data_1NLW
# 
_entry.id   1NLW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1NLW         pdb_00001nlw 10.2210/pdb1nlw/pdb 
NDB   PD0387       ?            ?                   
RCSB  RCSB017988   ?            ?                   
WWPDB D_1000017988 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1NKP 
_pdbx_database_related.details        'Crystal structure of Myc-Max recognizing DNA' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NLW 
_pdbx_database_status.recvd_initial_deposition_date   2003-01-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nair, S.K.'   1 ?                   
'Burley, S.K.' 2 0000-0002-2487-9713 
# 
_citation.id                        primary 
_citation.title                     
'X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            112 
_citation.page_first                193 
_citation.page_last                 205 
_citation.year                      2003 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12553908 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01284-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nair, S.K.'   1 ?                   
primary 'Burley, S.K.' 2 0000-0002-2487-9713 
# 
_cell.entry_id           1NLW 
_cell.length_a           47.346 
_cell.length_b           56.020 
_cell.length_c           65.602 
_cell.angle_alpha        88.82 
_cell.angle_beta         79.08 
_cell.angle_gamma        67.11 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NLW 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*GP*AP*GP*TP*AP*GP*CP*AP*CP*GP*TP*GP*CP*TP*AP*CP*TP*C)-3'" 5516.579 4   ? ? ?              ? 
2 polymer man 'MAD PROTEIN'                                                    9445.983 2   ? ? 'bHLHZ region' ? 
3 polymer man 'MAX PROTEIN'                                                    9121.248 2   ? ? 'bHLHZ region' ? 
4 water   nat water                                                            18.015   251 ? ? ?              ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'MAX DIMERIZER' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DT)(DA)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DT)(DA)(DC)(DT)(DC)'       
GAGTAGCACGTGCTACTC                                                               F,G,H,J ? 
2 'polypeptide(L)'        no no SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQREQRHLKRQLEKL 
SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQREQRHLKRQLEKL A,D     ? 
3 'polypeptide(L)'        no no KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQV     
KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQV     B,E     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DG  n 
1 2  DA  n 
1 3  DG  n 
1 4  DT  n 
1 5  DA  n 
1 6  DG  n 
1 7  DC  n 
1 8  DA  n 
1 9  DC  n 
1 10 DG  n 
1 11 DT  n 
1 12 DG  n 
1 13 DC  n 
1 14 DT  n 
1 15 DA  n 
1 16 DC  n 
1 17 DT  n 
1 18 DC  n 
2 1  SER n 
2 2  ARG n 
2 3  SER n 
2 4  THR n 
2 5  HIS n 
2 6  ASN n 
2 7  GLU n 
2 8  MET n 
2 9  GLU n 
2 10 LYS n 
2 11 ASN n 
2 12 ARG n 
2 13 ARG n 
2 14 ALA n 
2 15 HIS n 
2 16 LEU n 
2 17 ARG n 
2 18 LEU n 
2 19 SER n 
2 20 LEU n 
2 21 GLU n 
2 22 LYS n 
2 23 LEU n 
2 24 LYS n 
2 25 GLY n 
2 26 LEU n 
2 27 VAL n 
2 28 PRO n 
2 29 LEU n 
2 30 GLY n 
2 31 PRO n 
2 32 ASP n 
2 33 SER n 
2 34 SER n 
2 35 ARG n 
2 36 HIS n 
2 37 THR n 
2 38 THR n 
2 39 LEU n 
2 40 SER n 
2 41 LEU n 
2 42 LEU n 
2 43 THR n 
2 44 LYS n 
2 45 ALA n 
2 46 LYS n 
2 47 LEU n 
2 48 HIS n 
2 49 ILE n 
2 50 LYS n 
2 51 LYS n 
2 52 LEU n 
2 53 GLU n 
2 54 ASP n 
2 55 SER n 
2 56 ASP n 
2 57 ARG n 
2 58 LYS n 
2 59 ALA n 
2 60 VAL n 
2 61 HIS n 
2 62 GLN n 
2 63 ILE n 
2 64 ASP n 
2 65 GLN n 
2 66 LEU n 
2 67 GLN n 
2 68 ARG n 
2 69 GLU n 
2 70 GLN n 
2 71 ARG n 
2 72 HIS n 
2 73 LEU n 
2 74 LYS n 
2 75 ARG n 
2 76 GLN n 
2 77 LEU n 
2 78 GLU n 
2 79 LYS n 
2 80 LEU n 
3 1  LYS n 
3 2  ARG n 
3 3  ALA n 
3 4  HIS n 
3 5  HIS n 
3 6  ASN n 
3 7  ALA n 
3 8  LEU n 
3 9  GLU n 
3 10 ARG n 
3 11 LYS n 
3 12 ARG n 
3 13 ARG n 
3 14 ASP n 
3 15 HIS n 
3 16 ILE n 
3 17 LYS n 
3 18 ASP n 
3 19 SER n 
3 20 PHE n 
3 21 HIS n 
3 22 SER n 
3 23 LEU n 
3 24 ARG n 
3 25 ASP n 
3 26 SER n 
3 27 VAL n 
3 28 PRO n 
3 29 SER n 
3 30 LEU n 
3 31 GLN n 
3 32 GLY n 
3 33 GLU n 
3 34 LYS n 
3 35 ALA n 
3 36 SER n 
3 37 ARG n 
3 38 ALA n 
3 39 GLN n 
3 40 ILE n 
3 41 LEU n 
3 42 ASP n 
3 43 LYS n 
3 44 ALA n 
3 45 THR n 
3 46 GLU n 
3 47 TYR n 
3 48 ILE n 
3 49 GLN n 
3 50 TYR n 
3 51 MET n 
3 52 ARG n 
3 53 ARG n 
3 54 LYS n 
3 55 ASN n 
3 56 HIS n 
3 57 THR n 
3 58 HIS n 
3 59 GLN n 
3 60 GLN n 
3 61 ASP n 
3 62 ILE n 
3 63 ASP n 
3 64 ASP n 
3 65 LEU n 
3 66 LYS n 
3 67 ARG n 
3 68 GLN n 
3 69 ASN n 
3 70 ALA n 
3 71 LEU n 
3 72 LEU n 
3 73 GLU n 
3 74 GLN n 
3 75 GLN n 
3 76 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
2 1 sample ? ? ? human Homo Mad ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid pET     ? ? ? ? ? 
3 1 sample ? ? ? human Homo Max ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid 'pET 3' ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MAD_HUMAN 2 
;SRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKL

;
57 Q05195 ? 
2 UNP MAX_HUMAN 3 KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQV        24 P61244 ? 
3 PDB 1NLW      1 ?                                                                                   ?  1NLW   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NLW A 1 ? 80 ? Q05195 57  ? 136 ? 2   81  
2 1 1NLW D 1 ? 80 ? Q05195 57  ? 136 ? 502 581 
3 2 1NLW B 1 ? 76 ? P61244 24  ? 99  ? 203 278 
4 2 1NLW E 1 ? 76 ? P61244 24  ? 99  ? 703 778 
5 3 1NLW F 1 ? 18 ? 1NLW   102 ? 119 ? 102 119 
6 3 1NLW G 1 ? 18 ? 1NLW   302 ? 319 ? 302 319 
7 3 1NLW H 1 ? 18 ? 1NLW   602 ? 619 ? 602 619 
8 3 1NLW J 1 ? 18 ? 1NLW   802 ? 819 ? 802 819 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1NLW SER A 19 ? UNP Q05195 CYS 75  'engineered mutation' 20  1 
1 1NLW ASP A 32 ? UNP Q05195 GLU 88  variant               33  2 
1 1NLW SER A 55 ? UNP Q05195 CYS 111 'engineered mutation' 56  3 
2 1NLW SER D 19 ? UNP Q05195 CYS 75  'engineered mutation' 520 4 
2 1NLW ASP D 32 ? UNP Q05195 GLU 88  variant               533 5 
2 1NLW SER D 55 ? UNP Q05195 CYS 111 'engineered mutation' 556 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1NLW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   52.95 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'20% MPD, 5mM magnesium chloride, 50 mM sodium cacodylate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 288K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 '20% methyl pentane diol'       ? ? ? 
1 2 1 '5MM magnesium chloride'        ? ? ? 
1 3 1 '50MM sodium cacodylate pH 6.0' ? ? ? 
1 4 2 'methyl pentane diol'           ? ? ? 
1 5 2 'magnesium chloride'            ? ? ? 
1 6 2 'sodium cacodylate pH 6.0'      ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.92 
# 
_reflns.entry_id                     1NLW 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   4.0 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   ? 
_reflns.number_obs                   35483 
_reflns.percent_possible_obs         88.8 
_reflns.pdbx_Rmerge_I_obs            0.052 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1NLW 
_refine.ls_d_res_high                            2.0 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     35483 
_refine.ls_number_reflns_obs                     33720 
_refine.ls_number_reflns_R_free                  3376 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.264 
_refine.ls_R_factor_R_work                       0.264 
_refine.ls_R_factor_R_free                       0.324 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1NKP' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.612 
_refine.aniso_B[1][2]                            12.525 
_refine.aniso_B[1][3]                            -1.434 
_refine.aniso_B[2][2]                            -10.682 
_refine.aniso_B[2][3]                            4.315 
_refine.aniso_B[3][3]                            11.294 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2497 
_refine_hist.pdbx_number_atoms_nucleic_acid   1464 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             251 
_refine_hist.number_atoms_total               4212 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 0.94  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 water_rep.param   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1NLW 
_struct.title                     'Crystal structure of Mad-Max recognizing DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NLW 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'transcription factor, DNA, bHLHZ, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER E 1  ? LEU E 26 ? SER A 2   LEU A 27  1 ? 26 
HELX_P HELX_P2  2  THR E 38 ? HIS E 61 ? THR A 39  HIS A 62  1 ? 24 
HELX_P HELX_P3  3  ILE E 63 ? GLU E 78 ? ILE A 64  GLU A 79  1 ? 16 
HELX_P HELX_P4  4  LYS F 1  ? ASP F 25 ? LYS B 203 ASP B 227 1 ? 25 
HELX_P HELX_P5  5  SER F 36 ? VAL F 76 ? SER B 238 VAL B 278 1 ? 41 
HELX_P HELX_P6  6  ARG G 2  ? LYS G 10 ? ARG D 503 LYS D 511 1 ? 9  
HELX_P HELX_P7  7  ARG G 12 ? LEU G 26 ? ARG D 513 LEU D 527 1 ? 15 
HELX_P HELX_P8  8  THR G 37 ? LYS G 74 ? THR D 538 LYS D 575 1 ? 38 
HELX_P HELX_P9  9  ALA H 3  ? ASP H 25 ? ALA E 705 ASP E 727 1 ? 23 
HELX_P HELX_P10 10 SER H 36 ? VAL H 76 ? SER E 738 VAL E 778 1 ? 41 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC 18 N3 ? ? F DG 102 G DC 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC 18 O2 ? ? F DG 102 G DC 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC 18 N4 ? ? F DG 102 G DC 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 17 N3 ? ? F DA 103 G DT 318 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 17 O4 ? ? F DA 103 G DT 318 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 16 N3 ? ? F DG 104 G DC 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 16 O2 ? ? F DG 104 G DC 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 16 N4 ? ? F DG 104 G DC 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 15 N1 ? ? F DT 105 G DA 316 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 15 N6 ? ? F DT 105 G DA 316 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 14 N3 ? ? F DA 106 G DT 315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 14 O4 ? ? F DA 106 G DT 315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 13 N3 ? ? F DG 107 G DC 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 13 O2 ? ? F DG 107 G DC 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 13 N4 ? ? F DG 107 G DC 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DC 7  N3 ? ? ? 1_555 B DG 12 N1 ? ? F DC 108 G DG 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DC 7  N4 ? ? ? 1_555 B DG 12 O6 ? ? F DC 108 G DG 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 7  O2 ? ? ? 1_555 B DG 12 N2 ? ? F DC 108 G DG 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 11 N3 ? ? F DA 109 G DT 312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 11 O4 ? ? F DA 109 G DT 312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 10 N1 ? ? F DC 110 G DG 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 10 O6 ? ? F DC 110 G DG 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 10 N2 ? ? F DC 110 G DG 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 9  N3 ? ? F DG 111 G DC 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 9  O2 ? ? F DG 111 G DC 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 9  N4 ? ? F DG 111 G DC 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 8  N1 ? ? F DT 112 G DA 309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 8  N6 ? ? F DT 112 G DA 309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 7  N3 ? ? F DG 113 G DC 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 7  O2 ? ? F DG 113 G DC 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 7  N4 ? ? F DG 113 G DC 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DC 13 N3 ? ? ? 1_555 B DG 6  N1 ? ? F DC 114 G DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DC 13 N4 ? ? ? 1_555 B DG 6  O6 ? ? F DC 114 G DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DC 13 O2 ? ? ? 1_555 B DG 6  N2 ? ? F DC 114 G DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 5  N1 ? ? F DT 115 G DA 306 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 5  N6 ? ? F DT 115 G DA 306 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 4  N3 ? ? F DA 116 G DT 305 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 4  O4 ? ? F DA 116 G DT 305 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? A DC 16 N3 ? ? ? 1_555 B DG 3  N1 ? ? F DC 117 G DG 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? A DC 16 N4 ? ? ? 1_555 B DG 3  O6 ? ? F DC 117 G DG 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41 hydrog ? ? A DC 16 O2 ? ? ? 1_555 B DG 3  N2 ? ? F DC 117 G DG 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? A DT 17 N3 ? ? ? 1_555 B DA 2  N1 ? ? F DT 118 G DA 303 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43 hydrog ? ? A DT 17 O4 ? ? ? 1_555 B DA 2  N6 ? ? F DT 118 G DA 303 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44 hydrog ? ? A DC 18 N3 ? ? ? 1_555 B DG 1  N1 ? ? F DC 119 G DG 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45 hydrog ? ? A DC 18 N4 ? ? ? 1_555 B DG 1  O6 ? ? F DC 119 G DG 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog46 hydrog ? ? A DC 18 O2 ? ? ? 1_555 B DG 1  N2 ? ? F DC 119 G DG 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47 hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC 18 N3 ? ? H DG 602 J DC 819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog48 hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC 18 O2 ? ? H DG 602 J DC 819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog49 hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC 18 N4 ? ? H DG 602 J DC 819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog50 hydrog ? ? C DA 2  N1 ? ? ? 1_555 D DT 17 N3 ? ? H DA 603 J DT 818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog51 hydrog ? ? C DA 2  N6 ? ? ? 1_555 D DT 17 O4 ? ? H DA 603 J DT 818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog52 hydrog ? ? C DG 3  N1 ? ? ? 1_555 D DC 16 N3 ? ? H DG 604 J DC 817 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? ? 
hydrog53 hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA 15 N1 ? ? H DT 605 J DA 816 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog54 hydrog ? ? C DT 4  O4 ? ? ? 1_555 D DA 15 N6 ? ? H DT 605 J DA 816 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog55 hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 14 N3 ? ? H DA 606 J DT 815 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog56 hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 14 O4 ? ? H DA 606 J DT 815 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog57 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 13 N3 ? ? H DG 607 J DC 814 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog58 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 13 O2 ? ? H DG 607 J DC 814 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog59 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 13 N4 ? ? H DG 607 J DC 814 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog60 hydrog ? ? C DC 7  N3 ? ? ? 1_555 D DG 12 N1 ? ? H DC 608 J DG 813 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog61 hydrog ? ? C DC 7  N4 ? ? ? 1_555 D DG 12 O6 ? ? H DC 608 J DG 813 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog62 hydrog ? ? C DC 7  O2 ? ? ? 1_555 D DG 12 N2 ? ? H DC 608 J DG 813 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog63 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 11 N3 ? ? H DA 609 J DT 812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog64 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 11 O4 ? ? H DA 609 J DT 812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog65 hydrog ? ? C DC 9  N3 ? ? ? 1_555 D DG 10 N1 ? ? H DC 610 J DG 811 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog66 hydrog ? ? C DC 9  N4 ? ? ? 1_555 D DG 10 O6 ? ? H DC 610 J DG 811 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog67 hydrog ? ? C DC 9  O2 ? ? ? 1_555 D DG 10 N2 ? ? H DC 610 J DG 811 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog68 hydrog ? ? C DG 10 N1 ? ? ? 1_555 D DC 9  N3 ? ? H DG 611 J DC 810 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog69 hydrog ? ? C DG 10 N2 ? ? ? 1_555 D DC 9  O2 ? ? H DG 611 J DC 810 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog70 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 9  N4 ? ? H DG 611 J DC 810 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog71 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 8  N1 ? ? H DT 612 J DA 809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog72 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA 8  N6 ? ? H DT 612 J DA 809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog73 hydrog ? ? C DG 12 N1 ? ? ? 1_555 D DC 7  N3 ? ? H DG 613 J DC 808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog74 hydrog ? ? C DG 12 N2 ? ? ? 1_555 D DC 7  O2 ? ? H DG 613 J DC 808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog75 hydrog ? ? C DG 12 O6 ? ? ? 1_555 D DC 7  N4 ? ? H DG 613 J DC 808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog76 hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG 6  N1 ? ? H DC 614 J DG 807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog77 hydrog ? ? C DC 13 N4 ? ? ? 1_555 D DG 6  O6 ? ? H DC 614 J DG 807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog78 hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG 6  N2 ? ? H DC 614 J DG 807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog79 hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 5  N1 ? ? H DT 615 J DA 806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog80 hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA 5  N6 ? ? H DT 615 J DA 806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog81 hydrog ? ? C DA 15 N1 ? ? ? 1_555 D DT 4  N3 ? ? H DA 616 J DT 805 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog82 hydrog ? ? C DC 16 O2 ? ? ? 1_555 D DG 3  N2 ? ? H DC 617 J DG 804 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? ? 
hydrog83 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 2  N1 ? ? H DT 618 J DA 803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog84 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 2  N6 ? ? H DT 618 J DA 803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog85 hydrog ? ? C DC 18 N3 ? ? ? 1_555 D DG 1  N1 ? ? H DC 619 J DG 802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog86 hydrog ? ? C DC 18 N4 ? ? ? 1_555 D DG 1  O6 ? ? H DC 619 J DG 802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog87 hydrog ? ? C DC 18 O2 ? ? ? 1_555 D DG 1  N2 ? ? H DC 619 J DG 802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1NLW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NLW 
_atom_sites.fract_transf_matrix[1][1]   0.021121 
_atom_sites.fract_transf_matrix[1][2]   -0.008918 
_atom_sites.fract_transf_matrix[1][3]   -0.004606 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019377 
_atom_sites.fract_transf_matrix[2][3]   0.001139 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015551 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1  ? 10.446  -6.726  -35.996 1.00 61.35 ? 102 DG  F "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1  ? 9.375   -7.374  -35.304 1.00 62.07 ? 102 DG  F "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1  ? 9.782   -8.671  -34.639 1.00 62.32 ? 102 DG  F "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1  ? 11.036  -8.484  -33.942 1.00 61.85 ? 102 DG  F "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1  ? 8.792   -9.155  -33.582 1.00 62.42 ? 102 DG  F "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1  ? 8.774   -10.583 -33.518 1.00 62.54 ? 102 DG  F "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1  ? 9.356   -8.584  -32.296 1.00 61.87 ? 102 DG  F "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1  ? 10.854  -8.652  -32.543 1.00 60.37 ? 102 DG  F "C1'" 1 
ATOM   9    N N9    . DG  A 1 1  ? 11.604  -7.597  -31.876 1.00 57.34 ? 102 DG  F N9    1 
ATOM   10   C C8    . DG  A 1 1  ? 11.617  -6.262  -32.203 1.00 57.01 ? 102 DG  F C8    1 
ATOM   11   N N7    . DG  A 1 1  ? 12.400  -5.556  -31.435 1.00 55.81 ? 102 DG  F N7    1 
ATOM   12   C C5    . DG  A 1 1  ? 12.935  -6.481  -30.549 1.00 54.73 ? 102 DG  F C5    1 
ATOM   13   C C6    . DG  A 1 1  ? 13.858  -6.307  -29.491 1.00 53.89 ? 102 DG  F C6    1 
ATOM   14   O O6    . DG  A 1 1  ? 14.420  -5.268  -29.124 1.00 52.79 ? 102 DG  F O6    1 
ATOM   15   N N1    . DG  A 1 1  ? 14.118  -7.509  -28.837 1.00 53.26 ? 102 DG  F N1    1 
ATOM   16   C C2    . DG  A 1 1  ? 13.567  -8.723  -29.166 1.00 53.45 ? 102 DG  F C2    1 
ATOM   17   N N2    . DG  A 1 1  ? 13.939  -9.768  -28.411 1.00 49.70 ? 102 DG  F N2    1 
ATOM   18   N N3    . DG  A 1 1  ? 12.713  -8.899  -30.160 1.00 53.93 ? 102 DG  F N3    1 
ATOM   19   C C4    . DG  A 1 1  ? 12.443  -7.744  -30.803 1.00 55.19 ? 102 DG  F C4    1 
ATOM   20   P P     . DA  A 1 2  ? 7.551   -11.323 -32.788 1.00 63.29 ? 103 DA  F P     1 
ATOM   21   O OP1   . DA  A 1 2  ? 7.160   -12.477 -33.637 1.00 63.74 ? 103 DA  F OP1   1 
ATOM   22   O OP2   . DA  A 1 2  ? 6.540   -10.293 -32.438 1.00 63.41 ? 103 DA  F OP2   1 
ATOM   23   O "O5'" . DA  A 1 2  ? 8.182   -11.889 -31.438 1.00 62.15 ? 103 DA  F "O5'" 1 
ATOM   24   C "C5'" . DA  A 1 2  ? 8.987   -13.067 -31.446 1.00 59.31 ? 103 DA  F "C5'" 1 
ATOM   25   C "C4'" . DA  A 1 2  ? 9.365   -13.458 -30.036 1.00 57.01 ? 103 DA  F "C4'" 1 
ATOM   26   O "O4'" . DA  A 1 2  ? 10.189  -12.413 -29.458 1.00 56.56 ? 103 DA  F "O4'" 1 
ATOM   27   C "C3'" . DA  A 1 2  ? 8.187   -13.648 -29.079 1.00 56.02 ? 103 DA  F "C3'" 1 
ATOM   28   O "O3'" . DA  A 1 2  ? 8.442   -14.747 -28.199 1.00 54.42 ? 103 DA  F "O3'" 1 
ATOM   29   C "C2'" . DA  A 1 2  ? 8.140   -12.341 -28.308 1.00 55.55 ? 103 DA  F "C2'" 1 
ATOM   30   C "C1'" . DA  A 1 2  ? 9.598   -11.911 -28.266 1.00 54.30 ? 103 DA  F "C1'" 1 
ATOM   31   N N9    . DA  A 1 2  ? 9.782   -10.458 -28.260 1.00 52.21 ? 103 DA  F N9    1 
ATOM   32   C C8    . DA  A 1 2  ? 9.211   -9.548  -29.115 1.00 50.68 ? 103 DA  F C8    1 
ATOM   33   N N7    . DA  A 1 2  ? 9.569   -8.308  -28.885 1.00 49.86 ? 103 DA  F N7    1 
ATOM   34   C C5    . DA  A 1 2  ? 10.432  -8.404  -27.804 1.00 49.16 ? 103 DA  F C5    1 
ATOM   35   C C6    . DA  A 1 2  ? 11.158  -7.438  -27.085 1.00 48.99 ? 103 DA  F C6    1 
ATOM   36   N N6    . DA  A 1 2  ? 11.128  -6.133  -27.364 1.00 47.88 ? 103 DA  F N6    1 
ATOM   37   N N1    . DA  A 1 2  ? 11.928  -7.865  -26.059 1.00 49.27 ? 103 DA  F N1    1 
ATOM   38   C C2    . DA  A 1 2  ? 11.959  -9.175  -25.785 1.00 48.27 ? 103 DA  F C2    1 
ATOM   39   N N3    . DA  A 1 2  ? 11.324  -10.179 -26.388 1.00 48.08 ? 103 DA  F N3    1 
ATOM   40   C C4    . DA  A 1 2  ? 10.569  -9.722  -27.402 1.00 50.10 ? 103 DA  F C4    1 
ATOM   41   P P     . DG  A 1 3  ? 7.382   -15.114 -27.049 1.00 55.07 ? 104 DG  F P     1 
ATOM   42   O OP1   . DG  A 1 3  ? 7.563   -16.551 -26.712 1.00 54.87 ? 104 DG  F OP1   1 
ATOM   43   O OP2   . DG  A 1 3  ? 6.040   -14.619 -27.452 1.00 53.40 ? 104 DG  F OP2   1 
ATOM   44   O "O5'" . DG  A 1 3  ? 7.889   -14.267 -25.799 1.00 52.21 ? 104 DG  F "O5'" 1 
ATOM   45   C "C5'" . DG  A 1 3  ? 9.179   -14.511 -25.243 1.00 50.63 ? 104 DG  F "C5'" 1 
ATOM   46   C "C4'" . DG  A 1 3  ? 9.303   -13.835 -23.900 1.00 48.52 ? 104 DG  F "C4'" 1 
ATOM   47   O "O4'" . DG  A 1 3  ? 9.534   -12.414 -24.079 1.00 47.37 ? 104 DG  F "O4'" 1 
ATOM   48   C "C3'" . DG  A 1 3  ? 8.045   -13.964 -23.043 1.00 48.94 ? 104 DG  F "C3'" 1 
ATOM   49   O "O3'" . DG  A 1 3  ? 8.375   -14.338 -21.704 1.00 49.72 ? 104 DG  F "O3'" 1 
ATOM   50   C "C2'" . DG  A 1 3  ? 7.402   -12.587 -23.128 1.00 47.48 ? 104 DG  F "C2'" 1 
ATOM   51   C "C1'" . DG  A 1 3  ? 8.596   -11.667 -23.321 1.00 45.49 ? 104 DG  F "C1'" 1 
ATOM   52   N N9    . DG  A 1 3  ? 8.326   -10.426 -24.047 1.00 42.82 ? 104 DG  F N9    1 
ATOM   53   C C8    . DG  A 1 3  ? 7.560   -10.270 -25.178 1.00 40.95 ? 104 DG  F C8    1 
ATOM   54   N N7    . DG  A 1 3  ? 7.546   -9.041  -25.623 1.00 39.81 ? 104 DG  F N7    1 
ATOM   55   C C5    . DG  A 1 3  ? 8.335   -8.337  -24.721 1.00 41.29 ? 104 DG  F C5    1 
ATOM   56   C C6    . DG  A 1 3  ? 8.684   -6.959  -24.680 1.00 39.65 ? 104 DG  F C6    1 
ATOM   57   O O6    . DG  A 1 3  ? 8.347   -6.053  -25.451 1.00 41.82 ? 104 DG  F O6    1 
ATOM   58   N N1    . DG  A 1 3  ? 9.513   -6.675  -23.604 1.00 39.31 ? 104 DG  F N1    1 
ATOM   59   C C2    . DG  A 1 3  ? 9.951   -7.593  -22.680 1.00 38.54 ? 104 DG  F C2    1 
ATOM   60   N N2    . DG  A 1 3  ? 10.774  -7.133  -21.733 1.00 35.59 ? 104 DG  F N2    1 
ATOM   61   N N3    . DG  A 1 3  ? 9.615   -8.870  -22.694 1.00 40.76 ? 104 DG  F N3    1 
ATOM   62   C C4    . DG  A 1 3  ? 8.818   -9.174  -23.738 1.00 40.64 ? 104 DG  F C4    1 
ATOM   63   P P     . DT  A 1 4  ? 7.247   -14.267 -20.572 1.00 50.25 ? 105 DT  F P     1 
ATOM   64   O OP1   . DT  A 1 4  ? 7.806   -14.732 -19.276 1.00 50.35 ? 105 DT  F OP1   1 
ATOM   65   O OP2   . DT  A 1 4  ? 5.976   -14.846 -21.062 1.00 49.43 ? 105 DT  F OP2   1 
ATOM   66   O "O5'" . DT  A 1 4  ? 7.041   -12.699 -20.501 1.00 52.34 ? 105 DT  F "O5'" 1 
ATOM   67   C "C5'" . DT  A 1 4  ? 6.306   -12.127 -19.467 1.00 49.92 ? 105 DT  F "C5'" 1 
ATOM   68   C "C4'" . DT  A 1 4  ? 7.165   -11.127 -18.742 1.00 49.26 ? 105 DT  F "C4'" 1 
ATOM   69   O "O4'" . DT  A 1 4  ? 7.650   -10.115 -19.663 1.00 46.35 ? 105 DT  F "O4'" 1 
ATOM   70   C "C3'" . DT  A 1 4  ? 6.326   -10.394 -17.716 1.00 46.10 ? 105 DT  F "C3'" 1 
ATOM   71   O "O3'" . DT  A 1 4  ? 7.141   -10.059 -16.613 1.00 46.64 ? 105 DT  F "O3'" 1 
ATOM   72   C "C2'" . DT  A 1 4  ? 5.853   -9.178  -18.478 1.00 44.80 ? 105 DT  F "C2'" 1 
ATOM   73   C "C1'" . DT  A 1 4  ? 7.032   -8.868  -19.372 1.00 43.04 ? 105 DT  F "C1'" 1 
ATOM   74   N N1    . DT  A 1 4  ? 6.616   -8.241  -20.641 1.00 37.47 ? 105 DT  F N1    1 
ATOM   75   C C2    . DT  A 1 4  ? 7.004   -6.945  -20.863 1.00 33.24 ? 105 DT  F C2    1 
ATOM   76   O O2    . DT  A 1 4  ? 7.706   -6.325  -20.085 1.00 35.22 ? 105 DT  F O2    1 
ATOM   77   N N3    . DT  A 1 4  ? 6.540   -6.399  -22.033 1.00 33.77 ? 105 DT  F N3    1 
ATOM   78   C C4    . DT  A 1 4  ? 5.743   -7.013  -22.979 1.00 34.88 ? 105 DT  F C4    1 
ATOM   79   O O4    . DT  A 1 4  ? 5.389   -6.394  -23.967 1.00 36.31 ? 105 DT  F O4    1 
ATOM   80   C C5    . DT  A 1 4  ? 5.386   -8.384  -22.690 1.00 37.50 ? 105 DT  F C5    1 
ATOM   81   C C7    . DT  A 1 4  ? 4.521   -9.130  -23.659 1.00 37.40 ? 105 DT  F C7    1 
ATOM   82   C C6    . DT  A 1 4  ? 5.843   -8.926  -21.553 1.00 36.34 ? 105 DT  F C6    1 
ATOM   83   P P     . DA  A 1 5  ? 6.555   -10.186 -15.138 1.00 41.91 ? 106 DA  F P     1 
ATOM   84   O OP1   . DA  A 1 5  ? 7.410   -11.160 -14.411 1.00 45.04 ? 106 DA  F OP1   1 
ATOM   85   O OP2   . DA  A 1 5  ? 5.096   -10.404 -15.214 1.00 42.58 ? 106 DA  F OP2   1 
ATOM   86   O "O5'" . DA  A 1 5  ? 6.845   -8.737  -14.552 1.00 43.03 ? 106 DA  F "O5'" 1 
ATOM   87   C "C5'" . DA  A 1 5  ? 8.130   -8.146  -14.717 1.00 38.60 ? 106 DA  F "C5'" 1 
ATOM   88   C "C4'" . DA  A 1 5  ? 8.033   -6.646  -14.593 1.00 37.12 ? 106 DA  F "C4'" 1 
ATOM   89   O "O4'" . DA  A 1 5  ? 7.600   -6.029  -15.830 1.00 36.71 ? 106 DA  F "O4'" 1 
ATOM   90   C "C3'" . DA  A 1 5  ? 7.050   -6.186  -13.522 1.00 35.33 ? 106 DA  F "C3'" 1 
ATOM   91   O "O3'" . DA  A 1 5  ? 7.624   -5.084  -12.821 1.00 33.03 ? 106 DA  F "O3'" 1 
ATOM   92   C "C2'" . DA  A 1 5  ? 5.811   -5.805  -14.324 1.00 34.20 ? 106 DA  F "C2'" 1 
ATOM   93   C "C1'" . DA  A 1 5  ? 6.408   -5.279  -15.622 1.00 33.67 ? 106 DA  F "C1'" 1 
ATOM   94   N N9    . DA  A 1 5  ? 5.581   -5.450  -16.817 1.00 31.10 ? 106 DA  F N9    1 
ATOM   95   C C8    . DA  A 1 5  ? 4.979   -6.604  -17.240 1.00 26.61 ? 106 DA  F C8    1 
ATOM   96   N N7    . DA  A 1 5  ? 4.380   -6.494  -18.395 1.00 29.67 ? 106 DA  F N7    1 
ATOM   97   C C5    . DA  A 1 5  ? 4.580   -5.167  -18.751 1.00 26.95 ? 106 DA  F C5    1 
ATOM   98   C C6    . DA  A 1 5  ? 4.198   -4.427  -19.879 1.00 29.24 ? 106 DA  F C6    1 
ATOM   99   N N6    . DA  A 1 5  ? 3.528   -4.944  -20.909 1.00 28.58 ? 106 DA  F N6    1 
ATOM   100  N N1    . DA  A 1 5  ? 4.540   -3.120  -19.920 1.00 27.71 ? 106 DA  F N1    1 
ATOM   101  C C2    . DA  A 1 5  ? 5.233   -2.612  -18.899 1.00 27.17 ? 106 DA  F C2    1 
ATOM   102  N N3    . DA  A 1 5  ? 5.665   -3.214  -17.791 1.00 28.99 ? 106 DA  F N3    1 
ATOM   103  C C4    . DA  A 1 5  ? 5.297   -4.506  -17.779 1.00 28.19 ? 106 DA  F C4    1 
ATOM   104  P P     . DG  A 1 6  ? 6.860   -4.458  -11.561 1.00 30.77 ? 107 DG  F P     1 
ATOM   105  O OP1   . DG  A 1 6  ? 7.914   -3.817  -10.763 1.00 31.42 ? 107 DG  F OP1   1 
ATOM   106  O OP2   . DG  A 1 6  ? 5.986   -5.495  -10.951 1.00 32.66 ? 107 DG  F OP2   1 
ATOM   107  O "O5'" . DG  A 1 6  ? 5.960   -3.326  -12.219 1.00 30.92 ? 107 DG  F "O5'" 1 
ATOM   108  C "C5'" . DG  A 1 6  ? 6.584   -2.183  -12.798 1.00 28.29 ? 107 DG  F "C5'" 1 
ATOM   109  C "C4'" . DG  A 1 6  ? 5.548   -1.174  -13.229 1.00 28.53 ? 107 DG  F "C4'" 1 
ATOM   110  O "O4'" . DG  A 1 6  ? 4.982   -1.538  -14.507 1.00 25.38 ? 107 DG  F "O4'" 1 
ATOM   111  C "C3'" . DG  A 1 6  ? 4.376   -0.951  -12.272 1.00 26.37 ? 107 DG  F "C3'" 1 
ATOM   112  O "O3'" . DG  A 1 6  ? 4.259   0.456   -12.032 1.00 31.43 ? 107 DG  F "O3'" 1 
ATOM   113  C "C2'" . DG  A 1 6  ? 3.176   -1.505  -13.030 1.00 25.93 ? 107 DG  F "C2'" 1 
ATOM   114  C "C1'" . DG  A 1 6  ? 3.585   -1.372  -14.491 1.00 24.34 ? 107 DG  F "C1'" 1 
ATOM   115  N N9    . DG  A 1 6  ? 3.010   -2.361  -15.405 1.00 27.29 ? 107 DG  F N9    1 
ATOM   116  C C8    . DG  A 1 6  ? 2.879   -3.710  -15.188 1.00 27.38 ? 107 DG  F C8    1 
ATOM   117  N N7    . DG  A 1 6  ? 2.299   -4.336  -16.177 1.00 28.01 ? 107 DG  F N7    1 
ATOM   118  C C5    . DG  A 1 6  ? 2.038   -3.342  -17.115 1.00 27.18 ? 107 DG  F C5    1 
ATOM   119  C C6    . DG  A 1 6  ? 1.392   -3.417  -18.388 1.00 28.23 ? 107 DG  F C6    1 
ATOM   120  O O6    . DG  A 1 6  ? 0.899   -4.404  -18.947 1.00 25.55 ? 107 DG  F O6    1 
ATOM   121  N N1    . DG  A 1 6  ? 1.330   -2.168  -19.007 1.00 27.69 ? 107 DG  F N1    1 
ATOM   122  C C2    . DG  A 1 6  ? 1.801   -0.997  -18.458 1.00 30.16 ? 107 DG  F C2    1 
ATOM   123  N N2    . DG  A 1 6  ? 1.602   0.112   -19.172 1.00 27.49 ? 107 DG  F N2    1 
ATOM   124  N N3    . DG  A 1 6  ? 2.405   -0.918  -17.280 1.00 28.98 ? 107 DG  F N3    1 
ATOM   125  C C4    . DG  A 1 6  ? 2.482   -2.120  -16.666 1.00 26.89 ? 107 DG  F C4    1 
ATOM   126  P P     . DC  A 1 7  ? 3.152   1.022   -11.002 1.00 29.64 ? 108 DC  F P     1 
ATOM   127  O OP1   . DC  A 1 7  ? 3.754   2.289   -10.530 1.00 32.79 ? 108 DC  F OP1   1 
ATOM   128  O OP2   . DC  A 1 7  ? 2.704   0.006   -10.024 1.00 29.07 ? 108 DC  F OP2   1 
ATOM   129  O "O5'" . DC  A 1 7  ? 1.959   1.365   -11.980 1.00 29.65 ? 108 DC  F "O5'" 1 
ATOM   130  C "C5'" . DC  A 1 7  ? 2.223   2.216   -13.089 1.00 32.31 ? 108 DC  F "C5'" 1 
ATOM   131  C "C4'" . DC  A 1 7  ? 1.011   2.338   -13.975 1.00 30.67 ? 108 DC  F "C4'" 1 
ATOM   132  O "O4'" . DC  A 1 7  ? 0.853   1.158   -14.801 1.00 30.89 ? 108 DC  F "O4'" 1 
ATOM   133  C "C3'" . DC  A 1 7  ? -0.310  2.540   -13.240 1.00 32.18 ? 108 DC  F "C3'" 1 
ATOM   134  O "O3'" . DC  A 1 7  ? -0.857  3.806   -13.575 1.00 37.62 ? 108 DC  F "O3'" 1 
ATOM   135  C "C2'" . DC  A 1 7  ? -1.202  1.414   -13.748 1.00 30.01 ? 108 DC  F "C2'" 1 
ATOM   136  C "C1'" . DC  A 1 7  ? -0.520  0.938   -15.029 1.00 29.58 ? 108 DC  F "C1'" 1 
ATOM   137  N N1    . DC  A 1 7  ? -0.705  -0.499  -15.351 1.00 28.31 ? 108 DC  F N1    1 
ATOM   138  C C2    . DC  A 1 7  ? -1.246  -0.863  -16.609 1.00 26.55 ? 108 DC  F C2    1 
ATOM   139  O O2    . DC  A 1 7  ? -1.556  0.018   -17.417 1.00 26.99 ? 108 DC  F O2    1 
ATOM   140  N N3    . DC  A 1 7  ? -1.418  -2.174  -16.908 1.00 25.05 ? 108 DC  F N3    1 
ATOM   141  C C4    . DC  A 1 7  ? -1.077  -3.111  -16.025 1.00 27.78 ? 108 DC  F C4    1 
ATOM   142  N N4    . DC  A 1 7  ? -1.264  -4.389  -16.381 1.00 29.14 ? 108 DC  F N4    1 
ATOM   143  C C5    . DC  A 1 7  ? -0.522  -2.778  -14.740 1.00 25.00 ? 108 DC  F C5    1 
ATOM   144  C C6    . DC  A 1 7  ? -0.358  -1.470  -14.451 1.00 25.52 ? 108 DC  F C6    1 
ATOM   145  P P     . DA  A 1 8  ? -2.083  4.390   -12.723 1.00 39.52 ? 109 DA  F P     1 
ATOM   146  O OP1   . DA  A 1 8  ? -1.674  5.757   -12.319 1.00 37.64 ? 109 DA  F OP1   1 
ATOM   147  O OP2   . DA  A 1 8  ? -2.521  3.412   -11.697 1.00 34.87 ? 109 DA  F OP2   1 
ATOM   148  O "O5'" . DA  A 1 8  ? -3.241  4.474   -13.807 1.00 37.76 ? 109 DA  F "O5'" 1 
ATOM   149  C "C5'" . DA  A 1 8  ? -2.990  5.055   -15.076 1.00 38.09 ? 109 DA  F "C5'" 1 
ATOM   150  C "C4'" . DA  A 1 8  ? -4.149  4.788   -16.003 1.00 39.84 ? 109 DA  F "C4'" 1 
ATOM   151  O "O4'" . DA  A 1 8  ? -4.154  3.395   -16.390 1.00 35.67 ? 109 DA  F "O4'" 1 
ATOM   152  C "C3'" . DA  A 1 8  ? -5.520  5.067   -15.390 1.00 39.80 ? 109 DA  F "C3'" 1 
ATOM   153  O "O3'" . DA  A 1 8  ? -6.366  5.640   -16.387 1.00 45.51 ? 109 DA  F "O3'" 1 
ATOM   154  C "C2'" . DA  A 1 8  ? -6.003  3.687   -14.979 1.00 38.34 ? 109 DA  F "C2'" 1 
ATOM   155  C "C1'" . DA  A 1 8  ? -5.379  2.783   -16.035 1.00 35.31 ? 109 DA  F "C1'" 1 
ATOM   156  N N9    . DA  A 1 8  ? -5.061  1.437   -15.558 1.00 33.95 ? 109 DA  F N9    1 
ATOM   157  C C8    . DA  A 1 8  ? -4.531  1.104   -14.341 1.00 31.33 ? 109 DA  F C8    1 
ATOM   158  N N7    . DA  A 1 8  ? -4.297  -0.179  -14.197 1.00 31.89 ? 109 DA  F N7    1 
ATOM   159  C C5    . DA  A 1 8  ? -4.706  -0.732  -15.398 1.00 29.32 ? 109 DA  F C5    1 
ATOM   160  C C6    . DA  A 1 8  ? -4.700  -2.059  -15.885 1.00 29.48 ? 109 DA  F C6    1 
ATOM   161  N N6    . DA  A 1 8  ? -4.214  -3.104  -15.202 1.00 25.76 ? 109 DA  F N6    1 
ATOM   162  N N1    . DA  A 1 8  ? -5.207  -2.273  -17.117 1.00 30.39 ? 109 DA  F N1    1 
ATOM   163  C C2    . DA  A 1 8  ? -5.661  -1.220  -17.816 1.00 30.92 ? 109 DA  F C2    1 
ATOM   164  N N3    . DA  A 1 8  ? -5.695  0.070   -17.477 1.00 30.26 ? 109 DA  F N3    1 
ATOM   165  C C4    . DA  A 1 8  ? -5.200  0.250   -16.243 1.00 31.03 ? 109 DA  F C4    1 
ATOM   166  P P     . DC  A 1 9  ? -7.575  6.606   -15.955 1.00 45.59 ? 110 DC  F P     1 
ATOM   167  O OP1   . DC  A 1 9  ? -7.662  7.656   -17.002 1.00 49.43 ? 110 DC  F OP1   1 
ATOM   168  O OP2   . DC  A 1 9  ? -7.417  6.991   -14.534 1.00 49.30 ? 110 DC  F OP2   1 
ATOM   169  O "O5'" . DC  A 1 9  ? -8.835  5.660   -16.091 1.00 47.21 ? 110 DC  F "O5'" 1 
ATOM   170  C "C5'" . DC  A 1 9  ? -8.643  4.268   -16.197 1.00 46.02 ? 110 DC  F "C5'" 1 
ATOM   171  C "C4'" . DC  A 1 9  ? -9.292  3.740   -17.450 1.00 44.19 ? 110 DC  F "C4'" 1 
ATOM   172  O "O4'" . DC  A 1 9  ? -8.756  2.419   -17.663 1.00 40.21 ? 110 DC  F "O4'" 1 
ATOM   173  C "C3'" . DC  A 1 9  ? -10.800 3.577   -17.302 1.00 43.04 ? 110 DC  F "C3'" 1 
ATOM   174  O "O3'" . DC  A 1 9  ? -11.497 3.846   -18.516 1.00 43.06 ? 110 DC  F "O3'" 1 
ATOM   175  C "C2'" . DC  A 1 9  ? -10.968 2.136   -16.862 1.00 41.68 ? 110 DC  F "C2'" 1 
ATOM   176  C "C1'" . DC  A 1 9  ? -9.714  1.427   -17.363 1.00 39.55 ? 110 DC  F "C1'" 1 
ATOM   177  N N1    . DC  A 1 9  ? -9.122  0.553   -16.340 1.00 38.23 ? 110 DC  F N1    1 
ATOM   178  C C2    . DC  A 1 9  ? -9.006  -0.797  -16.610 1.00 36.24 ? 110 DC  F C2    1 
ATOM   179  O O2    . DC  A 1 9  ? -9.411  -1.212  -17.700 1.00 34.95 ? 110 DC  F O2    1 
ATOM   180  N N3    . DC  A 1 9  ? -8.462  -1.620  -15.679 1.00 31.75 ? 110 DC  F N3    1 
ATOM   181  C C4    . DC  A 1 9  ? -8.052  -1.124  -14.513 1.00 34.61 ? 110 DC  F C4    1 
ATOM   182  N N4    . DC  A 1 9  ? -7.514  -1.969  -13.625 1.00 30.86 ? 110 DC  F N4    1 
ATOM   183  C C5    . DC  A 1 9  ? -8.170  0.263   -14.205 1.00 33.26 ? 110 DC  F C5    1 
ATOM   184  C C6    . DC  A 1 9  ? -8.700  1.057   -15.141 1.00 36.75 ? 110 DC  F C6    1 
ATOM   185  P P     . DG  A 1 10 ? -13.063 4.206   -18.456 1.00 46.39 ? 111 DG  F P     1 
ATOM   186  O OP1   . DG  A 1 10 ? -13.364 5.067   -19.628 1.00 45.57 ? 111 DG  F OP1   1 
ATOM   187  O OP2   . DG  A 1 10 ? -13.387 4.684   -17.090 1.00 44.86 ? 111 DG  F OP2   1 
ATOM   188  O "O5'" . DG  A 1 10 ? -13.772 2.796   -18.646 1.00 43.51 ? 111 DG  F "O5'" 1 
ATOM   189  C "C5'" . DG  A 1 10 ? -13.542 2.032   -19.825 1.00 45.34 ? 111 DG  F "C5'" 1 
ATOM   190  C "C4'" . DG  A 1 10 ? -14.193 0.677   -19.702 1.00 44.41 ? 111 DG  F "C4'" 1 
ATOM   191  O "O4'" . DG  A 1 10 ? -13.471 -0.131  -18.738 1.00 44.41 ? 111 DG  F "O4'" 1 
ATOM   192  C "C3'" . DG  A 1 10 ? -15.648 0.696   -19.231 1.00 45.44 ? 111 DG  F "C3'" 1 
ATOM   193  O "O3'" . DG  A 1 10 ? -16.350 -0.332  -19.942 1.00 47.09 ? 111 DG  F "O3'" 1 
ATOM   194  C "C2'" . DG  A 1 10 ? -15.530 0.384   -17.742 1.00 43.72 ? 111 DG  F "C2'" 1 
ATOM   195  C "C1'" . DG  A 1 10 ? -14.354 -0.585  -17.721 1.00 40.64 ? 111 DG  F "C1'" 1 
ATOM   196  N N9    . DG  A 1 10 ? -13.586 -0.680  -16.479 1.00 39.04 ? 111 DG  F N9    1 
ATOM   197  C C8    . DG  A 1 10 ? -13.255 0.336   -15.614 1.00 38.18 ? 111 DG  F C8    1 
ATOM   198  N N7    . DG  A 1 10 ? -12.496 -0.059  -14.624 1.00 38.04 ? 111 DG  F N7    1 
ATOM   199  C C5    . DG  A 1 10 ? -12.327 -1.422  -14.841 1.00 37.24 ? 111 DG  F C5    1 
ATOM   200  C C6    . DG  A 1 10 ? -11.583 -2.398  -14.103 1.00 36.84 ? 111 DG  F C6    1 
ATOM   201  O O6    . DG  A 1 10 ? -10.886 -2.238  -13.081 1.00 35.69 ? 111 DG  F O6    1 
ATOM   202  N N1    . DG  A 1 10 ? -11.696 -3.663  -14.675 1.00 34.04 ? 111 DG  F N1    1 
ATOM   203  C C2    . DG  A 1 10 ? -12.413 -3.957  -15.809 1.00 34.61 ? 111 DG  F C2    1 
ATOM   204  N N2    . DG  A 1 10 ? -12.391 -5.242  -16.212 1.00 33.51 ? 111 DG  F N2    1 
ATOM   205  N N3    . DG  A 1 10 ? -13.099 -3.064  -16.502 1.00 35.35 ? 111 DG  F N3    1 
ATOM   206  C C4    . DG  A 1 10 ? -13.011 -1.826  -15.968 1.00 36.77 ? 111 DG  F C4    1 
ATOM   207  P P     . DT  A 1 11 ? -17.952 -0.410  -19.880 1.00 52.66 ? 112 DT  F P     1 
ATOM   208  O OP1   . DT  A 1 11 ? -18.434 -0.680  -21.259 1.00 52.69 ? 112 DT  F OP1   1 
ATOM   209  O OP2   . DT  A 1 11 ? -18.463 0.773   -19.140 1.00 52.50 ? 112 DT  F OP2   1 
ATOM   210  O "O5'" . DT  A 1 11 ? -18.216 -1.708  -18.995 1.00 50.77 ? 112 DT  F "O5'" 1 
ATOM   211  C "C5'" . DT  A 1 11 ? -17.310 -2.058  -17.961 1.00 50.34 ? 112 DT  F "C5'" 1 
ATOM   212  C "C4'" . DT  A 1 11 ? -17.368 -3.538  -17.672 1.00 50.87 ? 112 DT  F "C4'" 1 
ATOM   213  O "O4'" . DT  A 1 11 ? -16.276 -3.834  -16.768 1.00 48.14 ? 112 DT  F "O4'" 1 
ATOM   214  C "C3'" . DT  A 1 11 ? -18.644 -3.977  -16.958 1.00 50.88 ? 112 DT  F "C3'" 1 
ATOM   215  O "O3'" . DT  A 1 11 ? -19.013 -5.304  -17.339 1.00 55.32 ? 112 DT  F "O3'" 1 
ATOM   216  C "C2'" . DT  A 1 11 ? -18.261 -3.921  -15.493 1.00 49.89 ? 112 DT  F "C2'" 1 
ATOM   217  C "C1'" . DT  A 1 11 ? -16.768 -4.229  -15.498 1.00 46.20 ? 112 DT  F "C1'" 1 
ATOM   218  N N1    . DT  A 1 11 ? -16.031 -3.469  -14.471 1.00 42.12 ? 112 DT  F N1    1 
ATOM   219  C C2    . DT  A 1 11 ? -15.196 -4.152  -13.609 1.00 40.74 ? 112 DT  F C2    1 
ATOM   220  O O2    . DT  A 1 11 ? -14.988 -5.350  -13.689 1.00 39.38 ? 112 DT  F O2    1 
ATOM   221  N N3    . DT  A 1 11 ? -14.607 -3.372  -12.642 1.00 39.31 ? 112 DT  F N3    1 
ATOM   222  C C4    . DT  A 1 11 ? -14.752 -2.010  -12.464 1.00 39.74 ? 112 DT  F C4    1 
ATOM   223  O O4    . DT  A 1 11 ? -14.175 -1.450  -11.534 1.00 39.99 ? 112 DT  F O4    1 
ATOM   224  C C5    . DT  A 1 11 ? -15.610 -1.352  -13.428 1.00 41.54 ? 112 DT  F C5    1 
ATOM   225  C C7    . DT  A 1 11 ? -15.797 0.129   -13.341 1.00 41.84 ? 112 DT  F C7    1 
ATOM   226  C C6    . DT  A 1 11 ? -16.201 -2.105  -14.367 1.00 41.94 ? 112 DT  F C6    1 
ATOM   227  P P     . DG  A 1 12 ? -20.446 -5.890  -16.902 1.00 58.18 ? 113 DG  F P     1 
ATOM   228  O OP1   . DG  A 1 12 ? -21.018 -6.558  -18.098 1.00 59.19 ? 113 DG  F OP1   1 
ATOM   229  O OP2   . DG  A 1 12 ? -21.226 -4.827  -16.217 1.00 57.32 ? 113 DG  F OP2   1 
ATOM   230  O "O5'" . DG  A 1 12 ? -20.079 -7.013  -15.833 1.00 57.82 ? 113 DG  F "O5'" 1 
ATOM   231  C "C5'" . DG  A 1 12 ? -19.148 -8.042  -16.159 1.00 59.19 ? 113 DG  F "C5'" 1 
ATOM   232  C "C4'" . DG  A 1 12 ? -18.721 -8.787  -14.916 1.00 58.91 ? 113 DG  F "C4'" 1 
ATOM   233  O "O4'" . DG  A 1 12 ? -17.940 -7.934  -14.042 1.00 56.59 ? 113 DG  F "O4'" 1 
ATOM   234  C "C3'" . DG  A 1 12 ? -19.862 -9.330  -14.060 1.00 60.40 ? 113 DG  F "C3'" 1 
ATOM   235  O "O3'" . DG  A 1 12 ? -19.478 -10.615 -13.561 1.00 64.69 ? 113 DG  F "O3'" 1 
ATOM   236  C "C2'" . DG  A 1 12 ? -19.959 -8.318  -12.931 1.00 58.69 ? 113 DG  F "C2'" 1 
ATOM   237  C "C1'" . DG  A 1 12 ? -18.504 -7.937  -12.738 1.00 54.53 ? 113 DG  F "C1'" 1 
ATOM   238  N N9    . DG  A 1 12 ? -18.252 -6.627  -12.142 1.00 50.32 ? 113 DG  F N9    1 
ATOM   239  C C8    . DG  A 1 12 ? -18.773 -5.419  -12.536 1.00 48.41 ? 113 DG  F C8    1 
ATOM   240  N N7    . DG  A 1 12 ? -18.305 -4.411  -11.849 1.00 45.64 ? 113 DG  F N7    1 
ATOM   241  C C5    . DG  A 1 12 ? -17.432 -4.989  -10.937 1.00 45.27 ? 113 DG  F C5    1 
ATOM   242  C C6    . DG  A 1 12 ? -16.617 -4.394  -9.932  1.00 43.21 ? 113 DG  F C6    1 
ATOM   243  O O6    . DG  A 1 12 ? -16.486 -3.198  -9.652  1.00 41.88 ? 113 DG  F O6    1 
ATOM   244  N N1    . DG  A 1 12 ? -15.903 -5.349  -9.222  1.00 43.40 ? 113 DG  F N1    1 
ATOM   245  C C2    . DG  A 1 12 ? -15.953 -6.701  -9.449  1.00 45.41 ? 113 DG  F C2    1 
ATOM   246  N N2    . DG  A 1 12 ? -15.191 -7.462  -8.648  1.00 44.05 ? 113 DG  F N2    1 
ATOM   247  N N3    . DG  A 1 12 ? -16.695 -7.267  -10.390 1.00 46.27 ? 113 DG  F N3    1 
ATOM   248  C C4    . DG  A 1 12 ? -17.404 -6.358  -11.090 1.00 46.45 ? 113 DG  F C4    1 
ATOM   249  P P     . DC  A 1 13 ? -20.599 -11.645 -13.055 1.00 67.88 ? 114 DC  F P     1 
ATOM   250  O OP1   . DC  A 1 13 ? -20.406 -12.926 -13.784 1.00 67.68 ? 114 DC  F OP1   1 
ATOM   251  O OP2   . DC  A 1 13 ? -21.918 -10.962 -13.094 1.00 67.39 ? 114 DC  F OP2   1 
ATOM   252  O "O5'" . DC  A 1 13 ? -20.197 -11.868 -11.533 1.00 67.02 ? 114 DC  F "O5'" 1 
ATOM   253  C "C5'" . DC  A 1 13 ? -19.536 -10.829 -10.823 1.00 65.84 ? 114 DC  F "C5'" 1 
ATOM   254  C "C4'" . DC  A 1 13 ? -19.083 -11.314 -9.468  1.00 63.59 ? 114 DC  F "C4'" 1 
ATOM   255  O "O4'" . DC  A 1 13 ? -18.390 -10.216 -8.833  1.00 61.89 ? 114 DC  F "O4'" 1 
ATOM   256  C "C3'" . DC  A 1 13 ? -20.229 -11.692 -8.532  1.00 63.91 ? 114 DC  F "C3'" 1 
ATOM   257  O "O3'" . DC  A 1 13 ? -19.853 -12.791 -7.693  1.00 65.25 ? 114 DC  F "O3'" 1 
ATOM   258  C "C2'" . DC  A 1 13 ? -20.490 -10.417 -7.751  1.00 62.18 ? 114 DC  F "C2'" 1 
ATOM   259  C "C1'" . DC  A 1 13 ? -19.143 -9.699  -7.746  1.00 59.25 ? 114 DC  F "C1'" 1 
ATOM   260  N N1    . DC  A 1 13 ? -19.261 -8.244  -7.942  1.00 55.66 ? 114 DC  F N1    1 
ATOM   261  C C2    . DC  A 1 13 ? -18.483 -7.396  -7.154  1.00 53.30 ? 114 DC  F C2    1 
ATOM   262  O O2    . DC  A 1 13 ? -17.699 -7.894  -6.337  1.00 53.18 ? 114 DC  F O2    1 
ATOM   263  N N3    . DC  A 1 13 ? -18.605 -6.057  -7.301  1.00 50.85 ? 114 DC  F N3    1 
ATOM   264  C C4    . DC  A 1 13 ? -19.455 -5.559  -8.201  1.00 50.54 ? 114 DC  F C4    1 
ATOM   265  N N4    . DC  A 1 13 ? -19.545 -4.231  -8.305  1.00 46.91 ? 114 DC  F N4    1 
ATOM   266  C C5    . DC  A 1 13 ? -20.251 -6.401  -9.034  1.00 50.59 ? 114 DC  F C5    1 
ATOM   267  C C6    . DC  A 1 13 ? -20.123 -7.726  -8.871  1.00 54.09 ? 114 DC  F C6    1 
ATOM   268  P P     . DT  A 1 14 ? -20.837 -13.270 -6.515  1.00 66.94 ? 115 DT  F P     1 
ATOM   269  O OP1   . DT  A 1 14 ? -20.539 -14.701 -6.237  1.00 65.80 ? 115 DT  F OP1   1 
ATOM   270  O OP2   . DT  A 1 14 ? -22.229 -12.854 -6.829  1.00 65.31 ? 115 DT  F OP2   1 
ATOM   271  O "O5'" . DT  A 1 14 ? -20.334 -12.418 -5.273  1.00 66.20 ? 115 DT  F "O5'" 1 
ATOM   272  C "C5'" . DT  A 1 14 ? -18.958 -12.427 -4.914  1.00 65.84 ? 115 DT  F "C5'" 1 
ATOM   273  C "C4'" . DT  A 1 14 ? -18.765 -11.714 -3.600  1.00 65.41 ? 115 DT  F "C4'" 1 
ATOM   274  O "O4'" . DT  A 1 14 ? -18.797 -10.281 -3.798  1.00 64.33 ? 115 DT  F "O4'" 1 
ATOM   275  C "C3'" . DT  A 1 14 ? -19.852 -12.034 -2.581  1.00 65.33 ? 115 DT  F "C3'" 1 
ATOM   276  O "O3'" . DT  A 1 14 ? -19.263 -12.222 -1.302  1.00 66.34 ? 115 DT  F "O3'" 1 
ATOM   277  C "C2'" . DT  A 1 14 ? -20.749 -10.807 -2.611  1.00 65.07 ? 115 DT  F "C2'" 1 
ATOM   278  C "C1'" . DT  A 1 14 ? -19.783 -9.688  -2.970  1.00 63.94 ? 115 DT  F "C1'" 1 
ATOM   279  N N1    . DT  A 1 14 ? -20.381 -8.569  -3.728  1.00 62.67 ? 115 DT  F N1    1 
ATOM   280  C C2    . DT  A 1 14 ? -19.956 -7.287  -3.451  1.00 61.78 ? 115 DT  F C2    1 
ATOM   281  O O2    . DT  A 1 14 ? -19.125 -7.026  -2.600  1.00 60.44 ? 115 DT  F O2    1 
ATOM   282  N N3    . DT  A 1 14 ? -20.546 -6.313  -4.216  1.00 62.47 ? 115 DT  F N3    1 
ATOM   283  C C4    . DT  A 1 14 ? -21.493 -6.485  -5.208  1.00 62.05 ? 115 DT  F C4    1 
ATOM   284  O O4    . DT  A 1 14 ? -21.919 -5.512  -5.824  1.00 61.82 ? 115 DT  F O4    1 
ATOM   285  C C5    . DT  A 1 14 ? -21.901 -7.848  -5.439  1.00 62.06 ? 115 DT  F C5    1 
ATOM   286  C C7    . DT  A 1 14 ? -22.929 -8.128  -6.489  1.00 61.79 ? 115 DT  F C7    1 
ATOM   287  C C6    . DT  A 1 14 ? -21.334 -8.809  -4.697  1.00 62.31 ? 115 DT  F C6    1 
ATOM   288  P P     . DA  A 1 15 ? -20.170 -12.718 -0.080  1.00 67.73 ? 116 DA  F P     1 
ATOM   289  O OP1   . DA  A 1 15 ? -19.364 -13.712 0.677   1.00 66.53 ? 116 DA  F OP1   1 
ATOM   290  O OP2   . DA  A 1 15 ? -21.509 -13.096 -0.601  1.00 66.67 ? 116 DA  F OP2   1 
ATOM   291  O "O5'" . DA  A 1 15 ? -20.320 -11.398 0.795   1.00 65.08 ? 116 DA  F "O5'" 1 
ATOM   292  C "C5'" . DA  A 1 15 ? -19.166 -10.673 1.199   1.00 62.68 ? 116 DA  F "C5'" 1 
ATOM   293  C "C4'" . DA  A 1 15 ? -19.565 -9.393  1.893   1.00 61.66 ? 116 DA  F "C4'" 1 
ATOM   294  O "O4'" . DA  A 1 15 ? -20.001 -8.401  0.932   1.00 60.42 ? 116 DA  F "O4'" 1 
ATOM   295  C "C3'" . DA  A 1 15 ? -20.706 -9.543  2.900   1.00 61.95 ? 116 DA  F "C3'" 1 
ATOM   296  O "O3'" . DA  A 1 15 ? -20.413 -8.755  4.057   1.00 62.92 ? 116 DA  F "O3'" 1 
ATOM   297  C "C2'" . DA  A 1 15 ? -21.904 -8.982  2.152   1.00 60.29 ? 116 DA  F "C2'" 1 
ATOM   298  C "C1'" . DA  A 1 15 ? -21.258 -7.881  1.329   1.00 58.92 ? 116 DA  F "C1'" 1 
ATOM   299  N N9    . DA  A 1 15 ? -21.980 -7.471  0.121   1.00 56.37 ? 116 DA  F N9    1 
ATOM   300  C C8    . DA  A 1 15 ? -22.648 -8.257  -0.787  1.00 55.30 ? 116 DA  F C8    1 
ATOM   301  N N7    . DA  A 1 15 ? -23.186 -7.581  -1.775  1.00 54.95 ? 116 DA  F N7    1 
ATOM   302  C C5    . DA  A 1 15 ? -22.854 -6.261  -1.497  1.00 53.84 ? 116 DA  F C5    1 
ATOM   303  C C6    . DA  A 1 15 ? -23.129 -5.049  -2.168  1.00 54.05 ? 116 DA  F C6    1 
ATOM   304  N N6    . DA  A 1 15 ? -23.834 -4.968  -3.298  1.00 53.18 ? 116 DA  F N6    1 
ATOM   305  N N1    . DA  A 1 15 ? -22.646 -3.909  -1.627  1.00 52.27 ? 116 DA  F N1    1 
ATOM   306  C C2    . DA  A 1 15 ? -21.939 -3.989  -0.491  1.00 53.05 ? 116 DA  F C2    1 
ATOM   307  N N3    . DA  A 1 15 ? -21.618 -5.062  0.231   1.00 52.95 ? 116 DA  F N3    1 
ATOM   308  C C4    . DA  A 1 15 ? -22.112 -6.179  -0.333  1.00 54.15 ? 116 DA  F C4    1 
ATOM   309  P P     . DC  A 1 16 ? -21.245 -8.984  5.410   1.00 64.01 ? 117 DC  F P     1 
ATOM   310  O OP1   . DC  A 1 16 ? -20.272 -9.171  6.518   1.00 65.29 ? 117 DC  F OP1   1 
ATOM   311  O OP2   . DC  A 1 16 ? -22.293 -10.006 5.163   1.00 64.06 ? 117 DC  F OP2   1 
ATOM   312  O "O5'" . DC  A 1 16 ? -21.969 -7.586  5.613   1.00 63.91 ? 117 DC  F "O5'" 1 
ATOM   313  C "C5'" . DC  A 1 16 ? -22.297 -6.803  4.476   1.00 61.85 ? 117 DC  F "C5'" 1 
ATOM   314  C "C4'" . DC  A 1 16 ? -22.228 -5.333  4.806   1.00 59.19 ? 117 DC  F "C4'" 1 
ATOM   315  O "O4'" . DC  A 1 16 ? -22.428 -4.626  3.565   1.00 57.18 ? 117 DC  F "O4'" 1 
ATOM   316  C "C3'" . DC  A 1 16 ? -23.354 -4.888  5.733   1.00 58.17 ? 117 DC  F "C3'" 1 
ATOM   317  O "O3'" . DC  A 1 16 ? -22.967 -3.806  6.580   1.00 57.11 ? 117 DC  F "O3'" 1 
ATOM   318  C "C2'" . DC  A 1 16 ? -24.454 -4.469  4.782   1.00 57.20 ? 117 DC  F "C2'" 1 
ATOM   319  C "C1'" . DC  A 1 16 ? -23.715 -4.032  3.526   1.00 55.75 ? 117 DC  F "C1'" 1 
ATOM   320  N N1    . DC  A 1 16 ? -24.385 -4.510  2.313   1.00 52.73 ? 117 DC  F N1    1 
ATOM   321  C C2    . DC  A 1 16 ? -24.699 -3.595  1.314   1.00 51.16 ? 117 DC  F C2    1 
ATOM   322  O O2    . DC  A 1 16 ? -24.365 -2.413  1.466   1.00 52.58 ? 117 DC  F O2    1 
ATOM   323  N N3    . DC  A 1 16 ? -25.357 -4.018  0.213   1.00 50.02 ? 117 DC  F N3    1 
ATOM   324  C C4    . DC  A 1 16 ? -25.692 -5.305  0.091   1.00 49.98 ? 117 DC  F C4    1 
ATOM   325  N N4    . DC  A 1 16 ? -26.346 -5.683  -1.008  1.00 48.28 ? 117 DC  F N4    1 
ATOM   326  C C5    . DC  A 1 16 ? -25.370 -6.264  1.093   1.00 50.37 ? 117 DC  F C5    1 
ATOM   327  C C6    . DC  A 1 16 ? -24.718 -5.828  2.174   1.00 50.96 ? 117 DC  F C6    1 
ATOM   328  P P     . DT  A 1 17 ? -23.986 -3.299  7.712   1.00 57.07 ? 118 DT  F P     1 
ATOM   329  O OP1   . DT  A 1 17 ? -23.209 -2.557  8.731   1.00 56.90 ? 118 DT  F OP1   1 
ATOM   330  O OP2   . DT  A 1 17 ? -24.824 -4.456  8.115   1.00 58.20 ? 118 DT  F OP2   1 
ATOM   331  O "O5'" . DT  A 1 17 ? -24.918 -2.264  6.947   1.00 54.76 ? 118 DT  F "O5'" 1 
ATOM   332  C "C5'" . DT  A 1 17 ? -24.385 -1.032  6.486   1.00 48.52 ? 118 DT  F "C5'" 1 
ATOM   333  C "C4'" . DT  A 1 17 ? -25.474 -0.199  5.860   1.00 45.09 ? 118 DT  F "C4'" 1 
ATOM   334  O "O4'" . DT  A 1 17 ? -25.870 -0.795  4.602   1.00 42.16 ? 118 DT  F "O4'" 1 
ATOM   335  C "C3'" . DT  A 1 17 ? -26.744 -0.075  6.708   1.00 45.58 ? 118 DT  F "C3'" 1 
ATOM   336  O "O3'" . DT  A 1 17 ? -27.173 1.289   6.758   1.00 44.83 ? 118 DT  F "O3'" 1 
ATOM   337  C "C2'" . DT  A 1 17 ? -27.760 -0.940  5.977   1.00 43.36 ? 118 DT  F "C2'" 1 
ATOM   338  C "C1'" . DT  A 1 17 ? -27.283 -0.879  4.531   1.00 42.20 ? 118 DT  F "C1'" 1 
ATOM   339  N N1    . DT  A 1 17 ? -27.621 -2.065  3.720   1.00 41.12 ? 118 DT  F N1    1 
ATOM   340  C C2    . DT  A 1 17 ? -28.112 -1.873  2.443   1.00 41.06 ? 118 DT  F C2    1 
ATOM   341  O O2    . DT  A 1 17 ? -28.279 -0.774  1.948   1.00 38.19 ? 118 DT  F O2    1 
ATOM   342  N N3    . DT  A 1 17 ? -28.405 -3.031  1.761   1.00 40.54 ? 118 DT  F N3    1 
ATOM   343  C C4    . DT  A 1 17 ? -28.271 -4.325  2.217   1.00 40.08 ? 118 DT  F C4    1 
ATOM   344  O O4    . DT  A 1 17 ? -28.592 -5.260  1.492   1.00 39.28 ? 118 DT  F O4    1 
ATOM   345  C C5    . DT  A 1 17 ? -27.748 -4.456  3.561   1.00 42.44 ? 118 DT  F C5    1 
ATOM   346  C C7    . DT  A 1 17 ? -27.572 -5.825  4.142   1.00 42.59 ? 118 DT  F C7    1 
ATOM   347  C C6    . DT  A 1 17 ? -27.450 -3.335  4.234   1.00 42.00 ? 118 DT  F C6    1 
ATOM   348  P P     . DC  A 1 18 ? -28.121 1.786   7.965   1.00 47.24 ? 119 DC  F P     1 
ATOM   349  O OP1   . DC  A 1 18 ? -27.591 3.105   8.410   1.00 44.41 ? 119 DC  F OP1   1 
ATOM   350  O OP2   . DC  A 1 18 ? -28.281 0.686   8.951   1.00 43.14 ? 119 DC  F OP2   1 
ATOM   351  O "O5'" . DC  A 1 18 ? -29.519 2.026   7.248   1.00 43.03 ? 119 DC  F "O5'" 1 
ATOM   352  C "C5'" . DC  A 1 18 ? -29.639 3.000   6.217   1.00 43.06 ? 119 DC  F "C5'" 1 
ATOM   353  C "C4'" . DC  A 1 18 ? -30.961 2.858   5.501   1.00 42.66 ? 119 DC  F "C4'" 1 
ATOM   354  O "O4'" . DC  A 1 18 ? -30.936 1.702   4.632   1.00 41.20 ? 119 DC  F "O4'" 1 
ATOM   355  C "C3'" . DC  A 1 18 ? -32.191 2.694   6.396   1.00 44.12 ? 119 DC  F "C3'" 1 
ATOM   356  O "O3'" . DC  A 1 18 ? -33.312 3.356   5.793   1.00 47.25 ? 119 DC  F "O3'" 1 
ATOM   357  C "C2'" . DC  A 1 18 ? -32.478 1.205   6.310   1.00 42.96 ? 119 DC  F "C2'" 1 
ATOM   358  C "C1'" . DC  A 1 18 ? -32.079 0.905   4.873   1.00 41.36 ? 119 DC  F "C1'" 1 
ATOM   359  N N1    . DC  A 1 18 ? -31.735 -0.502  4.589   1.00 38.46 ? 119 DC  F N1    1 
ATOM   360  C C2    . DC  A 1 18 ? -31.838 -0.968  3.272   1.00 37.95 ? 119 DC  F C2    1 
ATOM   361  O O2    . DC  A 1 18 ? -32.141 -0.169  2.373   1.00 35.49 ? 119 DC  F O2    1 
ATOM   362  N N3    . DC  A 1 18 ? -31.600 -2.275  3.013   1.00 37.82 ? 119 DC  F N3    1 
ATOM   363  C C4    . DC  A 1 18 ? -31.260 -3.101  4.007   1.00 37.41 ? 119 DC  F C4    1 
ATOM   364  N N4    . DC  A 1 18 ? -31.065 -4.390  3.711   1.00 37.54 ? 119 DC  F N4    1 
ATOM   365  C C5    . DC  A 1 18 ? -31.110 -2.642  5.349   1.00 34.66 ? 119 DC  F C5    1 
ATOM   366  C C6    . DC  A 1 18 ? -31.349 -1.350  5.591   1.00 35.71 ? 119 DC  F C6    1 
ATOM   367  O "O5'" . DG  B 1 1  ? -36.325 -7.062  -4.997  1.00 44.84 ? 302 DG  G "O5'" 1 
ATOM   368  C "C5'" . DG  B 1 1  ? -37.363 -6.070  -4.819  1.00 44.64 ? 302 DG  G "C5'" 1 
ATOM   369  C "C4'" . DG  B 1 1  ? -36.966 -4.616  -4.963  1.00 41.29 ? 302 DG  G "C4'" 1 
ATOM   370  O "O4'" . DG  B 1 1  ? -36.368 -4.132  -3.739  1.00 37.44 ? 302 DG  G "O4'" 1 
ATOM   371  C "C3'" . DG  B 1 1  ? -35.960 -4.312  -6.071  1.00 41.68 ? 302 DG  G "C3'" 1 
ATOM   372  O "O3'" . DG  B 1 1  ? -36.257 -3.045  -6.660  1.00 41.70 ? 302 DG  G "O3'" 1 
ATOM   373  C "C2'" . DG  B 1 1  ? -34.631 -4.276  -5.334  1.00 39.45 ? 302 DG  G "C2'" 1 
ATOM   374  C "C1'" . DG  B 1 1  ? -35.013 -3.758  -3.952  1.00 36.55 ? 302 DG  G "C1'" 1 
ATOM   375  N N9    . DG  B 1 1  ? -34.238 -4.346  -2.865  1.00 35.22 ? 302 DG  G N9    1 
ATOM   376  C C8    . DG  B 1 1  ? -33.841 -5.658  -2.750  1.00 34.90 ? 302 DG  G C8    1 
ATOM   377  N N7    . DG  B 1 1  ? -33.202 -5.904  -1.637  1.00 33.73 ? 302 DG  G N7    1 
ATOM   378  C C5    . DG  B 1 1  ? -33.162 -4.683  -0.986  1.00 32.61 ? 302 DG  G C5    1 
ATOM   379  C C6    . DG  B 1 1  ? -32.609 -4.332  0.266   1.00 34.02 ? 302 DG  G C6    1 
ATOM   380  O O6    . DG  B 1 1  ? -32.021 -5.062  1.083   1.00 35.40 ? 302 DG  G O6    1 
ATOM   381  N N1    . DG  B 1 1  ? -32.789 -2.978  0.541   1.00 32.14 ? 302 DG  G N1    1 
ATOM   382  C C2    . DG  B 1 1  ? -33.424 -2.077  -0.282  1.00 32.43 ? 302 DG  G C2    1 
ATOM   383  N N2    . DG  B 1 1  ? -33.490 -0.805  0.155   1.00 31.44 ? 302 DG  G N2    1 
ATOM   384  N N3    . DG  B 1 1  ? -33.951 -2.394  -1.448  1.00 32.15 ? 302 DG  G N3    1 
ATOM   385  C C4    . DG  B 1 1  ? -33.786 -3.705  -1.737  1.00 34.07 ? 302 DG  G C4    1 
ATOM   386  P P     . DA  B 1 2  ? -35.405 -2.530  -7.922  1.00 44.90 ? 303 DA  G P     1 
ATOM   387  O OP1   . DA  B 1 2  ? -36.326 -1.791  -8.820  1.00 43.20 ? 303 DA  G OP1   1 
ATOM   388  O OP2   . DA  B 1 2  ? -34.596 -3.653  -8.462  1.00 45.50 ? 303 DA  G OP2   1 
ATOM   389  O "O5'" . DA  B 1 2  ? -34.401 -1.477  -7.288  1.00 42.76 ? 303 DA  G "O5'" 1 
ATOM   390  C "C5'" . DA  B 1 2  ? -34.900 -0.322  -6.639  1.00 44.90 ? 303 DA  G "C5'" 1 
ATOM   391  C "C4'" . DA  B 1 2  ? -33.763 0.491   -6.075  1.00 45.12 ? 303 DA  G "C4'" 1 
