data_1NOZ
# 
_entry.id   1NOZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NOZ         
WWPDB D_1000175359 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NOZ 
_pdbx_database_status.recvd_initial_deposition_date   1996-02-16 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, J.'         1 
'Yu, P.'           2 
'Lin, T.C.'        3 
'Konigsberg, W.H.' 4 
'Steitz, T.A.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structures of an NH2-terminal fragment of T4 DNA polymerase and its complexes with single-stranded DNA and with divalent metal ions.
;
Biochemistry 35  8110  8119 1996 BICHAW US 0006-2960 0033 ? 8679562 10.1021/bi960178r 
1       
;Isolation, Characterization, and Kinetic Properties of Truncated Forms of T4 DNA Polymerase that Exhibit 3'-5' Exonuclease Activity
;
J.Biol.Chem. 269 19286 ?    1994 JBCHA3 US 0021-9258 0071 ? ?       ?                 
2       'Primary Structure of T4 DNA Polymerase. Evolutionary Relatedness to Eucaryotic and Other Procaryotic DNA Polymerases' 
J.Biol.Chem. 263 7478  ?    1988 JBCHA3 US 0021-9258 0071 ? ?       ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, J.'          1  
primary 'Yu, P.'            2  
primary 'Lin, T.C.'         3  
primary 'Konigsberg, W.H.'  4  
primary 'Steitz, T.A.'      5  
1       'Lin, T.C.'         6  
1       'Karam, G.'         7  
1       'Konigsberg, W.H.'  8  
2       'Spicer, E.K.'      9  
2       'Rush, J.'          10 
2       'Fung, C.'          11 
2       'Reha-Krantz, L.J.' 12 
2       'Karam, J.D.'       13 
2       'Konigsberg, W.H.'  14 
# 
_cell.entry_id           1NOZ 
_cell.length_a           113.617 
_cell.length_b           109.309 
_cell.length_c           68.577 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NOZ 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA POLYMERASE' 45315.727 2  2.7.7.7 ? 'RESIDUES 1 - 388' ? 
2 water   nat water            18.015    45 ?       ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'T4 GP43 N388' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDEFYISIETVGNNIVERYIDENGKERTREVEYLPTMFRHCKEESKYKDIYGKNCAPQKFPSMKDARDWMKRMEDIGLEA
LGMNDFKLAYISDTYGSEIVYDRKFVRVANCDIEVTGDKFPDPMKAEYEIDAITHYDSIDDRFYVFDLLNSMYGSVSKWD
AKLAAKLDCEGGDEVPQEILDRVIYMPFDNERDMLMEYINLWEQKRPAIFTGWNIEGFDVPYIMNRVKMILGERSMKRFS
