HOH WAT B . 
N 4 HOH 8  292 56  HOH WAT B . 
N 4 HOH 9  293 62  HOH WAT B . 
N 4 HOH 10 294 64  HOH WAT B . 
N 4 HOH 11 295 70  HOH WAT B . 
N 4 HOH 12 296 71  HOH WAT B . 
N 4 HOH 13 297 92  HOH WAT B . 
N 4 HOH 14 298 99  HOH WAT B . 
N 4 HOH 15 299 100 HOH WAT B . 
N 4 HOH 16 300 119 HOH WAT B . 
N 4 HOH 17 301 127 HOH WAT B . 
N 4 HOH 18 302 135 HOH WAT B . 
N 4 HOH 19 303 138 HOH WAT B . 
N 4 HOH 20 304 147 HOH WAT B . 
N 4 HOH 21 305 177 HOH WAT B . 
N 4 HOH 22 306 183 HOH WAT B . 
N 4 HOH 23 307 194 HOH WAT B . 
N 4 HOH 24 308 209 HOH WAT B . 
N 4 HOH 25 309 210 HOH WAT B . 
N 4 HOH 26 310 215 HOH WAT B . 
N 4 HOH 27 311 224 HOH WAT B . 
N 4 HOH 28 312 233 HOH WAT B . 
N 4 HOH 29 313 239 HOH WAT B . 
N 4 HOH 30 314 240 HOH WAT B . 
N 4 HOH 31 315 248 HOH WAT B . 
N 4 HOH 32 316 267 HOH WAT B . 
N 4 HOH 33 317 286 HOH WAT B . 
N 4 HOH 34 318 294 HOH WAT B . 
N 4 HOH 35 319 301 HOH WAT B . 
N 4 HOH 36 320 305 HOH WAT B . 
N 4 HOH 37 321 309 HOH WAT B . 
N 4 HOH 38 322 310 HOH WAT B . 
N 4 HOH 39 323 315 HOH WAT B . 
N 4 HOH 40 324 318 HOH WAT B . 
N 4 HOH 41 325 334 HOH WAT B . 
N 4 HOH 42 326 354 HOH WAT B . 
N 4 HOH 43 327 356 HOH WAT B . 
N 4 HOH 44 328 382 HOH WAT B . 
N 4 HOH 45 329 385 HOH WAT B . 
N 4 HOH 46 330 395 HOH WAT B . 
N 4 HOH 47 331 396 HOH WAT B . 
N 4 HOH 48 332 400 HOH WAT B . 
N 4 HOH 49 333 414 HOH WAT B . 
N 4 HOH 50 334 416 HOH WAT B . 
N 4 HOH 51 335 422 HOH WAT B . 
N 4 HOH 52 336 427 HOH WAT B . 
N 4 HOH 53 337 431 HOH WAT B . 
N 4 HOH 54 338 434 HOH WAT B . 
N 4 HOH 55 339 442 HOH WAT B . 
N 4 HOH 56 340 446 HOH WAT B . 
N 4 HOH 57 341 449 HOH WAT B . 
N 4 HOH 58 342 451 HOH WAT B . 
N 4 HOH 59 343 455 HOH WAT B . 
N 4 HOH 60 344 464 HOH WAT B . 
N 4 HOH 61 345 469 HOH WAT B . 
N 4 HOH 62 346 479 HOH WAT B . 
N 4 HOH 63 347 483 HOH WAT B . 
N 4 HOH 64 348 494 HOH WAT B . 
N 4 HOH 65 349 514 HOH WAT B . 
N 4 HOH 66 350 532 HOH WAT B . 
N 4 HOH 67 351 548 HOH WAT B . 
N 4 HOH 68 352 549 HOH WAT B . 
N 4 HOH 69 353 568 HOH WAT B . 
N 4 HOH 70 354 570 HOH WAT B . 
N 4 HOH 71 355 572 HOH WAT B . 
N 4 HOH 72 356 573 HOH WAT B . 
N 4 HOH 73 357 578 HOH WAT B . 
N 4 HOH 74 358 579 HOH WAT B . 
N 4 HOH 75 359 581 HOH WAT B . 
O 4 HOH 1  585 8   HOH WAT D . 
O 4 HOH 2  586 10  HOH WAT D . 
O 4 HOH 3  587 11  HOH WAT D . 
O 4 HOH 4  588 17  HOH WAT D . 