ATOM   392  O "O4'" . DA  B 1 2  ? -33.202 -0.167  -4.914  1.00 45.44 ? 303 DA  G "O4'" 1 
ATOM   393  C "C3'" . DA  B 1 2  ? -32.605 0.722   -7.043  1.00 47.38 ? 303 DA  G "C3'" 1 
ATOM   394  O "O3'" . DA  B 1 2  ? -32.217 2.087   -6.936  1.00 47.33 ? 303 DA  G "O3'" 1 
ATOM   395  C "C2'" . DA  B 1 2  ? -31.520 -0.223  -6.544  1.00 45.10 ? 303 DA  G "C2'" 1 
ATOM   396  C "C1'" . DA  B 1 2  ? -31.800 -0.289  -5.051  1.00 43.91 ? 303 DA  G "C1'" 1 
ATOM   397  N N9    . DA  B 1 2  ? -31.405 -1.532  -4.391  1.00 43.61 ? 303 DA  G N9    1 
ATOM   398  C C8    . DA  B 1 2  ? -31.529 -2.828  -4.837  1.00 41.88 ? 303 DA  G C8    1 
ATOM   399  N N7    . DA  B 1 2  ? -31.087 -3.724  -3.986  1.00 40.14 ? 303 DA  G N7    1 
ATOM   400  C C5    . DA  B 1 2  ? -30.636 -2.968  -2.913  1.00 39.54 ? 303 DA  G C5    1 
ATOM   401  C C6    . DA  B 1 2  ? -30.047 -3.323  -1.689  1.00 40.17 ? 303 DA  G C6    1 
ATOM   402  N N6    . DA  B 1 2  ? -29.793 -4.584  -1.326  1.00 37.17 ? 303 DA  G N6    1 
ATOM   403  N N1    . DA  B 1 2  ? -29.722 -2.327  -0.837  1.00 39.46 ? 303 DA  G N1    1 
ATOM   404  C C2    . DA  B 1 2  ? -29.976 -1.062  -1.200  1.00 42.54 ? 303 DA  G C2    1 
ATOM   405  N N3    . DA  B 1 2  ? -30.518 -0.602  -2.326  1.00 42.94 ? 303 DA  G N3    1 
ATOM   406  C C4    . DA  B 1 2  ? -30.826 -1.618  -3.149  1.00 40.97 ? 303 DA  G C4    1 
ATOM   407  P P     . DG  B 1 3  ? -30.946 2.620   -7.737  1.00 49.35 ? 304 DG  G P     1 
ATOM   408  O OP1   . DG  B 1 3  ? -31.330 3.951   -8.278  1.00 47.25 ? 304 DG  G OP1   1 
ATOM   409  O OP2   . DG  B 1 3  ? -30.455 1.562   -8.657  1.00 47.24 ? 304 DG  G OP2   1 
ATOM   410  O "O5'" . DG  B 1 3  ? -29.892 2.855   -6.571  1.00 48.60 ? 304 DG  G "O5'" 1 
ATOM   411  C "C5'" . DG  B 1 3  ? -30.262 3.641   -5.443  1.00 48.58 ? 304 DG  G "C5'" 1 
ATOM   412  C "C4'" . DG  B 1 3  ? -29.086 3.826   -4.517  1.00 47.80 ? 304 DG  G "C4'" 1 
ATOM   413  O "O4'" . DG  B 1 3  ? -28.851 2.620   -3.753  1.00 46.58 ? 304 DG  G "O4'" 1 
ATOM   414  C "C3'" . DG  B 1 3  ? -27.772 4.156   -5.220  1.00 49.40 ? 304 DG  G "C3'" 1 
ATOM   415  O "O3'" . DG  B 1 3  ? -27.085 5.166   -4.490  1.00 51.96 ? 304 DG  G "O3'" 1 
ATOM   416  C "C2'" . DG  B 1 3  ? -27.006 2.845   -5.178  1.00 46.49 ? 304 DG  G "C2'" 1 
ATOM   417  C "C1'" . DG  B 1 3  ? -27.496 2.218   -3.884  1.00 43.84 ? 304 DG  G "C1'" 1 
ATOM   418  N N9    . DG  B 1 3  ? -27.479 0.760   -3.887  1.00 40.53 ? 304 DG  G N9    1 
ATOM   419  C C8    . DG  B 1 3  ? -27.974 -0.067  -4.861  1.00 37.96 ? 304 DG  G C8    1 
ATOM   420  N N7    . DG  B 1 3  ? -27.838 -1.332  -4.578  1.00 37.72 ? 304 DG  G N7    1 
ATOM   421  C C5    . DG  B 1 3  ? -27.203 -1.341  -3.346  1.00 38.14 ? 304 DG  G C5    1 
ATOM   422  C C6    . DG  B 1 3  ? -26.782 -2.424  -2.543  1.00 37.60 ? 304 DG  G C6    1 
ATOM   423  O O6    . DG  B 1 3  ? -26.879 -3.630  -2.772  1.00 38.39 ? 304 DG  G O6    1 
ATOM   424  N N1    . DG  B 1 3  ? -26.192 -1.987  -1.363  1.00 35.85 ? 304 DG  G N1    1 
ATOM   425  C C2    . DG  B 1 3  ? -26.024 -0.672  -1.009  1.00 38.08 ? 304 DG  G C2    1 
ATOM   426  N N2    . DG  B 1 3  ? -25.460 -0.444  0.183   1.00 37.01 ? 304 DG  G N2    1 
ATOM   427  N N3    . DG  B 1 3  ? -26.392 0.350   -1.765  1.00 37.86 ? 304 DG  G N3    1 
ATOM   428  C C4    . DG  B 1 3  ? -26.975 -0.055  -2.906  1.00 38.03 ? 304 DG  G C4    1 
ATOM   429  P P     . DT  B 1 4  ? -25.601 5.586   -4.922  1.00 55.46 ? 305 DT  G P     1 
ATOM   430  O OP1   . DT  B 1 4  ? -25.460 7.012   -4.531  1.00 55.33 ? 305 DT  G OP1   1 
ATOM   431  O OP2   . DT  B 1 4  ? -25.366 5.177   -6.328  1.00 51.99 ? 305 DT  G OP2   1 
ATOM   432  O "O5'" . DT  B 1 4  ? -24.688 4.705   -3.961  1.00 54.18 ? 305 DT  G "O5'" 1 
ATOM   433  C "C5'" . DT  B 1 4  ? -24.884 4.761   -2.553  1.00 54.86 ? 305 DT  G "C5'" 1 
ATOM   434  C "C4'" . DT  B 1 4  ? -23.700 4.166   -1.832  1.00 55.56 ? 305 DT  G "C4'" 1 
ATOM   435  O "O4'" . DT  B 1 4  ? -23.818 2.726   -1.769  1.00 54.44 ? 305 DT  G "O4'" 1 
ATOM   436  C "C3'" . DT  B 1 4  ? -22.344 4.471   -2.468  1.00 56.23 ? 305 DT  G "C3'" 1 
ATOM   437  O "O3'" . DT  B 1 4  ? -21.414 4.833   -1.443  1.00 59.50 ? 305 DT  G "O3'" 1 
ATOM   438  C "C2'" . DT  B 1 4  ? -21.970 3.167   -3.158  1.00 54.10 ? 305 DT  G "C2'" 1 
ATOM   439  C "C1'" . DT  B 1 4  ? -22.657 2.107   -2.303  1.00 51.65 ? 305 DT  G "C1'" 1 
ATOM   440  N N1    . DT  B 1 4  ? -23.102 0.912   -3.046  1.00 49.08 ? 305 DT  G N1    1 
ATOM   441  C C2    . DT  B 1 4  ? -22.893 -0.332  -2.486  1.00 45.97 ? 305 DT  G C2    1 
ATOM   442  O O2    . DT  B 1 4  ? -22.334 -0.499  -1.417  1.00 46.13 ? 305 DT  G O2    1 
ATOM   443  N N3    . DT  B 1 4  ? -23.356 -1.379  -3.236  1.00 44.67 ? 305 DT  G N3    1 
ATOM   444  C C4    . DT  B 1 4  ? -23.970 -1.318  -4.469  1.00 44.02 ? 305 DT  G C4    1 
ATOM   445  O O4    . DT  B 1 4  ? -24.309 -2.353  -5.033  1.00 46.39 ? 305 DT  G O4    1 
ATOM   446  C C5    . DT  B 1 4  ? -24.151 0.014   -5.002  1.00 46.06 ? 305 DT  G C5    1 
ATOM   447  C C7    . DT  B 1 4  ? -24.803 0.183   -6.338  1.00 44.01 ? 305 DT  G C7    1 
ATOM   448  C C6    . DT  B 1 4  ? -23.718 1.047   -4.269  1.00 46.58 ? 305 DT  G C6    1 
ATOM   449  P P     . DA  B 1 5  ? -19.868 5.075   -1.807  1.00 62.28 ? 306 DA  G P     1 
ATOM   450  O OP1   . DA  B 1 5  ? -19.396 6.203   -0.965  1.00 61.57 ? 306 DA  G OP1   1 
ATOM   451  O OP2   . DA  B 1 5  ? -19.681 5.128   -3.278  1.00 59.68 ? 306 DA  G OP2   1 
ATOM   452  O "O5'" . DA  B 1 5  ? -19.193 3.747   -1.259  1.00 59.70 ? 306 DA  G "O5'" 1 
ATOM   453  C "C5'" . DA  B 1 5  ? -19.483 3.296   0.059   1.00 56.94 ? 306 DA  G "C5'" 1 
ATOM   454  C "C4'" . DA  B 1 5  ? -18.550 2.172   0.430   1.00 54.50 ? 306 DA  G "C4'" 1 
ATOM   455  O "O4'" . DA  B 1 5  ? -18.994 0.942   -0.183  1.00 53.30 ? 306 DA  G "O4'" 1 
ATOM   456  C "C3'" . DA  B 1 5  ? -17.131 2.414   -0.066  1.00 53.22 ? 306 DA  G "C3'" 1 
ATOM   457  O "O3'" . DA  B 1 5  ? -16.192 1.981   0.910   1.00 51.80 ? 306 DA  G "O3'" 1 
ATOM   458  C "C2'" . DA  B 1 5  ? -17.054 1.599   -1.345  1.00 52.60 ? 306 DA  G "C2'" 1 
ATOM   459  C "C1'" . DA  B 1 5  ? -18.023 0.453   -1.094  1.00 50.81 ? 306 DA  G "C1'" 1 
ATOM   460  N N9    . DA  B 1 5  ? -18.740 0.020   -2.290  1.00 48.11 ? 306 DA  G N9    1 
ATOM   461  C C8    . DA  B 1 5  ? -19.229 0.811   -3.300  1.00 47.16 ? 306 DA  G C8    1 
ATOM   462  N N7    . DA  B 1 5  ? -19.871 0.146   -4.227  1.00 46.43 ? 306 DA  G N7    1 
ATOM   463  C C5    . DA  B 1 5  ? -19.791 -1.174  -3.807  1.00 44.36 ? 306 DA  G C5    1 
ATOM   464  C C6    . DA  B 1 5  ? -20.283 -2.367  -4.351  1.00 43.30 ? 306 DA  G C6    1 
ATOM   465  N N6    . DA  B 1 5  ? -21.009 -2.429  -5.469  1.00 42.82 ? 306 DA  G N6    1 
ATOM   466  N N1    . DA  B 1 5  ? -20.011 -3.513  -3.694  1.00 44.01 ? 306 DA  G N1    1 
ATOM   467  C C2    . DA  B 1 5  ? -19.313 -3.447  -2.556  1.00 41.67 ? 306 DA  G C2    1 
ATOM   468  N N3    . DA  B 1 5  ? -18.812 -2.387  -1.936  1.00 43.61 ? 306 DA  G N3    1 
ATOM   469  C C4    . DA  B 1 5  ? -19.086 -1.267  -2.622  1.00 45.24 ? 306 DA  G C4    1 
ATOM   470  P P     . DG  B 1 6  ? -14.636 2.298   0.706   1.00 50.58 ? 307 DG  G P     1 
ATOM   471  O OP1   . DG  B 1 6  ? -14.073 2.609   2.042   1.00 51.38 ? 307 DG  G OP1   1 
ATOM   472  O OP2   . DG  B 1 6  ? -14.457 3.262   -0.406  1.00 51.80 ? 307 DG  G OP2   1 
ATOM   473  O "O5'" . DG  B 1 6  ? -14.075 0.893   0.215   1.00 49.05 ? 307 DG  G "O5'" 1 
ATOM   474  C "C5'" . DG  B 1 6  ? -14.432 -0.296  0.910   1.00 42.83 ? 307 DG  G "C5'" 1 
ATOM   475  C "C4'" . DG  B 1 6  ? -13.940 -1.510  0.160   1.00 43.04 ? 307 DG  G "C4'" 1 
ATOM   476  O "O4'" . DG  B 1 6  ? -14.866 -1.916  -0.882  1.00 40.25 ? 307 DG  G "O4'" 1 
ATOM   477  C "C3'" . DG  B 1 6  ? -12.569 -1.347  -0.503  1.00 41.03 ? 307 DG  G "C3'" 1 
ATOM   478  O "O3'" . DG  B 1 6  ? -11.784 -2.488  -0.165  1.00 43.12 ? 307 DG  G "O3'" 1 
ATOM   479  C "C2'" . DG  B 1 6  ? -12.901 -1.303  -1.991  1.00 40.25 ? 307 DG  G "C2'" 1 
ATOM   480  C "C1'" . DG  B 1 6  ? -14.147 -2.177  -2.076  1.00 39.95 ? 307 DG  G "C1'" 1 
ATOM   481  N N9    . DG  B 1 6  ? -15.038 -1.914  -3.206  1.00 36.94 ? 307 DG  G N9    1 
ATOM   482  C C8    . DG  B 1 6  ? -15.355 -0.691  -3.751  1.00 36.28 ? 307 DG  G C8    1 
ATOM   483  N N7    . DG  B 1 6  ? -16.187 -0.778  -4.758  1.00 36.73 ? 307 DG  G N7    1 
ATOM   484  C C5    . DG  B 1 6  ? -16.436 -2.139  -4.883  1.00 35.85 ? 307 DG  G C5    1 
ATOM   485  C C6    . DG  B 1 6  ? -17.263 -2.841  -5.803  1.00 36.71 ? 307 DG  G C6    1 
ATOM   486  O O6    . DG  B 1 6  ? -17.964 -2.379  -6.712  1.00 35.22 ? 307 DG  G O6    1 
ATOM   487  N N1    . DG  B 1 6  ? -17.221 -4.218  -5.584  1.00 35.11 ? 307 DG  G N1    1 
ATOM   488  C C2    . DG  B 1 6  ? -16.480 -4.839  -4.604  1.00 37.26 ? 307 DG  G C2    1 
ATOM   489  N N2    . DG  B 1 6  ? -16.557 -6.181  -4.553  1.00 34.06 ? 307 DG  G N2    1 
ATOM   490  N N3    . DG  B 1 6  ? -15.712 -4.192  -3.736  1.00 35.45 ? 307 DG  G N3    1 
ATOM   491  C C4    . DG  B 1 6  ? -15.736 -2.856  -3.935  1.00 36.43 ? 307 DG  G C4    1 
ATOM   492  P P     . DC  B 1 7  ? -10.214 -2.537  -0.515  1.00 41.46 ? 308 DC  G P     1 
ATOM   493  O OP1   . DC  B 1 7  ? -9.527  -3.063  0.688   1.00 44.98 ? 308 DC  G OP1   1 
ATOM   494  O OP2   . DC  B 1 7  ? -9.740  -1.296  -1.151  1.00 41.51 ? 308 DC  G OP2   1 
ATOM   495  O "O5'" . DC  B 1 7  ? -10.162 -3.688  -1.600  1.00 43.57 ? 308 DC  G "O5'" 1 
ATOM   496  C "C5'" . DC  B 1 7  ? -11.296 -3.932  -2.398  1.00 44.85 ? 308 DC  G "C5'" 1 
ATOM   497  C "C4'" . DC  B 1 7  ? -11.421 -5.401  -2.702  1.00 43.60 ? 308 DC  G "C4'" 1 
ATOM   498  O "O4'" . DC  B 1 7  ? -12.557 -5.525  -3.577  1.00 42.95 ? 308 DC  G "O4'" 1 
ATOM   499  C "C3'" . DC  B 1 7  ? -10.232 -5.945  -3.487  1.00 42.42 ? 308 DC  G "C3'" 1 
ATOM   500  O "O3'" . DC  B 1 7  ? -10.079 -7.346  -3.217  1.00 44.05 ? 308 DC  G "O3'" 1 
ATOM   501  C "C2'" . DC  B 1 7  ? -10.608 -5.629  -4.924  1.00 41.06 ? 308 DC  G "C2'" 1 
ATOM   502  C "C1'" . DC  B 1 7  ? -12.138 -5.646  -4.926  1.00 42.76 ? 308 DC  G "C1'" 1 
ATOM   503  N N1    . DC  B 1 7  ? -12.784 -4.551  -5.680  1.00 41.25 ? 308 DC  G N1    1 
ATOM   504  C C2    . DC  B 1 7  ? -13.755 -4.876  -6.612  1.00 39.24 ? 308 DC  G C2    1 
ATOM   505  O O2    . DC  B 1 7  ? -14.036 -6.067  -6.775  1.00 41.56 ? 308 DC  G O2    1 
ATOM   506  N N3    . DC  B 1 7  ? -14.371 -3.889  -7.309  1.00 38.99 ? 308 DC  G N3    1 
ATOM   507  C C4    . DC  B 1 7  ? -14.053 -2.614  -7.080  1.00 40.24 ? 308 DC  G C4    1 
ATOM   508  N N4    . DC  B 1 7  ? -14.707 -1.674  -7.766  1.00 34.50 ? 308 DC  G N4    1 
ATOM   509  C C5    . DC  B 1 7  ? -13.054 -2.247  -6.129  1.00 39.27 ? 308 DC  G C5    1 
ATOM   510  C C6    . DC  B 1 7  ? -12.448 -3.241  -5.461  1.00 41.44 ? 308 DC  G C6    1 
ATOM   511  P P     . DA  B 1 8  ? -8.703  -8.100  -3.601  1.00 46.13 ? 309 DA  G P     1 
ATOM   512  O OP1   . DA  B 1 8  ? -8.606  -9.289  -2.706  1.00 44.30 ? 309 DA  G OP1   1 
ATOM   513  O OP2   . DA  B 1 8  ? -7.585  -7.130  -3.662  1.00 41.81 ? 309 DA  G OP2   1 
ATOM   514  O "O5'" . DA  B 1 8  ? -8.980  -8.634  -5.069  1.00 42.40 ? 309 DA  G "O5'" 1 
ATOM   515  C "C5'" . DA  B 1 8  ? -10.020 -9.574  -5.291  1.00 42.51 ? 309 DA  G "C5'" 1 
ATOM   516  C "C4'" . DA  B 1 8  ? -10.184 -9.825  -6.767  1.00 41.95 ? 309 DA  G "C4'" 1 
ATOM   517  O "O4'" . DA  B 1 8  ? -10.916 -8.753  -7.406  1.00 41.01 ? 309 DA  G "O4'" 1 
ATOM   518  C "C3'" . DA  B 1 8  ? -8.868  -9.953  -7.528  1.00 41.23 ? 309 DA  G "C3'" 1 
ATOM   519  O "O3'" . DA  B 1 8  ? -9.076  -10.906 -8.547  1.00 43.12 ? 309 DA  G "O3'" 1 
ATOM   520  C "C2'" . DA  B 1 8  ? -8.713  -8.588  -8.170  1.00 39.72 ? 309 DA  G "C2'" 1 
ATOM   521  C "C1'" . DA  B 1 8  ? -10.154 -8.248  -8.492  1.00 39.30 ? 309 DA  G "C1'" 1 
ATOM   522  N N9    . DA  B 1 8  ? -10.430 -6.819  -8.608  1.00 36.50 ? 309 DA  G N9    1 
ATOM   523  C C8    . DA  B 1 8  ? -9.864  -5.780  -7.919  1.00 34.84 ? 309 DA  G C8    1 
ATOM   524  N N7    . DA  B 1 8  ? -10.338 -4.605  -8.253  1.00 35.98 ? 309 DA  G N7    1 
ATOM   525  C C5    . DA  B 1 8  ? -11.277 -4.893  -9.236  1.00 34.91 ? 309 DA  G C5    1 
ATOM   526  C C6    . DA  B 1 8  ? -12.125 -4.078  -10.006 1.00 34.78 ? 309 DA  G C6    1 
ATOM   527  N N6    . DA  B 1 8  ? -12.169 -2.753  -9.905  1.00 32.67 ? 309 DA  G N6    1 
ATOM   528  N N1    . DA  B 1 8  ? -12.934 -4.685  -10.902 1.00 36.59 ? 309 DA  G N1    1 
ATOM   529  C C2    . DA  B 1 8  ? -12.886 -6.014  -11.011 1.00 35.80 ? 309 DA  G C2    1 
ATOM   530  N N3    . DA  B 1 8  ? -12.132 -6.885  -10.345 1.00 37.57 ? 309 DA  G N3    1 
ATOM   531  C C4    . DA  B 1 8  ? -11.341 -6.251  -9.464  1.00 35.98 ? 309 DA  G C4    1 
ATOM   532  P P     . DC  B 1 9  ? -7.834  -11.653 -9.221  1.00 42.22 ? 310 DC  G P     1 
ATOM   533  O OP1   . DC  B 1 9  ? -7.715  -12.958 -8.519  1.00 43.06 ? 310 DC  G OP1   1 
ATOM   534  O OP2   . DC  B 1 9  ? -6.657  -10.758 -9.325  1.00 39.94 ? 310 DC  G OP2   1 
ATOM   535  O "O5'" . DC  B 1 9  ? -8.421  -11.937 -10.661 1.00 41.70 ? 310 DC  G "O5'" 1 
ATOM   536  C "C5'" . DC  B 1 9  ? -9.802  -12.261 -10.790 1.00 43.65 ? 310 DC  G "C5'" 1 
ATOM   537  C "C4'" . DC  B 1 9  ? -10.343 -11.727 -12.091 1.00 42.31 ? 310 DC  G "C4'" 1 
ATOM   538  O "O4'" . DC  B 1 9  ? -10.651 -10.313 -11.991 1.00 41.09 ? 310 DC  G "O4'" 1 
ATOM   539  C "C3'" . DC  B 1 9  ? -9.351  -11.881 -13.240 1.00 41.03 ? 310 DC  G "C3'" 1 
ATOM   540  O "O3'" . DC  B 1 9  ? -9.950  -12.566 -14.336 1.00 40.94 ? 310 DC  G "O3'" 1 
ATOM   541  C "C2'" . DC  B 1 9  ? -8.966  -10.457 -13.601 1.00 40.03 ? 310 DC  G "C2'" 1 
ATOM   542  C "C1'" . DC  B 1 9  ? -10.163 -9.640  -13.142 1.00 39.00 ? 310 DC  G "C1'" 1 
ATOM   543  N N1    . DC  B 1 9  ? -9.850  -8.240  -12.762 1.00 35.52 ? 310 DC  G N1    1 
ATOM   544  C C2    . DC  B 1 9  ? -10.552 -7.196  -13.388 1.00 33.40 ? 310 DC  G C2    1 
ATOM   545  O O2    . DC  B 1 9  ? -11.393 -7.468  -14.258 1.00 33.29 ? 310 DC  G O2    1 
ATOM   546  N N3    . DC  B 1 9  ? -10.294 -5.920  -13.038 1.00 30.32 ? 310 DC  G N3    1 
ATOM   547  C C4    . DC  B 1 9  ? -9.372  -5.651  -12.117 1.00 31.68 ? 310 DC  G C4    1 
ATOM   548  N N4    . DC  B 1 9  ? -9.159  -4.370  -11.817 1.00 29.72 ? 310 DC  G N4    1 
ATOM   549  C C5    . DC  B 1 9  ? -8.628  -6.686  -11.468 1.00 30.61 ? 310 DC  G C5    1 
ATOM   550  C C6    . DC  B 1 9  ? -8.901  -7.957  -11.817 1.00 33.55 ? 310 DC  G C6    1 
ATOM   551  P P     . DG  B 1 10 ? -9.010  -13.203 -15.471 1.00 38.77 ? 311 DG  G P     1 
ATOM   552  O OP1   . DG  B 1 10 ? -9.541  -14.551 -15.792 1.00 42.19 ? 311 DG  G OP1   1 
ATOM   553  O OP2   . DG  B 1 10 ? -7.595  -13.051 -15.065 1.00 39.97 ? 311 DG  G OP2   1 
ATOM   554  O "O5'" . DG  B 1 10 ? -9.322  -12.270 -16.716 1.00 39.40 ? 311 DG  G "O5'" 1 
ATOM   555  C "C5'" . DG  B 1 10 ? -10.670 -12.071 -17.124 1.00 36.07 ? 311 DG  G "C5'" 1 
ATOM   556  C "C4'" . DG  B 1 10 ? -10.744 -11.015 -18.201 1.00 38.74 ? 311 DG  G "C4'" 1 
ATOM   557  O "O4'" . DG  B 1 10 ? -10.475 -9.710  -17.634 1.00 35.50 ? 311 DG  G "O4'" 1 
ATOM   558  C "C3'" . DG  B 1 10 ? -9.751  -11.194 -19.350 1.00 38.67 ? 311 DG  G "C3'" 1 
ATOM   559  O "O3'" . DG  B 1 10 ? -10.406 -10.869 -20.577 1.00 38.82 ? 311 DG  G "O3'" 1 
ATOM   560  C "C2'" . DG  B 1 10 ? -8.648  -10.200 -19.023 1.00 36.57 ? 311 DG  G "C2'" 1 
ATOM   561  C "C1'" . DG  B 1 10 ? -9.409  -9.084  -18.322 1.00 34.19 ? 311 DG  G "C1'" 1 
ATOM   562  N N9    . DG  B 1 10 ? -8.650  -8.308  -17.342 1.00 33.35 ? 311 DG  G N9    1 
ATOM   563  C C8    . DG  B 1 10 ? -7.767  -8.778  -16.399 1.00 29.31 ? 311 DG  G C8    1 
ATOM   564  N N7    . DG  B 1 10 ? -7.277  -7.834  -15.642 1.00 29.75 ? 311 DG  G N7    1 
ATOM   565  C C5    . DG  B 1 10 ? -7.863  -6.669  -16.122 1.00 29.26 ? 311 DG  G C5    1 
ATOM   566  C C6    . DG  B 1 10 ? -7.735  -5.310  -15.689 1.00 30.48 ? 311 DG  G C6    1 
ATOM   567  O O6    . DG  B 1 10 ? -7.059  -4.846  -14.758 1.00 27.26 ? 311 DG  G O6    1 
ATOM   568  N N1    . DG  B 1 10 ? -8.512  -4.456  -16.468 1.00 29.35 ? 311 DG  G N1    1 
ATOM   569  C C2    . DG  B 1 10 ? -9.313  -4.844  -17.511 1.00 30.17 ? 311 DG  G C2    1 
ATOM   570  N N2    . DG  B 1 10 ? -9.980  -3.866  -18.140 1.00 31.13 ? 311 DG  G N2    1 
ATOM   571  N N3    . DG  B 1 10 ? -9.451  -6.093  -17.911 1.00 28.93 ? 311 DG  G N3    1 
ATOM   572  C C4    . DG  B 1 10 ? -8.703  -6.945  -17.179 1.00 29.21 ? 311 DG  G C4    1 
ATOM   573  P P     . DT  B 1 11 ? -9.632  -11.042 -21.973 1.00 40.12 ? 312 DT  G P     1 
ATOM   574  O OP1   . DT  B 1 11 ? -10.680 -11.314 -22.990 1.00 40.27 ? 312 DT  G OP1   1 
ATOM   575  O OP2   . DT  B 1 11 ? -8.474  -11.961 -21.847 1.00 37.57 ? 312 DT  G OP2   1 
ATOM   576  O "O5'" . DT  B 1 11 ? -9.084  -9.577  -22.243 1.00 36.16 ? 312 DT  G "O5'" 1 
ATOM   577  C "C5'" . DT  B 1 11 ? -9.955  -8.470  -22.084 1.00 38.66 ? 312 DT  G "C5'" 1 
ATOM   578  C "C4'" . DT  B 1 11 ? -9.204  -7.176  -22.265 1.00 35.77 ? 312 DT  G "C4'" 1 
ATOM   579  O "O4'" . DT  B 1 11 ? -8.597  -6.746  -21.022 1.00 34.84 ? 312 DT  G "O4'" 1 
ATOM   580  C "C3'" . DT  B 1 11 ? -8.083  -7.228  -23.302 1.00 36.69 ? 312 DT  G "C3'" 1 
ATOM   581  O "O3'" . DT  B 1 11 ? -8.327  -6.276  -24.331 1.00 40.55 ? 312 DT  G "O3'" 1 
ATOM   582  C "C2'" . DT  B 1 11 ? -6.829  -6.866  -22.513 1.00 36.37 ? 312 DT  G "C2'" 1 
ATOM   583  C "C1'" . DT  B 1 11 ? -7.399  -6.077  -21.342 1.00 34.96 ? 312 DT  G "C1'" 1 
ATOM   584  N N1    . DT  B 1 11 ? -6.581  -5.993  -20.114 1.00 33.90 ? 312 DT  G N1    1 
ATOM   585  C C2    . DT  B 1 11 ? -6.432  -4.748  -19.532 1.00 32.29 ? 312 DT  G C2    1 
ATOM   586  O O2    . DT  B 1 11 ? -6.927  -3.738  -19.992 1.00 34.34 ? 312 DT  G O2    1 
ATOM   587  N N3    . DT  B 1 11 ? -5.681  -4.733  -18.381 1.00 31.22 ? 312 DT  G N3    1 
ATOM   588  C C4    . DT  B 1 11 ? -5.077  -5.809  -17.766 1.00 30.45 ? 312 DT  G C4    1 
ATOM   589  O O4    . DT  B 1 11 ? -4.435  -5.636  -16.728 1.00 29.51 ? 312 DT  G O4    1 
ATOM   590  C C5    . DT  B 1 11 ? -5.268  -7.088  -18.437 1.00 30.05 ? 312 DT  G C5    1 
ATOM   591  C C7    . DT  B 1 11 ? -4.651  -8.318  -17.849 1.00 28.85 ? 312 DT  G C7    1 
ATOM   592  C C6    . DT  B 1 11 ? -5.998  -7.111  -19.561 1.00 30.79 ? 312 DT  G C6    1 
ATOM   593  P P     . DG  B 1 12 ? -7.604  -6.442  -25.753 1.00 41.10 ? 313 DG  G P     1 
ATOM   594  O OP1   . DG  B 1 12 ? -8.669  -6.469  -26.777 1.00 43.76 ? 313 DG  G OP1   1 
ATOM   595  O OP2   . DG  B 1 12 ? -6.618  -7.549  -25.684 1.00 42.57 ? 313 DG  G OP2   1 
ATOM   596  O "O5'" . DG  B 1 12 ? -6.803  -5.076  -25.892 1.00 39.68 ? 313 DG  G "O5'" 1 
ATOM   597  C "C5'" . DG  B 1 12 ? -7.481  -3.834  -25.738 1.00 38.97 ? 313 DG  G "C5'" 1 
ATOM   598  C "C4'" . DG  B 1 12 ? -6.491  -2.730  -25.454 1.00 37.86 ? 313 DG  G "C4'" 1 
ATOM   599  O "O4'" . DG  B 1 12 ? -5.926  -2.895  -24.132 1.00 33.47 ? 313 DG  G "O4'" 1 
ATOM   600  C "C3'" . DG  B 1 12 ? -5.302  -2.667  -26.413 1.00 38.62 ? 313 DG  G "C3'" 1 
ATOM   601  O "O3'" . DG  B 1 12 ? -4.921  -1.299  -26.529 1.00 41.95 ? 313 DG  G "O3'" 1 
ATOM   602  C "C2'" . DG  B 1 12 ? -4.215  -3.391  -25.636 1.00 37.29 ? 313 DG  G "C2'" 1 
ATOM   603  C "C1'" . DG  B 1 12 ? -4.514  -2.901  -24.229 1.00 32.66 ? 313 DG  G "C1'" 1 
ATOM   604  N N9    . DG  B 1 12 ? -3.993  -3.715  -23.135 1.00 31.81 ? 313 DG  G N9    1 
ATOM   605  C C8    . DG  B 1 12 ? -3.832  -5.088  -23.097 1.00 28.78 ? 313 DG  G C8    1 
ATOM   606  N N7    . DG  B 1 12 ? -3.324  -5.508  -21.968 1.00 29.31 ? 313 DG  G N7    1 
ATOM   607  C C5    . DG  B 1 12 ? -3.147  -4.348  -21.219 1.00 30.09 ? 313 DG  G C5    1 
ATOM   608  C C6    . DG  B 1 12 ? -2.625  -4.157  -19.911 1.00 27.20 ? 313 DG  G C6    1 
ATOM   609  O O6    . DG  B 1 12 ? -2.212  -4.995  -19.113 1.00 29.64 ? 313 DG  G O6    1 
ATOM   610  N N1    . DG  B 1 12 ? -2.615  -2.817  -19.556 1.00 28.05 ? 313 DG  G N1    1 
ATOM   611  C C2    . DG  B 1 12 ? -3.056  -1.784  -20.341 1.00 27.53 ? 313 DG  G C2    1 
ATOM   612  N N2    . DG  B 1 12 ? -2.970  -0.549  -19.803 1.00 27.01 ? 313 DG  G N2    1 
ATOM   613  N N3    . DG  B 1 12 ? -3.542  -1.941  -21.555 1.00 26.84 ? 313 DG  G N3    1 
ATOM   614  C C4    . DG  B 1 12 ? -3.560  -3.238  -21.928 1.00 28.50 ? 313 DG  G C4    1 
ATOM   615  P P     . DC  B 1 13 ? -4.857  -0.588  -27.969 1.00 46.47 ? 314 DC  G P     1 
ATOM   616  O OP1   . DC  B 1 13 ? -6.139  0.126   -28.179 1.00 44.17 ? 314 DC  G OP1   1 
ATOM   617  O OP2   . DC  B 1 13 ? -4.376  -1.555  -28.987 1.00 43.98 ? 314 DC  G OP2   1 
ATOM   618  O "O5'" . DC  B 1 13 ? -3.698  0.471   -27.731 1.00 46.01 ? 314 DC  G "O5'" 1 
ATOM   619  C "C5'" . DC  B 1 13 ? -2.461  0.035   -27.172 1.00 45.21 ? 314 DC  G "C5'" 1 
ATOM   620  C "C4'" . DC  B 1 13 ? -1.986  1.011   -26.126 1.00 42.87 ? 314 DC  G "C4'" 1 
ATOM   621  O "O4'" . DC  B 1 13 ? -2.189  0.436   -24.803 1.00 42.76 ? 314 DC  G "O4'" 1 
ATOM   622  C "C3'" . DC  B 1 13 ? -0.493  1.266   -26.272 1.00 40.68 ? 314 DC  G "C3'" 1 
ATOM   623  O "O3'" . DC  B 1 13 ? -0.181  2.634   -26.463 1.00 39.16 ? 314 DC  G "O3'" 1 
ATOM   624  C "C2'" . DC  B 1 13 ? 0.148   0.738   -25.004 1.00 39.49 ? 314 DC  G "C2'" 1 
ATOM   625  C "C1'" . DC  B 1 13 ? -0.985  0.464   -24.037 1.00 38.74 ? 314 DC  G "C1'" 1 
ATOM   626  N N1    . DC  B 1 13 ? -0.764  -0.876  -23.462 1.00 32.77 ? 314 DC  G N1    1 
ATOM   627  C C2    . DC  B 1 13 ? -0.139  -0.975  -22.211 1.00 33.92 ? 314 DC  G C2    1 
ATOM   628  O O2    . DC  B 1 13 ? 0.099   0.065   -21.569 1.00 33.59 ? 314 DC  G O2    1 
ATOM   629  N N3    . DC  B 1 13 ? 0.189   -2.194  -21.730 1.00 28.88 ? 314 DC  G N3    1 
ATOM   630  C C4    . DC  B 1 13 ? -0.114  -3.290  -22.421 1.00 32.32 ? 314 DC  G C4    1 
ATOM   631  N N4    . DC  B 1 13 ? 0.232   -4.476  -21.890 1.00 30.57 ? 314 DC  G N4    1 
ATOM   632  C C5    . DC  B 1 13 ? -0.790  -3.226  -23.681 1.00 31.97 ? 314 DC  G C5    1 
ATOM   633  C C6    . DC  B 1 13 ? -1.101  -2.006  -24.154 1.00 32.09 ? 314 DC  G C6    1 
ATOM   634  P P     . DT  B 1 14 ? 1.268   3.011   -26.998 1.00 39.22 ? 315 DT  G P     1 
ATOM   635  O OP1   . DT  B 1 14 ? 1.175   4.310   -27.714 1.00 38.91 ? 315 DT  G OP1   1 
ATOM   636  O OP2   . DT  B 1 14 ? 1.810   1.824   -27.693 1.00 38.71 ? 315 DT  G OP2   1 
ATOM   637  O "O5'" . DT  B 1 14 ? 2.118   3.180   -25.668 1.00 36.95 ? 315 DT  G "O5'" 1 
ATOM   638  C "C5'" . DT  B 1 14 ? 1.725   4.100   -24.661 1.00 37.02 ? 315 DT  G "C5'" 1 
ATOM   639  C "C4'" . DT  B 1 14 ? 2.731   4.083   -23.537 1.00 34.56 ? 315 DT  G "C4'" 1 
ATOM   640  O "O4'" . DT  B 1 14 ? 2.655   2.786   -22.891 1.00 31.76 ? 315 DT  G "O4'" 1 
ATOM   641  C "C3'" . DT  B 1 14 ? 4.190   4.271   -23.982 1.00 34.07 ? 315 DT  G "C3'" 1 
ATOM   642  O "O3'" . DT  B 1 14 ? 4.859   5.201   -23.115 1.00 33.35 ? 315 DT  G "O3'" 1 
ATOM   643  C "C2'" . DT  B 1 14 ? 4.786   2.871   -23.891 1.00 34.09 ? 315 DT  G "C2'" 1 
ATOM   644  C "C1'" . DT  B 1 14 ? 3.952   2.203   -22.802 1.00 33.73 ? 315 DT  G "C1'" 1 
ATOM   645  N N1    . DT  B 1 14 ? 3.793   0.725   -22.915 1.00 31.77 ? 315 DT  G N1    1 
ATOM   646  C C2    . DT  B 1 14 ? 4.149   -0.050  -21.833 1.00 33.03 ? 315 DT  G C2    1 
ATOM   647  O O2    . DT  B 1 14 ? 4.625   0.412   -20.811 1.00 31.91 ? 315 DT  G O2    1 
ATOM   648  N N3    . DT  B 1 14 ? 3.926   -1.401  -21.996 1.00 30.28 ? 315 DT  G N3    1 
ATOM   649  C C4    . DT  B 1 14 ? 3.406   -2.031  -23.103 1.00 32.17 ? 315 DT  G C4    1 
ATOM   650  O O4    . DT  B 1 14 ? 3.230   -3.249  -23.094 1.00 32.98 ? 315 DT  G O4    1 
ATOM   651  C C5    . DT  B 1 14 ? 3.092   -1.166  -24.208 1.00 32.78 ? 315 DT  G C5    1 
ATOM   652  C C7    . DT  B 1 14 ? 2.567   -1.772  -25.473 1.00 34.86 ? 315 DT  G C7    1 
ATOM   653  C C6    . DT  B 1 14 ? 3.290   0.153   -24.058 1.00 31.31 ? 315 DT  G C6    1 
ATOM   654  P P     . DA  B 1 15 ? 6.317   5.759   -23.493 1.00 35.55 ? 316 DA  G P     1 
ATOM   655  O OP1   . DA  B 1 15 ? 6.477   7.057   -22.793 1.00 33.06 ? 316 DA  G OP1   1 
ATOM   656  O OP2   . DA  B 1 15 ? 6.548   5.699   -24.969 1.00 35.19 ? 316 DA  G OP2   1 
ATOM   657  O "O5'" . DA  B 1 15 ? 7.313   4.706   -22.826 1.00 36.76 ? 316 DA  G "O5'" 1 
ATOM   658  C "C5'" . DA  B 1 15 ? 7.207   4.373   -21.442 1.00 38.34 ? 316 DA  G "C5'" 1 
ATOM   659  C "C4'" . DA  B 1 15 ? 8.165   3.257   -21.087 1.00 40.49 ? 316 DA  G "C4'" 1 
ATOM   660  O "O4'" . DA  B 1 15 ? 7.624   1.963   -21.461 1.00 37.15 ? 316 DA  G "O4'" 1 
ATOM   661  C "C3'" . DA  B 1 15 ? 9.555   3.349   -21.727 1.00 40.33 ? 316 DA  G "C3'" 1 
ATOM   662  O "O3'" . DA  B 1 15 ? 10.570  3.129   -20.742 1.00 46.44 ? 316 DA  G "O3'" 1 
ATOM   663  C "C2'" . DA  B 1 15 ? 9.556   2.219   -22.743 1.00 40.44 ? 316 DA  G "C2'" 1 
ATOM   664  C "C1'" . DA  B 1 15 ? 8.644   1.203   -22.080 1.00 38.38 ? 316 DA  G "C1'" 1 
ATOM   665  N N9    . DA  B 1 15 ? 8.011   0.216   -22.956 1.00 37.97 ? 316 DA  G N9    1 
ATOM   666  C C8    . DA  B 1 15 ? 7.545   0.362   -24.245 1.00 38.14 ? 316 DA  G C8    1 
ATOM   667  N N7    . DA  B 1 15 ? 7.001   -0.728  -24.735 1.00 37.69 ? 316 DA  G N7    1 
ATOM   668  C C5    . DA  B 1 15 ? 7.117   -1.654  -23.704 1.00 35.40 ? 316 DA  G C5    1 
ATOM   669  C C6    . DA  B 1 15 ? 6.708   -2.999  -23.582 1.00 34.30 ? 316 DA  G C6    1 
ATOM   670  N N6    . DA  B 1 15 ? 6.078   -3.680  -24.543 1.00 33.65 ? 316 DA  G N6    1 
ATOM   671  N N1    . DA  B 1 15 ? 6.968   -3.628  -22.418 1.00 34.60 ? 316 DA  G N1    1 
ATOM   672  C C2    . DA  B 1 15 ? 7.595   -2.952  -21.448 1.00 35.29 ? 316 DA  G C2    1 
ATOM   673  N N3    . DA  B 1 15 ? 8.025   -1.692  -21.442 1.00 34.93 ? 316 DA  G N3    1 
ATOM   674  C C4    . DA  B 1 15 ? 7.748   -1.091  -22.610 1.00 36.82 ? 316 DA  G C4    1 
ATOM   675  P P     . DC  B 1 16 ? 12.094  3.543   -21.054 1.00 48.57 ? 317 DC  G P     1 
ATOM   676  O OP1   . DC  B 1 16 ? 12.907  3.154   -19.881 1.00 50.93 ? 317 DC  G OP1   1 
ATOM   677  O OP2   . DC  B 1 16 ? 12.144  4.940   -21.543 1.00 50.87 ? 317 DC  G OP2   1 
ATOM   678  O "O5'" . DC  B 1 16 ? 12.489  2.588   -22.264 1.00 51.76 ? 317 DC  G "O5'" 1 
ATOM   679  C "C5'" . DC  B 1 16 ? 13.502  1.597   -22.110 1.00 53.95 ? 317 DC  G "C5'" 1 
ATOM   680  C "C4'" . DC  B 1 16 ? 13.129  0.628   -21.010 1.00 54.20 ? 317 DC  G "C4'" 1 
ATOM   681  O "O4'" . DC  B 1 16 ? 11.859  -0.005  -21.318 1.00 52.55 ? 317 DC  G "O4'" 1 
ATOM   682  C "C3'" . DC  B 1 16 ? 14.147  -0.498  -20.836 1.00 54.21 ? 317 DC  G "C3'" 1 
ATOM   683  O "O3'" . DC  B 1 16 ? 14.452  -0.738  -19.463 1.00 57.89 ? 317 DC  G "O3'" 1 
ATOM   684  C "C2'" . DC  B 1 16 ? 13.481  -1.707  -21.460 1.00 53.77 ? 317 DC  G "C2'" 1 
ATOM   685  C "C1'" . DC  B 1 16 ? 11.993  -1.420  -21.348 1.00 52.35 ? 317 DC  G "C1'" 1 
ATOM   686  N N1    . DC  B 1 16 ? 11.263  -1.917  -22.524 1.00 50.10 ? 317 DC  G N1    1 
ATOM   687  C C2    . DC  B 1 16 ? 10.714  -3.203  -22.486 1.00 49.47 ? 317 DC  G C2    1 
ATOM   688  O O2    . DC  B 1 16 ? 10.832  -3.877  -21.451 1.00 48.00 ? 317 DC  G O2    1 
ATOM   689  N N3    . DC  B 1 16 ? 10.067  -3.677  -23.574 1.00 48.77 ? 317 DC  G N3    1 
ATOM   690  C C4    . DC  B 1 16 ? 9.952   -2.918  -24.666 1.00 49.57 ? 317 DC  G C4    1 
ATOM   691  N N4    . DC  B 1 16 ? 9.306   -3.430  -25.719 1.00 49.30 ? 317 DC  G N4    1 
ATOM   692  C C5    . DC  B 1 16 ? 10.493  -1.601  -24.729 1.00 49.45 ? 317 DC  G C5    1 
ATOM   693  C C6    . DC  B 1 16 ? 11.134  -1.145  -23.644 1.00 49.99 ? 317 DC  G C6    1 
ATOM   694  P P     . DT  B 1 17 ? 15.939  -1.210  -19.062 1.00 61.17 ? 318 DT  G P     1 
ATOM   695  O OP1   . DT  B 1 17 ? 16.109  -0.995  -17.598 1.00 59.83 ? 318 DT  G OP1   1 
ATOM   696  O OP2   . DT  B 1 17 ? 16.889  -0.584  -20.020 1.00 59.63 ? 318 DT  G OP2   1 
ATOM   697  O "O5'" . DT  B 1 17 ? 15.947  -2.776  -19.350 1.00 58.40 ? 318 DT  G "O5'" 1 
ATOM   698  C "C5'" . DT  B 1 17 ? 15.369  -3.690  -18.426 1.00 55.78 ? 318 DT  G "C5'" 1 
ATOM   699  C "C4'" . DT  B 1 17 ? 15.522  -5.104  -18.931 1.00 54.27 ? 318 DT  G "C4'" 1 
ATOM   700  O "O4'" . DT  B 1 17 ? 14.682  -5.313  -20.094 1.00 52.39 ? 318 DT  G "O4'" 1 
ATOM   701  C "C3'" . DT  B 1 17 ? 16.942  -5.482  -19.361 1.00 53.28 ? 318 DT  G "C3'" 1 
ATOM   702  O "O3'" . DT  B 1 17 ? 17.210  -6.822  -18.944 1.00 54.15 ? 318 DT  G "O3'" 1 
ATOM   703  C "C2'" . DT  B 1 17 ? 16.880  -5.405  -20.877 1.00 51.91 ? 318 DT  G "C2'" 1 
ATOM   704  C "C1'" . DT  B 1 17 ? 15.458  -5.860  -21.148 1.00 50.46 ? 318 DT  G "C1'" 1 
ATOM   705  N N1    . DT  B 1 17 ? 14.878  -5.401  -22.423 1.00 48.95 ? 318 DT  G N1    1 
ATOM   706  C C2    . DT  B 1 17 ? 14.161  -6.310  -23.176 1.00 46.80 ? 318 DT  G C2    1 
ATOM   707  O O2    . DT  B 1 17 ? 14.025  -7.485  -22.867 1.00 45.66 ? 318 DT  G O2    1 
ATOM   708  N N3    . DT  B 1 17 ? 13.609  -5.792  -24.316 1.00 46.98 ? 318 DT  G N3    1 
ATOM   709  C C4    . DT  B 1 17 ? 13.713  -4.498  -24.783 1.00 46.64 ? 318 DT  G C4    1 
ATOM   710  O O4    . DT  B 1 17 ? 13.140  -4.177  -25.818 1.00 47.60 ? 318 DT  G O4    1 
ATOM   711  C C5    . DT  B 1 17 ? 14.513  -3.611  -23.970 1.00 48.25 ? 318 DT  G C5    1 
ATOM   712  C C7    . DT  B 1 17 ? 14.722  -2.199  -24.428 1.00 48.05 ? 318 DT  G C7    1 
ATOM   713  C C6    . DT  B 1 17 ? 15.041  -4.098  -22.840 1.00 47.03 ? 318 DT  G C6    1 
ATOM   714  P P     . DC  B 1 18 ? 18.680  -7.445  -19.131 1.00 55.20 ? 319 DC  G P     1 
ATOM   715  O OP1   . DC  B 1 18 ? 19.004  -8.128  -17.855 1.00 52.79 ? 319 DC  G OP1   1 
ATOM   716  O OP2   . DC  B 1 18 ? 19.592  -6.401  -19.662 1.00 53.00 ? 319 DC  G OP2   1 
ATOM   717  O "O5'" . DC  B 1 18 ? 18.464  -8.550  -20.259 1.00 55.65 ? 319 DC  G "O5'" 1 
ATOM   718  C "C5'" . DC  B 1 18 ? 17.446  -9.541  -20.113 1.00 57.29 ? 319 DC  G "C5'" 1 
ATOM   719  C "C4'" . DC  B 1 18 ? 17.272  -10.325 -21.394 1.00 58.38 ? 319 DC  G "C4'" 1 
ATOM   720  O "O4'" . DC  B 1 18 ? 16.584  -9.534  -22.397 1.00 57.21 ? 319 DC  G "O4'" 1 
ATOM   721  C "C3'" . DC  B 1 18 ? 18.566  -10.822 -22.050 1.00 59.02 ? 319 DC  G "C3'" 1 
ATOM   722  O "O3'" . DC  B 1 18 ? 18.378  -12.131 -22.594 1.00 60.76 ? 319 DC  G "O3'" 1 
ATOM   723  C "C2'" . DC  B 1 18 ? 18.726  -9.896  -23.244 1.00 58.45 ? 319 DC  G "C2'" 1 
ATOM   724  C "C1'" . DC  B 1 18 ? 17.277  -9.654  -23.627 1.00 56.49 ? 319 DC  G "C1'" 1 
ATOM   725  N N1    . DC  B 1 18 ? 17.031  -8.440  -24.425 1.00 54.65 ? 319 DC  G N1    1 
ATOM   726  C C2    . DC  B 1 18 ? 16.095  -8.499  -25.462 1.00 54.27 ? 319 DC  G C2    1 
ATOM   727  O O2    . DC  B 1 18 ? 15.472  -9.556  -25.649 1.00 53.44 ? 319 DC  G O2    1 
ATOM   728  N N3    . DC  B 1 18 ? 15.891  -7.406  -26.232 1.00 53.52 ? 319 DC  G N3    1 
ATOM   729  C C4    . DC  B 1 18 ? 16.578  -6.287  -25.997 1.00 53.79 ? 319 DC  G C4    1 
ATOM   730  N N4    . DC  B 1 18 ? 16.365  -5.242  -26.801 1.00 54.10 ? 319 DC  G N4    1 
ATOM   731  C C5    . DC  B 1 18 ? 17.521  -6.192  -24.930 1.00 53.51 ? 319 DC  G C5    1 
ATOM   732  C C6    . DC  B 1 18 ? 17.713  -7.281  -24.176 1.00 54.77 ? 319 DC  G C6    1 
ATOM   733  O "O5'" . DG  C 1 1  ? 9.319   44.076  40.014  1.00 72.61 ? 602 DG  H "O5'" 1 
ATOM   734  C "C5'" . DG  C 1 1  ? 8.799   43.518  41.223  1.00 73.30 ? 602 DG  H "C5'" 1 
ATOM   735  C "C4'" . DG  C 1 1  ? 8.515   42.038  41.107  1.00 73.50 ? 602 DG  H "C4'" 1 
ATOM   736  O "O4'" . DG  C 1 1  ? 7.455   41.813  40.148  1.00 73.76 ? 602 DG  H "O4'" 1 
ATOM   737  C "C3'" . DG  C 1 1  ? 9.697   41.199  40.624  1.00 74.08 ? 602 DG  H "C3'" 1 
ATOM   738  O "O3'" . DG  C 1 1  ? 9.653   39.915  41.242  1.00 75.61 ? 602 DG  H "O3'" 1 
ATOM   739  C "C2'" . DG  C 1 1  ? 9.440   41.062  39.136  1.00 72.75 ? 602 DG  H "C2'" 1 
ATOM   740  C "C1'" . DG  C 1 1  ? 7.924   41.002  39.076  1.00 71.83 ? 602 DG  H "C1'" 1 
ATOM   741  N N9    . DG  C 1 1  ? 7.352   41.532  37.843  1.00 69.53 ? 602 DG  H N9    1 
ATOM   742  C C8    . DG  C 1 1  ? 7.495   42.805  37.344  1.00 68.35 ? 602 DG  H C8    1 
ATOM   743  N N7    . DG  C 1 1  ? 6.839   42.996  36.232  1.00 67.10 ? 602 DG  H N7    1 
ATOM   744  C C5    . DG  C 1 1  ? 6.233   41.773  35.977  1.00 66.50 ? 602 DG  H C5    1 
ATOM   745  C C6    . DG  C 1 1  ? 5.386   41.374  34.914  1.00 65.72 ? 602 DG  H C6    1 
ATOM   746  O O6    . DG  C 1 1  ? 4.989   42.043  33.954  1.00 64.98 ? 602 DG  H O6    1 
ATOM   747  N N1    . DG  C 1 1  ? 4.993   40.047  35.046  1.00 64.37 ? 602 DG  H N1    1 
ATOM   748  C C2    . DG  C 1 1  ? 5.364   39.209  36.069  1.00 65.54 ? 602 DG  H C2    1 
ATOM   749  N N2    . DG  C 1 1  ? 4.875   37.962  36.019  1.00 64.91 ? 602 DG  H N2    1 
ATOM   750  N N3    . DG  C 1 1  ? 6.155   39.569  37.067  1.00 66.36 ? 602 DG  H N3    1 
ATOM   751  C C4    . DG  C 1 1  ? 6.548   40.856  36.958  1.00 67.77 ? 602 DG  H C4    1 
ATOM   752  P P     . DA  C 1 2  ? 10.980  39.016  41.306  1.00 77.68 ? 603 DA  H P     1 
ATOM   753  O OP1   . DA  C 1 2  ? 11.614  39.238  42.632  1.00 77.22 ? 603 DA  H OP1   1 
ATOM   754  O OP2   . DA  C 1 2  ? 11.772  39.235  40.066  1.00 76.27 ? 603 DA  H OP2   1 
ATOM   755  O "O5'" . DA  C 1 2  ? 10.413  37.532  41.277  1.00 75.67 ? 603 DA  H "O5'" 1 
ATOM   756  C "C5'" . DA  C 1 2  ? 11.025  36.547  40.462  1.00 73.80 ? 603 DA  H "C5'" 1 
ATOM   757  C "C4'" . DA  C 1 2  ? 9.976   35.657  39.841  1.00 71.49 ? 603 DA  H "C4'" 1 
ATOM   758  O "O4'" . DA  C 1 2  ? 9.091   36.447  39.006  1.00 71.39 ? 603 DA  H "O4'" 1 
ATOM   759  C "C3'" . DA  C 1 2  ? 10.580  34.590  38.931  1.00 69.96 ? 603 DA  H "C3'" 1 
ATOM   760  O "O3'" . DA  C 1 2  ? 9.947   33.331  39.132  1.00 68.55 ? 603 DA  H "O3'" 1 
ATOM   761  C "C2'" . DA  C 1 2  ? 10.343  35.117  37.530  1.00 69.25 ? 603 DA  H "C2'" 1 
ATOM   762  C "C1'" . DA  C 1 2  ? 9.079   35.940  37.676  1.00 69.03 ? 603 DA  H "C1'" 1 
ATOM   763  N N9    . DA  C 1 2  ? 9.032   37.079  36.757  1.00 66.59 ? 603 DA  H N9    1 
ATOM   764  C C8    . DA  C 1 2  ? 9.731   38.259  36.841  1.00 65.99 ? 603 DA  H C8    1 
ATOM   765  N N7    . DA  C 1 2  ? 9.487   39.089  35.855  1.00 65.02 ? 603 DA  H N7    1 
ATOM   766  C C5    . DA  C 1 2  ? 8.562   38.413  35.072  1.00 64.45 ? 603 DA  H C5    1 
ATOM   767  C C6    . DA  C 1 2  ? 7.898   38.757  33.878  1.00 64.44 ? 603 DA  H C6    1 
ATOM   768  N N6    . DA  C 1 2  ? 8.068   39.920  33.241  1.00 63.41 ? 603 DA  H N6    1 
ATOM   769  N N1    . DA  C 1 2  ? 7.039   37.854  33.356  1.00 63.62 ? 603 DA  H N1    1 
ATOM   770  C C2    . DA  C 1 2  ? 6.862   36.693  33.996  1.00 63.29 ? 603 DA  H C2    1 
ATOM   771  N N3    . DA  C 1 2  ? 7.422   36.257  35.122  1.00 64.07 ? 603 DA  H N3    1 
ATOM   772  C C4    . DA  C 1 2  ? 8.272   37.175  35.616  1.00 65.30 ? 603 DA  H C4    1 
ATOM   773  P P     . DG  C 1 3  ? 10.709  31.995  38.680  1.00 68.38 ? 604 DG  H P     1 
ATOM   774  O OP1   . DG  C 1 3  ? 9.969   30.830  39.230  1.00 68.98 ? 604 DG  H OP1   1 
ATOM   775  O OP2   . DG  C 1 3  ? 12.156  32.153  38.978  1.00 68.17 ? 604 DG  H OP2   1 
ATOM   776  O "O5'" . DG  C 1 3  ? 10.515  32.007  37.103  1.00 66.33 ? 604 DG  H "O5'" 1 
ATOM   777  C "C5'" . DG  C 1 3  ? 9.221   31.823  36.543  1.00 63.43 ? 604 DG  H "C5'" 1 
ATOM   778  C "C4'" . DG  C 1 3  ? 9.318   31.717  35.042  1.00 59.97 ? 604 DG  H "C4'" 1 
ATOM   779  O "O4'" . DG  C 1 3  ? 9.109   33.007  34.417  1.00 58.74 ? 604 DG  H "O4'" 1 
ATOM   780  C "C3'" . DG  C 1 3  ? 10.670  31.201  34.547  1.00 58.20 ? 604 DG  H "C3'" 1 
ATOM   781  O "O3'" . DG  C 1 3  ? 10.466  30.142  33.620  1.00 57.54 ? 604 DG  H "O3'" 1 
ATOM   782  C "C2'" . DG  C 1 3  ? 11.298  32.414  33.883  1.00 57.10 ? 604 DG  H "C2'" 1 
ATOM   783  C "C1'" . DG  C 1 3  ? 10.085  33.194  33.410  1.00 57.34 ? 604 DG  H "C1'" 1 
ATOM   784  N N9    . DG  C 1 3  ? 10.315  34.627  33.250  1.00 55.36 ? 604 DG  H N9    1 
ATOM   785  C C8    . DG  C 1 3  ? 11.099  35.436  34.039  1.00 55.25 ? 604 DG  H C8    1 
ATOM   786  N N7    . DG  C 1 3  ? 11.166  36.666  33.604  1.00 53.72 ? 604 DG  H N7    1 
ATOM   787  C C5    . DG  C 1 3  ? 10.367  36.676  32.468  1.00 52.72 ? 604 DG  H C5    1 
ATOM   788  C C6    . DG  C 1 3  ? 10.071  37.728  31.558  1.00 52.24 ? 604 DG  H C6    1 
ATOM   789  O O6    . DG  C 1 3  ? 10.481  38.894  31.567  1.00 49.83 ? 604 DG  H O6    1 
ATOM   790  N N1    . DG  C 1 3  ? 9.209   37.306  30.551  1.00 50.96 ? 604 DG  H N1    1 
ATOM   791  C C2    . DG  C 1 3  ? 8.705   36.039  30.424  1.00 52.75 ? 604 DG  H C2    1 
ATOM   792  N N2    . DG  C 1 3  ? 7.884   35.834  29.383  1.00 51.93 ? 604 DG  H N2    1 
ATOM   793  N N3    . DG  C 1 3  ? 8.984   35.044  31.256  1.00 53.87 ? 604 DG  H N3    1 
ATOM   794  C C4    . DG  C 1 3  ? 9.817   35.431  32.247  1.00 53.94 ? 604 DG  H C4    1 
ATOM   795  P P     . DT  C 1 4  ? 11.695  29.588  32.750  1.00 56.74 ? 605 DT  H P     1 
ATOM   796  O OP1   . DT  C 1 4  ? 11.631  28.105  32.806  1.00 57.57 ? 605 DT  H OP1   1 
ATOM   797  O OP2   . DT  C 1 4  ? 12.957  30.285  33.114  1.00 55.71 ? 605 DT  H OP2   1 
ATOM   798  O "O5'" . DT  C 1 4  ? 11.268  30.038  31.293  1.00 56.35 ? 605 DT  H "O5'" 1 
ATOM   799  C "C5'" . DT  C 1 4  ? 9.891   30.026  30.935  1.00 57.18 ? 605 DT  H "C5'" 1 
ATOM   800  C "C4'" . DT  C 1 4  ? 9.730   30.481  29.509  1.00 57.97 ? 605 DT  H "C4'" 1 
ATOM   801  O "O4'" . DT  C 1 4  ? 9.866   31.920  29.430  1.00 57.96 ? 605 DT  H "O4'" 1 
ATOM   802  C "C3'" . DT  C 1 4  ? 10.794  29.894  28.586  1.00 58.42 ? 605 DT  H "C3'" 1 
ATOM   803  O "O3'" . DT  C 1 4  ? 10.199  29.524  27.344  1.00 58.20 ? 605 DT  H "O3'" 1 
ATOM   804  C "C2'" . DT  C 1 4  ? 11.787  31.031  28.420  1.00 58.13 ? 605 DT  H "C2'" 1 
ATOM   805  C "C1'" . DT  C 1 4  ? 10.899  32.260  28.519  1.00 57.86 ? 605 DT  H "C1'" 1 
ATOM   806  N N1    . DT  C 1 4  ? 11.562  33.475  29.030  1.00 58.44 ? 605 DT  H N1    1 
ATOM   807  C C2    . DT  C 1 4  ? 11.393  34.643  28.321  1.00 58.13 ? 605 DT  H C2    1 
ATOM   808  O O2    . DT  C 1 4  ? 10.758  34.704  27.281  1.00 57.52 ? 605 DT  H O2    1 
ATOM   809  N N3    . DT  C 1 4  ? 12.003  35.742  28.877  1.00 58.45 ? 605 DT  H N3    1 
ATOM   810  C C4    . DT  C 1 4  ? 12.758  35.784  30.037  1.00 57.89 ? 605 DT  H C4    1 
ATOM   811  O O4    . DT  C 1 4  ? 13.236  36.852  30.423  1.00 56.23 ? 605 DT  H O4    1 
ATOM   812  C C5    . DT  C 1 4  ? 12.914  34.518  30.713  1.00 57.65 ? 605 DT  H C5    1 
ATOM   813  C C7    . DT  C 1 4  ? 13.734  34.463  31.962  1.00 58.81 ? 605 DT  H C7    1 
ATOM   814  C C6    . DT  C 1 4  ? 12.315  33.441  30.185  1.00 58.50 ? 605 DT  H C6    1 
ATOM   815  P P     . DA  C 1 5  ? 11.061  28.717  26.260  1.00 57.25 ? 606 DA  H P     1 
ATOM   816  O OP1   . DA  C 1 5  ? 10.227  27.587  25.786  1.00 57.59 ? 606 DA  H OP1   1 
ATOM   817  O OP2   . DA  C 1 5  ? 12.419  28.453  26.804  1.00 57.32 ? 606 DA  H OP2   1 
ATOM   818  O "O5'" . DA  C 1 5  ? 11.183  29.767  25.072  1.00 55.30 ? 606 DA  H "O5'" 1 
ATOM   819  C "C5'" . DA  C 1 5  ? 10.032  30.482  24.631  1.00 47.57 ? 606 DA  H "C5'" 1 
ATOM   820  C "C4'" . DA  C 1 5  ? 10.425  31.537  23.628  1.00 44.83 ? 606 DA  H "C4'" 1 
ATOM   821  O "O4'" . DA  C 1 5  ? 11.006  32.695  24.270  1.00 42.60 ? 606 DA  H "O4'" 1 
ATOM   822  C "C3'" . DA  C 1 5  ? 11.443  31.068  22.594  1.00 44.33 ? 606 DA  H "C3'" 1 
ATOM   823  O "O3'" . DA  C 1 5  ? 11.047  31.586  21.333  1.00 43.13 ? 606 DA  H "O3'" 1 
ATOM   824  C "C2'" . DA  C 1 5  ? 12.750  31.682  23.077  1.00 43.44 ? 606 DA  H "C2'" 1 
ATOM   825  C "C1'" . DA  C 1 5  ? 12.284  32.980  23.715  1.00 42.81 ? 606 DA  H "C1'" 1 
ATOM   826  N N9    . DA  C 1 5  ? 13.124  33.492  24.799  1.00 43.57 ? 606 DA  H N9    1 
ATOM   827  C C8    . DA  C 1 5  ? 13.587  32.809  25.896  1.00 41.77 ? 606 DA  H C8    1 
ATOM   828  N N7    . DA  C 1 5  ? 14.259  33.554  26.739  1.00 42.72 ? 606 DA  H N7    1 
ATOM   829  C C5    . DA  C 1 5  ? 14.251  34.812  26.152  1.00 42.58 ? 606 DA  H C5    1 
ATOM   830  C C6    . DA  C 1 5  ? 14.782  36.053  26.561  1.00 42.99 ? 606 DA  H C6    1 
ATOM   831  N N6    . DA  C 1 5  ? 15.436  36.238  27.710  1.00 44.00 ? 606 DA  H N6    1 
ATOM   832  N N1    . DA  C 1 5  ? 14.607  37.110  25.742  1.00 42.43 ? 606 DA  H N1    1 
ATOM   833  C C2    . DA  C 1 5  ? 13.938  36.926  24.595  1.00 42.00 ? 606 DA  H C2    1 
ATOM   834  N N3    . DA  C 1 5  ? 13.386  35.816  24.107  1.00 42.70 ? 606 DA  H N3    1 
ATOM   835  C C4    . DA  C 1 5  ? 13.577  34.783  24.945  1.00 42.46 ? 606 DA  H C4    1 
ATOM   836  P P     . DG  C 1 6  ? 11.808  31.122  20.008  1.00 43.74 ? 607 DG  H P     1 
ATOM   837  O OP1   . DG  C 1 6  ? 10.789  31.105  18.938  1.00 41.88 ? 607 DG  H OP1   1 
ATOM   838  O OP2   . DG  C 1 6  ? 12.623  29.908  20.283  1.00 42.61 ? 607 DG  H OP2   1 
ATOM   839  O "O5'" . DG  C 1 6  ? 12.767  32.356  19.736  1.00 43.51 ? 607 DG  H "O5'" 1 
ATOM   840  C "C5'" . DG  C 1 6  ? 12.192  33.631  19.466  1.00 40.68 ? 607 DG  H "C5'" 1 
ATOM   841  C "C4'" . DG  C 1 6  ? 13.269  34.635  19.145  1.00 38.09 ? 607 DG  H "C4'" 1 
ATOM   842  O "O4'" . DG  C 1 6  ? 13.899  35.093  20.362  1.00 33.00 ? 607 DG  H "O4'" 1 
ATOM   843  C "C3'" . DG  C 1 6  ? 14.383  34.115  18.240  1.00 37.15 ? 607 DG  H "C3'" 1 
ATOM   844  O "O3'" . DG  C 1 6  ? 14.560  35.021  17.152  1.00 39.22 ? 607 DG  H "O3'" 1 
ATOM   845  C "C2'" . DG  C 1 6  ? 15.603  34.067  19.153  1.00 35.23 ? 607 DG  H "C2'" 1 
ATOM   846  C "C1'" . DG  C 1 6  ? 15.299  35.149  20.183  1.00 35.96 ? 607 DG  H "C1'" 1 
ATOM   847  N N9    . DG  C 1 6  ? 15.903  34.959  21.499  1.00 35.73 ? 607 DG  H N9    1 
ATOM   848  C C8    . DG  C 1 6  ? 15.877  33.803  22.245  1.00 35.96 ? 607 DG  H C8    1 
ATOM   849  N N7    . DG  C 1 6  ? 16.416  33.942  23.421  1.00 35.10 ? 607 DG  H N7    1 
ATOM   850  C C5    . DG  C 1 6  ? 16.842  35.264  23.454  1.00 34.14 ? 607 DG  H C5    1 
ATOM   851  C C6    . DG  C 1 6  ? 17.485  35.996  24.488  1.00 33.95 ? 607 DG  H C6    1 
ATOM   852  O O6    . DG  C 1 6  ? 17.798  35.619  25.623  1.00 34.97 ? 607 DG  H O6    1 
ATOM   853  N N1    . DG  C 1 6  ? 17.758  37.301  24.098  1.00 31.21 ? 607 DG  H N1    1 
ATOM   854  C C2    . DG  C 1 6  ? 17.459  37.841  22.881  1.00 32.84 ? 607 DG  H C2    1 
ATOM   855  N N2    . DG  C 1 6  ? 17.843  39.115  22.709  1.00 30.18 ? 607 DG  H N2    1 
ATOM   856  N N3    . DG  C 1 6  ? 16.842  37.180  21.906  1.00 32.22 ? 607 DG  H N3    1 
ATOM   857  C C4    . DG  C 1 6  ? 16.562  35.900  22.264  1.00 34.27 ? 607 DG  H C4    1 
ATOM   858  P P     . DC  C 1 7  ? 15.609  34.681  15.986  1.00 41.15 ? 608 DC  H P     1 
ATOM   859  O OP1   . DC  C 1 7  ? 15.053  35.274  14.742  1.00 40.53 ? 608 DC  H OP1   1 
ATOM   860  O OP2   . DC  C 1 7  ? 15.971  33.244  16.024  1.00 40.52 ? 608 DC  H OP2   1 
ATOM   861  O "O5'" . DC  C 1 7  ? 16.870  35.544  16.405  1.00 38.65 ? 608 DC  H "O5'" 1 
ATOM   862  C "C5'" . DC  C 1 7  ? 16.691  36.918  16.713  1.00 41.62 ? 608 DC  H "C5'" 1 
ATOM   863  C "C4'" . DC  C 1 7  ? 17.964  37.506  17.264  1.00 40.48 ? 608 DC  H "C4'" 1 
ATOM   864  O "O4'" . DC  C 1 7  ? 18.141  37.170  18.665  1.00 39.57 ? 608 DC  H "O4'" 1 
ATOM   865  C "C3'" . DC  C 1 7  ? 19.231  37.049  16.540  1.00 41.06 ? 608 DC  H "C3'" 1 
ATOM   866  O "O3'" . DC  C 1 7  ? 19.986  38.189  16.173  1.00 42.65 ? 608 DC  H "O3'" 1 
ATOM   867  C "C2'" . DC  C 1 7  ? 19.989  36.261  17.596  1.00 40.37 ? 608 DC  H "C2'" 1 
ATOM   868  C "C1'" . DC  C 1 7  ? 19.520  36.921  18.884  1.00 39.29 ? 608 DC  H "C1'" 1 
ATOM   869  N N1    . DC  C 1 7  ? 19.662  36.103  20.106  1.00 35.67 ? 608 DC  H N1    1 
ATOM   870  C C2    . DC  C 1 7  ? 20.199  36.697  21.265  1.00 35.45 ? 608 DC  H C2    1 
ATOM   871  O O2    . DC  C 1 7  ? 20.560  37.877  21.228  1.00 35.87 ? 608 DC  H O2    1 
ATOM   872  N N3    . DC  C 1 7  ? 20.320  35.959  22.392  1.00 34.69 ? 608 DC  H N3    1 
ATOM   873  C C4    . DC  C 1 7  ? 19.953  34.675  22.393  1.00 34.45 ? 608 DC  H C4    1 
ATOM   874  N N4    . DC  C 1 7  ? 20.115  33.984  23.530  1.00 30.16 ? 608 DC  H N4    1 
ATOM   875  C C5    . DC  C 1 7  ? 19.411  34.042  21.230  1.00 30.37 ? 608 DC  H C5    1 
ATOM   876  C C6    . DC  C 1 7  ? 19.285  34.787  20.121  1.00 33.03 ? 608 DC  H C6    1 
ATOM   877  P P     . DA  C 1 8  ? 20.991  38.106  14.935  1.00 43.79 ? 609 DA  H P     1 
ATOM   878  O OP1   . DA  C 1 8  ? 20.410  38.936  13.861  1.00 44.05 ? 609 DA  H OP1   1 
ATOM   879  O OP2   . DA  C 1 8  ? 21.327  36.683  14.670  1.00 42.70 ? 609 DA  H OP2   1 
ATOM   880  O "O5'" . DA  C 1 8  ? 22.280  38.830  15.507  1.00 43.00 ? 609 DA  H "O5'" 1 
ATOM   881  C "C5'" . DA  C 1 8  ? 22.175  40.124  16.073  1.00 41.59 ? 609 DA  H "C5'" 1 
ATOM   882  C "C4'" . DA  C 1 8  ? 23.368  40.397  16.949  1.00 41.28 ? 609 DA  H "C4'" 1 
ATOM   883  O "O4'" . DA  C 1 8  ? 23.278  39.600  18.152  1.00 41.70 ? 609 DA  H "O4'" 1 
ATOM   884  C "C3'" . DA  C 1 8  ? 24.705  40.054  16.298  1.00 43.54 ? 609 DA  H "C3'" 1 
ATOM   885  O "O3'" . DA  C 1 8  ? 25.626  41.110  16.538  1.00 46.06 ? 609 DA  H "O3'" 1 
ATOM   886  C "C2'" . DA  C 1 8  ? 25.133  38.764  16.981  1.00 41.61 ? 609 DA  H "C2'" 1 
ATOM   887  C "C1'" . DA  C 1 8  ? 24.462  38.845  18.345  1.00 40.13 ? 609 DA  H "C1'" 1 
ATOM   888  N N9    . DA  C 1 8  ? 24.058  37.547  18.887  1.00 38.04 ? 609 DA  H N9    1 
ATOM   889  C C8    . DA  C 1 8  ? 23.449  36.517  18.212  1.00 36.96 ? 609 DA  H C8    1 
ATOM   890  N N7    . DA  C 1 8  ? 23.173  35.482  18.965  1.00 35.36 ? 609 DA  H N7    1 
ATOM   891  C C5    . DA  C 1 8  ? 23.640  35.848  20.219  1.00 36.81 ? 609 DA  H C5    1 
ATOM   892  C C6    . DA  C 1 8  ? 23.648  35.183  21.453  1.00 35.35 ? 609 DA  H C6    1 
ATOM   893  N N6    . DA  C 1 8  ? 23.154  33.959  21.630  1.00 31.62 ? 609 DA  H N6    1 
ATOM   894  N N1    . DA  C 1 8  ? 24.188  35.825  22.512  1.00 35.43 ? 609 DA  H N1    1 
ATOM   895  C C2    . DA  C 1 8  ? 24.690  37.048  22.328  1.00 35.21 ? 609 DA  H C2    1 
ATOM   896  N N3    . DA  C 1 8  ? 24.745  37.777  21.217  1.00 36.51 ? 609 DA  H N3    1 
ATOM   897  C C4    . DA  C 1 8  ? 24.194  37.114  20.186  1.00 36.94 ? 609 DA  H C4    1 
ATOM   898  P P     . DC  C 1 9  ? 27.123  41.002  15.984  1.00 49.52 ? 610 DC  H P     1 
ATOM   899  O OP1   . DC  C 1 9  ? 27.479  42.341  15.452  1.00 48.53 ? 610 DC  H OP1   1 
ATOM   900  O OP2   . DC  C 1 9  ? 27.272  39.804  15.117  1.00 47.78 ? 610 DC  H OP2   1 
ATOM   901  O "O5'" . DC  C 1 9  ? 27.949  40.768  17.316  1.00 45.64 ? 610 DC  H "O5'" 1 
ATOM   902  C "C5'" . DC  C 1 9  ? 27.577  41.458  18.499  1.00 42.77 ? 610 DC  H "C5'" 1 
ATOM   903  C "C4'" . DC  C 1 9  ? 28.279  40.857  19.691  1.00 42.89 ? 610 DC  H "C4'" 1 
ATOM   904  O "O4'" . DC  C 1 9  ? 27.643  39.616  20.086  1.00 38.25 ? 610 DC  H "O4'" 1 
ATOM   905  C "C3'" . DC  C 1 9  ? 29.757  40.537  19.452  1.00 42.01 ? 610 DC  H "C3'" 1 
ATOM   906  O "O3'" . DC  C 1 9  ? 30.559  41.100  20.491  1.00 43.10 ? 610 DC  H "O3'" 1 
ATOM   907  C "C2'" . DC  C 1 9  ? 29.812  39.018  19.488  1.00 40.93 ? 610 DC  H "C2'" 1 
ATOM   908  C "C1'" . DC  C 1 9  ? 28.645  38.662  20.392  1.00 39.43 ? 610 DC  H "C1'" 1 
ATOM   909  N N1    . DC  C 1 9  ? 28.075  37.313  20.189  1.00 35.68 ? 610 DC  H N1    1 
ATOM   910  C C2    . DC  C 1 9  ? 27.996  36.452  21.287  1.00 33.95 ? 610 DC  H C2    1 
ATOM   911  O O2    . DC  C 1 9  ? 28.447  36.828  22.372  1.00 32.11 ? 610 DC  H O2    1 
ATOM   912  N N3    . DC  C 1 9  ? 27.439  35.231  21.135  1.00 31.41 ? 610 DC  H N3    1 
ATOM   913  C C4    . DC  C 1 9  ? 26.982  34.850  19.938  1.00 33.89 ? 610 DC  H C4    1 
ATOM   914  N N4    . DC  C 1 9  ? 26.413  33.634  19.839  1.00 31.10 ? 610 DC  H N4    1 
ATOM   915  C C5    . DC  C 1 9  ? 27.077  35.696  18.793  1.00 29.93 ? 610 DC  H C5    1 
ATOM   916  C C6    . DC  C 1 9  ? 27.625  36.909  18.964  1.00 32.51 ? 610 DC  H C6    1 
ATOM   917  P P     . DG  C 1 10 ? 32.099  41.450  20.206  1.00 46.14 ? 611 DG  H P     1 
ATOM   918  O OP1   . DG  C 1 10 ? 32.362  42.740  20.907  1.00 44.85 ? 611 DG  H OP1   1 
ATOM   919  O OP2   . DG  C 1 10 ? 32.389  41.328  18.764  1.00 44.00 ? 611 DG  H OP2   1 
ATOM   920  O "O5'" . DG  C 1 10 ? 32.877  40.295  20.975  1.00 44.06 ? 611 DG  H "O5'" 1 
ATOM   921  C "C5'" . DG  C 1 10 ? 32.755  40.184  22.380  1.00 41.73 ? 611 DG  H "C5'" 1 
ATOM   922  C "C4'" . DG  C 1 10 ? 33.458  38.949  22.883  1.00 40.53 ? 611 DG  H "C4'" 1 
ATOM   923  O "O4'" . DG  C 1 10 ? 32.677  37.764  22.587  1.00 39.43 ? 611 DG  H "O4'" 1 
ATOM   924  C "C3'" . DG  C 1 10 ? 34.864  38.703  22.327  1.00 41.89 ? 611 DG  H "C3'" 1 
ATOM   925  O "O3'" . DG  C 1 10 ? 35.723  38.406  23.437  1.00 43.34 ? 611 DG  H "O3'" 1 
ATOM   926  C "C2'" . DG  C 1 10 ? 34.667  37.520  21.383  1.00 37.33 ? 611 DG  H "C2'" 1 
ATOM   927  C "C1'" . DG  C 1 10 ? 33.514  36.764  22.032  1.00 36.16 ? 611 DG  H "C1'" 1 
ATOM   928  N N9    . DG  C 1 10 ? 32.686  35.944  21.147  1.00 32.91 ? 611 DG  H N9    1 
ATOM   929  C C8    . DG  C 1 10 ? 32.351  36.203  19.837  1.00 30.28 ? 611 DG  H C8    1 
ATOM   930  N N7    . DG  C 1 10 ? 31.533  35.315  19.333  1.00 32.51 ? 611 DG  H N7    1 
ATOM   931  C C5    . DG  C 1 10 ? 31.326  34.409  20.366  1.00 31.33 ? 611 DG  H C5    1 
ATOM   932  C C6    . DG  C 1 10 ? 30.520  33.238  20.418  1.00 32.62 ? 611 DG  H C6    1 
ATOM   933  O O6    . DG  C 1 10 ? 29.808  32.744  19.525  1.00 35.04 ? 611 DG  H O6    1 
ATOM   934  N N1    . DG  C 1 10 ? 30.595  32.623  21.664  1.00 31.32 ? 611 DG  H N1    1 
ATOM   935  C C2    . DG  C 1 10 ? 31.346  33.068  22.723  1.00 30.20 ? 611 DG  H C2    1 
ATOM   936  N N2    . DG  C 1 10 ? 31.262  32.342  23.849  1.00 28.95 ? 611 DG  H N2    1 
ATOM   937  N N3    . DG  C 1 10 ? 32.112  34.148  22.684  1.00 29.33 ? 611 DG  H N3    1 
ATOM   938  C C4    . DG  C 1 10 ? 32.049  34.770  21.486  1.00 31.66 ? 611 DG  H C4    1 
ATOM   939  P P     . DT  C 1 11 ? 37.302  38.168  23.215  1.00 46.58 ? 612 DT  H P     1 
ATOM   940  O OP1   . DT  C 1 11 ? 38.030  38.865  24.302  1.00 45.97 ? 612 DT  H OP1   1 
ATOM   941  O OP2   . DT  C 1 11 ? 37.674  38.416  21.799  1.00 43.66 ? 612 DT  H OP2   1 
ATOM   942  O "O5'" . DT  C 1 11 ? 37.420  36.619  23.516  1.00 45.34 ? 612 DT  H "O5'" 1 
ATOM   943  C "C5'" . DT  C 1 11 ? 36.350  35.775  23.172  1.00 46.00 ? 612 DT  H "C5'" 1 
ATOM   944  C "C4'" . DT  C 1 11 ? 36.434  34.485  23.936  1.00 46.15 ? 612 DT  H "C4'" 1 
ATOM   945  O "O4'" . DT  C 1 11 ? 35.342  33.689  23.439  1.00 42.81 ? 612 DT  H "O4'" 1 
ATOM   946  C "C3'" . DT  C 1 11 ? 37.710  33.715  23.621  1.00 46.84 ? 612 DT  H "C3'" 1 
ATOM   947  O "O3'" . DT  C 1 11 ? 38.152  32.979  24.757  1.00 49.69 ? 612 DT  H "O3'" 1 
ATOM   948  C "C2'" . DT  C 1 11 ? 37.316  32.823  22.460  1.00 46.04 ? 612 DT  H "C2'" 1 
ATOM   949  C "C1'" . DT  C 1 11 ? 35.813  32.628  22.635  1.00 44.75 ? 612 DT  H "C1'" 1 
ATOM   950  N N1    . DT  C 1 11 ? 35.062  32.670  21.368  1.00 41.76 ? 612 DT  H N1    1 
ATOM   951  C C2    . DT  C 1 11 ? 34.143  31.687  21.147  1.00 40.95 ? 612 DT  H C2    1 
ATOM   952  O O2    . DT  C 1 11 ? 33.899  30.812  21.965  1.00 43.97 ? 612 DT  H O2    1 
ATOM   953  N N3    . DT  C 1 11 ? 33.513  31.758  19.934  1.00 40.81 ? 612 DT  H N3    1 
ATOM   954  C C4    . DT  C 1 11 ? 33.706  32.698  18.943  1.00 39.21 ? 612 DT  H C4    1 
ATOM   955  O O4    . DT  C 1 11 ? 33.081  32.613  17.888  1.00 38.67 ? 612 DT  H O4    1 
ATOM   956  C C5    . DT  C 1 11 ? 34.668  33.722  19.251  1.00 40.12 ? 612 DT  H C5    1 
ATOM   957  C C7    . DT  C 1 11 ? 34.926  34.800  18.243  1.00 39.11 ? 612 DT  H C7    1 
ATOM   958  C C6    . DT  C 1 11 ? 35.293  33.660  20.434  1.00 40.19 ? 612 DT  H C6    1 
ATOM   959  P P     . DG  C 1 12 ? 39.589  32.261  24.718  1.00 52.11 ? 613 DG  H P     1 
ATOM   960  O OP1   . DG  C 1 12 ? 40.240  32.482  26.032  1.00 51.68 ? 613 DG  H OP1   1 
ATOM   961  O OP2   . DG  C 1 12 ? 40.286  32.669  23.470  1.00 48.16 ? 613 DG  H OP2   1 
ATOM   962  O "O5'" . DG  C 1 12 ? 39.217  30.720  24.601  1.00 52.11 ? 613 DG  H "O5'" 1 
ATOM   963  C "C5'" . DG  C 1 12 ? 38.346  30.115  25.547  1.00 53.65 ? 613 DG  H "C5'" 1 
ATOM   964  C "C4'" . DG  C 1 12 ? 38.001  28.716  25.103  1.00 55.09 ? 613 DG  H "C4'" 1 
ATOM   965  O "O4'" . DG  C 1 12 ? 37.136  28.781  23.941  1.00 52.40 ? 613 DG  H "O4'" 1 
ATOM   966  C "C3'" . DG  C 1 12 ? 39.221  27.894  24.686  1.00 57.29 ? 613 DG  H "C3'" 1 
ATOM   967  O "O3'" . DG  C 1 12 ? 39.086  26.546  25.147  1.00 61.12 ? 613 DG  H "O3'" 1 
ATOM   968  C "C2'" . DG  C 1 12 ? 39.198  27.972  23.168  1.00 54.63 ? 613 DG  H "C2'" 1 
ATOM   969  C "C1'" . DG  C 1 12 ? 37.711  28.053  22.866  1.00 52.26 ? 613 DG  H "C1'" 1 
ATOM   970  N N9    . DG  C 1 12 ? 37.367  28.739  21.620  1.00 49.82 ? 613 DG  H N9    1 
ATOM   971  C C8    . DG  C 1 12 ? 37.918  29.898  21.128  1.00 49.41 ? 613 DG  H C8    1 
ATOM   972  N N7    . DG  C 1 12 ? 37.387  30.280  19.997  1.00 47.62 ? 613 DG  H N7    1 
ATOM   973  C C5    . DG  C 1 12 ? 36.430  29.314  19.723  1.00 47.05 ? 613 DG  H C5    1 
ATOM   974  C C6    . DG  C 1 12 ? 35.521  29.199  18.635  1.00 45.49 ? 613 DG  H C6    1 
ATOM   975  O O6    . DG  C 1 12 ? 35.368  29.960  17.671  1.00 42.72 ? 613 DG  H O6    1 
ATOM   976  N N1    . DG  C 1 12 ? 34.736  28.060  18.747  1.00 44.03 ? 613 DG  H N1    1 
ATOM   977  C C2    . DG  C 1 12 ? 34.803  27.151  19.774  1.00 44.61 ? 613 DG  H C2    1 
ATOM   978  N N2    . DG  C 1 12 ? 33.954  26.119  19.701  1.00 43.30 ? 613 DG  H N2    1 
ATOM   979  N N3    . DG  C 1 12 ? 35.636  27.250  20.796  1.00 45.26 ? 613 DG  H N3    1 
ATOM   980  C C4    . DG  C 1 12 ? 36.413  28.348  20.709  1.00 47.54 ? 613 DG  H C4    1 
ATOM   981  P P     . DC  C 1 13 ? 40.218  25.459  24.790  1.00 64.81 ? 614 DC  H P     1 
ATOM   982  O OP1   . DC  C 1 13 ? 40.416  24.624  26.005  1.00 64.79 ? 614 DC  H OP1   1 
ATOM   983  O OP2   . DC  C 1 13 ? 41.386  26.133  24.160  1.00 63.83 ? 614 DC  H OP2   1 
ATOM   984  O "O5'" . DC  C 1 13 ? 39.510  24.561  23.686  1.00 63.47 ? 614 DC  H "O5'" 1 
ATOM   985  C "C5'" . DC  C 1 13 ? 38.236  23.985  23.943  1.00 63.41 ? 614 DC  H "C5'" 1 
ATOM   986  C "C4'" . DC  C 1 13 ? 37.803  23.136  22.774  1.00 62.51 ? 614 DC  H "C4'" 1 
ATOM   987  O "O4'" . DC  C 1 13 ? 37.335  23.980  21.694  1.00 60.90 ? 614 DC  H "O4'" 1 
ATOM   988  C "C3'" . DC  C 1 13 ? 38.912  22.256  22.195  1.00 62.63 ? 614 DC  H "C3'" 1 
ATOM   989  O "O3'" . DC  C 1 13 ? 38.411  20.938  21.962  1.00 65.11 ? 614 DC  H "O3'" 1 
ATOM   990  C "C2'" . DC  C 1 13 ? 39.285  22.951  20.895  1.00 60.51 ? 614 DC  H "C2'" 1 
ATOM   991  C "C1'" . DC  C 1 13 ? 37.980  23.619  20.483  1.00 59.10 ? 614 DC  H "C1'" 1 
ATOM   992  N N1    . DC  C 1 13 ? 38.128  24.841  19.665  1.00 55.54 ? 614 DC  H N1    1 
ATOM   993  C C2    . DC  C 1 13 ? 37.381  24.958  18.485  1.00 53.61 ? 614 DC  H C2    1 
ATOM   994  O O2    . DC  C 1 13 ? 36.606  24.045  18.172  1.00 53.32 ? 614 DC  H O2    1 
ATOM   995  N N3    . DC  C 1 13 ? 37.521  26.064  17.717  1.00 51.85 ? 614 DC  H N3    1 
ATOM   996  C C4    . DC  C 1 13 ? 38.362  27.030  18.086  1.00 50.37 ? 614 DC  H C4    1 