PIGRVKSKLLQNMYGSKEIYSIDGVSILDYLDLYKKFAFTNLPSFSLESVAQHETKKGKLPYDGPINKLRETNHQRYISY
NIIDVESVQAIDKIRGFIDLVLSMSYYAKMPFSGVMSPIKTWDAIIFNSLKGEHKVIPQQGSHVKQSF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDEFYISIETVGNNIVERYIDENGKERTREVEYLPTMFRHCKEESKYKDIYGKNCAPQKFPSMKDARDWMKRMEDIGLEA
LGMNDFKLAYISDTYGSEIVYDRKFVRVANCDIEVTGDKFPDPMKAEYEIDAITHYDSIDDRFYVFDLLNSMYGSVSKWD
AKLAAKLDCEGGDEVPQEILDRVIYMPFDNERDMLMEYINLWEQKRPAIFTGWNIEGFDVPYIMNRVKMILGERSMKRFS
PIGRVKSKLLQNMYGSKEIYSIDGVSILDYLDLYKKFAFTNLPSFSLESVAQHETKKGKLPYDGPINKLRETNHQRYISY
NIIDVESVQAIDKIRGFIDLVLSMSYYAKMPFSGVMSPIKTWDAIIFNSLKGEHKVIPQQGSHVKQSF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   ILE n 
1 7   SER n 
1 8   ILE n 
1 9   GLU n 
1 10  THR n 
1 11  VAL n 
1 12  GLY n 
1 13  ASN n 
1 14  ASN n 
1 15  ILE n 
1 16  VAL n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  GLU n 
1 23  ASN n 
1 24  GLY n 
1 25  LYS n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LEU n 
1 35  PRO n 
1 36  THR n 
1 37  MET n 
1 38  PHE n 
1 39  ARG n 
1 40  HIS n 
1 41  CYS n 
1 42  LYS n 
1 43  GLU n 
1 44  GLU n 
1 45  SER n 
1 46  LYS n 
1 47  TYR n 
1 48  LYS n 
1 49  ASP n 
1 50  ILE n 
1 51  TYR n 
1 52  GLY n 
1 53  LYS n 
1 54  ASN n 
1 55  CYS n 
1 56  ALA n 
1 57  PRO n 
1 58  GLN n 
1 59  LYS n 
1 60  PHE n 
1 61  PRO n 
1 62  SER n 
1 63  MET n 
1 64  LYS n 
1 65  ASP n 
1 66  ALA n 
1 67  ARG n 
1 68  ASP n 
1 69  TRP n 
1 70  MET n 
1 71  LYS n 
1 72  ARG n 
1 73  MET n 
1 74  GLU n 
1 75  ASP n 
1 76  ILE n 
1 77  GLY n 
1 78  LEU n 
1 79  GLU n 
1 80  ALA n 
1 81  LEU n 
1 82  GLY n 
1 83  MET n 
1 84  ASN n 
1 85  ASP n 
1 86  PHE n 
1 87  LYS n 
1 88  LEU n 
1 89  ALA n 
1 90  TYR n 
1 91  ILE n 
1 92  SER n 
1 93  ASP n 
1 94  THR n 
1 95  TYR n 
1 96  GLY n 
1 97  SER n 
1 98  GLU n 
1 99  ILE n 
1 100 VAL n 
1 101 TYR n 
1 102 ASP n 
1 103 ARG n 
1 104 LYS n 
1 105 PHE n 
1 106 VAL n 
1 107 ARG n 
1 108 VAL n 
1 109 ALA n 
1 110 ASN n 
1 111 CYS n 
1 112 ASP n 
1 113 ILE n 
1 114 GLU n 
1 115 VAL n 
1 116 THR n 
1 117 GLY n 
1 118 ASP n 
1 119 LYS n 
1 120 PHE n 
1 121 PRO n 
1 122 ASP n 
1 123 PRO n 
1 124 MET n 
1 125 LYS n 
1 126 ALA n 
1 127 GLU n 
1 128 TYR n 
1 129 GLU n 
1 130 ILE n 
1 131 ASP n 
1 132 ALA n 
1 133 ILE n 
1 134 THR n 
1 135 HIS n 
1 136 TYR n 
1 137 ASP n 
1 138 SER n 
1 139 ILE n 
1 140 ASP n 
1 141 ASP n 
1 142 ARG n 
1 143 PHE n 