O 4 HOH 5  589 25  HOH WAT D . 
O 4 HOH 6  590 32  HOH WAT D . 
O 4 HOH 7  591 39  HOH WAT D . 
O 4 HOH 8  592 42  HOH WAT D . 
O 4 HOH 9  593 44  HOH WAT D . 
O 4 HOH 10 594 49  HOH WAT D . 
O 4 HOH 11 595 84  HOH WAT D . 
O 4 HOH 12 596 85  HOH WAT D . 
O 4 HOH 13 597 106 HOH WAT D . 
O 4 HOH 14 598 112 HOH WAT D . 
O 4 HOH 15 599 118 HOH WAT D . 
O 4 HOH 16 600 121 HOH WAT D . 
O 4 HOH 17 601 123 HOH WAT D . 
O 4 HOH 18 602 124 HOH WAT D . 
O 4 HOH 19 603 129 HOH WAT D . 
O 4 HOH 20 604 136 HOH WAT D . 
O 4 HOH 21 605 139 HOH WAT D . 
O 4 HOH 22 606 145 HOH WAT D . 
O 4 HOH 23 607 152 HOH WAT D . 
O 4 HOH 24 608 159 HOH WAT D . 
O 4 HOH 25 609 161 HOH WAT D . 
O 4 HOH 26 610 163 HOH WAT D . 
O 4 HOH 27 611 164 HOH WAT D . 
O 4 HOH 28 612 167 HOH WAT D . 
O 4 HOH 29 613 179 HOH WAT D . 
O 4 HOH 30 614 185 HOH WAT D . 
O 4 HOH 31 615 192 HOH WAT D . 
O 4 HOH 32 616 195 HOH WAT D . 
O 4 HOH 33 617 203 HOH WAT D . 
O 4 HOH 34 618 207 HOH WAT D . 
O 4 HOH 35 619 208 HOH WAT D . 
O 4 HOH 36 620 242 HOH WAT D . 
O 4 HOH 37 621 258 HOH WAT D . 
O 4 HOH 38 622 266 HOH WAT D . 
O 4 HOH 39 623 270 HOH WAT D . 
O 4 HOH 40 624 280 HOH WAT D . 
O 4 HOH 41 625 291 HOH WAT D . 
O 4 HOH 42 626 302 HOH WAT D . 
O 4 HOH 43 627 303 HOH WAT D . 
O 4 HOH 44 628 307 HOH WAT D . 
O 4 HOH 45 629 317 HOH WAT D . 
O 4 HOH 46 630 330 HOH WAT D . 
O 4 HOH 47 631 350 HOH WAT D . 
O 4 HOH 48 632 351 HOH WAT D . 
O 4 HOH 49 633 359 HOH WAT D . 
O 4 HOH 50 634 362 HOH WAT D . 
O 4 HOH 51 635 364 HOH WAT D . 
O 4 HOH 52 636 367 HOH WAT D . 
O 4 HOH 53 637 371 HOH WAT D . 
O 4 HOH 54 638 378 HOH WAT D . 
O 4 HOH 55 639 383 HOH WAT D . 
O 4 HOH 56 640 390 HOH WAT D . 
O 4 HOH 57 641 405 HOH WAT D . 
O 4 HOH 58 642 406 HOH WAT D . 
O 4 HOH 59 643 415 HOH WAT D . 
O 4 HOH 60 644 418 HOH WAT D . 
O 4 HOH 61 645 430 HOH WAT D . 
O 4 HOH 62 646 447 HOH WAT D . 
O 4 HOH 63 647 452 HOH WAT D . 
O 4 HOH 64 648 453 HOH WAT D . 
O 4 HOH 65 649 456 HOH WAT D . 
O 4 HOH 66 650 458 HOH WAT D . 
O 4 HOH 67 651 465 HOH WAT D . 
O 4 HOH 68 652 467 HOH WAT D . 
O 4 HOH 69 653 472 HOH WAT D . 
O 4 HOH 70 654 480 HOH WAT D . 
O 4 HOH 71 655 491 HOH WAT D . 
O 4 HOH 72 656 503 HOH WAT D . 
O 4 HOH 73 657 504 HOH WAT D . 
O 4 HOH 74 658 520 HOH WAT D . 
O 4 HOH 75 659 521 HOH WAT D . 
O 4 HOH 76 660 526 HOH WAT D . 
O 4 HOH 77 661 539 HOH WAT D . 