ATOM   997  N N4    . DC  C 1 13 ? 38.476  28.094  17.288  1.00 47.20 ? 614 DC  H N4    1 
ATOM   998  C C5    . DC  C 1 13 ? 39.126  26.946  19.290  1.00 52.59 ? 614 DC  H C5    1 
ATOM   999  C C6    . DC  C 1 13 ? 38.979  25.843  20.042  1.00 54.16 ? 614 DC  H C6    1 
ATOM   1000 P P     . DT  C 1 14 ? 39.427  19.748  21.592  1.00 66.27 ? 615 DT  H P     1 
ATOM   1001 O OP1   . DT  C 1 14 ? 39.176  18.643  22.553  1.00 66.87 ? 615 DT  H OP1   1 
ATOM   1002 O OP2   . DT  C 1 14 ? 40.797  20.303  21.446  1.00 64.96 ? 615 DT  H OP2   1 
ATOM   1003 O "O5'" . DT  C 1 14 ? 38.918  19.305  20.155  1.00 65.77 ? 615 DT  H "O5'" 1 
ATOM   1004 C "C5'" . DT  C 1 14 ? 38.422  20.287  19.260  1.00 67.02 ? 615 DT  H "C5'" 1 
ATOM   1005 C "C4'" . DT  C 1 14 ? 37.706  19.643  18.100  1.00 66.99 ? 615 DT  H "C4'" 1 
ATOM   1006 O "O4'" . DT  C 1 14 ? 37.346  20.717  17.204  1.00 67.07 ? 615 DT  H "O4'" 1 
ATOM   1007 C "C3'" . DT  C 1 14 ? 38.599  18.715  17.288  1.00 67.43 ? 615 DT  H "C3'" 1 
ATOM   1008 O "O3'" . DT  C 1 14 ? 37.831  17.694  16.650  1.00 67.69 ? 615 DT  H "O3'" 1 
ATOM   1009 C "C2'" . DT  C 1 14 ? 39.249  19.643  16.282  1.00 67.28 ? 615 DT  H "C2'" 1 
ATOM   1010 C "C1'" . DT  C 1 14 ? 38.228  20.758  16.093  1.00 66.77 ? 615 DT  H "C1'" 1 
ATOM   1011 N N1    . DT  C 1 14 ? 38.852  22.091  16.079  1.00 65.69 ? 615 DT  H N1    1 
ATOM   1012 C C2    . DT  C 1 14 ? 38.509  22.954  15.074  1.00 64.95 ? 615 DT  H C2    1 
ATOM   1013 O O2    . DT  C 1 14 ? 37.699  22.673  14.207  1.00 64.62 ? 615 DT  H O2    1 
ATOM   1014 N N3    . DT  C 1 14 ? 39.149  24.168  15.121  1.00 64.29 ? 615 DT  H N3    1 
ATOM   1015 C C4    . DT  C 1 14 ? 40.072  24.591  16.060  1.00 64.22 ? 615 DT  H C4    1 
ATOM   1016 O O4    . DT  C 1 14 ? 40.565  25.713  15.973  1.00 63.92 ? 615 DT  H O4    1 
ATOM   1017 C C5    . DT  C 1 14 ? 40.379  23.633  17.094  1.00 64.57 ? 615 DT  H C5    1 
ATOM   1018 C C7    . DT  C 1 14 ? 41.367  24.001  18.156  1.00 63.71 ? 615 DT  H C7    1 
ATOM   1019 C C6    . DT  C 1 14 ? 39.761  22.448  17.053  1.00 65.03 ? 615 DT  H C6    1 
ATOM   1020 P P     . DA  C 1 15 ? 38.586  16.529  15.842  1.00 67.89 ? 616 DA  H P     1 
ATOM   1021 O OP1   . DA  C 1 15 ? 37.655  15.376  15.731  1.00 68.12 ? 616 DA  H OP1   1 
ATOM   1022 O OP2   . DA  C 1 15 ? 39.932  16.334  16.440  1.00 68.30 ? 616 DA  H OP2   1 
ATOM   1023 O "O5'" . DA  C 1 15 ? 38.783  17.151  14.393  1.00 67.39 ? 616 DA  H "O5'" 1 
ATOM   1024 C "C5'" . DA  C 1 15 ? 37.659  17.551  13.621  1.00 66.63 ? 616 DA  H "C5'" 1 
ATOM   1025 C "C4'" . DA  C 1 15 ? 38.116  18.134  12.307  1.00 66.70 ? 616 DA  H "C4'" 1 
ATOM   1026 O "O4'" . DA  C 1 15 ? 38.620  19.480  12.494  1.00 64.90 ? 616 DA  H "O4'" 1 
ATOM   1027 C "C3'" . DA  C 1 15 ? 39.238  17.342  11.635  1.00 66.86 ? 616 DA  H "C3'" 1 
ATOM   1028 O "O3'" . DA  C 1 15 ? 38.976  17.250  10.239  1.00 68.41 ? 616 DA  H "O3'" 1 
ATOM   1029 C "C2'" . DA  C 1 15 ? 40.475  18.183  11.899  1.00 66.33 ? 616 DA  H "C2'" 1 
ATOM   1030 C "C1'" . DA  C 1 15 ? 39.911  19.596  11.919  1.00 65.45 ? 616 DA  H "C1'" 1 
ATOM   1031 N N9    . DA  C 1 15 ? 40.676  20.555  12.719  1.00 63.98 ? 616 DA  H N9    1 
ATOM   1032 C C8    . DA  C 1 15 ? 41.297  20.336  13.924  1.00 64.64 ? 616 DA  H C8    1 
ATOM   1033 N N7    . DA  C 1 15 ? 41.904  21.393  14.408  1.00 64.00 ? 616 DA  H N7    1 
ATOM   1034 C C5    . DA  C 1 15 ? 41.672  22.376  13.458  1.00 63.33 ? 616 DA  H C5    1 
ATOM   1035 C C6    . DA  C 1 15 ? 42.055  23.729  13.381  1.00 63.46 ? 616 DA  H C6    1 
ATOM   1036 N N6    . DA  C 1 15 ? 42.778  24.350  14.317  1.00 61.42 ? 616 DA  H N6    1 
ATOM   1037 N N1    . DA  C 1 15 ? 41.664  24.430  12.296  1.00 62.88 ? 616 DA  H N1    1 
ATOM   1038 C C2    . DA  C 1 15 ? 40.936  23.809  11.361  1.00 63.05 ? 616 DA  H C2    1 
ATOM   1039 N N3    . DA  C 1 15 ? 40.511  22.547  11.320  1.00 63.23 ? 616 DA  H N3    1 
ATOM   1040 C C4    . DA  C 1 15 ? 40.917  21.875  12.411  1.00 63.77 ? 616 DA  H C4    1 
ATOM   1041 P P     . DC  C 1 16 ? 39.880  16.299  9.318   1.00 69.10 ? 617 DC  H P     1 
ATOM   1042 O OP1   . DC  C 1 16 ? 38.969  15.355  8.626   1.00 69.98 ? 617 DC  H OP1   1 
ATOM   1043 O OP2   . DC  C 1 16 ? 41.024  15.779  10.109  1.00 69.91 ? 617 DC  H OP2   1 
ATOM   1044 O "O5'" . DC  C 1 16 ? 40.435  17.307  8.228   1.00 68.35 ? 617 DC  H "O5'" 1 
ATOM   1045 C "C5'" . DC  C 1 16 ? 39.559  18.236  7.604   1.00 67.29 ? 617 DC  H "C5'" 1 
ATOM   1046 C "C4'" . DC  C 1 16 ? 40.369  19.289  6.893   1.00 66.61 ? 617 DC  H "C4'" 1 
ATOM   1047 O "O4'" . DC  C 1 16 ? 40.864  20.260  7.852   1.00 65.48 ? 617 DC  H "O4'" 1 
ATOM   1048 C "C3'" . DC  C 1 16 ? 41.596  18.677  6.224   1.00 66.69 ? 617 DC  H "C3'" 1 
ATOM   1049 O "O3'" . DC  C 1 16 ? 41.754  19.149  4.893   1.00 66.18 ? 617 DC  H "O3'" 1 
ATOM   1050 C "C2'" . DC  C 1 16 ? 42.753  19.110  7.108   1.00 66.11 ? 617 DC  H "C2'" 1 
ATOM   1051 C "C1'" . DC  C 1 16 ? 42.263  20.419  7.699   1.00 65.57 ? 617 DC  H "C1'" 1 
ATOM   1052 N N1    . DC  C 1 16 ? 42.843  20.712  9.022   1.00 65.33 ? 617 DC  H N1    1 
ATOM   1053 C C2    . DC  C 1 16 ? 43.431  21.963  9.244   1.00 65.16 ? 617 DC  H C2    1 
ATOM   1054 O O2    . DC  C 1 16 ? 43.405  22.811  8.341   1.00 64.76 ? 617 DC  H O2    1 
ATOM   1055 N N3    . DC  C 1 16 ? 44.014  22.215  10.439  1.00 65.48 ? 617 DC  H N3    1 
ATOM   1056 C C4    . DC  C 1 16 ? 44.021  21.279  11.389  1.00 65.02 ? 617 DC  H C4    1 
ATOM   1057 N N4    . DC  C 1 16 ? 44.630  21.563  12.542  1.00 64.99 ? 617 DC  H N4    1 
ATOM   1058 C C5    . DC  C 1 16 ? 43.408  20.008  11.198  1.00 65.42 ? 617 DC  H C5    1 
ATOM   1059 C C6    . DC  C 1 16 ? 42.832  19.771  10.013  1.00 65.24 ? 617 DC  H C6    1 
ATOM   1060 P P     . DT  C 1 17 ? 43.154  18.928  4.150   1.00 66.74 ? 618 DT  H P     1 
ATOM   1061 O OP1   . DT  C 1 17 ? 42.885  18.759  2.699   1.00 65.97 ? 618 DT  H OP1   1 
ATOM   1062 O OP2   . DT  C 1 17 ? 43.922  17.889  4.887   1.00 65.43 ? 618 DT  H OP2   1 
ATOM   1063 O "O5'" . DT  C 1 17 ? 43.860  20.332  4.369   1.00 64.16 ? 618 DT  H "O5'" 1 
ATOM   1064 C "C5'" . DT  C 1 17 ? 43.129  21.529  4.138   1.00 61.27 ? 618 DT  H "C5'" 1 
ATOM   1065 C "C4'" . DT  C 1 17 ? 44.081  22.684  3.974   1.00 58.69 ? 618 DT  H "C4'" 1 
ATOM   1066 O "O4'" . DT  C 1 17 ? 44.564  23.093  5.275   1.00 57.28 ? 618 DT  H "O4'" 1 
ATOM   1067 C "C3'" . DT  C 1 17 ? 45.309  22.318  3.145   1.00 58.35 ? 618 DT  H "C3'" 1 
ATOM   1068 O "O3'" . DT  C 1 17 ? 45.615  23.358  2.222   1.00 58.49 ? 618 DT  H "O3'" 1 
ATOM   1069 C "C2'" . DT  C 1 17 ? 46.411  22.136  4.177   1.00 57.29 ? 618 DT  H "C2'" 1 
ATOM   1070 C "C1'" . DT  C 1 17 ? 45.982  23.049  5.317   1.00 56.01 ? 618 DT  H "C1'" 1 
ATOM   1071 N N1    . DT  C 1 17 ? 46.362  22.554  6.649   1.00 54.54 ? 618 DT  H N1    1 
ATOM   1072 C C2    . DT  C 1 17 ? 46.910  23.438  7.552   1.00 52.59 ? 618 DT  H C2    1 
ATOM   1073 O O2    . DT  C 1 17 ? 47.111  24.613  7.300   1.00 52.05 ? 618 DT  H O2    1 
ATOM   1074 N N3    . DT  C 1 17 ? 47.217  22.888  8.770   1.00 52.30 ? 618 DT  H N3    1 
ATOM   1075 C C4    . DT  C 1 17 ? 47.037  21.575  9.164   1.00 51.25 ? 618 DT  H C4    1 
ATOM   1076 O O4    . DT  C 1 17 ? 47.357  21.228  10.293  1.00 52.55 ? 618 DT  H O4    1 
ATOM   1077 C C5    . DT  C 1 17 ? 46.463  20.705  8.167   1.00 52.18 ? 618 DT  H C5    1 
ATOM   1078 C C7    . DT  C 1 17 ? 46.227  19.268  8.505   1.00 53.03 ? 618 DT  H C7    1 
ATOM   1079 C C6    . DT  C 1 17 ? 46.161  21.229  6.976   1.00 52.57 ? 618 DT  H C6    1 
ATOM   1080 P P     . DC  C 1 18 ? 46.670  23.085  1.049   1.00 60.63 ? 619 DC  H P     1 
ATOM   1081 O OP1   . DC  C 1 18 ? 46.003  23.381  -0.244  1.00 60.01 ? 619 DC  H OP1   1 
ATOM   1082 O OP2   . DC  C 1 18 ? 47.295  21.750  1.268   1.00 58.79 ? 619 DC  H OP2   1 
ATOM   1083 O "O5'" . DC  C 1 18 ? 47.770  24.201  1.309   1.00 58.53 ? 619 DC  H "O5'" 1 
ATOM   1084 C "C5'" . DC  C 1 18 ? 49.143  23.898  1.202   1.00 57.60 ? 619 DC  H "C5'" 1 
ATOM   1085 C "C4'" . DC  C 1 18 ? 49.957  24.893  1.989   1.00 57.71 ? 619 DC  H "C4'" 1 
ATOM   1086 O "O4'" . DC  C 1 18 ? 49.671  24.730  3.405   1.00 56.79 ? 619 DC  H "O4'" 1 
ATOM   1087 C "C3'" . DC  C 1 18 ? 51.459  24.681  1.833   1.00 56.11 ? 619 DC  H "C3'" 1 
ATOM   1088 O "O3'" . DC  C 1 18 ? 52.097  25.958  1.917   1.00 59.03 ? 619 DC  H "O3'" 1 
ATOM   1089 C "C2'" . DC  C 1 18 ? 51.804  23.820  3.033   1.00 56.63 ? 619 DC  H "C2'" 1 
ATOM   1090 C "C1'" . DC  C 1 18 ? 50.853  24.353  4.096   1.00 55.15 ? 619 DC  H "C1'" 1 
ATOM   1091 N N1    . DC  C 1 18 ? 50.494  23.374  5.142   1.00 52.46 ? 619 DC  H N1    1 
ATOM   1092 C C2    . DC  C 1 18 ? 50.637  23.745  6.485   1.00 51.92 ? 619 DC  H C2    1 
ATOM   1093 O O2    . DC  C 1 18 ? 51.010  24.897  6.750   1.00 52.56 ? 619 DC  H O2    1 
ATOM   1094 N N3    . DC  C 1 18 ? 50.364  22.841  7.455   1.00 50.23 ? 619 DC  H N3    1 
ATOM   1095 C C4    . DC  C 1 18 ? 49.955  21.614  7.127   1.00 50.15 ? 619 DC  H C4    1 
ATOM   1096 N N4    . DC  C 1 18 ? 49.724  20.745  8.117   1.00 47.60 ? 619 DC  H N4    1 
ATOM   1097 C C5    . DC  C 1 18 ? 49.772  21.219  5.767   1.00 49.26 ? 619 DC  H C5    1 
ATOM   1098 C C6    . DC  C 1 18 ? 50.049  22.122  4.817   1.00 51.35 ? 619 DC  H C6    1 
ATOM   1099 O "O5'" . DG  D 1 1  ? 55.644  22.644  16.556  1.00 71.90 ? 802 DG  J "O5'" 1 
ATOM   1100 C "C5'" . DG  D 1 1  ? 56.810  23.390  16.216  1.00 70.14 ? 802 DG  J "C5'" 1 
ATOM   1101 C "C4'" . DG  D 1 1  ? 56.536  24.617  15.375  1.00 70.49 ? 802 DG  J "C4'" 1 
ATOM   1102 O "O4'" . DG  D 1 1  ? 55.896  24.233  14.135  1.00 69.64 ? 802 DG  J "O4'" 1 
ATOM   1103 C "C3'" . DG  D 1 1  ? 55.623  25.664  16.011  1.00 70.95 ? 802 DG  J "C3'" 1 
ATOM   1104 O "O3'" . DG  D 1 1  ? 56.080  26.974  15.649  1.00 72.86 ? 802 DG  J "O3'" 1 
ATOM   1105 C "C2'" . DG  D 1 1  ? 54.266  25.365  15.400  1.00 69.88 ? 802 DG  J "C2'" 1 
ATOM   1106 C "C1'" . DG  D 1 1  ? 54.626  24.864  14.010  1.00 68.06 ? 802 DG  J "C1'" 1 
ATOM   1107 N N9    . DG  D 1 1  ? 53.699  23.874  13.469  1.00 65.05 ? 802 DG  J N9    1 
ATOM   1108 C C8    . DG  D 1 1  ? 53.292  22.712  14.077  1.00 64.44 ? 802 DG  J C8    1 
ATOM   1109 N N7    . DG  D 1 1  ? 52.485  22.002  13.339  1.00 62.70 ? 802 DG  J N7    1 
ATOM   1110 C C5    . DG  D 1 1  ? 52.343  22.741  12.175  1.00 62.58 ? 802 DG  J C5    1 
ATOM   1111 C C6    . DG  D 1 1  ? 51.593  22.470  11.005  1.00 62.04 ? 802 DG  J C6    1 
ATOM   1112 O O6    . DG  D 1 1  ? 50.880  21.488  10.756  1.00 62.30 ? 802 DG  J O6    1 
ATOM   1113 N N1    . DG  D 1 1  ? 51.729  23.487  10.064  1.00 61.03 ? 802 DG  J N1    1 
ATOM   1114 C C2    . DG  D 1 1  ? 52.489  24.619  10.231  1.00 61.59 ? 802 DG  J C2    1 
ATOM   1115 N N2    . DG  D 1 1  ? 52.493  25.485  9.212   1.00 61.81 ? 802 DG  J N2    1 
ATOM   1116 N N3    . DG  D 1 1  ? 53.193  24.883  11.319  1.00 62.59 ? 802 DG  J N3    1 
ATOM   1117 C C4    . DG  D 1 1  ? 53.077  23.906  12.243  1.00 63.65 ? 802 DG  J C4    1 
ATOM   1118 P P     . DA  D 1 2  ? 55.311  28.275  16.200  1.00 74.24 ? 803 DA  J P     1 
ATOM   1119 O OP1   . DA  D 1 2  ? 56.252  29.422  16.135  1.00 74.08 ? 803 DA  J OP1   1 
ATOM   1120 O OP2   . DA  D 1 2  ? 54.653  27.939  17.491  1.00 74.45 ? 803 DA  J OP2   1 
ATOM   1121 O "O5'" . DA  D 1 2  ? 54.181  28.507  15.107  1.00 73.05 ? 803 DA  J "O5'" 1 
ATOM   1122 C "C5'" . DA  D 1 2  ? 53.110  29.403  15.342  1.00 71.17 ? 803 DA  J "C5'" 1 
ATOM   1123 C "C4'" . DA  D 1 2  ? 52.440  29.744  14.035  1.00 70.20 ? 803 DA  J "C4'" 1 
ATOM   1124 O "O4'" . DA  D 1 2  ? 52.158  28.517  13.318  1.00 69.19 ? 803 DA  J "O4'" 1 
ATOM   1125 C "C3'" . DA  D 1 2  ? 51.104  30.468  14.188  1.00 69.76 ? 803 DA  J "C3'" 1 
ATOM   1126 O "O3'" . DA  D 1 2  ? 50.959  31.453  13.164  1.00 70.14 ? 803 DA  J "O3'" 1 
ATOM   1127 C "C2'" . DA  D 1 2  ? 50.082  29.359  14.026  1.00 68.77 ? 803 DA  J "C2'" 1 
ATOM   1128 C "C1'" . DA  D 1 2  ? 50.766  28.408  13.059  1.00 67.87 ? 803 DA  J "C1'" 1 
ATOM   1129 N N9    . DA  D 1 2  ? 50.385  27.007  13.242  1.00 65.91 ? 803 DA  J N9    1 
ATOM   1130 C C8    . DA  D 1 2  ? 50.571  26.220  14.353  1.00 65.79 ? 803 DA  J C8    1 
ATOM   1131 N N7    . DA  D 1 2  ? 50.100  25.003  14.223  1.00 64.45 ? 803 DA  J N7    1 
ATOM   1132 C C5    . DA  D 1 2  ? 49.568  24.986  12.941  1.00 64.87 ? 803 DA  J C5    1 
ATOM   1133 C C6    . DA  D 1 2  ? 48.909  23.986  12.199  1.00 64.91 ? 803 DA  J C6    1 
ATOM   1134 N N6    . DA  D 1 2  ? 48.650  22.761  12.668  1.00 64.99 ? 803 DA  J N6    1 
ATOM   1135 N N1    . DA  D 1 2  ? 48.517  24.292  10.944  1.00 63.78 ? 803 DA  J N1    1 
ATOM   1136 C C2    . DA  D 1 2  ? 48.768  25.522  10.476  1.00 64.53 ? 803 DA  J C2    1 
ATOM   1137 N N3    . DA  D 1 2  ? 49.368  26.547  11.076  1.00 64.27 ? 803 DA  J N3    1 
ATOM   1138 C C4    . DA  D 1 2  ? 49.748  26.211  12.321  1.00 65.37 ? 803 DA  J C4    1 
ATOM   1139 P P     . DG  D 1 3  ? 49.813  32.570  13.295  1.00 69.78 ? 804 DG  J P     1 
ATOM   1140 O OP1   . DG  D 1 3  ? 50.434  33.902  13.067  1.00 69.22 ? 804 DG  J OP1   1 
ATOM   1141 O OP2   . DG  D 1 3  ? 49.048  32.319  14.546  1.00 70.24 ? 804 DG  J OP2   1 
ATOM   1142 O "O5'" . DG  D 1 3  ? 48.874  32.267  12.052  1.00 69.07 ? 804 DG  J "O5'" 1 
ATOM   1143 C "C5'" . DG  D 1 3  ? 49.384  32.361  10.727  1.00 68.54 ? 804 DG  J "C5'" 1 
ATOM   1144 C "C4'" . DG  D 1 3  ? 48.321  31.952  9.740   1.00 67.39 ? 804 DG  J "C4'" 1 
ATOM   1145 O "O4'" . DG  D 1 3  ? 48.116  30.521  9.823   1.00 66.68 ? 804 DG  J "O4'" 1 
ATOM   1146 C "C3'" . DG  D 1 3  ? 46.965  32.597  10.016  1.00 67.34 ? 804 DG  J "C3'" 1 
ATOM   1147 O "O3'" . DG  D 1 3  ? 46.342  32.977  8.793   1.00 68.23 ? 804 DG  J "O3'" 1 
ATOM   1148 C "C2'" . DG  D 1 3  ? 46.181  31.500  10.713  1.00 66.77 ? 804 DG  J "C2'" 1 
ATOM   1149 C "C1'" . DG  D 1 3  ? 46.756  30.234  10.101  1.00 65.50 ? 804 DG  J "C1'" 1 
ATOM   1150 N N9    . DG  D 1 3  ? 46.718  29.076  10.989  1.00 63.33 ? 804 DG  J N9    1 
ATOM   1151 C C8    . DG  D 1 3  ? 47.287  28.973  12.234  1.00 63.65 ? 804 DG  J C8    1 
ATOM   1152 N N7    . DG  D 1 3  ? 47.075  27.817  12.801  1.00 63.01 ? 804 DG  J N7    1 
ATOM   1153 C C5    . DG  D 1 3  ? 46.320  27.113  11.873  1.00 62.23 ? 804 DG  J C5    1 
ATOM   1154 C C6    . DG  D 1 3  ? 45.788  25.800  11.929  1.00 61.87 ? 804 DG  J C6    1 
ATOM   1155 O O6    . DG  D 1 3  ? 45.869  24.972  12.843  1.00 61.78 ? 804 DG  J O6    1 
ATOM   1156 N N1    . DG  D 1 3  ? 45.100  25.479  10.765  1.00 61.89 ? 804 DG  J N1    1 
ATOM   1157 C C2    . DG  D 1 3  ? 44.942  26.310  9.687   1.00 60.83 ? 804 DG  J C2    1 
ATOM   1158 N N2    . DG  D 1 3  ? 44.263  25.806  8.649   1.00 59.66 ? 804 DG  J N2    1 
ATOM   1159 N N3    . DG  D 1 3  ? 45.419  27.541  9.628   1.00 61.66 ? 804 DG  J N3    1 
ATOM   1160 C C4    . DG  D 1 3  ? 46.096  27.873  10.746  1.00 62.41 ? 804 DG  J C4    1 
ATOM   1161 P P     . DT  D 1 4  ? 44.972  33.806  8.829   1.00 69.74 ? 805 DT  J P     1 
ATOM   1162 O OP1   . DT  D 1 4  ? 45.019  34.820  7.743   1.00 68.37 ? 805 DT  J OP1   1 
ATOM   1163 O OP2   . DT  D 1 4  ? 44.726  34.238  10.228  1.00 69.58 ? 805 DT  J OP2   1 
ATOM   1164 O "O5'" . DT  D 1 4  ? 43.887  32.709  8.448   1.00 68.60 ? 805 DT  J "O5'" 1 
ATOM   1165 C "C5'" . DT  D 1 4  ? 43.976  32.011  7.213   1.00 69.14 ? 805 DT  J "C5'" 1 
ATOM   1166 C "C4'" . DT  D 1 4  ? 42.798  31.081  7.057   1.00 69.23 ? 805 DT  J "C4'" 1 
ATOM   1167 O "O4'" . DT  D 1 4  ? 42.931  29.958  7.960   1.00 69.11 ? 805 DT  J "O4'" 1 
ATOM   1168 C "C3'" . DT  D 1 4  ? 41.450  31.722  7.374   1.00 69.10 ? 805 DT  J "C3'" 1 
ATOM   1169 O "O3'" . DT  D 1 4  ? 40.481  31.262  6.437   1.00 69.37 ? 805 DT  J "O3'" 1 
ATOM   1170 C "C2'" . DT  D 1 4  ? 41.135  31.215  8.771   1.00 68.21 ? 805 DT  J "C2'" 1 
ATOM   1171 C "C1'" . DT  D 1 4  ? 41.766  29.836  8.758   1.00 67.78 ? 805 DT  J "C1'" 1 
ATOM   1172 N N1    . DT  D 1 4  ? 42.179  29.329  10.080  1.00 67.41 ? 805 DT  J N1    1 
ATOM   1173 C C2    . DT  D 1 4  ? 41.848  28.035  10.407  1.00 66.12 ? 805 DT  J C2    1 
ATOM   1174 O O2    . DT  D 1 4  ? 41.211  27.303  9.669   1.00 66.91 ? 805 DT  J O2    1 
ATOM   1175 N N3    . DT  D 1 4  ? 42.287  27.627  11.640  1.00 65.54 ? 805 DT  J N3    1 
ATOM   1176 C C4    . DT  D 1 4  ? 42.999  28.370  12.561  1.00 65.56 ? 805 DT  J C4    1 
ATOM   1177 O O4    . DT  D 1 4  ? 43.326  27.866  13.630  1.00 65.10 ? 805 DT  J O4    1 
ATOM   1178 C C5    . DT  D 1 4  ? 43.300  29.726  12.158  1.00 65.78 ? 805 DT  J C5    1 
ATOM   1179 C C7    . DT  D 1 4  ? 44.058  30.611  13.097  1.00 66.08 ? 805 DT  J C7    1 
ATOM   1180 C C6    . DT  D 1 4  ? 42.883  30.131  10.953  1.00 66.60 ? 805 DT  J C6    1 
ATOM   1181 P P     . DA  D 1 5  ? 38.960  31.753  6.557   1.00 69.30 ? 806 DA  J P     1 
ATOM   1182 O OP1   . DA  D 1 5  ? 38.558  32.249  5.215   1.00 69.66 ? 806 DA  J OP1   1 
ATOM   1183 O OP2   . DA  D 1 5  ? 38.808  32.634  7.745   1.00 69.50 ? 806 DA  J OP2   1 
ATOM   1184 O "O5'" . DA  D 1 5  ? 38.171  30.403  6.835   1.00 66.29 ? 806 DA  J "O5'" 1 
ATOM   1185 C "C5'" . DA  D 1 5  ? 38.273  29.315  5.927   1.00 61.59 ? 806 DA  J "C5'" 1 
ATOM   1186 C "C4'" . DA  D 1 5  ? 37.395  28.176  6.383   1.00 58.83 ? 806 DA  J "C4'" 1 
ATOM   1187 O "O4'" . DA  D 1 5  ? 37.932  27.612  7.602   1.00 57.57 ? 806 DA  J "O4'" 1 
ATOM   1188 C "C3'" . DA  D 1 5  ? 35.958  28.581  6.700   1.00 57.05 ? 806 DA  J "C3'" 1 
ATOM   1189 O "O3'" . DA  D 1 5  ? 35.083  27.531  6.296   1.00 55.79 ? 806 DA  J "O3'" 1 
ATOM   1190 C "C2'" . DA  D 1 5  ? 35.962  28.738  8.211   1.00 56.01 ? 806 DA  J "C2'" 1 
ATOM   1191 C "C1'" . DA  D 1 5  ? 36.978  27.694  8.647   1.00 55.30 ? 806 DA  J "C1'" 1 
ATOM   1192 N N9    . DA  D 1 5  ? 37.709  28.027  9.865   1.00 52.87 ? 806 DA  J N9    1 
ATOM   1193 C C8    . DA  D 1 5  ? 38.337  29.206  10.171  1.00 52.07 ? 806 DA  J C8    1 
ATOM   1194 N N7    . DA  D 1 5  ? 38.942  29.196  11.331  1.00 50.99 ? 806 DA  J N7    1 
ATOM   1195 C C5    . DA  D 1 5  ? 38.690  27.926  11.826  1.00 51.05 ? 806 DA  J C5    1 
ATOM   1196 C C6    . DA  D 1 5  ? 39.059  27.289  13.019  1.00 50.52 ? 806 DA  J C6    1 
ATOM   1197 N N6    . DA  D 1 5  ? 39.801  27.862  13.967  1.00 49.72 ? 806 DA  J N6    1 
ATOM   1198 N N1    . DA  D 1 5  ? 38.634  26.024  13.209  1.00 50.38 ? 806 DA  J N1    1 
ATOM   1199 C C2    . DA  D 1 5  ? 37.896  25.447  12.256  1.00 50.27 ? 806 DA  J C2    1 
ATOM   1200 N N3    . DA  D 1 5  ? 37.490  25.940  11.093  1.00 50.30 ? 806 DA  J N3    1 
ATOM   1201 C C4    . DA  D 1 5  ? 37.924  27.199  10.938  1.00 51.28 ? 806 DA  J C4    1 
ATOM   1202 P P     . DG  D 1 6  ? 33.505  27.796  6.218   1.00 56.23 ? 807 DG  J P     1 
ATOM   1203 O OP1   . DG  D 1 6  ? 33.026  27.116  4.989   1.00 55.11 ? 807 DG  J OP1   1 
ATOM   1204 O OP2   . DG  D 1 6  ? 33.220  29.245  6.421   1.00 54.18 ? 807 DG  J OP2   1 
ATOM   1205 O "O5'" . DG  D 1 6  ? 32.956  26.985  7.470   1.00 51.77 ? 807 DG  J "O5'" 1 
ATOM   1206 C "C5'" . DG  D 1 6  ? 33.170  25.584  7.555   1.00 48.66 ? 807 DG  J "C5'" 1 
ATOM   1207 C "C4'" . DG  D 1 6  ? 32.702  25.057  8.888   1.00 45.92 ? 807 DG  J "C4'" 1 
ATOM   1208 O "O4'" . DG  D 1 6  ? 33.661  25.370  9.929   1.00 41.99 ? 807 DG  J "O4'" 1 
ATOM   1209 C "C3'" . DG  D 1 6  ? 31.351  25.605  9.358   1.00 44.86 ? 807 DG  J "C3'" 1 
ATOM   1210 O "O3'" . DG  D 1 6  ? 30.536  24.518  9.788   1.00 45.26 ? 807 DG  J "O3'" 1 
ATOM   1211 C "C2'" . DG  D 1 6  ? 31.724  26.507  10.526  1.00 43.77 ? 807 DG  J "C2'" 1 
ATOM   1212 C "C1'" . DG  D 1 6  ? 32.968  25.829  11.074  1.00 43.04 ? 807 DG  J "C1'" 1 
ATOM   1213 N N9    . DG  D 1 6  ? 33.865  26.710  11.815  1.00 42.39 ? 807 DG  J N9    1 
ATOM   1214 C C8    . DG  D 1 6  ? 34.236  27.985  11.465  1.00 42.84 ? 807 DG  J C8    1 
ATOM   1215 N N7    . DG  D 1 6  ? 35.059  28.531  12.316  1.00 44.14 ? 807 DG  J N7    1 
ATOM   1216 C C5    . DG  D 1 6  ? 35.241  27.561  13.290  1.00 41.20 ? 807 DG  J C5    1 
ATOM   1217 C C6    . DG  D 1 6  ? 36.031  27.581  14.466  1.00 40.38 ? 807 DG  J C6    1 
ATOM   1218 O O6    . DG  D 1 6  ? 36.728  28.497  14.906  1.00 37.61 ? 807 DG  J O6    1 
ATOM   1219 N N1    . DG  D 1 6  ? 35.949  26.378  15.159  1.00 39.65 ? 807 DG  J N1    1 
ATOM   1220 C C2    . DG  D 1 6  ? 35.194  25.301  14.778  1.00 40.84 ? 807 DG  J C2    1 
ATOM   1221 N N2    . DG  D 1 6  ? 35.261  24.224  15.578  1.00 41.12 ? 807 DG  J N2    1 
ATOM   1222 N N3    . DG  D 1 6  ? 34.434  25.276  13.693  1.00 41.82 ? 807 DG  J N3    1 
ATOM   1223 C C4    . DG  D 1 6  ? 34.511  26.430  12.997  1.00 42.25 ? 807 DG  J C4    1 
ATOM   1224 P P     . DC  D 1 7  ? 28.956  24.728  10.024  1.00 45.03 ? 808 DC  J P     1 
ATOM   1225 O OP1   . DC  D 1 7  ? 28.249  23.571  9.425   1.00 45.69 ? 808 DC  J OP1   1 
ATOM   1226 O OP2   . DC  D 1 7  ? 28.553  26.110  9.668   1.00 42.69 ? 808 DC  J OP2   1 
ATOM   1227 O "O5'" . DC  D 1 7  ? 28.835  24.563  11.589  1.00 44.29 ? 808 DC  J "O5'" 1 
ATOM   1228 C "C5'" . DC  D 1 7  ? 29.947  24.860  12.398  1.00 45.94 ? 808 DC  J "C5'" 1 
ATOM   1229 C "C4'" . DC  D 1 7  ? 30.033  23.881  13.539  1.00 45.27 ? 808 DC  J "C4'" 1 
ATOM   1230 O "O4'" . DC  D 1 7  ? 31.213  24.238  14.284  1.00 42.37 ? 808 DC  J "O4'" 1 
ATOM   1231 C "C3'" . DC  D 1 7  ? 28.858  23.996  14.505  1.00 44.83 ? 808 DC  J "C3'" 1 
ATOM   1232 O "O3'" . DC  D 1 7  ? 28.531  22.712  15.050  1.00 45.88 ? 808 DC  J "O3'" 1 
ATOM   1233 C "C2'" . DC  D 1 7  ? 29.347  24.998  15.537  1.00 43.67 ? 808 DC  J "C2'" 1 
ATOM   1234 C "C1'" . DC  D 1 7  ? 30.869  24.886  15.497  1.00 43.41 ? 808 DC  J "C1'" 1 
ATOM   1235 N N1    . DC  D 1 7  ? 31.575  26.184  15.507  1.00 41.41 ? 808 DC  J N1    1 
ATOM   1236 C C2    . DC  D 1 7  ? 32.435  26.469  16.558  1.00 40.17 ? 808 DC  J C2    1 
ATOM   1237 O O2    . DC  D 1 7  ? 32.559  25.635  17.464  1.00 42.06 ? 808 DC  J O2    1 
ATOM   1238 N N3    . DC  D 1 7  ? 33.110  27.647  16.571  1.00 37.62 ? 808 DC  J N3    1 
ATOM   1239 C C4    . DC  D 1 7  ? 32.938  28.523  15.584  1.00 38.61 ? 808 DC  J C4    1 
ATOM   1240 N N4    . DC  D 1 7  ? 33.629  29.667  15.637  1.00 38.70 ? 808 DC  J N4    1 
ATOM   1241 C C5    . DC  D 1 7  ? 32.050  28.265  14.494  1.00 39.07 ? 808 DC  J C5    1 
ATOM   1242 C C6    . DC  D 1 7  ? 31.396  27.092  14.496  1.00 41.09 ? 808 DC  J C6    1 
ATOM   1243 P P     . DA  D 1 8  ? 27.150  22.504  15.860  1.00 51.61 ? 809 DA  J P     1 
ATOM   1244 O OP1   . DA  D 1 8  ? 26.929  21.037  15.970  1.00 49.06 ? 809 DA  J OP1   1 
ATOM   1245 O OP2   . DA  D 1 8  ? 26.078  23.364  15.290  1.00 50.64 ? 809 DA  J OP2   1 
ATOM   1246 O "O5'" . DA  D 1 8  ? 27.502  23.040  17.318  1.00 48.41 ? 809 DA  J "O5'" 1 
ATOM   1247 C "C5'" . DA  D 1 8  ? 28.557  22.436  18.061  1.00 46.93 ? 809 DA  J "C5'" 1 
ATOM   1248 C "C4'" . DA  D 1 8  ? 28.685  23.082  19.419  1.00 44.91 ? 809 DA  J "C4'" 1 
ATOM   1249 O "O4'" . DA  D 1 8  ? 29.418  24.325  19.348  1.00 42.42 ? 809 DA  J "O4'" 1 
ATOM   1250 C "C3'" . DA  D 1 8  ? 27.369  23.410  20.115  1.00 44.69 ? 809 DA  J "C3'" 1 
ATOM   1251 O "O3'" . DA  D 1 8  ? 27.575  23.195  21.501  1.00 46.70 ? 809 DA  J "O3'" 1 
ATOM   1252 C "C2'" . DA  D 1 8  ? 27.207  24.894  19.846  1.00 42.94 ? 809 DA  J "C2'" 1 
ATOM   1253 C "C1'" . DA  D 1 8  ? 28.644  25.372  19.902  1.00 41.17 ? 809 DA  J "C1'" 1 
ATOM   1254 N N9    . DA  D 1 8  ? 28.919  26.568  19.114  1.00 40.23 ? 809 DA  J N9    1 
ATOM   1255 C C8    . DA  D 1 8  ? 28.308  26.982  17.955  1.00 39.10 ? 809 DA  J C8    1 
ATOM   1256 N N7    . DA  D 1 8  ? 28.817  28.079  17.457  1.00 38.79 ? 809 DA  J N7    1 
ATOM   1257 C C5    . DA  D 1 8  ? 29.821  28.420  18.356  1.00 38.59 ? 809 DA  J C5    1 
ATOM   1258 C C6    . DA  D 1 8  ? 30.739  29.480  18.390  1.00 37.41 ? 809 DA  J C6    1 
ATOM   1259 N N6    . DA  D 1 8  ? 30.800  30.431  17.460  1.00 38.68 ? 809 DA  J N6    1 
ATOM   1260 N N1    . DA  D 1 8  ? 31.609  29.527  19.424  1.00 39.26 ? 809 DA  J N1    1 
ATOM   1261 C C2    . DA  D 1 8  ? 31.551  28.564  20.357  1.00 39.05 ? 809 DA  J C2    1 
ATOM   1262 N N3    . DA  D 1 8  ? 30.737  27.519  20.434  1.00 37.87 ? 809 DA  J N3    1 
ATOM   1263 C C4    . DA  D 1 8  ? 29.886  27.503  19.387  1.00 38.60 ? 809 DA  J C4    1 
ATOM   1264 P P     . DC  D 1 9  ? 26.334  23.172  22.506  1.00 45.56 ? 810 DC  J P     1 
ATOM   1265 O OP1   . DC  D 1 9  ? 26.162  21.754  22.908  1.00 46.39 ? 810 DC  J OP1   1 
ATOM   1266 O OP2   . DC  D 1 9  ? 25.189  23.905  21.920  1.00 47.26 ? 810 DC  J OP2   1 
ATOM   1267 O "O5'" . DC  D 1 9  ? 26.931  23.988  23.726  1.00 42.09 ? 810 DC  J "O5'" 1 
ATOM   1268 C "C5'" . DC  D 1 9  ? 28.287  23.780  24.094  1.00 44.28 ? 810 DC  J "C5'" 1 
ATOM   1269 C "C4'" . DC  D 1 9  ? 28.834  24.979  24.829  1.00 44.12 ? 810 DC  J "C4'" 1 
ATOM   1270 O "O4'" . DC  D 1 9  ? 29.242  26.036  23.917  1.00 44.30 ? 810 DC  J "O4'" 1 
ATOM   1271 C "C3'" . DC  D 1 9  ? 27.862  25.600  25.830  1.00 42.78 ? 810 DC  J "C3'" 1 
ATOM   1272 O "O3'" . DC  D 1 9  ? 28.479  25.666  27.114  1.00 43.99 ? 810 DC  J "O3'" 1 
ATOM   1273 C "C2'" . DC  D 1 9  ? 27.574  26.984  25.264  1.00 41.59 ? 810 DC  J "C2'" 1 
ATOM   1274 C "C1'" . DC  D 1 9  ? 28.800  27.296  24.414  1.00 42.17 ? 810 DC  J "C1'" 1 
ATOM   1275 N N1    . DC  D 1 9  ? 28.530  28.175  23.256  1.00 37.59 ? 810 DC  J N1    1 
ATOM   1276 C C2    . DC  D 1 9  ? 29.326  29.318  23.066  1.00 36.40 ? 810 DC  J C2    1 
ATOM   1277 O O2    . DC  D 1 9  ? 30.211  29.578  23.890  1.00 32.63 ? 810 DC  J O2    1 
ATOM   1278 N N3    . DC  D 1 9  ? 29.105  30.111  21.992  1.00 33.25 ? 810 DC  J N3    1 
ATOM   1279 C C4    . DC  D 1 9  ? 28.131  29.813  21.132  1.00 34.58 ? 810 DC  J C4    1 
ATOM   1280 N N4    . DC  D 1 9  ? 27.957  30.626  20.081  1.00 29.01 ? 810 DC  J N4    1 
ATOM   1281 C C5    . DC  D 1 9  ? 27.293  28.668  21.307  1.00 34.44 ? 810 DC  J C5    1 
ATOM   1282 C C6    . DC  D 1 9  ? 27.529  27.884  22.373  1.00 36.77 ? 810 DC  J C6    1 
ATOM   1283 P P     . DG  D 1 10 ? 27.588  25.969  28.414  1.00 43.09 ? 811 DG  J P     1 
ATOM   1284 O OP1   . DG  D 1 10 ? 28.176  25.159  29.514  1.00 45.40 ? 811 DG  J OP1   1 
ATOM   1285 O OP2   . DG  D 1 10 ? 26.149  25.848  28.101  1.00 43.26 ? 811 DG  J OP2   1 
ATOM   1286 O "O5'" . DG  D 1 10 ? 27.924  27.495  28.699  1.00 40.90 ? 811 DG  J "O5'" 1 
ATOM   1287 C "C5'" . DG  D 1 10 ? 29.281  27.906  28.801  1.00 41.04 ? 811 DG  J "C5'" 1 
ATOM   1288 C "C4'" . DG  D 1 10 ? 29.364  29.407  28.912  1.00 41.25 ? 811 DG  J "C4'" 1 
ATOM   1289 O "O4'" . DG  D 1 10 ? 29.042  30.042  27.649  1.00 37.08 ? 811 DG  J "O4'" 1 
ATOM   1290 C "C3'" . DG  D 1 10 ? 28.410  30.007  29.938  1.00 40.83 ? 811 DG  J "C3'" 1 
ATOM   1291 O "O3'" . DG  D 1 10 ? 29.076  31.106  30.557  1.00 43.54 ? 811 DG  J "O3'" 1 
ATOM   1292 C "C2'" . DG  D 1 10 ? 27.258  30.501  29.079  1.00 39.32 ? 811 DG  J "C2'" 1 
ATOM   1293 C "C1'" . DG  D 1 10 ? 28.007  30.995  27.858  1.00 36.35 ? 811 DG  J "C1'" 1 
ATOM   1294 N N9    . DG  D 1 10 ? 27.236  31.081  26.622  1.00 34.36 ? 811 DG  J N9    1 
ATOM   1295 C C8    . DG  D 1 10 ? 26.242  30.235  26.203  1.00 30.53 ? 811 DG  J C8    1 
ATOM   1296 N N7    . DG  D 1 10 ? 25.821  30.497  24.998  1.00 30.17 ? 811 DG  J N7    1 
ATOM   1297 C C5    . DG  D 1 10 ? 26.564  31.600  24.604  1.00 32.08 ? 811 DG  J C5    1 
ATOM   1298 C C6    . DG  D 1 10 ? 26.576  32.315  23.374  1.00 31.67 ? 811 DG  J C6    1 
ATOM   1299 O O6    . DG  D 1 10 ? 25.906  32.110  22.361  1.00 34.52 ? 811 DG  J O6    1 
ATOM   1300 N N1    . DG  D 1 10 ? 27.495  33.360  23.399  1.00 31.19 ? 811 DG  J N1    1 
ATOM   1301 C C2    . DG  D 1 10 ? 28.290  33.688  24.467  1.00 29.20 ? 811 DG  J C2    1 
ATOM   1302 N N2    . DG  D 1 10 ? 29.110  34.744  24.294  1.00 30.27 ? 811 DG  J N2    1 
ATOM   1303 N N3    . DG  D 1 10 ? 28.286  33.032  25.621  1.00 30.75 ? 811 DG  J N3    1 
ATOM   1304 C C4    . DG  D 1 10 ? 27.415  32.000  25.613  1.00 31.88 ? 811 DG  J C4    1 
ATOM   1305 P P     . DT  D 1 11 ? 28.529  31.706  31.936  1.00 44.71 ? 812 DT  J P     1 
ATOM   1306 O OP1   . DT  D 1 11 ? 29.732  32.022  32.748  1.00 45.91 ? 812 DT  J OP1   1 
ATOM   1307 O OP2   . DT  D 1 11 ? 27.465  30.844  32.497  1.00 44.61 ? 812 DT  J OP2   1 
ATOM   1308 O "O5'" . DT  D 1 11 ? 27.863  33.084  31.509  1.00 45.83 ? 812 DT  J "O5'" 1 
ATOM   1309 C "C5'" . DT  D 1 11 ? 27.406  33.266  30.183  1.00 47.13 ? 812 DT  J "C5'" 1 
ATOM   1310 C "C4'" . DT  D 1 11 ? 27.705  34.667  29.720  1.00 43.75 ? 812 DT  J "C4'" 1 
ATOM   1311 O "O4'" . DT  D 1 11 ? 27.448  34.722  28.301  1.00 41.91 ? 812 DT  J "O4'" 1 
ATOM   1312 C "C3'" . DT  D 1 11 ? 26.795  35.700  30.375  1.00 42.02 ? 812 DT  J "C3'" 1 
ATOM   1313 O "O3'" . DT  D 1 11 ? 27.515  36.882  30.721  1.00 42.40 ? 812 DT  J "O3'" 1 
ATOM   1314 C "C2'" . DT  D 1 11 ? 25.706  35.945  29.343  1.00 40.16 ? 812 DT  J "C2'" 1 
ATOM   1315 C "C1'" . DT  D 1 11 ? 26.356  35.578  28.012  1.00 39.60 ? 812 DT  J "C1'" 1 
ATOM   1316 N N1    . DT  D 1 11 ? 25.468  34.852  27.077  1.00 37.14 ? 812 DT  J N1    1 
ATOM   1317 C C2    . DT  D 1 11 ? 25.377  35.325  25.791  1.00 35.24 ? 812 DT  J C2    1 
ATOM   1318 O O2    . DT  D 1 11 ? 26.004  36.287  25.401  1.00 37.25 ? 812 DT  J O2    1 
ATOM   1319 N N3    . DT  D 1 11 ? 24.530  34.613  24.975  1.00 35.53 ? 812 DT  J N3    1 
ATOM   1320 C C4    . DT  D 1 11 ? 23.795  33.488  25.313  1.00 34.39 ? 812 DT  J C4    1 
ATOM   1321 O O4    . DT  D 1 11 ? 23.077  32.950  24.481  1.00 33.11 ? 812 DT  J O4    1 
ATOM   1322 C C5    . DT  D 1 11 ? 23.954  33.037  26.675  1.00 34.25 ? 812 DT  J C5    1 
ATOM   1323 C C7    . DT  D 1 11 ? 23.216  31.815  27.119  1.00 35.49 ? 812 DT  J C7    1 
ATOM   1324 C C6    . DT  D 1 11 ? 24.764  33.735  27.480  1.00 33.59 ? 812 DT  J C6    1 
ATOM   1325 P P     . DG  D 1 12 ? 26.895  37.884  31.810  1.00 46.42 ? 813 DG  J P     1 
ATOM   1326 O OP1   . DG  D 1 12 ? 28.011  38.541  32.542  1.00 46.64 ? 813 DG  J OP1   1 
ATOM   1327 O OP2   . DG  D 1 12 ? 25.828  37.180  32.568  1.00 41.41 ? 813 DG  J OP2   1 
ATOM   1328 O "O5'" . DG  D 1 12 ? 26.192  38.982  30.912  1.00 43.38 ? 813 DG  J "O5'" 1 
ATOM   1329 C "C5'" . DG  D 1 12 ? 26.936  39.695  29.945  1.00 44.95 ? 813 DG  J "C5'" 1 
ATOM   1330 C "C4'" . DG  D 1 12 ? 25.998  40.509  29.093  1.00 45.65 ? 813 DG  J "C4'" 1 
ATOM   1331 O "O4'" . DG  D 1 12 ? 25.247  39.643  28.212  1.00 43.90 ? 813 DG  J "O4'" 1 
ATOM   1332 C "C3'" . DG  D 1 12 ? 24.959  41.282  29.900  1.00 46.17 ? 813 DG  J "C3'" 1 
ATOM   1333 O "O3'" . DG  D 1 12 ? 24.744  42.523  29.249  1.00 50.56 ? 813 DG  J "O3'" 1 
ATOM   1334 C "C2'" . DG  D 1 12 ? 23.712  40.419  29.789  1.00 45.63 ? 813 DG  J "C2'" 1 
ATOM   1335 C "C1'" . DG  D 1 12 ? 23.857  39.877  28.384  1.00 42.08 ? 813 DG  J "C1'" 1 
ATOM   1336 N N9    . DG  D 1 12 ? 23.156  38.634  28.075  1.00 41.57 ? 813 DG  J N9    1 
ATOM   1337 C C8    . DG  D 1 12 ? 22.864  37.590  28.919  1.00 39.62 ? 813 DG  J C8    1 
ATOM   1338 N N7    . DG  D 1 12 ? 22.285  36.588  28.309  1.00 37.81 ? 813 DG  J N7    1 
ATOM   1339 C C5    . DG  D 1 12 ? 22.175  37.004  26.990  1.00 36.51 ? 813 DG  J C5    1 
ATOM   1340 C C6    . DG  D 1 12 ? 21.647  36.335  25.850  1.00 36.01 ? 813 DG  J C6    1 
ATOM   1341 O O6    . DG  D 1 12 ? 21.184  35.193  25.774  1.00 32.54 ? 813 DG  J O6    1 
ATOM   1342 N N1    . DG  D 1 12 ? 21.715  37.134  24.708  1.00 33.81 ? 813 DG  J N1    1 
ATOM   1343 C C2    . DG  D 1 12 ? 22.244  38.404  24.670  1.00 35.69 ? 813 DG  J C2    1 
ATOM   1344 N N2    . DG  D 1 12 ? 22.229  39.024  23.487  1.00 30.25 ? 813 DG  J N2    1 
ATOM   1345 N N3    . DG  D 1 12 ? 22.754  39.024  25.721  1.00 35.98 ? 813 DG  J N3    1 
ATOM   1346 C C4    . DG  D 1 12 ? 22.687  38.272  26.835  1.00 38.40 ? 813 DG  J C4    1 
ATOM   1347 P P     . DC  D 1 13 ? 24.041  43.724  30.037  1.00 53.17 ? 814 DC  J P     1 
ATOM   1348 O OP1   . DC  D 1 13 ? 25.079  44.763  30.208  1.00 52.72 ? 814 DC  J OP1   1 
ATOM   1349 O OP2   . DC  D 1 13 ? 23.341  43.166  31.226  1.00 51.29 ? 814 DC  J OP2   1 
ATOM   1350 O "O5'" . DC  D 1 13 ? 22.965  44.225  28.981  1.00 50.46 ? 814 DC  J "O5'" 1 
ATOM   1351 C "C5'" . DC  D 1 13 ? 23.313  44.308  27.604  1.00 49.70 ? 814 DC  J "C5'" 1 
ATOM   1352 C "C4'" . DC  D 1 13 ? 22.090  44.129  26.737  1.00 48.78 ? 814 DC  J "C4'" 1 
ATOM   1353 O "O4'" . DC  D 1 13 ? 21.783  42.727  26.506  1.00 45.24 ? 814 DC  J "O4'" 1 
ATOM   1354 C "C3'" . DC  D 1 13 ? 20.820  44.766  27.305  1.00 48.76 ? 814 DC  J "C3'" 1 
ATOM   1355 O "O3'" . DC  D 1 13 ? 20.193  45.581  26.322  1.00 51.43 ? 814 DC  J "O3'" 1 
ATOM   1356 C "C2'" . DC  D 1 13 ? 19.926  43.574  27.609  1.00 46.95 ? 814 DC  J "C2'" 1 
ATOM   1357 C "C1'" . DC  D 1 13 ? 20.378  42.568  26.568  1.00 44.81 ? 814 DC  J "C1'" 1 
ATOM   1358 N N1    . DC  D 1 13 ? 20.060  41.164  26.902  1.00 42.43 ? 814 DC  J N1    1 
ATOM   1359 C C2    . DC  D 1 13 ? 19.535  40.332  25.899  1.00 41.63 ? 814 DC  J C2    1 
ATOM   1360 O O2    . DC  D 1 13 ? 19.459  40.763  24.740  1.00 40.14 ? 814 DC  J O2    1 
ATOM   1361 N N3    . DC  D 1 13 ? 19.132  39.078  26.223  1.00 38.16 ? 814 DC  J N3    1 
ATOM   1362 C C4    . DC  D 1 13 ? 19.258  38.642  27.477  1.00 36.39 ? 814 DC  J C4    1 
ATOM   1363 N N4    . DC  D 1 13 ? 18.799  37.421  27.763  1.00 35.44 ? 814 DC  J N4    1 
ATOM   1364 C C5    . DC  D 1 13 ? 19.845  39.443  28.499  1.00 37.61 ? 814 DC  J C5    1 
ATOM   1365 C C6    . DC  D 1 13 ? 20.229  40.684  28.171  1.00 40.23 ? 814 DC  J C6    1 
ATOM   1366 P P     . DT  D 1 14 ? 18.820  46.336  26.676  1.00 54.78 ? 815 DT  J P     1 
ATOM   1367 O OP1   . DT  D 1 14 ? 19.033  47.778  26.381  1.00 53.31 ? 815 DT  J OP1   1 
ATOM   1368 O OP2   . DT  D 1 14 ? 18.349  45.920  28.026  1.00 54.56 ? 815 DT  J OP2   1 
ATOM   1369 O "O5'" . DT  D 1 14 ? 17.813  45.742  25.602  1.00 53.71 ? 815 DT  J "O5'" 1 
ATOM   1370 C "C5'" . DT  D 1 14 ? 18.232  45.545  24.258  1.00 52.42 ? 815 DT  J "C5'" 1 
ATOM   1371 C "C4'" . DT  D 1 14 ? 17.120  44.906  23.467  1.00 51.88 ? 815 DT  J "C4'" 1 
ATOM   1372 O "O4'" . DT  D 1 14 ? 16.993  43.511  23.832  1.00 50.50 ? 815 DT  J "O4'" 1 
ATOM   1373 C "C3'" . DT  D 1 14 ? 15.762  45.544  23.746  1.00 53.02 ? 815 DT  J "C3'" 1 
ATOM   1374 O "O3'" . DT  D 1 14 ? 15.022  45.663  22.539  1.00 54.95 ? 815 DT  J "O3'" 1 
ATOM   1375 C "C2'" . DT  D 1 14 ? 15.094  44.572  24.704  1.00 50.36 ? 815 DT  J "C2'" 1 
ATOM   1376 C "C1'" . DT  D 1 14 ? 15.671  43.235  24.274  1.00 49.02 ? 815 DT  J "C1'" 1 
ATOM   1377 N N1    . DT  D 1 14 ? 15.759  42.229  25.350  1.00 45.31 ? 815 DT  J N1    1 
ATOM   1378 C C2    . DT  D 1 14 ? 15.457  40.920  25.042  1.00 45.71 ? 815 DT  J C2    1 
ATOM   1379 O O2    . DT  D 1 14 ? 15.135  40.555  23.918  1.00 43.94 ? 815 DT  J O2    1 
ATOM   1380 N N3    . DT  D 1 14 ? 15.563  40.044  26.096  1.00 41.16 ? 815 DT  J N3    1 
ATOM   1381 C C4    . DT  D 1 14 ? 15.945  40.341  27.392  1.00 44.22 ? 815 DT  J C4    1 
ATOM   1382 O O4    . DT  D 1 14 ? 16.013  39.444  28.234  1.00 41.18 ? 815 DT  J O4    1 
ATOM   1383 C C5    . DT  D 1 14 ? 16.246  41.735  27.643  1.00 44.20 ? 815 DT  J C5    1 
ATOM   1384 C C7    . DT  D 1 14 ? 16.660  42.151  29.019  1.00 44.28 ? 815 DT  J C7    1 
ATOM   1385 C C6    . DT  D 1 14 ? 16.138  42.596  26.623  1.00 44.42 ? 815 DT  J C6    1 
ATOM   1386 P P     . DA  D 1 15 ? 13.551  46.293  22.577  1.00 57.59 ? 816 DA  J P     1 
ATOM   1387 O OP1   . DA  D 1 15 ? 13.311  46.931  21.254  1.00 58.79 ? 816 DA  J OP1   1 
ATOM   1388 O OP2   . DA  D 1 15 ? 13.423  47.095  23.815  1.00 58.31 ? 816 DA  J OP2   1 
ATOM   1389 O "O5'" . DA  D 1 15 ? 12.626  45.007  22.696  1.00 57.23 ? 816 DA  J "O5'" 1 
ATOM   1390 C "C5'" . DA  D 1 15 ? 12.692  43.994  21.702  1.00 57.55 ? 816 DA  J "C5'" 1 
ATOM   1391 C "C4'" . DA  D 1 15 ? 11.518  43.057  21.832  1.00 59.27 ? 816 DA  J "C4'" 1 
ATOM   1392 O "O4'" . DA  D 1 15 ? 11.784  42.034  22.821  1.00 58.44 ? 816 DA  J "O4'" 1 
ATOM   1393 C "C3'" . DA  D 1 15 ? 10.215  43.739  22.243  1.00 60.42 ? 816 DA  J "C3'" 1 
ATOM   1394 O "O3'" . DA  D 1 15 ? 9.153   43.259  21.421  1.00 63.80 ? 816 DA  J "O3'" 1 
ATOM   1395 C "C2'" . DA  D 1 15 ? 10.045  43.339  23.701  1.00 58.88 ? 816 DA  J "C2'" 1 
ATOM   1396 C "C1'" . DA  D 1 15 ? 10.742  41.988  23.782  1.00 57.47 ? 816 DA  J "C1'" 1 
ATOM   1397 N N9    . DA  D 1 15 ? 11.356  41.704  25.081  1.00 55.28 ? 816 DA  J N9    1 
ATOM   1398 C C8    . DA  D 1 15 ? 11.975  42.600  25.915  1.00 54.62 ? 816 DA  J C8    1 
ATOM   1399 N N7    . DA  D 1 15 ? 12.443  42.064  27.015  1.00 54.05 ? 816 DA  J N7    1 
ATOM   1400 C C5    . DA  D 1 15 ? 12.110  40.723  26.902  1.00 52.98 ? 816 DA  J C5    1 
ATOM   1401 C C6    . DA  D 1 15 ? 12.332  39.621  27.746  1.00 52.70 ? 816 DA  J C6    1 
ATOM   1402 N N6    . DA  D 1 15 ? 12.962  39.705  28.919  1.00 51.99 ? 816 DA  J N6    1 
ATOM   1403 N N1    . DA  D 1 15 ? 11.878  38.416  27.340  1.00 53.25 ? 816 DA  J N1    1 
ATOM   1404 C C2    . DA  D 1 15 ? 11.240  38.337  26.161  1.00 53.06 ? 816 DA  J C2    1 
ATOM   1405 N N3    . DA  D 1 15 ? 10.968  39.301  25.283  1.00 52.01 ? 816 DA  J N3    1 
ATOM   1406 C C4    . DA  D 1 15 ? 11.436  40.485  25.717  1.00 53.50 ? 816 DA  J C4    1 
ATOM   1407 P P     . DC  D 1 16 ? 7.633   43.627  21.776  1.00 67.34 ? 817 DC  J P     1 
ATOM   1408 O OP1   . DC  D 1 16 ? 6.919   43.805  20.486  1.00 67.01 ? 817 DC  J OP1   1 
ATOM   1409 O OP2   . DC  D 1 16 ? 7.593   44.709  22.796  1.00 66.66 ? 817 DC  J OP2   1 
ATOM   1410 O "O5'" . DC  D 1 16 ? 7.115   42.280  22.434  1.00 66.92 ? 817 DC  J "O5'" 1 
ATOM   1411 C "C5'" . DC  D 1 16 ? 7.440   41.036  21.829  1.00 68.76 ? 817 DC  J "C5'" 1 
ATOM   1412 C "C4'" . DC  D 1 16 ? 6.881   39.899  22.645  1.00 69.16 ? 817 DC  J "C4'" 1 
ATOM   1413 O "O4'" . DC  D 1 16 ? 7.700   39.662  23.818  1.00 68.59 ? 817 DC  J "O4'" 1 
ATOM   1414 C "C3'" . DC  D 1 16 ? 5.465   40.164  23.148  1.00 69.49 ? 817 DC  J "C3'" 1 
ATOM   1415 O "O3'" . DC  D 1 16 ? 4.655   39.012  22.953  1.00 70.80 ? 817 DC  J "O3'" 1 
ATOM   1416 C "C2'" . DC  D 1 16 ? 5.652   40.450  24.626  1.00 68.77 ? 817 DC  J "C2'" 1 
ATOM   1417 C "C1'" . DC  D 1 16 ? 6.882   39.628  24.973  1.00 68.03 ? 817 DC  J "C1'" 1 
ATOM   1418 N N1    . DC  D 1 16 ? 7.660   40.165  26.102  1.00 65.90 ? 817 DC  J N1    1 
ATOM   1419 C C2    . DC  D 1 16 ? 8.175   39.278  27.048  1.00 64.96 ? 817 DC  J C2    1 
ATOM   1420 O O2    . DC  D 1 16 ? 8.018   38.059  26.877  1.00 62.47 ? 817 DC  J O2    1 
ATOM   1421 N N3    . DC  D 1 16 ? 8.836   39.769  28.121  1.00 65.23 ? 817 DC  J N3    1 
ATOM   1422 C C4    . DC  D 1 16 ? 9.004   41.086  28.255  1.00 64.41 ? 817 DC  J C4    1 
ATOM   1423 N N4    . DC  D 1 16 ? 9.650   41.526  29.335  1.00 64.25 ? 817 DC  J N4    1 
ATOM   1424 C C5    . DC  D 1 16 ? 8.516   42.009  27.290  1.00 64.98 ? 817 DC  J C5    1 
ATOM   1425 C C6    . DC  D 1 16 ? 7.858   41.510  26.238  1.00 65.37 ? 817 DC  J C6    1 
ATOM   1426 P P     . DT  D 1 17 ? 3.103   39.064  23.345  1.00 72.32 ? 818 DT  J P     1 
ATOM   1427 O OP1   . DT  D 1 17 ? 2.359   38.381  22.253  1.00 72.17 ? 818 DT  J OP1   1 
ATOM   1428 O OP2   . DT  D 1 17 ? 2.747   40.458  23.723  1.00 71.62 ? 818 DT  J OP2   1 
ATOM   1429 O "O5'" . DT  D 1 17 ? 3.044   38.144  24.640  1.00 70.56 ? 818 DT  J "O5'" 1 
ATOM   1430 C "C5'" . DT  D 1 17 ? 3.617   36.842  24.611  1.00 67.46 ? 818 DT  J "C5'" 1 
ATOM   1431 C "C4'" . DT  D 1 17 ? 3.459   36.171  25.953  1.00 66.70 ? 818 DT  J "C4'" 1 
ATOM   1432 O "O4'" . DT  D 1 17 ? 4.377   36.731  26.920  1.00 64.62 ? 818 DT  J "O4'" 1 
ATOM   1433 C "C3'" . DT  D 1 17 ? 2.065   36.300  26.566  1.00 66.39 ? 818 DT  J "C3'" 1 
ATOM   1434 O "O3'" . DT  D 1 17 ? 1.708   35.058  27.162  1.00 67.75 ? 818 DT  J "O3'" 1 
ATOM   1435 C "C2'" . DT  D 1 17 ? 2.256   37.345  27.650  1.00 65.00 ? 818 DT  J "C2'" 1 
ATOM   1436 C "C1'" . DT  D 1 17 ? 3.665   37.030  28.106  1.00 64.54 ? 818 DT  J "C1'" 1 
ATOM   1437 N N1    . DT  D 1 17 ? 4.370   38.118  28.799  1.00 63.48 ? 818 DT  J N1    1 
ATOM   1438 C C2    . DT  D 1 17 ? 5.025   37.808  29.970  1.00 62.30 ? 818 DT  J C2    1 
ATOM   1439 O O2    . DT  D 1 17 ? 5.009   36.694  30.469  1.00 61.71 ? 818 DT  J O2    1 
ATOM   1440 N N3    . DT  D 1 17 ? 5.695   38.857  30.544  1.00 61.59 ? 818 DT  J N3    1 
ATOM   1441 C C4    . DT  D 1 17 ? 5.758   40.158  30.083  1.00 61.71 ? 818 DT  J C4    1 
ATOM   1442 O O4    . DT  D 1 17 ? 6.408   40.994  30.702  1.00 62.22 ? 818 DT  J O4    1 
ATOM   1443 C C5    . DT  D 1 17 ? 5.027   40.419  28.866  1.00 62.32 ? 818 DT  J C5    1 
ATOM   1444 C C7    . DT  D 1 17 ? 5.020   41.808  28.310  1.00 62.51 ? 818 DT  J C7    1 
ATOM   1445 C C6    . DT  D 1 17 ? 4.381   39.398  28.288  1.00 63.05 ? 818 DT  J C6    1 
ATOM   1446 P P     . DC  D 1 18 ? 0.164   34.709  27.411  1.00 69.73 ? 819 DC  J P     1 
ATOM   1447 O OP1   . DC  D 1 18 ? -0.094  33.451  26.663  1.00 70.38 ? 819 DC  J OP1   1 
ATOM   1448 O OP2   . DC  D 1 18 ? -0.666  35.918  27.139  1.00 67.56 ? 819 DC  J OP2   1 
ATOM   1449 O "O5'" . DC  D 1 18 ? 0.114   34.384  28.968  1.00 69.18 ? 819 DC  J "O5'" 1 
ATOM   1450 C "C5'" . DC  D 1 18 ? 0.985   33.400  29.525  1.00 69.15 ? 819 DC  J "C5'" 1 
ATOM   1451 C "C4'" . DC  D 1 18 ? 1.124   33.594  31.017  1.00 68.32 ? 819 DC  J "C4'" 1 
ATOM   1452 O "O4'" . DC  D 1 18 ? 1.930   34.764  31.314  1.00 67.63 ? 819 DC  J "O4'" 1 
ATOM   1453 C "C3'" . DC  D 1 18 ? -0.190  33.775  31.781  1.00 68.03 ? 819 DC  J "C3'" 1 
ATOM   1454 O "O3'" . DC  D 1 18 ? -0.077  33.125  33.051  1.00 70.14 ? 819 DC  J "O3'" 1 
ATOM   1455 C "C2'" . DC  D 1 18 ? -0.217  35.266  32.068  1.00 66.90 ? 819 DC  J "C2'" 1 
ATOM   1456 C "C1'" . DC  D 1 18 ? 1.259   35.541  32.290  1.00 65.24 ? 819 DC  J "C1'" 1 
ATOM   1457 N N1    . DC  D 1 18 ? 1.680   36.945  32.144  1.00 62.34 ? 819 DC  J N1    1 
ATOM   1458 C C2    . DC  D 1 18 ? 2.675   37.436  32.997  1.00 60.99 ? 819 DC  J C2    1 
ATOM   1459 O O2    . DC  D 1 18 ? 3.200   36.665  33.809  1.00 59.57 ? 819 DC  J O2    1 
ATOM   1460 N N3    . DC  D 1 18 ? 3.039   38.734  32.913  1.00 59.74 ? 819 DC  J N3    1 
ATOM   1461 C C4    . DC  D 1 18 ? 2.457   39.530  32.016  1.00 59.93 ? 819 DC  J C4    1 
ATOM   1462 N N4    . DC  D 1 18 ? 2.834   40.808  31.983  1.00 60.08 ? 819 DC  J N4    1 
ATOM   1463 C C5    . DC  D 1 18 ? 1.459   39.052  31.117  1.00 59.63 ? 819 DC  J C5    1 
ATOM   1464 C C6    . DC  D 1 18 ? 1.106   37.764  31.213  1.00 61.13 ? 819 DC  J C6    1 
ATOM   1465 N N     . SER E 2 1  ? -26.237 5.145   -15.543 1.00 71.27 ? 2   SER A N     1 
ATOM   1466 C CA    . SER E 2 1  ? -26.053 3.673   -15.698 1.00 71.31 ? 2   SER A CA    1 
ATOM   1467 C C     . SER E 2 1  ? -24.608 3.295   -15.396 1.00 71.11 ? 2   SER A C     1 
ATOM   1468 O O     . SER E 2 1  ? -24.052 3.699   -14.376 1.00 70.71 ? 2   SER A O     1 
ATOM   1469 C CB    . SER E 2 1  ? -26.419 3.241   -17.126 1.00 72.23 ? 2   SER A CB    1 
ATOM   1470 O OG    . SER E 2 1  ? -25.626 3.917   -18.089 1.00 71.76 ? 2   SER A OG    1 
ATOM   1471 N N     . ARG E 2 2  ? -24.006 2.521   -16.292 1.00 71.02 ? 3   ARG A N     1 
ATOM   1472 C CA    . ARG E 2 2  ? -22.623 2.091   -16.139 1.00 70.91 ? 3   ARG A CA    1 
ATOM   1473 C C     . ARG E 2 2  ? -21.705 3.285   -15.899 1.00 70.32 ? 3   ARG A C     1 
ATOM   1474 O O     . ARG E 2 2  ? -20.720 3.177   -15.166 1.00 69.38 ? 3   ARG A O     1 
ATOM   1475 C CB    . ARG E 2 2  ? -22.174 1.333   -17.392 1.00 71.82 ? 3   ARG A CB    1 
ATOM   1476 C CG    . ARG E 2 2  ? -22.818 -0.039  -17.555 1.00 72.84 ? 3   ARG A CG    1 
ATOM   1477 C CD    . ARG E 2 2  ? -23.017 -0.407  -19.025 1.00 73.79 ? 3   ARG A CD    1 
ATOM   1478 N NE    . ARG E 2 2  ? -24.000 0.459   -19.677 1.00 74.76 ? 3   ARG A NE    1 
ATOM   1479 C CZ    . ARG E 2 2  ? -25.264 0.593   -19.279 1.00 75.37 ? 3   ARG A CZ    1 
ATOM   1480 N NH1   . ARG E 2 2  ? -25.709 -0.084  -18.228 1.00 75.78 ? 3   ARG A NH1   1 
ATOM   1481 N NH2   . ARG E 2 2  ? -26.084 1.412   -19.925 1.00 75.58 ? 3   ARG A NH2   1 
ATOM   1482 N N     . SER E 2 3  ? -22.033 4.422   -16.513 1.00 69.88 ? 4   SER A N     1 
ATOM   1483 C CA    . SER E 2 3  ? -21.222 5.628   -16.360 1.00 69.92 ? 4   SER A CA    1 
ATOM   1484 C C     . SER E 2 3  ? -21.243 6.124   -14.920 1.00 68.64 ? 4   SER A C     1 
ATOM   1485 O O     . SER E 2 3  ? -20.505 7.037   -14.562 1.00 69.43 ? 4   SER A O     1 
ATOM   1486 C CB    . SER E 2 3  ? -21.711 6.740   -17.297 1.00 70.32 ? 4   SER A CB    1 
ATOM   1487 O OG    . SER E 2 3  ? -22.999 7.202   -16.932 1.00 72.83 ? 4   SER A OG    1 
ATOM   1488 N N     . THR E 2 4  ? -22.094 5.518   -14.099 1.00 67.55 ? 5   THR A N     1 
ATOM   1489 C CA    . THR E 2 4  ? -22.194 5.889   -12.694 1.00 66.05 ? 5   THR A CA    1 
ATOM   1490 C C     . THR E 2 4  ? -21.193 5.056   -11.913 1.00 64.17 ? 5   THR A C     1 
ATOM   1491 O O     . THR E 2 4  ? -20.454 5.574   -11.080 1.00 64.09 ? 5   THR A O     1 
ATOM   1492 C CB    . THR E 2 4  ? -23.605 5.617   -12.130 1.00 66.72 ? 5   THR A CB    1 
ATOM   1493 O OG1   . THR E 2 4  ? -24.553 6.481   -12.769 1.00 67.80 ? 5   THR A OG1   1 
ATOM   1494 C CG2   . THR E 2 4  ? -23.634 5.859   -10.625 1.00 65.92 ? 5   THR A CG2   1 
ATOM   1495 N N     . HIS E 2 5  ? -21.181 3.757   -12.188 1.00 62.26 ? 6   HIS A N     1 
ATOM   1496 C CA    . HIS E 2 5  ? -20.261 2.852   -11.518 1.00 60.98 ? 6   HIS A CA    1 
ATOM   1497 C C     . HIS E 2 5  ? -18.843 3.153   -11.985 1.00 59.55 ? 6   HIS A C     1 
ATOM   1498 O O     . HIS E 2 5  ? -17.921 3.241   -11.178 1.00 58.93 ? 6   HIS A O     1 
ATOM   1499 C CB    . HIS E 2 5  ? -20.614 1.399   -11.840 1.00 60.89 ? 6   HIS A CB    1 
ATOM   1500 C CG    . HIS E 2 5  ? -19.746 0.397   -11.141 1.00 60.72 ? 6   HIS A CG    1 
ATOM   1501 N ND1   . HIS E 2 5  ? -19.545 0.410   -9.778  1.00 61.34 ? 6   HIS A ND1   1 
ATOM   1502 C CD2   . HIS E 2 5  ? -19.039 -0.657  -11.615 1.00 61.11 ? 6   HIS A CD2   1 
ATOM   1503 C CE1   . HIS E 2 5  ? -18.753 -0.593  -9.441  1.00 61.16 ? 6   HIS A CE1   1 
ATOM   1504 N NE2   . HIS E 2 5  ? -18.431 -1.256  -10.538 1.00 61.48 ? 6   HIS A NE2   1 
ATOM   1505 N N     . ASN E 2 6  ? -18.684 3.323   -13.293 1.00 58.25 ? 7   ASN A N     1 
ATOM   1506 C CA    . ASN E 2 6  ? -17.380 3.608   -13.883 1.00 57.75 ? 7   ASN A CA    1 
ATOM   1507 C C     . ASN E 2 6  ? -16.791 4.918   -13.372 1.00 57.09 ? 7   ASN A C     1 
ATOM   1508 O O     . ASN E 2 6  ? -15.571 5.050   -13.238 1.00 55.44 ? 7   ASN A O     1 
ATOM   1509 C CB    . ASN E 2 6  ? -17.492 3.667   -15.410 1.00 57.89 ? 7   ASN A CB    1 
ATOM   1510 C CG    . ASN E 2 6  ? -17.953 2.351   -16.016 1.00 58.38 ? 7   ASN A CG    1 
ATOM   1511 O OD1   . ASN E 2 6  ? -18.175 2.258   -17.226 1.00 58.72 ? 7   ASN A OD1   1 
ATOM   1512 N ND2   . ASN E 2 6  ? -18.097 1.327   -15.181 1.00 59.00 ? 7   ASN A ND2   1 
ATOM   1513 N N     . GLU E 2 7  ? -17.661 5.884   -13.091 1.00 56.46 ? 8   GLU A N     1 
ATOM   1514 C CA    . GLU E 2 7  ? -17.212 7.186   -12.614 1.00 55.54 ? 8   GLU A CA    1 
ATOM   1515 C C     . GLU E 2 7  ? -16.877 7.135   -11.132 1.00 54.01 ? 8   GLU A C     1 
ATOM   1516 O O     . GLU E 2 7  ? -15.959 7.816   -10.678 1.00 53.50 ? 8   GLU A O     1 
ATOM   1517 C CB    . GLU E 2 7  ? -18.282 8.254   -12.874 1.00 58.43 ? 8   GLU A CB    1 
ATOM   1518 C CG    . GLU E 2 7  ? -17.715 9.671   -12.980 1.00 60.88 ? 8   GLU A CG    1 
ATOM   1519 C CD    . GLU E 2 7  ? -16.758 9.832   -14.158 1.00 62.96 ? 8   GLU A CD    1 
ATOM   1520 O OE1   . GLU E 2 7  ? -16.107 10.895  -14.268 1.00 64.18 ? 8   GLU A OE1   1 
ATOM   1521 O OE2   . GLU E 2 7  ? -16.657 8.896   -14.981 1.00 64.04 ? 8   GLU A OE2   1 
ATOM   1522 N N     . MET E 2 8  ? -17.618 6.329   -10.378 1.00 51.47 ? 9   MET A N     1 
ATOM   1523 C CA    . MET E 2 8  ? -17.355 6.196   -8.952  1.00 51.18 ? 9   MET A CA    1 
ATOM   1524 C C     . MET E 2 8  ? -16.014 5.498   -8.742  1.00 48.38 ? 9   MET A C     1 
ATOM   1525 O O     . MET E 2 8  ? -15.230 5.888   -7.884  1.00 46.10 ? 9   MET A O     1 
ATOM   1526 C CB    . MET E 2 8  ? -18.457 5.386   -8.259  1.00 54.04 ? 9   MET A CB    1 
ATOM   1527 C CG    . MET E 2 8  ? -19.834 6.040   -8.290  1.00 59.23 ? 9   MET A CG    1 
ATOM   1528 S SD    . MET E 2 8  ? -20.980 5.350   -7.065  1.00 64.72 ? 9   MET A SD    1 
ATOM   1529 C CE    . MET E 2 8  ? -21.562 3.865   -7.914  1.00 62.39 ? 9   MET A CE    1 
ATOM   1530 N N     . GLU E 2 9  ? -15.762 4.461   -9.534  1.00 46.55 ? 10  GLU A N     1 
ATOM   1531 C CA    . GLU E 2 9  ? -14.520 3.701   -9.429  1.00 44.68 ? 10  GLU A CA    1 
ATOM   1532 C C     . GLU E 2 9  ? -13.323 4.605   -9.728  1.00 43.71 ? 10  GLU A C     1 
ATOM   1533 O O     . GLU E 2 9  ? -12.350 4.636   -8.968  1.00 42.90 ? 10  GLU A O     1 
ATOM   1534 C CB    . GLU E 2 9  ? -14.554 2.514   -10.399 1.00 44.01 ? 10  GLU A CB    1 
ATOM   1535 C CG    . GLU E 2 9  ? -13.319 1.598   -10.378 1.00 45.29 ? 10  GLU A CG    1 
ATOM   1536 C CD    . GLU E 2 9  ? -13.015 0.993   -9.007  1.00 43.92 ? 10  GLU A CD    1 
ATOM   1537 O OE1   . GLU E 2 9  ? -13.938 0.867   -8.177  1.00 45.21 ? 10  GLU A OE1   1 
ATOM   1538 O OE2   . GLU E 2 9  ? -11.846 0.626   -8.763  1.00 43.97 ? 10  GLU A OE2   1 
ATOM   1539 N N     . LYS E 2 10 ? -13.407 5.352   -10.825 1.00 42.42 ? 11  LYS A N     1 
ATOM   1540 C CA    . LYS E 2 10 ? -12.332 6.254   -11.220 1.00 42.61 ? 11  LYS A CA    1 
ATOM   1541 C C     . LYS E 2 10 ? -12.021 7.254   -10.123 1.00 41.58 ? 11  LYS A C     1 
ATOM   1542 O O     . LYS E 2 10 ? -10.871 7.645   -9.933  1.00 42.26 ? 11  LYS A O     1 
ATOM   1543 C CB    . LYS E 2 10 ? -12.705 7.007   -12.499 1.00 44.72 ? 11  LYS A CB    1 
ATOM   1544 C CG    . LYS E 2 10 ? -11.620 7.958   -12.974 1.00 47.43 ? 11  LYS A CG    1 
ATOM   1545 C CD    . LYS E 2 10 ? -11.766 8.265   -14.460 1.00 51.29 ? 11  LYS A CD    1 
ATOM   1546 C CE    . LYS E 2 10 ? -10.440 8.754   -15.037 1.00 50.64 ? 11  LYS A CE    1 
ATOM   1547 N NZ    . LYS E 2 10 ? -10.447 8.793   -16.530 1.00 55.57 ? 11  LYS A NZ    1 
ATOM   1548 N N     . ASN E 2 11 ? -13.057 7.675   -9.409  1.00 40.07 ? 12  ASN A N     1 
ATOM   1549 C CA    . ASN E 2 11 ? -12.886 8.625   -8.322  1.00 40.06 ? 12  ASN A CA    1 
ATOM   1550 C C     . ASN E 2 11 ? -12.294 7.906   -7.117  1.00 37.46 ? 12  ASN A C     1 
ATOM   1551 O O     . ASN E 2 11 ? -11.532 8.484   -6.348  1.00 35.97 ? 12  ASN A O     1 
ATOM   1552 C CB    . ASN E 2 11 ? -14.232 9.248   -7.948  1.00 41.91 ? 12  ASN A CB    1 
ATOM   1553 C CG    . ASN E 2 11 ? -14.112 10.248  -6.819  1.00 44.79 ? 12  ASN A CG    1 
ATOM   1554 O OD1   . ASN E 2 11 ? -13.351 11.212  -6.913  1.00 49.51 ? 12  ASN A OD1   1 
ATOM   1555 N ND2   . ASN E 2 11 ? -14.856 10.024  -5.743  1.00 46.43 ? 12  ASN A ND2   1 
ATOM   1556 N N     . ARG E 2 12 ? -12.648 6.636   -6.953  1.00 36.36 ? 13  ARG A N     1 
ATOM   1557 C CA    . ARG E 2 12 ? -12.121 5.859   -5.838  1.00 35.40 ? 13  ARG A CA    1 
ATOM   1558 C C     . ARG E 2 12 ? -10.618 5.697   -6.063  1.00 36.22 ? 13  ARG A C     1 
ATOM   1559 O O     . ARG E 2 12 ? -9.817  5.886   -5.152  1.00 36.02 ? 13  ARG A O     1 
ATOM   1560 C CB    . ARG E 2 12 ? -12.799 4.487   -5.794  1.00 36.79 ? 13  ARG A CB    1 
ATOM   1561 C CG    . ARG E 2 12 ? -12.736 3.784   -4.450  1.00 36.96 ? 13  ARG A CG    1 
ATOM   1562 C CD    . ARG E 2 12 ? -13.343 2.385   -4.547  1.00 38.95 ? 13  ARG A CD    1 
ATOM   1563 N NE    . ARG E 2 12 ? -12.578 1.546   -5.459  1.00 39.32 ? 13  ARG A NE    1 
ATOM   1564 C CZ    . ARG E 2 12 ? -11.355 1.086   -5.209  1.00 38.79 ? 13  ARG A CZ    1 
ATOM   1565 N NH1   . ARG E 2 12 ? -10.758 1.373   -4.061  1.00 40.38 ? 13  ARG A NH1   1 
ATOM   1566 N NH2   . ARG E 2 12 ? -10.718 0.366   -6.119  1.00 35.56 ? 13  ARG A NH2   1 
ATOM   1567 N N     . ARG E 2 13 ? -10.233 5.364   -7.291  1.00 37.34 ? 14  ARG A N     1 
ATOM   1568 C CA    . ARG E 2 13 ? -8.820  5.182   -7.612  1.00 39.05 ? 14  ARG A CA    1 
ATOM   1569 C C     . ARG E 2 13 ? -8.002  6.464   -7.444  1.00 39.58 ? 14  ARG A C     1 
ATOM   1570 O O     . ARG E 2 13 ? -6.850  6.416   -7.011  1.00 39.43 ? 14  ARG A O     1 
ATOM   1571 C CB    . ARG E 2 13 ? -8.668  4.639   -9.038  1.00 39.65 ? 14  ARG A CB    1 
ATOM   1572 C CG    . ARG E 2 13 ? -9.083  3.172   -9.162  1.00 42.36 ? 14  ARG A CG    1 
ATOM   1573 C CD    . ARG E 2 13 ? -8.679  2.566   -10.492 1.00 43.24 ? 14  ARG A CD    1 
ATOM   1574 N NE    . ARG E 2 13 ? -9.524  3.018   -11.594 1.00 45.49 ? 14  ARG A NE    1 
ATOM   1575 C CZ    . ARG E 2 13 ? -9.166  3.920   -12.501 1.00 44.20 ? 14  ARG A CZ    1 
ATOM   1576 N NH1   . ARG E 2 13 ? -7.968  4.486   -12.449 1.00 45.94 ? 14  ARG A NH1   1 
ATOM   1577 N NH2   . ARG E 2 13 ? -10.008 4.248   -13.472 1.00 45.97 ? 14  ARG A NH2   1 
ATOM   1578 N N     . ALA E 2 14 ? -8.597  7.608   -7.779  1.00 39.51 ? 15  ALA A N     1 
ATOM   1579 C CA    . ALA E 2 14 ? -7.895  8.885   -7.645  1.00 39.88 ? 15  ALA A CA    1 
ATOM   1580 C C     . ALA E 2 14 ? -7.554  9.177   -6.180  1.00 39.55 ? 15  ALA A C     1 
ATOM   1581 O O     . ALA E 2 14 ? -6.419  9.539   -5.860  1.00 38.59 ? 15  ALA A O     1 
ATOM   1582 C CB    . ALA E 2 14 ? -8.741  10.014  -8.226  1.00 38.99 ? 15  ALA A CB    1 
ATOM   1583 N N     . HIS E 2 15 ? -8.538  9.030   -5.299  1.00 40.21 ? 16  HIS A N     1 
ATOM   1584 C CA    . HIS E 2 15 ? -8.327  9.253   -3.868  1.00 42.02 ? 16  HIS A CA    1 
ATOM   1585 C C     . HIS E 2 15 ? -7.275  8.295   -3.314  1.00 40.65 ? 16  HIS A C     1 
ATOM   1586 O O     . HIS E 2 15 ? -6.485  8.662   -2.448  1.00 39.45 ? 16  HIS A O     1 
ATOM   1587 C CB    . HIS E 2 15 ? -9.633  9.064   -3.103  1.00 45.78 ? 16  HIS A CB    1 
ATOM   1588 C CG    . HIS E 2 15 ? -10.538 10.254  -3.163  1.00 49.86 ? 16  HIS A CG    1 
ATOM   1589 N ND1   . HIS E 2 15 ? -10.321 11.389  -2.412  1.00 49.43 ? 16  HIS A ND1   1 
ATOM   1590 C CD2   . HIS E 2 15 ? -11.636 10.501  -3.914  1.00 50.26 ? 16  HIS A CD2   1 
ATOM   1591 C CE1   . HIS E 2 15 ? -11.246 12.285  -2.698  1.00 51.83 ? 16  HIS A CE1   1 
ATOM   1592 N NE2   . HIS E 2 15 ? -12.056 11.772  -3.607  1.00 53.02 ? 16  HIS A NE2   1 
ATOM   1593 N N     . LEU E 2 16 ? -7.266  7.067   -3.822  1.00 40.00 ? 17  LEU A N     1 
ATOM   1594 C CA    . LEU E 2 16 ? -6.292  6.076   -3.367  1.00 38.37 ? 17  LEU A CA    1 
ATOM   1595 C C     . LEU E 2 16 ? -4.922  6.523   -3.853  1.00 38.03 ? 17  LEU A C     1 
ATOM   1596 O O     . LEU E 2 16 ? -3.913  6.340   -3.172  1.00 37.09 ? 17  LEU A O     1 
ATOM   1597 C CB    . LEU E 2 16 ? -6.644  4.689   -3.929  1.00 36.97 ? 17  LEU A CB    1 
ATOM   1598 C CG    . LEU E 2 16 ? -5.792  3.496   -3.484  1.00 38.89 ? 17  LEU A CG    1 
ATOM   1599 C CD1   . LEU E 2 16 ? -5.772  3.412   -1.959  1.00 36.30 ? 17  LEU A CD1   1 
ATOM   1600 C CD2   . LEU E 2 16 ? -6.364  2.199   -4.079  1.00 38.89 ? 17  LEU A CD2   1 
ATOM   1601 N N     . ARG E 2 17 ? -4.895  7.128   -5.037  1.00 36.88 ? 18  ARG A N     1 