1 144 TYR n 
1 145 VAL n 
1 146 PHE n 
1 147 ASP n 
1 148 LEU n 
1 149 LEU n 
1 150 ASN n 
1 151 SER n 
1 152 MET n 
1 153 TYR n 
1 154 GLY n 
1 155 SER n 
1 156 VAL n 
1 157 SER n 
1 158 LYS n 
1 159 TRP n 
1 160 ASP n 
1 161 ALA n 
1 162 LYS n 
1 163 LEU n 
1 164 ALA n 
1 165 ALA n 
1 166 LYS n 
1 167 LEU n 
1 168 ASP n 
1 169 CYS n 
1 170 GLU n 
1 171 GLY n 
1 172 GLY n 
1 173 ASP n 
1 174 GLU n 
1 175 VAL n 
1 176 PRO n 
1 177 GLN n 
1 178 GLU n 
1 179 ILE n 
1 180 LEU n 
1 181 ASP n 
1 182 ARG n 
1 183 VAL n 
1 184 ILE n 
1 185 TYR n 
1 186 MET n 
1 187 PRO n 
1 188 PHE n 
1 189 ASP n 
1 190 ASN n 
1 191 GLU n 
1 192 ARG n 
1 193 ASP n 
1 194 MET n 
1 195 LEU n 
1 196 MET n 
1 197 GLU n 
1 198 TYR n 
1 199 ILE n 
1 200 ASN n 
1 201 LEU n 
1 202 TRP n 
1 203 GLU n 
1 204 GLN n 
1 205 LYS n 
1 206 ARG n 
1 207 PRO n 
1 208 ALA n 
1 209 ILE n 
1 210 PHE n 
1 211 THR n 
1 212 GLY n 
1 213 TRP n 
1 214 ASN n 
1 215 ILE n 
1 216 GLU n 
1 217 GLY n 
1 218 PHE n 
1 219 ASP n 
1 220 VAL n 
1 221 PRO n 
1 222 TYR n 
1 223 ILE n 
1 224 MET n 
1 225 ASN n 
1 226 ARG n 
1 227 VAL n 
1 228 LYS n 
1 229 MET n 
1 230 ILE n 
1 231 LEU n 
1 232 GLY n 
1 233 GLU n 
1 234 ARG n 
1 235 SER n 
1 236 MET n 
1 237 LYS n 
1 238 ARG n 
1 239 PHE n 
1 240 SER n 
1 241 PRO n 
1 242 ILE n 
1 243 GLY n 
1 244 ARG n 
1 245 VAL n 
1 246 LYS n 
1 247 SER n 
1 248 LYS n 
1 249 LEU n 
1 250 LEU n 
1 251 GLN n 
1 252 ASN n 
1 253 MET n 
1 254 TYR n 
1 255 GLY n 
1 256 SER n 
1 257 LYS n 
1 258 GLU n 
1 259 ILE n 
1 260 TYR n 
1 261 SER n 
1 262 ILE n 
1 263 ASP n 
1 264 GLY n 
1 265 VAL n 
1 266 SER n 
1 267 ILE n 
1 268 LEU n 
1 269 ASP n 
1 270 TYR n 
1 271 LEU n 
1 272 ASP n 
1 273 LEU n 
1 274 TYR n 
1 275 LYS n 
1 276 LYS n 
1 277 PHE n 
1 278 ALA n 
1 279 PHE n 
1 280 THR n 
1 281 ASN n 
1 282 LEU n 
1 283 PRO n 
1 284 SER n 
1 285 PHE n 
1 286 SER n 
1 287 LEU n 
1 288 GLU n 
1 289 SER n 
1 290 VAL n 
1 291 ALA n 
1 292 GLN n 
1 293 HIS n 
1 294 GLU n 
1 295 THR n 
1 296 LYS n 
1 297 LYS n 
1 298 GLY n 
1 299 LYS n 
1 300 LEU n 
1 301 PRO n 
1 302 TYR n 
1 303 ASP n 
1 304 GLY n 
1 305 PRO n 
1 306 ILE n 
1 307 ASN n 
1 308 LYS n 
1 309 LEU n 
1 310 ARG n 
1 311 GLU n 
1 312 THR n 
1 313 ASN n 
1 314 HIS n 
1 315 GLN n 
1 316 ARG n 
1 317 TYR n 
1 318 ILE n 
1 319 SER n 
1 320 TYR n 
1 321 ASN n 