O 4 HOH 78 662 540 HOH WAT D . 
O 4 HOH 79 663 551 HOH WAT D . 
O 4 HOH 80 664 560 HOH WAT D . 
O 4 HOH 81 665 576 HOH WAT D . 
O 4 HOH 82 666 577 HOH WAT D . 
P 4 HOH 1  12  12  HOH WAT E . 
P 4 HOH 2  26  26  HOH WAT E . 
P 4 HOH 3  28  28  HOH WAT E . 
P 4 HOH 4  29  29  HOH WAT E . 
P 4 HOH 5  34  34  HOH WAT E . 
P 4 HOH 6  35  35  HOH WAT E . 
P 4 HOH 7  45  45  HOH WAT E . 
P 4 HOH 8  48  48  HOH WAT E . 
P 4 HOH 9  54  54  HOH WAT E . 
P 4 HOH 10 57  57  HOH WAT E . 
P 4 HOH 11 59  59  HOH WAT E . 
P 4 HOH 12 79  79  HOH WAT E . 
P 4 HOH 13 83  83  HOH WAT E . 
P 4 HOH 14 95  95  HOH WAT E . 
P 4 HOH 15 104 104 HOH WAT E . 
P 4 HOH 16 115 115 HOH WAT E . 
P 4 HOH 17 117 117 HOH WAT E . 
P 4 HOH 18 126 126 HOH WAT E . 
P 4 HOH 19 141 141 HOH WAT E . 
P 4 HOH 20 150 150 HOH WAT E . 
P 4 HOH 21 151 151 HOH WAT E . 
P 4 HOH 22 154 154 HOH WAT E . 
P 4 HOH 23 157 157 HOH WAT E . 
P 4 HOH 24 160 160 HOH WAT E . 
P 4 HOH 25 166 166 HOH WAT E . 
P 4 HOH 26 186 186 HOH WAT E . 
P 4 HOH 27 189 189 HOH WAT E . 
P 4 HOH 28 198 198 HOH WAT E . 
P 4 HOH 29 216 216 HOH WAT E . 
P 4 HOH 30 220 220 HOH WAT E . 
P 4 HOH 31 222 222 HOH WAT E . 
P 4 HOH 32 227 227 HOH WAT E . 
P 4 HOH 33 229 229 HOH WAT E . 
P 4 HOH 34 241 241 HOH WAT E . 
P 4 HOH 35 253 253 HOH WAT E . 
P 4 HOH 36 259 259 HOH WAT E . 
P 4 HOH 37 261 261 HOH WAT E . 
P 4 HOH 38 265 265 HOH WAT E . 
P 4 HOH 39 269 269 HOH WAT E . 
P 4 HOH 40 273 273 HOH WAT E . 
P 4 HOH 41 274 274 HOH WAT E . 
P 4 HOH 42 275 275 HOH WAT E . 
P 4 HOH 43 281 281 HOH WAT E . 
P 4 HOH 44 323 323 HOH WAT E . 
P 4 HOH 45 326 326 HOH WAT E . 
P 4 HOH 46 336 336 HOH WAT E . 
P 4 HOH 47 337 337 HOH WAT E . 
P 4 HOH 48 339 339 HOH WAT E . 
P 4 HOH 49 355 355 HOH WAT E . 
P 4 HOH 50 361 361 HOH WAT E . 
P 4 HOH 51 363 363 HOH WAT E . 
P 4 HOH 52 374 374 HOH WAT E . 
P 4 HOH 53 387 387 HOH WAT E . 
P 4 HOH 54 392 392 HOH WAT E . 
P 4 HOH 55 402 402 HOH WAT E . 
P 4 HOH 56 409 409 HOH WAT E . 
P 4 HOH 57 413 413 HOH WAT E . 
P 4 HOH 58 419 419 HOH WAT E . 
P 4 HOH 59 423 423 HOH WAT E . 
P 4 HOH 60 466 466 HOH WAT E . 
P 4 HOH 61 470 470 HOH WAT E . 
P 4 HOH 62 471 471 HOH WAT E . 
P 4 HOH 63 490 490 HOH WAT E . 
P 4 HOH 64 495 495 HOH WAT E . 
P 4 HOH 65 502 502 HOH WAT E . 
P 4 HOH 66 507 507 HOH WAT E . 
P 4 HOH 67 509 509 HOH WAT E . 
P 4 HOH 68 516 516 HOH WAT E . 