ATOM   1602 C CA    . ARG E 2 17 ? -3.652  7.617   -5.613  1.00 36.75 ? 18  ARG A CA    1 
ATOM   1603 C C     . ARG E 2 17 ? -3.098  8.754   -4.753  1.00 34.21 ? 18  ARG A C     1 
ATOM   1604 O O     . ARG E 2 17 ? -1.889  8.863   -4.564  1.00 31.68 ? 18  ARG A O     1 
ATOM   1605 C CB    . ARG E 2 17 ? -3.891  8.106   -7.045  1.00 40.31 ? 18  ARG A CB    1 
ATOM   1606 C CG    . ARG E 2 17 ? -2.665  8.030   -7.953  1.00 46.52 ? 18  ARG A CG    1 
ATOM   1607 C CD    . ARG E 2 17 ? -3.042  8.331   -9.413  1.00 51.06 ? 18  ARG A CD    1 
ATOM   1608 N NE    . ARG E 2 17 ? -4.344  7.762   -9.754  1.00 54.62 ? 18  ARG A NE    1 
ATOM   1609 C CZ    . ARG E 2 17 ? -4.831  7.653   -10.990 1.00 56.96 ? 18  ARG A CZ    1 
ATOM   1610 N NH1   . ARG E 2 17 ? -4.122  8.071   -12.038 1.00 58.23 ? 18  ARG A NH1   1 
ATOM   1611 N NH2   . ARG E 2 17 ? -6.036  7.131   -11.173 1.00 58.41 ? 18  ARG A NH2   1 
ATOM   1612 N N     . LEU E 2 18 ? -3.987  9.595   -4.227  1.00 32.85 ? 19  LEU A N     1 
ATOM   1613 C CA    . LEU E 2 18 ? -3.573  10.709  -3.376  1.00 32.60 ? 19  LEU A CA    1 
ATOM   1614 C C     . LEU E 2 18 ? -2.950  10.169  -2.085  1.00 31.59 ? 19  LEU A C     1 
ATOM   1615 O O     . LEU E 2 18 ? -1.967  10.702  -1.592  1.00 31.62 ? 19  LEU A O     1 
ATOM   1616 C CB    . LEU E 2 18 ? -4.771  11.613  -3.041  1.00 35.53 ? 19  LEU A CB    1 
ATOM   1617 C CG    . LEU E 2 18 ? -5.329  12.514  -4.159  1.00 38.73 ? 19  LEU A CG    1 
ATOM   1618 C CD1   . LEU E 2 18 ? -6.554  13.280  -3.659  1.00 40.85 ? 19  LEU A CD1   1 
ATOM   1619 C CD2   . LEU E 2 18 ? -4.255  13.497  -4.603  1.00 40.55 ? 19  LEU A CD2   1 
ATOM   1620 N N     . SER E 2 19 ? -3.511  9.097   -1.545  1.00 31.04 ? 20  SER A N     1 
ATOM   1621 C CA    . SER E 2 19 ? -2.960  8.518   -0.324  1.00 31.22 ? 20  SER A CA    1 
ATOM   1622 C C     . SER E 2 19 ? -1.580  7.922   -0.592  1.00 31.55 ? 20  SER A C     1 
ATOM   1623 O O     . SER E 2 19 ? -0.670  8.051   0.224   1.00 30.69 ? 20  SER A O     1 
ATOM   1624 C CB    . SER E 2 19 ? -3.910  7.464   0.221   1.00 32.19 ? 20  SER A CB    1 
ATOM   1625 O OG    . SER E 2 19 ? -5.134  8.077   0.583   1.00 35.53 ? 20  SER A OG    1 
ATOM   1626 N N     . LEU E 2 20 ? -1.415  7.308   -1.758  1.00 31.41 ? 21  LEU A N     1 
ATOM   1627 C CA    . LEU E 2 20 ? -0.129  6.718   -2.136  1.00 33.56 ? 21  LEU A CA    1 
ATOM   1628 C C     . LEU E 2 20 ? 0.976   7.775   -2.320  1.00 33.16 ? 21  LEU A C     1 
ATOM   1629 O O     . LEU E 2 20 ? 2.099   7.619   -1.820  1.00 31.92 ? 21  LEU A O     1 
ATOM   1630 C CB    . LEU E 2 20 ? -0.299  5.916   -3.429  1.00 34.16 ? 21  LEU A CB    1 
ATOM   1631 C CG    . LEU E 2 20 ? 0.694   4.774   -3.647  1.00 38.25 ? 21  LEU A CG    1 
ATOM   1632 C CD1   . LEU E 2 20 ? 0.407   3.669   -2.627  1.00 33.90 ? 21  LEU A CD1   1 
ATOM   1633 C CD2   . LEU E 2 20 ? 0.558   4.240   -5.075  1.00 37.56 ? 21  LEU A CD2   1 
ATOM   1634 N N     . GLU E 2 21 ? 0.666   8.851   -3.040  1.00 34.98 ? 22  GLU A N     1 
ATOM   1635 C CA    . GLU E 2 21 ? 1.646   9.913   -3.260  1.00 36.26 ? 22  GLU A CA    1 
ATOM   1636 C C     . GLU E 2 21 ? 2.107   10.508  -1.927  1.00 37.05 ? 22  GLU A C     1 
ATOM   1637 O O     . GLU E 2 21 ? 3.294   10.775  -1.740  1.00 37.51 ? 22  GLU A O     1 
ATOM   1638 C CB    . GLU E 2 21 ? 1.059   11.030  -4.133  1.00 39.21 ? 22  GLU A CB    1 
ATOM   1639 C CG    . GLU E 2 21 ? 0.854   10.692  -5.607  1.00 41.42 ? 22  GLU A CG    1 
ATOM   1640 C CD    . GLU E 2 21 ? 2.156   10.402  -6.348  1.00 44.16 ? 22  GLU A CD    1 
ATOM   1641 O OE1   . GLU E 2 21 ? 3.210   10.945  -5.963  1.00 46.39 ? 22  GLU A OE1   1 
ATOM   1642 O OE2   . GLU E 2 21 ? 2.123   9.641   -7.335  1.00 48.00 ? 22  GLU A OE2   1 
ATOM   1643 N N     . LYS E 2 22 ? 1.171   10.717  -1.004  1.00 36.86 ? 23  LYS A N     1 
ATOM   1644 C CA    . LYS E 2 22 ? 1.514   11.274  0.303   1.00 39.48 ? 23  LYS A CA    1 
ATOM   1645 C C     . LYS E 2 22 ? 2.534   10.365  1.013   1.00 38.09 ? 23  LYS A C     1 
ATOM   1646 O O     . LYS E 2 22 ? 3.585   10.829  1.458   1.00 37.86 ? 23  LYS A O     1 
ATOM   1647 C CB    . LYS E 2 22 ? 0.252   11.443  1.159   1.00 39.92 ? 23  LYS A CB    1 
ATOM   1648 C CG    . LYS E 2 22 ? 0.467   12.286  2.409   1.00 45.84 ? 23  LYS A CG    1 
ATOM   1649 C CD    . LYS E 2 22 ? -0.839  12.547  3.169   1.00 48.92 ? 23  LYS A CD    1 
ATOM   1650 C CE    . LYS E 2 22 ? -1.385  11.273  3.811   1.00 52.04 ? 23  LYS A CE    1 
ATOM   1651 N NZ    . LYS E 2 22 ? -2.623  11.493  4.624   1.00 53.04 ? 23  LYS A NZ    1 
ATOM   1652 N N     . LEU E 2 23 ? 2.234   9.070   1.099   1.00 38.70 ? 24  LEU A N     1 
ATOM   1653 C CA    . LEU E 2 23 ? 3.143   8.108   1.733   1.00 35.83 ? 24  LEU A CA    1 
ATOM   1654 C C     . LEU E 2 23 ? 4.486   8.140   0.998   1.00 37.82 ? 24  LEU A C     1 
ATOM   1655 O O     . LEU E 2 23 ? 5.549   7.985   1.598   1.00 36.20 ? 24  LEU A O     1 
ATOM   1656 C CB    . LEU E 2 23 ? 2.541   6.694   1.673   1.00 33.41 ? 24  LEU A CB    1 
ATOM   1657 C CG    . LEU E 2 23 ? 3.327   5.557   2.337   1.00 30.80 ? 24  LEU A CG    1 
ATOM   1658 C CD1   . LEU E 2 23 ? 3.686   5.931   3.784   1.00 28.00 ? 24  LEU A CD1   1 
ATOM   1659 C CD2   . LEU E 2 23 ? 2.488   4.279   2.315   1.00 30.91 ? 24  LEU A CD2   1 
ATOM   1660 N N     . LYS E 2 24 ? 4.427   8.344   -0.312  1.00 41.14 ? 25  LYS A N     1 
ATOM   1661 C CA    . LYS E 2 24 ? 5.627   8.419   -1.125  1.00 46.34 ? 25  LYS A CA    1 
ATOM   1662 C C     . LYS E 2 24 ? 6.448   9.630   -0.688  1.00 49.89 ? 25  LYS A C     1 
ATOM   1663 O O     . LYS E 2 24 ? 7.679   9.601   -0.712  1.00 50.35 ? 25  LYS A O     1 
ATOM   1664 C CB    . LYS E 2 24 ? 5.253   8.541   -2.607  1.00 48.46 ? 25  LYS A CB    1 
ATOM   1665 C CG    . LYS E 2 24 ? 6.439   8.831   -3.524  1.00 50.83 ? 25  LYS A CG    1 
ATOM   1666 C CD    . LYS E 2 24 ? 6.047   8.837   -4.994  1.00 52.71 ? 25  LYS A CD    1 
ATOM   1667 C CE    . LYS E 2 24 ? 5.878   7.418   -5.520  1.00 54.50 ? 25  LYS A CE    1 
ATOM   1668 N NZ    . LYS E 2 24 ? 4.932   6.602   -4.695  1.00 53.58 ? 25  LYS A NZ    1 
ATOM   1669 N N     . GLY E 2 25 ? 5.755   10.688  -0.281  1.00 52.42 ? 26  GLY A N     1 
ATOM   1670 C CA    . GLY E 2 25 ? 6.426   11.894  0.166   1.00 57.10 ? 26  GLY A CA    1 
ATOM   1671 C C     . GLY E 2 25 ? 7.303   11.594  1.359   1.00 59.66 ? 26  GLY A C     1 
ATOM   1672 O O     . GLY E 2 25 ? 8.464   11.993  1.396   1.00 60.48 ? 26  GLY A O     1 
ATOM   1673 N N     . LEU E 2 26 ? 6.739   10.907  2.350   1.00 62.05 ? 27  LEU A N     1 
ATOM   1674 C CA    . LEU E 2 26 ? 7.498   10.516  3.533   1.00 64.32 ? 27  LEU A CA    1 
ATOM   1675 C C     . LEU E 2 26 ? 8.317   9.327   3.058   1.00 65.88 ? 27  LEU A C     1 
ATOM   1676 O O     . LEU E 2 26 ? 8.171   8.901   1.914   1.00 66.98 ? 27  LEU A O     1 
ATOM   1677 C CB    . LEU E 2 26 ? 6.559   10.075  4.659   1.00 62.44 ? 27  LEU A CB    1 
ATOM   1678 C CG    . LEU E 2 26 ? 5.590   11.130  5.184   1.00 62.90 ? 27  LEU A CG    1 
ATOM   1679 C CD1   . LEU E 2 26 ? 4.613   10.507  6.168   1.00 62.70 ? 27  LEU A CD1   1 
ATOM   1680 C CD2   . LEU E 2 26 ? 6.380   12.248  5.837   1.00 62.53 ? 27  LEU A CD2   1 
ATOM   1681 N N     . VAL E 2 27 ? 9.173   8.788   3.915   1.00 68.45 ? 28  VAL A N     1 
ATOM   1682 C CA    . VAL E 2 27 ? 9.977   7.636   3.522   1.00 70.78 ? 28  VAL A CA    1 
ATOM   1683 C C     . VAL E 2 27 ? 11.036  8.060   2.514   1.00 73.33 ? 28  VAL A C     1 
ATOM   1684 O O     . VAL E 2 27 ? 10.714  8.595   1.450   1.00 73.56 ? 28  VAL A O     1 
ATOM   1685 C CB    . VAL E 2 27 ? 9.094   6.532   2.876   1.00 69.71 ? 28  VAL A CB    1 
ATOM   1686 C CG1   . VAL E 2 27 ? 9.948   5.360   2.451   1.00 69.26 ? 28  VAL A CG1   1 
ATOM   1687 C CG2   . VAL E 2 27 ? 8.015   6.081   3.855   1.00 69.63 ? 28  VAL A CG2   1 
ATOM   1688 N N     . PRO E 2 28 ? 12.320  7.823   2.832   1.00 75.65 ? 29  PRO A N     1 
ATOM   1689 C CA    . PRO E 2 28 ? 13.395  8.202   1.910   1.00 77.81 ? 29  PRO A CA    1 
ATOM   1690 C C     . PRO E 2 28 ? 13.139  7.691   0.496   1.00 79.57 ? 29  PRO A C     1 
ATOM   1691 O O     . PRO E 2 28 ? 13.590  8.289   -0.480  1.00 80.54 ? 29  PRO A O     1 
ATOM   1692 C CB    . PRO E 2 28 ? 14.640  7.580   2.549   1.00 77.02 ? 29  PRO A CB    1 
ATOM   1693 C CG    . PRO E 2 28 ? 14.089  6.427   3.336   1.00 76.88 ? 29  PRO A CG    1 
ATOM   1694 C CD    . PRO E 2 28 ? 12.848  7.021   3.947   1.00 75.96 ? 29  PRO A CD    1 
ATOM   1695 N N     . LEU E 2 29 ? 12.397  6.591   0.397   1.00 81.77 ? 30  LEU A N     1 
ATOM   1696 C CA    . LEU E 2 29 ? 12.086  6.018   -0.899  1.00 83.21 ? 30  LEU A CA    1 
ATOM   1697 C C     . LEU E 2 29 ? 13.337  5.700   -1.690  1.00 84.10 ? 30  LEU A C     1 
ATOM   1698 O O     . LEU E 2 29 ? 13.829  4.572   -1.663  1.00 84.64 ? 30  LEU A O     1 
ATOM   1699 N N     . GLY E 2 30 ? 13.854  6.699   -2.395  1.00 84.74 ? 31  GLY A N     1 
ATOM   1700 C CA    . GLY E 2 30 ? 15.058  6.527   -3.193  1.00 84.93 ? 31  GLY A CA    1 
ATOM   1701 C C     . GLY E 2 30 ? 15.714  7.879   -3.437  1.00 84.97 ? 31  GLY A C     1 
ATOM   1702 O O     . GLY E 2 30 ? 15.101  8.922   -3.221  1.00 85.14 ? 31  GLY A O     1 
ATOM   1703 N N     . PRO E 2 31 ? 16.965  7.856   -3.884  1.00 85.49 ? 32  PRO A N     1 
ATOM   1704 C CA    . PRO E 2 31 ? 17.697  9.082   -4.166  1.00 85.46 ? 32  PRO A CA    1 
ATOM   1705 C C     . PRO E 2 31 ? 17.557  9.402   -5.648  1.00 85.49 ? 32  PRO A C     1 
ATOM   1706 O O     . PRO E 2 31 ? 17.660  8.510   -6.491  1.00 85.88 ? 32  PRO A O     1 
ATOM   1707 C CB    . PRO E 2 31 ? 19.167  8.912   -3.798  1.00 85.95 ? 32  PRO A CB    1 
ATOM   1708 N N     . ASP E 2 32 ? 17.320  10.674  -5.957  1.00 85.25 ? 33  ASP A N     1 
ATOM   1709 C CA    . ASP E 2 32 ? 17.150  11.126  -7.337  1.00 85.05 ? 33  ASP A CA    1 
ATOM   1710 C C     . ASP E 2 32 ? 15.804  10.651  -7.884  1.00 84.66 ? 33  ASP A C     1 
ATOM   1711 O O     . ASP E 2 32 ? 14.911  10.295  -7.113  1.00 84.89 ? 33  ASP A O     1 
ATOM   1712 C CB    . ASP E 2 32 ? 18.292  10.603  -8.213  1.00 85.00 ? 33  ASP A CB    1 
ATOM   1713 N N     . SER E 2 33 ? 15.666  10.650  -9.209  1.00 83.78 ? 34  SER A N     1 
ATOM   1714 C CA    . SER E 2 33 ? 14.430  10.217  -9.860  1.00 82.25 ? 34  SER A CA    1 
ATOM   1715 C C     . SER E 2 33 ? 13.914  8.926   -9.228  1.00 81.26 ? 34  SER A C     1 
ATOM   1716 O O     . SER E 2 33 ? 14.512  7.862   -9.392  1.00 81.44 ? 34  SER A O     1 
ATOM   1717 C CB    . SER E 2 33 ? 14.672  10.013  -11.347 1.00 82.62 ? 34  SER A CB    1 
ATOM   1718 N N     . SER E 2 34 ? 12.796  9.028   -8.514  1.00 79.28 ? 35  SER A N     1 
ATOM   1719 C CA    . SER E 2 34 ? 12.198  7.885   -7.830  1.00 76.51 ? 35  SER A CA    1 
ATOM   1720 C C     . SER E 2 34 ? 11.340  6.974   -8.711  1.00 74.71 ? 35  SER A C     1 
ATOM   1721 O O     . SER E 2 34 ? 11.015  7.310   -9.851  1.00 74.67 ? 35  SER A O     1 
ATOM   1722 C CB    . SER E 2 34 ? 11.371  8.379   -6.644  1.00 77.30 ? 35  SER A CB    1 
ATOM   1723 N N     . ARG E 2 35 ? 10.980  5.816   -8.159  1.00 72.30 ? 36  ARG A N     1 
ATOM   1724 C CA    . ARG E 2 35 ? 10.148  4.836   -8.850  1.00 68.66 ? 36  ARG A CA    1 
ATOM   1725 C C     . ARG E 2 35 ? 8.883   4.560   -8.038  1.00 66.43 ? 36  ARG A C     1 
ATOM   1726 O O     . ARG E 2 35 ? 8.899   4.593   -6.809  1.00 65.90 ? 36  ARG A O     1 
ATOM   1727 C CB    . ARG E 2 35 ? 10.926  3.537   -9.078  1.00 70.19 ? 36  ARG A CB    1 
ATOM   1728 C CG    . ARG E 2 35 ? 12.110  3.689   -10.027 1.00 72.43 ? 36  ARG A CG    1 
ATOM   1729 C CD    . ARG E 2 35 ? 12.713  2.339   -10.393 1.00 74.66 ? 36  ARG A CD    1 
ATOM   1730 N NE    . ARG E 2 35 ? 13.802  2.465   -11.362 1.00 76.10 ? 36  ARG A NE    1 
ATOM   1731 C CZ    . ARG E 2 35 ? 14.447  1.435   -11.907 1.00 76.47 ? 36  ARG A CZ    1 
ATOM   1732 N NH1   . ARG E 2 35 ? 14.118  0.190   -11.582 1.00 76.46 ? 36  ARG A NH1   1 
ATOM   1733 N NH2   . ARG E 2 35 ? 15.422  1.652   -12.779 1.00 77.06 ? 36  ARG A NH2   1 
ATOM   1734 N N     . HIS E 2 36 ? 7.790   4.282   -8.742  1.00 63.12 ? 37  HIS A N     1 
ATOM   1735 C CA    . HIS E 2 36 ? 6.490   4.032   -8.129  1.00 59.28 ? 37  HIS A CA    1 
ATOM   1736 C C     . HIS E 2 36 ? 6.286   2.541   -7.858  1.00 57.39 ? 37  HIS A C     1 
ATOM   1737 O O     . HIS E 2 36 ? 6.392   2.073   -6.715  1.00 57.81 ? 37  HIS A O     1 
ATOM   1738 C CB    . HIS E 2 36 ? 5.404   4.555   -9.079  1.00 61.22 ? 37  HIS A CB    1 
ATOM   1739 C CG    . HIS E 2 36 ? 4.077   4.805   -8.431  1.00 62.44 ? 37  HIS A CG    1 
ATOM   1740 N ND1   . HIS E 2 36 ? 2.957   4.052   -8.714  1.00 61.12 ? 37  HIS A ND1   1 
ATOM   1741 C CD2   . HIS E 2 36 ? 3.679   5.758   -7.553  1.00 61.30 ? 37  HIS A CD2   1 
ATOM   1742 C CE1   . HIS E 2 36 ? 1.926   4.531   -8.042  1.00 63.01 ? 37  HIS A CE1   1 
ATOM   1743 N NE2   . HIS E 2 36 ? 2.338   5.567   -7.330  1.00 62.41 ? 37  HIS A NE2   1 
ATOM   1744 N N     . THR E 2 37 ? 5.953   1.804   -8.911  1.00 53.15 ? 38  THR A N     1 
ATOM   1745 C CA    . THR E 2 37 ? 5.760   0.369   -8.807  1.00 49.20 ? 38  THR A CA    1 
ATOM   1746 C C     . THR E 2 37 ? 4.584   0.013   -7.915  1.00 46.66 ? 38  THR A C     1 
ATOM   1747 O O     . THR E 2 37 ? 3.979   -1.070  -8.062  1.00 45.14 ? 38  THR A O     1 
ATOM   1748 C CB    . THR E 2 37 ? 6.983   -0.287  -8.176  1.00 47.14 ? 38  THR A CB    1 
ATOM   1749 O OG1   . THR E 2 37 ? 8.147   0.471   -8.520  1.00 52.73 ? 38  THR A OG1   1 
ATOM   1750 C CG2   . THR E 2 37 ? 7.145   -1.725  -8.679  1.00 51.83 ? 38  THR A CG2   1 
ATOM   1751 N N     . THR E 2 38 ? 4.281   0.940   -7.005  1.00 40.13 ? 39  THR A N     1 
ATOM   1752 C CA    . THR E 2 38 ? 3.270   0.766   -5.976  1.00 35.09 ? 39  THR A CA    1 
ATOM   1753 C C     . THR E 2 38 ? 3.941   -0.284  -5.097  1.00 32.10 ? 39  THR A C     1 
ATOM   1754 O O     . THR E 2 38 ? 4.069   -0.121  -3.889  1.00 25.50 ? 39  THR A O     1 
ATOM   1755 C CB    . THR E 2 38 ? 1.939   0.224   -6.511  1.00 35.46 ? 39  THR A CB    1 
ATOM   1756 O OG1   . THR E 2 38 ? 1.341   1.189   -7.383  1.00 38.71 ? 39  THR A OG1   1 
ATOM   1757 C CG2   . THR E 2 38 ? 0.993   -0.052  -5.362  1.00 36.04 ? 39  THR A CG2   1 
ATOM   1758 N N     . LEU E 2 39 ? 4.452   -1.331  -5.737  1.00 29.09 ? 40  LEU A N     1 
ATOM   1759 C CA    . LEU E 2 39 ? 5.116   -2.406  -5.017  1.00 27.53 ? 40  LEU A CA    1 
ATOM   1760 C C     . LEU E 2 39 ? 6.355   -1.929  -4.260  1.00 26.01 ? 40  LEU A C     1 
ATOM   1761 O O     . LEU E 2 39 ? 6.532   -2.294  -3.103  1.00 21.85 ? 40  LEU A O     1 
ATOM   1762 C CB    . LEU E 2 39 ? 5.498   -3.530  -5.984  1.00 27.26 ? 40  LEU A CB    1 
ATOM   1763 C CG    . LEU E 2 39 ? 6.309   -4.689  -5.396  1.00 27.70 ? 40  LEU A CG    1 
ATOM   1764 C CD1   . LEU E 2 39 ? 5.490   -5.476  -4.347  1.00 23.98 ? 40  LEU A CD1   1 
ATOM   1765 C CD2   . LEU E 2 39 ? 6.699   -5.611  -6.558  1.00 30.55 ? 40  LEU A CD2   1 
ATOM   1766 N N     . SER E 2 40 ? 7.201   -1.107  -4.886  1.00 24.36 ? 41  SER A N     1 
ATOM   1767 C CA    . SER E 2 40 ? 8.416   -0.640  -4.211  1.00 25.22 ? 41  SER A CA    1 
ATOM   1768 C C     . SER E 2 40 ? 8.075   0.278   -3.067  1.00 24.46 ? 41  SER A C     1 
ATOM   1769 O O     . SER E 2 40 ? 8.785   0.304   -2.070  1.00 26.56 ? 41  SER A O     1 
ATOM   1770 C CB    . SER E 2 40 ? 9.370   0.101   -5.164  1.00 26.52 ? 41  SER A CB    1 
ATOM   1771 O OG    . SER E 2 40 ? 8.859   1.379   -5.530  1.00 31.65 ? 41  SER A OG    1 
ATOM   1772 N N     . LEU E 2 41 ? 6.989   1.032   -3.208  1.00 24.82 ? 42  LEU A N     1 
ATOM   1773 C CA    . LEU E 2 41 ? 6.582   1.965   -2.160  1.00 27.07 ? 42  LEU A CA    1 
ATOM   1774 C C     . LEU E 2 41 ? 6.081   1.199   -0.939  1.00 23.49 ? 42  LEU A C     1 
ATOM   1775 O O     . LEU E 2 41 ? 6.510   1.469   0.177   1.00 27.71 ? 42  LEU A O     1 
ATOM   1776 C CB    . LEU E 2 41 ? 5.479   2.918   -2.661  1.00 28.22 ? 42  LEU A CB    1 
ATOM   1777 C CG    . LEU E 2 41 ? 4.891   3.833   -1.572  1.00 28.68 ? 42  LEU A CG    1 
ATOM   1778 C CD1   . LEU E 2 41 ? 6.012   4.603   -0.876  1.00 30.05 ? 42  LEU A CD1   1 
ATOM   1779 C CD2   . LEU E 2 41 ? 3.880   4.775   -2.187  1.00 30.76 ? 42  LEU A CD2   1 
ATOM   1780 N N     . LEU E 2 42 ? 5.181   0.245   -1.156  1.00 24.98 ? 43  LEU A N     1 
ATOM   1781 C CA    . LEU E 2 42 ? 4.629   -0.559  -0.060  1.00 24.83 ? 43  LEU A CA    1 
ATOM   1782 C C     . LEU E 2 42 ? 5.722   -1.311  0.672   1.00 26.04 ? 43  LEU A C     1 
ATOM   1783 O O     . LEU E 2 42 ? 5.652   -1.520  1.888   1.00 29.16 ? 43  LEU A O     1 
ATOM   1784 C CB    . LEU E 2 42 ? 3.606   -1.555  -0.596  1.00 24.40 ? 43  LEU A CB    1 
ATOM   1785 C CG    . LEU E 2 42 ? 2.386   -0.949  -1.285  1.00 27.28 ? 43  LEU A CG    1 
ATOM   1786 C CD1   . LEU E 2 42 ? 1.561   -2.035  -1.979  1.00 26.48 ? 43  LEU A CD1   1 
ATOM   1787 C CD2   . LEU E 2 42 ? 1.557   -0.213  -0.242  1.00 28.46 ? 43  LEU A CD2   1 
ATOM   1788 N N     . THR E 2 43 ? 6.735   -1.729  -0.074  1.00 23.92 ? 44  THR A N     1 
ATOM   1789 C CA    . THR E 2 43 ? 7.858   -2.448  0.494   1.00 24.60 ? 44  THR A CA    1 
ATOM   1790 C C     . THR E 2 43 ? 8.720   -1.523  1.351   1.00 25.95 ? 44  THR A C     1 
ATOM   1791 O O     . THR E 2 43 ? 9.034   -1.826  2.510   1.00 25.75 ? 44  THR A O     1 
ATOM   1792 C CB    . THR E 2 43 ? 8.726   -3.048  -0.638  1.00 25.03 ? 44  THR A CB    1 
ATOM   1793 O OG1   . THR E 2 43 ? 7.976   -4.049  -1.345  1.00 24.70 ? 44  THR A OG1   1 
ATOM   1794 C CG2   . THR E 2 43 ? 9.982   -3.648  -0.074  1.00 29.18 ? 44  THR A CG2   1 
ATOM   1795 N N     . LYS E 2 44 ? 9.098   -0.383  0.778   1.00 24.42 ? 45  LYS A N     1 
ATOM   1796 C CA    . LYS E 2 44 ? 9.934   0.567   1.474   1.00 25.43 ? 45  LYS A CA    1 
ATOM   1797 C C     . LYS E 2 44 ? 9.264   1.118   2.723   1.00 24.92 ? 45  LYS A C     1 
ATOM   1798 O O     . LYS E 2 44 ? 9.923   1.313   3.740   1.00 24.23 ? 45  LYS A O     1 
ATOM   1799 C CB    . LYS E 2 44 ? 10.299  1.727   0.546   1.00 29.69 ? 45  LYS A CB    1 
ATOM   1800 C CG    . LYS E 2 44 ? 11.361  2.658   1.108   1.00 35.07 ? 45  LYS A CG    1 
ATOM   1801 C CD    . LYS E 2 44 ? 12.764  2.136   0.840   1.00 38.61 ? 45  LYS A CD    1 
ATOM   1802 C CE    . LYS E 2 44 ? 13.839  2.969   1.540   1.00 43.27 ? 45  LYS A CE    1 
ATOM   1803 N NZ    . LYS E 2 44 ? 13.869  4.406   1.129   1.00 45.16 ? 45  LYS A NZ    1 
ATOM   1804 N N     . ALA E 2 45 ? 7.963   1.385   2.641   1.00 24.74 ? 46  ALA A N     1 
ATOM   1805 C CA    . ALA E 2 45 ? 7.244   1.919   3.786   1.00 25.55 ? 46  ALA A CA    1 
ATOM   1806 C C     . ALA E 2 45 ? 7.293   0.904   4.941   1.00 24.56 ? 46  ALA A C     1 
ATOM   1807 O O     . ALA E 2 45 ? 7.618   1.257   6.073   1.00 23.41 ? 46  ALA A O     1 
ATOM   1808 C CB    . ALA E 2 45 ? 5.808   2.222   3.398   1.00 25.01 ? 46  ALA A CB    1 
ATOM   1809 N N     . LYS E 2 46 ? 6.988   -0.356  4.649   1.00 25.14 ? 47  LYS A N     1 
ATOM   1810 C CA    . LYS E 2 46 ? 7.025   -1.377  5.690   1.00 24.46 ? 47  LYS A CA    1 
ATOM   1811 C C     . LYS E 2 46 ? 8.393   -1.419  6.360   1.00 25.71 ? 47  LYS A C     1 
ATOM   1812 O O     . LYS E 2 46 ? 8.498   -1.353  7.586   1.00 27.26 ? 47  LYS A O     1 
ATOM   1813 C CB    . LYS E 2 46 ? 6.701   -2.763  5.125   1.00 23.92 ? 47  LYS A CB    1 
ATOM   1814 C CG    . LYS E 2 46 ? 6.749   -3.867  6.217   1.00 26.01 ? 47  LYS A CG    1 
ATOM   1815 C CD    . LYS E 2 46 ? 6.510   -5.262  5.663   1.00 26.00 ? 47  LYS A CD    1 
ATOM   1816 C CE    . LYS E 2 46 ? 7.756   -5.789  4.953   1.00 28.48 ? 47  LYS A CE    1 
ATOM   1817 N NZ    . LYS E 2 46 ? 7.422   -7.064  4.246   1.00 29.02 ? 47  LYS A NZ    1 
ATOM   1818 N N     . LEU E 2 47 ? 9.450   -1.501  5.559   1.00 25.35 ? 48  LEU A N     1 
ATOM   1819 C CA    . LEU E 2 47 ? 10.800  -1.568  6.109   1.00 25.84 ? 48  LEU A CA    1 
ATOM   1820 C C     . LEU E 2 47 ? 11.193  -0.327  6.907   1.00 27.09 ? 48  LEU A C     1 
ATOM   1821 O O     . LEU E 2 47 ? 11.871  -0.439  7.933   1.00 25.73 ? 48  LEU A O     1 
ATOM   1822 C CB    . LEU E 2 47 ? 11.794  -1.852  4.987   1.00 26.35 ? 48  LEU A CB    1 
ATOM   1823 C CG    . LEU E 2 47 ? 11.560  -3.215  4.307   1.00 29.78 ? 48  LEU A CG    1 
ATOM   1824 C CD1   . LEU E 2 47 ? 12.556  -3.393  3.137   1.00 28.63 ? 48  LEU A CD1   1 
ATOM   1825 C CD2   . LEU E 2 47 ? 11.718  -4.351  5.325   1.00 29.11 ? 48  LEU A CD2   1 
ATOM   1826 N N     . HIS E 2 48 ? 10.742  0.847   6.461   1.00 27.15 ? 49  HIS A N     1 
ATOM   1827 C CA    . HIS E 2 48 ? 11.018  2.095   7.172   1.00 27.94 ? 49  HIS A CA    1 
ATOM   1828 C C     . HIS E 2 48 ? 10.307  2.061   8.547   1.00 27.46 ? 49  HIS A C     1 
ATOM   1829 O O     . HIS E 2 48 ? 10.902  2.420   9.571   1.00 30.10 ? 49  HIS A O     1 
ATOM   1830 C CB    . HIS E 2 48 ? 10.525  3.301   6.350   1.00 27.37 ? 49  HIS A CB    1 
ATOM   1831 C CG    . HIS E 2 48 ? 10.774  4.626   7.006   1.00 27.62 ? 49  HIS A CG    1 
ATOM   1832 N ND1   . HIS E 2 48 ? 12.040  5.113   7.246   1.00 30.48 ? 49  HIS A ND1   1 
ATOM   1833 C CD2   . HIS E 2 48 ? 9.917   5.566   7.467   1.00 28.48 ? 49  HIS A CD2   1 
ATOM   1834 C CE1   . HIS E 2 48 ? 11.954  6.294   7.832   1.00 31.61 ? 49  HIS A CE1   1 
ATOM   1835 N NE2   . HIS E 2 48 ? 10.676  6.593   7.978   1.00 30.75 ? 49  HIS A NE2   1 
ATOM   1836 N N     . ILE E 2 49 ? 9.049   1.625   8.576   1.00 28.26 ? 50  ILE A N     1 
ATOM   1837 C CA    . ILE E 2 49 ? 8.314   1.552   9.843   1.00 27.64 ? 50  ILE A CA    1 
ATOM   1838 C C     . ILE E 2 49 ? 9.107   0.640   10.773  1.00 29.38 ? 50  ILE A C     1 
ATOM   1839 O O     . ILE E 2 49 ? 9.324   0.979   11.934  1.00 27.25 ? 50  ILE A O     1 
ATOM   1840 C CB    . ILE E 2 49 ? 6.865   1.010   9.651   1.00 27.25 ? 50  ILE A CB    1 
ATOM   1841 C CG1   . ILE E 2 49 ? 5.982   2.092   9.029   1.00 26.30 ? 50  ILE A CG1   1 
ATOM   1842 C CG2   . ILE E 2 49 ? 6.257   0.576   11.002  1.00 29.18 ? 50  ILE A CG2   1 
ATOM   1843 C CD1   . ILE E 2 49 ? 4.601   1.604   8.611   1.00 21.17 ? 50  ILE A CD1   1 
ATOM   1844 N N     . LYS E 2 50 ? 9.556   -0.501  10.243  1.00 29.60 ? 51  LYS A N     1 
ATOM   1845 C CA    . LYS E 2 50 ? 10.349  -1.461  10.999  1.00 32.54 ? 51  LYS A CA    1 
ATOM   1846 C C     . LYS E 2 50 ? 11.580  -0.807  11.620  1.00 33.19 ? 51  LYS A C     1 
ATOM   1847 O O     . LYS E 2 50 ? 11.913  -1.068  12.777  1.00 35.00 ? 51  LYS A O     1 
ATOM   1848 C CB    . LYS E 2 50 ? 10.776  -2.621  10.084  1.00 35.72 ? 51  LYS A CB    1 
ATOM   1849 C CG    . LYS E 2 50 ? 10.032  -3.935  10.315  1.00 36.90 ? 51  LYS A CG    1 
ATOM   1850 C CD    . LYS E 2 50 ? 8.524   -3.772  10.422  1.00 38.63 ? 51  LYS A CD    1 
ATOM   1851 C CE    . LYS E 2 50 ? 7.874   -5.107  10.765  1.00 41.30 ? 51  LYS A CE    1 
ATOM   1852 N NZ    . LYS E 2 50 ? 6.430   -5.005  11.111  1.00 41.21 ? 51  LYS A NZ    1 
ATOM   1853 N N     . LYS E 2 51 ? 12.256  0.040   10.848  1.00 33.50 ? 52  LYS A N     1 
ATOM   1854 C CA    . LYS E 2 51 ? 13.440  0.741   11.315  1.00 32.89 ? 52  LYS A CA    1 
ATOM   1855 C C     . LYS E 2 51 ? 13.077  1.725   12.434  1.00 32.92 ? 52  LYS A C     1 
ATOM   1856 O O     . LYS E 2 51 ? 13.803  1.836   13.432  1.00 33.10 ? 52  LYS A O     1 
ATOM   1857 C CB    . LYS E 2 51 ? 14.105  1.500   10.152  1.00 33.78 ? 52  LYS A CB    1 
ATOM   1858 C CG    . LYS E 2 51 ? 15.355  2.288   10.545  1.00 34.72 ? 52  LYS A CG    1 
ATOM   1859 C CD    . LYS E 2 51 ? 16.450  1.362   11.068  1.00 37.68 ? 52  LYS A CD    1 
ATOM   1860 C CE    . LYS E 2 51 ? 17.700  2.126   11.498  1.00 41.46 ? 52  LYS A CE    1 
ATOM   1861 N NZ    . LYS E 2 51 ? 18.744  1.207   12.070  1.00 42.53 ? 52  LYS A NZ    1 
ATOM   1862 N N     . LEU E 2 52 ? 11.958  2.435   12.268  1.00 29.19 ? 53  LEU A N     1 
ATOM   1863 C CA    . LEU E 2 52 ? 11.505  3.395   13.278  1.00 29.98 ? 53  LEU A CA    1 
ATOM   1864 C C     . LEU E 2 52 ? 11.238  2.691   14.613  1.00 28.73 ? 53  LEU A C     1 
ATOM   1865 O O     . LEU E 2 52 ? 11.571  3.228   15.665  1.00 29.63 ? 53  LEU A O     1 
ATOM   1866 C CB    . LEU E 2 52 ? 10.224  4.122   12.814  1.00 25.41 ? 53  LEU A CB    1 
ATOM   1867 C CG    . LEU E 2 52 ? 10.430  5.067   11.615  1.00 25.10 ? 53  LEU A CG    1 
ATOM   1868 C CD1   . LEU E 2 52 ? 9.097   5.597   11.124  1.00 28.39 ? 53  LEU A CD1   1 
ATOM   1869 C CD2   . LEU E 2 52 ? 11.343  6.183   12.014  1.00 27.63 ? 53  LEU A CD2   1 
ATOM   1870 N N     . GLU E 2 53 ? 10.625  1.506   14.560  1.00 27.20 ? 54  GLU A N     1 
ATOM   1871 C CA    . GLU E 2 53 ? 10.323  0.753   15.775  1.00 31.11 ? 54  GLU A CA    1 
ATOM   1872 C C     . GLU E 2 53 ? 11.598  0.229   16.432  1.00 32.73 ? 54  GLU A C     1 
ATOM   1873 O O     . GLU E 2 53 ? 11.737  0.286   17.648  1.00 36.10 ? 54  GLU A O     1 
ATOM   1874 C CB    . GLU E 2 53 ? 9.343   -0.393  15.481  1.00 28.02 ? 54  GLU A CB    1 
ATOM   1875 C CG    . GLU E 2 53 ? 7.910   0.092   15.249  1.00 27.98 ? 54  GLU A CG    1 
ATOM   1876 C CD    . GLU E 2 53 ? 6.991   -0.959  14.639  1.00 29.87 ? 54  GLU A CD    1 
ATOM   1877 O OE1   . GLU E 2 53 ? 7.510   -1.921  14.039  1.00 34.48 ? 54  GLU A OE1   1 
ATOM   1878 O OE2   . GLU E 2 53 ? 5.746   -0.815  14.734  1.00 27.97 ? 54  GLU A OE2   1 
ATOM   1879 N N     . ASP E 2 54 ? 12.545  -0.248  15.635  1.00 33.94 ? 55  ASP A N     1 
ATOM   1880 C CA    . ASP E 2 54 ? 13.796  -0.740  16.197  1.00 34.94 ? 55  ASP A CA    1 
ATOM   1881 C C     . ASP E 2 54 ? 14.569  0.399   16.880  1.00 35.07 ? 55  ASP A C     1 
ATOM   1882 O O     . ASP E 2 54 ? 15.178  0.200   17.930  1.00 34.31 ? 55  ASP A O     1 
ATOM   1883 C CB    . ASP E 2 54 ? 14.649  -1.392  15.107  1.00 36.57 ? 55  ASP A CB    1 
ATOM   1884 C CG    . ASP E 2 54 ? 15.918  -2.017  15.660  1.00 38.05 ? 55  ASP A CG    1 
ATOM   1885 O OD1   . ASP E 2 54 ? 17.005  -1.426  15.484  1.00 37.45 ? 55  ASP A OD1   1 
ATOM   1886 O OD2   . ASP E 2 54 ? 15.818  -3.103  16.276  1.00 39.88 ? 55  ASP A OD2   1 
ATOM   1887 N N     . SER E 2 55 ? 14.539  1.593   16.293  1.00 32.66 ? 56  SER A N     1 
ATOM   1888 C CA    . SER E 2 55 ? 15.225  2.733   16.885  1.00 33.02 ? 56  SER A CA    1 
ATOM   1889 C C     . SER E 2 55 ? 14.519  3.174   18.175  1.00 31.88 ? 56  SER A C     1 
ATOM   1890 O O     . SER E 2 55 ? 15.171  3.589   19.123  1.00 32.51 ? 56  SER A O     1 
ATOM   1891 C CB    . SER E 2 55 ? 15.311  3.890   15.885  1.00 31.11 ? 56  SER A CB    1 
ATOM   1892 O OG    . SER E 2 55 ? 16.276  3.581   14.892  1.00 36.04 ? 56  SER A OG    1 
ATOM   1893 N N     . ASP E 2 56 ? 13.194  3.067   18.199  1.00 32.52 ? 57  ASP A N     1 
ATOM   1894 C CA    . ASP E 2 56 ? 12.404  3.413   19.385  1.00 32.83 ? 57  ASP A CA    1 
ATOM   1895 C C     . ASP E 2 56 ? 12.859  2.485   20.520  1.00 33.21 ? 57  ASP A C     1 
ATOM   1896 O O     . ASP E 2 56 ? 13.262  2.948   21.586  1.00 31.30 ? 57  ASP A O     1 
ATOM   1897 C CB    . ASP E 2 56 ? 10.905  3.200   19.102  1.00 33.18 ? 57  ASP A CB    1 
ATOM   1898 C CG    . ASP E 2 56 ? 10.026  3.262   20.368  1.00 35.85 ? 57  ASP A CG    1 
ATOM   1899 O OD1   . ASP E 2 56 ? 9.066   2.462   20.461  1.00 31.71 ? 57  ASP A OD1   1 
ATOM   1900 O OD2   . ASP E 2 56 ? 10.273  4.109   21.256  1.00 34.21 ? 57  ASP A OD2   1 
ATOM   1901 N N     . ARG E 2 57 ? 12.801  1.176   20.276  1.00 33.32 ? 58  ARG A N     1 
ATOM   1902 C CA    . ARG E 2 57 ? 13.205  0.189   21.281  1.00 35.86 ? 58  ARG A CA    1 
ATOM   1903 C C     . ARG E 2 57 ? 14.599  0.451   21.834  1.00 36.79 ? 58  ARG A C     1 
ATOM   1904 O O     . ARG E 2 57 ? 14.824  0.351   23.042  1.00 37.90 ? 58  ARG A O     1 
ATOM   1905 C CB    . ARG E 2 57 ? 13.158  -1.227  20.704  1.00 35.64 ? 58  ARG A CB    1 
ATOM   1906 C CG    . ARG E 2 57 ? 11.762  -1.721  20.388  1.00 37.34 ? 58  ARG A CG    1 
ATOM   1907 C CD    . ARG E 2 57 ? 11.790  -3.210  20.043  1.00 40.06 ? 58  ARG A CD    1 
ATOM   1908 N NE    . ARG E 2 57 ? 12.635  -3.492  18.886  1.00 40.62 ? 58  ARG A NE    1 
ATOM   1909 C CZ    . ARG E 2 57 ? 12.210  -3.467  17.625  1.00 42.64 ? 58  ARG A CZ    1 
ATOM   1910 N NH1   . ARG E 2 57 ? 10.945  -3.174  17.354  1.00 42.38 ? 58  ARG A NH1   1 
ATOM   1911 N NH2   . ARG E 2 57 ? 13.051  -3.735  16.631  1.00 44.98 ? 58  ARG A NH2   1 
ATOM   1912 N N     . LYS E 2 58 ? 15.534  0.800   20.958  1.00 37.39 ? 59  LYS A N     1 
ATOM   1913 C CA    . LYS E 2 58 ? 16.898  1.066   21.396  1.00 38.40 ? 59  LYS A CA    1 
ATOM   1914 C C     . LYS E 2 58 ? 17.027  2.398   22.133  1.00 38.31 ? 59  LYS A C     1 
ATOM   1915 O O     . LYS E 2 58 ? 17.886  2.555   23.004  1.00 39.36 ? 59  LYS A O     1 
ATOM   1916 C CB    . LYS E 2 58 ? 17.841  1.019   20.197  1.00 39.11 ? 59  LYS A CB    1 
ATOM   1917 C CG    . LYS E 2 58 ? 17.878  -0.358  19.551  1.00 42.48 ? 59  LYS A CG    1 
ATOM   1918 C CD    . LYS E 2 58 ? 18.828  -0.409  18.369  1.00 42.43 ? 59  LYS A CD    1 
ATOM   1919 C CE    . LYS E 2 58 ? 18.820  -1.788  17.741  1.00 43.99 ? 59  LYS A CE    1 
ATOM   1920 N NZ    . LYS E 2 58 ? 19.611  -1.795  16.484  1.00 47.48 ? 59  LYS A NZ    1 
ATOM   1921 N N     . ALA E 2 59 ? 16.172  3.357   21.796  1.00 37.42 ? 60  ALA A N     1 
ATOM   1922 C CA    . ALA E 2 59 ? 16.215  4.655   22.464  1.00 36.99 ? 60  ALA A CA    1 
ATOM   1923 C C     . ALA E 2 59 ? 15.662  4.500   23.885  1.00 35.49 ? 60  ALA A C     1 
ATOM   1924 O O     . ALA E 2 59 ? 16.269  4.963   24.840  1.00 34.98 ? 60  ALA A O     1 
ATOM   1925 C CB    . ALA E 2 59 ? 15.392  5.685   21.692  1.00 37.32 ? 60  ALA A CB    1 
ATOM   1926 N N     . VAL E 2 60 ? 14.514  3.847   24.019  1.00 35.63 ? 61  VAL A N     1 
ATOM   1927 C CA    . VAL E 2 60 ? 13.922  3.649   25.335  1.00 37.75 ? 61  VAL A CA    1 
ATOM   1928 C C     . VAL E 2 60 ? 14.908  2.916   26.248  1.00 38.34 ? 61  VAL A C     1 
ATOM   1929 O O     . VAL E 2 60 ? 15.007  3.223   27.435  1.00 37.05 ? 61  VAL A O     1 
ATOM   1930 C CB    . VAL E 2 60 ? 12.606  2.846   25.249  1.00 38.21 ? 61  VAL A CB    1 
ATOM   1931 C CG1   . VAL E 2 60 ? 12.089  2.523   26.654  1.00 37.03 ? 61  VAL A CG1   1 
ATOM   1932 C CG2   . VAL E 2 60 ? 11.565  3.655   24.491  1.00 39.02 ? 61  VAL A CG2   1 
ATOM   1933 N N     . HIS E 2 61 ? 15.646  1.963   25.681  1.00 38.05 ? 62  HIS A N     1 
ATOM   1934 C CA    . HIS E 2 61 ? 16.625  1.185   26.435  1.00 38.40 ? 62  HIS A CA    1 
ATOM   1935 C C     . HIS E 2 61 ? 17.833  1.998   26.903  1.00 38.63 ? 62  HIS A C     1 
ATOM   1936 O O     . HIS E 2 61 ? 18.287  1.854   28.045  1.00 37.61 ? 62  HIS A O     1 
ATOM   1937 C CB    . HIS E 2 61 ? 17.122  0.005   25.599  1.00 41.50 ? 62  HIS A CB    1 
ATOM   1938 C CG    . HIS E 2 61 ? 18.042  -0.907  26.348  1.00 43.99 ? 62  HIS A CG    1 
ATOM   1939 N ND1   . HIS E 2 61 ? 17.601  -1.750  27.347  1.00 45.41 ? 62  HIS A ND1   1 
ATOM   1940 C CD2   . HIS E 2 61 ? 19.383  -1.077  26.275  1.00 43.58 ? 62  HIS A CD2   1 
ATOM   1941 C CE1   . HIS E 2 61 ? 18.632  -2.401  27.857  1.00 45.12 ? 62  HIS A CE1   1 
ATOM   1942 N NE2   . HIS E 2 61 ? 19.724  -2.010  27.225  1.00 46.73 ? 62  HIS A NE2   1 
ATOM   1943 N N     . GLN E 2 62 ? 18.365  2.844   26.026  1.00 37.44 ? 63  GLN A N     1 
ATOM   1944 C CA    . GLN E 2 62 ? 19.518  3.660   26.378  1.00 35.43 ? 63  GLN A CA    1 
ATOM   1945 C C     . GLN E 2 62 ? 19.121  4.712   27.406  1.00 35.04 ? 63  GLN A C     1 
ATOM   1946 O O     . GLN E 2 62 ? 19.911  5.051   28.286  1.00 34.46 ? 63  GLN A O     1 
ATOM   1947 C CB    . GLN E 2 62 ? 20.112  4.321   25.132  1.00 35.35 ? 63  GLN A CB    1 
ATOM   1948 N N     . ILE E 2 63 ? 17.900  5.227   27.293  1.00 32.77 ? 64  ILE A N     1 
ATOM   1949 C CA    . ILE E 2 63 ? 17.404  6.219   28.246  1.00 32.30 ? 64  ILE A CA    1 
ATOM   1950 C C     . ILE E 2 63 ? 17.406  5.572   29.638  1.00 32.17 ? 64  ILE A C     1 
ATOM   1951 O O     . ILE E 2 63 ? 17.889  6.158   30.609  1.00 31.11 ? 64  ILE A O     1 
ATOM   1952 C CB    . ILE E 2 63 ? 15.970  6.674   27.870  1.00 30.52 ? 64  ILE A CB    1 
ATOM   1953 C CG1   . ILE E 2 63 ? 16.036  7.639   26.673  1.00 29.66 ? 64  ILE A CG1   1 
ATOM   1954 C CG2   . ILE E 2 63 ? 15.277  7.336   29.059  1.00 32.66 ? 64  ILE A CG2   1 
ATOM   1955 C CD1   . ILE E 2 63 ? 14.662  8.172   26.256  1.00 33.30 ? 64  ILE A CD1   1 
ATOM   1956 N N     . ASP E 2 64 ? 16.889  4.351   29.709  1.00 32.45 ? 65  ASP A N     1 
ATOM   1957 C CA    . ASP E 2 64 ? 16.845  3.603   30.961  1.00 35.30 ? 65  ASP A CA    1 
ATOM   1958 C C     . ASP E 2 64 ? 18.249  3.374   31.507  1.00 33.36 ? 65  ASP A C     1 
ATOM   1959 O O     . ASP E 2 64 ? 18.485  3.533   32.699  1.00 34.64 ? 65  ASP A O     1 
ATOM   1960 C CB    . ASP E 2 64 ? 16.128  2.263   30.752  1.00 38.80 ? 65  ASP A CB    1 
ATOM   1961 C CG    . ASP E 2 64 ? 16.325  1.300   31.923  1.00 43.82 ? 65  ASP A CG    1 
ATOM   1962 O OD1   . ASP E 2 64 ? 17.427  0.724   32.051  1.00 43.41 ? 65  ASP A OD1   1 
ATOM   1963 O OD2   . ASP E 2 64 ? 15.377  1.126   32.715  1.00 45.83 ? 65  ASP A OD2   1 
ATOM   1964 N N     . GLN E 2 65 ? 19.189  3.015   30.640  1.00 33.91 ? 66  GLN A N     1 
ATOM   1965 C CA    . GLN E 2 65 ? 20.562  2.796   31.082  1.00 34.74 ? 66  GLN A CA    1 
ATOM   1966 C C     . GLN E 2 65 ? 21.202  4.101   31.550  1.00 34.14 ? 66  GLN A C     1 
ATOM   1967 O O     . GLN E 2 65 ? 21.919  4.127   32.548  1.00 33.64 ? 66  GLN A O     1 
ATOM   1968 C CB    . GLN E 2 65 ? 21.402  2.192   29.957  1.00 36.35 ? 66  GLN A CB    1 
ATOM   1969 C CG    . GLN E 2 65 ? 20.939  0.813   29.547  1.00 42.86 ? 66  GLN A CG    1 
ATOM   1970 C CD    . GLN E 2 65 ? 20.853  -0.141  30.727  1.00 44.22 ? 66  GLN A CD    1 
ATOM   1971 O OE1   . GLN E 2 65 ? 21.831  -0.342  31.449  1.00 45.73 ? 66  GLN A OE1   1 
ATOM   1972 N NE2   . GLN E 2 65 ? 19.678  -0.729  30.929  1.00 46.13 ? 66  GLN A NE2   1 
ATOM   1973 N N     . LEU E 2 66 ? 20.949  5.185   30.827  1.00 32.41 ? 67  LEU A N     1 
ATOM   1974 C CA    . LEU E 2 66 ? 21.510  6.482   31.200  1.00 32.63 ? 67  LEU A CA    1 
ATOM   1975 C C     . LEU E 2 66 ? 20.946  6.940   32.546  1.00 31.61 ? 67  LEU A C     1 
ATOM   1976 O O     . LEU E 2 66 ? 21.651  7.561   33.347  1.00 33.92 ? 67  LEU A O     1 
ATOM   1977 C CB    . LEU E 2 66 ? 21.213  7.522   30.109  1.00 31.81 ? 67  LEU A CB    1 
ATOM   1978 C CG    . LEU E 2 66 ? 22.027  7.327   28.817  1.00 34.32 ? 67  LEU A CG    1 
ATOM   1979 C CD1   . LEU E 2 66 ? 21.577  8.329   27.740  1.00 34.59 ? 67  LEU A CD1   1 
ATOM   1980 C CD2   . LEU E 2 66 ? 23.510  7.517   29.131  1.00 33.27 ? 67  LEU A CD2   1 
ATOM   1981 N N     . GLN E 2 67 ? 19.683  6.619   32.793  1.00 31.26 ? 68  GLN A N     1 
ATOM   1982 C CA    . GLN E 2 67 ? 19.030  6.984   34.045  1.00 32.47 ? 68  GLN A CA    1 
ATOM   1983 C C     . GLN E 2 67 ? 19.621  6.179   35.215  1.00 33.28 ? 68  GLN A C     1 
ATOM   1984 O O     . GLN E 2 67 ? 19.806  6.724   36.301  1.00 29.80 ? 68  GLN A O     1 
ATOM   1985 C CB    . GLN E 2 67 ? 17.521  6.744   33.945  1.00 32.67 ? 68  GLN A CB    1 
ATOM   1986 C CG    . GLN E 2 67 ? 16.821  7.652   32.948  1.00 40.06 ? 68  GLN A CG    1 
ATOM   1987 C CD    . GLN E 2 67 ? 15.321  7.462   32.916  1.00 41.04 ? 68  GLN A CD    1 
ATOM   1988 O OE1   . GLN E 2 67 ? 14.825  6.343   33.003  1.00 43.32 ? 68  GLN A OE1   1 
ATOM   1989 N NE2   . GLN E 2 67 ? 14.588  8.559   32.769  1.00 46.78 ? 68  GLN A NE2   1 
ATOM   1990 N N     . ARG E 2 68 ? 19.917  4.891   34.994  1.00 32.20 ? 69  ARG A N     1 
ATOM   1991 C CA    . ARG E 2 68 ? 20.518  4.076   36.051  1.00 33.38 ? 69  ARG A CA    1 
ATOM   1992 C C     . ARG E 2 68 ? 21.930  4.618   36.286  1.00 34.41 ? 69  ARG A C     1 
ATOM   1993 O O     . ARG E 2 68 ? 22.398  4.733   37.426  1.00 35.62 ? 69  ARG A O     1 
ATOM   1994 C CB    . ARG E 2 68 ? 20.562  2.586   35.646  1.00 29.73 ? 69  ARG A CB    1 
ATOM   1995 C CG    . ARG E 2 68 ? 19.196  1.936   35.469  1.00 29.96 ? 69  ARG A CG    1 
ATOM   1996 C CD    . ARG E 2 68 ? 19.282  0.485   34.941  1.00 29.79 ? 69  ARG A CD    1 
ATOM   1997 N NE    . ARG E 2 68 ? 17.971  0.006   34.491  1.00 31.54 ? 69  ARG A NE    1 
ATOM   1998 C CZ    . ARG E 2 68 ? 17.178  -0.830  35.162  1.00 32.92 ? 69  ARG A CZ    1 
ATOM   1999 N NH1   . ARG E 2 68 ? 17.552  -1.319  36.343  1.00 30.53 ? 69  ARG A NH1   1 
ATOM   2000 N NH2   . ARG E 2 68 ? 15.987  -1.150  34.666  1.00 28.83 ? 69  ARG A NH2   1 
ATOM   2001 N N     . GLU E 2 69 ? 22.607  4.960   35.198  1.00 35.57 ? 70  GLU A N     1 
ATOM   2002 C CA    . GLU E 2 69 ? 23.954  5.521   35.271  1.00 37.44 ? 70  GLU A CA    1 
ATOM   2003 C C     . GLU E 2 69 ? 23.908  6.841   36.051  1.00 37.51 ? 70  GLU A C     1 
ATOM   2004 O O     . GLU E 2 69 ? 24.776  7.126   36.879  1.00 36.05 ? 70  GLU A O     1 
ATOM   2005 C CB    . GLU E 2 69 ? 24.496  5.756   33.852  1.00 40.20 ? 70  GLU A CB    1 
ATOM   2006 C CG    . GLU E 2 69 ? 25.789  6.563   33.757  1.00 46.48 ? 70  GLU A CG    1 
ATOM   2007 C CD    . GLU E 2 69 ? 26.289  6.718   32.308  1.00 50.50 ? 70  GLU A CD    1 
ATOM   2008 O OE1   . GLU E 2 69 ? 26.630  5.690   31.676  1.00 52.11 ? 70  GLU A OE1   1 
ATOM   2009 O OE2   . GLU E 2 69 ? 26.343  7.866   31.800  1.00 49.73 ? 70  GLU A OE2   1 
ATOM   2010 N N     . GLN E 2 70 ? 22.879  7.641   35.813  1.00 37.21 ? 71  GLN A N     1 
ATOM   2011 C CA    . GLN E 2 70 ? 22.790  8.911   36.519  1.00 37.37 ? 71  GLN A CA    1 
ATOM   2012 C C     . GLN E 2 70 ? 22.614  8.739   38.029  1.00 36.81 ? 71  GLN A C     1 
ATOM   2013 O O     . GLN E 2 70 ? 23.343  9.356   38.802  1.00 35.62 ? 71  GLN A O     1 
ATOM   2014 C CB    . GLN E 2 70 ? 21.655  9.772   35.959  1.00 37.09 ? 71  GLN A CB    1 
ATOM   2015 C CG    . GLN E 2 70 ? 21.787  11.250  36.346  1.00 42.39 ? 71  GLN A CG    1 
ATOM   2016 C CD    . GLN E 2 70 ? 20.668  12.116  35.798  1.00 43.31 ? 71  GLN A CD    1 
ATOM   2017 O OE1   . GLN E 2 70 ? 19.566  12.145  36.339  1.00 42.56 ? 71  GLN A OE1   1 
ATOM   2018 N NE2   . GLN E 2 70 ? 20.947  12.820  34.707  1.00 45.55 ? 71  GLN A NE2   1 
ATOM   2019 N N     . ARG E 2 71 ? 21.660  7.908   38.451  1.00 37.42 ? 72  ARG A N     1 
ATOM   2020 C CA    . ARG E 2 71 ? 21.423  7.698   39.882  1.00 39.14 ? 72  ARG A CA    1 
ATOM   2021 C C     . ARG E 2 71 ? 22.668  7.178   40.586  1.00 40.96 ? 72  ARG A C     1 
ATOM   2022 O O     . ARG E 2 71 ? 22.909  7.514   41.747  1.00 41.22 ? 72  ARG A O     1 
ATOM   2023 C CB    . ARG E 2 71 ? 20.258  6.729   40.120  1.00 38.42 ? 72  ARG A CB    1 
ATOM   2024 C CG    . ARG E 2 71 ? 18.910  7.240   39.609  1.00 37.45 ? 72  ARG A CG    1 
ATOM   2025 C CD    . ARG E 2 71 ? 17.754  6.392   40.112  1.00 35.47 ? 72  ARG A CD    1 
ATOM   2026 N NE    . ARG E 2 71 ? 17.696  5.061   39.514  1.00 33.70 ? 72  ARG A NE    1 
ATOM   2027 C CZ    . ARG E 2 71 ? 17.100  4.774   38.358  1.00 35.24 ? 72  ARG A CZ    1 
ATOM   2028 N NH1   . ARG E 2 71 ? 16.504  5.727   37.649  1.00 30.71 ? 72  ARG A NH1   1 
ATOM   2029 N NH2   . ARG E 2 71 ? 17.067  3.517   37.924  1.00 32.33 ? 72  ARG A NH2   1 
ATOM   2030 N N     . HIS E 2 72 ? 23.462  6.364   39.889  1.00 40.71 ? 73  HIS A N     1 
ATOM   2031 C CA    . HIS E 2 72 ? 24.687  5.837   40.474  1.00 40.58 ? 73  HIS A CA    1 
ATOM   2032 C C     . HIS E 2 72 ? 25.688  6.975   40.724  1.00 41.10 ? 73  HIS A C     1 
ATOM   2033 O O     . HIS E 2 72 ? 26.309  7.051   41.792  1.00 40.37 ? 73  HIS A O     1 
ATOM   2034 C CB    . HIS E 2 72 ? 25.303  4.775   39.554  1.00 42.47 ? 73  HIS A CB    1 
ATOM   2035 C CG    . HIS E 2 72 ? 26.629  4.259   40.028  1.00 45.48 ? 73  HIS A CG    1 
ATOM   2036 N ND1   . HIS E 2 72 ? 27.760  5.046   40.076  1.00 47.61 ? 73  HIS A ND1   1 
ATOM   2037 C CD2   . HIS E 2 72 ? 27.004  3.036   40.472  1.00 46.58 ? 73  HIS A CD2   1 
ATOM   2038 C CE1   . HIS E 2 72 ? 28.775  4.328   40.525  1.00 47.96 ? 73  HIS A CE1   1 
ATOM   2039 N NE2   . HIS E 2 72 ? 28.342  3.105   40.774  1.00 46.30 ? 73  HIS A NE2   1 
ATOM   2040 N N     . LEU E 2 73 ? 25.845  7.862   39.744  1.00 40.24 ? 74  LEU A N     1 
ATOM   2041 C CA    . LEU E 2 73 ? 26.765  8.991   39.882  1.00 40.91 ? 74  LEU A CA    1 
ATOM   2042 C C     . LEU E 2 73 ? 26.315  9.900   41.027  1.00 42.61 ? 74  LEU A C     1 
ATOM   2043 O O     . LEU E 2 73 ? 27.140  10.413  41.794  1.00 44.05 ? 74  LEU A O     1 
ATOM   2044 C CB    . LEU E 2 73 ? 26.837  9.788   38.573  1.00 41.53 ? 74  LEU A CB    1 
ATOM   2045 C CG    . LEU E 2 73 ? 27.472  9.080   37.367  1.00 40.68 ? 74  LEU A CG    1 
ATOM   2046 C CD1   . LEU E 2 73 ? 27.287  9.912   36.091  1.00 41.84 ? 74  LEU A CD1   1 
ATOM   2047 C CD2   . LEU E 2 73 ? 28.950  8.864   37.654  1.00 41.32 ? 74  LEU A CD2   1 
ATOM   2048 N N     . LYS E 2 74 ? 25.010  10.101  41.146  1.00 41.73 ? 75  LYS A N     1 
ATOM   2049 C CA    . LYS E 2 74 ? 24.488  10.937  42.218  1.00 46.19 ? 75  LYS A CA    1 
ATOM   2050 C C     . LYS E 2 74 ? 24.804  10.342  43.591  1.00 46.11 ? 75  LYS A C     1 
ATOM   2051 O O     . LYS E 2 74 ? 25.322  11.032  44.465  1.00 46.63 ? 75  LYS A O     1 
ATOM   2052 C CB    . LYS E 2 74 ? 22.977  11.104  42.082  1.00 45.20 ? 75  LYS A CB    1 
ATOM   2053 C CG    . LYS E 2 74 ? 22.528  11.909  40.877  1.00 50.08 ? 75  LYS A CG    1 
ATOM   2054 C CD    . LYS E 2 74 ? 22.733  13.403  41.066  1.00 51.48 ? 75  LYS A CD    1 
ATOM   2055 C CE    . LYS E 2 74 ? 22.047  14.181  39.951  1.00 52.30 ? 75  LYS A CE    1 
ATOM   2056 N NZ    . LYS E 2 74 ? 22.292  15.644  40.062  1.00 55.30 ? 75  LYS A NZ    1 
ATOM   2057 N N     . ARG E 2 75 ? 24.485  9.064   43.780  1.00 47.41 ? 76  ARG A N     1 
ATOM   2058 C CA    . ARG E 2 75 ? 24.734  8.396   45.057  1.00 49.08 ? 76  ARG A CA    1 
ATOM   2059 C C     . ARG E 2 75 ? 26.213  8.375   45.387  1.00 50.32 ? 76  ARG A C     1 
ATOM   2060 O O     . ARG E 2 75 ? 26.612  8.513   46.545  1.00 49.88 ? 76  ARG A O     1 
ATOM   2061 C CB    . ARG E 2 75 ? 24.177  6.968   45.033  1.00 49.64 ? 76  ARG A CB    1 
ATOM   2062 C CG    . ARG E 2 75 ? 22.663  6.902   45.214  1.00 51.13 ? 76  ARG A CG    1 
ATOM   2063 C CD    . ARG E 2 75 ? 22.115  5.470   45.240  1.00 49.14 ? 76  ARG A CD    1 
ATOM   2064 N NE    . ARG E 2 75 ? 21.908  4.919   43.900  1.00 51.59 ? 76  ARG A NE    1 
ATOM   2065 C CZ    . ARG E 2 75 ? 22.667  3.973   43.361  1.00 49.73 ? 76  ARG A CZ    1 
ATOM   2066 N NH1   . ARG E 2 75 ? 23.682  3.475   44.052  1.00 50.25 ? 76  ARG A NH1   1 
ATOM   2067 N NH2   . ARG E 2 75 ? 22.415  3.527   42.138  1.00 47.39 ? 76  ARG A NH2   1 
ATOM   2068 N N     . GLN E 2 76 ? 27.025  8.205   44.353  1.00 52.45 ? 77  GLN A N     1 
ATOM   2069 C CA    . GLN E 2 76 ? 28.464  8.173   44.506  1.00 54.58 ? 77  GLN A CA    1 
ATOM   2070 C C     . GLN E 2 76 ? 28.935  9.553   44.946  1.00 56.34 ? 77  GLN A C     1 
ATOM   2071 O O     . GLN E 2 76 ? 29.685  9.693   45.914  1.00 56.21 ? 77  GLN A O     1 
ATOM   2072 C CB    . GLN E 2 76 ? 29.103  7.789   43.172  1.00 55.07 ? 77  GLN A CB    1 
ATOM   2073 C CG    . GLN E 2 76 ? 30.603  7.638   43.211  1.00 57.33 ? 77  GLN A CG    1 
ATOM   2074 C CD    . GLN E 2 76 ? 31.145  6.995   41.950  1.00 59.24 ? 77  GLN A CD    1 
ATOM   2075 O OE1   . GLN E 2 76 ? 30.854  7.443   40.838  1.00 59.69 ? 77  GLN A OE1   1 
ATOM   2076 N NE2   . GLN E 2 76 ? 31.941  5.941   42.116  1.00 59.33 ? 77  GLN A NE2   1 
ATOM   2077 N N     . LEU E 2 77 ? 28.467  10.572  44.235  1.00 58.35 ? 78  LEU A N     1 
ATOM   2078 C CA    . LEU E 2 77 ? 28.826  11.952  44.526  1.00 59.65 ? 78  LEU A CA    1 
ATOM   2079 C C     . LEU E 2 77 ? 28.562  12.296  45.991  1.00 61.47 ? 78  LEU A C     1 
ATOM   2080 O O     . LEU E 2 77 ? 29.120  13.256  46.524  1.00 61.20 ? 78  LEU A O     1 
ATOM   2081 C CB    . LEU E 2 77 ? 28.035  12.888  43.613  1.00 59.39 ? 78  LEU A CB    1 
ATOM   2082 C CG    . LEU E 2 77 ? 28.640  14.266  43.356  1.00 59.52 ? 78  LEU A CG    1 
ATOM   2083 C CD1   . LEU E 2 77 ? 30.055  14.115  42.827  1.00 60.90 ? 78  LEU A CD1   1 
ATOM   2084 C CD2   . LEU E 2 77 ? 27.775  15.015  42.358  1.00 60.19 ? 78  LEU A CD2   1 
ATOM   2085 N N     . GLU E 2 78 ? 27.710  11.510  46.640  1.00 63.54 ? 79  GLU A N     1 
ATOM   2086 C CA    . GLU E 2 78 ? 27.401  11.739  48.046  1.00 65.55 ? 79  GLU A CA    1 
ATOM   2087 C C     . GLU E 2 78 ? 28.640  11.432  48.872  1.00 66.24 ? 79  GLU A C     1 
ATOM   2088 O O     . GLU E 2 78 ? 29.073  12.245  49.688  1.00 66.68 ? 79  GLU A O     1 
ATOM   2089 C CB    . GLU E 2 78 ? 26.252  10.837  48.503  1.00 67.01 ? 79  GLU A CB    1 
ATOM   2090 C CG    . GLU E 2 78 ? 25.016  10.931  47.639  1.00 69.19 ? 79  GLU A CG    1 
ATOM   2091 C CD    . GLU E 2 78 ? 24.572  12.360  47.431  1.00 70.77 ? 79  GLU A CD    1 
ATOM   2092 O OE1   . GLU E 2 78 ? 24.187  13.016  48.420  1.00 71.78 ? 79  GLU A OE1   1 
ATOM   2093 O OE2   . GLU E 2 78 ? 24.617  12.830  46.275  1.00 71.61 ? 79  GLU A OE2   1 
ATOM   2094 N N     . LYS E 2 79 ? 29.213  10.254  48.654  1.00 67.11 ? 80  LYS A N     1 
ATOM   2095 C CA    . LYS E 2 79 ? 30.405  9.846   49.382  1.00 67.21 ? 80  LYS A CA    1 
ATOM   2096 C C     . LYS E 2 79 ? 31.643  10.577  48.864  1.00 67.45 ? 80  LYS A C     1 
ATOM   2097 O O     . LYS E 2 79 ? 31.597  11.826  48.806  1.00 67.52 ? 80  LYS A O     1 
ATOM   2098 C CB    . LYS E 2 79 ? 30.593  8.343   49.258  1.00 67.20 ? 80  LYS A CB    1 
ATOM   2099 N N     . LYS F 3 1  ? -2.210  -15.770 -26.312 1.00 43.44 ? 203 LYS B N     1 
ATOM   2100 C CA    . LYS F 3 1  ? -1.308  -14.935 -25.456 1.00 43.66 ? 203 LYS B CA    1 
ATOM   2101 C C     . LYS F 3 1  ? -2.016  -14.297 -24.259 1.00 43.73 ? 203 LYS B C     1 
ATOM   2102 O O     . LYS F 3 1  ? -1.446  -14.214 -23.164 1.00 43.21 ? 203 LYS B O     1 
ATOM   2103 C CB    . LYS F 3 1  ? -0.653  -13.828 -26.291 1.00 45.56 ? 203 LYS B CB    1 
ATOM   2104 C CG    . LYS F 3 1  ? 0.692   -14.205 -26.891 1.00 47.08 ? 203 LYS B CG    1 
ATOM   2105 C CD    . LYS F 3 1  ? 1.766   -14.360 -25.814 1.00 49.39 ? 203 LYS B CD    1 
ATOM   2106 C CE    . LYS F 3 1  ? 2.149   -13.022 -25.182 1.00 50.43 ? 203 LYS B CE    1 
ATOM   2107 N NZ    . LYS F 3 1  ? 3.213   -13.148 -24.131 1.00 50.46 ? 203 LYS B NZ    1 
ATOM   2108 N N     . ARG F 3 2  ? -3.247  -13.842 -24.470 1.00 41.32 ? 204 ARG B N     1 
ATOM   2109 C CA    . ARG F 3 2  ? -4.013  -13.206 -23.407 1.00 43.34 ? 204 ARG B CA    1 
ATOM   2110 C C     . ARG F 3 2  ? -4.157  -14.087 -22.168 1.00 43.50 ? 204 ARG B C     1 
ATOM   2111 O O     . ARG F 3 2  ? -4.105  -13.589 -21.040 1.00 42.31 ? 204 ARG B O     1 
ATOM   2112 C CB    . ARG F 3 2  ? -5.391  -12.786 -23.928 1.00 40.86 ? 204 ARG B CB    1 
ATOM   2113 C CG    . ARG F 3 2  ? -5.314  -11.687 -24.987 1.00 44.68 ? 204 ARG B CG    1 
ATOM   2114 C CD    . ARG F 3 2  ? -6.657  -11.432 -25.663 1.00 46.15 ? 204 ARG B CD    1 
ATOM   2115 N NE    . ARG F 3 2  ? -6.487  -10.615 -26.862 1.00 50.60 ? 204 ARG B NE    1 
ATOM   2116 C CZ    . ARG F 3 2  ? -7.336  -10.594 -27.884 1.00 51.75 ? 204 ARG B CZ    1 
ATOM   2117 N NH1   . ARG F 3 2  ? -8.434  -11.343 -27.866 1.00 53.51 ? 204 ARG B NH1   1 
ATOM   2118 N NH2   . ARG F 3 2  ? -7.079  -9.832  -28.934 1.00 51.55 ? 204 ARG B NH2   1 
ATOM   2119 N N     . ALA F 3 3  ? -4.330  -15.390 -22.368 1.00 42.05 ? 205 ALA B N     1 
ATOM   2120 C CA    . ALA F 3 3  ? -4.465  -16.297 -21.234 1.00 43.94 ? 205 ALA B CA    1 
ATOM   2121 C C     . ALA F 3 3  ? -3.250  -16.173 -20.307 1.00 42.75 ? 205 ALA B C     1 
ATOM   2122 O O     . ALA F 3 3  ? -3.400  -16.117 -19.081 1.00 44.70 ? 205 ALA B O     1 
ATOM   2123 C CB    . ALA F 3 3  ? -4.618  -17.737 -21.726 1.00 44.58 ? 205 ALA B CB    1 
ATOM   2124 N N     . HIS F 3 4  ? -2.058  -16.117 -20.905 1.00 40.55 ? 206 HIS B N     1 
ATOM   2125 C CA    . HIS F 3 4  ? -0.787  -15.991 -20.181 1.00 38.44 ? 206 HIS B CA    1 
ATOM   2126 C C     . HIS F 3 4  ? -0.604  -14.571 -19.597 1.00 38.05 ? 206 HIS B C     1 
ATOM   2127 O O     . HIS F 3 4  ? -0.204  -14.418 -18.440 1.00 38.09 ? 206 HIS B O     1 
ATOM   2128 C CB    . HIS F 3 4  ? 0.371   -16.336 -21.130 1.00 38.26 ? 206 HIS B CB    1 
ATOM   2129 C CG    . HIS F 3 4  ? 1.730   -16.220 -20.514 1.00 35.73 ? 206 HIS B CG    1 
ATOM   2130 N ND1   . HIS F 3 4  ? 2.105   -16.928 -19.393 1.00 36.52 ? 206 HIS B ND1   1 
ATOM   2131 C CD2   . HIS F 3 4  ? 2.813   -15.494 -20.877 1.00 36.98 ? 206 HIS B CD2   1 
ATOM   2132 C CE1   . HIS F 3 4  ? 3.359   -16.644 -19.091 1.00 35.07 ? 206 HIS B CE1   1 
ATOM   2133 N NE2   . HIS F 3 4  ? 3.812   -15.775 -19.976 1.00 36.72 ? 206 HIS B NE2   1 
ATOM   2134 N N     . HIS F 3 5  ? -0.890  -13.545 -20.392 1.00 37.17 ? 207 HIS B N     1 
ATOM   2135 C CA    . HIS F 3 5  ? -0.786  -12.156 -19.923 1.00 36.73 ? 207 HIS B CA    1 
ATOM   2136 C C     . HIS F 3 5  ? -1.667  -12.026 -18.687 1.00 35.54 ? 207 HIS B C     1 
ATOM   2137 O O     . HIS F 3 5  ? -1.267  -11.431 -17.684 1.00 34.58 ? 207 HIS B O     1 
ATOM   2138 C CB    . HIS F 3 5  ? -1.291  -11.179 -20.995 1.00 37.62 ? 207 HIS B CB    1 
ATOM   2139 C CG    . HIS F 3 5  ? -1.217  -9.731  -20.594 1.00 39.52 ? 207 HIS B CG    1 
ATOM   2140 N ND1   . HIS F 3 5  ? -2.131  -8.791  -21.030 1.00 41.39 ? 207 HIS B ND1   1 
ATOM   2141 C CD2   . HIS F 3 5  ? -0.332  -9.059  -19.820 1.00 36.78 ? 207 HIS B CD2   1 
ATOM   2142 C CE1   . HIS F 3 5  ? -1.813  -7.606  -20.539 1.00 36.10 ? 207 HIS B CE1   1 
ATOM   2143 N NE2   . HIS F 3 5  ? -0.725  -7.740  -19.803 1.00 39.50 ? 207 HIS B NE2   1 
ATOM   2144 N N     . ASN F 3 6  ? -2.869  -12.593 -18.776 1.00 35.61 ? 208 ASN B N     1 
ATOM   2145 C CA    . ASN F 3 6  ? -3.838  -12.556 -17.684 1.00 36.14 ? 208 ASN B CA    1 
ATOM   2146 C C     . ASN F 3 6  ? -3.317  -13.240 -16.420 1.00 36.67 ? 208 ASN B C     1 
ATOM   2147 O O     . ASN F 3 6  ? -3.546  -12.757 -15.307 1.00 37.26 ? 208 ASN B O     1 
ATOM   2148 C CB    . ASN F 3 6  ? -5.161  -13.205 -18.124 1.00 34.05 ? 208 ASN B CB    1 
ATOM   2149 C CG    . ASN F 3 6  ? -5.816  -12.471 -19.293 1.00 35.05 ? 208 ASN B CG    1 
ATOM   2150 O OD1   . ASN F 3 6  ? -5.440  -11.344 -19.625 1.00 33.86 ? 208 ASN B OD1   1 
ATOM   2151 N ND2   . ASN F 3 6  ? -6.796  -13.114 -19.924 1.00 33.74 ? 208 ASN B ND2   1 
ATOM   2152 N N     . ALA F 3 7  ? -2.615  -14.359 -16.595 1.00 35.92 ? 209 ALA B N     1 
ATOM   2153 C CA    . ALA F 3 7  ? -2.063  -15.104 -15.468 1.00 35.42 ? 209 ALA B CA    1 
ATOM   2154 C C     . ALA F 3 7  ? -0.944  -14.336 -14.766 1.00 33.82 ? 209 ALA B C     1 
ATOM   2155 O O     . ALA F 3 7  ? -0.863  -14.351 -13.541 1.00 31.08 ? 209 ALA B O     1 
ATOM   2156 C CB    . ALA F 3 7  ? -1.546  -16.469 -15.931 1.00 37.00 ? 209 ALA B CB    1 
ATOM   2157 N N     . LEU F 3 8  ? -0.087  -13.666 -15.538 1.00 33.04 ? 210 LEU B N     1 
ATOM   2158 C CA    . LEU F 3 8  ? 1.017   -12.896 -14.959 1.00 33.84 ? 210 LEU B CA    1 
ATOM   2159 C C     . LEU F 3 8  ? 0.541   -11.618 -14.241 1.00 32.07 ? 210 LEU B C     1 
ATOM   2160 O O     . LEU F 3 8  ? 1.115   -11.209 -13.223 1.00 30.84 ? 210 LEU B O     1 
ATOM   2161 C CB    . LEU F 3 8  ? 2.024   -12.519 -16.045 1.00 35.72 ? 210 LEU B CB    1 
ATOM   2162 C CG    . LEU F 3 8  ? 2.779   -13.675 -16.717 1.00 38.53 ? 210 LEU B CG    1 
ATOM   2163 C CD1   . LEU F 3 8  ? 3.472   -13.182 -17.985 1.00 34.51 ? 210 LEU B CD1   1 
ATOM   2164 C CD2   . LEU F 3 8  ? 3.773   -14.272 -15.743 1.00 36.41 ? 210 LEU B CD2   1 
ATOM   2165 N N     . GLU F 3 9  ? -0.484  -10.976 -14.786 1.00 31.65 ? 211 GLU B N     1 
ATOM   2166 C CA    . GLU F 3 9  ? -1.010  -9.758  -14.164 1.00 33.68 ? 211 GLU B CA    1 
ATOM   2167 C C     . GLU F 3 9  ? -1.670  -10.209 -12.856 1.00 31.94 ? 211 GLU B C     1 
ATOM   2168 O O     . GLU F 3 9  ? -1.531  -9.562  -11.836 1.00 33.39 ? 211 GLU B O     1 
ATOM   2169 C CB    . GLU F 3 9  ? -1.999  -9.065  -15.119 1.00 32.30 ? 211 GLU B CB    1 
ATOM   2170 C CG    . GLU F 3 9  ? -2.732  -7.788  -14.594 1.00 31.17 ? 211 GLU B CG    1 
ATOM   2171 C CD    . GLU F 3 9  ? -1.825  -6.664  -14.086 1.00 30.38 ? 211 GLU B CD    1 
ATOM   2172 O OE1   . GLU F 3 9  ? -0.597  -6.625  -14.374 1.00 27.26 ? 211 GLU B OE1   1 
ATOM   2173 O OE2   . GLU F 3 9  ? -2.365  -5.784  -13.379 1.00 31.10 ? 211 GLU B OE2   1 
ATOM   2174 N N     . ARG F 3 10 ? -2.349  -11.351 -12.881 1.00 33.83 ? 212 ARG B N     1 
ATOM   2175 C CA    . ARG F 3 10 ? -2.981  -11.872 -11.671 1.00 35.22 ? 212 ARG B CA    1 
ATOM   2176 C C     . ARG F 3 10 ? -1.905  -12.112 -10.605 1.00 34.26 ? 212 ARG B C     1 
ATOM   2177 O O     . ARG F 3 10 ? -2.106  -11.809 -9.428  1.00 33.88 ? 212 ARG B O     1 
ATOM   2178 C CB    . ARG F 3 10 ? -3.728  -13.180 -11.964 1.00 38.89 ? 212 ARG B CB    1 
ATOM   2179 C CG    . ARG F 3 10 ? -4.751  -13.543 -10.900 1.00 42.67 ? 212 ARG B CG    1 
ATOM   2180 C CD    . ARG F 3 10 ? -5.429  -14.890 -11.168 1.00 48.81 ? 212 ARG B CD    1 
ATOM   2181 N NE    . ARG F 3 10 ? -6.076  -14.961 -12.541 1.00 48.97 ? 212 ARG B NE    1 
ATOM   2182 N N     . LYS F 3 11 ? -0.755  -12.641 -11.018 1.00 32.95 ? 213 LYS B N     1 
ATOM   2183 C CA    . LYS F 3 11 ? 0.342   -12.887 -10.082 1.00 33.49 ? 213 LYS B CA    1 
ATOM   2184 C C     . LYS F 3 11 ? 0.853   -11.557 -9.544  1.00 30.75 ? 213 LYS B C     1 
ATOM   2185 O O     . LYS F 3 11 ? 1.176   -11.399 -8.360  1.00 28.15 ? 213 LYS B O     1 
ATOM   2186 C CB    . LYS F 3 11 ? 1.509   -13.599 -10.784 1.00 36.91 ? 213 LYS B CB    1 
ATOM   2187 C CG    . LYS F 3 11 ? 1.145   -14.903 -11.481 1.00 43.66 ? 213 LYS B CG    1 
ATOM   2188 C CD    . LYS F 3 11 ? 2.361   -15.481 -12.216 1.00 47.03 ? 213 LYS B CD    1 
ATOM   2189 C CE    . LYS F 3 11 ? 2.004   -16.737 -13.007 1.00 48.30 ? 213 LYS B CE    1 
ATOM   2190 N NZ    . LYS F 3 11 ? 1.480   -17.836 -12.141 1.00 50.23 ? 213 LYS B NZ    1 
ATOM   2191 N N     . ARG F 3 12 ? 0.938   -10.592 -10.439 1.00 27.57 ? 214 ARG B N     1 
ATOM   2192 C CA    . ARG F 3 12 ? 1.426   -9.283  -10.068 1.00 27.13 ? 214 ARG B CA    1 
ATOM   2193 C C     . ARG F 3 12 ? 0.501   -8.657  -9.032  1.00 25.07 ? 214 ARG B C     1 
ATOM   2194 O O     . ARG F 3 12 ? 0.980   -8.079  -8.053  1.00 25.57 ? 214 ARG B O     1 
ATOM   2195 C CB    . ARG F 3 12 ? 1.517   -8.405  -11.318 1.00 25.35 ? 214 ARG B CB    1 
ATOM   2196 C CG    . ARG F 3 12 ? 2.094   -7.032  -11.079 1.00 30.34 ? 214 ARG B CG    1 
ATOM   2197 C CD    . ARG F 3 12 ? 2.012   -6.192  -12.356 1.00 31.64 ? 214 ARG B CD    1 
ATOM   2198 N NE    . ARG F 3 12 ? 1.936   -4.785  -12.016 1.00 44.32 ? 214 ARG B NE    1 
ATOM   2199 C CZ    . ARG F 3 12 ? 0.832   -4.171  -11.601 1.00 43.33 ? 214 ARG B CZ    1 
ATOM   2200 N NH1   . ARG F 3 12 ? -0.304  -4.837  -11.485 1.00 42.60 ? 214 ARG B NH1   1 
ATOM   2201 N NH2   . ARG F 3 12 ? 0.875   -2.886  -11.279 1.00 49.95 ? 214 ARG B NH2   1 
ATOM   2202 N N     . ARG F 3 13 ? -0.810  -8.777  -9.247  1.00 25.83 ? 215 ARG B N     1 
ATOM   2203 C CA    . ARG F 3 13 ? -1.790  -8.220  -8.313  1.00 29.70 ? 215 ARG B CA    1 
ATOM   2204 C C     . ARG F 3 13 ? -1.725  -8.913  -6.961  1.00 31.83 ? 215 ARG B C     1 
ATOM   2205 O O     . ARG F 3 13 ? -1.876  -8.265  -5.918  1.00 34.34 ? 215 ARG B O     1 
ATOM   2206 C CB    . ARG F 3 13 ? -3.216  -8.321  -8.865  1.00 23.79 ? 215 ARG B CB    1 