P 4 HOH 69 517 517 HOH WAT E . 
P 4 HOH 70 518 518 HOH WAT E . 
P 4 HOH 71 524 524 HOH WAT E . 
P 4 HOH 72 527 527 HOH WAT E . 
P 4 HOH 73 531 531 HOH WAT E . 
P 4 HOH 74 544 544 HOH WAT E . 
P 4 HOH 75 545 545 HOH WAT E . 
P 4 HOH 76 554 554 HOH WAT E . 
P 4 HOH 77 559 559 HOH WAT E . 
P 4 HOH 78 563 563 HOH WAT E . 
P 4 HOH 79 574 574 HOH WAT E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J,M,N 
2 1 C,D,G,H,K,L,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-02-04 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-02-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' audit_author       
2 4 'Structure model' citation_author    
3 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_audit_author.identifier_ORCID'    
2 4 'Structure model' '_citation_author.identifier_ORCID' 
3 4 'Structure model' '_struct_ref_seq_dif.details'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
X-PLOR    'model building'  . ? 3 
CNS       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
X-PLOR    phasing           . ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 E ASN 771 ? ? O E HOH 57  ? ? 2.13 
2 1 NE  D ARG 519 ? ? O D HOH 612 ? ? 2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN D 533 ? ? -93.92 51.15  
2 1 LEU E 781 ? ? -46.14 159.25 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DC 
_pdbx_validate_planes.auth_asym_id    F 
_pdbx_validate_planes.auth_seq_id     114 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.077 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 E GLU 735 ? CG  ? H GLU 34 CG  
2 1 Y 1 E GLU 735 ? CD  ? H GLU 34 CD  
3 1 Y 1 E GLU 735 ? OE1 ? H GLU 34 OE1 
4 1 Y 1 E GLU 735 ? OE2 ? H GLU 34 OE2 
5 1 Y 1 E LYS 736 ? CG  ? H LYS 35 CG  
6 1 Y 1 E LYS 736 ? CD  ? H LYS 35 CD  
7 1 Y 1 E LYS 736 ? CE  ? H LYS 35 CE  
8 1 Y 1 E LYS 736 ? NZ  ? H LYS 35 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D GLY 497 ? G GLY 1  
2 1 Y 1 D HIS 498 ? G HIS 2  
3 1 Y 1 D GLY 582 ? G GLY 86 
4 1 Y 1 D GLY 583 ? G GLY 87 
5 1 Y 1 D CYS 584 ? G CYS 88 
6 1 Y 1 E ASP 702 ? H ASP 1  
7 1 Y 1 E LYS 703 ? H LYS 2  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1NKP 'double helix'        
1NKP 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 19 1_555 0.046  -0.036 -0.362 -6.801 0.668   2.535  1  F_DG102:DC319_G F 102 ? G 319 ? 19 1 
1 A DA 3  1_555 B DT 18 1_555 0.025  0.026  0.534  8.863  -14.408 2.970  2  F_DA103:DT318_G F 103 ? G 318 ? 20 1 
1 A DG 4  1_555 B DC 17 1_555 -0.163 0.016  0.010  1.579  -14.316 3.861  3  F_DG104:DC317_G F 104 ? G 317 ? 19 1 
1 A DT 5  1_555 B DA 16 1_555 -0.202 0.174  0.019  -2.500 -17.547 1.744  4  F_DT105:DA316_G F 105 ? G 316 ? 20 1 
1 A DA 6  1_555 B DT 15 1_555 -0.154 -0.129 0.283  3.424  -1.219  8.420  5  F_DA106:DT315_G F 106 ? G 315 ? 20 1 
1 A DG 7  1_555 B DC 14 1_555 -0.054 -0.073 0.243  11.748 -2.365  0.071  6  F_DG107:DC314_G F 107 ? G 314 ? 19 1 
1 A DC 8  1_555 B DG 13 1_555 0.316  -0.051 -0.259 15.073 -8.241  -0.534 7  F_DC108:DG313_G F 108 ? G 313 ? 19 1 
1 A DA 9  1_555 B DT 12 1_555 -0.099 -0.067 -0.032 -4.974 -9.362  2.496  8  F_DA109:DT312_G F 109 ? G 312 ? 20 1 
1 A DC 10 1_555 B DG 11 1_555 0.156  -0.133 0.112  -4.953 -18.277 2.299  9  F_DC110:DG311_G F 110 ? G 311 ? 19 1 
1 A DG 11 1_555 B DC 10 1_555 -0.182 -0.095 -0.106 -7.736 -15.053 -1.530 10 F_DG111:DC310_G F 111 ? G 310 ? 19 1 
1 A DT 12 1_555 B DA 9  1_555 -0.120 -0.124 0.023  -6.554 -7.100  -2.567 11 F_DT112:DA309_G F 112 ? G 309 ? 20 1 
1 A DG 13 1_555 B DC 8  1_555 0.008  -0.102 -0.160 1.943  -9.391  0.290  12 F_DG113:DC308_G F 113 ? G 308 ? 19 1 
1 A DC 14 1_555 B DG 7  1_555 0.121  -0.027 -0.032 1.406  -8.652  -4.564 13 F_DC114:DG307_G F 114 ? G 307 ? 19 1 
1 A DT 15 1_555 B DA 6  1_555 -0.146 -0.096 -0.102 5.394  -9.351  -1.307 14 F_DT115:DA306_G F 115 ? G 306 ? 20 1 
1 A DA 16 1_555 B DT 5  1_555 -0.317 -0.023 -0.106 -0.054 -2.209  0.266  15 F_DA116:DT305_G F 116 ? G 305 ? 20 1 
1 A DC 17 1_555 B DG 4  1_555 0.078  0.003  0.025  6.884  -11.333 1.029  16 F_DC117:DG304_G F 117 ? G 304 ? 19 1 
1 A DT 18 1_555 B DA 3  1_555 0.060  0.113  0.220  1.635  -9.790  0.162  17 F_DT118:DA303_G F 118 ? G 303 ? 20 1 
1 A DC 19 1_555 B DG 2  1_555 0.381  -0.189 -0.114 0.131  -7.923  -3.191 18 F_DC119:DG302_G F 119 ? G 302 ? 19 1 
1 C DG 2  1_555 D DC 19 1_555 -0.036 -0.090 -0.224 -0.114 -4.306  -1.587 19 H_DG602:DC819_J H 602 ? J 819 ? 19 1 
1 C DA 3  1_555 D DT 18 1_555 -0.058 -0.002 -0.009 -3.196 -5.469  -1.557 20 H_DA603:DT818_J H 603 ? J 818 ? 20 1 
1 C DG 4  1_555 D DC 17 1_555 -0.437 -0.048 -0.055 -4.696 -6.946  -0.014 21 H_DG604:DC817_J H 604 ? J 817 ? 19 1 
1 C DT 5  1_555 D DA 16 1_555 0.104  0.047  -0.129 3.906  -7.877  1.235  22 H_DT605:DA816_J H 605 ? J 816 ? 20 1 
1 C DA 6  1_555 D DT 15 1_555 0.115  0.012  0.067  -2.677 -12.174 -1.433 23 H_DA606:DT815_J H 606 ? J 815 ? 20 1 
1 C DG 7  1_555 D DC 14 1_555 -0.315 -0.178 -0.249 -3.505 -9.111  -0.099 24 H_DG607:DC814_J H 607 ? J 814 ? 19 1 
1 C DC 8  1_555 D DG 13 1_555 0.138  -0.059 -0.309 -2.776 -10.284 0.728  25 H_DC608:DG813_J H 608 ? J 813 ? 19 1 
1 C DA 9  1_555 D DT 12 1_555 0.021  -0.091 -0.105 4.336  -13.102 0.742  26 H_DA609:DT812_J H 609 ? J 812 ? 20 1 
1 C DC 10 1_555 D DG 11 1_555 0.216  -0.046 0.138  -0.956 -16.997 0.232  27 H_DC610:DG811_J H 610 ? J 811 ? 19 1 
1 C DG 11 1_555 D DC 10 1_555 -0.059 -0.026 0.109  0.323  -15.776 -0.214 28 H_DG611:DC810_J H 611 ? J 810 ? 19 1 
1 C DT 12 1_555 D DA 9  1_555 -0.130 0.015  -0.095 -0.722 -9.924  0.395  29 H_DT612:DA809_J H 612 ? J 809 ? 20 1 