ATOM   2207 C CG    . ARG F 3 13 ? -3.496  -7.385  -10.054 1.00 29.71 ? 215 ARG B CG    1 
ATOM   2208 C CD    . ARG F 3 13 ? -4.994  -7.106  -10.199 1.00 29.79 ? 215 ARG B CD    1 
ATOM   2209 N NE    . ARG F 3 13 ? -5.391  -7.039  -11.599 1.00 40.92 ? 215 ARG B NE    1 
ATOM   2210 C CZ    . ARG F 3 13 ? -5.510  -8.099  -12.396 1.00 37.84 ? 215 ARG B CZ    1 
ATOM   2211 N NH1   . ARG F 3 13 ? -5.272  -9.316  -11.934 1.00 44.28 ? 215 ARG B NH1   1 
ATOM   2212 N NH2   . ARG F 3 13 ? -5.850  -7.936  -13.656 1.00 38.63 ? 215 ARG B NH2   1 
ATOM   2213 N N     . ASP F 3 14 ? -1.497  -10.222 -6.977  1.00 33.27 ? 216 ASP B N     1 
ATOM   2214 C CA    . ASP F 3 14 ? -1.387  -10.999 -5.738  1.00 34.19 ? 216 ASP B CA    1 
ATOM   2215 C C     . ASP F 3 14 ? -0.215  -10.543 -4.871  1.00 32.69 ? 216 ASP B C     1 
ATOM   2216 O O     . ASP F 3 14 ? -0.331  -10.490 -3.650  1.00 32.74 ? 216 ASP B O     1 
ATOM   2217 C CB    . ASP F 3 14 ? -1.233  -12.487 -6.058  1.00 37.58 ? 216 ASP B CB    1 
ATOM   2218 C CG    . ASP F 3 14 ? -2.558  -13.218 -6.079  1.00 42.68 ? 216 ASP B CG    1 
ATOM   2219 O OD1   . ASP F 3 14 ? -3.489  -12.751 -6.770  1.00 47.27 ? 216 ASP B OD1   1 
ATOM   2220 O OD2   . ASP F 3 14 ? -2.672  -14.270 -5.408  1.00 48.93 ? 216 ASP B OD2   1 
ATOM   2221 N N     . HIS F 3 15 ? 0.918   -10.240 -5.497  1.00 32.49 ? 217 HIS B N     1 
ATOM   2222 C CA    . HIS F 3 15 ? 2.091   -9.772  -4.764  1.00 33.78 ? 217 HIS B CA    1 
ATOM   2223 C C     . HIS F 3 15 ? 1.801   -8.410  -4.120  1.00 31.61 ? 217 HIS B C     1 
ATOM   2224 O O     . HIS F 3 15 ? 2.217   -8.150  -2.996  1.00 32.52 ? 217 HIS B O     1 
ATOM   2225 C CB    . HIS F 3 15 ? 3.294   -9.659  -5.701  1.00 39.21 ? 217 HIS B CB    1 
ATOM   2226 C CG    . HIS F 3 15 ? 3.682   -10.956 -6.339  1.00 46.96 ? 217 HIS B CG    1 
ATOM   2227 N ND1   . HIS F 3 15 ? 4.492   -11.028 -7.453  1.00 50.56 ? 217 HIS B ND1   1 
ATOM   2228 C CD2   . HIS F 3 15 ? 3.365   -12.236 -6.023  1.00 49.86 ? 217 HIS B CD2   1 
ATOM   2229 C CE1   . HIS F 3 15 ? 4.656   -12.293 -7.797  1.00 51.21 ? 217 HIS B CE1   1 
ATOM   2230 N NE2   . HIS F 3 15 ? 3.982   -13.047 -6.946  1.00 51.77 ? 217 HIS B NE2   1 
ATOM   2231 N N     . ILE F 3 16 ? 1.088   -7.547  -4.835  1.00 29.59 ? 218 ILE B N     1 
ATOM   2232 C CA    . ILE F 3 16 ? 0.741   -6.227  -4.311  1.00 29.77 ? 218 ILE B CA    1 
ATOM   2233 C C     . ILE F 3 16 ? -0.221  -6.373  -3.132  1.00 28.20 ? 218 ILE B C     1 
ATOM   2234 O O     . ILE F 3 16 ? -0.096  -5.672  -2.127  1.00 25.49 ? 218 ILE B O     1 
ATOM   2235 C CB    . ILE F 3 16 ? 0.095   -5.345  -5.404  1.00 30.18 ? 218 ILE B CB    1 
ATOM   2236 C CG1   . ILE F 3 16 ? 1.193   -4.827  -6.341  1.00 30.90 ? 218 ILE B CG1   1 
ATOM   2237 C CG2   . ILE F 3 16 ? -0.670  -4.178  -4.757  1.00 29.07 ? 218 ILE B CG2   1 
ATOM   2238 C CD1   . ILE F 3 16 ? 0.671   -4.218  -7.601  1.00 34.91 ? 218 ILE B CD1   1 
ATOM   2239 N N     . LYS F 3 17 ? -1.169  -7.294  -3.262  1.00 27.61 ? 219 LYS B N     1 
ATOM   2240 C CA    . LYS F 3 17 ? -2.132  -7.563  -2.200  1.00 30.50 ? 219 LYS B CA    1 
ATOM   2241 C C     . LYS F 3 17 ? -1.373  -8.064  -0.964  1.00 29.35 ? 219 LYS B C     1 
ATOM   2242 O O     . LYS F 3 17 ? -1.655  -7.632  0.150   1.00 31.30 ? 219 LYS B O     1 
ATOM   2243 C CB    . LYS F 3 17 ? -3.151  -8.608  -2.669  1.00 31.27 ? 219 LYS B CB    1 
ATOM   2244 C CG    . LYS F 3 17 ? -4.132  -9.063  -1.605  1.00 38.89 ? 219 LYS B CG    1 
ATOM   2245 C CD    . LYS F 3 17 ? -5.101  -10.103 -2.162  1.00 41.30 ? 219 LYS B CD    1 
ATOM   2246 C CE    . LYS F 3 17 ? -6.041  -10.621 -1.081  1.00 45.98 ? 219 LYS B CE    1 
ATOM   2247 N NZ    . LYS F 3 17 ? -6.839  -9.535  -0.441  1.00 48.70 ? 219 LYS B NZ    1 
ATOM   2248 N N     . ASP F 3 18 ? -0.400  -8.957  -1.155  1.00 28.90 ? 220 ASP B N     1 
ATOM   2249 C CA    . ASP F 3 18 ? 0.378   -9.469  -0.019  1.00 28.56 ? 220 ASP B CA    1 
ATOM   2250 C C     . ASP F 3 18 ? 1.118   -8.310  0.665   1.00 26.71 ? 220 ASP B C     1 
ATOM   2251 O O     . ASP F 3 18 ? 1.221   -8.257  1.889   1.00 24.72 ? 220 ASP B O     1 
ATOM   2252 C CB    . ASP F 3 18 ? 1.417   -10.511 -0.463  1.00 29.63 ? 220 ASP B CB    1 
ATOM   2253 C CG    . ASP F 3 18 ? 0.810   -11.888 -0.753  1.00 34.92 ? 220 ASP B CG    1 
ATOM   2254 O OD1   . ASP F 3 18 ? -0.359  -12.133 -0.390  1.00 37.05 ? 220 ASP B OD1   1 
ATOM   2255 O OD2   . ASP F 3 18 ? 1.525   -12.749 -1.335  1.00 35.96 ? 220 ASP B OD2   1 
ATOM   2256 N N     . SER F 3 19 ? 1.642   -7.396  -0.146  1.00 24.65 ? 221 SER B N     1 
ATOM   2257 C CA    . SER F 3 19 ? 2.381   -6.239  0.348   1.00 24.49 ? 221 SER B CA    1 
ATOM   2258 C C     . SER F 3 19 ? 1.482   -5.266  1.116   1.00 21.83 ? 221 SER B C     1 
ATOM   2259 O O     . SER F 3 19 ? 1.964   -4.539  1.974   1.00 25.61 ? 221 SER B O     1 
ATOM   2260 C CB    . SER F 3 19 ? 3.060   -5.519  -0.817  1.00 26.64 ? 221 SER B CB    1 
ATOM   2261 O OG    . SER F 3 19 ? 4.029   -6.363  -1.423  1.00 35.00 ? 221 SER B OG    1 
ATOM   2262 N N     . PHE F 3 20 ? 0.201   -5.209  0.774   1.00 20.30 ? 222 PHE B N     1 
ATOM   2263 C CA    . PHE F 3 20 ? -0.723  -4.360  1.537   1.00 23.44 ? 222 PHE B CA    1 
ATOM   2264 C C     . PHE F 3 20 ? -0.945  -5.073  2.883   1.00 23.75 ? 222 PHE B C     1 
ATOM   2265 O O     . PHE F 3 20 ? -0.942  -4.444  3.941   1.00 23.04 ? 222 PHE B O     1 
ATOM   2266 C CB    . PHE F 3 20 ? -2.075  -4.215  0.834   1.00 24.10 ? 222 PHE B CB    1 
ATOM   2267 C CG    . PHE F 3 20 ? -2.179  -2.986  -0.041  1.00 24.84 ? 222 PHE B CG    1 
ATOM   2268 C CD1   . PHE F 3 20 ? -2.066  -3.087  -1.411  1.00 23.98 ? 222 PHE B CD1   1 
ATOM   2269 C CD2   . PHE F 3 20 ? -2.401  -1.729  0.523   1.00 26.92 ? 222 PHE B CD2   1 
ATOM   2270 C CE1   . PHE F 3 20 ? -2.175  -1.962  -2.234  1.00 24.71 ? 222 PHE B CE1   1 
ATOM   2271 C CE2   . PHE F 3 20 ? -2.511  -0.589  -0.288  1.00 22.93 ? 222 PHE B CE2   1 
ATOM   2272 C CZ    . PHE F 3 20 ? -2.400  -0.704  -1.654  1.00 25.50 ? 222 PHE B CZ    1 
ATOM   2273 N N     . HIS F 3 21 ? -1.136  -6.394  2.836   1.00 22.81 ? 223 HIS B N     1 
ATOM   2274 C CA    . HIS F 3 21 ? -1.342  -7.145  4.075   1.00 24.47 ? 223 HIS B CA    1 
ATOM   2275 C C     . HIS F 3 21 ? -0.171  -6.971  5.016   1.00 21.77 ? 223 HIS B C     1 
ATOM   2276 O O     . HIS F 3 21 ? -0.367  -6.808  6.213   1.00 26.15 ? 223 HIS B O     1 
ATOM   2277 C CB    . HIS F 3 21 ? -1.535  -8.648  3.817   1.00 24.05 ? 223 HIS B CB    1 
ATOM   2278 C CG    . HIS F 3 21 ? -2.745  -8.984  3.013   1.00 25.84 ? 223 HIS B CG    1 
ATOM   2279 N ND1   . HIS F 3 21 ? -3.812  -8.123  2.873   1.00 29.06 ? 223 HIS B ND1   1 
ATOM   2280 C CD2   . HIS F 3 21 ? -3.097  -10.126 2.376   1.00 27.48 ? 223 HIS B CD2   1 
ATOM   2281 C CE1   . HIS F 3 21 ? -4.771  -8.721  2.192   1.00 25.87 ? 223 HIS B CE1   1 
ATOM   2282 N NE2   . HIS F 3 21 ? -4.364  -9.938  1.879   1.00 28.22 ? 223 HIS B NE2   1 
ATOM   2283 N N     . SER F 3 22 ? 1.053   -6.994  4.491   1.00 22.70 ? 224 SER B N     1 
ATOM   2284 C CA    . SER F 3 22 ? 2.235   -6.857  5.339   1.00 22.85 ? 224 SER B CA    1 
ATOM   2285 C C     . SER F 3 22 ? 2.403   -5.464  5.936   1.00 23.85 ? 224 SER B C     1 
ATOM   2286 O O     . SER F 3 22 ? 2.873   -5.333  7.061   1.00 19.62 ? 224 SER B O     1 
ATOM   2287 C CB    . SER F 3 22 ? 3.513   -7.220  4.581   1.00 22.57 ? 224 SER B CB    1 
ATOM   2288 O OG    . SER F 3 22 ? 3.376   -8.466  3.946   1.00 32.91 ? 224 SER B OG    1 
ATOM   2289 N N     . LEU F 3 23 ? 2.034   -4.428  5.182   1.00 23.84 ? 225 LEU B N     1 
ATOM   2290 C CA    . LEU F 3 23 ? 2.126   -3.050  5.689   1.00 23.95 ? 225 LEU B CA    1 
ATOM   2291 C C     . LEU F 3 23 ? 1.069   -2.833  6.780   1.00 23.35 ? 225 LEU B C     1 
ATOM   2292 O O     . LEU F 3 23 ? 1.305   -2.134  7.772   1.00 22.72 ? 225 LEU B O     1 
ATOM   2293 C CB    . LEU F 3 23 ? 1.876   -2.047  4.554   1.00 19.62 ? 225 LEU B CB    1 
ATOM   2294 C CG    . LEU F 3 23 ? 1.905   -0.576  4.968   1.00 22.17 ? 225 LEU B CG    1 
ATOM   2295 C CD1   . LEU F 3 23 ? 3.241   -0.242  5.561   1.00 20.74 ? 225 LEU B CD1   1 
ATOM   2296 C CD2   . LEU F 3 23 ? 1.608   0.329   3.742   1.00 18.66 ? 225 LEU B CD2   1 
ATOM   2297 N N     . ARG F 3 24 ? -0.110  -3.402  6.554   1.00 26.25 ? 226 ARG B N     1 
ATOM   2298 C CA    . ARG F 3 24 ? -1.219  -3.296  7.502   1.00 27.62 ? 226 ARG B CA    1 
ATOM   2299 C C     . ARG F 3 24 ? -0.817  -3.894  8.846   1.00 30.09 ? 226 ARG B C     1 
ATOM   2300 O O     . ARG F 3 24 ? -1.144  -3.357  9.907   1.00 27.58 ? 226 ARG B O     1 
ATOM   2301 C CB    . ARG F 3 24 ? -2.445  -4.051  6.981   1.00 30.12 ? 226 ARG B CB    1 
ATOM   2302 C CG    . ARG F 3 24 ? -3.506  -4.360  8.047   1.00 33.58 ? 226 ARG B CG    1 
ATOM   2303 C CD    . ARG F 3 24 ? -3.715  -5.875  8.211   1.00 34.75 ? 226 ARG B CD    1 
ATOM   2304 N NE    . ARG F 3 24 ? -4.609  -6.404  7.196   1.00 35.04 ? 226 ARG B NE    1 
ATOM   2305 C CZ    . ARG F 3 24 ? -4.597  -7.656  6.746   1.00 33.53 ? 226 ARG B CZ    1 
ATOM   2306 N NH1   . ARG F 3 24 ? -3.722  -8.549  7.214   1.00 33.04 ? 226 ARG B NH1   1 
ATOM   2307 N NH2   . ARG F 3 24 ? -5.468  -8.009  5.821   1.00 27.60 ? 226 ARG B NH2   1 
ATOM   2308 N N     . ASP F 3 25 ? -0.106  -5.014  8.794   1.00 30.19 ? 227 ASP B N     1 
ATOM   2309 C CA    . ASP F 3 25 ? 0.290   -5.682  10.014  1.00 30.55 ? 227 ASP B CA    1 
ATOM   2310 C C     . ASP F 3 25 ? 1.496   -5.086  10.705  1.00 30.25 ? 227 ASP B C     1 
ATOM   2311 O O     . ASP F 3 25 ? 1.845   -5.485  11.812  1.00 29.92 ? 227 ASP B O     1 
ATOM   2312 C CB    . ASP F 3 25 ? 0.451   -7.175  9.755   1.00 32.62 ? 227 ASP B CB    1 
ATOM   2313 C CG    . ASP F 3 25 ? -0.892  -7.865  9.559   1.00 34.58 ? 227 ASP B CG    1 
ATOM   2314 O OD1   . ASP F 3 25 ? -1.901  -7.376  10.124  1.00 35.84 ? 227 ASP B OD1   1 
ATOM   2315 O OD2   . ASP F 3 25 ? -0.951  -8.892  8.861   1.00 38.49 ? 227 ASP B OD2   1 
ATOM   2316 N N     . SER F 3 26 ? 2.107   -4.090  10.074  1.00 30.43 ? 228 SER B N     1 
ATOM   2317 C CA    . SER F 3 26 ? 3.237   -3.417  10.687  1.00 29.86 ? 228 SER B CA    1 
ATOM   2318 C C     . SER F 3 26 ? 2.701   -2.179  11.396  1.00 28.33 ? 228 SER B C     1 
ATOM   2319 O O     . SER F 3 26 ? 3.441   -1.457  12.046  1.00 27.23 ? 228 SER B O     1 
ATOM   2320 C CB    . SER F 3 26 ? 4.270   -3.007  9.634   1.00 31.72 ? 228 SER B CB    1 
ATOM   2321 O OG    . SER F 3 26 ? 4.803   -4.148  8.996   1.00 40.09 ? 228 SER B OG    1 
ATOM   2322 N N     . VAL F 3 27 ? 1.401   -1.945  11.289  1.00 27.89 ? 229 VAL B N     1 
ATOM   2323 C CA    . VAL F 3 27 ? 0.832   -0.781  11.949  1.00 29.72 ? 229 VAL B CA    1 
ATOM   2324 C C     . VAL F 3 27 ? -0.064  -1.152  13.132  1.00 25.72 ? 229 VAL B C     1 
ATOM   2325 O O     . VAL F 3 27 ? -1.102  -1.784  12.958  1.00 22.43 ? 229 VAL B O     1 
ATOM   2326 C CB    . VAL F 3 27 ? 0.057   0.104   10.939  1.00 29.19 ? 229 VAL B CB    1 
ATOM   2327 C CG1   . VAL F 3 27 ? 1.006   0.536   9.801   1.00 33.55 ? 229 VAL B CG1   1 
ATOM   2328 C CG2   . VAL F 3 27 ? -1.104  -0.650  10.355  1.00 36.33 ? 229 VAL B CG2   1 
ATOM   2329 N N     . PRO F 3 28 ? 0.359   -0.772  14.349  1.00 30.79 ? 230 PRO B N     1 
ATOM   2330 C CA    . PRO F 3 28 ? -0.291  -0.987  15.645  1.00 34.74 ? 230 PRO B CA    1 
ATOM   2331 C C     . PRO F 3 28 ? -1.597  -0.216  15.820  1.00 37.21 ? 230 PRO B C     1 
ATOM   2332 O O     . PRO F 3 28 ? -1.711  0.618   16.722  1.00 42.26 ? 230 PRO B O     1 
ATOM   2333 C CB    . PRO F 3 28 ? 0.752   -0.502  16.639  1.00 34.93 ? 230 PRO B CB    1 
ATOM   2334 C CG    . PRO F 3 28 ? 2.040   -0.730  15.931  1.00 36.19 ? 230 PRO B CG    1 
ATOM   2335 C CD    . PRO F 3 28 ? 1.725   -0.258  14.554  1.00 30.32 ? 230 PRO B CD    1 
ATOM   2336 N N     . SER F 3 29 ? -2.558  -0.462  14.946  1.00 38.08 ? 231 SER B N     1 
ATOM   2337 C CA    . SER F 3 29 ? -3.872  0.178   15.021  1.00 37.54 ? 231 SER B CA    1 
ATOM   2338 C C     . SER F 3 29 ? -4.702  -0.539  13.985  1.00 36.03 ? 231 SER B C     1 
ATOM   2339 O O     . SER F 3 29 ? -5.928  -0.471  13.994  1.00 37.03 ? 231 SER B O     1 
ATOM   2340 C CB    . SER F 3 29 ? -3.803  1.690   14.719  1.00 39.49 ? 231 SER B CB    1 
ATOM   2341 O OG    . SER F 3 29 ? -4.017  2.002   13.343  1.00 41.22 ? 231 SER B OG    1 
ATOM   2342 N N     . LEU F 3 30 ? -4.015  -1.262  13.102  1.00 36.02 ? 232 LEU B N     1 
ATOM   2343 C CA    . LEU F 3 30 ? -4.683  -2.014  12.041  1.00 35.20 ? 232 LEU B CA    1 
ATOM   2344 C C     . LEU F 3 30 ? -4.353  -3.511  12.041  1.00 35.83 ? 232 LEU B C     1 
ATOM   2345 O O     . LEU F 3 30 ? -5.041  -4.299  11.407  1.00 34.96 ? 232 LEU B O     1 
ATOM   2346 C CB    . LEU F 3 30 ? -4.325  -1.419  10.671  1.00 36.46 ? 232 LEU B CB    1 
ATOM   2347 C CG    . LEU F 3 30 ? -4.929  -0.064  10.276  1.00 35.99 ? 232 LEU B CG    1 
ATOM   2348 C CD1   . LEU F 3 30 ? -4.518  0.291   8.845   1.00 35.74 ? 232 LEU B CD1   1 
ATOM   2349 C CD2   . LEU F 3 30 ? -6.443  -0.128  10.374  1.00 36.31 ? 232 LEU B CD2   1 
ATOM   2350 N N     . GLN F 3 31 ? -3.296  -3.904  12.742  1.00 39.03 ? 233 GLN B N     1 
ATOM   2351 C CA    . GLN F 3 31 ? -2.907  -5.303  12.781  1.00 41.77 ? 233 GLN B CA    1 
ATOM   2352 C C     . GLN F 3 31 ? -4.061  -6.196  13.237  1.00 43.99 ? 233 GLN B C     1 
ATOM   2353 O O     . GLN F 3 31 ? -4.684  -5.945  14.271  1.00 43.47 ? 233 GLN B O     1 
ATOM   2354 C CB    . GLN F 3 31 ? -1.707  -5.483  13.704  1.00 44.12 ? 233 GLN B CB    1 
ATOM   2355 C CG    . GLN F 3 31 ? -1.196  -6.909  13.774  1.00 48.55 ? 233 GLN B CG    1 
ATOM   2356 C CD    . GLN F 3 31 ? -0.038  -7.046  14.731  1.00 52.38 ? 233 GLN B CD    1 
ATOM   2357 O OE1   . GLN F 3 31 ? -0.155  -6.698  15.907  1.00 55.32 ? 233 GLN B OE1   1 
ATOM   2358 N NE2   . GLN F 3 31 ? 1.091   -7.548  14.238  1.00 52.26 ? 233 GLN B NE2   1 
ATOM   2359 N N     . GLY F 3 32 ? -4.345  -7.232  12.449  1.00 45.61 ? 234 GLY B N     1 
ATOM   2360 C CA    . GLY F 3 32 ? -5.424  -8.152  12.773  1.00 48.80 ? 234 GLY B CA    1 
ATOM   2361 C C     . GLY F 3 32 ? -6.807  -7.570  12.532  1.00 49.60 ? 234 GLY B C     1 
ATOM   2362 O O     . GLY F 3 32 ? -7.790  -8.027  13.117  1.00 50.23 ? 234 GLY B O     1 
ATOM   2363 N N     . GLU F 3 33 ? -6.882  -6.561  11.667  1.00 49.70 ? 235 GLU B N     1 
ATOM   2364 C CA    . GLU F 3 33 ? -8.140  -5.892  11.349  1.00 49.04 ? 235 GLU B CA    1 
ATOM   2365 C C     . GLU F 3 33 ? -8.420  -5.966  9.853   1.00 48.54 ? 235 GLU B C     1 
ATOM   2366 O O     . GLU F 3 33 ? -7.497  -6.098  9.047   1.00 47.56 ? 235 GLU B O     1 
ATOM   2367 C CB    . GLU F 3 33 ? -8.067  -4.418  11.759  1.00 50.45 ? 235 GLU B CB    1 
ATOM   2368 C CG    . GLU F 3 33 ? -7.752  -4.179  13.224  1.00 52.69 ? 235 GLU B CG    1 
ATOM   2369 C CD    . GLU F 3 33 ? -8.998  -4.089  14.083  1.00 55.23 ? 235 GLU B CD    1 
ATOM   2370 O OE1   . GLU F 3 33 ? -9.883  -4.960  13.941  1.00 56.77 ? 235 GLU B OE1   1 
ATOM   2371 O OE2   . GLU F 3 33 ? -9.090  -3.148  14.902  1.00 55.50 ? 235 GLU B OE2   1 
ATOM   2372 N N     . LYS F 3 34 ? -9.698  -5.876  9.491   1.00 47.48 ? 236 LYS B N     1 
ATOM   2373 C CA    . LYS F 3 34 ? -10.119 -5.904  8.093   1.00 46.83 ? 236 LYS B CA    1 
ATOM   2374 C C     . LYS F 3 34 ? -10.073 -4.463  7.578   1.00 45.63 ? 236 LYS B C     1 
ATOM   2375 O O     . LYS F 3 34 ? -11.105 -3.796  7.491   1.00 47.13 ? 236 LYS B O     1 
ATOM   2376 C CB    . LYS F 3 34 ? -11.560 -6.413  7.969   1.00 48.71 ? 236 LYS B CB    1 
ATOM   2377 C CG    . LYS F 3 34 ? -11.894 -7.631  8.804   1.00 51.90 ? 236 LYS B CG    1 
ATOM   2378 C CD    . LYS F 3 34 ? -13.325 -8.099  8.549   1.00 54.50 ? 236 LYS B CD    1 
ATOM   2379 C CE    . LYS F 3 34 ? -13.706 -9.278  9.446   1.00 56.23 ? 236 LYS B CE    1 
ATOM   2380 N NZ    . LYS F 3 34 ? -15.090 -9.776  9.161   1.00 58.05 ? 236 LYS B NZ    1 
ATOM   2381 N N     . ALA F 3 35 ? -8.887  -3.981  7.233   1.00 41.63 ? 237 ALA B N     1 
ATOM   2382 C CA    . ALA F 3 35 ? -8.763  -2.610  6.759   1.00 38.61 ? 237 ALA B CA    1 
ATOM   2383 C C     . ALA F 3 35 ? -8.715  -2.526  5.236   1.00 37.12 ? 237 ALA B C     1 
ATOM   2384 O O     . ALA F 3 35 ? -8.147  -3.392  4.576   1.00 35.22 ? 237 ALA B O     1 
ATOM   2385 C CB    . ALA F 3 35 ? -7.516  -1.969  7.376   1.00 37.72 ? 237 ALA B CB    1 
ATOM   2386 N N     . SER F 3 36 ? -9.333  -1.491  4.681   1.00 33.72 ? 238 SER B N     1 
ATOM   2387 C CA    . SER F 3 36 ? -9.331  -1.289  3.231   1.00 32.74 ? 238 SER B CA    1 
ATOM   2388 C C     . SER F 3 36 ? -7.955  -0.751  2.850   1.00 30.51 ? 238 SER B C     1 
ATOM   2389 O O     . SER F 3 36 ? -7.187  -0.347  3.722   1.00 30.92 ? 238 SER B O     1 
ATOM   2390 C CB    . SER F 3 36 ? -10.384 -0.258  2.852   1.00 31.48 ? 238 SER B CB    1 
ATOM   2391 O OG    . SER F 3 36 ? -10.048 0.978   3.448   1.00 30.88 ? 238 SER B OG    1 
ATOM   2392 N N     . ARG F 3 37 ? -7.647  -0.737  1.554   1.00 30.34 ? 239 ARG B N     1 
ATOM   2393 C CA    . ARG F 3 37 ? -6.353  -0.236  1.107   1.00 30.20 ? 239 ARG B CA    1 
ATOM   2394 C C     . ARG F 3 37 ? -6.207  1.247   1.454   1.00 29.41 ? 239 ARG B C     1 
ATOM   2395 O O     . ARG F 3 37 ? -5.121  1.706   1.762   1.00 24.98 ? 239 ARG B O     1 
ATOM   2396 C CB    . ARG F 3 37 ? -6.181  -0.449  -0.400  1.00 31.61 ? 239 ARG B CB    1 
ATOM   2397 C CG    . ARG F 3 37 ? -6.107  -1.913  -0.796  1.00 32.95 ? 239 ARG B CG    1 
ATOM   2398 C CD    . ARG F 3 37 ? -5.808  -2.113  -2.278  1.00 33.77 ? 239 ARG B CD    1 
ATOM   2399 N NE    . ARG F 3 37 ? -5.569  -3.525  -2.577  1.00 33.19 ? 239 ARG B NE    1 
ATOM   2400 C CZ    . ARG F 3 37 ? -4.966  -3.985  -3.675  1.00 35.01 ? 239 ARG B CZ    1 
ATOM   2401 N NH1   . ARG F 3 37 ? -4.522  -3.155  -4.615  1.00 32.92 ? 239 ARG B NH1   1 
ATOM   2402 N NH2   . ARG F 3 37 ? -4.803  -5.290  -3.829  1.00 35.88 ? 239 ARG B NH2   1 
ATOM   2403 N N     . ALA F 3 38 ? -7.311  1.990   1.419   1.00 30.10 ? 240 ALA B N     1 
ATOM   2404 C CA    . ALA F 3 38 ? -7.257  3.410   1.755   1.00 31.15 ? 240 ALA B CA    1 
ATOM   2405 C C     . ALA F 3 38 ? -6.854  3.569   3.228   1.00 29.95 ? 240 ALA B C     1 
ATOM   2406 O O     . ALA F 3 38 ? -5.966  4.353   3.556   1.00 30.52 ? 240 ALA B O     1 
ATOM   2407 C CB    . ALA F 3 38 ? -8.631  4.078   1.494   1.00 32.00 ? 240 ALA B CB    1 
ATOM   2408 N N     . GLN F 3 39 ? -7.491  2.811   4.116   1.00 30.84 ? 241 GLN B N     1 
ATOM   2409 C CA    . GLN F 3 39 ? -7.177  2.888   5.545   1.00 30.57 ? 241 GLN B CA    1 
ATOM   2410 C C     . GLN F 3 39 ? -5.726  2.506   5.861   1.00 30.01 ? 241 GLN B C     1 
ATOM   2411 O O     . GLN F 3 39 ? -5.084  3.102   6.740   1.00 28.36 ? 241 GLN B O     1 
ATOM   2412 C CB    . GLN F 3 39 ? -8.132  1.986   6.337   1.00 36.07 ? 241 GLN B CB    1 
ATOM   2413 C CG    . GLN F 3 39 ? -9.498  2.629   6.620   1.00 39.89 ? 241 GLN B CG    1 
ATOM   2414 C CD    . GLN F 3 39 ? -10.538 1.623   7.075   1.00 42.36 ? 241 GLN B CD    1 
ATOM   2415 O OE1   . GLN F 3 39 ? -11.630 1.996   7.526   1.00 47.91 ? 241 GLN B OE1   1 
ATOM   2416 N NE2   . GLN F 3 39 ? -10.217 0.344   6.951   1.00 38.94 ? 241 GLN B NE2   1 
ATOM   2417 N N     . ILE F 3 40 ? -5.205  1.513   5.145   1.00 25.62 ? 242 ILE B N     1 
ATOM   2418 C CA    . ILE F 3 40 ? -3.831  1.078   5.367   1.00 23.57 ? 242 ILE B CA    1 
ATOM   2419 C C     . ILE F 3 40 ? -2.842  2.197   5.019   1.00 22.81 ? 242 ILE B C     1 
ATOM   2420 O O     . ILE F 3 40 ? -1.917  2.476   5.774   1.00 23.80 ? 242 ILE B O     1 
ATOM   2421 C CB    . ILE F 3 40 ? -3.507  -0.196  4.523   1.00 25.33 ? 242 ILE B CB    1 
ATOM   2422 C CG1   . ILE F 3 40 ? -4.343  -1.383  5.039   1.00 25.13 ? 242 ILE B CG1   1 
ATOM   2423 C CG2   . ILE F 3 40 ? -2.008  -0.495  4.597   1.00 20.65 ? 242 ILE B CG2   1 
ATOM   2424 C CD1   . ILE F 3 40 ? -4.273  -2.641  4.173   1.00 28.78 ? 242 ILE B CD1   1 
ATOM   2425 N N     . LEU F 3 41 ? -3.019  2.830   3.863   1.00 25.10 ? 243 LEU B N     1 
ATOM   2426 C CA    . LEU F 3 41 ? -2.116  3.910   3.479   1.00 27.11 ? 243 LEU B CA    1 
ATOM   2427 C C     . LEU F 3 41 ? -2.174  5.081   4.450   1.00 26.99 ? 243 LEU B C     1 
ATOM   2428 O O     . LEU F 3 41 ? -1.136  5.586   4.863   1.00 32.55 ? 243 LEU B O     1 
ATOM   2429 C CB    . LEU F 3 41 ? -2.427  4.408   2.073   1.00 25.33 ? 243 LEU B CB    1 
ATOM   2430 C CG    . LEU F 3 41 ? -2.266  3.343   0.985   1.00 28.57 ? 243 LEU B CG    1 
ATOM   2431 C CD1   . LEU F 3 41 ? -2.497  3.981   -0.376  1.00 24.38 ? 243 LEU B CD1   1 
ATOM   2432 C CD2   . LEU F 3 41 ? -0.876  2.723   1.079   1.00 23.81 ? 243 LEU B CD2   1 
ATOM   2433 N N     . ASP F 3 42 ? -3.382  5.509   4.797   1.00 28.41 ? 244 ASP B N     1 
ATOM   2434 C CA    . ASP F 3 42 ? -3.581  6.636   5.717   1.00 30.15 ? 244 ASP B CA    1 
ATOM   2435 C C     . ASP F 3 42 ? -3.036  6.376   7.139   1.00 29.10 ? 244 ASP B C     1 
ATOM   2436 O O     . ASP F 3 42 ? -2.327  7.206   7.689   1.00 31.18 ? 244 ASP B O     1 
ATOM   2437 C CB    . ASP F 3 42 ? -5.076  6.984   5.767   1.00 32.87 ? 244 ASP B CB    1 
ATOM   2438 C CG    . ASP F 3 42 ? -5.586  7.610   4.461   1.00 37.87 ? 244 ASP B CG    1 
ATOM   2439 O OD1   . ASP F 3 42 ? -6.825  7.636   4.263   1.00 40.88 ? 244 ASP B OD1   1 
ATOM   2440 O OD2   . ASP F 3 42 ? -4.759  8.087   3.643   1.00 38.93 ? 244 ASP B OD2   1 
ATOM   2441 N N     . LYS F 3 43 ? -3.348  5.227   7.730   1.00 27.95 ? 245 LYS B N     1 
ATOM   2442 C CA    . LYS F 3 43 ? -2.841  4.922   9.068   1.00 29.41 ? 245 LYS B CA    1 
ATOM   2443 C C     . LYS F 3 43 ? -1.330  4.698   9.101   1.00 28.27 ? 245 LYS B C     1 
ATOM   2444 O O     . LYS F 3 43 ? -0.661  5.082   10.074  1.00 28.08 ? 245 LYS B O     1 
ATOM   2445 C CB    . LYS F 3 43 ? -3.578  3.713   9.659   1.00 33.38 ? 245 LYS B CB    1 
ATOM   2446 C CG    . LYS F 3 43 ? -4.861  4.097   10.391  1.00 39.77 ? 245 LYS B CG    1 
ATOM   2447 C CD    . LYS F 3 43 ? -5.718  5.004   9.535   1.00 41.68 ? 245 LYS B CD    1 
ATOM   2448 C CE    . LYS F 3 43 ? -6.461  6.027   10.379  1.00 44.40 ? 245 LYS B CE    1 
ATOM   2449 N NZ    . LYS F 3 43 ? -7.394  5.393   11.343  1.00 43.60 ? 245 LYS B NZ    1 
ATOM   2450 N N     . ALA F 3 44 ? -0.778  4.095   8.050   1.00 24.88 ? 246 ALA B N     1 
ATOM   2451 C CA    . ALA F 3 44 ? 0.674   3.879   8.011   1.00 24.79 ? 246 ALA B CA    1 
ATOM   2452 C C     . ALA F 3 44 ? 1.336   5.250   7.964   1.00 24.86 ? 246 ALA B C     1 
ATOM   2453 O O     . ALA F 3 44 ? 2.327   5.495   8.630   1.00 25.19 ? 246 ALA B O     1 
ATOM   2454 C CB    . ALA F 3 44 ? 1.075   3.056   6.760   1.00 23.17 ? 246 ALA B CB    1 
ATOM   2455 N N     . THR F 3 45 ? 0.787   6.142   7.146   1.00 27.98 ? 247 THR B N     1 
ATOM   2456 C CA    . THR F 3 45 ? 1.318   7.495   7.042   1.00 27.87 ? 247 THR B CA    1 
ATOM   2457 C C     . THR F 3 45 ? 1.307   8.122   8.431   1.00 28.80 ? 247 THR B C     1 
ATOM   2458 O O     . THR F 3 45 ? 2.290   8.694   8.861   1.00 31.83 ? 247 THR B O     1 
ATOM   2459 C CB    . THR F 3 45 ? 0.442   8.356   6.112   1.00 28.32 ? 247 THR B CB    1 
ATOM   2460 O OG1   . THR F 3 45 ? 0.513   7.831   4.784   1.00 26.66 ? 247 THR B OG1   1 
ATOM   2461 C CG2   . THR F 3 45 ? 0.895   9.818   6.134   1.00 29.52 ? 247 THR B CG2   1 
ATOM   2462 N N     . GLU F 3 46 ? 0.179   8.009   9.121   1.00 31.92 ? 248 GLU B N     1 
ATOM   2463 C CA    . GLU F 3 46 ? 0.047   8.566   10.463  1.00 35.32 ? 248 GLU B CA    1 
ATOM   2464 C C     . GLU F 3 46 ? 1.080   7.981   11.421  1.00 33.92 ? 248 GLU B C     1 
ATOM   2465 O O     . GLU F 3 46 ? 1.793   8.713   12.110  1.00 32.99 ? 248 GLU B O     1 
ATOM   2466 C CB    . GLU F 3 46 ? -1.356  8.299   11.013  1.00 38.07 ? 248 GLU B CB    1 
ATOM   2467 C CG    . GLU F 3 46 ? -1.513  8.657   12.494  1.00 42.55 ? 248 GLU B CG    1 
ATOM   2468 C CD    . GLU F 3 46 ? -1.690  7.434   13.398  1.00 46.50 ? 248 GLU B CD    1 
ATOM   2469 O OE1   . GLU F 3 46 ? -2.782  6.811   13.358  1.00 49.07 ? 248 GLU B OE1   1 
ATOM   2470 O OE2   . GLU F 3 46 ? -0.740  7.097   14.148  1.00 48.28 ? 248 GLU B OE2   1 
ATOM   2471 N N     . TYR F 3 47 ? 1.145   6.654   11.468  1.00 33.54 ? 249 TYR B N     1 
ATOM   2472 C CA    . TYR F 3 47 ? 2.087   5.956   12.335  1.00 29.96 ? 249 TYR B CA    1 
ATOM   2473 C C     . TYR F 3 47 ? 3.539   6.386   12.084  1.00 27.83 ? 249 TYR B C     1 
ATOM   2474 O O     . TYR F 3 47 ? 4.297   6.597   13.030  1.00 28.22 ? 249 TYR B O     1 
ATOM   2475 C CB    . TYR F 3 47 ? 1.923   4.438   12.144  1.00 31.85 ? 249 TYR B CB    1 
ATOM   2476 C CG    . TYR F 3 47 ? 2.669   3.613   13.163  1.00 30.21 ? 249 TYR B CG    1 
ATOM   2477 C CD1   . TYR F 3 47 ? 2.488   3.839   14.530  1.00 31.23 ? 249 TYR B CD1   1 
ATOM   2478 C CD2   . TYR F 3 47 ? 3.567   2.615   12.769  1.00 30.54 ? 249 TYR B CD2   1 
ATOM   2479 C CE1   . TYR F 3 47 ? 3.177   3.106   15.477  1.00 29.29 ? 249 TYR B CE1   1 
ATOM   2480 C CE2   . TYR F 3 47 ? 4.269   1.871   13.716  1.00 29.14 ? 249 TYR B CE2   1 
ATOM   2481 C CZ    . TYR F 3 47 ? 4.069   2.126   15.061  1.00 28.79 ? 249 TYR B CZ    1 
ATOM   2482 O OH    . TYR F 3 47 ? 4.780   1.441   16.000  1.00 32.57 ? 249 TYR B OH    1 
ATOM   2483 N N     . ILE F 3 48 ? 3.928   6.532   10.816  1.00 28.85 ? 250 ILE B N     1 
ATOM   2484 C CA    . ILE F 3 48 ? 5.296   6.947   10.467  1.00 28.55 ? 250 ILE B CA    1 
ATOM   2485 C C     . ILE F 3 48 ? 5.579   8.358   10.988  1.00 32.38 ? 250 ILE B C     1 
ATOM   2486 O O     . ILE F 3 48 ? 6.672   8.633   11.498  1.00 30.65 ? 250 ILE B O     1 
ATOM   2487 C CB    . ILE F 3 48 ? 5.539   6.952   8.914   1.00 31.10 ? 250 ILE B CB    1 
ATOM   2488 C CG1   . ILE F 3 48 ? 5.843   5.538   8.408   1.00 30.14 ? 250 ILE B CG1   1 
ATOM   2489 C CG2   . ILE F 3 48 ? 6.701   7.880   8.563   1.00 29.47 ? 250 ILE B CG2   1 
ATOM   2490 C CD1   . ILE F 3 48 ? 5.779   5.413   6.889   1.00 29.64 ? 250 ILE B CD1   1 
ATOM   2491 N N     . GLN F 3 49 ? 4.602   9.254   10.848  1.00 33.41 ? 251 GLN B N     1 
ATOM   2492 C CA    . GLN F 3 49 ? 4.786   10.630  11.318  1.00 35.89 ? 251 GLN B CA    1 
ATOM   2493 C C     . GLN F 3 49 ? 4.898   10.601  12.840  1.00 33.53 ? 251 GLN B C     1 
ATOM   2494 O O     . GLN F 3 49 ? 5.737   11.274  13.426  1.00 35.55 ? 251 GLN B O     1 
ATOM   2495 C CB    . GLN F 3 49 ? 3.610   11.511  10.883  1.00 36.35 ? 251 GLN B CB    1 
ATOM   2496 C CG    . GLN F 3 49 ? 3.370   11.508  9.378   1.00 42.95 ? 251 GLN B CG    1 
ATOM   2497 C CD    . GLN F 3 49 ? 2.379   12.566  8.932   1.00 47.07 ? 251 GLN B CD    1 
ATOM   2498 O OE1   . GLN F 3 49 ? 2.670   13.767  8.974   1.00 49.80 ? 251 GLN B OE1   1 
ATOM   2499 N NE2   . GLN F 3 49 ? 1.199   12.129  8.510   1.00 48.60 ? 251 GLN B NE2   1 
ATOM   2500 N N     . TYR F 3 50 ? 4.047   9.799   13.463  1.00 34.11 ? 252 TYR B N     1 
ATOM   2501 C CA    . TYR F 3 50 ? 4.046   9.641   14.908  1.00 34.87 ? 252 TYR B CA    1 
ATOM   2502 C C     . TYR F 3 50 ? 5.391   9.108   15.409  1.00 35.05 ? 252 TYR B C     1 
ATOM   2503 O O     . TYR F 3 50 ? 6.003   9.691   16.318  1.00 34.44 ? 252 TYR B O     1 
ATOM   2504 C CB    . TYR F 3 50 ? 2.932   8.680   15.324  1.00 36.34 ? 252 TYR B CB    1 
ATOM   2505 C CG    . TYR F 3 50 ? 3.042   8.194   16.754  1.00 40.97 ? 252 TYR B CG    1 
ATOM   2506 C CD1   . TYR F 3 50 ? 2.832   9.062   17.827  1.00 41.70 ? 252 TYR B CD1   1 
ATOM   2507 C CD2   . TYR F 3 50 ? 3.361   6.862   17.036  1.00 40.91 ? 252 TYR B CD2   1 
ATOM   2508 C CE1   . TYR F 3 50 ? 2.933   8.613   19.143  1.00 43.44 ? 252 TYR B CE1   1 
ATOM   2509 C CE2   . TYR F 3 50 ? 3.464   6.405   18.345  1.00 40.84 ? 252 TYR B CE2   1 
ATOM   2510 C CZ    . TYR F 3 50 ? 3.247   7.283   19.393  1.00 44.31 ? 252 TYR B CZ    1 
ATOM   2511 O OH    . TYR F 3 50 ? 3.322   6.828   20.698  1.00 45.87 ? 252 TYR B OH    1 
ATOM   2512 N N     . MET F 3 51 ? 5.841   7.999   14.824  1.00 32.84 ? 253 MET B N     1 
ATOM   2513 C CA    . MET F 3 51 ? 7.104   7.379   15.224  1.00 32.61 ? 253 MET B CA    1 
ATOM   2514 C C     . MET F 3 51 ? 8.332   8.252   15.020  1.00 33.45 ? 253 MET B C     1 
ATOM   2515 O O     . MET F 3 51 ? 9.292   8.172   15.784  1.00 33.13 ? 253 MET B O     1 
ATOM   2516 C CB    . MET F 3 51 ? 7.291   6.045   14.489  1.00 31.96 ? 253 MET B CB    1 
ATOM   2517 C CG    . MET F 3 51 ? 6.300   4.975   14.925  1.00 30.07 ? 253 MET B CG    1 
ATOM   2518 S SD    . MET F 3 51 ? 6.415   4.629   16.696  1.00 33.90 ? 253 MET B SD    1 
ATOM   2519 C CE    . MET F 3 51 ? 8.098   4.181   16.815  1.00 35.91 ? 253 MET B CE    1 
ATOM   2520 N N     . ARG F 3 52 ? 8.326   9.074   13.976  1.00 33.83 ? 254 ARG B N     1 
ATOM   2521 C CA    . ARG F 3 52 ? 9.459   9.959   13.740  1.00 35.11 ? 254 ARG B CA    1 
ATOM   2522 C C     . ARG F 3 52 ? 9.497   11.007  14.854  1.00 33.55 ? 254 ARG B C     1 
ATOM   2523 O O     . ARG F 3 52 ? 10.560  11.340  15.360  1.00 33.70 ? 254 ARG B O     1 
ATOM   2524 C CB    . ARG F 3 52 ? 9.335   10.643  12.372  1.00 37.23 ? 254 ARG B CB    1 
ATOM   2525 C CG    . ARG F 3 52 ? 9.761   9.744   11.212  1.00 43.34 ? 254 ARG B CG    1 
ATOM   2526 C CD    . ARG F 3 52 ? 9.605   10.425  9.858   1.00 44.35 ? 254 ARG B CD    1 
ATOM   2527 N NE    . ARG F 3 52 ? 9.977   9.536   8.759   1.00 49.89 ? 254 ARG B NE    1 
ATOM   2528 C CZ    . ARG F 3 52 ? 9.867   9.853   7.471   1.00 52.16 ? 254 ARG B CZ    1 
ATOM   2529 N NH1   . ARG F 3 52 ? 9.394   11.043  7.115   1.00 54.48 ? 254 ARG B NH1   1 
ATOM   2530 N NH2   . ARG F 3 52 ? 10.233  8.981   6.537   1.00 52.55 ? 254 ARG B NH2   1 
ATOM   2531 N N     . ARG F 3 53 ? 8.330   11.520  15.225  1.00 34.40 ? 255 ARG B N     1 
ATOM   2532 C CA    . ARG F 3 53 ? 8.233   12.511  16.299  1.00 36.77 ? 255 ARG B CA    1 
ATOM   2533 C C     . ARG F 3 53 ? 8.700   11.919  17.627  1.00 35.89 ? 255 ARG B C     1 
ATOM   2534 O O     . ARG F 3 53 ? 9.460   12.543  18.352  1.00 36.67 ? 255 ARG B O     1 
ATOM   2535 C CB    . ARG F 3 53 ? 6.796   13.006  16.450  1.00 38.52 ? 255 ARG B CB    1 
ATOM   2536 C CG    . ARG F 3 53 ? 6.324   13.926  15.327  1.00 47.09 ? 255 ARG B CG    1 
ATOM   2537 C CD    . ARG F 3 53 ? 4.991   14.582  15.683  1.00 51.32 ? 255 ARG B CD    1 
ATOM   2538 N NE    . ARG F 3 53 ? 5.013   15.104  17.049  1.00 56.23 ? 255 ARG B NE    1 
ATOM   2539 C CZ    . ARG F 3 53 ? 4.107   15.935  17.560  1.00 57.78 ? 255 ARG B CZ    1 
ATOM   2540 N NH1   . ARG F 3 53 ? 3.087   16.355  16.816  1.00 58.12 ? 255 ARG B NH1   1 
ATOM   2541 N NH2   . ARG F 3 53 ? 4.221   16.343  18.820  1.00 57.11 ? 255 ARG B NH2   1 
ATOM   2542 N N     . LYS F 3 54 ? 8.243   10.710  17.932  1.00 36.45 ? 256 LYS B N     1 
ATOM   2543 C CA    . LYS F 3 54 ? 8.621   10.023  19.174  1.00 37.13 ? 256 LYS B CA    1 
ATOM   2544 C C     . LYS F 3 54 ? 10.137  9.770   19.253  1.00 35.91 ? 256 LYS B C     1 
ATOM   2545 O O     . LYS F 3 54 ? 10.768  10.025  20.279  1.00 36.23 ? 256 LYS B O     1 
ATOM   2546 C CB    . LYS F 3 54 ? 7.863   8.690   19.285  1.00 36.92 ? 256 LYS B CB    1 
ATOM   2547 C CG    . LYS F 3 54 ? 8.296   7.813   20.470  1.00 42.13 ? 256 LYS B CG    1 
ATOM   2548 C CD    . LYS F 3 54 ? 7.676   6.418   20.387  1.00 41.44 ? 256 LYS B CD    1 
ATOM   2549 C CE    . LYS F 3 54 ? 6.187   6.472   20.572  1.00 42.91 ? 256 LYS B CE    1 
ATOM   2550 N NZ    . LYS F 3 54 ? 5.547   5.215   20.096  1.00 46.08 ? 256 LYS B NZ    1 
ATOM   2551 N N     . ASN F 3 55 ? 10.714  9.272   18.167  1.00 35.40 ? 257 ASN B N     1 
ATOM   2552 C CA    . ASN F 3 55 ? 12.145  8.985   18.120  1.00 36.57 ? 257 ASN B CA    1 
ATOM   2553 C C     . ASN F 3 55 ? 12.998  10.247  18.244  1.00 38.95 ? 257 ASN B C     1 
ATOM   2554 O O     . ASN F 3 55 ? 14.105  10.199  18.769  1.00 38.23 ? 257 ASN B O     1 
ATOM   2555 C CB    . ASN F 3 55 ? 12.490  8.227   16.832  1.00 35.24 ? 257 ASN B CB    1 
ATOM   2556 C CG    . ASN F 3 55 ? 12.023  6.768   16.868  1.00 37.32 ? 257 ASN B CG    1 
ATOM   2557 O OD1   . ASN F 3 55 ? 12.067  6.064   15.860  1.00 36.67 ? 257 ASN B OD1   1 
ATOM   2558 N ND2   . ASN F 3 55 ? 11.576  6.314   18.038  1.00 35.50 ? 257 ASN B ND2   1 
ATOM   2559 N N     . HIS F 3 56 ? 12.488  11.376  17.760  1.00 39.84 ? 258 HIS B N     1 
ATOM   2560 C CA    . HIS F 3 56 ? 13.221  12.629  17.870  1.00 41.80 ? 258 HIS B CA    1 
ATOM   2561 C C     . HIS F 3 56 ? 13.199  13.100  19.328  1.00 42.12 ? 258 HIS B C     1 
ATOM   2562 O O     . HIS F 3 56 ? 14.229  13.481  19.883  1.00 42.84 ? 258 HIS B O     1 
ATOM   2563 C CB    . HIS F 3 56 ? 12.598  13.694  16.967  1.00 44.86 ? 258 HIS B CB    1 
ATOM   2564 C CG    . HIS F 3 56 ? 13.082  15.077  17.258  1.00 48.77 ? 258 HIS B CG    1 
ATOM   2565 N ND1   . HIS F 3 56 ? 14.412  15.432  17.176  1.00 50.76 ? 258 HIS B ND1   1 
ATOM   2566 C CD2   . HIS F 3 56 ? 12.429  16.170  17.719  1.00 50.56 ? 258 HIS B CD2   1 
ATOM   2567 C CE1   . HIS F 3 56 ? 14.557  16.681  17.583  1.00 51.07 ? 258 HIS B CE1   1 
ATOM   2568 N NE2   . HIS F 3 56 ? 13.368  17.151  17.917  1.00 51.90 ? 258 HIS B NE2   1 
ATOM   2569 N N     . THR F 3 57 ? 12.016  13.069  19.936  1.00 40.97 ? 259 THR B N     1 
ATOM   2570 C CA    . THR F 3 57 ? 11.848  13.472  21.325  1.00 40.94 ? 259 THR B CA    1 
ATOM   2571 C C     . THR F 3 57 ? 12.773  12.656  22.230  1.00 42.19 ? 259 THR B C     1 
ATOM   2572 O O     . THR F 3 57 ? 13.403  13.210  23.131  1.00 41.90 ? 259 THR B O     1 
ATOM   2573 C CB    . THR F 3 57 ? 10.390  13.270  21.777  1.00 42.16 ? 259 THR B CB    1 
ATOM   2574 O OG1   . THR F 3 57 ? 9.547   14.202  21.091  1.00 44.62 ? 259 THR B OG1   1 
ATOM   2575 C CG2   . THR F 3 57 ? 10.255  13.468  23.280  1.00 42.63 ? 259 THR B CG2   1 
ATOM   2576 N N     . HIS F 3 58 ? 12.844  11.343  21.998  1.00 40.17 ? 260 HIS B N     1 
ATOM   2577 C CA    . HIS F 3 58 ? 13.713  10.479  22.793  1.00 40.92 ? 260 HIS B CA    1 
ATOM   2578 C C     . HIS F 3 58 ? 15.178  10.780  22.531  1.00 42.05 ? 260 HIS B C     1 
ATOM   2579 O O     . HIS F 3 58 ? 16.011  10.668  23.431  1.00 41.43 ? 260 HIS B O     1 
ATOM   2580 C CB    . HIS F 3 58 ? 13.440  9.008   22.494  1.00 38.90 ? 260 HIS B CB    1 
ATOM   2581 C CG    . HIS F 3 58 ? 12.146  8.516   23.055  1.00 39.23 ? 260 HIS B CG    1 
ATOM   2582 N ND1   . HIS F 3 58 ? 11.446  7.470   22.497  1.00 38.83 ? 260 HIS B ND1   1 
ATOM   2583 C CD2   . HIS F 3 58 ? 11.397  8.962   24.092  1.00 39.60 ? 260 HIS B CD2   1 
ATOM   2584 C CE1   . HIS F 3 58 ? 10.316  7.299   23.160  1.00 41.11 ? 260 HIS B CE1   1 
ATOM   2585 N NE2   . HIS F 3 58 ? 10.263  8.192   24.133  1.00 39.56 ? 260 HIS B NE2   1 
ATOM   2586 N N     . GLN F 3 59 ? 15.502  11.158  21.298  1.00 42.65 ? 261 GLN B N     1 
ATOM   2587 C CA    . GLN F 3 59 ? 16.888  11.481  20.976  1.00 45.06 ? 261 GLN B CA    1 
ATOM   2588 C C     . GLN F 3 59 ? 17.325  12.650  21.853  1.00 44.87 ? 261 GLN B C     1 
ATOM   2589 O O     . GLN F 3 59 ? 18.424  12.648  22.411  1.00 44.21 ? 261 GLN B O     1 
ATOM   2590 C CB    . GLN F 3 59 ? 17.032  11.850  19.500  1.00 46.97 ? 261 GLN B CB    1 
ATOM   2591 C CG    . GLN F 3 59 ? 18.470  12.060  19.088  1.00 48.67 ? 261 GLN B CG    1 
ATOM   2592 C CD    . GLN F 3 59 ? 19.361  10.925  19.560  1.00 52.17 ? 261 GLN B CD    1 
ATOM   2593 O OE1   . GLN F 3 59 ? 19.145  9.763   19.205  1.00 52.86 ? 261 GLN B OE1   1 
ATOM   2594 N NE2   . GLN F 3 59 ? 20.365  11.256  20.374  1.00 52.55 ? 261 GLN B NE2   1 
ATOM   2595 N N     . GLN F 3 60 ? 16.445  13.638  21.981  1.00 45.47 ? 262 GLN B N     1 
ATOM   2596 C CA    . GLN F 3 60 ? 16.718  14.809  22.804  1.00 46.83 ? 262 GLN B CA    1 
ATOM   2597 C C     . GLN F 3 60 ? 16.965  14.361  24.244  1.00 47.10 ? 262 GLN B C     1 
ATOM   2598 O O     . GLN F 3 60 ? 17.986  14.701  24.846  1.00 46.01 ? 262 GLN B O     1 
ATOM   2599 C CB    . GLN F 3 60 ? 15.533  15.776  22.757  1.00 48.66 ? 262 GLN B CB    1 
ATOM   2600 C CG    . GLN F 3 60 ? 15.139  16.201  21.353  1.00 51.04 ? 262 GLN B CG    1 
ATOM   2601 C CD    . GLN F 3 60 ? 14.079  17.282  21.342  1.00 53.42 ? 262 GLN B CD    1 
ATOM   2602 O OE1   . GLN F 3 60 ? 13.005  17.130  21.937  1.00 54.37 ? 262 GLN B OE1   1 
ATOM   2603 N NE2   . GLN F 3 60 ? 14.371  18.385  20.656  1.00 52.81 ? 262 GLN B NE2   1 
ATOM   2604 N N     . ASP F 3 61 ? 16.027  13.593  24.792  1.00 46.82 ? 263 ASP B N     1 
ATOM   2605 C CA    . ASP F 3 61 ? 16.170  13.093  26.154  1.00 46.97 ? 263 ASP B CA    1 
ATOM   2606 C C     . ASP F 3 61 ? 17.527  12.408  26.318  1.00 46.19 ? 263 ASP B C     1 
ATOM   2607 O O     . ASP F 3 61 ? 18.183  12.556  27.351  1.00 46.60 ? 263 ASP B O     1 
ATOM   2608 C CB    . ASP F 3 61 ? 15.050  12.097  26.495  1.00 47.51 ? 263 ASP B CB    1 
ATOM   2609 C CG    . ASP F 3 61 ? 13.670  12.742  26.515  1.00 50.08 ? 263 ASP B CG    1 
ATOM   2610 O OD1   . ASP F 3 61 ? 13.590  13.990  26.474  1.00 51.51 ? 263 ASP B OD1   1 
ATOM   2611 O OD2   . ASP F 3 61 ? 12.664  12.001  26.579  1.00 49.51 ? 263 ASP B OD2   1 
ATOM   2612 N N     . ILE F 3 62 ? 17.949  11.665  25.300  1.00 45.78 ? 264 ILE B N     1 
ATOM   2613 C CA    . ILE F 3 62 ? 19.224  10.957  25.362  1.00 46.30 ? 264 ILE B CA    1 
ATOM   2614 C C     . ILE F 3 62 ? 20.429  11.886  25.400  1.00 49.33 ? 264 ILE B C     1 
ATOM   2615 O O     . ILE F 3 62 ? 21.467  11.539  25.969  1.00 50.64 ? 264 ILE B O     1 
ATOM   2616 C CB    . ILE F 3 62 ? 19.398  9.978   24.182  1.00 45.82 ? 264 ILE B CB    1 
ATOM   2617 C CG1   . ILE F 3 62 ? 18.377  8.842   24.291  1.00 42.69 ? 264 ILE B CG1   1 
ATOM   2618 C CG2   . ILE F 3 62 ? 20.809  9.408   24.187  1.00 45.26 ? 264 ILE B CG2   1 
ATOM   2619 C CD1   . ILE F 3 62 ? 18.508  7.766   23.217  1.00 42.00 ? 264 ILE B CD1   1 
ATOM   2620 N N     . ASP F 3 63 ? 20.306  13.059  24.785  1.00 51.04 ? 265 ASP B N     1 
ATOM   2621 C CA    . ASP F 3 63 ? 21.407  14.008  24.789  1.00 52.60 ? 265 ASP B CA    1 
ATOM   2622 C C     . ASP F 3 63 ? 21.398  14.755  26.113  1.00 53.28 ? 265 ASP B C     1 
ATOM   2623 O O     . ASP F 3 63 ? 22.453  15.056  26.669  1.00 52.82 ? 265 ASP B O     1 
ATOM   2624 C CB    . ASP F 3 63 ? 21.285  14.982  23.614  1.00 54.05 ? 265 ASP B CB    1 
ATOM   2625 C CG    . ASP F 3 63 ? 21.455  14.292  22.270  1.00 56.43 ? 265 ASP B CG    1 
ATOM   2626 O OD1   . ASP F 3 63 ? 22.484  13.611  22.075  1.00 56.81 ? 265 ASP B OD1   1 
ATOM   2627 O OD2   . ASP F 3 63 ? 20.562  14.428  21.408  1.00 58.32 ? 265 ASP B OD2   1 
ATOM   2628 N N     . ASP F 3 64 ? 20.199  15.040  26.616  1.00 53.62 ? 266 ASP B N     1 
ATOM   2629 C CA    . ASP F 3 64 ? 20.043  15.736  27.887  1.00 54.47 ? 266 ASP B CA    1 
ATOM   2630 C C     . ASP F 3 64 ? 20.666  14.934  29.031  1.00 55.43 ? 266 ASP B C     1 
ATOM   2631 O O     . ASP F 3 64 ? 21.320  15.497  29.905  1.00 55.46 ? 266 ASP B O     1 
ATOM   2632 C CB    . ASP F 3 64 ? 18.560  15.978  28.173  1.00 55.23 ? 266 ASP B CB    1 
ATOM   2633 C CG    . ASP F 3 64 ? 17.971  17.088  27.314  1.00 56.10 ? 266 ASP B CG    1 
ATOM   2634 O OD1   . ASP F 3 64 ? 16.733  17.232  27.293  1.00 53.71 ? 266 ASP B OD1   1 
ATOM   2635 O OD2   . ASP F 3 64 ? 18.748  17.821  26.667  1.00 58.31 ? 266 ASP B OD2   1 
ATOM   2636 N N     . LEU F 3 65 ? 20.459  13.620  29.020  1.00 55.61 ? 267 LEU B N     1 
ATOM   2637 C CA    . LEU F 3 65 ? 21.007  12.747  30.056  1.00 56.28 ? 267 LEU B CA    1 
ATOM   2638 C C     . LEU F 3 65 ? 22.506  12.557  29.889  1.00 56.83 ? 267 LEU B C     1 
ATOM   2639 O O     . LEU F 3 65 ? 23.233  12.411  30.870  1.00 56.51 ? 267 LEU B O     1 
ATOM   2640 C CB    . LEU F 3 65 ? 20.310  11.382  30.031  1.00 54.52 ? 267 LEU B CB    1 
ATOM   2641 C CG    . LEU F 3 65 ? 18.931  11.268  30.688  1.00 55.33 ? 267 LEU B CG    1 
ATOM   2642 C CD1   . LEU F 3 65 ? 18.097  12.514  30.429  1.00 57.54 ? 267 LEU B CD1   1 
ATOM   2643 C CD2   . LEU F 3 65 ? 18.231  10.031  30.151  1.00 54.33 ? 267 LEU B CD2   1 
ATOM   2644 N N     . LYS F 3 66 ? 22.971  12.553  28.645  1.00 58.64 ? 268 LYS B N     1 
ATOM   2645 C CA    . LYS F 3 66 ? 24.396  12.393  28.393  1.00 60.31 ? 268 LYS B CA    1 
ATOM   2646 C C     . LYS F 3 66 ? 25.158  13.605  28.912  1.00 60.86 ? 268 LYS B C     1 
ATOM   2647 O O     . LYS F 3 66 ? 26.224  13.466  29.517  1.00 61.38 ? 268 LYS B O     1 
ATOM   2648 C CB    . LYS F 3 66 ? 24.672  12.218  26.901  1.00 60.54 ? 268 LYS B CB    1 
ATOM   2649 C CG    . LYS F 3 66 ? 24.374  10.826  26.378  1.00 63.40 ? 268 LYS B CG    1 
ATOM   2650 C CD    . LYS F 3 66 ? 24.890  10.647  24.958  1.00 62.99 ? 268 LYS B CD    1 
ATOM   2651 C CE    . LYS F 3 66 ? 24.686  9.221   24.475  1.00 64.43 ? 268 LYS B CE    1 
ATOM   2652 N NZ    . LYS F 3 66 ? 25.153  9.031   23.070  1.00 64.68 ? 268 LYS B NZ    1 
ATOM   2653 N N     . ARG F 3 67 ? 24.613  14.793  28.678  1.00 60.71 ? 269 ARG B N     1 
ATOM   2654 C CA    . ARG F 3 67 ? 25.274  16.002  29.134  1.00 61.90 ? 269 ARG B CA    1 
ATOM   2655 C C     . ARG F 3 67 ? 25.262  16.017  30.654  1.00 62.15 ? 269 ARG B C     1 
ATOM   2656 O O     . ARG F 3 67 ? 26.267  16.340  31.290  1.00 62.08 ? 269 ARG B O     1 
ATOM   2657 C CB    . ARG F 3 67 ? 24.573  17.257  28.589  1.00 63.20 ? 269 ARG B CB    1 
ATOM   2658 C CG    . ARG F 3 67 ? 23.201  17.544  29.196  1.00 64.62 ? 269 ARG B CG    1 
ATOM   2659 C CD    . ARG F 3 67 ? 22.766  19.000  29.001  1.00 66.40 ? 269 ARG B CD    1 
ATOM   2660 N NE    . ARG F 3 67 ? 22.026  19.266  27.764  1.00 66.76 ? 269 ARG B NE    1 
ATOM   2661 C CZ    . ARG F 3 67 ? 22.547  19.250  26.540  1.00 68.05 ? 269 ARG B CZ    1 
ATOM   2662 N NH1   . ARG F 3 67 ? 23.831  18.972  26.359  1.00 67.73 ? 269 ARG B NH1   1 
ATOM   2663 N NH2   . ARG F 3 67 ? 21.781  19.533  25.490  1.00 66.75 ? 269 ARG B NH2   1 
ATOM   2664 N N     . GLN F 3 68 ? 24.121  15.658  31.233  1.00 61.48 ? 270 GLN B N     1 
ATOM   2665 C CA    . GLN F 3 68 ? 23.977  15.637  32.680  1.00 61.47 ? 270 GLN B CA    1 
ATOM   2666 C C     . GLN F 3 68 ? 24.933  14.640  33.336  1.00 60.83 ? 270 GLN B C     1 
ATOM   2667 O O     . GLN F 3 68 ? 25.458  14.902  34.415  1.00 60.96 ? 270 GLN B O     1 
ATOM   2668 C CB    . GLN F 3 68 ? 22.537  15.291  33.068  1.00 61.90 ? 270 GLN B CB    1 
ATOM   2669 C CG    . GLN F 3 68 ? 21.482  16.288  32.610  1.00 62.59 ? 270 GLN B CG    1 
ATOM   2670 C CD    . GLN F 3 68 ? 20.079  15.897  33.058  1.00 63.60 ? 270 GLN B CD    1 
ATOM   2671 O OE1   . GLN F 3 68 ? 19.609  14.793  32.777  1.00 63.88 ? 270 GLN B OE1   1 
ATOM   2672 N NE2   . GLN F 3 68 ? 19.405  16.804  33.759  1.00 63.36 ? 270 GLN B NE2   1 
ATOM   2673 N N     . ASN F 3 69 ? 25.159  13.501  32.687  1.00 60.36 ? 271 ASN B N     1 
ATOM   2674 C CA    . ASN F 3 69 ? 26.043  12.474  33.240  1.00 59.59 ? 271 ASN B CA    1 
ATOM   2675 C C     . ASN F 3 69 ? 27.528  12.794  33.108  1.00 61.62 ? 271 ASN B C     1 
ATOM   2676 O O     . ASN F 3 69 ? 28.278  12.683  34.079  1.00 61.46 ? 271 ASN B O     1 
ATOM   2677 C CB    . ASN F 3 69 ? 25.762  11.116  32.592  1.00 54.55 ? 271 ASN B CB    1 
ATOM   2678 C CG    . ASN F 3 69 ? 24.470  10.481  33.086  1.00 50.92 ? 271 ASN B CG    1 
ATOM   2679 O OD1   . ASN F 3 69 ? 23.706  11.217  33.887  1.00 46.66 ? 271 ASN B OD1   1 
ATOM   2680 N ND2   . ASN F 3 69 ? 24.166  9.339   32.745  1.00 45.08 ? 271 ASN B ND2   1 
ATOM   2681 N N     . ALA F 3 70 ? 27.957  13.179  31.909  1.00 63.45 ? 272 ALA B N     1 
ATOM   2682 C CA    . ALA F 3 70 ? 29.363  13.504  31.684  1.00 65.20 ? 272 ALA B CA    1 
ATOM   2683 C C     . ALA F 3 70 ? 29.811  14.635  32.605  1.00 66.41 ? 272 ALA B C     1 
ATOM   2684 O O     . ALA F 3 70 ? 30.996  14.753  32.921  1.00 67.05 ? 272 ALA B O     1 
ATOM   2685 C CB    . ALA F 3 70 ? 29.591  13.891  30.225  1.00 65.40 ? 272 ALA B CB    1 
ATOM   2686 N N     . LEU F 3 71 ? 28.861  15.461  33.034  1.00 68.18 ? 273 LEU B N     1 
ATOM   2687 C CA    . LEU F 3 71 ? 29.160  16.577  33.925  1.00 70.07 ? 273 LEU B CA    1 
ATOM   2688 C C     . LEU F 3 71 ? 29.202  16.136  35.385  1.00 71.63 ? 273 LEU B C     1 
ATOM   2689 O O     . LEU F 3 71 ? 29.663  16.880  36.253  1.00 71.80 ? 273 LEU B O     1 
ATOM   2690 C CB    . LEU F 3 71 ? 28.128  17.692  33.748  1.00 70.68 ? 273 LEU B CB    1 
ATOM   2691 C CG    . LEU F 3 71 ? 28.207  18.468  32.427  1.00 71.72 ? 273 LEU B CG    1 
ATOM   2692 C CD1   . LEU F 3 71 ? 27.067  19.478  32.345  1.00 71.72 ? 273 LEU B CD1   1 
ATOM   2693 C CD2   . LEU F 3 71 ? 29.558  19.172  32.327  1.00 71.17 ? 273 LEU B CD2   1 
ATOM   2694 N N     . LEU F 3 72 ? 28.704  14.933  35.654  1.00 72.63 ? 274 LEU B N     1 
ATOM   2695 C CA    . LEU F 3 72 ? 28.715  14.390  37.009  1.00 73.88 ? 274 LEU B CA    1 
ATOM   2696 C C     . LEU F 3 72 ? 30.011  13.615  37.201  1.00 74.73 ? 274 LEU B C     1 
ATOM   2697 O O     . LEU F 3 72 ? 30.565  13.577  38.298  1.00 75.02 ? 274 LEU B O     1 
ATOM   2698 C CB    . LEU F 3 72 ? 27.510  13.470  37.237  1.00 73.31 ? 274 LEU B CB    1 
ATOM   2699 C CG    . LEU F 3 72 ? 26.308  14.099  37.948  1.00 73.13 ? 274 LEU B CG    1 
ATOM   2700 C CD1   . LEU F 3 72 ? 25.908  15.390  37.260  1.00 73.20 ? 274 LEU B CD1   1 
ATOM   2701 C CD2   . LEU F 3 72 ? 25.154  13.113  37.964  1.00 73.35 ? 274 LEU B CD2   1 
ATOM   2702 N N     . GLU F 3 73 ? 30.490  12.999  36.124  1.00 76.35 ? 275 GLU B N     1 
ATOM   2703 C CA    . GLU F 3 73 ? 31.736  12.245  36.171  1.00 77.71 ? 275 GLU B CA    1 
ATOM   2704 C C     . GLU F 3 73 ? 32.853  13.210  36.542  1.00 78.18 ? 275 GLU B C     1 
ATOM   2705 O O     . GLU F 3 73 ? 33.842  12.822  37.164  1.00 78.15 ? 275 GLU B O     1 
ATOM   2706 C CB    . GLU F 3 73 ? 32.031  11.603  34.812  1.00 78.86 ? 275 GLU B CB    1 
ATOM   2707 C CG    . GLU F 3 73 ? 31.090  10.467  34.434  1.00 81.06 ? 275 GLU B CG    1 
ATOM   2708 C CD    . GLU F 3 73 ? 31.208  9.273   35.366  1.00 82.14 ? 275 GLU B CD    1 
ATOM   2709 O OE1   . GLU F 3 73 ? 30.476  8.280   35.160  1.00 83.02 ? 275 GLU B OE1   1 
ATOM   2710 O OE2   . GLU F 3 73 ? 32.033  9.326   36.305  1.00 82.43 ? 275 GLU B OE2   1 
ATOM   2711 N N     . GLN F 3 74 ? 32.684  14.471  36.149  1.00 78.35 ? 276 GLN B N     1 
ATOM   2712 C CA    . GLN F 3 74 ? 33.662  15.505  36.460  1.00 79.09 ? 276 GLN B CA    1 
ATOM   2713 C C     . GLN F 3 74 ? 33.644  15.769  37.959  1.00 79.18 ? 276 GLN B C     1 
ATOM   2714 O O     . GLN F 3 74 ? 34.675  15.687  38.627  1.00 79.52 ? 276 GLN B O     1 
ATOM   2715 C CB    . GLN F 3 74 ? 33.340  16.801  35.708  1.00 79.26 ? 276 GLN B CB    1 
ATOM   2716 C CG    . GLN F 3 74 ? 34.002  16.915  34.344  1.00 79.99 ? 276 GLN B CG    1 
ATOM   2717 C CD    . GLN F 3 74 ? 33.807  18.284  33.713  1.00 80.32 ? 276 GLN B CD    1 
ATOM   2718 O OE1   . GLN F 3 74 ? 32.710  18.628  33.272  1.00 80.15 ? 276 GLN B OE1   1 
ATOM   2719 N NE2   . GLN F 3 74 ? 34.875  19.076  33.678  1.00 79.92 ? 276 GLN B NE2   1 
ATOM   2720 N N     . GLN F 3 75 ? 32.462  16.084  38.481  1.00 79.12 ? 277 GLN B N     1 
ATOM   2721 C CA    . GLN F 3 75 ? 32.303  16.350  39.902  1.00 79.02 ? 277 GLN B CA    1 
ATOM   2722 C C     . GLN F 3 75 ? 32.795  15.151  40.708  1.00 79.00 ? 277 GLN B C     1 
ATOM   2723 O O     . GLN F 3 75 ? 33.173  15.287  41.871  1.00 78.85 ? 277 GLN B O     1 
ATOM   2724 C CB    . GLN F 3 75 ? 30.834  16.628  40.222  1.00 79.67 ? 277 GLN B CB    1 
ATOM   2725 C CG    . GLN F 3 75 ? 30.265  17.833  39.494  1.00 80.29 ? 277 GLN B CG    1 
ATOM   2726 C CD    . GLN F 3 75 ? 28.793  18.041  39.779  1.00 80.89 ? 277 GLN B CD    1 
ATOM   2727 O OE1   . GLN F 3 75 ? 28.396  18.294  40.917  1.00 81.03 ? 277 GLN B OE1   1 
ATOM   2728 N NE2   . GLN F 3 75 ? 27.970  17.929  38.744  1.00 81.61 ? 277 GLN B NE2   1 
ATOM   2729 N N     . VAL F 3 76 ? 32.787  13.979  40.077  1.00 78.59 ? 278 VAL B N     1 
ATOM   2730 C CA    . VAL F 3 76 ? 33.240  12.748  40.717  1.00 77.69 ? 278 VAL B CA    1 
ATOM   2731 C C     . VAL F 3 76 ? 34.696  12.464  40.356  1.00 77.46 ? 278 VAL B C     1 
ATOM   2732 O O     . VAL F 3 76 ? 35.322  13.366  39.761  1.00 77.46 ? 278 VAL B O     1 
ATOM   2733 C CB    . VAL F 3 76 ? 32.374  11.538  40.286  1.00 77.17 ? 278 VAL B CB    1 
ATOM   2734 C CG1   . VAL F 3 76 ? 32.983  10.248  40.809  1.00 76.97 ? 278 VAL B CG1   1 
ATOM   2735 C CG2   . VAL F 3 76 ? 30.957  11.696  40.814  1.00 76.11 ? 278 VAL B CG2   1 
ATOM   2736 N N     . SER G 2 1  ? 45.505  37.943  18.171  1.00 54.32 ? 502 SER D N     1 
ATOM   2737 C CA    . SER G 2 1  ? 44.902  36.697  17.614  1.00 54.24 ? 502 SER D CA    1 
ATOM   2738 C C     . SER G 2 1  ? 43.403  36.671  17.926  1.00 54.30 ? 502 SER D C     1 
ATOM   2739 O O     . SER G 2 1  ? 42.583  36.325  17.070  1.00 53.40 ? 502 SER D O     1 
ATOM   2740 N N     . ARG G 2 2  ? 43.055  37.043  19.157  1.00 53.94 ? 503 ARG D N     1 
ATOM   2741 C CA    . ARG G 2 2  ? 41.665  37.067  19.597  1.00 53.78 ? 503 ARG D CA    1 
ATOM   2742 C C     . ARG G 2 2  ? 40.792  37.959  18.716  1.00 52.72 ? 503 ARG D C     1 
ATOM   2743 O O     . ARG G 2 2  ? 39.702  37.562  18.314  1.00 52.14 ? 503 ARG D O     1 
ATOM   2744 C CB    . ARG G 2 2  ? 41.566  37.551  21.052  1.00 55.30 ? 503 ARG D CB    1 
ATOM   2745 C CG    . ARG G 2 2  ? 41.839  36.492  22.121  1.00 58.27 ? 503 ARG D CG    1 
ATOM   2746 C CD    . ARG G 2 2  ? 41.495  37.031  23.514  1.00 61.06 ? 503 ARG D CD    1 
ATOM   2747 N NE    . ARG G 2 2  ? 41.567  36.011  24.559  1.00 62.44 ? 503 ARG D NE    1 
ATOM   2748 C CZ    . ARG G 2 2  ? 41.052  36.149  25.780  1.00 63.93 ? 503 ARG D CZ    1 
ATOM   2749 N NH1   . ARG G 2 2  ? 40.423  37.266  26.118  1.00 63.28 ? 503 ARG D NH1   1 
ATOM   2750 N NH2   . ARG G 2 2  ? 41.158  35.165  26.666  1.00 62.99 ? 503 ARG D NH2   1 
ATOM   2751 N N     . SER G 2 3  ? 41.268  39.162  18.414  1.00 52.35 ? 504 SER D N     1 
ATOM   2752 C CA    . SER G 2 3  ? 40.493  40.094  17.601  1.00 51.69 ? 504 SER D CA    1 
ATOM   2753 C C     . SER G 2 3  ? 40.406  39.691  16.135  1.00 51.05 ? 504 SER D C     1 
ATOM   2754 O O     . SER G 2 3  ? 39.486  40.101  15.421  1.00 51.42 ? 504 SER D O     1 
ATOM   2755 C CB    . SER G 2 3  ? 41.069  41.501  17.717  1.00 52.26 ? 504 SER D CB    1 
ATOM   2756 O OG    . SER G 2 3  ? 40.051  42.469  17.514  1.00 53.77 ? 504 SER D OG    1 
ATOM   2757 N N     . THR G 2 4  ? 41.364  38.897  15.675  1.00 49.36 ? 505 THR D N     1 
ATOM   2758 C CA    . THR G 2 4  ? 41.338  38.446  14.291  1.00 47.74 ? 505 THR D CA    1 
ATOM   2759 C C     . THR G 2 4  ? 40.247  37.383  14.188  1.00 45.51 ? 505 THR D C     1 
ATOM   2760 O O     . THR G 2 4  ? 39.482  37.346  13.221  1.00 45.21 ? 505 THR D O     1 
ATOM   2761 C CB    . THR G 2 4  ? 42.675  37.802  13.862  1.00 48.20 ? 505 THR D CB    1 
ATOM   2762 O OG1   . THR G 2 4  ? 43.754  38.714  14.095  1.00 50.30 ? 505 THR D OG1   1 
ATOM   2763 C CG2   . THR G 2 4  ? 42.631  37.448  12.384  1.00 49.24 ? 505 THR D CG2   1 
ATOM   2764 N N     . HIS G 2 5  ? 40.181  36.524  15.202  1.00 42.47 ? 506 HIS D N     1 
ATOM   2765 C CA    . HIS G 2 5  ? 39.188  35.462  15.230  1.00 40.61 ? 506 HIS D CA    1 
ATOM   2766 C C     . HIS G 2 5  ? 37.798  36.086  15.268  1.00 40.27 ? 506 HIS D C     1 
ATOM   2767 O O     . HIS G 2 5  ? 36.902  35.662  14.541  1.00 36.37 ? 506 HIS D O     1 
ATOM   2768 C CB    . HIS G 2 5  ? 39.383  34.575  16.461  1.00 39.21 ? 506 HIS D CB    1 
ATOM   2769 C CG    . HIS G 2 5  ? 38.545  33.336  16.448  1.00 36.74 ? 506 HIS D CG    1 
ATOM   2770 N ND1   . HIS G 2 5  ? 38.168  32.680  17.600  1.00 39.15 ? 506 HIS D ND1   1 
ATOM   2771 C CD2   . HIS G 2 5  ? 38.031  32.619  15.423  1.00 36.85 ? 506 HIS D CD2   1 
ATOM   2772 C CE1   . HIS G 2 5  ? 37.457  31.614  17.285  1.00 37.00 ? 506 HIS D CE1   1 
ATOM   2773 N NE2   . HIS G 2 5  ? 37.358  31.553  15.970  1.00 34.59 ? 506 HIS D NE2   1 
ATOM   2774 N N     . ASN G 2 6  ? 37.632  37.092  16.125  1.00 41.83 ? 507 ASN D N     1 
ATOM   2775 C CA    . ASN G 2 6  ? 36.358  37.795  16.265  1.00 43.19 ? 507 ASN D CA    1 
ATOM   2776 C C     . ASN G 2 6  ? 35.866  38.281  14.909  1.00 43.20 ? 507 ASN D C     1 
ATOM   2777 O O     . ASN G 2 6  ? 34.751  37.967  14.495  1.00 43.57 ? 507 ASN D O     1 
ATOM   2778 C CB    . ASN G 2 6  ? 36.501  39.008  17.194  1.00 46.16 ? 507 ASN D CB    1 
ATOM   2779 C CG    . ASN G 2 6  ? 37.195  38.673  18.495  1.00 49.99 ? 507 ASN D CG    1 
ATOM   2780 O OD1   . ASN G 2 6  ? 36.991  37.600  19.070  1.00 54.40 ? 507 ASN D OD1   1 
ATOM   2781 N ND2   . ASN G 2 6  ? 38.012  39.603  18.983  1.00 54.51 ? 507 ASN D ND2   1 
ATOM   2782 N N     . GLU G 2 7  ? 36.708  39.044  14.218  1.00 42.83 ? 508 GLU D N     1 
ATOM   2783 C CA    . GLU G 2 7  ? 36.363  39.586  12.907  1.00 44.21 ? 508 GLU D CA    1 
ATOM   2784 C C     . GLU G 2 7  ? 35.931  38.524  11.910  1.00 43.97 ? 508 GLU D C     1 
ATOM   2785 O O     . GLU G 2 7  ? 34.943  38.705  11.194  1.00 43.15 ? 508 GLU D O     1 
ATOM   2786 C CB    . GLU G 2 7  ? 37.537  40.375  12.330  1.00 46.72 ? 508 GLU D CB    1 
ATOM   2787 C CG    . GLU G 2 7  ? 37.668  41.777  12.897  1.00 49.70 ? 508 GLU D CG    1 
ATOM   2788 C CD    . GLU G 2 7  ? 36.392  42.585  12.719  1.00 52.29 ? 508 GLU D CD    1 
ATOM   2789 O OE1   . GLU G 2 7  ? 35.910  42.714  11.569  1.00 51.57 ? 508 GLU D OE1   1 
ATOM   2790 O OE2   . GLU G 2 7  ? 35.870  43.087  13.734  1.00 54.20 ? 508 GLU D OE2   1 
ATOM   2791 N N     . MET G 2 8  ? 36.674  37.423  11.862  1.00 42.24 ? 509 MET D N     1 
ATOM   2792 C CA    . MET G 2 8  ? 36.355  36.329  10.953  1.00 42.46 ? 509 MET D CA    1 
ATOM   2793 C C     . MET G 2 8  ? 34.984  35.716  11.267  1.00 39.98 ? 509 MET D C     1 
ATOM   2794 O O     . MET G 2 8  ? 34.215  35.406  10.357  1.00 37.86 ? 509 MET D O     1 
ATOM   2795 C CB    . MET G 2 8  ? 37.434  35.236  11.026  1.00 45.45 ? 509 MET D CB    1 
ATOM   2796 C CG    . MET G 2 8  ? 38.833  35.694  10.610  1.00 50.71 ? 509 MET D CG    1 
ATOM   2797 S SD    . MET G 2 8  ? 39.966  34.316  10.206  1.00 57.96 ? 509 MET D SD    1 
ATOM   2798 C CE    . MET G 2 8  ? 40.747  33.993  11.792  1.00 53.69 ? 509 MET D CE    1 
ATOM   2799 N N     . GLU G 2 9  ? 34.684  35.540  12.553  1.00 38.14 ? 510 GLU D N     1 
ATOM   2800 C CA    . GLU G 2 9  ? 33.409  34.963  12.958  1.00 36.48 ? 510 GLU D CA    1 
ATOM   2801 C C     . GLU G 2 9  ? 32.258  35.933  12.657  1.00 36.66 ? 510 GLU D C     1 
ATOM   2802 O O     . GLU G 2 9  ? 31.194  35.521  12.198  1.00 35.22 ? 510 GLU D O     1 
ATOM   2803 C CB    . GLU G 2 9  ? 33.436  34.611  14.451  1.00 36.51 ? 510 GLU D CB    1 
ATOM   2804 C CG    . GLU G 2 9  ? 32.150  33.996  14.971  1.00 37.30 ? 510 GLU D CG    1 
ATOM   2805 C CD    . GLU G 2 9  ? 31.897  32.590  14.441  1.00 38.28 ? 510 GLU D CD    1 
ATOM   2806 O OE1   . GLU G 2 9  ? 32.718  32.083  13.644  1.00 37.43 ? 510 GLU D OE1   1 
ATOM   2807 O OE2   . GLU G 2 9  ? 30.876  31.988  14.828  1.00 38.60 ? 510 GLU D OE2   1 
ATOM   2808 N N     . LYS G 2 10 ? 32.478  37.221  12.906  1.00 36.66 ? 511 LYS D N     1 
ATOM   2809 C CA    . LYS G 2 10 ? 31.454  38.225  12.638  1.00 38.88 ? 511 LYS D CA    1 
ATOM   2810 C C     . LYS G 2 10 ? 31.103  38.243  11.159  1.00 38.09 ? 511 LYS D C     1 
ATOM   2811 O O     . LYS G 2 10 ? 29.933  38.323  10.801  1.00 37.52 ? 511 LYS D O     1 
ATOM   2812 C CB    . LYS G 2 10 ? 31.915  39.624  13.072  1.00 38.11 ? 511 LYS D CB    1 
ATOM   2813 C CG    . LYS G 2 10 ? 31.969  39.840  14.579  1.00 43.16 ? 511 LYS D CG    1 
ATOM   2814 C CD    . LYS G 2 10 ? 32.037  41.344  14.936  1.00 44.45 ? 511 LYS D CD    1 
ATOM   2815 C CE    . LYS G 2 10 ? 33.189  42.028  14.221  1.00 46.88 ? 511 LYS D CE    1 
ATOM   2816 N NZ    . LYS G 2 10 ? 33.297  43.498  14.484  1.00 47.51 ? 511 LYS D NZ    1 
ATOM   2817 N N     . ASN G 2 11 ? 32.115  38.168  10.300  1.00 38.89 ? 512 ASN D N     1 
ATOM   2818 C CA    . ASN G 2 11 ? 31.881  38.165  8.857   1.00 40.16 ? 512 ASN D CA    1 
ATOM   2819 C C     . ASN G 2 11 ? 31.190  36.856  8.460   1.00 40.25 ? 512 ASN D C     1 
ATOM   2820 O O     . ASN G 2 11 ? 30.318  36.829  7.585   1.00 40.48 ? 512 ASN D O     1 
ATOM   2821 C CB    . ASN G 2 11 ? 33.206  38.311  8.100   1.00 44.90 ? 512 ASN D CB    1 
ATOM   2822 N N     . ARG G 2 12 ? 31.571  35.773  9.125   1.00 39.26 ? 513 ARG D N     1 
ATOM   2823 C CA    . ARG G 2 12 ? 30.980  34.471  8.857   1.00 38.11 ? 513 ARG D CA    1 
ATOM   2824 C C     . ARG G 2 12 ? 29.499  34.535  9.226   1.00 37.98 ? 513 ARG D C     1 
ATOM   2825 O O     . ARG G 2 12 ? 28.642  34.090  8.454   1.00 37.30 ? 513 ARG D O     1 
ATOM   2826 C CB    . ARG G 2 12 ? 31.687  33.398  9.685   1.00 39.53 ? 513 ARG D CB    1 
ATOM   2827 C CG    . ARG G 2 12 ? 31.581  31.991  9.105   1.00 42.27 ? 513 ARG D CG    1 
ATOM   2828 C CD    . ARG G 2 12 ? 32.259  30.976  10.021  1.00 42.08 ? 513 ARG D CD    1 
ATOM   2829 N NE    . ARG G 2 12 ? 31.515  30.852  11.268  1.00 39.76 ? 513 ARG D NE    1 
ATOM   2830 C CZ    . ARG G 2 12 ? 30.343  30.243  11.363  1.00 39.37 ? 513 ARG D CZ    1 
ATOM   2831 N NH1   . ARG G 2 12 ? 29.800  29.693  10.282  1.00 39.95 ? 513 ARG D NH1   1 
ATOM   2832 N NH2   . ARG G 2 12 ? 29.697  30.217  12.522  1.00 39.13 ? 513 ARG D NH2   1 
ATOM   2833 N N     . ARG G 2 13 ? 29.196  35.096  10.398  1.00 35.48 ? 514 ARG D N     1 
ATOM   2834 C CA    . ARG G 2 13 ? 27.807  35.223  10.834  1.00 36.61 ? 514 ARG D CA    1 
ATOM   2835 C C     . ARG G 2 13 ? 27.030  36.147  9.900   1.00 35.37 ? 514 ARG D C     1 
ATOM   2836 O O     . ARG G 2 13 ? 25.892  35.850  9.554   1.00 36.99 ? 514 ARG D O     1 
ATOM   2837 C CB    . ARG G 2 13 ? 27.702  35.768  12.272  1.00 36.93 ? 514 ARG D CB    1 
ATOM   2838 C CG    . ARG G 2 13 ? 28.098  34.800  13.393  1.00 41.74 ? 514 ARG D CG    1 
ATOM   2839 C CD    . ARG G 2 13 ? 27.621  35.310  14.773  1.00 44.92 ? 514 ARG D CD    1 
ATOM   2840 N NE    . ARG G 2 13 ? 28.141  36.639  15.099  1.00 45.25 ? 514 ARG D NE    1 
ATOM   2841 C CZ    . ARG G 2 13 ? 29.259  36.869  15.789  1.00 47.01 ? 514 ARG D CZ    1 
ATOM   2842 N NH1   . ARG G 2 13 ? 29.993  35.858  16.248  1.00 45.47 ? 514 ARG D NH1   1 
ATOM   2843 N NH2   . ARG G 2 13 ? 29.660  38.113  16.004  1.00 46.08 ? 514 ARG D NH2   1 
ATOM   2844 N N     . ALA G 2 14 ? 27.639  37.266  9.498   1.00 34.97 ? 515 ALA D N     1 
ATOM   2845 C CA    . ALA G 2 14 ? 26.972  38.215  8.600   1.00 35.46 ? 515 ALA D CA    1 
ATOM   2846 C C     . ALA G 2 14 ? 26.535  37.561  7.289   1.00 35.12 ? 515 ALA D C     1 
ATOM   2847 O O     . ALA G 2 14 ? 25.414  37.762  6.838   1.00 34.33 ? 515 ALA D O     1 
ATOM   2848 C CB    . ALA G 2 14 ? 27.890  39.411  8.302   1.00 33.32 ? 515 ALA D CB    1 
ATOM   2849 N N     . HIS G 2 15 ? 27.425  36.788  6.673   1.00 36.76 ? 516 HIS D N     1 
ATOM   2850 C CA    . HIS G 2 15 ? 27.103  36.106  5.417   1.00 37.45 ? 516 HIS D CA    1 
ATOM   2851 C C     . HIS G 2 15 ? 25.967  35.106  5.608   1.00 36.65 ? 516 HIS D C     1 
ATOM   2852 O O     . HIS G 2 15 ? 25.128  34.918  4.725   1.00 35.32 ? 516 HIS D O     1 
ATOM   2853 C CB    . HIS G 2 15 ? 28.341  35.384  4.868   1.00 41.02 ? 516 HIS D CB    1 
ATOM   2854 C CG    . HIS G 2 15 ? 28.055  34.498  3.690   1.00 46.08 ? 516 HIS D CG    1 
ATOM   2855 N ND1   . HIS G 2 15 ? 27.378  33.301  3.803   1.00 47.89 ? 516 HIS D ND1   1 
ATOM   2856 C CD2   . HIS G 2 15 ? 28.360  34.633  2.377   1.00 47.10 ? 516 HIS D CD2   1 
ATOM   2857 C CE1   . HIS G 2 15 ? 27.280  32.736  2.612   1.00 48.51 ? 516 HIS D CE1   1 
ATOM   2858 N NE2   . HIS G 2 15 ? 27.867  33.525  1.729   1.00 49.33 ? 516 HIS D NE2   1 
ATOM   2859 N N     . LEU G 2 16 ? 25.948  34.465  6.772   1.00 35.05 ? 517 LEU D N     1 
ATOM   2860 C CA    . LEU G 2 16 ? 24.920  33.486  7.094   1.00 34.47 ? 517 LEU D CA    1 
ATOM   2861 C C     . LEU G 2 16 ? 23.590  34.233  7.237   1.00 32.31 ? 517 LEU D C     1 
ATOM   2862 O O     . LEU G 2 16 ? 22.545  33.765  6.771   1.00 31.50 ? 517 LEU D O     1 
ATOM   2863 C CB    . LEU G 2 16 ? 25.300  32.768  8.398   1.00 36.96 ? 517 LEU D CB    1 
ATOM   2864 C CG    . LEU G 2 16 ? 25.303  31.238  8.441   1.00 41.69 ? 517 LEU D CG    1 
ATOM   2865 C CD1   . LEU G 2 16 ? 25.875  30.643  7.149   1.00 44.60 ? 517 LEU D CD1   1 
ATOM   2866 C CD2   . LEU G 2 16 ? 26.126  30.799  9.645   1.00 41.59 ? 517 LEU D CD2   1 
ATOM   2867 N N     . ARG G 2 17 ? 23.632  35.410  7.864   1.00 31.84 ? 518 ARG D N     1 
ATOM   2868 C CA    . ARG G 2 17 ? 22.412  36.206  8.018   1.00 32.96 ? 518 ARG D CA    1 
ATOM   2869 C C     . ARG G 2 17 ? 21.810  36.540  6.665   1.00 29.69 ? 518 ARG D C     1 
ATOM   2870 O O     . ARG G 2 17 ? 20.593  36.534  6.508   1.00 30.40 ? 518 ARG D O     1 
ATOM   2871 C CB    . ARG G 2 17 ? 22.681  37.512  8.771   1.00 35.36 ? 518 ARG D CB    1 
ATOM   2872 C CG    . ARG G 2 17 ? 22.982  37.313  10.234  1.00 40.42 ? 518 ARG D CG    1 
ATOM   2873 C CD    . ARG G 2 17 ? 22.615  38.547  11.046  1.00 41.76 ? 518 ARG D CD    1 
ATOM   2874 N NE    . ARG G 2 17 ? 23.465  38.663  12.223  1.00 46.82 ? 518 ARG D NE    1 
ATOM   2875 C CZ    . ARG G 2 17 ? 24.748  38.996  12.174  1.00 45.84 ? 518 ARG D CZ    1 
ATOM   2876 N NH1   . ARG G 2 17 ? 25.318  39.248  11.004  1.00 48.40 ? 518 ARG D NH1   1 
ATOM   2877 N NH2   . ARG G 2 17 ? 25.462  39.076  13.289  1.00 48.41 ? 518 ARG D NH2   1 
ATOM   2878 N N     . LEU G 2 18 ? 22.667  36.829  5.688   1.00 31.55 ? 519 LEU D N     1 
ATOM   2879 C CA    . LEU G 2 18 ? 22.213  37.161  4.337   1.00 32.08 ? 519 LEU D CA    1 
ATOM   2880 C C     . LEU G 2 18 ? 21.571  35.958  3.639   1.00 33.76 ? 519 LEU D C     1 
ATOM   2881 O O     . LEU G 2 18 ? 20.519  36.085  3.015   1.00 32.15 ? 519 LEU D O     1 
ATOM   2882 C CB    . LEU G 2 18 ? 23.380  37.672  3.485   1.00 32.32 ? 519 LEU D CB    1 
ATOM   2883 C CG    . LEU G 2 18 ? 23.904  39.093  3.746   1.00 34.26 ? 519 LEU D CG    1 
ATOM   2884 C CD1   . LEU G 2 18 ? 24.997  39.407  2.738   1.00 31.66 ? 519 LEU D CD1   1 
ATOM   2885 C CD2   . LEU G 2 18 ? 22.756  40.112  3.615   1.00 32.00 ? 519 LEU D CD2   1 
ATOM   2886 N N     . SER G 2 19 ? 22.223  34.800  3.723   1.00 34.22 ? 520 SER D N     1 
ATOM   2887 C CA    . SER G 2 19 ? 21.683  33.590  3.108   1.00 34.48 ? 520 SER D CA    1 
ATOM   2888 C C     . SER G 2 19 ? 20.322  33.309  3.726   1.00 33.72 ? 520 SER D C     1 
ATOM   2889 O O     . SER G 2 19 ? 19.377  32.968  3.033   1.00 34.54 ? 520 SER D O     1 
ATOM   2890 C CB    . SER G 2 19 ? 22.622  32.404  3.343   1.00 34.94 ? 520 SER D CB    1 
ATOM   2891 O OG    . SER G 2 19 ? 23.828  32.578  2.626   1.00 38.74 ? 520 SER D OG    1 
ATOM   2892 N N     . LEU G 2 20 ? 20.218  33.485  5.039   1.00 34.96 ? 521 LEU D N     1 
ATOM   2893 C CA    . LEU G 2 20 ? 18.959  33.246  5.725   1.00 35.58 ? 521 LEU D CA    1 
ATOM   2894 C C     . LEU G 2 20 ? 17.850  34.175  5.225   1.00 35.29 ? 521 LEU D C     1 
ATOM   2895 O O     . LEU G 2 20 ? 16.742  33.730  4.913   1.00 34.17 ? 521 LEU D O     1 
ATOM   2896 C CB    . LEU G 2 20 ? 19.152  33.427  7.225   1.00 36.94 ? 521 LEU D CB    1 
ATOM   2897 C CG    . LEU G 2 20 ? 18.071  32.814  8.108   1.00 40.26 ? 521 LEU D CG    1 
ATOM   2898 C CD1   . LEU G 2 20 ? 17.842  31.362  7.710   1.00 39.94 ? 521 LEU D CD1   1 
ATOM   2899 C CD2   . LEU G 2 20 ? 18.498  32.934  9.574   1.00 40.66 ? 521 LEU D CD2   1 
ATOM   2900 N N     . GLU G 2 21 ? 18.153  35.468  5.140   1.00 35.78 ? 522 GLU D N     1 
ATOM   2901 C CA    . GLU G 2 21 ? 17.165  36.432  4.684   1.00 35.22 ? 522 GLU D CA    1 
ATOM   2902 C C     . GLU G 2 21 ? 16.750  36.135  3.244   1.00 35.20 ? 522 GLU D C     1 
ATOM   2903 O O     . GLU G 2 21 ? 15.588  36.285  2.889   1.00 33.29 ? 522 GLU D O     1 
ATOM   2904 C CB    . GLU G 2 21 ? 17.710  37.864  4.821   1.00 36.17 ? 522 GLU D CB    1 
ATOM   2905 C CG    . GLU G 2 21 ? 16.789  38.955  4.261   1.00 37.96 ? 522 GLU D CG    1 
ATOM   2906 C CD    . GLU G 2 21 ? 16.966  40.301  4.966   1.00 41.02 ? 522 GLU D CD    1 
ATOM   2907 O OE1   . GLU G 2 21 ? 18.028  40.530  5.587   1.00 39.60 ? 522 GLU D OE1   1 
ATOM   2908 O OE2   . GLU G 2 21 ? 16.044  41.137  4.891   1.00 40.32 ? 522 GLU D OE2   1 
ATOM   2909 N N     . LYS G 2 22 ? 17.695  35.699  2.417   1.00 36.46 ? 523 LYS D N     1 
ATOM   2910 C CA    . LYS G 2 22 ? 17.364  35.381  1.037   1.00 38.41 ? 523 LYS D CA    1 
ATOM   2911 C C     . LYS G 2 22 ? 16.416  34.183  0.978   1.00 37.23 ? 523 LYS D C     1 
ATOM   2912 O O     . LYS G 2 22 ? 15.526  34.127  0.132   1.00 37.48 ? 523 LYS D O     1 
ATOM   2913 C CB    . LYS G 2 22 ? 18.630  35.090  0.226   1.00 38.68 ? 523 LYS D CB    1 
ATOM   2914 C CG    . LYS G 2 22 ? 18.364  34.846  -1.255  1.00 42.32 ? 523 LYS D CG    1 
ATOM   2915 C CD    . LYS G 2 22 ? 19.656  34.783  -2.055  1.00 44.24 ? 523 LYS D CD    1 
ATOM   2916 C CE    . LYS G 2 22 ? 19.410  34.321  -3.484  1.00 48.58 ? 523 LYS D CE    1 
ATOM   2917 N NZ    . LYS G 2 22 ? 20.670  34.298  -4.309  1.00 50.97 ? 523 LYS D NZ    1 
ATOM   2918 N N     . LEU G 2 23 ? 16.592  33.228  1.883   1.00 35.56 ? 524 LEU D N     1 
ATOM   2919 C CA    . LEU G 2 23 ? 15.723  32.061  1.877   1.00 35.42 ? 524 LEU D CA    1 
ATOM   2920 C C     . LEU G 2 23 ? 14.340  32.468  2.369   1.00 36.47 ? 524 LEU D C     1 
ATOM   2921 O O     . LEU G 2 23 ? 13.324  31.996  1.859   1.00 34.53 ? 524 LEU D O     1 
ATOM   2922 C CB    . LEU G 2 23 ? 16.311  30.943  2.757   1.00 34.74 ? 524 LEU D CB    1 
ATOM   2923 C CG    . LEU G 2 23 ? 15.478  29.657  2.898   1.00 34.06 ? 524 LEU D CG    1 
ATOM   2924 C CD1   . LEU G 2 23 ? 15.058  29.144  1.535   1.00 34.21 ? 524 LEU D CD1   1 
ATOM   2925 C CD2   . LEU G 2 23 ? 16.296  28.602  3.643   1.00 35.99 ? 524 LEU D CD2   1 
ATOM   2926 N N     . LYS G 2 24 ? 14.305  33.364  3.352   1.00 38.44 ? 525 LYS D N     1 
ATOM   2927 C CA    . LYS G 2 24 ? 13.043  33.835  3.894   1.00 42.09 ? 525 LYS D CA    1 
ATOM   2928 C C     . LYS G 2 24 ? 12.165  34.390  2.777   1.00 43.83 ? 525 LYS D C     1 
ATOM   2929 O O     . LYS G 2 24 ? 10.953  34.191  2.771   1.00 44.65 ? 525 LYS D O     1 
ATOM   2930 C CB    . LYS G 2 24 ? 13.280  34.933  4.936   1.00 43.60 ? 525 LYS D CB    1 
ATOM   2931 C CG    . LYS G 2 24 ? 11.999  35.405  5.615   1.00 45.18 ? 525 LYS D CG    1 
ATOM   2932 C CD    . LYS G 2 24 ? 12.261  36.566  6.558   1.00 47.75 ? 525 LYS D CD    1 
ATOM   2933 C CE    . LYS G 2 24 ? 12.452  37.871  5.791   1.00 48.58 ? 525 LYS D CE    1 
ATOM   2934 N NZ    . LYS G 2 24 ? 11.208  38.260  5.060   1.00 48.44 ? 525 LYS D NZ    1 
ATOM   2935 N N     . GLY G 2 25 ? 12.789  35.087  1.834   1.00 46.36 ? 526 GLY D N     1 
ATOM   2936 C CA    . GLY G 2 25 ? 12.049  35.673  0.731   1.00 50.35 ? 526 GLY D CA    1 
ATOM   2937 C C     . GLY G 2 25 ? 11.462  34.691  -0.266  1.00 52.94 ? 526 GLY D C     1 
ATOM   2938 O O     . GLY G 2 25 ? 10.456  34.991  -0.908  1.00 53.13 ? 526 GLY D O     1 
ATOM   2939 N N     . LEU G 2 26 ? 12.086  33.525  -0.404  1.00 55.26 ? 527 LEU D N     1 
ATOM   2940 C CA    . LEU G 2 26 ? 11.603  32.508  -1.335  1.00 57.73 ? 527 LEU D CA    1 
ATOM   2941 C C     . LEU G 2 26 ? 10.630  31.539  -0.683  1.00 59.68 ? 527 LEU D C     1 
ATOM   2942 O O     . LEU G 2 26 ? 10.244  30.543  -1.297  1.00 60.21 ? 527 LEU D O     1 
ATOM   2943 C CB    . LEU G 2 26 ? 12.768  31.703  -1.915  1.00 57.22 ? 527 LEU D CB    1 
ATOM   2944 C CG    . LEU G 2 26 ? 13.781  32.422  -2.803  1.00 57.76 ? 527 LEU D CG    1 
ATOM   2945 C CD1   . LEU G 2 26 ? 14.758  31.396  -3.366  1.00 58.05 ? 527 LEU D CD1   1 
ATOM   2946 C CD2   . LEU G 2 26 ? 13.060  33.148  -3.932  1.00 55.94 ? 527 LEU D CD2   1 
ATOM   2947 N N     . VAL G 2 27 ? 10.242  31.823  0.556   1.00 61.64 ? 528 VAL D N     1 
ATOM   2948 C CA    . VAL G 2 27 ? 9.321   30.960  1.283   1.00 64.77 ? 528 VAL D CA    1 
ATOM   2949 C C     . VAL G 2 27 ? 7.929   31.577  1.387   1.00 67.80 ? 528 VAL D C     1 
ATOM   2950 O O     . VAL G 2 27 ? 7.718   32.532  2.136   1.00 67.84 ? 528 VAL D O     1 
ATOM   2951 C CB    . VAL G 2 27 ? 9.849   30.660  2.698   1.00 64.72 ? 528 VAL D CB    1 
ATOM   2952 C CG1   . VAL G 2 27 ? 8.820   29.870  3.487   1.00 64.92 ? 528 VAL D CG1   1 
ATOM   2953 C CG2   . VAL G 2 27 ? 11.151  29.877  2.600   1.00 65.18 ? 528 VAL D CG2   1 
ATOM   2954 N N     . PRO G 2 28 ? 6.965   31.041  0.614   1.00 70.43 ? 529 PRO D N     1 
ATOM   2955 C CA    . PRO G 2 28 ? 5.564   31.472  0.554   1.00 72.45 ? 529 PRO D CA    1 
ATOM   2956 C C     . PRO G 2 28 ? 4.836   31.316  1.882   1.00 74.31 ? 529 PRO D C     1 
ATOM   2957 O O     . PRO G 2 28 ? 3.621   31.125  1.916   1.00 74.59 ? 529 PRO D O     1 
ATOM   2958 C CB    . PRO G 2 28 ? 4.974   30.573  -0.528  1.00 72.01 ? 529 PRO D CB    1 
ATOM   2959 C CG    . PRO G 2 28 ? 6.124   30.377  -1.447  1.00 72.04 ? 529 PRO D CG    1 
ATOM   2960 C CD    . PRO G 2 28 ? 7.248   30.093  -0.477  1.00 71.16 ? 529 PRO D CD    1 
ATOM   2961 N N     . LEU G 2 29 ? 5.592   31.378  2.972   1.00 76.50 ? 530 LEU D N     1 
ATOM   2962 C CA    . LEU G 2 29 ? 5.031   31.271  4.313   1.00 78.20 ? 530 LEU D CA    1 
ATOM   2963 C C     . LEU G 2 29 ? 5.660   32.408  5.110   1.00 79.48 ? 530 LEU D C     1 
ATOM   2964 O O     . LEU G 2 29 ? 6.135   32.225  6.233   1.00 79.51 ? 530 LEU D O     1 
ATOM   2965 C CB    . LEU G 2 29 ? 5.378   29.914  4.938   1.00 78.19 ? 530 LEU D CB    1 
ATOM   2966 C CG    . LEU G 2 29 ? 4.244   29.154  5.642   1.00 78.27 ? 530 LEU D CG    1 
ATOM   2967 C CD1   . LEU G 2 29 ? 3.671   29.997  6.773   1.00 78.93 ? 530 LEU D CD1   1 
ATOM   2968 C CD2   . LEU G 2 29 ? 3.155   28.804  4.638   1.00 78.17 ? 530 LEU D CD2   1 
ATOM   2969 N N     . GLY G 2 30 ? 5.660   33.586  4.494   1.00 80.64 ? 531 GLY D N     1 
ATOM   2970 C CA    . GLY G 2 30 ? 6.232   34.765  5.113   1.00 82.29 ? 531 GLY D CA    1 
ATOM   2971 C C     . GLY G 2 30 ? 7.314   35.382  4.242   1.00 83.46 ? 531 GLY D C     1 
ATOM   2972 O O     . GLY G 2 30 ? 8.394   35.705  4.741   1.00 83.18 ? 531 GLY D O     1 
ATOM   2973 N N     . PRO G 2 31 ? 7.063   35.552  2.930   1.00 84.37 ? 532 PRO D N     1 
ATOM   2974 C CA    . PRO G 2 31 ? 8.067   36.144  2.038   1.00 84.97 ? 532 PRO D CA    1 
ATOM   2975 C C     . PRO G 2 31 ? 8.253   37.649  2.258   1.00 85.17 ? 532 PRO D C     1 
ATOM   2976 O O     . PRO G 2 31 ? 9.046   38.291  1.569   1.00 85.30 ? 532 PRO D O     1 
ATOM   2977 C CB    . PRO G 2 31 ? 7.525   35.814  0.649   1.00 85.28 ? 532 PRO D CB    1 
ATOM   2978 C CG    . PRO G 2 31 ? 6.044   35.863  0.859   1.00 85.01 ? 532 PRO D CG    1 
ATOM   2979 C CD    . PRO G 2 31 ? 5.877   35.120  2.166   1.00 84.62 ? 532 PRO D CD    1 
ATOM   2980 N N     . ASP G 2 32 ? 7.517   38.196  3.224   1.00 85.30 ? 533 ASP D N     1 
ATOM   2981 C CA    . ASP G 2 32 ? 7.580   39.619  3.565   1.00 85.23 ? 533 ASP D CA    1 
ATOM   2982 C C     . ASP G 2 32 ? 7.514   39.809  5.083   1.00 84.53 ? 533 ASP D C     1 
ATOM   2983 O O     . ASP G 2 32 ? 6.962   40.802  5.568   1.00 84.31 ? 533 ASP D O     1 
ATOM   2984 C CB    . ASP G 2 32 ? 6.414   40.384  2.918   1.00 86.13 ? 533 ASP D CB    1 
ATOM   2985 C CG    . ASP G 2 32 ? 6.624   40.646  1.432   1.00 87.18 ? 533 ASP D CG    1 
ATOM   2986 O OD1   . ASP G 2 32 ? 5.717   41.121  0.744   1.00 87.50 ? 533 ASP D OD1   1 
ATOM   2987 O OD2   . ASP G 2 32 ? 7.820   40.351  0.935   1.00 87.17 ? 533 ASP D OD2   1 
ATOM   2988 N N     . SER G 2 33 ? 8.078   38.863  5.830   1.00 83.26 ? 534 SER D N     1 
ATOM   2989 C CA    . SER G 2 33 ? 8.054   38.941  7.287   1.00 82.01 ? 534 SER D CA    1 
ATOM   2990 C C     . SER G 2 33 ? 9.438   38.912  7.927   1.00 81.02 ? 534 SER D C     1 
ATOM   2991 O O     . SER G 2 33 ? 10.203  37.964  7.740   1.00 80.86 ? 534 SER D O     1 
ATOM   2992 C CB    . SER G 2 33 ? 7.219   37.791  7.868   1.00 82.33 ? 534 SER D CB    1 
ATOM   2993 O OG    . SER G 2 33 ? 7.904   36.551  7.771   1.00 81.40 ? 534 SER D OG    1 
ATOM   2994 N N     . SER G 2 34 ? 9.753   39.958  8.686   1.00 79.11 ? 535 SER D N     1 
ATOM   2995 C CA    . SER G 2 34 ? 11.030  40.041  9.382   1.00 77.06 ? 535 SER D CA    1 
ATOM   2996 C C     . SER G 2 34 ? 10.759  39.636  10.827  1.00 75.13 ? 535 SER D C     1 
ATOM   2997 O O     . SER G 2 34 ? 11.534  39.947  11.736  1.00 75.28 ? 535 SER D O     1 
ATOM   2998 C CB    . SER G 2 34 ? 11.584  41.466  9.329   1.00 77.74 ? 535 SER D CB    1 
ATOM   2999 O OG    . SER G 2 34 ? 11.727  41.909  7.988   1.00 78.52 ? 535 SER D OG    1 
ATOM   3000 N N     . ARG G 2 35 ? 9.641   38.939  11.016  1.00 72.47 ? 536 ARG D N     1 
ATOM   3001 C CA    . ARG G 2 35 ? 9.209   38.466  12.326  1.00 68.67 ? 536 ARG D CA    1 
ATOM   3002 C C     . ARG G 2 35 ? 9.586   37.001  12.520  1.00 65.98 ? 536 ARG D C     1 
ATOM   3003 O O     . ARG G 2 35 ? 10.088  36.613  13.580  1.00 66.54 ? 536 ARG D O     1 
ATOM   3004 C CB    . ARG G 2 35 ? 7.703   38.637  12.464  1.00 69.65 ? 536 ARG D CB    1 
ATOM   3005 N N     . HIS G 2 36 ? 9.334   36.187  11.497  1.00 61.29 ? 537 HIS D N     1 
ATOM   3006 C CA    . HIS G 2 36 ? 9.661   34.766  11.558  1.00 55.66 ? 537 HIS D CA    1 
ATOM   3007 C C     . HIS G 2 36 ? 11.062  34.580  12.141  1.00 50.98 ? 537 HIS D C     1 
ATOM   3008 O O     . HIS G 2 36 ? 11.973  35.365  11.879  1.00 48.47 ? 537 HIS D O     1 
ATOM   3009 C CB    . HIS G 2 36 ? 9.584   34.146  10.165  1.00 56.68 ? 537 HIS D CB    1 
ATOM   3010 N N     . THR G 2 37 ? 11.219  33.535  12.939  1.00 45.82 ? 538 THR D N     1 
ATOM   3011 C CA    . THR G 2 37 ? 12.494  33.242  13.576  1.00 40.69 ? 538 THR D CA    1 
ATOM   3012 C C     . THR G 2 37 ? 13.372  32.360  12.684  1.00 38.76 ? 538 THR D C     1 
ATOM   3013 O O     . THR G 2 37 ? 12.960  31.940  11.610  1.00 35.36 ? 538 THR D O     1 
ATOM   3014 C CB    . THR G 2 37 ? 12.257  32.514  14.897  1.00 39.38 ? 538 THR D CB    1 
ATOM   3015 O OG1   . THR G 2 37 ? 13.503  32.327  15.576  1.00 46.92 ? 538 THR D OG1   1 
ATOM   3016 C CG2   . THR G 2 37 ? 11.621  31.163  14.643  1.00 34.41 ? 538 THR D CG2   1 
ATOM   3017 N N     . THR G 2 38 ? 14.593  32.100  13.130  1.00 37.41 ? 539 THR D N     1 
ATOM   3018 C CA    . THR G 2 38 ? 15.476  31.233  12.381  1.00 35.42 ? 539 THR D CA    1 
ATOM   3019 C C     . THR G 2 38 ? 14.790  29.867  12.362  1.00 34.54 ? 539 THR D C     1 
ATOM   3020 O O     . THR G 2 38 ? 14.673  29.223  11.315  1.00 31.82 ? 539 THR D O     1 
ATOM   3021 C CB    . THR G 2 38 ? 16.846  31.099  13.071  1.00 36.42 ? 539 THR D CB    1 
ATOM   3022 O OG1   . THR G 2 38 ? 17.629  32.268  12.811  1.00 40.56 ? 539 THR D OG1   1 
ATOM   3023 C CG2   . THR G 2 38 ? 17.593  29.878  12.553  1.00 40.81 ? 539 THR D CG2   1 
ATOM   3024 N N     . LEU G 2 39 ? 14.303  29.441  13.522  1.00 33.68 ? 540 LEU D N     1 
ATOM   3025 C CA    . LEU G 2 39 ? 13.649  28.143  13.618  1.00 34.15 ? 540 LEU D CA    1 
ATOM   3026 C C     . LEU G 2 39 ? 12.427  27.974  12.723  1.00 34.16 ? 540 LEU D C     1 
ATOM   3027 O O     . LEU G 2 39 ? 12.367  27.032  11.938  1.00 34.60 ? 540 LEU D O     1 
ATOM   3028 C CB    . LEU G 2 39 ? 13.257  27.848  15.066  1.00 36.73 ? 540 LEU D CB    1 
ATOM   3029 C CG    . LEU G 2 39 ? 12.707  26.439  15.310  1.00 38.42 ? 540 LEU D CG    1 
ATOM   3030 C CD1   . LEU G 2 39 ? 13.700  25.391  14.812  1.00 37.89 ? 540 LEU D CD1   1 
ATOM   3031 C CD2   . LEU G 2 39 ? 12.455  26.261  16.794  1.00 40.50 ? 540 LEU D CD2   1 
ATOM   3032 N N     . SER G 2 40 ? 11.454  28.876  12.836  1.00 32.13 ? 541 SER D N     1 
ATOM   3033 C CA    . SER G 2 40 ? 10.239  28.772  12.034  1.00 31.51 ? 541 SER D CA    1 
ATOM   3034 C C     . SER G 2 40 ? 10.577  28.709  10.550  1.00 29.75 ? 541 SER D C     1 
ATOM   3035 O O     . SER G 2 40 ? 9.987   27.924  9.815   1.00 31.41 ? 541 SER D O     1 
ATOM   3036 C CB    . SER G 2 40 ? 9.295   29.963  12.292  1.00 33.17 ? 541 SER D CB    1 
ATOM   3037 O OG    . SER G 2 40 ? 9.815   31.163  11.741  1.00 29.79 ? 541 SER D OG    1 
ATOM   3038 N N     . LEU G 2 41 ? 11.523  29.544  10.126  1.00 31.63 ? 542 LEU D N     1 
ATOM   3039 C CA    . LEU G 2 41 ? 11.972  29.608  8.730   1.00 29.76 ? 542 LEU D CA    1 
ATOM   3040 C C     . LEU G 2 41 ? 12.621  28.308  8.260   1.00 28.91 ? 542 LEU D C     1 
ATOM   3041 O O     . LEU G 2 41 ? 12.320  27.823  7.181   1.00 25.88 ? 542 LEU D O     1 
ATOM   3042 C CB    . LEU G 2 41 ? 12.973  30.745  8.554   1.00 29.54 ? 542 LEU D CB    1 
ATOM   3043 C CG    . LEU G 2 41 ? 13.602  30.927  7.175   1.00 32.67 ? 542 LEU D CG    1 
ATOM   3044 C CD1   . LEU G 2 41 ? 12.526  31.003  6.113   1.00 35.15 ? 542 LEU D CD1   1 
ATOM   3045 C CD2   . LEU G 2 41 ? 14.455  32.178  7.179   1.00 37.37 ? 542 LEU D CD2   1 
ATOM   3046 N N     . LEU G 2 42 ? 13.527  27.763  9.065   1.00 29.69 ? 543 LEU D N     1 
ATOM   3047 C CA    . LEU G 2 42 ? 14.191  26.514  8.705   1.00 30.54 ? 543 LEU D CA    1 
ATOM   3048 C C     . LEU G 2 42 ? 13.124  25.445  8.482   1.00 30.97 ? 543 LEU D C     1 
ATOM   3049 O O     . LEU G 2 42 ? 13.193  24.684  7.527   1.00 29.42 ? 543 LEU D O     1 
ATOM   3050 C CB    . LEU G 2 42 ? 15.161  26.085  9.810   1.00 29.35 ? 543 LEU D CB    1 
ATOM   3051 C CG    . LEU G 2 42 ? 16.492  26.841  9.825   1.00 31.04 ? 543 LEU D CG    1 
ATOM   3052 C CD1   . LEU G 2 42 ? 17.424  26.225  10.869  1.00 31.72 ? 543 LEU D CD1   1 
ATOM   3053 C CD2   . LEU G 2 42 ? 17.148  26.760  8.434   1.00 32.04 ? 543 LEU D CD2   1 
ATOM   3054 N N     . THR G 2 43 ? 12.119  25.428  9.355   1.00 32.09 ? 544 THR D N     1 
ATOM   3055 C CA    . THR G 2 43 ? 11.011  24.476  9.279   1.00 33.54 ? 544 THR D CA    1 
ATOM   3056 C C     . THR G 2 43 ? 10.114  24.703  8.067   1.00 34.36 ? 544 THR D C     1 
ATOM   3057 O O     . THR G 2 43 ? 9.809   23.759  7.325   1.00 33.33 ? 544 THR D O     1 
ATOM   3058 C CB    . THR G 2 43 ? 10.135  24.561  10.545  1.00 34.78 ? 544 THR D CB    1 
ATOM   3059 O OG1   . THR G 2 43 ? 10.914  24.175  11.680  1.00 38.53 ? 544 THR D OG1   1 
ATOM   3060 C CG2   . THR G 2 43 ? 8.921   23.669  10.421  1.00 34.36 ? 544 THR D CG2   1 
ATOM   3061 N N     . LYS G 2 44 ? 9.680   25.946  7.868   1.00 34.34 ? 545 LYS D N     1 
ATOM   3062 C CA    . LYS G 2 44 ? 8.826   26.271  6.726   1.00 34.93 ? 545 LYS D CA    1 
ATOM   3063 C C     . LYS G 2 44 ? 9.527   25.886  5.432   1.00 34.00 ? 545 LYS D C     1 
ATOM   3064 O O     . LYS G 2 44 ? 8.914   25.316  4.526   1.00 34.36 ? 545 LYS D O     1 
ATOM   3065 C CB    . LYS G 2 44 ? 8.533   27.775  6.651   1.00 38.86 ? 545 LYS D CB    1 
ATOM   3066 C CG    . LYS G 2 44 ? 7.783   28.371  7.825   1.00 44.54 ? 545 LYS D CG    1 
ATOM   3067 C CD    . LYS G 2 44 ? 7.673   29.910  7.677   1.00 47.36 ? 545 LYS D CD    1 
ATOM   3068 C CE    . LYS G 2 44 ? 9.048   30.578  7.625   1.00 46.90 ? 545 LYS D CE    1 
ATOM   3069 N NZ    . LYS G 2 44 ? 9.014   32.072  7.532   1.00 49.09 ? 545 LYS D NZ    1 
ATOM   3070 N N     . ALA G 2 45 ? 10.809  26.233  5.348   1.00 30.72 ? 546 ALA D N     1 
ATOM   3071 C CA    . ALA G 2 45 ? 11.612  25.952  4.160   1.00 31.97 ? 546 ALA D CA    1 
ATOM   3072 C C     . ALA G 2 45 ? 11.564  24.458  3.822   1.00 30.14 ? 546 ALA D C     1 
ATOM   3073 O O     . ALA G 2 45 ? 11.316  24.087  2.677   1.00 29.96 ? 546 ALA D O     1 
ATOM   3074 C CB    . ALA G 2 45 ? 13.047  26.412  4.379   1.00 30.04 ? 546 ALA D CB    1 
ATOM   3075 N N     . LYS G 2 46 ? 11.778  23.604  4.818   1.00 30.67 ? 547 LYS D N     1 
ATOM   3076 C CA    . LYS G 2 46 ? 11.712  22.171  4.570   1.00 32.99 ? 547 LYS D CA    1 
ATOM   3077 C C     . LYS G 2 46 ? 10.358  21.797  3.981   1.00 32.64 ? 547 LYS D C     1 
ATOM   3078 O O     . LYS G 2 46 ? 10.281  21.254  2.883   1.00 32.18 ? 547 LYS D O     1 
ATOM   3079 C CB    . LYS G 2 46 ? 11.929  21.362  5.845   1.00 33.78 ? 547 LYS D CB    1 
ATOM   3080 C CG    . LYS G 2 46 ? 11.916  19.862  5.563   1.00 37.01 ? 547 LYS D CG    1 
ATOM   3081 C CD    . LYS G 2 46 ? 11.851  19.001  6.821   1.00 39.16 ? 547 LYS D CD    1 
ATOM   3082 C CE    . LYS G 2 46 ? 11.793  17.516  6.433   1.00 44.25 ? 547 LYS D CE    1 
ATOM   3083 N NZ    . LYS G 2 46 ? 11.625  16.582  7.582   1.00 44.70 ? 547 LYS D NZ    1 
ATOM   3084 N N     . LEU G 2 47 ? 9.284   22.103  4.705   1.00 32.63 ? 548 LEU D N     1 
ATOM   3085 C CA    . LEU G 2 47 ? 7.942   21.782  4.241   1.00 30.96 ? 548 LEU D CA    1 
ATOM   3086 C C     . LEU G 2 47 ? 7.612   22.402  2.883   1.00 28.91 ? 548 LEU D C     1 
ATOM   3087 O O     . LEU G 2 47 ? 6.876   21.813  2.092   1.00 29.40 ? 548 LEU D O     1 
ATOM   3088 C CB    . LEU G 2 47 ? 6.912   22.210  5.290   1.00 33.37 ? 548 LEU D CB    1 
ATOM   3089 C CG    . LEU G 2 47 ? 7.253   21.764  6.719   1.00 33.51 ? 548 LEU D CG    1 
ATOM   3090 C CD1   . LEU G 2 47 ? 6.077   22.080  7.644   1.00 38.21 ? 548 LEU D CD1   1 
ATOM   3091 C CD2   . LEU G 2 47 ? 7.558   20.278  6.750   1.00 38.56 ? 548 LEU D CD2   1 
ATOM   3092 N N     . HIS G 2 48 ? 8.155   23.580  2.597   1.00 29.47 ? 549 HIS D N     1 
ATOM   3093 C CA    . HIS G 2 48 ? 7.887   24.198  1.299   1.00 28.41 ? 549 HIS D CA    1 
ATOM   3094 C C     . HIS G 2 48 ? 8.536   23.363  0.195   1.00 28.48 ? 549 HIS D C     1 
ATOM   3095 O O     . HIS G 2 48 ? 7.956   23.157  -0.869  1.00 29.49 ? 549 HIS D O     1 
ATOM   3096 C CB    . HIS G 2 48 ? 8.434   25.620  1.227   1.00 29.39 ? 549 HIS D CB    1 
ATOM   3097 C CG    . HIS G 2 48 ? 8.025   26.349  -0.018  1.00 30.41 ? 549 HIS D CG    1 
ATOM   3098 N ND1   . HIS G 2 48 ? 6.731   26.336  -0.489  1.00 32.12 ? 549 HIS D ND1   1 
ATOM   3099 C CD2   . HIS G 2 48 ? 8.730   27.117  -0.883  1.00 34.10 ? 549 HIS D CD2   1 
ATOM   3100 C CE1   . HIS G 2 48 ? 6.655   27.064  -1.590  1.00 33.85 ? 549 HIS D CE1   1 
ATOM   3101 N NE2   . HIS G 2 48 ? 7.854   27.550  -1.851  1.00 32.07 ? 549 HIS D NE2   1 
ATOM   3102 N N     . ILE G 2 49 ? 9.755   22.902  0.439   1.00 28.03 ? 550 ILE D N     1 
ATOM   3103 C CA    . ILE G 2 49 ? 10.425  22.073  -0.550  1.00 31.42 ? 550 ILE D CA    1 
ATOM   3104 C C     . ILE G 2 49 ? 9.559   20.834  -0.758  1.00 32.77 ? 550 ILE D C     1 
ATOM   3105 O O     . ILE G 2 49 ? 9.277   20.456  -1.897  1.00 33.48 ? 550 ILE D O     1 
ATOM   3106 C CB    . ILE G 2 49 ? 11.861  21.684  -0.086  1.00 31.33 ? 550 ILE D CB    1 
ATOM   3107 C CG1   . ILE G 2 49 ? 12.803  22.878  -0.287  1.00 29.09 ? 550 ILE D CG1   1 
ATOM   3108 C CG2   . ILE G 2 49 ? 12.382  20.475  -0.896  1.00 30.43 ? 550 ILE D CG2   1 
ATOM   3109 C CD1   . ILE G 2 49 ? 14.181  22.739  0.398   1.00 29.56 ? 550 ILE D CD1   1 
ATOM   3110 N N     . LYS G 2 50 ? 9.091   20.231  0.338   1.00 33.59 ? 551 LYS D N     1 
ATOM   3111 C CA    . LYS G 2 50 ? 8.262   19.032  0.231   1.00 35.25 ? 551 LYS D CA    1 
ATOM   3112 C C     . LYS G 2 50 ? 7.015   19.285  -0.598  1.00 36.68 ? 551 LYS D C     1 
ATOM   3113 O O     . LYS G 2 50 ? 6.622   18.433  -1.407  1.00 34.93 ? 551 LYS D O     1 
ATOM   3114 C CB    . LYS G 2 50 ? 7.875   18.499  1.618   1.00 38.03 ? 551 LYS D CB    1 
ATOM   3115 C CG    . LYS G 2 50 ? 8.793   17.393  2.147   1.00 37.97 ? 551 LYS D CG    1 
ATOM   3116 C CD    . LYS G 2 50 ? 10.215  17.866  2.334   1.00 43.62 ? 551 LYS D CD    1 
ATOM   3117 C CE    . LYS G 2 50 ? 11.095  16.788  2.989   1.00 44.20 ? 551 LYS D CE    1 
ATOM   3118 N NZ    . LYS G 2 50 ? 11.446  15.658  2.078   1.00 45.32 ? 551 LYS D NZ    1 
ATOM   3119 N N     . LYS G 2 51 ? 6.414   20.463  -0.416  1.00 33.84 ? 552 LYS D N     1 
ATOM   3120 C CA    . LYS G 2 51 ? 5.219   20.839  -1.154  1.00 34.42 ? 552 LYS D CA    1 
ATOM   3121 C C     . LYS G 2 51 ? 5.523   20.988  -2.642  1.00 34.35 ? 552 LYS D C     1 
ATOM   3122 O O     . LYS G 2 51 ? 4.778   20.486  -3.477  1.00 34.00 ? 552 LYS D O     1 
ATOM   3123 C CB    . LYS G 2 51 ? 4.656   22.169  -0.633  1.00 35.61 ? 552 LYS D CB    1 
ATOM   3124 C CG    . LYS G 2 51 ? 3.174   22.392  -0.947  1.00 37.33 ? 552 LYS D CG    1 
ATOM   3125 C CD    . LYS G 2 51 ? 2.878   22.543  -2.422  1.00 39.18 ? 552 LYS D CD    1 
ATOM   3126 C CE    . LYS G 2 51 ? 1.411   22.937  -2.675  1.00 39.42 ? 552 LYS D CE    1 
ATOM   3127 N NZ    . LYS G 2 51 ? 0.416   21.907  -2.260  1.00 40.05 ? 552 LYS D NZ    1 
ATOM   3128 N N     . LEU G 2 52 ? 6.595   21.708  -2.966  1.00 34.25 ? 553 LEU D N     1 
ATOM   3129 C CA    . LEU G 2 52 ? 6.975   21.912  -4.363  1.00 35.41 ? 553 LEU D CA    1 
ATOM   3130 C C     . LEU G 2 52 ? 7.185   20.553  -5.050  1.00 36.88 ? 553 LEU D C     1 
ATOM   3131 O O     . LEU G 2 52 ? 6.623   20.306  -6.116  1.00 36.53 ? 553 LEU D O     1 
ATOM   3132 C CB    . LEU G 2 52 ? 8.254   22.767  -4.461  1.00 35.27 ? 553 LEU D CB    1 
ATOM   3133 C CG    . LEU G 2 52 ? 8.150   24.276  -4.170  1.00 35.47 ? 553 LEU D CG    1 
ATOM   3134 C CD1   . LEU G 2 52 ? 9.535   24.880  -4.039  1.00 31.65 ? 553 LEU D CD1   1 
ATOM   3135 C CD2   . LEU G 2 52 ? 7.365   24.971  -5.289  1.00 35.79 ? 553 LEU D CD2   1 
ATOM   3136 N N     . GLU G 2 53 ? 7.982   19.679  -4.432  1.00 36.80 ? 554 GLU D N     1 
ATOM   3137 C CA    . GLU G 2 53 ? 8.244   18.351  -4.991  1.00 37.52 ? 554 GLU D CA    1 
ATOM   3138 C C     . GLU G 2 53 ? 6.930   17.604  -5.213  1.00 39.01 ? 554 GLU D C     1 
ATOM   3139 O O     . GLU G 2 53 ? 6.792   16.837  -6.172  1.00 40.41 ? 554 GLU D O     1 
ATOM   3140 C CB    . GLU G 2 53 ? 9.143   17.526  -4.055  1.00 36.95 ? 554 GLU D CB    1 
ATOM   3141 C CG    . GLU G 2 53 ? 10.467  18.180  -3.724  1.00 35.94 ? 554 GLU D CG    1 
ATOM   3142 C CD    . GLU G 2 53 ? 11.363  17.315  -2.850  1.00 37.79 ? 554 GLU D CD    1 
ATOM   3143 O OE1   . GLU G 2 53 ? 10.835  16.588  -1.979  1.00 40.83 ? 554 GLU D OE1   1 
ATOM   3144 O OE2   . GLU G 2 53 ? 12.601  17.373  -3.026  1.00 37.24 ? 554 GLU D OE2   1 
ATOM   3145 N N     . ASP G 2 54 ? 5.960   17.838  -4.335  1.00 38.72 ? 555 ASP D N     1 
ATOM   3146 C CA    . ASP G 2 54 ? 4.669   17.173  -4.448  1.00 40.41 ? 555 ASP D CA    1 
ATOM   3147 C C     . ASP G 2 54 ? 3.891   17.661  -5.665  1.00 40.37 ? 555 ASP D C     1 
ATOM   3148 O O     . ASP G 2 54 ? 3.258   16.865  -6.369  1.00 39.48 ? 555 ASP D O     1 
ATOM   3149 C CB    . ASP G 2 54 ? 3.837   17.385  -3.176  1.00 40.96 ? 555 ASP D CB    1 
ATOM   3150 C CG    . ASP G 2 54 ? 2.525   16.619  -3.211  1.00 43.70 ? 555 ASP D CG    1 
ATOM   3151 O OD1   . ASP G 2 54 ? 1.470   17.232  -3.492  1.00 44.04 ? 555 ASP D OD1   1 
ATOM   3152 O OD2   . ASP G 2 54 ? 2.549   15.393  -2.971  1.00 45.77 ? 555 ASP D OD2   1 
ATOM   3153 N N     . SER G 2 55 ? 3.932   18.968  -5.905  1.00 39.85 ? 556 SER D N     1 
ATOM   3154 C CA    . SER G 2 55 ? 3.248   19.561  -7.053  1.00 38.94 ? 556 SER D CA    1 
ATOM   3155 C C     . SER G 2 55 ? 3.960   19.168  -8.340  1.00 40.35 ? 556 SER D C     1 
ATOM   3156 O O     . SER G 2 55 ? 3.347   19.118  -9.410  1.00 40.80 ? 556 SER D O     1 
ATOM   3157 C CB    . SER G 2 55 ? 3.216   21.080  -6.925  1.00 38.02 ? 556 SER D CB    1 
ATOM   3158 O OG    . SER G 2 55 ? 2.431   21.461  -5.811  1.00 38.99 ? 556 SER D OG    1 
ATOM   3159 N N     . ASP G 2 56 ? 5.258   18.896  -8.243  1.00 41.15 ? 557 ASP D N     1 
ATOM   3160 C CA    . ASP G 2 56 ? 6.013   18.484  -9.417  1.00 43.93 ? 557 ASP D CA    1 
ATOM   3161 C C     . ASP G 2 56 ? 5.628   17.056  -9.844  1.00 44.02 ? 557 ASP D C     1 
ATOM   3162 O O     . ASP G 2 56 ? 5.478   16.783  -11.035 1.00 44.71 ? 557 ASP D O     1 
ATOM   3163 C CB    . ASP G 2 56 ? 7.514   18.582  -9.148  1.00 44.78 ? 557 ASP D CB    1 
ATOM   3164 C CG    . ASP G 2 56 ? 8.341   18.257  -10.371 1.00 50.04 ? 557 ASP D CG    1 
ATOM   3165 O OD1   . ASP G 2 56 ? 8.630   17.061  -10.592 1.00 50.87 ? 557 ASP D OD1   1 
ATOM   3166 O OD2   . ASP G 2 56 ? 8.689   19.197  -11.121 1.00 52.48 ? 557 ASP D OD2   1 
ATOM   3167 N N     . ARG G 2 57 ? 5.459   16.146  -8.884  1.00 43.80 ? 558 ARG D N     1 
ATOM   3168 C CA    . ARG G 2 57 ? 5.061   14.770  -9.218  1.00 44.80 ? 558 ARG D CA    1 
ATOM   3169 C C     . ARG G 2 57 ? 3.620   14.773  -9.725  1.00 45.00 ? 558 ARG D C     1 
ATOM   3170 O O     . ARG G 2 57 ? 3.249   13.990  -10.607 1.00 43.97 ? 558 ARG D O     1 
ATOM   3171 C CB    . ARG G 2 57 ? 5.172   13.859  -7.992  1.00 44.89 ? 558 ARG D CB    1 
ATOM   3172 C CG    . ARG G 2 57 ? 6.526   13.209  -7.816  1.00 48.08 ? 558 ARG D CG    1 
ATOM   3173 C CD    . ARG G 2 57 ? 6.854   13.058  -6.347  1.00 49.36 ? 558 ARG D CD    1 
ATOM   3174 N NE    . ARG G 2 57 ? 5.692   12.611  -5.588  1.00 52.93 ? 558 ARG D NE    1 
ATOM   3175 C CZ    . ARG G 2 57 ? 5.488   12.898  -4.305  1.00 54.02 ? 558 ARG D CZ    1 
ATOM   3176 N NH1   . ARG G 2 57 ? 6.375   13.631  -3.635  1.00 51.61 ? 558 ARG D NH1   1 
ATOM   3177 N NH2   . ARG G 2 57 ? 4.390   12.469  -3.696  1.00 53.36 ? 558 ARG D NH2   1 
ATOM   3178 N N     . LYS G 2 58 ? 2.816   15.666  -9.155  1.00 44.53 ? 559 LYS D N     1 
ATOM   3179 C CA    . LYS G 2 58 ? 1.421   15.818  -9.536  1.00 44.01 ? 559 LYS D CA    1 
ATOM   3180 C C     . LYS G 2 58 ? 1.340   16.356  -10.970 1.00 43.42 ? 559 LYS D C     1 
ATOM   3181 O O     . LYS G 2 58 ? 0.524   15.901  -11.774 1.00 40.01 ? 559 LYS D O     1 
ATOM   3182 C CB    . LYS G 2 58 ? 0.727   16.796  -8.579  1.00 45.29 ? 559 LYS D CB    1 
ATOM   3183 C CG    . LYS G 2 58 ? -0.779  16.915  -8.770  1.00 48.66 ? 559 LYS D CG    1 
ATOM   3184 C CD    . LYS G 2 58 ? -1.371  17.985  -7.855  1.00 51.68 ? 559 LYS D CD    1 
ATOM   3185 C CE    . LYS G 2 58 ? -2.887  18.089  -7.986  1.00 52.43 ? 559 LYS D CE    1 
ATOM   3186 N NZ    . LYS G 2 58 ? -3.613  16.990  -7.280  1.00 56.40 ? 559 LYS D NZ    1 
ATOM   3187 N N     . ALA G 2 59 ? 2.182   17.335  -11.281 1.00 42.43 ? 560 ALA D N     1 
ATOM   3188 C CA    . ALA G 2 59 ? 2.193   17.925  -12.613 1.00 43.90 ? 560 ALA D CA    1 
ATOM   3189 C C     . ALA G 2 59 ? 2.611   16.878  -13.639 1.00 43.89 ? 560 ALA D C     1 
ATOM   3190 O O     . ALA G 2 59 ? 1.972   16.732  -14.676 1.00 44.48 ? 560 ALA D O     1 
ATOM   3191 C CB    . ALA G 2 59 ? 3.146   19.123  -12.654 1.00 44.52 ? 560 ALA D CB    1 
ATOM   3192 N N     . VAL G 2 60 ? 3.678   16.144  -13.340 1.00 45.64 ? 561 VAL D N     1 
ATOM   3193 C CA    . VAL G 2 60 ? 4.170   15.102  -14.239 1.00 46.56 ? 561 VAL D CA    1 
ATOM   3194 C C     . VAL G 2 60 ? 3.085   14.054  -14.509 1.00 47.35 ? 561 VAL D C     1 
ATOM   3195 O O     . VAL G 2 60 ? 2.978   13.534  -15.624 1.00 46.16 ? 561 VAL D O     1 
ATOM   3196 C CB    . VAL G 2 60 ? 5.439   14.421  -13.656 1.00 46.34 ? 561 VAL D CB    1 
ATOM   3197 C CG1   . VAL G 2 60 ? 5.742   13.127  -14.397 1.00 46.35 ? 561 VAL D CG1   1 
ATOM   3198 C CG2   . VAL G 2 60 ? 6.621   15.366  -13.772 1.00 45.40 ? 561 VAL D CG2   1 
ATOM   3199 N N     . HIS G 2 61 ? 2.281   13.748  -13.492 1.00 47.30 ? 562 HIS D N     1 
ATOM   3200 C CA    . HIS G 2 61 ? 1.196   12.781  -13.645 1.00 48.65 ? 562 HIS D CA    1 
ATOM   3201 C C     . HIS G 2 61 ? 0.109   13.403  -14.522 1.00 49.19 ? 562 HIS D C     1 
ATOM   3202 O O     . HIS G 2 61 ? -0.548  12.721  -15.310 1.00 49.16 ? 562 HIS D O     1 
ATOM   3203 C CB    . HIS G 2 61 ? 0.615   12.402  -12.275 1.00 47.64 ? 562 HIS D CB    1 
ATOM   3204 C CG    . HIS G 2 61 ? -0.716  11.720  -12.351 1.00 48.02 ? 562 HIS D CG    1 
ATOM   3205 N ND1   . HIS G 2 61 ? -0.961  10.653  -13.190 1.00 49.90 ? 562 HIS D ND1   1 
ATOM   3206 C CD2   . HIS G 2 61 ? -1.873  11.946  -11.684 1.00 48.72 ? 562 HIS D CD2   1 
ATOM   3207 C CE1   . HIS G 2 61 ? -2.211  10.252  -13.035 1.00 50.76 ? 562 HIS D CE1   1 
ATOM   3208 N NE2   . HIS G 2 61 ? -2.786  11.021  -12.127 1.00 50.64 ? 562 HIS D NE2   1 
ATOM   3209 N N     . GLN G 2 62 ? -0.069  14.708  -14.370 1.00 49.39 ? 563 GLN D N     1 
ATOM   3210 C CA    . GLN G 2 62 ? -1.043  15.465  -15.149 1.00 49.87 ? 563 GLN D CA    1 
ATOM   3211 C C     . GLN G 2 62 ? -0.713  15.345  -16.641 1.00 48.13 ? 563 GLN D C     1 
ATOM   3212 O O     . GLN G 2 62 ? -1.558  14.972  -17.453 1.00 46.71 ? 563 GLN D O     1 
ATOM   3213 C CB    . GLN G 2 62 ? -0.983  16.931  -14.732 1.00 51.94 ? 563 GLN D CB    1 
ATOM   3214 C CG    . GLN G 2 62 ? -1.726  17.878  -15.656 1.00 56.78 ? 563 GLN D CG    1 
ATOM   3215 C CD    . GLN G 2 62 ? -3.219  17.742  -15.530 1.00 58.53 ? 563 GLN D CD    1 
ATOM   3216 O OE1   . GLN G 2 62 ? -3.769  16.655  -15.712 1.00 60.92 ? 563 GLN D OE1   1 
ATOM   3217 N NE2   . GLN G 2 62 ? -3.891  18.847  -15.214 1.00 58.07 ? 563 GLN D NE2   1 
ATOM   3218 N N     . ILE G 2 63 ? 0.525   15.676  -16.988 1.00 47.75 ? 564 ILE D N     1 
ATOM   3219 C CA    . ILE G 2 63 ? 0.985   15.610  -18.372 1.00 48.83 ? 564 ILE D CA    1 
ATOM   3220 C C     . ILE G 2 63 ? 0.772   14.205  -18.932 1.00 49.29 ? 564 ILE D C     1 
ATOM   3221 O O     . ILE G 2 63 ? 0.280   14.029  -20.048 1.00 48.86 ? 564 ILE D O     1 
ATOM   3222 C CB    . ILE G 2 63 ? 2.477   15.996  -18.458 1.00 48.63 ? 564 ILE D CB    1 
ATOM   3223 C CG1   . ILE G 2 63 ? 2.632   17.489  -18.136 1.00 48.36 ? 564 ILE D CG1   1 
ATOM   3224 C CG2   . ILE G 2 63 ? 3.041   15.657  -19.839 1.00 48.80 ? 564 ILE D CG2   1 
ATOM   3225 C CD1   . ILE G 2 63 ? 4.070   17.940  -17.914 1.00 48.12 ? 564 ILE D CD1   1 
ATOM   3226 N N     . ASP G 2 64 ? 1.128   13.203  -18.141 1.00 49.81 ? 565 ASP D N     1 
ATOM   3227 C CA    . ASP G 2 64 ? 0.962   11.820  -18.560 1.00 50.45 ? 565 ASP D CA    1 
ATOM   3228 C C     . ASP G 2 64 ? -0.473  11.529  -18.996 1.00 50.43 ? 565 ASP D C     1 
ATOM   3229 O O     . ASP G 2 64 ? -0.710  10.970  -20.067 1.00 49.53 ? 565 ASP D O     1 
ATOM   3230 C CB    . ASP G 2 64 ? 1.346   10.884  -17.415 1.00 52.43 ? 565 ASP D CB    1 
ATOM   3231 C CG    . ASP G 2 64 ? 0.959   9.444   -17.685 1.00 55.96 ? 565 ASP D CG    1 
ATOM   3232 O OD1   . ASP G 2 64 ? -0.249  9.178   -17.850 1.00 57.97 ? 565 ASP D OD1   1 
ATOM   3233 O OD2   . ASP G 2 64 ? 1.860   8.575   -17.735 1.00 57.62 ? 565 ASP D OD2   1 
ATOM   3234 N N     . GLN G 2 65 ? -1.431  11.921  -18.163 1.00 50.05 ? 566 GLN D N     1 
ATOM   3235 C CA    . GLN G 2 65 ? -2.838  11.675  -18.447 1.00 51.19 ? 566 GLN D CA    1 
ATOM   3236 C C     . GLN G 2 65 ? -3.383  12.428  -19.650 1.00 50.95 ? 566 GLN D C     1 
ATOM   3237 O O     . GLN G 2 65 ? -4.313  11.959  -20.311 1.00 49.53 ? 566 GLN D O     1 
ATOM   3238 C CB    . GLN G 2 65 ? -3.672  11.994  -17.208 1.00 52.56 ? 566 GLN D CB    1 
ATOM   3239 C CG    . GLN G 2 65 ? -3.190  11.249  -15.966 1.00 57.01 ? 566 GLN D CG    1 
ATOM   3240 C CD    . GLN G 2 65 ? -2.970  9.758   -16.212 1.00 59.08 ? 566 GLN D CD    1 
ATOM   3241 O OE1   . GLN G 2 65 ? -3.865  9.057   -16.690 1.00 61.01 ? 566 GLN D OE1   1 
ATOM   3242 N NE2   . GLN G 2 65 ? -1.776  9.270   -15.879 1.00 59.93 ? 566 GLN D NE2   1 
ATOM   3243 N N     . LEU G 2 66 ? -2.819  13.597  -19.930 1.00 50.87 ? 567 LEU D N     1 
ATOM   3244 C CA    . LEU G 2 66 ? -3.258  14.385  -21.074 1.00 50.61 ? 567 LEU D CA    1 
ATOM   3245 C C     . LEU G 2 66 ? -2.731  13.737  -22.352 1.00 51.37 ? 567 LEU D C     1 
ATOM   3246 O O     . LEU G 2 66 ? -3.401  13.744  -23.388 1.00 51.46 ? 567 LEU D O     1 
ATOM   3247 C CB    . LEU G 2 66 ? -2.756  15.826  -20.949 1.00 50.78 ? 567 LEU D CB    1 
ATOM   3248 C CG    . LEU G 2 66 ? -3.514  16.667  -19.912 1.00 50.22 ? 567 LEU D CG    1 
ATOM   3249 C CD1   . LEU G 2 66 ? -2.805  17.997  -19.681 1.00 49.66 ? 567 LEU D CD1   1 
ATOM   3250 C CD2   . LEU G 2 66 ? -4.940  16.892  -20.392 1.00 50.40 ? 567 LEU D CD2   1 
ATOM   3251 N N     . GLN G 2 67 ? -1.531  13.169  -22.273 1.00 50.83 ? 568 GLN D N     1 
ATOM   3252 C CA    . GLN G 2 67 ? -0.942  12.499  -23.425 1.00 53.21 ? 568 GLN D CA    1 
ATOM   3253 C C     . GLN G 2 67 ? -1.715  11.202  -23.690 1.00 55.00 ? 568 GLN D C     1 
ATOM   3254 O O     . GLN G 2 67 ? -2.055  10.888  -24.828 1.00 54.72 ? 568 GLN D O     1 
ATOM   3255 C CB    . GLN G 2 67 ? 0.541   12.191  -23.167 1.00 50.93 ? 568 GLN D CB    1 
ATOM   3256 C CG    . GLN G 2 67 ? 1.398   13.424  -22.914 1.00 47.94 ? 568 GLN D CG    1 
ATOM   3257 C CD    . GLN G 2 67 ? 2.866   13.091  -22.682 1.00 47.05 ? 568 GLN D CD    1 
ATOM   3258 O OE1   . GLN G 2 67 ? 3.200   12.038  -22.135 1.00 43.42 ? 568 GLN D OE1   1 
ATOM   3259 N NE2   . GLN G 2 67 ? 3.748   14.002  -23.081 1.00 44.70 ? 568 GLN D NE2   1 
ATOM   3260 N N     . ARG G 2 68 ? -1.993  10.458  -22.623 1.00 57.22 ? 569 ARG D N     1 
ATOM   3261 C CA    . ARG G 2 68 ? -2.734  9.209   -22.721 1.00 59.34 ? 569 ARG D CA    1 
ATOM   3262 C C     . ARG G 2 68 ? -4.101  9.513   -23.323 1.00 60.39 ? 569 ARG D C     1 
ATOM   3263 O O     . ARG G 2 68 ? -4.718  8.655   -23.954 1.00 60.97 ? 569 ARG D O     1 
ATOM   3264 C CB    . ARG G 2 68 ? -2.914  8.596   -21.333 1.00 60.44 ? 569 ARG D CB    1 
ATOM   3265 C CG    . ARG G 2 68 ? -3.372  7.151   -21.336 1.00 62.91 ? 569 ARG D CG    1 
ATOM   3266 C CD    . ARG G 2 68 ? -4.079  6.806   -20.029 1.00 65.67 ? 569 ARG D CD    1 
ATOM   3267 N NE    . ARG G 2 68 ? -3.310  7.201   -18.850 1.00 66.72 ? 569 ARG D NE    1 
ATOM   3268 C CZ    . ARG G 2 68 ? -2.164  6.639   -18.475 1.00 67.82 ? 569 ARG D CZ    1 
ATOM   3269 N NH1   . ARG G 2 68 ? -1.644  5.647   -19.187 1.00 67.80 ? 569 ARG D NH1   1 
ATOM   3270 N NH2   . ARG G 2 68 ? -1.541  7.067   -17.386 1.00 66.54 ? 569 ARG D NH2   1 
ATOM   3271 N N     . GLU G 2 69 ? -4.565  10.742  -23.119 1.00 61.62 ? 570 GLU D N     1 
ATOM   3272 C CA    . GLU G 2 69 ? -5.855  11.186  -23.635 1.00 62.87 ? 570 GLU D CA    1 
ATOM   3273 C C     . GLU G 2 69 ? -5.723  11.654  -25.078 1.00 63.43 ? 570 GLU D C     1 
ATOM   3274 O O     . GLU G 2 69 ? -6.621  11.445  -25.893 1.00 62.74 ? 570 GLU D O     1 
ATOM   3275 C CB    . GLU G 2 69 ? -6.411  12.330  -22.775 1.00 62.83 ? 570 GLU D CB    1 
ATOM   3276 C CG    . GLU G 2 69 ? -7.631  13.032  -23.374 1.00 63.96 ? 570 GLU D CG    1 
ATOM   3277 C CD    . GLU G 2 69 ? -8.136  14.186  -22.513 1.00 65.79 ? 570 GLU D CD    1 
ATOM   3278 O OE1   . GLU G 2 69 ? -8.677  13.928  -21.414 1.00 64.43 ? 570 GLU D OE1   1 
ATOM   3279 O OE2   . GLU G 2 69 ? -7.985  15.356  -22.933 1.00 65.98 ? 570 GLU D OE2   1 
ATOM   3280 N N     . GLN G 2 70 ? -4.601  12.293  -25.390 1.00 64.53 ? 571 GLN D N     1 
ATOM   3281 C CA    . GLN G 2 70 ? -4.365  12.784  -26.741 1.00 65.97 ? 571 GLN D CA    1 
ATOM   3282 C C     . GLN G 2 70 ? -4.221  11.600  -27.693 1.00 67.36 ? 571 GLN D C     1 
ATOM   3283 O O     . GLN G 2 70 ? -4.751  11.609  -28.808 1.00 66.96 ? 571 GLN D O     1 
ATOM   3284 C CB    . GLN G 2 70 ? -3.098  13.635  -26.773 1.00 66.56 ? 571 GLN D CB    1 
ATOM   3285 C CG    . GLN G 2 70 ? -2.961  14.492  -28.017 1.00 67.70 ? 571 GLN D CG    1 
ATOM   3286 C CD    . GLN G 2 70 ? -1.740  15.384  -27.971 1.00 68.85 ? 571 GLN D CD    1 
ATOM   3287 O OE1   . GLN G 2 70 ? -0.610  14.918  -28.117 1.00 70.52 ? 571 GLN D OE1   1 
ATOM   3288 N NE2   . GLN G 2 70 ? -1.959  16.675  -27.755 1.00 68.14 ? 571 GLN D NE2   1 
ATOM   3289 N N     . ARG G 2 71 ? -3.499  10.578  -27.243 1.00 68.60 ? 572 ARG D N     1 
ATOM   3290 C CA    . ARG G 2 71 ? -3.297  9.381   -28.046 1.00 70.11 ? 572 ARG D CA    1 
ATOM   3291 C C     . ARG G 2 71 ? -4.631  8.660   -28.225 1.00 70.59 ? 572 ARG D C     1 
ATOM   3292 O O     . ARG G 2 71 ? -4.822  7.915   -29.185 1.00 71.01 ? 572 ARG D O     1 
ATOM   3293 C CB    . ARG G 2 71 ? -2.268  8.458   -27.377 1.00 69.92 ? 572 ARG D CB    1 
ATOM   3294 C CG    . ARG G 2 71 ? -0.883  9.095   -27.242 1.00 70.97 ? 572 ARG D CG    1 
ATOM   3295 C CD    . ARG G 2 71 ? 0.223   8.088   -26.932 1.00 71.24 ? 572 ARG D CD    1 
ATOM   3296 N NE    . ARG G 2 71 ? 0.481   7.927   -25.501 1.00 71.22 ? 572 ARG D NE    1 
ATOM   3297 C CZ    . ARG G 2 71 ? -0.296  7.247   -24.665 1.00 71.11 ? 572 ARG D CZ    1 
ATOM   3298 N NH1   . ARG G 2 71 ? -1.397  6.653   -25.107 1.00 71.68 ? 572 ARG D NH1   1 
ATOM   3299 N NH2   . ARG G 2 71 ? 0.036   7.151   -23.385 1.00 70.18 ? 572 ARG D NH2   1 
ATOM   3300 N N     . HIS G 2 72 ? -5.555  8.899   -27.300 1.00 71.17 ? 573 HIS D N     1 
ATOM   3301 C CA    . HIS G 2 72 ? -6.873  8.279   -27.355 1.00 72.51 ? 573 HIS D CA    1 
ATOM   3302 C C     . HIS G 2 72 ? -7.714  8.915   -28.455 1.00 73.12 ? 573 HIS D C     1 
ATOM   3303 O O     . HIS G 2 72 ? -8.190  8.226   -29.359 1.00 73.13 ? 573 HIS D O     1 
ATOM   3304 C CB    . HIS G 2 72 ? -7.592  8.434   -26.014 1.00 73.59 ? 573 HIS D CB    1 
ATOM   3305 C CG    . HIS G 2 72 ? -8.956  7.818   -25.985 1.00 74.60 ? 573 HIS D CG    1 
ATOM   3306 N ND1   . HIS G 2 72 ? -9.160  6.458   -26.067 1.00 74.99 ? 573 HIS D ND1   1 
ATOM   3307 C CD2   . HIS G 2 72 ? -10.185 8.378   -25.889 1.00 75.18 ? 573 HIS D CD2   1 
ATOM   3308 C CE1   . HIS G 2 72 ? -10.456 6.205   -26.024 1.00 75.37 ? 573 HIS D CE1   1 
ATOM   3309 N NE2   . HIS G 2 72 ? -11.100 7.354   -25.916 1.00 75.99 ? 573 HIS D NE2   1 
ATOM   3310 N N     . LEU G 2 73 ? -7.896  10.231  -28.365 1.00 73.37 ? 574 LEU D N     1 
ATOM   3311 C CA    . LEU G 2 73 ? -8.676  10.971  -29.350 1.00 73.88 ? 574 LEU D CA    1 
ATOM   3312 C C     . LEU G 2 73 ? -8.203  10.641  -30.757 1.00 74.56 ? 574 LEU D C     1 
ATOM   3313 O O     . LEU G 2 73 ? -9.008  10.325  -31.635 1.00 74.69 ? 574 LEU D O     1 
ATOM   3314 C CB    . LEU G 2 73 ? -8.552  12.480  -29.111 1.00 73.40 ? 574 LEU D CB    1 
ATOM   3315 C CG    . LEU G 2 73 ? -9.311  13.069  -27.921 1.00 72.90 ? 574 LEU D CG    1 
ATOM   3316 C CD1   . LEU G 2 73 ? -8.989  14.546  -27.780 1.00 72.89 ? 574 LEU D CD1   1 
ATOM   3317 C CD2   . LEU G 2 73 ? -10.800 12.869  -28.125 1.00 72.21 ? 574 LEU D CD2   1 
ATOM   3318 N N     . LYS G 2 74 ? -6.892  10.717  -30.968 1.00 74.84 ? 575 LYS D N     1 
ATOM   3319 C CA    . LYS G 2 74 ? -6.321  10.422  -32.273 1.00 75.30 ? 575 LYS D CA    1 
ATOM   3320 C C     . LYS G 2 74 ? -6.697  9.012   -32.722 1.00 75.03 ? 575 LYS D C     1 
ATOM   3321 O O     . LYS G 2 74 ? -7.119  8.809   -33.861 1.00 75.01 ? 575 LYS D O     1 
ATOM   3322 C CB    . LYS G 2 74 ? -4.798  10.585  -32.237 1.00 75.89 ? 575 LYS D CB    1 
ATOM   3323 C CG    . LYS G 2 74 ? -4.337  12.041  -32.208 1.00 76.90 ? 575 LYS D CG    1 
ATOM   3324 C CD    . LYS G 2 74 ? -2.818  12.150  -32.280 1.00 78.12 ? 575 LYS D CD    1 
ATOM   3325 C CE    . LYS G 2 74 ? -2.358  13.605  -32.305 1.00 78.37 ? 575 LYS D CE    1 
ATOM   3326 N NZ    . LYS G 2 74 ? -0.872  13.726  -32.362 1.00 77.91 ? 575 LYS D NZ    1 
ATOM   3327 N N     . ARG G 2 75 ? -6.553  8.040   -31.825 1.00 74.38 ? 576 ARG D N     1 
ATOM   3328 C CA    . ARG G 2 75 ? -6.900  6.662   -32.149 1.00 74.08 ? 576 ARG D CA    1 
ATOM   3329 C C     . ARG G 2 75 ? -8.357  6.623   -32.601 1.00 73.58 ? 576 ARG D C     1 
ATOM   3330 O O     . ARG G 2 75 ? -8.741  5.804   -33.435 1.00 73.71 ? 576 ARG D O     1 
ATOM   3331 C CB    . ARG G 2 75 ? -6.702  5.767   -30.930 1.00 74.03 ? 576 ARG D CB    1 
ATOM   3332 N N     . GLN G 2 76 ? -9.161  7.525   -32.048 1.00 73.32 ? 577 GLN D N     1 
ATOM   3333 C CA    . GLN G 2 76 ? -10.576 7.609   -32.386 1.00 73.31 ? 577 GLN D CA    1 
ATOM   3334 C C     . GLN G 2 76 ? -10.792 8.336   -33.714 1.00 73.00 ? 577 GLN D C     1 
ATOM   3335 O O     . GLN G 2 76 ? -11.870 8.260   -34.304 1.00 73.12 ? 577 GLN D O     1 
ATOM   3336 C CB    . GLN G 2 76 ? -11.333 8.319   -31.270 1.00 73.03 ? 577 GLN D CB    1 
ATOM   3337 N N     . LEU G 2 77 ? -9.764  9.039   -34.179 1.00 72.80 ? 578 LEU D N     1 
ATOM   3338 C CA    . LEU G 2 77 ? -9.841  9.778   -35.438 1.00 72.64 ? 578 LEU D CA    1 
ATOM   3339 C C     . LEU G 2 77 ? -9.066  9.067   -36.547 1.00 72.06 ? 578 LEU D C     1 
ATOM   3340 O O     . LEU G 2 77 ? -9.421  7.905   -36.840 1.00 71.48 ? 578 LEU D O     1 
ATOM   3341 C CB    . LEU G 2 77 ? -9.291  11.198  -35.253 1.00 72.18 ? 578 LEU D CB    1 
ATOM   3342 C CG    . LEU G 2 77 ? -10.048 12.132  -34.304 1.00 71.69 ? 578 LEU D CG    1 
ATOM   3343 C CD1   . LEU G 2 77 ? -9.335  13.470  -34.225 1.00 72.18 ? 578 LEU D CD1   1 
ATOM   3344 C CD2   . LEU G 2 77 ? -11.468 12.325  -34.795 1.00 72.13 ? 578 LEU D CD2   1 
ATOM   3345 N N     . ALA H 3 3  ? 23.496  28.236  35.134  1.00 42.65 ? 705 ALA E N     1 
ATOM   3346 C CA    . ALA H 3 3  ? 22.232  28.989  34.919  1.00 42.15 ? 705 ALA E CA    1 
ATOM   3347 C C     . ALA H 3 3  ? 21.226  28.155  34.153  1.00 41.12 ? 705 ALA E C     1 
ATOM   3348 O O     . ALA H 3 3  ? 21.584  27.314  33.325  1.00 42.23 ? 705 ALA E O     1 
ATOM   3349 C CB    . ALA H 3 3  ? 22.502  30.292  34.154  1.00 42.08 ? 705 ALA E CB    1 
ATOM   3350 N N     . HIS H 3 4  ? 19.958  28.400  34.434  1.00 40.84 ? 706 HIS E N     1 
ATOM   3351 C CA    . HIS H 3 4  ? 18.879  27.708  33.748  1.00 41.76 ? 706 HIS E CA    1 
ATOM   3352 C C     . HIS H 3 4  ? 18.838  28.277  32.319  1.00 41.01 ? 706 HIS E C     1 
ATOM   3353 O O     . HIS H 3 4  ? 18.572  27.547  31.353  1.00 41.34 ? 706 HIS E O     1 
ATOM   3354 C CB    . HIS H 3 4  ? 17.555  27.974  34.468  1.00 43.06 ? 706 HIS E CB    1 
ATOM   3355 C CG    . HIS H 3 4  ? 16.406  27.166  33.948  1.00 46.08 ? 706 HIS E CG    1 
ATOM   3356 N ND1   . HIS H 3 4  ? 15.224  27.740  33.533  1.00 46.52 ? 706 HIS E ND1   1 
ATOM   3357 C CD2   . HIS H 3 4  ? 16.250  25.830  33.796  1.00 46.93 ? 706 HIS E CD2   1 
ATOM   3358 C CE1   . HIS H 3 4  ? 14.388  26.792  33.147  1.00 47.77 ? 706 HIS E CE1   1 
ATOM   3359 N NE2   . HIS H 3 4  ? 14.986  25.623  33.297  1.00 49.45 ? 706 HIS E NE2   1 
ATOM   3360 N N     . HIS H 3 5  ? 19.123  29.577  32.196  1.00 37.78 ? 707 HIS E N     1 
ATOM   3361 C CA    . HIS H 3 5  ? 19.134  30.254  30.896  1.00 38.18 ? 707 HIS E CA    1 
ATOM   3362 C C     . HIS H 3 5  ? 20.114  29.566  29.965  1.00 36.27 ? 707 HIS E C     1 
ATOM   3363 O O     . HIS H 3 5  ? 19.829  29.375  28.795  1.00 36.63 ? 707 HIS E O     1 
ATOM   3364 C CB    . HIS H 3 5  ? 19.559  31.718  31.028  1.00 38.28 ? 707 HIS E CB    1 
ATOM   3365 C CG    . HIS H 3 5  ? 19.532  32.472  29.729  1.00 36.81 ? 707 HIS E CG    1 
ATOM   3366 N ND1   . HIS H 3 5  ? 20.530  33.345  29.349  1.00 39.43 ? 707 HIS E ND1   1 
ATOM   3367 C CD2   . HIS H 3 5  ? 18.602  32.517  28.745  1.00 36.02 ? 707 HIS E CD2   1 
ATOM   3368 C CE1   . HIS H 3 5  ? 20.216  33.895  28.188  1.00 36.31 ? 707 HIS E CE1   1 
ATOM   3369 N NE2   . HIS H 3 5  ? 19.049  33.410  27.801  1.00 37.22 ? 707 HIS E NE2   1 
ATOM   3370 N N     . ASN H 3 6  ? 21.281  29.224  30.499  1.00 36.24 ? 708 ASN E N     1 
ATOM   3371 C CA    . ASN H 3 6  ? 22.320  28.538  29.740  1.00 37.18 ? 708 ASN E CA    1 
ATOM   3372 C C     . ASN H 3 6  ? 21.774  27.237  29.145  1.00 37.36 ? 708 ASN E C     1 
ATOM   3373 O O     . ASN H 3 6  ? 21.927  26.969  27.953  1.00 37.57 ? 708 ASN E O     1 
ATOM   3374 C CB    . ASN H 3 6  ? 23.507  28.208  30.650  1.00 36.54 ? 708 ASN E CB    1 
ATOM   3375 C CG    . ASN H 3 6  ? 24.354  29.409  30.972  1.00 37.37 ? 708 ASN E CG    1 
ATOM   3376 O OD1   . ASN H 3 6  ? 25.343  29.297  31.703  1.00 38.70 ? 708 ASN E OD1   1 
ATOM   3377 N ND2   . ASN H 3 6  ? 23.985  30.570  30.427  1.00 37.52 ? 708 ASN E ND2   1 
ATOM   3378 N N     . ALA H 3 7  ? 21.139  26.431  29.992  1.00 37.19 ? 709 ALA E N     1 
ATOM   3379 C CA    . ALA H 3 7  ? 20.573  25.165  29.565  1.00 36.42 ? 709 ALA E CA    1 
ATOM   3380 C C     . ALA H 3 7  ? 19.469  25.384  28.522  1.00 37.76 ? 709 ALA E C     1 
ATOM   3381 O O     . ALA H 3 7  ? 19.438  24.694  27.501  1.00 37.33 ? 709 ALA E O     1 
ATOM   3382 C CB    . ALA H 3 7  ? 20.032  24.411  30.769  1.00 37.58 ? 709 ALA E CB    1 
ATOM   3383 N N     . LEU H 3 8  ? 18.574  26.344  28.768  1.00 36.25 ? 710 LEU E N     1 
ATOM   3384 C CA    . LEU H 3 8  ? 17.494  26.629  27.819  1.00 36.39 ? 710 LEU E CA    1 
ATOM   3385 C C     . LEU H 3 8  ? 18.071  27.024  26.453  1.00 35.92 ? 710 LEU E C     1 
ATOM   3386 O O     . LEU H 3 8  ? 17.684  26.472  25.433  1.00 36.68 ? 710 LEU E O     1 
ATOM   3387 C CB    . LEU H 3 8  ? 16.586  27.764  28.328  1.00 36.15 ? 710 LEU E CB    1 
ATOM   3388 C CG    . LEU H 3 8  ? 15.575  27.506  29.454  1.00 38.60 ? 710 LEU E CG    1 
ATOM   3389 C CD1   . LEU H 3 8  ? 15.002  28.832  29.947  1.00 39.06 ? 710 LEU E CD1   1 
ATOM   3390 C CD2   . LEU H 3 8  ? 14.452  26.600  28.956  1.00 35.87 ? 710 LEU E CD2   1 
ATOM   3391 N N     . GLU H 3 9  ? 18.986  27.987  26.438  1.00 36.24 ? 711 GLU E N     1 
ATOM   3392 C CA    . GLU H 3 9  ? 19.595  28.437  25.186  1.00 36.78 ? 711 GLU E CA    1 
ATOM   3393 C C     . GLU H 3 9  ? 20.253  27.243  24.476  1.00 37.51 ? 711 GLU E C     1 
ATOM   3394 O O     . GLU H 3 9  ? 20.262  27.167  23.243  1.00 35.40 ? 711 GLU E O     1 
ATOM   3395 C CB    . GLU H 3 9  ? 20.620  29.538  25.475  1.00 35.39 ? 711 GLU E CB    1 
ATOM   3396 C CG    . GLU H 3 9  ? 21.433  30.046  24.281  1.00 36.84 ? 711 GLU E CG    1 
ATOM   3397 C CD    . GLU H 3 9  ? 20.614  30.773  23.209  1.00 38.93 ? 711 GLU E CD    1 
ATOM   3398 O OE1   . GLU H 3 9  ? 19.403  31.032  23.407  1.00 36.78 ? 711 GLU E OE1   1 
ATOM   3399 O OE2   . GLU H 3 9  ? 21.204  31.096  22.153  1.00 36.72 ? 711 GLU E OE2   1 
ATOM   3400 N N     . ARG H 3 10 ? 20.789  26.308  25.257  1.00 37.20 ? 712 ARG E N     1 
ATOM   3401 C CA    . ARG H 3 10 ? 21.423  25.126  24.680  1.00 39.44 ? 712 ARG E CA    1 
ATOM   3402 C C     . ARG H 3 10 ? 20.366  24.279  23.970  1.00 38.56 ? 712 ARG E C     1 
ATOM   3403 O O     . ARG H 3 10 ? 20.585  23.830  22.848  1.00 38.68 ? 712 ARG E O     1 
ATOM   3404 C CB    . ARG H 3 10 ? 22.136  24.294  25.759  1.00 42.28 ? 712 ARG E CB    1 
ATOM   3405 C CG    . ARG H 3 10 ? 23.073  23.224  25.178  1.00 43.97 ? 712 ARG E CG    1 
ATOM   3406 C CD    . ARG H 3 10 ? 23.960  22.587  26.245  1.00 47.40 ? 712 ARG E CD    1 
ATOM   3407 N NE    . ARG H 3 10 ? 24.988  21.644  25.621  1.00 47.12 ? 712 ARG E NE    1 
ATOM   3408 N N     . LYS H 3 11 ? 19.214  24.078  24.603  1.00 37.83 ? 713 LYS E N     1 
ATOM   3409 C CA    . LYS H 3 11 ? 18.165  23.292  23.971  1.00 38.07 ? 713 LYS E CA    1 
ATOM   3410 C C     . LYS H 3 11 ? 17.669  24.017  22.725  1.00 38.03 ? 713 LYS E C     1 
ATOM   3411 O O     . LYS H 3 11 ? 17.326  23.384  21.723  1.00 36.13 ? 713 LYS E O     1 
ATOM   3412 C CB    . LYS H 3 11 ? 17.000  23.046  24.928  1.00 41.07 ? 713 LYS E CB    1 
ATOM   3413 C CG    . LYS H 3 11 ? 17.202  21.862  25.878  1.00 42.88 ? 713 LYS E CG    1 
ATOM   3414 C CD    . LYS H 3 11 ? 18.457  22.001  26.718  1.00 45.76 ? 713 LYS E CD    1 
ATOM   3415 C CE    . LYS H 3 11 ? 18.496  20.936  27.818  1.00 49.59 ? 713 LYS E CE    1 
ATOM   3416 N NZ    . LYS H 3 11 ? 19.785  20.963  28.568  1.00 52.10 ? 713 LYS E NZ    1 