1 C DG 13 1_555 D DC 8  1_555 -0.126 -0.003 -0.127 1.027  -1.910  -2.366 30 H_DG613:DC808_J H 613 ? J 808 ? 19 1 
1 C DC 14 1_555 D DG 7  1_555 -0.063 -0.039 0.172  -1.572 -3.529  1.069  31 H_DC614:DG807_J H 614 ? J 807 ? 19 1 
1 C DT 15 1_555 D DA 6  1_555 -0.355 -0.059 0.131  1.893  -13.089 0.499  32 H_DT615:DA806_J H 615 ? J 806 ? 20 1 
1 C DA 16 1_555 D DT 5  1_555 -0.160 0.033  -0.109 3.305  -18.205 -0.525 33 H_DA616:DT805_J H 616 ? J 805 ? 20 1 
1 C DC 17 1_555 D DG 4  1_555 -0.024 0.056  0.111  0.228  -16.662 1.670  34 H_DC617:DG804_J H 617 ? J 804 ? 19 1 
1 C DT 18 1_555 D DA 3  1_555 -0.142 0.072  0.294  -6.171 -12.465 3.797  35 H_DT618:DA803_J H 618 ? J 803 ? 20 1 
1 C DC 19 1_555 D DG 2  1_555 -0.003 -0.175 -0.747 7.726  6.749   0.575  36 H_DC619:DG802_J H 619 ? J 802 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 19 1_555 A DA 3  1_555 B DT 18 1_555 -0.632 1.262  3.018 -7.202 -1.511 36.884 2.142  0.106  3.032 -2.359 
11.246  37.586 1  FF_DG102DA103:DT318DC319_GG F 102 ? G 319 ? F 103 ? G 318 ? 
1 A DA 3  1_555 B DT 18 1_555 A DG 4  1_555 B DC 17 1_555 -0.444 -0.208 3.416 0.462  2.579  37.798 -0.665 0.746  3.389 3.975  
-0.712  37.885 2  FF_DA103DG104:DC317DT318_GG F 103 ? G 318 ? F 104 ? G 317 ? 
1 A DG 4  1_555 B DC 17 1_555 A DT 5  1_555 B DA 16 1_555 -0.349 -0.211 3.414 -1.219 4.066  31.320 -1.172 0.405  3.371 7.488  
2.245   31.599 3  FF_DG104DT105:DA316DC317_GG F 104 ? G 317 ? F 105 ? G 316 ? 
1 A DT 5  1_555 B DA 16 1_555 A DA 6  1_555 B DT 15 1_555 0.846  1.281  3.195 0.533  -4.298 42.891 2.149  -1.101 3.069 -5.859 
-0.727  43.099 4  FF_DT105DA106:DT315DA316_GG F 105 ? G 316 ? F 106 ? G 315 ? 
1 A DA 6  1_555 B DT 15 1_555 A DG 7  1_555 B DC 14 1_555 -0.086 0.205  3.198 -0.833 12.155 24.187 -2.637 -0.026 2.959 26.931 
1.847   27.041 5  FF_DA106DG107:DC314DT315_GG F 106 ? G 315 ? F 107 ? G 314 ? 
1 A DG 7  1_555 B DC 14 1_555 A DC 8  1_555 B DG 13 1_555 -0.320 -0.347 3.170 3.208  5.636  33.996 -1.415 1.012  3.034 9.532  
-5.426  34.591 6  FF_DG107DC108:DG313DC314_GG F 107 ? G 314 ? F 108 ? G 313 ? 
1 A DC 8  1_555 B DG 13 1_555 A DA 9  1_555 B DT 12 1_555 -0.121 -0.765 3.624 -2.990 6.887  39.503 -1.968 -0.194 3.448 10.079 
4.376   40.182 7  FF_DC108DA109:DT312DG313_GG F 108 ? G 313 ? F 109 ? G 312 ? 
1 A DA 9  1_555 B DT 12 1_555 A DC 10 1_555 B DG 11 1_555 -0.610 -0.796 3.265 0.192  -0.241 29.983 -1.488 1.218  3.268 -0.467 
-0.371  29.985 8  FF_DA109DC110:DG311DT312_GG F 109 ? G 312 ? F 110 ? G 311 ? 
1 A DC 10 1_555 B DG 11 1_555 A DG 11 1_555 B DC 10 1_555 -0.442 0.530  3.539 -1.914 8.983  35.021 -0.547 0.414  3.581 14.619 
3.114   36.169 9  FF_DC110DG111:DC310DG311_GG F 110 ? G 311 ? F 111 ? G 310 ? 