ATOM   3417 N N     . ARG H 3 12 ? 17.631  25.344  22.793  1.00 35.73 ? 714 ARG E N     1 
ATOM   3418 C CA    . ARG H 3 12 ? 17.202  26.148  21.651  1.00 34.12 ? 714 ARG E CA    1 
ATOM   3419 C C     . ARG H 3 12 ? 18.176  25.884  20.499  1.00 31.03 ? 714 ARG E C     1 
ATOM   3420 O O     . ARG H 3 12 ? 17.762  25.693  19.375  1.00 30.76 ? 714 ARG E O     1 
ATOM   3421 C CB    . ARG H 3 12 ? 17.202  27.648  22.007  1.00 34.42 ? 714 ARG E CB    1 
ATOM   3422 C CG    . ARG H 3 12 ? 16.892  28.560  20.823  1.00 40.74 ? 714 ARG E CG    1 
ATOM   3423 C CD    . ARG H 3 12 ? 17.236  30.042  21.084  1.00 42.27 ? 714 ARG E CD    1 
ATOM   3424 N NE    . ARG H 3 12 ? 17.444  30.743  19.816  1.00 45.28 ? 714 ARG E NE    1 
ATOM   3425 C CZ    . ARG H 3 12 ? 18.636  31.066  19.316  1.00 46.21 ? 714 ARG E CZ    1 
ATOM   3426 N NH1   . ARG H 3 12 ? 19.744  30.764  19.973  1.00 46.12 ? 714 ARG E NH1   1 
ATOM   3427 N NH2   . ARG H 3 12 ? 18.722  31.692  18.146  1.00 48.34 ? 714 ARG E NH2   1 
ATOM   3428 N N     . ARG H 3 13 ? 19.473  25.881  20.780  1.00 30.47 ? 715 ARG E N     1 
ATOM   3429 C CA    . ARG H 3 13 ? 20.448  25.613  19.728  1.00 31.75 ? 715 ARG E CA    1 
ATOM   3430 C C     . ARG H 3 13 ? 20.290  24.200  19.170  1.00 31.39 ? 715 ARG E C     1 
ATOM   3431 O O     . ARG H 3 13 ? 20.365  24.010  17.963  1.00 33.36 ? 715 ARG E O     1 
ATOM   3432 C CB    . ARG H 3 13 ? 21.875  25.836  20.230  1.00 30.18 ? 715 ARG E CB    1 
ATOM   3433 C CG    . ARG H 3 13 ? 22.220  27.326  20.316  1.00 35.70 ? 715 ARG E CG    1 
ATOM   3434 C CD    . ARG H 3 13 ? 23.699  27.595  20.448  1.00 36.41 ? 715 ARG E CD    1 
ATOM   3435 N NE    . ARG H 3 13 ? 24.060  27.983  21.805  1.00 42.36 ? 715 ARG E NE    1 
ATOM   3436 C CZ    . ARG H 3 13 ? 24.175  27.132  22.812  1.00 40.37 ? 715 ARG E CZ    1 
ATOM   3437 N NH1   . ARG H 3 13 ? 23.962  25.843  22.602  1.00 43.97 ? 715 ARG E NH1   1 
ATOM   3438 N NH2   . ARG H 3 13 ? 24.490  27.567  24.019  1.00 39.20 ? 715 ARG E NH2   1 
ATOM   3439 N N     . ASP H 3 14 ? 20.063  23.213  20.038  1.00 32.44 ? 716 ASP E N     1 
ATOM   3440 C CA    . ASP H 3 14 ? 19.861  21.833  19.578  1.00 33.57 ? 716 ASP E CA    1 
ATOM   3441 C C     . ASP H 3 14 ? 18.734  21.769  18.547  1.00 33.18 ? 716 ASP E C     1 
ATOM   3442 O O     . ASP H 3 14 ? 18.876  21.128  17.514  1.00 33.26 ? 716 ASP E O     1 
ATOM   3443 C CB    . ASP H 3 14 ? 19.496  20.913  20.745  1.00 35.04 ? 716 ASP E CB    1 
ATOM   3444 C CG    . ASP H 3 14 ? 20.635  20.705  21.706  1.00 37.33 ? 716 ASP E CG    1 
ATOM   3445 O OD1   . ASP H 3 14 ? 20.359  20.318  22.863  1.00 42.22 ? 716 ASP E OD1   1 
ATOM   3446 O OD2   . ASP H 3 14 ? 21.802  20.913  21.311  1.00 42.87 ? 716 ASP E OD2   1 
ATOM   3447 N N     . HIS H 3 15 ? 17.609  22.425  18.838  1.00 34.49 ? 717 HIS E N     1 
ATOM   3448 C CA    . HIS H 3 15 ? 16.464  22.436  17.922  1.00 34.81 ? 717 HIS E CA    1 
ATOM   3449 C C     . HIS H 3 15 ? 16.826  23.032  16.563  1.00 32.17 ? 717 HIS E C     1 
ATOM   3450 O O     . HIS H 3 15 ? 16.398  22.535  15.516  1.00 32.31 ? 717 HIS E O     1 
ATOM   3451 C CB    . HIS H 3 15 ? 15.299  23.244  18.519  1.00 37.10 ? 717 HIS E CB    1 
ATOM   3452 C CG    . HIS H 3 15 ? 14.652  22.603  19.708  1.00 41.14 ? 717 HIS E CG    1 
ATOM   3453 N ND1   . HIS H 3 15 ? 13.980  21.404  19.635  1.00 43.59 ? 717 HIS E ND1   1 
ATOM   3454 C CD2   . HIS H 3 15 ? 14.551  23.012  20.996  1.00 41.84 ? 717 HIS E CD2   1 
ATOM   3455 C CE1   . HIS H 3 15 ? 13.491  21.101  20.826  1.00 42.55 ? 717 HIS E CE1   1 
ATOM   3456 N NE2   . HIS H 3 15 ? 13.824  22.061  21.668  1.00 42.68 ? 717 HIS E NE2   1 
ATOM   3457 N N     . ILE H 3 16 ? 17.593  24.117  16.586  1.00 31.57 ? 718 ILE E N     1 
ATOM   3458 C CA    . ILE H 3 16 ? 18.010  24.769  15.353  1.00 29.82 ? 718 ILE E CA    1 
ATOM   3459 C C     . ILE H 3 16 ? 18.965  23.838  14.593  1.00 29.73 ? 718 ILE E C     1 
ATOM   3460 O O     . ILE H 3 16 ? 18.896  23.723  13.372  1.00 27.17 ? 718 ILE E O     1 
ATOM   3461 C CB    . ILE H 3 16 ? 18.709  26.129  15.647  1.00 27.00 ? 718 ILE E CB    1 
ATOM   3462 C CG1   . ILE H 3 16 ? 17.654  27.194  16.014  1.00 29.71 ? 718 ILE E CG1   1 
ATOM   3463 C CG2   . ILE H 3 16 ? 19.505  26.581  14.422  1.00 26.93 ? 718 ILE E CG2   1 
ATOM   3464 C CD1   . ILE H 3 16 ? 18.260  28.561  16.397  1.00 24.82 ? 718 ILE E CD1   1 
ATOM   3465 N N     . LYS H 3 17 ? 19.849  23.175  15.328  1.00 31.44 ? 719 LYS E N     1 
ATOM   3466 C CA    . LYS H 3 17 ? 20.783  22.241  14.720  1.00 34.00 ? 719 LYS E CA    1 
ATOM   3467 C C     . LYS H 3 17 ? 19.954  21.142  14.043  1.00 35.40 ? 719 LYS E C     1 
ATOM   3468 O O     . LYS H 3 17 ? 20.205  20.776  12.891  1.00 35.92 ? 719 LYS E O     1 
ATOM   3469 C CB    . LYS H 3 17 ? 21.687  21.655  15.806  1.00 38.25 ? 719 LYS E CB    1 
ATOM   3470 C CG    . LYS H 3 17 ? 22.638  20.562  15.349  1.00 39.13 ? 719 LYS E CG    1 
ATOM   3471 C CD    . LYS H 3 17 ? 23.354  19.981  16.552  1.00 45.28 ? 719 LYS E CD    1 
ATOM   3472 C CE    . LYS H 3 17 ? 24.265  18.821  16.172  1.00 45.98 ? 719 LYS E CE    1 
ATOM   3473 N NZ    . LYS H 3 17 ? 24.732  18.117  17.400  1.00 49.85 ? 719 LYS E NZ    1 
ATOM   3474 N N     . ASP H 3 18 ? 18.943  20.646  14.753  1.00 36.75 ? 720 ASP E N     1 
ATOM   3475 C CA    . ASP H 3 18 ? 18.061  19.595  14.239  1.00 38.34 ? 720 ASP E CA    1 
ATOM   3476 C C     . ASP H 3 18 ? 17.385  20.009  12.938  1.00 38.08 ? 720 ASP E C     1 
ATOM   3477 O O     . ASP H 3 18 ? 17.280  19.215  11.994  1.00 35.96 ? 720 ASP E O     1 
ATOM   3478 C CB    . ASP H 3 18 ? 16.977  19.256  15.272  1.00 41.62 ? 720 ASP E CB    1 
ATOM   3479 C CG    . ASP H 3 18 ? 15.976  18.212  14.763  1.00 45.76 ? 720 ASP E CG    1 
ATOM   3480 O OD1   . ASP H 3 18 ? 15.306  18.448  13.732  1.00 50.79 ? 720 ASP E OD1   1 
ATOM   3481 O OD2   . ASP H 3 18 ? 15.853  17.146  15.398  1.00 48.60 ? 720 ASP E OD2   1 
ATOM   3482 N N     . SER H 3 19 ? 16.921  21.254  12.897  1.00 36.05 ? 721 SER E N     1 
ATOM   3483 C CA    . SER H 3 19 ? 16.230  21.766  11.720  1.00 34.53 ? 721 SER E CA    1 
ATOM   3484 C C     . SER H 3 19 ? 17.163  21.903  10.540  1.00 32.01 ? 721 SER E C     1 
ATOM   3485 O O     . SER H 3 19 ? 16.781  21.601  9.414   1.00 30.03 ? 721 SER E O     1 
ATOM   3486 C CB    . SER H 3 19 ? 15.586  23.119  12.027  1.00 35.55 ? 721 SER E CB    1 
ATOM   3487 O OG    . SER H 3 19 ? 14.768  23.023  13.181  1.00 40.00 ? 721 SER E OG    1 
ATOM   3488 N N     . PHE H 3 20 ? 18.378  22.382  10.790  1.00 32.32 ? 722 PHE E N     1 
ATOM   3489 C CA    . PHE H 3 20 ? 19.342  22.522  9.712   1.00 33.00 ? 722 PHE E CA    1 
ATOM   3490 C C     . PHE H 3 20 ? 19.539  21.171  9.026   1.00 33.94 ? 722 PHE E C     1 
ATOM   3491 O O     . PHE H 3 20 ? 19.608  21.093  7.801   1.00 35.13 ? 722 PHE E O     1 
ATOM   3492 C CB    . PHE H 3 20 ? 20.687  23.017  10.236  1.00 32.15 ? 722 PHE E CB    1 
ATOM   3493 C CG    . PHE H 3 20 ? 20.883  24.502  10.100  1.00 31.56 ? 722 PHE E CG    1 
ATOM   3494 C CD1   . PHE H 3 20 ? 20.792  25.338  11.211  1.00 30.79 ? 722 PHE E CD1   1 
ATOM   3495 C CD2   . PHE H 3 20 ? 21.147  25.065  8.854   1.00 31.98 ? 722 PHE E CD2   1 
ATOM   3496 C CE1   . PHE H 3 20 ? 20.963  26.722  11.078  1.00 32.47 ? 722 PHE E CE1   1 
ATOM   3497 C CE2   . PHE H 3 20 ? 21.318  26.449  8.708   1.00 31.23 ? 722 PHE E CE2   1 
ATOM   3498 C CZ    . PHE H 3 20 ? 21.225  27.272  9.824   1.00 31.54 ? 722 PHE E CZ    1 
ATOM   3499 N N     . HIS H 3 21 ? 19.621  20.115  9.827   1.00 34.83 ? 723 HIS E N     1 
ATOM   3500 C CA    . HIS H 3 21 ? 19.820  18.766  9.304   1.00 37.12 ? 723 HIS E CA    1 
ATOM   3501 C C     . HIS H 3 21 ? 18.602  18.222  8.565   1.00 35.74 ? 723 HIS E C     1 
ATOM   3502 O O     . HIS H 3 21 ? 18.740  17.488  7.581   1.00 35.89 ? 723 HIS E O     1 
ATOM   3503 C CB    . HIS H 3 21 ? 20.239  17.840  10.445  1.00 37.48 ? 723 HIS E CB    1 
ATOM   3504 C CG    . HIS H 3 21 ? 21.584  18.174  11.009  1.00 42.89 ? 723 HIS E CG    1 
ATOM   3505 N ND1   . HIS H 3 21 ? 22.094  17.573  12.139  1.00 45.33 ? 723 HIS E ND1   1 
ATOM   3506 C CD2   . HIS H 3 21 ? 22.542  19.027  10.571  1.00 44.05 ? 723 HIS E CD2   1 
ATOM   3507 C CE1   . HIS H 3 21 ? 23.309  18.038  12.373  1.00 46.12 ? 723 HIS E CE1   1 
ATOM   3508 N NE2   . HIS H 3 21 ? 23.605  18.921  11.434  1.00 47.62 ? 723 HIS E NE2   1 
ATOM   3509 N N     . SER H 3 22 ? 17.412  18.593  9.025   1.00 33.28 ? 724 SER E N     1 
ATOM   3510 C CA    . SER H 3 22 ? 16.192  18.149  8.375   1.00 33.45 ? 724 SER E CA    1 
ATOM   3511 C C     . SER H 3 22 ? 16.041  18.892  7.053   1.00 32.27 ? 724 SER E C     1 
ATOM   3512 O O     . SER H 3 22 ? 15.389  18.405  6.130   1.00 31.11 ? 724 SER E O     1 
ATOM   3513 C CB    . SER H 3 22 ? 14.966  18.415  9.261   1.00 35.11 ? 724 SER E CB    1 
ATOM   3514 O OG    . SER H 3 22 ? 15.023  17.657  10.457  1.00 41.08 ? 724 SER E OG    1 
ATOM   3515 N N     . LEU H 3 23 ? 16.639  20.079  6.968   1.00 30.98 ? 725 LEU E N     1 
ATOM   3516 C CA    . LEU H 3 23 ? 16.580  20.870  5.738   1.00 31.11 ? 725 LEU E CA    1 
ATOM   3517 C C     . LEU H 3 23 ? 17.625  20.287  4.766   1.00 29.93 ? 725 LEU E C     1 
ATOM   3518 O O     . LEU H 3 23 ? 17.366  20.123  3.578   1.00 29.85 ? 725 LEU E O     1 
ATOM   3519 C CB    . LEU H 3 23 ? 16.922  22.340  6.016   1.00 27.74 ? 725 LEU E CB    1 
ATOM   3520 C CG    . LEU H 3 23 ? 16.172  23.441  5.243   1.00 32.45 ? 725 LEU E CG    1 
ATOM   3521 C CD1   . LEU H 3 23 ? 17.086  24.668  5.143   1.00 28.65 ? 725 LEU E CD1   1 
ATOM   3522 C CD2   . LEU H 3 23 ? 15.726  22.974  3.858   1.00 25.57 ? 725 LEU E CD2   1 
ATOM   3523 N N     . ARG H 3 24 ? 18.808  19.986  5.286   1.00 31.83 ? 726 ARG E N     1 
ATOM   3524 C CA    . ARG H 3 24 ? 19.878  19.427  4.471   1.00 34.28 ? 726 ARG E CA    1 
ATOM   3525 C C     . ARG H 3 24 ? 19.416  18.111  3.847   1.00 36.26 ? 726 ARG E C     1 
ATOM   3526 O O     . ARG H 3 24 ? 19.620  17.874  2.661   1.00 37.51 ? 726 ARG E O     1 
ATOM   3527 C CB    . ARG H 3 24 ? 21.118  19.184  5.331   1.00 34.99 ? 726 ARG E CB    1 
ATOM   3528 C CG    . ARG H 3 24 ? 22.275  18.525  4.599   1.00 39.45 ? 726 ARG E CG    1 
ATOM   3529 C CD    . ARG H 3 24 ? 23.288  17.975  5.590   1.00 43.16 ? 726 ARG E CD    1 
ATOM   3530 N NE    . ARG H 3 24 ? 22.631  17.090  6.545   1.00 47.29 ? 726 ARG E NE    1 
ATOM   3531 C CZ    . ARG H 3 24 ? 23.241  16.466  7.547   1.00 50.47 ? 726 ARG E CZ    1 
ATOM   3532 N NH1   . ARG H 3 24 ? 24.546  16.620  7.739   1.00 51.15 ? 726 ARG E NH1   1 
ATOM   3533 N NH2   . ARG H 3 24 ? 22.538  15.694  8.369   1.00 51.11 ? 726 ARG E NH2   1 
ATOM   3534 N N     . ASP H 3 25 ? 18.764  17.271  4.644   1.00 36.74 ? 727 ASP E N     1 
ATOM   3535 C CA    . ASP H 3 25 ? 18.310  15.994  4.136   1.00 39.59 ? 727 ASP E CA    1 
ATOM   3536 C C     . ASP H 3 25 ? 17.134  16.056  3.187   1.00 39.20 ? 727 ASP E C     1 
ATOM   3537 O O     . ASP H 3 25 ? 16.669  15.019  2.725   1.00 41.16 ? 727 ASP E O     1 
ATOM   3538 C CB    . ASP H 3 25 ? 17.997  15.036  5.290   1.00 40.15 ? 727 ASP E CB    1 
ATOM   3539 C CG    . ASP H 3 25 ? 19.236  14.664  6.075   1.00 42.26 ? 727 ASP E CG    1 
ATOM   3540 O OD1   . ASP H 3 25 ? 20.328  14.641  5.474   1.00 43.11 ? 727 ASP E OD1   1 
ATOM   3541 O OD2   . ASP H 3 25 ? 19.121  14.385  7.286   1.00 46.15 ? 727 ASP E OD2   1 
ATOM   3542 N N     . SER H 3 26 ? 16.655  17.257  2.876   1.00 39.24 ? 728 SER E N     1 
ATOM   3543 C CA    . SER H 3 26 ? 15.533  17.376  1.953   1.00 37.62 ? 728 SER E CA    1 
ATOM   3544 C C     . SER H 3 26 ? 15.993  17.960  0.621   1.00 35.95 ? 728 SER E C     1 
ATOM   3545 O O     . SER H 3 26 ? 15.219  18.071  -0.326  1.00 33.22 ? 728 SER E O     1 
ATOM   3546 C CB    . SER H 3 26 ? 14.418  18.238  2.556   1.00 37.68 ? 728 SER E CB    1 
ATOM   3547 O OG    . SER H 3 26 ? 14.698  19.616  2.402   1.00 41.61 ? 728 SER E OG    1 
ATOM   3548 N N     . VAL H 3 27 ? 17.265  18.335  0.554   1.00 38.20 ? 729 VAL E N     1 
ATOM   3549 C CA    . VAL H 3 27 ? 17.823  18.887  -0.672  1.00 39.65 ? 729 VAL E CA    1 
ATOM   3550 C C     . VAL H 3 27 ? 18.627  17.769  -1.344  1.00 40.84 ? 729 VAL E C     1 
ATOM   3551 O O     . VAL H 3 27 ? 19.605  17.279  -0.787  1.00 38.95 ? 729 VAL E O     1 
ATOM   3552 C CB    . VAL H 3 27 ? 18.739  20.096  -0.375  1.00 39.44 ? 729 VAL E CB    1 
ATOM   3553 C CG1   . VAL H 3 27 ? 19.278  20.664  -1.669  1.00 39.58 ? 729 VAL E CG1   1 
ATOM   3554 C CG2   . VAL H 3 27 ? 17.952  21.177  0.373   1.00 42.25 ? 729 VAL E CG2   1 
ATOM   3555 N N     . PRO H 3 28 ? 18.220  17.355  -2.553  1.00 42.49 ? 730 PRO E N     1 
ATOM   3556 C CA    . PRO H 3 28 ? 18.921  16.283  -3.267  1.00 44.76 ? 730 PRO E CA    1 
ATOM   3557 C C     . PRO H 3 28 ? 20.439  16.405  -3.271  1.00 47.03 ? 730 PRO E C     1 
ATOM   3558 O O     . PRO H 3 28 ? 21.140  15.464  -2.902  1.00 47.25 ? 730 PRO E O     1 
ATOM   3559 C CB    . PRO H 3 28 ? 18.330  16.362  -4.672  1.00 44.73 ? 730 PRO E CB    1 
ATOM   3560 C CG    . PRO H 3 28 ? 16.923  16.826  -4.410  1.00 44.19 ? 730 PRO E CG    1 
ATOM   3561 C CD    . PRO H 3 28 ? 17.148  17.924  -3.387  1.00 41.93 ? 730 PRO E CD    1 
ATOM   3562 N N     . SER H 3 29 ? 20.935  17.569  -3.677  1.00 49.54 ? 731 SER E N     1 
ATOM   3563 C CA    . SER H 3 29 ? 22.367  17.821  -3.756  1.00 52.17 ? 731 SER E CA    1 
ATOM   3564 C C     . SER H 3 29 ? 23.112  17.838  -2.424  1.00 54.00 ? 731 SER E C     1 
ATOM   3565 O O     . SER H 3 29 ? 24.341  17.919  -2.415  1.00 55.30 ? 731 SER E O     1 
ATOM   3566 C CB    . SER H 3 29 ? 22.619  19.151  -4.469  1.00 53.03 ? 731 SER E CB    1 
ATOM   3567 O OG    . SER H 3 29 ? 22.176  20.241  -3.679  1.00 52.40 ? 731 SER E OG    1 
ATOM   3568 N N     . LEU H 3 30 ? 22.388  17.758  -1.310  1.00 55.41 ? 732 LEU E N     1 
ATOM   3569 C CA    . LEU H 3 30 ? 23.017  17.791  0.014   1.00 57.79 ? 732 LEU E CA    1 
ATOM   3570 C C     . LEU H 3 30 ? 22.815  16.532  0.861   1.00 59.77 ? 732 LEU E C     1 
ATOM   3571 O O     . LEU H 3 30 ? 23.721  16.106  1.576   1.00 59.67 ? 732 LEU E O     1 
ATOM   3572 C CB    . LEU H 3 30 ? 22.498  18.988  0.814   1.00 56.71 ? 732 LEU E CB    1 
ATOM   3573 C CG    . LEU H 3 30 ? 22.759  20.401  0.296   1.00 57.00 ? 732 LEU E CG    1 
ATOM   3574 C CD1   . LEU H 3 30 ? 22.116  21.412  1.242   1.00 56.16 ? 732 LEU E CD1   1 
ATOM   3575 C CD2   . LEU H 3 30 ? 24.256  20.641  0.191   1.00 56.61 ? 732 LEU E CD2   1 
ATOM   3576 N N     . GLN H 3 31 ? 21.619  15.957  0.791   1.00 61.96 ? 733 GLN E N     1 
ATOM   3577 C CA    . GLN H 3 31 ? 21.282  14.767  1.566   1.00 64.58 ? 733 GLN E CA    1 
ATOM   3578 C C     . GLN H 3 31 ? 22.436  13.779  1.720   1.00 64.96 ? 733 GLN E C     1 
ATOM   3579 O O     . GLN H 3 31 ? 23.249  13.603  0.808   1.00 64.89 ? 733 GLN E O     1 
ATOM   3580 C CB    . GLN H 3 31 ? 20.085  14.055  0.935   1.00 65.71 ? 733 GLN E CB    1 
ATOM   3581 C CG    . GLN H 3 31 ? 19.653  12.808  1.680   1.00 68.02 ? 733 GLN E CG    1 
ATOM   3582 C CD    . GLN H 3 31 ? 18.540  12.079  0.970   1.00 69.99 ? 733 GLN E CD    1 
ATOM   3583 O OE1   . GLN H 3 31 ? 17.451  12.625  0.768   1.00 71.53 ? 733 GLN E OE1   1 
ATOM   3584 N NE2   . GLN H 3 31 ? 18.804  10.837  0.577   1.00 71.06 ? 733 GLN E NE2   1 
ATOM   3585 N N     . GLY H 3 32 ? 22.498  13.143  2.888   1.00 65.72 ? 734 GLY E N     1 
ATOM   3586 C CA    . GLY H 3 32 ? 23.542  12.172  3.160   1.00 66.58 ? 734 GLY E CA    1 
ATOM   3587 C C     . GLY H 3 32 ? 24.872  12.752  3.604   1.00 67.62 ? 734 GLY E C     1 
ATOM   3588 O O     . GLY H 3 32 ? 25.280  12.579  4.755   1.00 68.25 ? 734 GLY E O     1 
ATOM   3589 N N     . GLU H 3 33 ? 25.551  13.440  2.690   1.00 67.91 ? 735 GLU E N     1 
ATOM   3590 C CA    . GLU H 3 33 ? 26.856  14.039  2.964   1.00 67.86 ? 735 GLU E CA    1 
ATOM   3591 C C     . GLU H 3 33 ? 26.818  15.089  4.074   1.00 67.24 ? 735 GLU E C     1 
ATOM   3592 O O     . GLU H 3 33 ? 25.784  15.316  4.709   1.00 67.72 ? 735 GLU E O     1 
ATOM   3593 C CB    . GLU H 3 33 ? 27.410  14.681  1.687   1.00 69.75 ? 735 GLU E CB    1 
ATOM   3594 C CG    . GLU H 3 33 ? 27.387  13.771  0.458   1.00 71.80 ? 735 GLU E CG    1 
ATOM   3595 C CD    . GLU H 3 33 ? 27.837  14.483  -0.808  1.00 73.22 ? 735 GLU E CD    1 
ATOM   3596 O OE1   . GLU H 3 33 ? 27.235  15.523  -1.152  1.00 73.77 ? 735 GLU E OE1   1 
ATOM   3597 O OE2   . GLU H 3 33 ? 28.789  14.004  -1.462  1.00 74.06 ? 735 GLU E OE2   1 
ATOM   3598 N N     . LYS H 3 34 ? 27.962  15.721  4.309   1.00 65.48 ? 736 LYS E N     1 
ATOM   3599 C CA    . LYS H 3 34 ? 28.063  16.767  5.317   1.00 63.28 ? 736 LYS E CA    1 
ATOM   3600 C C     . LYS H 3 34 ? 28.230  18.096  4.589   1.00 61.06 ? 736 LYS E C     1 
ATOM   3601 O O     . LYS H 3 34 ? 29.032  18.208  3.653   1.00 61.49 ? 736 LYS E O     1 
ATOM   3602 C CB    . LYS H 3 34 ? 29.263  16.527  6.238   1.00 64.40 ? 736 LYS E CB    1 
ATOM   3603 C CG    . LYS H 3 34 ? 29.146  15.289  7.117   1.00 66.66 ? 736 LYS E CG    1 
ATOM   3604 C CD    . LYS H 3 34 ? 30.318  15.191  8.087   1.00 68.50 ? 736 LYS E CD    1 
ATOM   3605 C CE    . LYS H 3 34 ? 30.236  13.935  8.945   1.00 69.64 ? 736 LYS E CE    1 
ATOM   3606 N NZ    . LYS H 3 34 ? 31.413  13.806  9.852   1.00 69.32 ? 736 LYS E NZ    1 
ATOM   3607 N N     . ALA H 3 35 ? 27.463  19.095  5.011   1.00 56.60 ? 737 ALA E N     1 
ATOM   3608 C CA    . ALA H 3 35 ? 27.523  20.418  4.403   1.00 51.77 ? 737 ALA E CA    1 
ATOM   3609 C C     . ALA H 3 35 ? 27.410  21.472  5.496   1.00 47.68 ? 737 ALA E C     1 
ATOM   3610 O O     . ALA H 3 35 ? 26.705  21.267  6.484   1.00 47.17 ? 737 ALA E O     1 
ATOM   3611 C CB    . ALA H 3 35 ? 26.393  20.580  3.392   1.00 51.19 ? 737 ALA E CB    1 
ATOM   3612 N N     . SER H 3 36 ? 28.112  22.588  5.324   1.00 43.78 ? 738 SER E N     1 
ATOM   3613 C CA    . SER H 3 36 ? 28.072  23.664  6.312   1.00 41.48 ? 738 SER E CA    1 
ATOM   3614 C C     . SER H 3 36 ? 26.688  24.312  6.326   1.00 38.41 ? 738 SER E C     1 
ATOM   3615 O O     . SER H 3 36 ? 25.863  24.048  5.448   1.00 34.37 ? 738 SER E O     1 
ATOM   3616 C CB    . SER H 3 36 ? 29.130  24.721  5.992   1.00 40.48 ? 738 SER E CB    1 
ATOM   3617 O OG    . SER H 3 36 ? 28.831  25.372  4.772   1.00 44.19 ? 738 SER E OG    1 
ATOM   3618 N N     . ARG H 3 37 ? 26.428  25.143  7.333   1.00 36.61 ? 739 ARG E N     1 
ATOM   3619 C CA    . ARG H 3 37 ? 25.130  25.812  7.426   1.00 36.70 ? 739 ARG E CA    1 
ATOM   3620 C C     . ARG H 3 37 ? 24.963  26.706  6.220   1.00 33.39 ? 739 ARG E C     1 
ATOM   3621 O O     . ARG H 3 37 ? 23.872  26.831  5.681   1.00 30.60 ? 739 ARG E O     1 
ATOM   3622 C CB    . ARG H 3 37 ? 25.020  26.628  8.719   1.00 34.46 ? 739 ARG E CB    1 
ATOM   3623 C CG    . ARG H 3 37 ? 24.900  25.741  9.940   1.00 38.98 ? 739 ARG E CG    1 
ATOM   3624 C CD    . ARG H 3 37 ? 24.573  26.507  11.221  1.00 40.22 ? 739 ARG E CD    1 
ATOM   3625 N NE    . ARG H 3 37 ? 24.186  25.556  12.258  1.00 41.92 ? 739 ARG E NE    1 
ATOM   3626 C CZ    . ARG H 3 37 ? 23.697  25.880  13.449  1.00 44.92 ? 739 ARG E CZ    1 
ATOM   3627 N NH1   . ARG H 3 37 ? 23.524  27.165  13.791  1.00 42.09 ? 739 ARG E NH1   1 
ATOM   3628 N NH2   . ARG H 3 37 ? 23.373  24.910  14.294  1.00 41.34 ? 739 ARG E NH2   1 
ATOM   3629 N N     . ALA H 3 38 ? 26.077  27.290  5.789   1.00 34.98 ? 740 ALA E N     1 
ATOM   3630 C CA    . ALA H 3 38 ? 26.104  28.171  4.634   1.00 35.82 ? 740 ALA E CA    1 
ATOM   3631 C C     . ALA H 3 38 ? 25.745  27.403  3.361   1.00 37.32 ? 740 ALA E C     1 
ATOM   3632 O O     . ALA H 3 38 ? 25.027  27.905  2.489   1.00 35.03 ? 740 ALA E O     1 
ATOM   3633 C CB    . ALA H 3 38 ? 27.492  28.786  4.498   1.00 37.38 ? 740 ALA E CB    1 
ATOM   3634 N N     . GLN H 3 39 ? 26.267  26.186  3.252   1.00 38.75 ? 741 GLN E N     1 
ATOM   3635 C CA    . GLN H 3 39 ? 26.008  25.344  2.090   1.00 39.33 ? 741 GLN E CA    1 
ATOM   3636 C C     . GLN H 3 39 ? 24.552  24.916  2.051   1.00 37.34 ? 741 GLN E C     1 
ATOM   3637 O O     . GLN H 3 39 ? 23.936  24.858  0.985   1.00 38.07 ? 741 GLN E O     1 
ATOM   3638 C CB    . GLN H 3 39 ? 26.905  24.105  2.132   1.00 41.99 ? 741 GLN E CB    1 
ATOM   3639 C CG    . GLN H 3 39 ? 28.382  24.417  1.961   1.00 46.35 ? 741 GLN E CG    1 
ATOM   3640 C CD    . GLN H 3 39 ? 29.231  23.168  1.958   1.00 48.23 ? 741 GLN E CD    1 
ATOM   3641 O OE1   . GLN H 3 39 ? 29.411  22.519  2.993   1.00 49.85 ? 741 GLN E OE1   1 
ATOM   3642 N NE2   . GLN H 3 39 ? 29.750  22.812  0.786   1.00 49.65 ? 741 GLN E NE2   1 
ATOM   3643 N N     . ILE H 3 40 ? 24.011  24.598  3.222   1.00 35.41 ? 742 ILE E N     1 
ATOM   3644 C CA    . ILE H 3 40 ? 22.625  24.181  3.339   1.00 35.86 ? 742 ILE E CA    1 
ATOM   3645 C C     . ILE H 3 40 ? 21.670  25.305  2.911   1.00 37.48 ? 742 ILE E C     1 
ATOM   3646 O O     . ILE H 3 40 ? 20.732  25.078  2.144   1.00 36.92 ? 742 ILE E O     1 
ATOM   3647 C CB    . ILE H 3 40 ? 22.321  23.730  4.794   1.00 35.77 ? 742 ILE E CB    1 
ATOM   3648 C CG1   . ILE H 3 40 ? 23.074  22.428  5.083   1.00 35.12 ? 742 ILE E CG1   1 
ATOM   3649 C CG2   . ILE H 3 40 ? 20.827  23.546  5.007   1.00 34.41 ? 742 ILE E CG2   1 
ATOM   3650 C CD1   . ILE H 3 40 ? 22.847  21.864  6.476   1.00 37.26 ? 742 ILE E CD1   1 
ATOM   3651 N N     . LEU H 3 41 ? 21.923  26.522  3.384   1.00 37.72 ? 743 LEU E N     1 
ATOM   3652 C CA    . LEU H 3 41 ? 21.057  27.651  3.045   1.00 36.63 ? 743 LEU E CA    1 
ATOM   3653 C C     . LEU H 3 41 ? 21.085  27.988  1.561   1.00 37.41 ? 743 LEU E C     1 
ATOM   3654 O O     . LEU H 3 41 ? 20.033  28.140  0.932   1.00 35.85 ? 743 LEU E O     1 
ATOM   3655 C CB    . LEU H 3 41 ? 21.449  28.879  3.874   1.00 34.31 ? 743 LEU E CB    1 
ATOM   3656 C CG    . LEU H 3 41 ? 21.263  28.741  5.392   1.00 29.76 ? 743 LEU E CG    1 
ATOM   3657 C CD1   . LEU H 3 41 ? 21.611  30.063  6.060   1.00 31.78 ? 743 LEU E CD1   1 
ATOM   3658 C CD2   . LEU H 3 41 ? 19.828  28.339  5.696   1.00 26.27 ? 743 LEU E CD2   1 
ATOM   3659 N N     . ASP H 3 42 ? 22.292  28.087  1.005   1.00 38.82 ? 744 ASP E N     1 
ATOM   3660 C CA    . ASP H 3 42 ? 22.470  28.407  -0.406  1.00 41.32 ? 744 ASP E CA    1 
ATOM   3661 C C     . ASP H 3 42 ? 21.948  27.309  -1.327  1.00 40.60 ? 744 ASP E C     1 
ATOM   3662 O O     . ASP H 3 42 ? 21.305  27.599  -2.334  1.00 41.74 ? 744 ASP E O     1 
ATOM   3663 C CB    . ASP H 3 42 ? 23.948  28.675  -0.709  1.00 44.54 ? 744 ASP E CB    1 
ATOM   3664 C CG    . ASP H 3 42 ? 24.544  29.748  0.186   1.00 48.46 ? 744 ASP E CG    1 
ATOM   3665 O OD1   . ASP H 3 42 ? 23.798  30.658  0.614   1.00 49.89 ? 744 ASP E OD1   1 
ATOM   3666 O OD2   . ASP H 3 42 ? 25.764  29.686  0.453   1.00 50.49 ? 744 ASP E OD2   1 
ATOM   3667 N N     . LYS H 3 43 ? 22.204  26.049  -0.986  1.00 40.52 ? 745 LYS E N     1 
ATOM   3668 C CA    . LYS H 3 43 ? 21.730  24.947  -1.824  1.00 39.29 ? 745 LYS E CA    1 
ATOM   3669 C C     . LYS H 3 43 ? 20.221  24.740  -1.716  1.00 37.90 ? 745 LYS E C     1 
ATOM   3670 O O     . LYS H 3 43 ? 19.580  24.305  -2.675  1.00 36.09 ? 745 LYS E O     1 
ATOM   3671 C CB    . LYS H 3 43 ? 22.462  23.643  -1.484  1.00 40.42 ? 745 LYS E CB    1 
ATOM   3672 C CG    . LYS H 3 43 ? 23.924  23.620  -1.911  1.00 42.85 ? 745 LYS E CG    1 
ATOM   3673 C CD    . LYS H 3 43 ? 24.070  23.787  -3.424  1.00 45.93 ? 745 LYS E CD    1 
ATOM   3674 C CE    . LYS H 3 43 ? 25.525  23.951  -3.834  1.00 47.33 ? 745 LYS E CE    1 
ATOM   3675 N NZ    . LYS H 3 43 ? 25.667  24.198  -5.302  1.00 49.75 ? 745 LYS E NZ    1 
ATOM   3676 N N     . ALA H 3 44 ? 19.648  25.027  -0.552  1.00 35.92 ? 746 ALA E N     1 
ATOM   3677 C CA    . ALA H 3 44 ? 18.202  24.879  -0.399  1.00 36.43 ? 746 ALA E CA    1 
ATOM   3678 C C     . ALA H 3 44 ? 17.544  25.981  -1.214  1.00 34.45 ? 746 ALA E C     1 
ATOM   3679 O O     . ALA H 3 44 ? 16.462  25.804  -1.764  1.00 35.94 ? 746 ALA E O     1 
ATOM   3680 C CB    . ALA H 3 44 ? 17.786  25.004  1.078   1.00 35.29 ? 746 ALA E CB    1 
ATOM   3681 N N     . THR H 3 45 ? 18.206  27.129  -1.273  1.00 35.71 ? 747 THR E N     1 
ATOM   3682 C CA    . THR H 3 45 ? 17.684  28.260  -2.016  1.00 36.51 ? 747 THR E CA    1 
ATOM   3683 C C     . THR H 3 45 ? 17.676  27.943  -3.515  1.00 37.22 ? 747 THR E C     1 
ATOM   3684 O O     . THR H 3 45 ? 16.653  28.113  -4.187  1.00 36.30 ? 747 THR E O     1 
ATOM   3685 C CB    . THR H 3 45 ? 18.526  29.520  -1.733  1.00 37.62 ? 747 THR E CB    1 
ATOM   3686 O OG1   . THR H 3 45 ? 18.493  29.794  -0.333  1.00 37.03 ? 747 THR E OG1   1 
ATOM   3687 C CG2   . THR H 3 45 ? 17.983  30.722  -2.482  1.00 38.84 ? 747 THR E CG2   1 
ATOM   3688 N N     . GLU H 3 46 ? 18.799  27.460  -4.042  1.00 37.18 ? 748 GLU E N     1 
ATOM   3689 C CA    . GLU H 3 46 ? 18.842  27.140  -5.463  1.00 39.29 ? 748 GLU E CA    1 
ATOM   3690 C C     . GLU H 3 46 ? 17.943  25.965  -5.812  1.00 38.15 ? 748 GLU E C     1 
ATOM   3691 O O     . GLU H 3 46 ? 17.423  25.899  -6.928  1.00 38.04 ? 748 GLU E O     1 
ATOM   3692 C CB    . GLU H 3 46 ? 20.278  26.886  -5.948  1.00 42.32 ? 748 GLU E CB    1 
ATOM   3693 C CG    . GLU H 3 46 ? 21.062  25.821  -5.213  1.00 46.50 ? 748 GLU E CG    1 
ATOM   3694 C CD    . GLU H 3 46 ? 22.491  25.690  -5.746  1.00 50.75 ? 748 GLU E CD    1 
ATOM   3695 O OE1   . GLU H 3 46 ? 22.673  25.164  -6.866  1.00 51.83 ? 748 GLU E OE1   1 
ATOM   3696 O OE2   . GLU H 3 46 ? 23.432  26.124  -5.050  1.00 52.93 ? 748 GLU E OE2   1 
ATOM   3697 N N     . TYR H 3 47 ? 17.731  25.044  -4.873  1.00 36.53 ? 749 TYR E N     1 
ATOM   3698 C CA    . TYR H 3 47 ? 16.849  23.915  -5.170  1.00 36.51 ? 749 TYR E CA    1 
ATOM   3699 C C     . TYR H 3 47 ? 15.410  24.412  -5.264  1.00 36.28 ? 749 TYR E C     1 
ATOM   3700 O O     . TYR H 3 47 ? 14.669  24.010  -6.163  1.00 36.29 ? 749 TYR E O     1 
ATOM   3701 C CB    . TYR H 3 47 ? 16.932  22.827  -4.096  1.00 35.33 ? 749 TYR E CB    1 
ATOM   3702 C CG    . TYR H 3 47 ? 16.080  21.610  -4.404  1.00 36.21 ? 749 TYR E CG    1 
ATOM   3703 C CD1   . TYR H 3 47 ? 16.210  20.935  -5.619  1.00 36.41 ? 749 TYR E CD1   1 
ATOM   3704 C CD2   . TYR H 3 47 ? 15.153  21.127  -3.484  1.00 35.67 ? 749 TYR E CD2   1 
ATOM   3705 C CE1   . TYR H 3 47 ? 15.443  19.812  -5.908  1.00 35.87 ? 749 TYR E CE1   1 
ATOM   3706 C CE2   . TYR H 3 47 ? 14.382  20.007  -3.764  1.00 36.02 ? 749 TYR E CE2   1 
ATOM   3707 C CZ    . TYR H 3 47 ? 14.537  19.353  -4.981  1.00 35.90 ? 749 TYR E CZ    1 
ATOM   3708 O OH    . TYR H 3 47 ? 13.800  18.234  -5.260  1.00 35.72 ? 749 TYR E OH    1 
ATOM   3709 N N     . ILE H 3 48 ? 15.013  25.288  -4.340  1.00 36.58 ? 750 ILE E N     1 
ATOM   3710 C CA    . ILE H 3 48 ? 13.645  25.816  -4.360  1.00 36.08 ? 750 ILE E CA    1 
ATOM   3711 C C     . ILE H 3 48 ? 13.421  26.556  -5.662  1.00 36.74 ? 750 ILE E C     1 
ATOM   3712 O O     . ILE H 3 48 ? 12.380  26.410  -6.294  1.00 35.73 ? 750 ILE E O     1 
ATOM   3713 C CB    . ILE H 3 48 ? 13.374  26.771  -3.180  1.00 38.23 ? 750 ILE E CB    1 
ATOM   3714 C CG1   . ILE H 3 48 ? 13.304  25.971  -1.877  1.00 37.60 ? 750 ILE E CG1   1 
ATOM   3715 C CG2   . ILE H 3 48 ? 12.057  27.546  -3.408  1.00 37.31 ? 750 ILE E CG2   1 
ATOM   3716 C CD1   . ILE H 3 48 ? 13.246  26.834  -0.635  1.00 38.45 ? 750 ILE E CD1   1 
ATOM   3717 N N     . GLN H 3 49 ? 14.411  27.339  -6.076  1.00 38.53 ? 751 GLN E N     1 
ATOM   3718 C CA    . GLN H 3 49 ? 14.298  28.083  -7.331  1.00 41.14 ? 751 GLN E CA    1 
ATOM   3719 C C     . GLN H 3 49 ? 14.241  27.119  -8.516  1.00 41.40 ? 751 GLN E C     1 
ATOM   3720 O O     . GLN H 3 49 ? 13.469  27.319  -9.454  1.00 42.26 ? 751 GLN E O     1 
ATOM   3721 C CB    . GLN H 3 49 ? 15.485  29.024  -7.504  1.00 42.92 ? 751 GLN E CB    1 
ATOM   3722 C CG    . GLN H 3 49 ? 15.670  29.992  -6.363  1.00 46.30 ? 751 GLN E CG    1 
ATOM   3723 C CD    . GLN H 3 49 ? 16.042  31.364  -6.850  1.00 48.94 ? 751 GLN E CD    1 
ATOM   3724 O OE1   . GLN H 3 49 ? 15.221  32.053  -7.455  1.00 51.80 ? 751 GLN E OE1   1 
ATOM   3725 N NE2   . GLN H 3 49 ? 17.284  31.770  -6.604  1.00 49.02 ? 751 GLN E NE2   1 
ATOM   3726 N N     . TYR H 3 50 ? 15.076  26.085  -8.479  1.00 43.63 ? 752 TYR E N     1 
ATOM   3727 C CA    . TYR H 3 50 ? 15.097  25.089  -9.544  1.00 45.20 ? 752 TYR E CA    1 
ATOM   3728 C C     . TYR H 3 50 ? 13.734  24.412  -9.662  1.00 45.14 ? 752 TYR E C     1 
ATOM   3729 O O     . TYR H 3 50 ? 13.243  24.179  -10.767 1.00 45.37 ? 752 TYR E O     1 
ATOM   3730 C CB    . TYR H 3 50 ? 16.178  24.034  -9.277  1.00 47.45 ? 752 TYR E CB    1 
ATOM   3731 C CG    . TYR H 3 50 ? 15.997  22.761  -10.086 1.00 48.13 ? 752 TYR E CG    1 
ATOM   3732 C CD1   . TYR H 3 50 ? 16.084  22.770  -11.478 1.00 49.96 ? 752 TYR E CD1   1 
ATOM   3733 C CD2   . TYR H 3 50 ? 15.682  21.562  -9.458  1.00 49.40 ? 752 TYR E CD2   1 
ATOM   3734 C CE1   . TYR H 3 50 ? 15.853  21.611  -12.223 1.00 51.35 ? 752 TYR E CE1   1 
ATOM   3735 C CE2   . TYR H 3 50 ? 15.450  20.401  -10.188 1.00 51.14 ? 752 TYR E CE2   1 
ATOM   3736 C CZ    . TYR H 3 50 ? 15.532  20.430  -11.565 1.00 51.71 ? 752 TYR E CZ    1 
ATOM   3737 O OH    . TYR H 3 50 ? 15.256  19.283  -12.274 1.00 52.63 ? 752 TYR E OH    1 
ATOM   3738 N N     . MET H 3 51 ? 13.126  24.102  -8.519  1.00 46.08 ? 753 MET E N     1 
ATOM   3739 C CA    . MET H 3 51 ? 11.823  23.451  -8.492  1.00 47.90 ? 753 MET E CA    1 
ATOM   3740 C C     . MET H 3 51 ? 10.718  24.370  -8.984  1.00 49.30 ? 753 MET E C     1 
ATOM   3741 O O     . MET H 3 51 ? 9.747   23.922  -9.599  1.00 48.15 ? 753 MET E O     1 
ATOM   3742 C CB    . MET H 3 51 ? 11.504  22.961  -7.073  1.00 49.29 ? 753 MET E CB    1 
ATOM   3743 C CG    . MET H 3 51 ? 12.387  21.804  -6.608  1.00 49.91 ? 753 MET E CG    1 
ATOM   3744 S SD    . MET H 3 51 ? 12.042  20.265  -7.493  1.00 52.62 ? 753 MET E SD    1 
ATOM   3745 C CE    . MET H 3 51 ? 12.593  20.613  -9.038  1.00 52.34 ? 753 MET E CE    1 
ATOM   3746 N N     . ARG H 3 52 ? 10.871  25.661  -8.722  1.00 51.17 ? 754 ARG E N     1 
ATOM   3747 C CA    . ARG H 3 52 ? 9.872   26.631  -9.144  1.00 54.47 ? 754 ARG E CA    1 
ATOM   3748 C C     . ARG H 3 52 ? 9.882   26.784  -10.659 1.00 54.89 ? 754 ARG E C     1 
ATOM   3749 O O     . ARG H 3 52 ? 8.850   27.073  -11.259 1.00 55.65 ? 754 ARG E O     1 
ATOM   3750 C CB    . ARG H 3 52 ? 10.130  27.978  -8.469  1.00 56.21 ? 754 ARG E CB    1 
ATOM   3751 C CG    . ARG H 3 52 ? 9.024   28.993  -8.668  1.00 58.35 ? 754 ARG E CG    1 
ATOM   3752 C CD    . ARG H 3 52 ? 9.090   30.048  -7.585  1.00 60.62 ? 754 ARG E CD    1 
ATOM   3753 N NE    . ARG H 3 52 ? 10.416  30.650  -7.511  1.00 63.06 ? 754 ARG E NE    1 
ATOM   3754 C CZ    . ARG H 3 52 ? 10.841  31.394  -6.498  1.00 64.15 ? 754 ARG E CZ    1 
ATOM   3755 N NH1   . ARG H 3 52 ? 10.040  31.632  -5.464  1.00 63.97 ? 754 ARG E NH1   1 
ATOM   3756 N NH2   . ARG H 3 52 ? 12.070  31.897  -6.518  1.00 64.85 ? 754 ARG E NH2   1 
ATOM   3757 N N     . ARG H 3 53 ? 11.044  26.575  -11.273 1.00 55.95 ? 755 ARG E N     1 
ATOM   3758 C CA    . ARG H 3 53 ? 11.172  26.673  -12.726 1.00 57.55 ? 755 ARG E CA    1 
ATOM   3759 C C     . ARG H 3 53 ? 10.760  25.354  -13.381 1.00 57.58 ? 755 ARG E C     1 
ATOM   3760 O O     . ARG H 3 53 ? 10.223  25.337  -14.490 1.00 56.91 ? 755 ARG E O     1 
ATOM   3761 C CB    . ARG H 3 53 ? 12.613  27.009  -13.123 1.00 58.48 ? 755 ARG E CB    1 
ATOM   3762 C CG    . ARG H 3 53 ? 13.150  28.281  -12.492 1.00 60.57 ? 755 ARG E CG    1 
ATOM   3763 C CD    . ARG H 3 53 ? 14.534  28.625  -13.015 1.00 61.54 ? 755 ARG E CD    1 
ATOM   3764 N NE    . ARG H 3 53 ? 15.124  29.738  -12.273 1.00 63.44 ? 755 ARG E NE    1 
ATOM   3765 C CZ    . ARG H 3 53 ? 15.682  29.626  -11.072 1.00 64.92 ? 755 ARG E CZ    1 
ATOM   3766 N NH1   . ARG H 3 53 ? 15.737  28.445  -10.470 1.00 64.70 ? 755 ARG E NH1   1 
ATOM   3767 N NH2   . ARG H 3 53 ? 16.175  30.699  -10.463 1.00 65.97 ? 755 ARG E NH2   1 
ATOM   3768 N N     . LYS H 3 54 ? 11.021  24.249  -12.690 1.00 57.76 ? 756 LYS E N     1 
ATOM   3769 C CA    . LYS H 3 54 ? 10.665  22.928  -13.194 1.00 58.69 ? 756 LYS E CA    1 
ATOM   3770 C C     . LYS H 3 54 ? 9.144   22.811  -13.232 1.00 58.85 ? 756 LYS E C     1 
ATOM   3771 O O     . LYS H 3 54 ? 8.583   22.196  -14.137 1.00 58.91 ? 756 LYS E O     1 
ATOM   3772 C CB    . LYS H 3 54 ? 11.259  21.843  -12.291 1.00 59.29 ? 756 LYS E CB    1 
ATOM   3773 C CG    . LYS H 3 54 ? 10.965  20.418  -12.727 1.00 61.31 ? 756 LYS E CG    1 
ATOM   3774 C CD    . LYS H 3 54 ? 11.669  19.431  -11.807 1.00 62.39 ? 756 LYS E CD    1 
ATOM   3775 C CE    . LYS H 3 54 ? 11.257  17.996  -12.084 1.00 64.71 ? 756 LYS E CE    1 
ATOM   3776 N NZ    . LYS H 3 54 ? 11.631  17.543  -13.451 1.00 65.59 ? 756 LYS E NZ    1 
ATOM   3777 N N     . ASN H 3 55 ? 8.480   23.414  -12.249 1.00 59.24 ? 757 ASN E N     1 
ATOM   3778 C CA    . ASN H 3 55 ? 7.021   23.382  -12.187 1.00 59.88 ? 757 ASN E CA    1 
ATOM   3779 C C     . ASN H 3 55 ? 6.401   24.343  -13.195 1.00 59.73 ? 757 ASN E C     1 
ATOM   3780 O O     . ASN H 3 55 ? 5.346   24.060  -13.759 1.00 58.54 ? 757 ASN E O     1 
ATOM   3781 C CB    . ASN H 3 55 ? 6.533   23.721  -10.772 1.00 60.26 ? 757 ASN E CB    1 
ATOM   3782 C CG    . ASN H 3 55 ? 6.400   22.485  -9.886  1.00 61.67 ? 757 ASN E CG    1 
ATOM   3783 O OD1   . ASN H 3 55 ? 5.511   21.654  -10.093 1.00 62.83 ? 757 ASN E OD1   1 
ATOM   3784 N ND2   . ASN H 3 55 ? 7.285   22.358  -8.900  1.00 60.36 ? 757 ASN E ND2   1 
ATOM   3785 N N     . HIS H 3 56 ? 7.060   25.479  -13.414 1.00 60.72 ? 758 HIS E N     1 
ATOM   3786 C CA    . HIS H 3 56 ? 6.577   26.475  -14.364 1.00 61.54 ? 758 HIS E CA    1 
ATOM   3787 C C     . HIS H 3 56 ? 6.611   25.870  -15.756 1.00 61.06 ? 758 HIS E C     1 
ATOM   3788 O O     . HIS H 3 56 ? 5.689   26.046  -16.547 1.00 61.71 ? 758 HIS E O     1 
ATOM   3789 C CB    . HIS H 3 56 ? 7.462   27.719  -14.334 1.00 63.76 ? 758 HIS E CB    1 
ATOM   3790 C CG    . HIS H 3 56 ? 6.937   28.849  -15.164 1.00 66.53 ? 758 HIS E CG    1 
ATOM   3791 N ND1   . HIS H 3 56 ? 5.780   29.529  -14.847 1.00 67.38 ? 758 HIS E ND1   1 
ATOM   3792 C CD2   . HIS H 3 56 ? 7.402   29.408  -16.307 1.00 67.15 ? 758 HIS E CD2   1 
ATOM   3793 C CE1   . HIS H 3 56 ? 5.555   30.458  -15.759 1.00 68.44 ? 758 HIS E CE1   1 
ATOM   3794 N NE2   . HIS H 3 56 ? 6.524   30.406  -16.656 1.00 68.40 ? 758 HIS E NE2   1 
ATOM   3795 N N     . THR H 3 57 ? 7.692   25.159  -16.052 1.00 61.25 ? 759 THR E N     1 
ATOM   3796 C CA    . THR H 3 57 ? 7.840   24.506  -17.345 1.00 61.50 ? 759 THR E CA    1 
ATOM   3797 C C     . THR H 3 57 ? 6.683   23.522  -17.522 1.00 61.27 ? 759 THR E C     1 
ATOM   3798 O O     . THR H 3 57 ? 5.993   23.542  -18.543 1.00 60.00 ? 759 THR E O     1 
ATOM   3799 C CB    . THR H 3 57 ? 9.190   23.757  -17.430 1.00 62.47 ? 759 THR E CB    1 
ATOM   3800 O OG1   . THR H 3 57 ? 10.257  24.711  -17.468 1.00 63.58 ? 759 THR E OG1   1 
ATOM   3801 C CG2   . THR H 3 57 ? 9.256   22.889  -18.673 1.00 63.34 ? 759 THR E CG2   1 
ATOM   3802 N N     . HIS H 3 58 ? 6.466   22.678  -16.513 1.00 60.34 ? 760 HIS E N     1 
ATOM   3803 C CA    . HIS H 3 58 ? 5.388   21.694  -16.549 1.00 59.99 ? 760 HIS E CA    1 
ATOM   3804 C C     . HIS H 3 58 ? 4.034   22.352  -16.753 1.00 60.03 ? 760 HIS E C     1 
ATOM   3805 O O     . HIS H 3 58 ? 3.178   21.821  -17.456 1.00 59.48 ? 760 HIS E O     1 
ATOM   3806 C CB    . HIS H 3 58 ? 5.357   20.882  -15.257 1.00 59.50 ? 760 HIS E CB    1 
ATOM   3807 C CG    . HIS H 3 58 ? 6.531   19.974  -15.086 1.00 60.25 ? 760 HIS E CG    1 
ATOM   3808 N ND1   . HIS H 3 58 ? 6.714   19.198  -13.963 1.00 60.89 ? 760 HIS E ND1   1 
ATOM   3809 C CD2   . HIS H 3 58 ? 7.581   19.712  -15.899 1.00 61.20 ? 760 HIS E CD2   1 
ATOM   3810 C CE1   . HIS H 3 58 ? 7.826   18.498  -14.090 1.00 61.16 ? 760 HIS E CE1   1 
ATOM   3811 N NE2   . HIS H 3 58 ? 8.371   18.792  -15.256 1.00 62.25 ? 760 HIS E NE2   1 
ATOM   3812 N N     . GLN H 3 59 ? 3.836   23.507  -16.130 1.00 60.27 ? 761 GLN E N     1 
ATOM   3813 C CA    . GLN H 3 59 ? 2.573   24.211  -16.273 1.00 61.56 ? 761 GLN E CA    1 
ATOM   3814 C C     . GLN H 3 59 ? 2.376   24.615  -17.727 1.00 61.91 ? 761 GLN E C     1 
ATOM   3815 O O     . GLN H 3 59 ? 1.270   24.537  -18.258 1.00 62.30 ? 761 GLN E O     1 
ATOM   3816 C CB    . GLN H 3 59 ? 2.545   25.450  -15.380 1.00 62.33 ? 761 GLN E CB    1 
ATOM   3817 C CG    . GLN H 3 59 ? 1.178   26.086  -15.313 1.00 62.86 ? 761 GLN E CG    1 
ATOM   3818 C CD    . GLN H 3 59 ? 0.101   25.058  -15.050 1.00 64.51 ? 761 GLN E CD    1 
ATOM   3819 O OE1   . GLN H 3 59 ? 0.181   24.294  -14.085 1.00 65.32 ? 761 GLN E OE1   1 
ATOM   3820 N NE2   . GLN H 3 59 ? -0.913  25.026  -15.912 1.00 63.33 ? 761 GLN E NE2   1 
ATOM   3821 N N     . GLN H 3 60 ? 3.457   25.048  -18.367 1.00 62.60 ? 762 GLN E N     1 
ATOM   3822 C CA    . GLN H 3 60 ? 3.407   25.447  -19.767 1.00 63.57 ? 762 GLN E CA    1 
ATOM   3823 C C     . GLN H 3 60 ? 3.128   24.216  -20.626 1.00 63.48 ? 762 GLN E C     1 
ATOM   3824 O O     . GLN H 3 60 ? 2.497   24.306  -21.678 1.00 62.69 ? 762 GLN E O     1 
ATOM   3825 C CB    . GLN H 3 60 ? 4.740   26.078  -20.183 1.00 64.70 ? 762 GLN E CB    1 
ATOM   3826 C CG    . GLN H 3 60 ? 4.829   26.448  -21.659 1.00 67.05 ? 762 GLN E CG    1 
ATOM   3827 C CD    . GLN H 3 60 ? 6.188   27.010  -22.039 1.00 69.48 ? 762 GLN E CD    1 
ATOM   3828 O OE1   . GLN H 3 60 ? 6.630   28.022  -21.491 1.00 70.59 ? 762 GLN E OE1   1 
ATOM   3829 N NE2   . GLN H 3 60 ? 6.860   26.354  -22.982 1.00 69.81 ? 762 GLN E NE2   1 
ATOM   3830 N N     . ASP H 3 61 ? 3.612   23.065  -20.170 1.00 63.57 ? 763 ASP E N     1 
ATOM   3831 C CA    . ASP H 3 61 ? 3.417   21.813  -20.889 1.00 63.81 ? 763 ASP E CA    1 
ATOM   3832 C C     . ASP H 3 61 ? 1.964   21.378  -20.760 1.00 63.80 ? 763 ASP E C     1 
ATOM   3833 O O     . ASP H 3 61 ? 1.322   20.999  -21.742 1.00 63.46 ? 763 ASP E O     1 
ATOM   3834 C CB    . ASP H 3 61 ? 4.329   20.723  -20.319 1.00 64.06 ? 763 ASP E CB    1 
ATOM   3835 C CG    . ASP H 3 61 ? 5.801   21.073  -20.425 1.00 64.21 ? 763 ASP E CG    1 
ATOM   3836 O OD1   . ASP H 3 61 ? 6.270   21.366  -21.545 1.00 65.57 ? 763 ASP E OD1   1 
ATOM   3837 O OD2   . ASP H 3 61 ? 6.496   21.049  -19.388 1.00 65.88 ? 763 ASP E OD2   1 
ATOM   3838 N N     . ILE H 3 62 ? 1.457   21.441  -19.534 1.00 63.82 ? 764 ILE E N     1 
ATOM   3839 C CA    . ILE H 3 62 ? 0.086   21.061  -19.242 1.00 64.47 ? 764 ILE E CA    1 
ATOM   3840 C C     . ILE H 3 62 ? -0.899  21.848  -20.103 1.00 65.21 ? 764 ILE E C     1 
ATOM   3841 O O     . ILE H 3 62 ? -1.703  21.258  -20.828 1.00 64.98 ? 764 ILE E O     1 
ATOM   3842 C CB    . ILE H 3 62 ? -0.233  21.281  -17.743 1.00 64.54 ? 764 ILE E CB    1 
ATOM   3843 C CG1   . ILE H 3 62 ? 0.625   20.331  -16.899 1.00 64.14 ? 764 ILE E CG1   1 
ATOM   3844 C CG2   . ILE H 3 62 ? -1.716  21.052  -17.473 1.00 63.67 ? 764 ILE E CG2   1 
ATOM   3845 C CD1   . ILE H 3 62 ? 0.443   20.483  -15.402 1.00 63.87 ? 764 ILE E CD1   1 
ATOM   3846 N N     . ASP H 3 63 ? -0.825  23.175  -20.034 1.00 65.62 ? 765 ASP E N     1 
ATOM   3847 C CA    . ASP H 3 63 ? -1.719  24.027  -20.809 1.00 65.85 ? 765 ASP E CA    1 
ATOM   3848 C C     . ASP H 3 63 ? -1.512  23.891  -22.312 1.00 65.32 ? 765 ASP E C     1 
ATOM   3849 O O     . ASP H 3 63 ? -2.412  24.178  -23.098 1.00 65.02 ? 765 ASP E O     1 
ATOM   3850 C CB    . ASP H 3 63 ? -1.569  25.486  -20.381 1.00 66.81 ? 765 ASP E CB    1 
ATOM   3851 C CG    . ASP H 3 63 ? -2.578  25.882  -19.315 1.00 67.48 ? 765 ASP E CG    1 
ATOM   3852 O OD1   . ASP H 3 63 ? -3.793  25.766  -19.580 1.00 67.25 ? 765 ASP E OD1   1 
ATOM   3853 O OD2   . ASP H 3 63 ? -2.163  26.308  -18.216 1.00 69.20 ? 765 ASP E OD2   1 
ATOM   3854 N N     . ASP H 3 64 ? -0.323  23.460  -22.714 1.00 65.81 ? 766 ASP E N     1 
ATOM   3855 C CA    . ASP H 3 64 ? -0.046  23.254  -24.128 1.00 65.90 ? 766 ASP E CA    1 
ATOM   3856 C C     . ASP H 3 64 ? -0.842  22.018  -24.540 1.00 65.65 ? 766 ASP E C     1 
ATOM   3857 O O     . ASP H 3 64 ? -1.569  22.034  -25.534 1.00 65.72 ? 766 ASP E O     1 
ATOM   3858 C CB    . ASP H 3 64 ? 1.449   23.006  -24.356 1.00 67.33 ? 766 ASP E CB    1 
ATOM   3859 C CG    . ASP H 3 64 ? 2.208   24.267  -24.730 1.00 68.65 ? 766 ASP E CG    1 
ATOM   3860 O OD1   . ASP H 3 64 ? 2.104   25.283  -24.006 1.00 69.28 ? 766 ASP E OD1   1 
ATOM   3861 O OD2   . ASP H 3 64 ? 2.921   24.233  -25.755 1.00 69.96 ? 766 ASP E OD2   1 
ATOM   3862 N N     . LEU H 3 65 ? -0.711  20.954  -23.749 1.00 64.46 ? 767 LEU E N     1 
ATOM   3863 C CA    . LEU H 3 65 ? -1.402  19.699  -24.017 1.00 63.46 ? 767 LEU E CA    1 
ATOM   3864 C C     . LEU H 3 65 ? -2.914  19.861  -24.053 1.00 63.35 ? 767 LEU E C     1 
ATOM   3865 O O     . LEU H 3 65 ? -3.599  19.132  -24.770 1.00 63.50 ? 767 LEU E O     1 
ATOM   3866 C CB    . LEU H 3 65 ? -1.026  18.646  -22.969 1.00 63.09 ? 767 LEU E CB    1 
ATOM   3867 C CG    . LEU H 3 65 ? 0.465   18.317  -22.860 1.00 62.23 ? 767 LEU E CG    1 
ATOM   3868 C CD1   . LEU H 3 65 ? 0.652   17.082  -21.997 1.00 62.35 ? 767 LEU E CD1   1 
ATOM   3869 C CD2   . LEU H 3 65 ? 1.041   18.077  -24.245 1.00 63.26 ? 767 LEU E CD2   1 
ATOM   3870 N N     . LYS H 3 66 ? -3.435  20.813  -23.284 1.00 62.82 ? 768 LYS E N     1 
ATOM   3871 C CA    . LYS H 3 66 ? -4.873  21.056  -23.253 1.00 62.66 ? 768 LYS E CA    1 
ATOM   3872 C C     . LYS H 3 66 ? -5.359  21.653  -24.566 1.00 62.77 ? 768 LYS E C     1 
ATOM   3873 O O     . LYS H 3 66 ? -6.441  21.313  -25.043 1.00 62.44 ? 768 LYS E O     1 
ATOM   3874 C CB    . LYS H 3 66 ? -5.242  21.984  -22.091 1.00 62.37 ? 768 LYS E CB    1 
ATOM   3875 C CG    . LYS H 3 66 ? -5.189  21.316  -20.725 1.00 61.01 ? 768 LYS E CG    1 
ATOM   3876 C CD    . LYS H 3 66 ? -5.608  22.281  -19.638 1.00 61.89 ? 768 LYS E CD    1 
ATOM   3877 C CE    . LYS H 3 66 ? -5.662  21.611  -18.283 1.00 62.27 ? 768 LYS E CE    1 
ATOM   3878 N NZ    . LYS H 3 66 ? -5.957  22.604  -17.222 1.00 63.63 ? 768 LYS E NZ    1 
ATOM   3879 N N     . ARG H 3 67 ? -4.562  22.544  -25.149 1.00 63.91 ? 769 ARG E N     1 
ATOM   3880 C CA    . ARG H 3 67 ? -4.935  23.153  -26.421 1.00 64.63 ? 769 ARG E CA    1 
ATOM   3881 C C     . ARG H 3 67 ? -5.013  22.047  -27.473 1.00 64.75 ? 769 ARG E C     1 
ATOM   3882 O O     . ARG H 3 67 ? -6.028  21.891  -28.157 1.00 64.01 ? 769 ARG E O     1 
ATOM   3883 C CB    . ARG H 3 67 ? -3.905  24.207  -26.850 1.00 65.66 ? 769 ARG E CB    1 
ATOM   3884 C CG    . ARG H 3 67 ? -3.784  25.416  -25.923 1.00 67.40 ? 769 ARG E CG    1 
ATOM   3885 C CD    . ARG H 3 67 ? -3.041  26.554  -26.621 1.00 69.10 ? 769 ARG E CD    1 
ATOM   3886 N NE    . ARG H 3 67 ? -2.816  27.710  -25.756 1.00 71.46 ? 769 ARG E NE    1 
ATOM   3887 C CZ    . ARG H 3 67 ? -2.394  28.899  -26.187 1.00 72.25 ? 769 ARG E CZ    1 
ATOM   3888 N NH1   . ARG H 3 67 ? -2.152  29.097  -27.477 1.00 73.33 ? 769 ARG E NH1   1 
ATOM   3889 N NH2   . ARG H 3 67 ? -2.209  29.894  -25.329 1.00 73.34 ? 769 ARG E NH2   1 
ATOM   3890 N N     . GLN H 3 68 ? -3.935  21.273  -27.581 1.00 64.37 ? 770 GLN E N     1 
ATOM   3891 C CA    . GLN H 3 68 ? -3.865  20.172  -28.532 1.00 64.95 ? 770 GLN E CA    1 
ATOM   3892 C C     . GLN H 3 68 ? -5.074  19.253  -28.409 1.00 65.16 ? 770 GLN E C     1 
ATOM   3893 O O     . GLN H 3 68 ? -5.634  18.814  -29.415 1.00 65.46 ? 770 GLN E O     1 
ATOM   3894 C CB    . GLN H 3 68 ? -2.588  19.364  -28.307 1.00 65.69 ? 770 GLN E CB    1 
ATOM   3895 C CG    . GLN H 3 68 ? -1.311  20.189  -28.321 1.00 66.45 ? 770 GLN E CG    1 
ATOM   3896 C CD    . GLN H 3 68 ? -0.070  19.338  -28.153 1.00 66.87 ? 770 GLN E CD    1 
ATOM   3897 O OE1   . GLN H 3 68 ? 0.042   18.565  -27.202 1.00 68.85 ? 770 GLN E OE1   1 
ATOM   3898 N NE2   . GLN H 3 68 ? 0.874   19.478  -29.075 1.00 67.38 ? 770 GLN E NE2   1 
ATOM   3899 N N     . ASN H 3 69 ? -5.472  18.958  -27.175 1.00 65.22 ? 771 ASN E N     1 
ATOM   3900 C CA    . ASN H 3 69 ? -6.624  18.093  -26.941 1.00 65.98 ? 771 ASN E CA    1 
ATOM   3901 C C     . ASN H 3 69 ? -7.945  18.807  -27.225 1.00 67.09 ? 771 ASN E C     1 
ATOM   3902 O O     . ASN H 3 69 ? -8.899  18.190  -27.701 1.00 66.93 ? 771 ASN E O     1 
ATOM   3903 C CB    . ASN H 3 69 ? -6.631  17.575  -25.499 1.00 64.60 ? 771 ASN E CB    1 
ATOM   3904 C CG    . ASN H 3 69 ? -5.449  16.677  -25.196 1.00 63.99 ? 771 ASN E CG    1 
ATOM   3905 O OD1   . ASN H 3 69 ? -4.854  16.086  -26.099 1.00 62.23 ? 771 ASN E OD1   1 
ATOM   3906 N ND2   . ASN H 3 69 ? -5.113  16.555  -23.916 1.00 62.62 ? 771 ASN E ND2   1 
ATOM   3907 N N     . ALA H 3 70 ? -7.997  20.103  -26.927 1.00 68.15 ? 772 ALA E N     1 
ATOM   3908 C CA    . ALA H 3 70 ? -9.206  20.888  -27.149 1.00 69.59 ? 772 ALA E CA    1 
ATOM   3909 C C     . ALA H 3 70 ? -9.553  20.947  -28.633 1.00 70.79 ? 772 ALA E C     1 
ATOM   3910 O O     . ALA H 3 70 ? -10.725 21.000  -29.008 1.00 71.42 ? 772 ALA E O     1 
ATOM   3911 C CB    . ALA H 3 70 ? -9.022  22.295  -26.597 1.00 68.90 ? 772 ALA E CB    1 
ATOM   3912 N N     . LEU H 3 71 ? -8.529  20.938  -29.477 1.00 71.50 ? 773 LEU E N     1 
ATOM   3913 C CA    . LEU H 3 71 ? -8.739  20.987  -30.916 1.00 73.00 ? 773 LEU E CA    1 
ATOM   3914 C C     . LEU H 3 71 ? -9.181  19.622  -31.428 1.00 73.54 ? 773 LEU E C     1 
ATOM   3915 O O     . LEU H 3 71 ? -10.114 19.526  -32.226 1.00 73.79 ? 773 LEU E O     1 
ATOM   3916 C CB    . LEU H 3 71 ? -7.453  21.426  -31.623 1.00 73.68 ? 773 LEU E CB    1 
ATOM   3917 C CG    . LEU H 3 71 ? -6.885  22.782  -31.184 1.00 74.18 ? 773 LEU E CG    1 
ATOM   3918 C CD1   . LEU H 3 71 ? -5.590  23.062  -31.926 1.00 73.88 ? 773 LEU E CD1   1 
ATOM   3919 C CD2   . LEU H 3 71 ? -7.904  23.882  -31.449 1.00 74.69 ? 773 LEU E CD2   1 
ATOM   3920 N N     . LEU H 3 72 ? -8.514  18.568  -30.963 1.00 74.29 ? 774 LEU E N     1 
ATOM   3921 C CA    . LEU H 3 72 ? -8.854  17.209  -31.377 1.00 75.25 ? 774 LEU E CA    1 
ATOM   3922 C C     . LEU H 3 72 ? -10.312 16.904  -31.066 1.00 75.95 ? 774 LEU E C     1 
ATOM   3923 O O     . LEU H 3 72 ? -10.962 16.151  -31.790 1.00 76.29 ? 774 LEU E O     1 
ATOM   3924 C CB    . LEU H 3 72 ? -7.948  16.184  -30.683 1.00 74.60 ? 774 LEU E CB    1 
ATOM   3925 C CG    . LEU H 3 72 ? -6.496  16.112  -31.166 1.00 74.66 ? 774 LEU E CG    1 
ATOM   3926 C CD1   . LEU H 3 72 ? -5.719  15.122  -30.318 1.00 74.88 ? 774 LEU E CD1   1 
ATOM   3927 C CD2   . LEU H 3 72 ? -6.463  15.700  -32.628 1.00 74.50 ? 774 LEU E CD2   1 
ATOM   3928 N N     . GLU H 3 73 ? -10.822 17.487  -29.987 1.00 77.05 ? 775 GLU E N     1 
ATOM   3929 C CA    . GLU H 3 73 ? -12.213 17.284  -29.607 1.00 78.49 ? 775 GLU E CA    1 
ATOM   3930 C C     . GLU H 3 73 ? -13.081 18.059  -30.591 1.00 79.22 ? 775 GLU E C     1 
ATOM   3931 O O     . GLU H 3 73 ? -14.018 17.510  -31.174 1.00 79.38 ? 775 GLU E O     1 
ATOM   3932 C CB    . GLU H 3 73 ? -12.462 17.796  -28.189 1.00 78.98 ? 775 GLU E CB    1 
ATOM   3933 C CG    . GLU H 3 73 ? -11.595 17.139  -27.134 1.00 80.71 ? 775 GLU E CG    1 
ATOM   3934 C CD    . GLU H 3 73 ? -11.845 17.692  -25.744 1.00 81.38 ? 775 GLU E CD    1 
ATOM   3935 O OE1   . GLU H 3 73 ? -12.967 17.509  -25.222 1.00 81.70 ? 775 GLU E OE1   1 
ATOM   3936 O OE2   . GLU H 3 73 ? -10.920 18.314  -25.177 1.00 81.83 ? 775 GLU E OE2   1 
ATOM   3937 N N     . GLN H 3 74 ? -12.753 19.337  -30.770 1.00 79.67 ? 776 GLN E N     1 
ATOM   3938 C CA    . GLN H 3 74 ? -13.479 20.213  -31.685 1.00 80.04 ? 776 GLN E CA    1 
ATOM   3939 C C     . GLN H 3 74 ? -13.658 19.524  -33.038 1.00 80.05 ? 776 GLN E C     1 
ATOM   3940 O O     . GLN H 3 74 ? -14.672 19.705  -33.712 1.00 80.07 ? 776 GLN E O     1 
ATOM   3941 C CB    . GLN H 3 74 ? -12.712 21.526  -31.868 1.00 80.54 ? 776 GLN E CB    1 
ATOM   3942 C CG    . GLN H 3 74 ? -13.410 22.559  -32.746 1.00 81.18 ? 776 GLN E CG    1 
ATOM   3943 C CD    . GLN H 3 74 ? -12.533 23.770  -33.032 1.00 81.79 ? 776 GLN E CD    1 
ATOM   3944 O OE1   . GLN H 3 74 ? -12.037 24.422  -32.113 1.00 82.41 ? 776 GLN E OE1   1 
ATOM   3945 N NE2   . GLN H 3 74 ? -12.340 24.076  -34.312 1.00 81.95 ? 776 GLN E NE2   1 
ATOM   3946 N N     . GLN H 3 75 ? -12.665 18.735  -33.432 1.00 79.89 ? 777 GLN E N     1 
ATOM   3947 C CA    . GLN H 3 75 ? -12.733 18.018  -34.697 1.00 79.71 ? 777 GLN E CA    1 
ATOM   3948 C C     . GLN H 3 75 ? -13.692 16.839  -34.577 1.00 79.43 ? 777 GLN E C     1 
ATOM   3949 O O     . GLN H 3 75 ? -14.598 16.681  -35.395 1.00 79.50 ? 777 GLN E O     1 
ATOM   3950 C CB    . GLN H 3 75 ? -11.344 17.523  -35.103 1.00 79.52 ? 777 GLN E CB    1 
ATOM   3951 C CG    . GLN H 3 75 ? -10.374 18.635  -35.469 1.00 80.81 ? 777 GLN E CG    1 
ATOM   3952 C CD    . GLN H 3 75 ? -8.977  18.117  -35.758 1.00 81.22 ? 777 GLN E CD    1 
ATOM   3953 O OE1   . GLN H 3 75 ? -8.319  17.554  -34.882 1.00 81.59 ? 777 GLN E OE1   1 
ATOM   3954 N NE2   . GLN H 3 75 ? -8.517  18.304  -36.991 1.00 81.65 ? 777 GLN E NE2   1 
ATOM   3955 N N     . VAL H 3 76 ? -13.490 16.017  -33.550 1.00 78.86 ? 778 VAL E N     1 
ATOM   3956 C CA    . VAL H 3 76 ? -14.339 14.852  -33.325 1.00 78.51 ? 778 VAL E CA    1 
ATOM   3957 C C     . VAL H 3 76 ? -15.809 15.259  -33.292 1.00 78.28 ? 778 VAL E C     1 
ATOM   3958 O O     . VAL H 3 76 ? -16.514 14.903  -34.260 1.00 77.91 ? 778 VAL E O     1 
ATOM   3959 C CB    . VAL H 3 76 ? -13.995 14.145  -31.989 1.00 78.20 ? 778 VAL E CB    1 
ATOM   3960 C CG1   . VAL H 3 76 ? -14.873 12.916  -31.810 1.00 77.81 ? 778 VAL E CG1   1 
ATOM   3961 C CG2   . VAL H 3 76 ? -12.529 13.748  -31.968 1.00 77.85 ? 778 VAL E CG2   1 
HETATM 3962 O O     . HOH I 4 .  ? 5.496   -8.016  -9.159  1.00 40.92 ? 120 HOH F O     1 
HETATM 3963 O O     . HOH I 4 .  ? -13.841 3.583   -14.784 1.00 44.43 ? 121 HOH F O     1 
HETATM 3964 O O     . HOH I 4 .  ? -6.252  1.773   -19.636 1.00 44.90 ? 122 HOH F O     1 
HETATM 3965 O O     . HOH I 4 .  ? 8.093   0.901   -15.461 1.00 46.32 ? 123 HOH F O     1 
HETATM 3966 O O     . HOH I 4 .  ? -22.543 -8.673  -11.510 1.00 66.70 ? 124 HOH F O     1 
HETATM 3967 O O     . HOH I 4 .  ? 2.709   -7.818  -20.672 1.00 43.86 ? 125 HOH F O     1 
HETATM 3968 O O     . HOH I 4 .  ? 4.141   1.230   -16.888 1.00 34.20 ? 126 HOH F O     1 
HETATM 3969 O O     . HOH I 4 .  ? 3.950   -4.643  -9.432  1.00 29.43 ? 127 HOH F O     1 
HETATM 3970 O O     . HOH I 4 .  ? -30.678 -6.133  6.023   1.00 47.96 ? 128 HOH F O     1 
HETATM 3971 O O     . HOH I 4 .  ? -10.970 -1.338  -20.229 1.00 44.38 ? 129 HOH F O     1 
HETATM 3972 O O     . HOH I 4 .  ? -26.945 -5.837  10.603  1.00 54.82 ? 130 HOH F O     1 
HETATM 3973 O O     . HOH I 4 .  ? 11.355  -10.172 -21.556 1.00 52.28 ? 131 HOH F O     1 
HETATM 3974 O O     . HOH I 4 .  ? -30.239 -1.203  8.508   1.00 43.70 ? 132 HOH F O     1 
HETATM 3975 O O     . HOH I 4 .  ? 7.392   -1.549  -16.490 1.00 37.94 ? 133 HOH F O     1 
HETATM 3976 O O     . HOH I 4 .  ? -31.009 -2.467  11.507  1.00 54.61 ? 134 HOH F O     1 
HETATM 3977 O O     . HOH I 4 .  ? -26.616 -0.859  10.522  1.00 63.71 ? 135 HOH F O     1 
HETATM 3978 O O     . HOH I 4 .  ? -9.288  1.782   -20.591 1.00 60.34 ? 136 HOH F O     1 
HETATM 3979 O O     . HOH I 4 .  ? 10.121  -1.343  -11.886 1.00 61.00 ? 137 HOH F O     1 
HETATM 3980 O O     . HOH I 4 .  ? -23.223 -12.465 4.189   1.00 63.73 ? 138 HOH F O     1 
HETATM 3981 O O     . HOH I 4 .  ? -16.855 -14.512 -14.968 1.00 58.23 ? 139 HOH F O     1 
HETATM 3982 O O     . HOH I 4 .  ? -28.745 -3.875  7.742   1.00 53.92 ? 140 HOH F O     1 
HETATM 3983 O O     . HOH I 4 .  ? -7.135  -1.097  -11.075 1.00 46.84 ? 141 HOH F O     1 
HETATM 3984 O O     . HOH I 4 .  ? 7.645   -10.531 -11.821 1.00 59.51 ? 142 HOH F O     1 
HETATM 3985 O O     . HOH I 4 .  ? -24.767 -9.640  -3.493  1.00 57.26 ? 143 HOH F O     1 
HETATM 3986 O O     . HOH I 4 .  ? -17.566 -0.342  -25.476 1.00 54.99 ? 144 HOH F O     1 
HETATM 3987 O O     . HOH I 4 .  ? -15.097 -9.371  -11.686 1.00 48.60 ? 145 HOH F O     1 
HETATM 3988 O O     . HOH J 4 .  ? -5.930  -11.002 -15.057 1.00 31.89 ? 3   HOH G O     1 
HETATM 3989 O O     . HOH J 4 .  ? -35.557 -0.298  -2.403  1.00 33.76 ? 8   HOH G O     1 
HETATM 3990 O O     . HOH J 4 .  ? -10.266 -12.154 -25.530 1.00 56.26 ? 16  HOH G O     1 
HETATM 3991 O O     . HOH J 4 .  ? -0.042  2.617   -21.158 1.00 42.56 ? 20  HOH G O     1 
HETATM 3992 O O     . HOH J 4 .  ? 7.655   3.254   -26.001 1.00 32.84 ? 21  HOH G O     1 
HETATM 3993 O O     . HOH J 4 .  ? -5.871  -7.940  -5.627  1.00 45.14 ? 32  HOH G O     1 
HETATM 3994 O O     . HOH J 4 .  ? -0.542  -2.301  -27.516 1.00 49.39 ? 37  HOH G O     1 
HETATM 3995 O O     . HOH J 4 .  ? 11.115  -4.379  -18.746 1.00 49.91 ? 45  HOH G O     1 
HETATM 3996 O O     . HOH J 4 .  ? -12.033 -6.519  -19.258 1.00 46.28 ? 48  HOH G O     1 
HETATM 3997 O O     . HOH J 4 .  ? -15.947 -5.669  -1.206  1.00 47.48 ? 57  HOH G O     1 
HETATM 3998 O O     . HOH J 4 .  ? -7.560  -3.673  2.114   1.00 47.08 ? 62  HOH G O     1 
HETATM 3999 O O     . HOH J 4 .  ? -21.700 -0.353  1.072   1.00 50.65 ? 63  HOH G O     1 
HETATM 4000 O O     . HOH J 4 .  ? 8.452   -0.388  -18.825 1.00 42.72 ? 64  HOH G O     1 
HETATM 4001 O O     . HOH J 4 .  ? -26.674 -5.864  -4.909  1.00 61.48 ? 70  HOH G O     1 
HETATM 4002 O O     . HOH J 4 .  ? 9.361   6.630   -24.803 1.00 30.83 ? 74  HOH G O     1 
HETATM 4003 O O     . HOH J 4 .  ? -8.167  -2.316  -21.802 1.00 48.06 ? 78  HOH G O     1 
HETATM 4004 O O     . HOH J 4 .  ? -10.162 -4.066  -22.769 1.00 51.66 ? 83  HOH G O     1 
HETATM 4005 O O     . HOH J 4 .  ? 2.321   -5.367  -24.718 1.00 44.70 ? 91  HOH G O     1 
HETATM 4006 O O     . HOH J 4 .  ? 0.320   -7.044  -23.026 1.00 45.87 ? 100 HOH G O     1 
HETATM 4007 O O     . HOH J 4 .  ? -11.914 2.780   3.342   1.00 43.20 ? 121 HOH G O     1 
HETATM 4008 O O     . HOH J 4 .  ? 6.016   1.440   -18.565 1.00 49.88 ? 122 HOH G O     1 
HETATM 4009 O O     . HOH J 4 .  ? -13.453 -9.529  -22.760 1.00 54.69 ? 131 HOH G O     1 
HETATM 4010 O O     . HOH J 4 .  ? -26.960 2.585   0.005   1.00 50.55 ? 136 HOH G O     1 
HETATM 4011 O O     . HOH J 4 .  ? -12.419 -14.926 -14.721 1.00 47.81 ? 154 HOH G O     1 
HETATM 4012 O O     . HOH J 4 .  ? -35.397 -7.607  3.144   1.00 54.83 ? 157 HOH G O     1 
HETATM 4013 O O     . HOH J 4 .  ? -6.850  -3.971  -9.897  1.00 42.30 ? 177 HOH G O     1 
HETATM 4014 O O     . HOH J 4 .  ? -17.825 -2.319  0.882   1.00 60.82 ? 179 HOH G O     1 
HETATM 4015 O O     . HOH J 4 .  ? 5.573   -3.078  -27.561 1.00 43.91 ? 181 HOH G O     1 
HETATM 4016 O O     . HOH J 4 .  ? -13.458 -12.092 -22.039 1.00 58.27 ? 187 HOH G O     1 
HETATM 4017 O O     . HOH J 4 .  ? -12.928 -8.981  -16.689 1.00 42.30 ? 195 HOH G O     1 
HETATM 4018 O O     . HOH J 4 .  ? -28.222 -3.963  -6.515  1.00 58.10 ? 199 HOH G O     1 
HETATM 4019 O O     . HOH J 4 .  ? -11.175 -4.784  3.114   1.00 56.80 ? 201 HOH G O     1 
HETATM 4020 O O     . HOH J 4 .  ? -13.320 -8.932  -5.607  1.00 50.02 ? 210 HOH G O     1 
HETATM 4021 O O     . HOH J 4 .  ? 16.232  -14.230 -21.650 1.00 53.84 ? 211 HOH G O     1 