1 A DG 11 1_555 B DC 10 1_555 A DT 12 1_555 B DA 9  1_555 0.575  -0.201 3.249 0.750  1.579  31.319 -0.667 -0.923 3.247 2.922  
-1.387  31.367 10 FF_DG111DT112:DA309DC310_GG F 111 ? G 310 ? F 112 ? G 309 ? 
1 A DT 12 1_555 B DA 9  1_555 A DG 13 1_555 B DC 8  1_555 -0.032 0.899  3.201 0.125  10.801 31.703 -0.267 0.076  3.321 19.092 
-0.221  33.448 11 FF_DT112DG113:DC308DA309_GG F 112 ? G 309 ? F 113 ? G 308 ? 
1 A DG 13 1_555 B DC 8  1_555 A DC 14 1_555 B DG 7  1_555 -0.371 -0.365 3.242 -2.322 6.628  31.600 -1.808 0.262  3.122 11.987 
4.199   32.352 12 FF_DG113DC114:DG307DC308_GG F 113 ? G 308 ? F 114 ? G 307 ? 
1 A DC 14 1_555 B DG 7  1_555 A DT 15 1_555 B DA 6  1_555 -0.290 -0.429 3.279 2.605  5.925  32.197 -1.763 0.955  3.120 10.551 
-4.638  32.824 13 FF_DC114DT115:DA306DG307_GG F 114 ? G 307 ? F 115 ? G 306 ? 
1 A DT 15 1_555 B DA 6  1_555 A DA 16 1_555 B DT 5  1_555 0.991  0.475  3.467 3.539  5.175  39.075 0.045  -1.015 3.571 7.677  
-5.249  39.555 14 FF_DT115DA116:DT305DA306_GG F 115 ? G 306 ? F 116 ? G 305 ? 
1 A DA 16 1_555 B DT 5  1_555 A DC 17 1_555 B DG 4  1_555 -0.349 -0.329 3.183 -0.727 3.024  29.500 -1.260 0.533  3.142 5.918  
1.423   29.660 15 FF_DA116DC117:DG304DT305_GG F 116 ? G 305 ? F 117 ? G 304 ? 
1 A DC 17 1_555 B DG 4  1_555 A DT 18 1_555 B DA 3  1_555 0.258  -0.414 3.421 0.606  9.720  31.876 -2.392 -0.346 3.166 17.202 
-1.073  33.294 16 FF_DC117DT118:DA303DG304_GG F 117 ? G 304 ? F 118 ? G 303 ? 
1 A DT 18 1_555 B DA 3  1_555 A DC 19 1_555 B DG 2  1_555 0.283  -0.224 3.222 4.312  3.169  37.351 -0.751 0.112  3.205 4.917  
-6.691  37.718 17 FF_DT118DC119:DG302DA303_GG F 118 ? G 303 ? F 119 ? G 302 ? 
1 C DG 2  1_555 D DC 19 1_555 C DA 3  1_555 D DT 18 1_555 -0.621 -0.316 3.323 -3.134 3.345  34.264 -1.058 0.551  3.320 5.646  
5.290   34.560 18 HH_DG602DA603:DT818DC819_JJ H 602 ? J 819 ? H 603 ? J 818 ? 
1 C DA 3  1_555 D DT 18 1_555 C DG 4  1_555 D DC 17 1_555 0.105  -0.248 3.369 -1.824 8.190  30.320 -2.023 -0.542 3.184 15.293 
3.406   31.433 19 HH_DA603DG604:DC817DT818_JJ H 603 ? J 818 ? H 604 ? J 817 ? 
1 C DG 4  1_555 D DC 17 1_555 C DT 5  1_555 D DA 16 1_555 -0.031 -0.437 3.054 1.395  6.875  30.026 -2.055 0.308  2.881 13.047 
-2.648  30.816 20 HH_DG604DT605:DA816DC817_JJ H 604 ? J 817 ? H 605 ? J 816 ? 
1 C DT 5  1_555 D DA 16 1_555 C DA 6  1_555 D DT 15 1_555 -0.898 0.428  3.398 -5.147 4.396  40.055 0.097  0.685  3.508 6.363  
7.450   40.600 21 HH_DT605DA606:DT815DA816_JJ H 605 ? J 816 ? H 606 ? J 815 ? 
1 C DA 6  1_555 D DT 15 1_555 C DG 7  1_555 D DC 14 1_555 0.301  -0.228 3.383 0.388  3.564  31.164 -1.114 -0.482 3.341 6.606  
-0.719  31.365 22 HH_DA606DG607:DC814DT815_JJ H 606 ? J 815 ? H 607 ? J 814 ? 