HETATM 4022 O O     . HOH J 4 .  ? -9.453  -14.517 -22.207 1.00 61.14 ? 223 HOH G O     1 
HETATM 4023 O O     . HOH J 4 .  ? -14.652 -5.986  -19.069 1.00 58.64 ? 229 HOH G O     1 
HETATM 4024 O O     . HOH J 4 .  ? -4.489  4.383   -27.226 1.00 57.01 ? 242 HOH G O     1 
HETATM 4025 O O     . HOH J 4 .  ? -27.432 0.982   -8.157  1.00 55.74 ? 247 HOH G O     1 
HETATM 4026 O O     . HOH K 4 .  ? 44.283  17.176  9.434   1.00 47.18 ? 55  HOH H O     1 
HETATM 4027 O O     . HOH K 4 .  ? 25.518  32.944  17.161  1.00 40.46 ? 56  HOH H O     1 
HETATM 4028 O O     . HOH K 4 .  ? 36.299  21.436  12.560  1.00 51.93 ? 67  HOH H O     1 
HETATM 4029 O O     . HOH K 4 .  ? 14.971  30.030  26.509  1.00 52.79 ? 96  HOH H O     1 
HETATM 4030 O O     . HOH K 4 .  ? 34.403  29.443  24.619  1.00 40.85 ? 97  HOH H O     1 
HETATM 4031 O O     . HOH K 4 .  ? 16.409  34.477  29.482  1.00 53.02 ? 103 HOH H O     1 
HETATM 4032 O O     . HOH K 4 .  ? 13.428  34.829  35.816  1.00 62.68 ? 107 HOH H O     1 
HETATM 4033 O O     . HOH K 4 .  ? 12.872  36.748  14.925  1.00 47.00 ? 125 HOH H O     1 
HETATM 4034 O O     . HOH K 4 .  ? 49.007  18.037  6.833   1.00 55.33 ? 129 HOH H O     1 
HETATM 4035 O O     . HOH K 4 .  ? 11.851  25.745  27.360  1.00 59.60 ? 145 HOH H O     1 
HETATM 4036 O O     . HOH K 4 .  ? 34.897  21.903  18.374  1.00 49.47 ? 146 HOH H O     1 
HETATM 4037 O O     . HOH K 4 .  ? 24.173  36.145  14.302  1.00 48.50 ? 152 HOH H O     1 
HETATM 4038 O O     . HOH K 4 .  ? 50.812  20.035  2.458   1.00 64.32 ? 169 HOH H O     1 
HETATM 4039 O O     . HOH K 4 .  ? 15.670  31.489  28.667  1.00 51.54 ? 183 HOH H O     1 
HETATM 4040 O O     . HOH K 4 .  ? 9.505   40.506  45.081  1.00 51.70 ? 184 HOH H O     1 
HETATM 4041 O O     . HOH K 4 .  ? 38.970  17.945  2.872   1.00 59.42 ? 188 HOH H O     1 
HETATM 4042 O O     . HOH K 4 .  ? 15.132  38.651  20.406  1.00 52.95 ? 196 HOH H O     1 
HETATM 4043 O O     . HOH K 4 .  ? 47.173  18.176  4.710   1.00 56.42 ? 203 HOH H O     1 
HETATM 4044 O O     . HOH K 4 .  ? 22.323  32.893  18.401  1.00 41.28 ? 218 HOH H O     1 
HETATM 4045 O O     . HOH K 4 .  ? 46.740  30.765  23.214  1.00 63.63 ? 226 HOH H O     1 
HETATM 4046 O O     . HOH K 4 .  ? 18.621  36.514  11.521  1.00 57.35 ? 231 HOH H O     1 
HETATM 4047 O O     . HOH K 4 .  ? 45.085  15.763  3.100   1.00 52.78 ? 244 HOH H O     1 
HETATM 4048 O O     . HOH K 4 .  ? 41.843  13.964  14.821  1.00 62.64 ? 245 HOH H O     1 
HETATM 4049 O O     . HOH L 4 .  ? 52.272  25.158  17.637  1.00 50.53 ? 35  HOH J O     1 
HETATM 4050 O O     . HOH L 4 .  ? 26.258  25.723  15.466  1.00 41.99 ? 41  HOH J O     1 
HETATM 4051 O O     . HOH L 4 .  ? 31.028  26.473  3.380   1.00 52.92 ? 54  HOH J O     1 
HETATM 4052 O O     . HOH L 4 .  ? 30.937  33.727  27.144  1.00 42.72 ? 59  HOH J O     1 
HETATM 4053 O O     . HOH L 4 .  ? 24.242  23.884  17.232  1.00 42.25 ? 73  HOH J O     1 
HETATM 4054 O O     . HOH L 4 .  ? 21.015  47.855  24.483  1.00 59.93 ? 75  HOH J O     1 
HETATM 4055 O O     . HOH L 4 .  ? 25.409  39.862  25.691  1.00 51.26 ? 90  HOH J O     1 
HETATM 4056 O O     . HOH L 4 .  ? 29.143  38.564  27.489  1.00 50.72 ? 99  HOH J O     1 
HETATM 4057 O O     . HOH L 4 .  ? 27.618  38.061  24.699  1.00 48.42 ? 110 HOH J O     1 
HETATM 4058 O O     . HOH L 4 .  ? 55.717  24.060  20.350  1.00 38.11 ? 118 HOH J O     1 
HETATM 4059 O O     . HOH L 4 .  ? 32.867  32.020  34.486  1.00 53.11 ? 127 HOH J O     1 
HETATM 4060 O O     . HOH L 4 .  ? 32.125  32.780  31.671  1.00 45.22 ? 139 HOH J O     1 
HETATM 4061 O O     . HOH L 4 .  ? 23.257  35.451  31.553  1.00 52.26 ? 149 HOH J O     1 
HETATM 4062 O O     . HOH L 4 .  ? 19.525  36.503  30.296  1.00 41.08 ? 155 HOH J O     1 
HETATM 4063 O O     . HOH L 4 .  ? 23.548  41.694  23.809  1.00 45.76 ? 176 HOH J O     1 
HETATM 4064 O O     . HOH L 4 .  ? 30.216  20.116  16.101  1.00 60.22 ? 180 HOH J O     1 
HETATM 4065 O O     . HOH L 4 .  ? 2.065   43.287  30.244  1.00 60.62 ? 213 HOH J O     1 
HETATM 4066 O O     . HOH L 4 .  ? 19.635  38.678  32.528  1.00 58.05 ? 228 HOH J O     1 
HETATM 4067 O O     . HOH L 4 .  ? 31.914  22.896  21.053  1.00 51.68 ? 234 HOH J O     1 
HETATM 4068 O O     . HOH L 4 .  ? 27.884  41.199  34.582  1.00 49.74 ? 237 HOH J O     1 
HETATM 4069 O O     . HOH L 4 .  ? 1.675   33.801  23.360  1.00 54.54 ? 240 HOH J O     1 
HETATM 4070 O O     . HOH M 4 .  ? 6.203   -6.468  2.033   1.00 30.40 ? 82  HOH A O     1 
HETATM 4071 O O     . HOH M 4 .  ? -8.502  7.976   -11.323 1.00 38.46 ? 83  HOH A O     1 
HETATM 4072 O O     . HOH M 4 .  ? -7.553  -1.191  -5.654  1.00 38.39 ? 84  HOH A O     1 
HETATM 4073 O O     . HOH M 4 .  ? 4.807   -4.097  2.446   1.00 32.79 ? 85  HOH A O     1 
HETATM 4074 O O     . HOH M 4 .  ? 4.307   -3.030  15.490  1.00 35.41 ? 86  HOH A O     1 
HETATM 4075 O O     . HOH M 4 .  ? 11.739  6.518   27.267  1.00 44.34 ? 87  HOH A O     1 
HETATM 4076 O O     . HOH M 4 .  ? -10.303 0.089   -11.191 1.00 44.91 ? 88  HOH A O     1 
HETATM 4077 O O     . HOH M 4 .  ? -1.325  8.571   2.680   1.00 34.67 ? 89  HOH A O     1 
HETATM 4078 O O     . HOH M 4 .  ? -5.199  11.341  -7.558  1.00 35.71 ? 90  HOH A O     1 
HETATM 4079 O O     . HOH M 4 .  ? 13.381  -0.990  24.691  1.00 39.99 ? 91  HOH A O     1 
HETATM 4080 O O     . HOH M 4 .  ? 13.166  4.606   29.019  1.00 35.45 ? 92  HOH A O     1 
HETATM 4081 O O     . HOH M 4 .  ? -5.184  10.365  -10.491 1.00 41.01 ? 93  HOH A O     1 
HETATM 4082 O O     . HOH M 4 .  ? 33.259  11.070  46.497  1.00 60.16 ? 94  HOH A O     1 
HETATM 4083 O O     . HOH M 4 .  ? 12.322  10.782  3.693   1.00 56.66 ? 95  HOH A O     1 
HETATM 4084 O O     . HOH M 4 .  ? 7.055   -8.776  6.284   1.00 46.58 ? 96  HOH A O     1 
HETATM 4085 O O     . HOH M 4 .  ? 6.707   -6.225  -0.346  1.00 37.69 ? 97  HOH A O     1 
HETATM 4086 O O     . HOH M 4 .  ? 13.781  -2.489  8.110   1.00 37.74 ? 98  HOH A O     1 
HETATM 4087 O O     . HOH M 4 .  ? -23.886 1.903   -12.966 1.00 46.72 ? 99  HOH A O     1 
HETATM 4088 O O     . HOH M 4 .  ? -24.922 -2.704  -17.786 1.00 49.81 ? 100 HOH A O     1 
HETATM 4089 O O     . HOH M 4 .  ? -1.202  13.397  -1.957  1.00 38.79 ? 101 HOH A O     1 
HETATM 4090 O O     . HOH M 4 .  ? -5.175  3.963   -7.867  1.00 49.67 ? 102 HOH A O     1 
HETATM 4091 O O     . HOH M 4 .  ? -10.134 5.566   -2.058  1.00 39.93 ? 103 HOH A O     1 
HETATM 4092 O O     . HOH M 4 .  ? 17.024  4.235   2.526   1.00 43.40 ? 104 HOH A O     1 
HETATM 4093 O O     . HOH M 4 .  ? 11.387  -3.578  14.001  1.00 38.07 ? 105 HOH A O     1 
HETATM 4094 O O     . HOH M 4 .  ? -6.606  10.285  -0.374  1.00 36.51 ? 106 HOH A O     1 
HETATM 4095 O O     . HOH M 4 .  ? 15.625  1.682   35.878  1.00 44.14 ? 107 HOH A O     1 
HETATM 4096 O O     . HOH M 4 .  ? 12.627  -5.315  11.779  1.00 61.91 ? 108 HOH A O     1 
HETATM 4097 O O     . HOH M 4 .  ? -15.143 7.423   -17.215 1.00 51.76 ? 109 HOH A O     1 
HETATM 4098 O O     . HOH M 4 .  ? -27.685 7.385   -14.421 1.00 49.36 ? 110 HOH A O     1 
HETATM 4099 O O     . HOH M 4 .  ? 9.941   4.022   -2.954  1.00 47.68 ? 111 HOH A O     1 
HETATM 4100 O O     . HOH M 4 .  ? -0.265  14.187  -5.008  1.00 54.95 ? 112 HOH A O     1 
HETATM 4101 O O     . HOH M 4 .  ? 24.832  2.635   36.118  1.00 60.03 ? 113 HOH A O     1 
HETATM 4102 O O     . HOH M 4 .  ? 5.180   -5.616  14.756  1.00 52.23 ? 114 HOH A O     1 
HETATM 4103 O O     . HOH M 4 .  ? 10.727  -8.090  5.585   1.00 52.76 ? 115 HOH A O     1 
HETATM 4104 O O     . HOH M 4 .  ? 33.170  13.374  51.876  1.00 60.85 ? 116 HOH A O     1 
HETATM 4105 O O     . HOH M 4 .  ? 14.029  -1.846  27.247  1.00 64.74 ? 117 HOH A O     1 
HETATM 4106 O O     . HOH N 4 .  ? 3.306   -6.723  -7.770  1.00 28.07 ? 279 HOH B O     1 
HETATM 4107 O O     . HOH N 4 .  ? 1.667   -3.767  14.172  1.00 35.65 ? 280 HOH B O     1 
HETATM 4108 O O     . HOH N 4 .  ? -3.211  -4.084  -7.726  1.00 40.18 ? 281 HOH B O     1 
HETATM 4109 O O     . HOH N 4 .  ? -1.704  -10.247 -24.286 1.00 33.87 ? 282 HOH B O     1 
HETATM 4110 O O     . HOH N 4 .  ? -6.037  -9.577  -21.771 1.00 44.58 ? 283 HOH B O     1 
HETATM 4111 O O     . HOH N 4 .  ? -3.741  -5.916  -6.219  1.00 32.32 ? 284 HOH B O     1 
HETATM 4112 O O     . HOH N 4 .  ? 3.633   -11.397 -12.790 1.00 34.32 ? 285 HOH B O     1 
HETATM 4113 O O     . HOH N 4 .  ? 4.240   -7.036  8.504   1.00 47.21 ? 286 HOH B O     1 
HETATM 4114 O O     . HOH N 4 .  ? 5.567   1.387   18.502  1.00 35.27 ? 287 HOH B O     1 
HETATM 4115 O O     . HOH N 4 .  ? -8.642  -0.761  12.572  1.00 55.35 ? 288 HOH B O     1 
HETATM 4116 O O     . HOH N 4 .  ? -1.865  -13.152 1.740   1.00 43.77 ? 289 HOH B O     1 
HETATM 4117 O O     . HOH N 4 .  ? -8.945  5.729   5.198   1.00 51.40 ? 290 HOH B O     1 
HETATM 4118 O O     . HOH N 4 .  ? -2.218  -12.362 -2.084  1.00 46.31 ? 291 HOH B O     1 
HETATM 4119 O O     . HOH N 4 .  ? -11.377 -6.366  12.365  1.00 55.91 ? 292 HOH B O     1 
HETATM 4120 O O     . HOH N 4 .  ? 0.321   10.800  13.374  1.00 44.75 ? 293 HOH B O     1 
HETATM 4121 O O     . HOH N 4 .  ? -9.308  1.470   0.007   1.00 43.29 ? 294 HOH B O     1 
HETATM 4122 O O     . HOH N 4 .  ? 4.713   -8.396  1.279   1.00 44.06 ? 295 HOH B O     1 
HETATM 4123 O O     . HOH N 4 .  ? -6.337  -13.074 -4.582  1.00 52.66 ? 296 HOH B O     1 
HETATM 4124 O O     . HOH N 4 .  ? -6.936  -5.687  4.987   1.00 35.83 ? 297 HOH B O     1 
HETATM 4125 O O     . HOH N 4 .  ? 23.173  11.160  21.767  1.00 50.88 ? 298 HOH B O     1 
HETATM 4126 O O     . HOH N 4 .  ? 1.614   -6.955  -15.695 1.00 33.50 ? 299 HOH B O     1 
HETATM 4127 O O     . HOH N 4 .  ? 4.837   -10.252 -9.914  1.00 39.57 ? 300 HOH B O     1 
HETATM 4128 O O     . HOH N 4 .  ? 36.852  16.732  35.920  1.00 61.35 ? 301 HOH B O     1 
HETATM 4129 O O     . HOH N 4 .  ? 2.676   -10.463 -20.051 1.00 48.46 ? 302 HOH B O     1 
HETATM 4130 O O     . HOH N 4 .  ? -4.348  -12.491 0.493   1.00 56.59 ? 303 HOH B O     1 
HETATM 4131 O O     . HOH N 4 .  ? 9.512   15.366  18.136  1.00 49.22 ? 304 HOH B O     1 
HETATM 4132 O O     . HOH N 4 .  ? -1.111  2.717   15.016  1.00 44.21 ? 305 HOH B O     1 
HETATM 4133 O O     . HOH N 4 .  ? -4.691  -5.627  3.060   1.00 43.73 ? 306 HOH B O     1 
HETATM 4134 O O     . HOH N 4 .  ? 5.268   -12.286 -25.846 1.00 54.20 ? 307 HOH B O     1 
HETATM 4135 O O     . HOH N 4 .  ? 23.536  21.943  29.369  1.00 64.28 ? 308 HOH B O     1 
HETATM 4136 O O     . HOH N 4 .  ? 4.255   -11.942 -21.671 1.00 63.78 ? 309 HOH B O     1 
HETATM 4137 O O     . HOH N 4 .  ? 2.367   13.133  14.998  1.00 52.21 ? 310 HOH B O     1 
HETATM 4138 O O     . HOH N 4 .  ? 0.337   -19.116 -18.170 1.00 51.58 ? 311 HOH B O     1 
HETATM 4139 O O     . HOH N 4 .  ? 9.149   -12.531 -7.579  1.00 61.51 ? 312 HOH B O     1 
HETATM 4140 O O     . HOH N 4 .  ? -5.046  -10.710 -6.519  1.00 49.79 ? 313 HOH B O     1 
HETATM 4141 O O     . HOH N 4 .  ? -6.273  -15.467 -26.944 1.00 63.79 ? 314 HOH B O     1 
HETATM 4142 O O     . HOH N 4 .  ? 3.182   -0.548  19.424  1.00 48.40 ? 315 HOH B O     1 
HETATM 4143 O O     . HOH N 4 .  ? -6.623  -8.964  8.722   1.00 53.72 ? 316 HOH B O     1 
HETATM 4144 O O     . HOH O 4 .  ? 29.367  33.308  16.820  1.00 30.53 ? 7   HOH D O     1 
HETATM 4145 O O     . HOH O 4 .  ? 7.249   27.332  10.783  1.00 40.42 ? 10  HOH D O     1 
HETATM 4146 O O     . HOH O 4 .  ? 20.383  39.736  6.059   1.00 44.29 ? 11  HOH D O     1 
HETATM 4147 O O     . HOH O 4 .  ? 13.895  22.159  8.580   1.00 31.70 ? 12  HOH D O     1 
HETATM 4148 O O     . HOH O 4 .  ? 14.799  30.385  16.033  1.00 48.08 ? 30  HOH D O     1 
HETATM 4149 O O     . HOH O 4 .  ? 44.935  40.084  20.230  1.00 54.54 ? 34  HOH D O     1 
HETATM 4150 O O     . HOH O 4 .  ? 6.669   15.547  -0.978  1.00 33.01 ? 50  HOH D O     1 
HETATM 4151 O O     . HOH O 4 .  ? 0.560   15.974  -32.704 1.00 57.90 ? 66  HOH D O     1 
HETATM 4152 O O     . HOH O 4 .  ? 0.632   4.295   -17.615 1.00 52.30 ? 69  HOH D O     1 
HETATM 4153 O O     . HOH O 4 .  ? 7.512   11.612  -10.893 1.00 60.62 ? 77  HOH D O     1 
HETATM 4154 O O     . HOH O 4 .  ? 15.159  35.043  10.146  1.00 49.49 ? 98  HOH D O     1 
HETATM 4155 O O     . HOH O 4 .  ? -5.122  11.910  -14.027 1.00 42.92 ? 106 HOH D O     1 
HETATM 4156 O O     . HOH O 4 .  ? -6.185  10.381  -19.605 1.00 55.44 ? 112 HOH D O     1 
HETATM 4157 O O     . HOH O 4 .  ? 42.420  33.797  19.118  1.00 43.67 ? 114 HOH D O     1 
HETATM 4158 O O     . HOH O 4 .  ? 3.413   11.094  -10.180 1.00 53.33 ? 115 HOH D O     1 
HETATM 4159 O O     . HOH O 4 .  ? 28.707  32.120  6.737   1.00 44.90 ? 116 HOH D O     1 
HETATM 4160 O O     . HOH O 4 .  ? 35.172  31.464  12.294  1.00 38.93 ? 119 HOH D O     1 
HETATM 4161 O O     . HOH O 4 .  ? 43.044  33.903  15.521  1.00 54.24 ? 120 HOH D O     1 
HETATM 4162 O O     . HOH O 4 .  ? 41.188  40.866  22.049  1.00 47.81 ? 130 HOH D O     1 
HETATM 4163 O O     . HOH O 4 .  ? -0.172  13.614  -35.830 1.00 56.44 ? 140 HOH D O     1 
HETATM 4164 O O     . HOH O 4 .  ? -1.814  18.936  -12.869 1.00 56.96 ? 144 HOH D O     1 
HETATM 4165 O O     . HOH O 4 .  ? 14.819  35.907  -1.809  1.00 45.98 ? 147 HOH D O     1 
HETATM 4166 O O     . HOH O 4 .  ? 27.894  39.666  12.197  1.00 41.08 ? 151 HOH D O     1 
HETATM 4167 O O     . HOH O 4 .  ? 12.519  20.683  10.090  1.00 49.52 ? 156 HOH D O     1 
HETATM 4168 O O     . HOH O 4 .  ? 40.568  42.521  13.038  1.00 58.16 ? 159 HOH D O     1 
HETATM 4169 O O     . HOH O 4 .  ? 30.490  37.150  3.436   1.00 60.46 ? 160 HOH D O     1 
HETATM 4170 O O     . HOH O 4 .  ? 0.501   8.944   -10.670 1.00 58.91 ? 162 HOH D O     1 
HETATM 4171 O O     . HOH O 4 .  ? -10.307 4.662   -36.193 1.00 48.04 ? 172 HOH D O     1 
HETATM 4172 O O     . HOH O 4 .  ? 24.386  34.388  12.009  1.00 49.66 ? 175 HOH D O     1 
HETATM 4173 O O     . HOH O 4 .  ? -8.629  3.997   -28.475 1.00 64.06 ? 189 HOH D O     1 
HETATM 4174 O O     . HOH O 4 .  ? 0.467   25.634  -4.916  1.00 50.28 ? 190 HOH D O     1 
HETATM 4175 O O     . HOH O 4 .  ? 36.708  42.327  8.811   1.00 50.92 ? 194 HOH D O     1 
HETATM 4176 O O     . HOH O 4 .  ? -2.845  15.509  -10.767 1.00 47.48 ? 207 HOH D O     1 
HETATM 4177 O O     . HOH O 4 .  ? 24.623  40.732  7.814   1.00 54.25 ? 216 HOH D O     1 
HETATM 4178 O O     . HOH O 4 .  ? -2.694  17.400  -4.438  1.00 64.15 ? 217 HOH D O     1 
HETATM 4179 O O     . HOH O 4 .  ? 30.152  29.245  7.421   1.00 53.91 ? 220 HOH D O     1 
HETATM 4180 O O     . HOH O 4 .  ? -10.423 15.884  -19.146 1.00 53.53 ? 232 HOH D O     1 
HETATM 4181 O O     . HOH O 4 .  ? 1.094   31.319  3.156   1.00 60.43 ? 235 HOH D O     1 
HETATM 4182 O O     . HOH O 4 .  ? 2.993   18.095  0.580   1.00 58.39 ? 236 HOH D O     1 
HETATM 4183 O O     . HOH O 4 .  ? -6.425  16.710  -4.551  1.00 55.98 ? 238 HOH D O     1 
HETATM 4184 O O     . HOH O 4 .  ? -7.977  17.986  -21.482 1.00 47.58 ? 251 HOH D O     1 
HETATM 4185 O O     . HOH P 4 .  ? 23.645  30.672  21.623  1.00 25.10 ? 1   HOH E O     1 
HETATM 4186 O O     . HOH P 4 .  ? 14.736  26.208  25.032  1.00 38.71 ? 5   HOH E O     1 
HETATM 4187 O O     . HOH P 4 .  ? 23.277  12.612  -3.363  1.00 47.26 ? 31  HOH E O     1 
HETATM 4188 O O     . HOH P 4 .  ? 15.142  26.757  18.434  1.00 34.02 ? 39  HOH E O     1 
HETATM 4189 O O     . HOH P 4 .  ? 24.387  27.536  26.690  1.00 42.05 ? 49  HOH E O     1 
HETATM 4190 O O     . HOH P 4 .  ? 26.814  26.627  32.886  1.00 47.63 ? 60  HOH E O     1 
HETATM 4191 O O     . HOH P 4 .  ? 29.573  12.435  3.169   1.00 51.50 ? 61  HOH E O     1 
HETATM 4192 O O     . HOH P 4 .  ? 19.833  19.076  30.946  1.00 51.31 ? 71  HOH E O     1 
HETATM 4193 O O     . HOH P 4 .  ? 23.539  25.641  32.390  1.00 46.95 ? 82  HOH E O     1 
HETATM 4194 O O     . HOH P 4 .  ? 22.378  25.890  16.734  1.00 34.18 ? 88  HOH E O     1 
HETATM 4195 O O     . HOH P 4 .  ? 20.618  22.398  -4.263  1.00 35.87 ? 94  HOH E O     1 
HETATM 4196 O O     . HOH P 4 .  ? 11.427  17.449  -8.076  1.00 60.61 ? 124 HOH E O     1 
HETATM 4197 O O     . HOH P 4 .  ? 19.549  29.818  37.495  1.00 40.90 ? 138 HOH E O     1 
HETATM 4198 O O     . HOH P 4 .  ? 14.541  15.764  6.355   1.00 47.39 ? 148 HOH E O     1 
HETATM 4199 O O     . HOH P 4 .  ? 18.841  23.255  -8.030  1.00 62.07 ? 166 HOH E O     1 
HETATM 4200 O O     . HOH P 4 .  ? 18.432  32.245  36.978  1.00 45.78 ? 173 HOH E O     1 
HETATM 4201 O O     . HOH P 4 .  ? 24.066  14.659  10.488  1.00 58.90 ? 174 HOH E O     1 
HETATM 4202 O O     . HOH P 4 .  ? 20.473  29.102  39.944  1.00 47.89 ? 186 HOH E O     1 
HETATM 4203 O O     . HOH P 4 .  ? 26.575  28.151  13.930  1.00 53.30 ? 193 HOH E O     1 
HETATM 4204 O O     . HOH P 4 .  ? 27.557  25.999  -1.566  1.00 61.61 ? 197 HOH E O     1 
HETATM 4205 O O     . HOH P 4 .  ? -13.863 27.220  -36.285 1.00 62.85 ? 200 HOH E O     1 
HETATM 4206 O O     . HOH P 4 .  ? 21.906  30.522  12.004  1.00 57.79 ? 209 HOH E O     1 
HETATM 4207 O O     . HOH P 4 .  ? 18.153  18.458  23.535  1.00 65.35 ? 214 HOH E O     1 
HETATM 4208 O O     . HOH P 4 .  ? 2.057   22.837  -11.338 1.00 61.92 ? 215 HOH E O     1 
HETATM 4209 O O     . HOH P 4 .  ? 16.436  15.069  -0.326  1.00 60.40 ? 241 HOH E O     1 
HETATM 4210 O O     . HOH P 4 .  ? 18.827  24.182  34.308  1.00 50.02 ? 243 HOH E O     1 
HETATM 4211 O O     . HOH P 4 .  ? 32.902  17.742  6.282   1.00 61.25 ? 246 HOH E O     1 
HETATM 4212 O O     . HOH P 4 .  ? 5.799   27.079  -7.361  1.00 50.03 ? 249 HOH E O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DG  1  102 102 DG  G   F . n 
A 1 2  DA  2  103 103 DA  A   F . n 
A 1 3  DG  3  104 104 DG  G   F . n 
A 1 4  DT  4  105 105 DT  T   F . n 
A 1 5  DA  5  106 106 DA  A   F . n 
A 1 6  DG  6  107 107 DG  G   F . n 
A 1 7  DC  7  108 108 DC  C   F . n 
A 1 8  DA  8  109 109 DA  A   F . n 
A 1 9  DC  9  110 110 DC  C   F . n 
A 1 10 DG  10 111 111 DG  G   F . n 
A 1 11 DT  11 112 112 DT  T   F . n 
A 1 12 DG  12 113 113 DG  G   F . n 
A 1 13 DC  13 114 114 DC  C   F . n 
A 1 14 DT  14 115 115 DT  T   F . n 
A 1 15 DA  15 116 116 DA  A   F . n 
A 1 16 DC  16 117 117 DC  C   F . n 
A 1 17 DT  17 118 118 DT  T   F . n 
A 1 18 DC  18 119 119 DC  C   F . n 
B 1 1  DG  1  302 302 DG  G   G . n 
B 1 2  DA  2  303 303 DA  A   G . n 
B 1 3  DG  3  304 304 DG  G   G . n 
B 1 4  DT  4  305 305 DT  T   G . n 
B 1 5  DA  5  306 306 DA  A   G . n 
B 1 6  DG  6  307 307 DG  G   G . n 
B 1 7  DC  7  308 308 DC  C   G . n 
B 1 8  DA  8  309 309 DA  A   G . n 
B 1 9  DC  9  310 310 DC  C   G . n 
B 1 10 DG  10 311 311 DG  G   G . n 
B 1 11 DT  11 312 312 DT  T   G . n 
B 1 12 DG  12 313 313 DG  G   G . n 
B 1 13 DC  13 314 314 DC  C   G . n 
B 1 14 DT  14 315 315 DT  T   G . n 
B 1 15 DA  15 316 316 DA  A   G . n 
B 1 16 DC  16 317 317 DC  C   G . n 
B 1 17 DT  17 318 318 DT  T   G . n 
B 1 18 DC  18 319 319 DC  C   G . n 
C 1 1  DG  1  602 602 DG  G   H . n 
C 1 2  DA  2  603 603 DA  A   H . n 
C 1 3  DG  3  604 604 DG  G   H . n 
C 1 4  DT  4  605 605 DT  T   H . n 
C 1 5  DA  5  606 606 DA  A   H . n 
C 1 6  DG  6  607 607 DG  G   H . n 
C 1 7  DC  7  608 608 DC  C   H . n 
C 1 8  DA  8  609 609 DA  A   H . n 
C 1 9  DC  9  610 610 DC  C   H . n 
C 1 10 DG  10 611 611 DG  G   H . n 
C 1 11 DT  11 612 612 DT  T   H . n 
C 1 12 DG  12 613 613 DG  G   H . n 
C 1 13 DC  13 614 614 DC  C   H . n 
C 1 14 DT  14 615 615 DT  T   H . n 
C 1 15 DA  15 616 616 DA  A   H . n 
C 1 16 DC  16 617 617 DC  C   H . n 
C 1 17 DT  17 618 618 DT  T   H . n 
C 1 18 DC  18 619 619 DC  C   H . n 
D 1 1  DG  1  802 802 DG  G   J . n 
D 1 2  DA  2  803 803 DA  A   J . n 
D 1 3  DG  3  804 804 DG  G   J . n 
D 1 4  DT  4  805 805 DT  T   J . n 
D 1 5  DA  5  806 806 DA  A   J . n 
D 1 6  DG  6  807 807 DG  G   J . n 
D 1 7  DC  7  808 808 DC  C   J . n 
D 1 8  DA  8  809 809 DA  A   J . n 
D 1 9  DC  9  810 810 DC  C   J . n 
D 1 10 DG  10 811 811 DG  G   J . n 
D 1 11 DT  11 812 812 DT  T   J . n 
D 1 12 DG  12 813 813 DG  G   J . n 
D 1 13 DC  13 814 814 DC  C   J . n 
D 1 14 DT  14 815 815 DT  T   J . n 
D 1 15 DA  15 816 816 DA  A   J . n 
D 1 16 DC  16 817 817 DC  C   J . n 
D 1 17 DT  17 818 818 DT  T   J . n 
D 1 18 DC  18 819 819 DC  C   J . n 
E 2 1  SER 1  2   2   SER SER A . n 
E 2 2  ARG 2  3   3   ARG ARG A . n 
E 2 3  SER 3  4   4   SER SER A . n 
E 2 4  THR 4  5   5   THR THR A . n 
E 2 5  HIS 5  6   6   HIS HIS A . n 
E 2 6  ASN 6  7   7   ASN ASN A . n 
E 2 7  GLU 7  8   8   GLU GLU A . n 
E 2 8  MET 8  9   9   MET MET A . n 
E 2 9  GLU 9  10  10  GLU GLU A . n 
E 2 10 LYS 10 11  11  LYS LYS A . n 
E 2 11 ASN 11 12  12  ASN ASN A . n 
E 2 12 ARG 12 13  13  ARG ARG A . n 
E 2 13 ARG 13 14  14  ARG ARG A . n 
E 2 14 ALA 14 15  15  ALA ALA A . n 
E 2 15 HIS 15 16  16  HIS HIS A . n 
E 2 16 LEU 16 17  17  LEU LEU A . n 
E 2 17 ARG 17 18  18  ARG ARG A . n 
E 2 18 LEU 18 19  19  LEU LEU A . n 
E 2 19 SER 19 20  20  SER SER A . n 
E 2 20 LEU 20 21  21  LEU LEU A . n 
E 2 21 GLU 21 22  22  GLU GLU A . n 
E 2 22 LYS 22 23  23  LYS LYS A . n 
E 2 23 LEU 23 24  24  LEU LEU A . n 
E 2 24 LYS 24 25  25  LYS LYS A . n 
E 2 25 GLY 25 26  26  GLY GLY A . n 
E 2 26 LEU 26 27  27  LEU LEU A . n 
E 2 27 VAL 27 28  28  VAL VAL A . n 
E 2 28 PRO 28 29  29  PRO PRO A . n 
E 2 29 LEU 29 30  30  LEU GLY A . n 
E 2 30 GLY 30 31  31  GLY GLY A . n 
E 2 31 PRO 31 32  32  PRO ALA A . n 
E 2 32 ASP 32 33  33  ASP ALA A . n 
E 2 33 SER 33 34  34  SER ALA A . n 
E 2 34 SER 34 35  35  SER ALA A . n 
E 2 35 ARG 35 36  36  ARG ARG A . n 
E 2 36 HIS 36 37  37  HIS HIS A . n 
E 2 37 THR 37 38  38  THR THR A . n 
E 2 38 THR 38 39  39  THR THR A . n 
E 2 39 LEU 39 40  40  LEU LEU A . n 
E 2 40 SER 40 41  41  SER SER A . n 
E 2 41 LEU 41 42  42  LEU LEU A . n 
E 2 42 LEU 42 43  43  LEU LEU A . n 
E 2 43 THR 43 44  44  THR THR A . n 
E 2 44 LYS 44 45  45  LYS LYS A . n 
E 2 45 ALA 45 46  46  ALA ALA A . n 
E 2 46 LYS 46 47  47  LYS LYS A . n 
E 2 47 LEU 47 48  48  LEU LEU A . n 
E 2 48 HIS 48 49  49  HIS HIS A . n 
E 2 49 ILE 49 50  50  ILE ILE A . n 
E 2 50 LYS 50 51  51  LYS LYS A . n 
E 2 51 LYS 51 52  52  LYS LYS A . n 
E 2 52 LEU 52 53  53  LEU LEU A . n 
E 2 53 GLU 53 54  54  GLU GLU A . n 
E 2 54 ASP 54 55  55  ASP ASP A . n 
E 2 55 SER 55 56  56  SER SER A . n 
E 2 56 ASP 56 57  57  ASP ASP A . n 
E 2 57 ARG 57 58  58  ARG ARG A . n 
E 2 58 LYS 58 59  59  LYS LYS A . n 
E 2 59 ALA 59 60  60  ALA ALA A . n 
E 2 60 VAL 60 61  61  VAL VAL A . n 
E 2 61 HIS 61 62  62  HIS HIS A . n 
E 2 62 GLN 62 63  63  GLN ALA A . n 
E 2 63 ILE 63 64  64  ILE ILE A . n 
E 2 64 ASP 64 65  65  ASP ASP A . n 
E 2 65 GLN 65 66  66  GLN GLN A . n 
E 2 66 LEU 66 67  67  LEU LEU A . n 
E 2 67 GLN 67 68  68  GLN GLN A . n 
E 2 68 ARG 68 69  69  ARG ARG A . n 
E 2 69 GLU 69 70  70  GLU GLU A . n 
E 2 70 GLN 70 71  71  GLN GLN A . n 
E 2 71 ARG 71 72  72  ARG ARG A . n 
E 2 72 HIS 72 73  73  HIS HIS A . n 
E 2 73 LEU 73 74  74  LEU LEU A . n 
E 2 74 LYS 74 75  75  LYS LYS A . n 
E 2 75 ARG 75 76  76  ARG ARG A . n 
E 2 76 GLN 76 77  77  GLN GLN A . n 
E 2 77 LEU 77 78  78  LEU LEU A . n 
E 2 78 GLU 78 79  79  GLU GLU A . n 
E 2 79 LYS 79 80  80  LYS ALA A . n 
E 2 80 LEU 80 81  ?   ?   ?   A . n 
F 3 1  LYS 1  203 203 LYS LYS B . n 
F 3 2  ARG 2  204 204 ARG ARG B . n 
F 3 3  ALA 3  205 205 ALA ALA B . n 
F 3 4  HIS 4  206 206 HIS HIS B . n 
F 3 5  HIS 5  207 207 HIS HIS B . n 
F 3 6  ASN 6  208 208 ASN ASN B . n 
F 3 7  ALA 7  209 209 ALA ALA B . n 
F 3 8  LEU 8  210 210 LEU LEU B . n 
F 3 9  GLU 9  211 211 GLU GLU B . n 
F 3 10 ARG 10 212 212 ARG ARG B . n 
F 3 11 LYS 11 213 213 LYS LYS B . n 
F 3 12 ARG 12 214 214 ARG ARG B . n 
F 3 13 ARG 13 215 215 ARG ARG B . n 
F 3 14 ASP 14 216 216 ASP ASP B . n 
F 3 15 HIS 15 217 217 HIS HIS B . n 
F 3 16 ILE 16 218 218 ILE ILE B . n 
F 3 17 LYS 17 219 219 LYS LYS B . n 
F 3 18 ASP 18 220 220 ASP ASP B . n 
F 3 19 SER 19 221 221 SER SER B . n 
F 3 20 PHE 20 222 222 PHE PHE B . n 
F 3 21 HIS 21 223 223 HIS HIS B . n 
F 3 22 SER 22 224 224 SER SER B . n 
F 3 23 LEU 23 225 225 LEU LEU B . n 
F 3 24 ARG 24 226 226 ARG ARG B . n 
F 3 25 ASP 25 227 227 ASP ASP B . n 
F 3 26 SER 26 228 228 SER SER B . n 
F 3 27 VAL 27 229 229 VAL VAL B . n 
F 3 28 PRO 28 230 230 PRO PRO B . n 
F 3 29 SER 29 231 231 SER SER B . n 
F 3 30 LEU 30 232 232 LEU LEU B . n 
F 3 31 GLN 31 233 233 GLN GLN B . n 
F 3 32 GLY 32 234 234 GLY GLY B . n 
F 3 33 GLU 33 235 235 GLU GLU B . n 
F 3 34 LYS 34 236 236 LYS LYS B . n 
F 3 35 ALA 35 237 237 ALA ALA B . n 
F 3 36 SER 36 238 238 SER SER B . n 
F 3 37 ARG 37 239 239 ARG ARG B . n 
F 3 38 ALA 38 240 240 ALA ALA B . n 
F 3 39 GLN 39 241 241 GLN GLN B . n 
F 3 40 ILE 40 242 242 ILE ILE B . n 
F 3 41 LEU 41 243 243 LEU LEU B . n 
F 3 42 ASP 42 244 244 ASP ASP B . n 
F 3 43 LYS 43 245 245 LYS LYS B . n 
F 3 44 ALA 44 246 246 ALA ALA B . n 
F 3 45 THR 45 247 247 THR THR B . n 
F 3 46 GLU 46 248 248 GLU GLU B . n 
F 3 47 TYR 47 249 249 TYR TYR B . n 
F 3 48 ILE 48 250 250 ILE ILE B . n 
F 3 49 GLN 49 251 251 GLN GLN B . n 
F 3 50 TYR 50 252 252 TYR TYR B . n 
F 3 51 MET 51 253 253 MET MET B . n 
F 3 52 ARG 52 254 254 ARG ARG B . n 
F 3 53 ARG 53 255 255 ARG ARG B . n 
F 3 54 LYS 54 256 256 LYS LYS B . n 
F 3 55 ASN 55 257 257 ASN ASN B . n 
F 3 56 HIS 56 258 258 HIS HIS B . n 
F 3 57 THR 57 259 259 THR THR B . n 
F 3 58 HIS 58 260 260 HIS HIS B . n 
F 3 59 GLN 59 261 261 GLN GLN B . n 
F 3 60 GLN 60 262 262 GLN GLN B . n 
F 3 61 ASP 61 263 263 ASP ASP B . n 
F 3 62 ILE 62 264 264 ILE ILE B . n 
F 3 63 ASP 63 265 265 ASP ASP B . n 
F 3 64 ASP 64 266 266 ASP ASP B . n 
F 3 65 LEU 65 267 267 LEU LEU B . n 
F 3 66 LYS 66 268 268 LYS LYS B . n 
F 3 67 ARG 67 269 269 ARG ARG B . n 
F 3 68 GLN 68 270 270 GLN GLN B . n 
F 3 69 ASN 69 271 271 ASN ASN B . n 
F 3 70 ALA 70 272 272 ALA ALA B . n 
F 3 71 LEU 71 273 273 LEU LEU B . n 
F 3 72 LEU 72 274 274 LEU LEU B . n 
F 3 73 GLU 73 275 275 GLU GLU B . n 
F 3 74 GLN 74 276 276 GLN GLN B . n 
F 3 75 GLN 75 277 277 GLN GLN B . n 
F 3 76 VAL 76 278 278 VAL VAL B . n 
G 2 1  SER 1  502 502 SER GLY D . n 
G 2 2  ARG 2  503 503 ARG ARG D . n 
G 2 3  SER 3  504 504 SER SER D . n 
G 2 4  THR 4  505 505 THR THR D . n 
G 2 5  HIS 5  506 506 HIS HIS D . n 
G 2 6  ASN 6  507 507 ASN ASN D . n 
G 2 7  GLU 7  508 508 GLU GLU D . n 
G 2 8  MET 8  509 509 MET MET D . n 
G 2 9  GLU 9  510 510 GLU GLU D . n 
G 2 10 LYS 10 511 511 LYS LYS D . n 
G 2 11 ASN 11 512 512 ASN ALA D . n 
G 2 12 ARG 12 513 513 ARG ARG D . n 
G 2 13 ARG 13 514 514 ARG ARG D . n 
G 2 14 ALA 14 515 515 ALA ALA D . n 
G 2 15 HIS 15 516 516 HIS HIS D . n 
G 2 16 LEU 16 517 517 LEU LEU D . n 
G 2 17 ARG 17 518 518 ARG ARG D . n 
G 2 18 LEU 18 519 519 LEU LEU D . n 
G 2 19 SER 19 520 520 SER SER D . n 
G 2 20 LEU 20 521 521 LEU LEU D . n 
G 2 21 GLU 21 522 522 GLU GLU D . n 
G 2 22 LYS 22 523 523 LYS LYS D . n 
G 2 23 LEU 23 524 524 LEU LEU D . n 
G 2 24 LYS 24 525 525 LYS LYS D . n 
G 2 25 GLY 25 526 526 GLY GLY D . n 
G 2 26 LEU 26 527 527 LEU LEU D . n 
G 2 27 VAL 27 528 528 VAL VAL D . n 
G 2 28 PRO 28 529 529 PRO PRO D . n 
G 2 29 LEU 29 530 530 LEU LEU D . n 
G 2 30 GLY 30 531 531 GLY GLY D . n 
G 2 31 PRO 31 532 532 PRO PRO D . n 
G 2 32 ASP 32 533 533 ASP ASP D . n 
G 2 33 SER 33 534 534 SER SER D . n 
G 2 34 SER 34 535 535 SER SER D . n 
G 2 35 ARG 35 536 536 ARG ALA D . n 
G 2 36 HIS 36 537 537 HIS ALA D . n 
G 2 37 THR 37 538 538 THR THR D . n 
G 2 38 THR 38 539 539 THR THR D . n 
G 2 39 LEU 39 540 540 LEU LEU D . n 
G 2 40 SER 40 541 541 SER SER D . n 
G 2 41 LEU 41 542 542 LEU LEU D . n 
G 2 42 LEU 42 543 543 LEU LEU D . n 
G 2 43 THR 43 544 544 THR THR D . n 
G 2 44 LYS 44 545 545 LYS LYS D . n 
G 2 45 ALA 45 546 546 ALA ALA D . n 
G 2 46 LYS 46 547 547 LYS LYS D . n 
G 2 47 LEU 47 548 548 LEU LEU D . n 
G 2 48 HIS 48 549 549 HIS HIS D . n 
G 2 49 ILE 49 550 550 ILE ILE D . n 
G 2 50 LYS 50 551 551 LYS LYS D . n 
G 2 51 LYS 51 552 552 LYS LYS D . n 
G 2 52 LEU 52 553 553 LEU LEU D . n 
G 2 53 GLU 53 554 554 GLU GLU D . n 
G 2 54 ASP 54 555 555 ASP ASP D . n 
G 2 55 SER 55 556 556 SER SER D . n 
G 2 56 ASP 56 557 557 ASP ASP D . n 
G 2 57 ARG 57 558 558 ARG ARG D . n 
G 2 58 LYS 58 559 559 LYS LYS D . n 
G 2 59 ALA 59 560 560 ALA ALA D . n 
G 2 60 VAL 60 561 561 VAL VAL D . n 
G 2 61 HIS 61 562 562 HIS HIS D . n 
G 2 62 GLN 62 563 563 GLN GLN D . n 
G 2 63 ILE 63 564 564 ILE ILE D . n 
G 2 64 ASP 64 565 565 ASP ASP D . n 
G 2 65 GLN 65 566 566 GLN GLN D . n 
G 2 66 LEU 66 567 567 LEU LEU D . n 
G 2 67 GLN 67 568 568 GLN GLN D . n 
G 2 68 ARG 68 569 569 ARG ARG D . n 
G 2 69 GLU 69 570 570 GLU GLU D . n 
G 2 70 GLN 70 571 571 GLN GLN D . n 
G 2 71 ARG 71 572 572 ARG ARG D . n 
G 2 72 HIS 72 573 573 HIS HIS D . n 
G 2 73 LEU 73 574 574 LEU LEU D . n 
G 2 74 LYS 74 575 575 LYS LYS D . n 
G 2 75 ARG 75 576 576 ARG ALA D . n 
G 2 76 GLN 76 577 577 GLN ALA D . n 
G 2 77 LEU 77 578 578 LEU LEU D . n 
G 2 78 GLU 78 579 ?   ?   ?   D . n 
G 2 79 LYS 79 580 ?   ?   ?   D . n 
G 2 80 LEU 80 581 ?   ?   ?   D . n 
H 3 1  LYS 1  703 ?   ?   ?   E . n 
H 3 2  ARG 2  704 ?   ?   ?   E . n 
H 3 3  ALA 3  705 705 ALA ALA E . n 
H 3 4  HIS 4  706 706 HIS HIS E . n 
H 3 5  HIS 5  707 707 HIS HIS E . n 
H 3 6  ASN 6  708 708 ASN ASN E . n 
H 3 7  ALA 7  709 709 ALA ALA E . n 
H 3 8  LEU 8  710 710 LEU LEU E . n 
H 3 9  GLU 9  711 711 GLU GLU E . n 
H 3 10 ARG 10 712 712 ARG ARG E . n 
H 3 11 LYS 11 713 713 LYS LYS E . n 
H 3 12 ARG 12 714 714 ARG ARG E . n 
H 3 13 ARG 13 715 715 ARG ARG E . n 
H 3 14 ASP 14 716 716 ASP ASP E . n 
H 3 15 HIS 15 717 717 HIS HIS E . n 
H 3 16 ILE 16 718 718 ILE ILE E . n 
H 3 17 LYS 17 719 719 LYS LYS E . n 
H 3 18 ASP 18 720 720 ASP ASP E . n 
H 3 19 SER 19 721 721 SER SER E . n 
H 3 20 PHE 20 722 722 PHE PHE E . n 
H 3 21 HIS 21 723 723 HIS HIS E . n 
H 3 22 SER 22 724 724 SER SER E . n 
H 3 23 LEU 23 725 725 LEU LEU E . n 
H 3 24 ARG 24 726 726 ARG ARG E . n 
H 3 25 ASP 25 727 727 ASP ASP E . n 
H 3 26 SER 26 728 728 SER SER E . n 
H 3 27 VAL 27 729 729 VAL VAL E . n 
H 3 28 PRO 28 730 730 PRO PRO E . n 
H 3 29 SER 29 731 731 SER SER E . n 
H 3 30 LEU 30 732 732 LEU LEU E . n 
H 3 31 GLN 31 733 733 GLN GLN E . n 
H 3 32 GLY 32 734 734 GLY GLY E . n 
H 3 33 GLU 33 735 735 GLU GLU E . n 
H 3 34 LYS 34 736 736 LYS LYS E . n 
H 3 35 ALA 35 737 737 ALA ALA E . n 
H 3 36 SER 36 738 738 SER SER E . n 
H 3 37 ARG 37 739 739 ARG ARG E . n 
H 3 38 ALA 38 740 740 ALA ALA E . n 
H 3 39 GLN 39 741 741 GLN GLN E . n 
H 3 40 ILE 40 742 742 ILE ILE E . n 
H 3 41 LEU 41 743 743 LEU LEU E . n 
H 3 42 ASP 42 744 744 ASP ASP E . n 
H 3 43 LYS 43 745 745 LYS LYS E . n 
H 3 44 ALA 44 746 746 ALA ALA E . n 
H 3 45 THR 45 747 747 THR THR E . n 
H 3 46 GLU 46 748 748 GLU GLU E . n 
H 3 47 TYR 47 749 749 TYR TYR E . n 
H 3 48 ILE 48 750 750 ILE ILE E . n 
H 3 49 GLN 49 751 751 GLN GLN E . n 
H 3 50 TYR 50 752 752 TYR TYR E . n 
H 3 51 MET 51 753 753 MET MET E . n 
H 3 52 ARG 52 754 754 ARG ARG E . n 
H 3 53 ARG 53 755 755 ARG ARG E . n 
H 3 54 LYS 54 756 756 LYS LYS E . n 
H 3 55 ASN 55 757 757 ASN ASN E . n 
H 3 56 HIS 56 758 758 HIS HIS E . n 
H 3 57 THR 57 759 759 THR THR E . n 
H 3 58 HIS 58 760 760 HIS HIS E . n 
H 3 59 GLN 59 761 761 GLN GLN E . n 
H 3 60 GLN 60 762 762 GLN GLN E . n 
H 3 61 ASP 61 763 763 ASP ASP E . n 
H 3 62 ILE 62 764 764 ILE ILE E . n 
H 3 63 ASP 63 765 765 ASP ASP E . n 
H 3 64 ASP 64 766 766 ASP ASP E . n 
H 3 65 LEU 65 767 767 LEU LEU E . n 
H 3 66 LYS 66 768 768 LYS LYS E . n 
H 3 67 ARG 67 769 769 ARG ARG E . n 
H 3 68 GLN 68 770 770 GLN GLN E . n 
H 3 69 ASN 69 771 771 ASN ASN E . n 
H 3 70 ALA 70 772 772 ALA ALA E . n 
H 3 71 LEU 71 773 773 LEU LEU E . n 
H 3 72 LEU 72 774 774 LEU LEU E . n 
H 3 73 GLU 73 775 775 GLU GLU E . n 
H 3 74 GLN 74 776 776 GLN GLN E . n 
H 3 75 GLN 75 777 777 GLN GLN E . n 
H 3 76 VAL 76 778 778 VAL VAL E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 4 HOH 1  120 19  HOH HOH F . 
I 4 HOH 2  121 22  HOH HOH F . 
I 4 HOH 3  122 28  HOH HOH F . 
I 4 HOH 4  123 36  HOH HOH F . 
I 4 HOH 5  124 43  HOH HOH F . 
I 4 HOH 6  125 46  HOH HOH F . 
I 4 HOH 7  126 53  HOH HOH F . 
I 4 HOH 8  127 92  HOH HOH F . 
I 4 HOH 9  128 101 HOH HOH F . 
I 4 HOH 10 129 108 HOH HOH F . 
I 4 HOH 11 130 117 HOH HOH F . 
I 4 HOH 12 131 150 HOH HOH F . 
I 4 HOH 13 132 153 HOH HOH F . 
I 4 HOH 14 133 168 HOH HOH F . 
I 4 HOH 15 134 171 HOH HOH F . 
I 4 HOH 16 135 192 HOH HOH F . 
I 4 HOH 17 136 198 HOH HOH F . 
I 4 HOH 18 137 202 HOH HOH F . 
I 4 HOH 19 138 204 HOH HOH F . 
I 4 HOH 20 139 206 HOH HOH F . 
I 4 HOH 21 140 212 HOH HOH F . 
I 4 HOH 22 141 222 HOH HOH F . 
I 4 HOH 23 142 225 HOH HOH F . 
I 4 HOH 24 143 239 HOH HOH F . 
I 4 HOH 25 144 248 HOH HOH F . 
I 4 HOH 26 145 250 HOH HOH F . 
J 4 HOH 1  3   3   HOH HOH G . 
J 4 HOH 2  8   8   HOH HOH G . 
J 4 HOH 3  16  16  HOH HOH G . 
J 4 HOH 4  20  20  HOH HOH G . 
J 4 HOH 5  21  21  HOH HOH G . 
J 4 HOH 6  32  32  HOH HOH G . 
J 4 HOH 7  37  37  HOH HOH G . 
J 4 HOH 8  45  45  HOH HOH G . 
J 4 HOH 9  48  48  HOH HOH G . 
J 4 HOH 10 57  57  HOH HOH G . 
J 4 HOH 11 62  62  HOH HOH G . 
J 4 HOH 12 63  63  HOH HOH G . 
J 4 HOH 13 64  64  HOH HOH G . 
J 4 HOH 14 70  70  HOH HOH G . 
J 4 HOH 15 74  74  HOH HOH G . 
J 4 HOH 16 78  78  HOH HOH G . 
J 4 HOH 17 83  83  HOH HOH G . 
J 4 HOH 18 91  91  HOH HOH G . 
J 4 HOH 19 100 100 HOH HOH G . 
J 4 HOH 20 121 121 HOH HOH G . 
J 4 HOH 21 122 122 HOH HOH G . 
J 4 HOH 22 131 131 HOH HOH G . 
J 4 HOH 23 136 136 HOH HOH G . 
J 4 HOH 24 154 154 HOH HOH G . 
J 4 HOH 25 157 157 HOH HOH G . 
J 4 HOH 26 177 177 HOH HOH G . 
J 4 HOH 27 179 179 HOH HOH G . 
J 4 HOH 28 181 181 HOH HOH G . 
J 4 HOH 29 187 187 HOH HOH G . 
J 4 HOH 30 195 195 HOH HOH G . 
J 4 HOH 31 199 199 HOH HOH G . 
J 4 HOH 32 201 201 HOH HOH G . 
J 4 HOH 33 210 210 HOH HOH G . 
J 4 HOH 34 211 211 HOH HOH G . 
J 4 HOH 35 223 223 HOH HOH G . 
J 4 HOH 36 229 229 HOH HOH G . 
J 4 HOH 37 242 242 HOH HOH G . 
J 4 HOH 38 247 247 HOH HOH G . 
K 4 HOH 1  55  55  HOH HOH H . 
K 4 HOH 2  56  56  HOH HOH H . 
K 4 HOH 3  67  67  HOH HOH H . 
K 4 HOH 4  96  96  HOH HOH H . 
K 4 HOH 5  97  97  HOH HOH H . 
K 4 HOH 6  103 103 HOH HOH H . 
K 4 HOH 7  107 107 HOH HOH H . 
K 4 HOH 8  125 125 HOH HOH H . 
K 4 HOH 9  129 129 HOH HOH H . 
K 4 HOH 10 145 145 HOH HOH H . 
K 4 HOH 11 146 146 HOH HOH H . 
K 4 HOH 12 152 152 HOH HOH H . 
K 4 HOH 13 169 169 HOH HOH H . 
K 4 HOH 14 183 183 HOH HOH H . 
K 4 HOH 15 184 184 HOH HOH H . 
K 4 HOH 16 188 188 HOH HOH H . 
K 4 HOH 17 196 196 HOH HOH H . 
K 4 HOH 18 203 203 HOH HOH H . 
K 4 HOH 19 218 218 HOH HOH H . 
K 4 HOH 20 226 226 HOH HOH H . 
K 4 HOH 21 231 231 HOH HOH H . 
K 4 HOH 22 244 244 HOH HOH H . 
K 4 HOH 23 245 245 HOH HOH H . 
L 4 HOH 1  35  35  HOH HOH J . 
L 4 HOH 2  41  41  HOH HOH J . 
L 4 HOH 3  54  54  HOH HOH J . 
L 4 HOH 4  59  59  HOH HOH J . 
L 4 HOH 5  73  73  HOH HOH J . 
L 4 HOH 6  75  75  HOH HOH J . 
L 4 HOH 7  90  90  HOH HOH J . 
L 4 HOH 8  99  99  HOH HOH J . 
L 4 HOH 9  110 110 HOH HOH J . 
L 4 HOH 10 118 118 HOH HOH J . 
L 4 HOH 11 127 127 HOH HOH J . 
L 4 HOH 12 139 139 HOH HOH J . 
L 4 HOH 13 149 149 HOH HOH J . 
L 4 HOH 14 155 155 HOH HOH J . 
L 4 HOH 15 176 176 HOH HOH J . 
L 4 HOH 16 180 180 HOH HOH J . 
L 4 HOH 17 213 213 HOH HOH J . 
L 4 HOH 18 228 228 HOH HOH J . 
L 4 HOH 19 234 234 HOH HOH J . 
L 4 HOH 20 237 237 HOH HOH J . 
L 4 HOH 21 240 240 HOH HOH J . 
M 4 HOH 1  82  6   HOH HOH A . 
M 4 HOH 2  83  9   HOH HOH A . 
M 4 HOH 3  84  14  HOH HOH A . 
M 4 HOH 4  85  24  HOH HOH A . 
M 4 HOH 5  86  25  HOH HOH A . 
M 4 HOH 6  87  29  HOH HOH A . 
M 4 HOH 7  88  33  HOH HOH A . 
M 4 HOH 8  89  38  HOH HOH A . 
M 4 HOH 9  90  42  HOH HOH A . 
M 4 HOH 10 91  44  HOH HOH A . 
M 4 HOH 11 92  52  HOH HOH A . 
M 4 HOH 12 93  80  HOH HOH A . 
M 4 HOH 13 94  81  HOH HOH A . 
M 4 HOH 14 95  86  HOH HOH A . 
M 4 HOH 15 96  87  HOH HOH A . 
M 4 HOH 16 97  89  HOH HOH A . 
M 4 HOH 17 98  93  HOH HOH A . 
M 4 HOH 18 99  95  HOH HOH A . 
M 4 HOH 19 100 102 HOH HOH A . 
M 4 HOH 20 101 104 HOH HOH A . 
M 4 HOH 21 102 109 HOH HOH A . 
M 4 HOH 22 103 111 HOH HOH A . 
M 4 HOH 23 104 113 HOH HOH A . 
M 4 HOH 24 105 123 HOH HOH A . 
M 4 HOH 25 106 132 HOH HOH A . 
M 4 HOH 26 107 137 HOH HOH A . 
M 4 HOH 27 108 163 HOH HOH A . 
M 4 HOH 28 109 165 HOH HOH A . 
M 4 HOH 29 110 167 HOH HOH A . 
M 4 HOH 30 111 170 HOH HOH A . 
M 4 HOH 31 112 178 HOH HOH A . 
M 4 HOH 32 113 182 HOH HOH A . 
M 4 HOH 33 114 221 HOH HOH A . 
M 4 HOH 34 115 227 HOH HOH A . 
M 4 HOH 35 116 230 HOH HOH A . 
M 4 HOH 36 117 233 HOH HOH A . 
N 4 HOH 1  279 2   HOH HOH B . 
N 4 HOH 2  280 4   HOH HOH B . 
N 4 HOH 3  281 15  HOH HOH B . 
N 4 HOH 4  282 17  HOH HOH B . 
N 4 HOH 5  283 18  HOH HOH B . 
N 4 HOH 6  284 23  HOH HOH B . 
N 4 HOH 7  285 26  HOH HOH B . 
N 4 HOH 8  286 27  HOH HOH B . 
N 4 HOH 9  287 40  HOH HOH B . 
N 4 HOH 10 288 47  HOH HOH B . 
N 4 HOH 11 289 51  HOH HOH B . 
N 4 HOH 12 290 58  HOH HOH B . 
N 4 HOH 13 291 65  HOH HOH B . 
N 4 HOH 14 292 68  HOH HOH B . 
N 4 HOH 15 293 72  HOH HOH B . 
N 4 HOH 16 294 76  HOH HOH B . 
N 4 HOH 17 295 79  HOH HOH B . 
N 4 HOH 18 296 84  HOH HOH B . 
N 4 HOH 19 297 85  HOH HOH B . 
N 4 HOH 20 298 105 HOH HOH B . 
N 4 HOH 21 299 126 HOH HOH B . 
N 4 HOH 22 300 128 HOH HOH B . 
N 4 HOH 23 301 133 HOH HOH B . 
N 4 HOH 24 302 134 HOH HOH B . 
N 4 HOH 25 303 135 HOH HOH B . 
N 4 HOH 26 304 141 HOH HOH B . 
N 4 HOH 27 305 142 HOH HOH B . 
N 4 HOH 28 306 143 HOH HOH B . 
N 4 HOH 29 307 158 HOH HOH B . 
N 4 HOH 30 308 161 HOH HOH B . 
N 4 HOH 31 309 164 HOH HOH B . 
N 4 HOH 32 310 185 HOH HOH B . 
N 4 HOH 33 311 191 HOH HOH B . 
N 4 HOH 34 312 205 HOH HOH B . 
N 4 HOH 35 313 208 HOH HOH B . 
N 4 HOH 36 314 219 HOH HOH B . 
N 4 HOH 37 315 224 HOH HOH B . 
N 4 HOH 38 316 252 HOH HOH B . 
O 4 HOH 1  7   7   HOH HOH D . 
O 4 HOH 2  10  10  HOH HOH D . 
O 4 HOH 3  11  11  HOH HOH D . 
O 4 HOH 4  12  12  HOH HOH D . 
O 4 HOH 5  30  30  HOH HOH D . 
O 4 HOH 6  34  34  HOH HOH D . 
O 4 HOH 7  50  50  HOH HOH D . 
O 4 HOH 8  66  66  HOH HOH D . 
O 4 HOH 9  69  69  HOH HOH D . 
O 4 HOH 10 77  77  HOH HOH D . 
O 4 HOH 11 98  98  HOH HOH D . 
O 4 HOH 12 106 106 HOH HOH D . 
O 4 HOH 13 112 112 HOH HOH D . 
O 4 HOH 14 114 114 HOH HOH D . 
O 4 HOH 15 115 115 HOH HOH D . 
O 4 HOH 16 116 116 HOH HOH D . 
O 4 HOH 17 119 119 HOH HOH D . 
O 4 HOH 18 120 120 HOH HOH D . 
O 4 HOH 19 130 130 HOH HOH D . 
O 4 HOH 20 140 140 HOH HOH D . 
O 4 HOH 21 144 144 HOH HOH D . 
O 4 HOH 22 147 147 HOH HOH D . 
O 4 HOH 23 151 151 HOH HOH D . 
O 4 HOH 24 156 156 HOH HOH D . 
O 4 HOH 25 159 159 HOH HOH D . 
O 4 HOH 26 160 160 HOH HOH D . 
O 4 HOH 27 162 162 HOH HOH D . 
O 4 HOH 28 172 172 HOH HOH D . 
O 4 HOH 29 175 175 HOH HOH D . 
O 4 HOH 30 189 189 HOH HOH D . 
O 4 HOH 31 190 190 HOH HOH D . 
O 4 HOH 32 194 194 HOH HOH D . 
O 4 HOH 33 207 207 HOH HOH D . 
O 4 HOH 34 216 216 HOH HOH D . 
O 4 HOH 35 217 217 HOH HOH D . 
O 4 HOH 36 220 220 HOH HOH D . 
O 4 HOH 37 232 232 HOH HOH D . 
O 4 HOH 38 235 235 HOH HOH D . 
O 4 HOH 39 236 236 HOH HOH D . 
O 4 HOH 40 238 238 HOH HOH D . 
O 4 HOH 41 251 251 HOH HOH D . 
P 4 HOH 1  1   1   HOH HOH E . 
P 4 HOH 2  5   5   HOH HOH E . 
P 4 HOH 3  31  31  HOH HOH E . 
P 4 HOH 4  39  39  HOH HOH E . 
P 4 HOH 5  49  49  HOH HOH E . 
P 4 HOH 6  60  60  HOH HOH E . 
P 4 HOH 7  61  61  HOH HOH E . 
P 4 HOH 8  71  71  HOH HOH E . 
P 4 HOH 9  82  82  HOH HOH E . 
P 4 HOH 10 88  88  HOH HOH E . 
P 4 HOH 11 94  94  HOH HOH E . 
P 4 HOH 12 124 124 HOH HOH E . 
P 4 HOH 13 138 138 HOH HOH E . 
P 4 HOH 14 148 148 HOH HOH E . 
P 4 HOH 15 166 166 HOH HOH E . 
P 4 HOH 16 173 173 HOH HOH E . 
P 4 HOH 17 174 174 HOH HOH E . 
P 4 HOH 18 186 186 HOH HOH E . 
P 4 HOH 19 193 193 HOH HOH E . 
P 4 HOH 20 197 197 HOH HOH E . 
P 4 HOH 21 200 200 HOH HOH E . 
P 4 HOH 22 209 209 HOH HOH E . 
P 4 HOH 23 214 214 HOH HOH E . 
P 4 HOH 24 215 215 HOH HOH E . 
P 4 HOH 25 241 241 HOH HOH E . 
P 4 HOH 26 243 243 HOH HOH E . 
P 4 HOH 27 246 246 HOH HOH E . 
P 4 HOH 28 249 249 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J,M,N 
2 1 C,D,G,H,K,L,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-02-04 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-02-03 
5 'Structure model' 1 4 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Structure summary'         
5 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' audit_author       
2 4 'Structure model' citation_author    
3 4 'Structure model' struct_ref_seq_dif 
4 5 'Structure model' database_2         
5 5 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_audit_author.identifier_ORCID'      
2 4 'Structure model' '_citation_author.identifier_ORCID'   
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 5 'Structure model' '_database_2.pdbx_DOI'                
5 5 'Structure model' '_database_2.pdbx_database_accession' 
6 5 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             VAL 
_pdbx_validate_rmsd_angle.auth_seq_id_1              229 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              230 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              230 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.31 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.01 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 28  ? ? 71.04   122.23  
2  1 LEU A 30  ? ? 56.55   -85.13  
3  1 ASP A 33  ? ? 72.27   -161.57 
4  1 HIS A 37  ? ? -91.68  -78.25  
5  1 THR A 38  ? ? 64.49   -25.07  
6  1 THR A 39  ? ? 69.31   -47.85  
7  1 PRO B 230 ? ? -67.46  59.08   
8  1 SER B 231 ? ? -171.51 -15.57  
9  1 PRO D 529 ? ? -62.06  27.27   
10 1 ASP D 533 ? ? -140.16 33.34   
11 1 GLN E 733 ? ? -36.44  144.27  
12 1 GLU E 735 ? ? -61.48  -176.19 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 30  ? CB  ? E LEU 29 CB  
2  1 Y 1 A LEU 30  ? CG  ? E LEU 29 CG  
3  1 Y 1 A LEU 30  ? CD1 ? E LEU 29 CD1 
4  1 Y 1 A LEU 30  ? CD2 ? E LEU 29 CD2 
5  1 Y 1 A PRO 32  ? CG  ? E PRO 31 CG  
6  1 Y 1 A PRO 32  ? CD  ? E PRO 31 CD  
7  1 Y 1 A ASP 33  ? CG  ? E ASP 32 CG  
8  1 Y 1 A ASP 33  ? OD1 ? E ASP 32 OD1 
9  1 Y 1 A ASP 33  ? OD2 ? E ASP 32 OD2 
10 1 Y 1 A SER 34  ? OG  ? E SER 33 OG  
11 1 Y 1 A SER 35  ? OG  ? E SER 34 OG  
12 1 Y 1 A GLN 63  ? CG  ? E GLN 62 CG  
13 1 Y 1 A GLN 63  ? CD  ? E GLN 62 CD  
14 1 Y 1 A GLN 63  ? OE1 ? E GLN 62 OE1 
15 1 Y 1 A GLN 63  ? NE2 ? E GLN 62 NE2 
16 1 Y 1 A LYS 80  ? CG  ? E LYS 79 CG  
17 1 Y 1 A LYS 80  ? CD  ? E LYS 79 CD  
18 1 Y 1 A LYS 80  ? CE  ? E LYS 79 CE  
19 1 Y 1 A LYS 80  ? NZ  ? E LYS 79 NZ  
20 1 Y 1 B ARG 212 ? CZ  ? F ARG 10 CZ  
21 1 Y 1 B ARG 212 ? NH1 ? F ARG 10 NH1 
22 1 Y 1 B ARG 212 ? NH2 ? F ARG 10 NH2 
23 1 Y 1 D SER 502 ? CB  ? G SER 1  CB  
24 1 Y 1 D SER 502 ? OG  ? G SER 1  OG  
25 1 Y 1 D ASN 512 ? CG  ? G ASN 11 CG  
26 1 Y 1 D ASN 512 ? OD1 ? G ASN 11 OD1 
27 1 Y 1 D ASN 512 ? ND2 ? G ASN 11 ND2 
28 1 Y 1 D ARG 536 ? CG  ? G ARG 35 CG  
29 1 Y 1 D ARG 536 ? CD  ? G ARG 35 CD  
30 1 Y 1 D ARG 536 ? NE  ? G ARG 35 NE  
31 1 Y 1 D ARG 536 ? CZ  ? G ARG 35 CZ  
32 1 Y 1 D ARG 536 ? NH1 ? G ARG 35 NH1 
33 1 Y 1 D ARG 536 ? NH2 ? G ARG 35 NH2 
34 1 Y 1 D HIS 537 ? CG  ? G HIS 36 CG  
35 1 Y 1 D HIS 537 ? ND1 ? G HIS 36 ND1 
36 1 Y 1 D HIS 537 ? CD2 ? G HIS 36 CD2 
37 1 Y 1 D HIS 537 ? CE1 ? G HIS 36 CE1 
38 1 Y 1 D HIS 537 ? NE2 ? G HIS 36 NE2 
39 1 Y 1 D ARG 576 ? CG  ? G ARG 75 CG  
40 1 Y 1 D ARG 576 ? CD  ? G ARG 75 CD  
41 1 Y 1 D ARG 576 ? NE  ? G ARG 75 NE  
42 1 Y 1 D ARG 576 ? CZ  ? G ARG 75 CZ  
43 1 Y 1 D ARG 576 ? NH1 ? G ARG 75 NH1 
44 1 Y 1 D ARG 576 ? NH2 ? G ARG 75 NH2 
45 1 Y 1 D GLN 577 ? CG  ? G GLN 76 CG  
46 1 Y 1 D GLN 577 ? CD  ? G GLN 76 CD  
47 1 Y 1 D GLN 577 ? OE1 ? G GLN 76 OE1 
48 1 Y 1 D GLN 577 ? NE2 ? G GLN 76 NE2 
49 1 Y 1 E ARG 712 ? CZ  ? H ARG 10 CZ  
50 1 Y 1 E ARG 712 ? NH1 ? H ARG 10 NH1 
51 1 Y 1 E ARG 712 ? NH2 ? H ARG 10 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LEU 81  ? E LEU 80 
2 1 Y 1 D GLU 579 ? G GLU 78 
3 1 Y 1 D LYS 580 ? G LYS 79 
4 1 Y 1 D LEU 581 ? G LEU 80 
5 1 Y 1 E LYS 703 ? H LYS 1  
6 1 Y 1 E ARG 704 ? H ARG 2  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1NLW 'double helix'        
1NLW 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 18 1_555 -0.009 0.102  -0.268 -0.348 -7.920  -2.614 1  F_DG102:DC319_G F 102 ? G 319 ? 19 1 
1 A DA 2  1_555 B DT 17 1_555 -0.044 0.199  0.092  1.461  -11.162 -2.296 2  F_DA103:DT318_G F 103 ? G 318 ? 20 1 
1 A DG 3  1_555 B DC 16 1_555 -0.362 -0.096 -0.363 -6.228 -15.124 -5.457 3  F_DG104:DC317_G F 104 ? G 317 ? 19 1 
1 A DT 4  1_555 B DA 15 1_555 -0.100 -0.145 -0.248 0.359  -7.682  -0.706 4  F_DT105:DA316_G F 105 ? G 316 ? 20 1 
1 A DA 5  1_555 B DT 14 1_555 0.214  -0.204 0.105  0.581  -10.843 -2.564 5  F_DA106:DT315_G F 106 ? G 315 ? 20 1 
1 A DG 6  1_555 B DC 13 1_555 -0.287 -0.087 0.370  4.291  -11.225 0.094  6  F_DG107:DC314_G F 107 ? G 314 ? 19 1 
1 A DC 7  1_555 B DG 12 1_555 0.187  -0.046 -0.002 -3.263 -6.753  0.411  7  F_DC108:DG313_G F 108 ? G 313 ? 19 1 
1 A DA 8  1_555 B DT 11 1_555 0.206  -0.111 -0.034 3.998  -9.712  2.327  8  F_DA109:DT312_G F 109 ? G 312 ? 20 1 
1 A DC 9  1_555 B DG 10 1_555 0.372  -0.066 0.104  2.710  -16.629 4.146  9  F_DC110:DG311_G F 110 ? G 311 ? 19 1 
1 A DG 10 1_555 B DC 9  1_555 -0.234 0.064  -0.109 0.400  -13.585 -1.619 10 F_DG111:DC310_G F 111 ? G 310 ? 19 1 
1 A DT 11 1_555 B DA 8  1_555 -0.090 -0.190 0.081  -4.431 -6.356  1.330  11 F_DT112:DA309_G F 112 ? G 309 ? 20 1 
1 A DG 12 1_555 B DC 7  1_555 -0.858 -0.308 -0.174 -5.703 -7.604  4.430  12 F_DG113:DC308_G F 113 ? G 308 ? 19 1 
1 A DC 13 1_555 B DG 6  1_555 -0.049 -0.115 -0.134 0.303  -5.691  1.083  13 F_DC114:DG307_G F 114 ? G 307 ? 19 1 
1 A DT 14 1_555 B DA 5  1_555 -0.329 0.006  -0.115 2.863  -11.733 6.309  14 F_DT115:DA306_G F 115 ? G 306 ? 20 1 
1 A DA 15 1_555 B DT 4  1_555 -0.508 0.024  0.040  0.755  -5.777  0.478  15 F_DA116:DT305_G F 116 ? G 305 ? 20 1 
1 A DC 16 1_555 B DG 3  1_555 0.353  -0.356 -0.207 5.782  -8.772  1.197  16 F_DC117:DG304_G F 117 ? G 304 ? 19 1 
1 A DT 17 1_555 B DA 2  1_555 0.285  0.004  -0.200 3.508  -4.713  1.829  17 F_DT118:DA303_G F 118 ? G 303 ? 20 1 
1 A DC 18 1_555 B DG 1  1_555 0.501  -0.256 -0.612 15.094 -8.033  2.229  18 F_DC119:DG302_G F 119 ? G 302 ? 19 1 
1 C DG 1  1_555 D DC 18 1_555 -0.011 0.176  -0.177 -7.053 -7.179  -0.001 19 H_DG602:DC819_J H 602 ? J 819 ? 19 1 
1 C DA 2  1_555 D DT 17 1_555 -0.419 0.194  -0.014 1.427  -11.138 -3.583 20 H_DA603:DT818_J H 603 ? J 818 ? 20 1 
1 C DG 3  1_555 D DC 16 1_555 -0.657 0.346  -0.525 -1.854 -11.641 3.126  21 H_DG604:DC817_J H 604 ? J 817 ? ?  1 
1 C DT 4  1_555 D DA 15 1_555 -0.175 0.155  -0.136 1.207  -5.059  1.482  22 H_DT605:DA816_J H 605 ? J 816 ? 20 1 
1 C DA 5  1_555 D DT 14 1_555 0.213  0.194  -0.144 -5.994 -13.803 2.509  23 H_DA606:DT815_J H 606 ? J 815 ? 20 1 
1 C DG 6  1_555 D DC 13 1_555 -0.110 0.044  -0.006 -3.026 -7.968  -3.292 24 H_DG607:DC814_J H 607 ? J 814 ? 19 1 
1 C DC 7  1_555 D DG 12 1_555 0.160  -0.130 -0.218 -1.655 -8.145  -3.986 25 H_DC608:DG813_J H 608 ? J 813 ? 19 1 
1 C DA 8  1_555 D DT 11 1_555 -0.106 -0.182 -0.126 1.108  -13.342 3.923  26 H_DA609:DT812_J H 609 ? J 812 ? 20 1 
1 C DC 9  1_555 D DG 10 1_555 0.137  -0.082 -0.046 -4.294 -18.506 1.321  27 H_DC610:DG811_J H 610 ? J 811 ? 19 1 
1 C DG 10 1_555 D DC 9  1_555 -0.065 -0.092 -0.036 -0.684 -14.837 -1.883 28 H_DG611:DC810_J H 611 ? J 810 ? 19 1 
1 C DT 11 1_555 D DA 8  1_555 0.018  0.034  -0.040 -3.363 -6.998  3.128  29 H_DT612:DA809_J H 612 ? J 809 ? 20 1 
1 C DG 12 1_555 D DC 7  1_555 -0.246 -0.309 -0.011 4.389  -5.701  -0.837 30 H_DG613:DC808_J H 613 ? J 808 ? 19 1 
1 C DC 13 1_555 D DG 6  1_555 0.027  0.002  0.072  -0.572 -5.045  -1.180 31 H_DC614:DG807_J H 614 ? J 807 ? 19 1 
1 C DT 14 1_555 D DA 5  1_555 -0.285 -0.181 0.094  5.067  -7.480  5.574  32 H_DT615:DA806_J H 615 ? J 806 ? 20 1 
1 C DA 15 1_555 D DT 4  1_555 -0.032 0.418  0.205  3.740  -3.499  5.365  33 H_DA616:DT805_J H 616 ? J 805 ? ?  ? 
1 C DC 16 1_555 D DG 3  1_555 0.430  0.433  0.306  1.314  3.435   4.977  34 H_DC617:DG804_J H 617 ? J 804 ? ?  1 
1 C DT 17 1_555 D DA 2  1_555 -0.546 -0.022 -0.095 4.474  -3.040  3.067  35 H_DT618:DA803_J H 618 ? J 803 ? 20 1 
1 C DC 18 1_555 D DG 1  1_555 0.397  -0.011 -0.648 23.749 -8.251  -0.231 36 H_DC619:DG802_J H 619 ? J 802 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 18 1_555 A DA 2  1_555 B DT 17 1_555 -0.814 -0.063 3.190 -5.293 -1.900 38.300 0.137  0.584  3.269 -2.877 
8.015   38.695 1  FF_DG102DA103:DT318DC319_GG F 102 ? G 319 ? F 103 ? G 318 ? 
1 A DA 2  1_555 B DT 17 1_555 A DG 3  1_555 B DC 16 1_555 0.171  -0.304 3.715 0.686  8.632  35.603 -1.821 -0.165 3.550 13.866 
-1.102  36.607 2  FF_DA103DG104:DC317DT318_GG F 103 ? G 318 ? F 104 ? G 317 ? 
1 A DG 3  1_555 B DC 16 1_555 A DT 4  1_555 B DA 15 1_555 0.135  -0.665 3.061 1.060  2.683  27.786 -1.968 -0.047 2.988 5.567  
-2.200  27.932 3  FF_DG104DT105:DA316DC317_GG F 104 ? G 317 ? F 105 ? G 316 ? 
1 A DT 4  1_555 B DA 15 1_555 A DA 5  1_555 B DT 14 1_555 -1.006 0.329  3.427 -6.255 4.501  37.346 -0.111 0.686  3.558 6.939  
9.642   38.105 4  FF_DT105DA106:DT315DA316_GG F 105 ? G 316 ? F 106 ? G 315 ? 
1 A DA 5  1_555 B DT 14 1_555 A DG 6  1_555 B DC 13 1_555 0.338  -0.524 3.201 -4.567 5.140  32.172 -1.769 -1.346 3.008 9.145  
8.125   32.880 5  FF_DA106DG107:DC314DT315_GG F 106 ? G 315 ? F 107 ? G 314 ? 
1 A DG 6  1_555 B DC 13 1_555 A DC 7  1_555 B DG 12 1_555 0.434  -0.565 3.419 4.525  5.069  33.509 -1.797 0.008  3.329 8.681  
-7.750  34.172 6  FF_DG107DC108:DG313DC314_GG F 107 ? G 314 ? F 108 ? G 313 ? 
1 A DC 7  1_555 B DG 12 1_555 A DA 8  1_555 B DT 11 1_555 -0.198 0.784  3.278 0.070  8.289  36.285 0.094  0.320  3.369 13.100 
-0.110  37.189 7  FF_DC108DA109:DT312DG313_GG F 108 ? G 313 ? F 109 ? G 312 ? 
1 A DA 8  1_555 B DT 11 1_555 A DC 9  1_555 B DG 10 1_555 -0.257 -0.564 3.309 -1.197 3.265  29.067 -1.825 0.249  3.236 6.476  
2.375   29.270 8  FF_DA109DC110:DG311DT312_GG F 109 ? G 312 ? F 110 ? G 311 ? 
1 A DC 9  1_555 B DG 10 1_555 A DG 10 1_555 B DC 9  1_555 -0.108 0.615  3.556 1.024  8.543  33.780 -0.417 0.354  3.596 14.413 
-1.728  34.828 9  FF_DC110DG111:DC310DG311_GG F 110 ? G 311 ? F 111 ? G 310 ? 
1 A DG 10 1_555 B DC 9  1_555 A DT 11 1_555 B DA 8  1_555 0.753  -0.497 3.372 0.975  0.725  33.485 -0.986 -1.140 3.381 1.257  
-1.691  33.506 10 FF_DG111DT112:DA309DC310_GG F 111 ? G 310 ? F 112 ? G 309 ? 
1 A DT 11 1_555 B DA 8  1_555 A DG 12 1_555 B DC 7  1_555 -0.014 0.312  3.406 1.093  6.022  31.241 -0.586 0.235  3.403 11.049 
-2.006  31.820 11 FF_DT112DG113:DC308DA309_GG F 112 ? G 309 ? F 113 ? G 308 ? 
1 A DG 12 1_555 B DC 7  1_555 A DC 13 1_555 B DG 6  1_555 -0.317 -0.552 3.119 0.077  4.061  36.290 -1.410 0.516  3.041 6.495  
-0.123  36.509 12 FF_DG113DC114:DG307DC308_GG F 113 ? G 308 ? F 114 ? G 307 ? 
1 A DC 13 1_555 B DG 6  1_555 A DT 14 1_555 B DA 5  1_555 0.066  0.001  3.315 0.600  5.243  28.917 -1.139 0.000  3.265 10.391 
-1.189  29.384 13 FF_DC114DT115:DA306DG307_GG F 114 ? G 307 ? F 115 ? G 306 ? 
1 A DT 14 1_555 B DA 5  1_555 A DA 15 1_555 B DT 4  1_555 0.116  0.133  3.323 -1.110 7.602  33.667 -0.980 -0.371 3.269 12.918 
1.887   34.507 14 FF_DT115DA116:DT305DA306_GG F 115 ? G 306 ? F 116 ? G 305 ? 
1 A DA 15 1_555 B DT 4  1_555 A DC 16 1_555 B DG 3  1_555 0.168  -0.667 3.177 1.897  1.618  36.649 -1.273 -0.017 3.150 2.569  
-3.012  36.731 15 FF_DA116DC117:DG304DT305_GG F 116 ? G 305 ? F 117 ? G 304 ? 
1 A DC 16 1_555 B DG 3  1_555 A DT 17 1_555 B DA 2  1_555 0.404  -0.268 3.370 2.018  7.089  33.166 -1.624 -0.360 3.263 12.231 
-3.482  33.952 16 FF_DC117DT118:DA303DG304_GG F 117 ? G 304 ? F 118 ? G 303 ? 
1 A DT 17 1_555 B DA 2  1_555 A DC 18 1_555 B DG 1  1_555 0.115  0.606  3.021 6.835  10.076 30.704 -0.574 0.911  3.022 18.159 
-12.319 32.976 17 FF_DT118DC119:DG302DA303_GG F 118 ? G 303 ? F 119 ? G 302 ? 
1 C DG 1  1_555 D DC 18 1_555 C DA 2  1_555 D DT 17 1_555 -0.687 0.123  3.145 -3.240 -3.752 36.092 0.702  0.664  3.165 -6.021 
5.199   36.420 18 HH_DG602DA603:DT818DC819_JJ H 602 ? J 819 ? H 603 ? J 818 ? 
1 C DA 2  1_555 D DT 17 1_555 C DG 3  1_555 D DC 16 1_555 0.452  -0.829 3.494 2.073  9.251  29.261 -3.445 -0.432 3.117 17.735 
-3.975  30.726 19 HH_DA603DG604:DC817DT818_JJ H 603 ? J 818 ? H 604 ? J 817 ? 
1 C DG 3  1_555 D DC 16 1_555 C DT 4  1_555 D DA 15 1_555 -0.264 -0.409 3.262 -2.918 0.944  33.140 -0.871 -0.026 3.260 1.650  
5.102   33.277 20 HH_DG604DT605:DA816DC817_JJ H 604 ? J 817 ? H 605 ? J 816 ? 
1 C DT 4  1_555 D DA 15 1_555 C DA 5  1_555 D DT 14 1_555 -0.328 -0.139 3.527 -1.582 8.608  36.211 -1.450 0.287  3.417 13.606 
2.500   37.219 21 HH_DT605DA606:DT815DA816_JJ H 605 ? J 816 ? H 606 ? J 815 ? 
1 C DA 5  1_555 D DT 14 1_555 C DG 6  1_555 D DC 13 1_555 -0.370 -0.435 3.229 -4.972 6.101  33.691 -1.660 -0.133 3.126 10.352 
8.437   34.572 22 HH_DA606DG607:DC814DT815_JJ H 606 ? J 815 ? H 607 ? J 814 ? 
1 C DG 6  1_555 D DC 13 1_555 C DC 7  1_555 D DG 12 1_555 0.088  -0.367 3.228 2.187  2.225  30.274 -1.137 0.263  3.192 4.245  
-4.173  30.430 23 HH_DG607DC608:DG813DC814_JJ H 607 ? J 814 ? H 608 ? J 813 ? 
1 C DC 7  1_555 D DG 12 1_555 C DA 8  1_555 D DT 11 1_555 -0.097 0.917  3.385 -1.347 10.275 34.646 -0.084 -0.048 3.508 16.794 
2.201   36.117 24 HH_DC608DA609:DT812DG813_JJ H 608 ? J 813 ? H 609 ? J 812 ? 
1 C DA 8  1_555 D DT 11 1_555 C DC 9  1_555 D DG 10 1_555 -0.487 -0.574 3.410 -2.072 1.893  31.263 -1.432 0.495  3.395 3.503  
3.834   31.385 25 HH_DA609DC610:DG811DT812_JJ H 609 ? J 812 ? H 610 ? J 811 ? 
1 C DC 9  1_555 D DG 10 1_555 C DG 10 1_555 D DC 9  1_555 -0.218 0.544  3.498 0.106  10.327 34.786 -0.712 0.367  3.511 16.821 
-0.172  36.241 26 HH_DC610DG611:DC810DG811_JJ H 610 ? J 811 ? H 611 ? J 810 ? 
1 C DG 10 1_555 D DC 9  1_555 C DT 11 1_555 D DA 8  1_555 0.784  -0.312 3.239 1.251  2.170  33.185 -0.904 -1.162 3.239 3.792  
-2.186  33.277 27 HH_DG611DT612:DA809DC810_JJ H 611 ? J 810 ? H 612 ? J 809 ? 
1 C DT 11 1_555 D DA 8  1_555 C DG 12 1_555 D DC 7  1_555 -0.410 0.577  3.283 -2.520 4.793  32.459 0.183  0.284  3.353 8.500  
4.470   32.896 28 HH_DT612DG613:DC808DA809_JJ H 612 ? J 809 ? H 613 ? J 808 ? 
1 C DG 12 1_555 D DC 7  1_555 C DC 13 1_555 D DG 6  1_555 -0.183 -0.730 3.407 -1.321 4.459  34.088 -1.950 0.098  3.292 7.562  
2.241   34.395 29 HH_DG613DC614:DG807DC808_JJ H 613 ? J 808 ? H 614 ? J 807 ? 
1 C DC 13 1_555 D DG 6  1_555 C DT 14 1_555 D DA 5  1_555 0.279  -0.470 3.143 0.177  3.429  32.950 -1.375 -0.461 3.081 6.025  
-0.310  33.123 30 HH_DC614DT615:DA806DG807_JJ H 614 ? J 807 ? H 615 ? J 806 ? 
1 C DT 14 1_555 D DA 5  1_555 C DA 15 1_555 D DT 4  1_555 0.636  0.106  3.269 1.291  5.900  35.556 -0.670 -0.844 3.265 9.577  
-2.095  36.049 31 HH_DT615DA616:DT805DA806_JJ H 615 ? J 806 ? H 616 ? J 805 ? 
1 C DA 15 1_555 D DT 4  1_555 C DC 16 1_555 D DG 3  1_555 0.043  -0.243 3.440 -3.573 3.967  35.270 -0.999 -0.613 3.374 6.502  
5.855   35.659 32 HH_DA616DC617:DG804DT805_JJ H 616 ? J 805 ? H 617 ? J 804 ? 
1 C DC 16 1_555 D DG 3  1_555 C DT 17 1_555 D DA 2  1_555 0.352  -0.745 3.132 5.889  -1.348 32.269 -1.095 0.360  3.173 -2.399 
-10.481 32.815 33 HH_DC617DT618:DA803DG804_JJ H 617 ? J 804 ? H 618 ? J 803 ? 
1 C DT 17 1_555 D DA 2  1_555 C DC 18 1_555 D DG 1  1_555 -0.221 0.271  2.910 3.583  10.186 33.694 -0.908 0.841  2.833 17.038 
-5.993  35.334 34 HH_DT618DC619:DG802DA803_JJ H 618 ? J 803 ? H 619 ? J 802 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#