1 C DG 7  1_555 D DC 14 1_555 C DC 8  1_555 D DG 13 1_555 0.295  -0.454 3.183 1.132  6.907  33.017 -1.861 -0.332 3.037 11.986 
-1.964  33.731 23 HH_DG607DC608:DG813DC814_JJ H 607 ? J 814 ? H 608 ? J 813 ? 
1 C DC 8  1_555 D DG 13 1_555 C DA 9  1_555 D DT 12 1_555 0.017  0.765  3.227 -0.875 10.362 32.094 -0.407 -0.175 3.307 18.156 
1.532   33.694 24 HH_DC608DA609:DT812DG813_JJ H 608 ? J 813 ? H 609 ? J 812 ? 
1 C DA 9  1_555 D DT 12 1_555 C DC 10 1_555 D DG 11 1_555 -0.547 -0.461 3.362 -3.301 2.184  31.919 -1.236 0.379  3.362 3.953  
5.974   32.157 25 HH_DA609DC610:DG811DT812_JJ H 609 ? J 812 ? H 610 ? J 811 ? 
1 C DC 10 1_555 D DG 11 1_555 C DG 11 1_555 D DC 10 1_555 0.218  0.470  3.432 0.858  7.642  35.498 -0.385 -0.222 3.460 12.356 
-1.387  36.295 26 HH_DC610DG611:DC810DG811_JJ H 610 ? J 811 ? H 611 ? J 810 ? 
1 C DG 11 1_555 D DC 10 1_555 C DT 12 1_555 D DA 9  1_555 0.428  -0.604 3.285 2.676  -0.507 28.927 -1.091 -0.259 3.321 -1.012 
-5.341  29.052 27 HH_DG611DT612:DA809DC810_JJ H 611 ? J 810 ? H 612 ? J 809 ? 
1 C DT 12 1_555 D DA 9  1_555 C DG 13 1_555 D DC 8  1_555 0.030  -0.087 3.334 -0.202 7.833  38.387 -1.086 -0.069 3.255 11.764 
0.304   39.149 28 HH_DT612DG613:DC808DA809_JJ H 612 ? J 809 ? H 613 ? J 808 ? 
1 C DG 13 1_555 D DC 8  1_555 C DC 14 1_555 D DG 7  1_555 0.109  -0.652 3.347 -2.584 2.174  32.577 -1.537 -0.646 3.280 3.863  
4.590   32.747 29 HH_DG613DC614:DG807DC808_JJ H 613 ? J 808 ? H 614 ? J 807 ? 
1 C DC 14 1_555 D DG 7  1_555 C DT 15 1_555 D DA 6  1_555 -0.367 -0.141 3.189 0.940  8.506  29.454 -1.891 0.874  3.019 16.301 
-1.801  30.646 30 HH_DC614DT615:DA806DG807_JJ H 614 ? J 807 ? H 615 ? J 806 ? 
1 C DT 15 1_555 D DA 6  1_555 C DA 16 1_555 D DT 5  1_555 -0.306 0.727  3.201 -0.320 5.114  39.658 0.480  0.411  3.268 7.500  
0.469   39.975 31 HH_DT615DA616:DT805DA806_JJ H 615 ? J 806 ? H 616 ? J 805 ? 
1 C DA 16 1_555 D DT 5  1_555 C DC 17 1_555 D DG 4  1_555 0.336  -0.262 3.360 -2.380 0.798  36.897 -0.523 -0.857 3.326 1.259  
3.755   36.979 32 HH_DA616DC617:DG804DT805_JJ H 616 ? J 805 ? H 617 ? J 804 ? 
1 C DC 17 1_555 D DG 4  1_555 C DT 18 1_555 D DA 3  1_555 0.707  -0.021 3.491 3.976  -0.640 38.733 0.052  -0.542 3.544 -0.962 
-5.975  38.934 33 HH_DC617DT618:DA803DG804_JJ H 617 ? J 804 ? H 618 ? J 803 ? 
1 C DT 18 1_555 D DA 3  1_555 C DC 19 1_555 D DG 2  1_555 0.842  1.268  3.002 8.248  2.427  32.687 1.805  -0.161 3.197 4.222  
-14.348 33.769 34 HH_DT618DC619:DG802DA803_JJ H 618 ? J 803 ? H 619 ? J 802 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#