1 322 ILE n 
1 323 ILE n 
1 324 ASP n 
1 325 VAL n 
1 326 GLU n 
1 327 SER n 
1 328 VAL n 
1 329 GLN n 
1 330 ALA n 
1 331 ILE n 
1 332 ASP n 
1 333 LYS n 
1 334 ILE n 
1 335 ARG n 
1 336 GLY n 
1 337 PHE n 
1 338 ILE n 
1 339 ASP n 
1 340 LEU n 
1 341 VAL n 
1 342 LEU n 
1 343 SER n 
1 344 MET n 
1 345 SER n 
1 346 TYR n 
1 347 TYR n 
1 348 ALA n 
1 349 LYS n 
1 350 MET n 
1 351 PRO n 
1 352 PHE n 
1 353 SER n 
1 354 GLY n 
1 355 VAL n 
1 356 MET n 
1 357 SER n 
1 358 PRO n 
1 359 ILE n 
1 360 LYS n 
1 361 THR n 
1 362 TRP n 
1 363 ASP n 
1 364 ALA n 
1 365 ILE n 
1 366 ILE n 
1 367 PHE n 
1 368 ASN n 
1 369 SER n 
1 370 LEU n 
1 371 LYS n 
1 372 GLY n 
1 373 GLU n 
1 374 HIS n 
1 375 LYS n 
1 376 VAL n 
1 377 ILE n 
1 378 PRO n 
1 379 GLN n 
1 380 GLN n 
1 381 GLY n 
1 382 SER n 
1 383 HIS n 
1 384 VAL n 
1 385 LYS n 
1 386 GLN n 
1 387 SER n 
1 388 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T4-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Enterobacteria phage T4 sensu lato' 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T4' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10665 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPOL_BPT4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04415 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKEFYISIETVGNNIVERYIDENGKERTREVEYLPTMFRHCKEESKYKDIYGKNCAPQKFPSMKDARDWMKRMEDIGLEA
LGMNDFKLAYISDTYGSEIVYDRKFVRVANCDIEVTGDKFPDPMKAEYEIDAITHYDSIDDRFYVFDLLNSMYGSVSKWD
AKLAAKLDCEGGDEVPQEILDRVIYMPFDNERDMLMEYINLWEQKRPAIFTGWNIEGFDVPYIMNRVKMILGERSMKRFS
PIGRVKSKLIQNMYGSKEIYSIDGVSILDYLDLYKKFAFTNLPSFSLESVAQHETKKGKLPYDGPINKLRETNHQRYISY
NIIDVESVQAIDKIRGFIDLVLSMSYYAKMPFSGVMSPIKTWDAIIFNSLKGEHKVIPQQGSHVKQSFPGAFVFEPKPIA
RRYIMSFDLTSLYPSIIRQVNISPETIRGQFKVHPIHEYIAGTAPKPSDEYSCSPNGWMYDKHQEGIIPKEIAKVFFQRK
DWKKKMFAEEMNAEAIKKIIMKGAGSCSTKPEVERYVKFSDDFLNELSNYTESVLNSLIEECEKAATLANTNQLNRKILI
NSLYGALGNIHFRYYDLRNATAITIFGQVGIQWIARKINEYLNKVCGTNDEDFIAAGDTDSVYVCVDKVIEKVGLDRFKE
QNDLVEFMNQFGKKKMEPMIDVAYRELCDYMNNREHLMHMDREAISCPPLGSKGVGGFWKAKKRYALNVYDMEDKRFAEP
HLKIMGMETQQSSTPKAVQEALEESIRRILQEGEESVQEYYKNFEKEYRQLDYKVIAEVKTANDIAKYDDKGWPGFKCPF
HIRGVLTYRRAVSGLGVAPILDGNKVMVLPLREGNPFGDKCIAWPSGTELPKEIRSDVLSWIDHSTLFQKSFVKPLAGMC
ESAGMDYEEKASLDFLFG
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NOZ A 1 ? 388 ? P04415 1 ? 388 ? 1 388 
2 1 1NOZ B 1 ? 388 ? P04415 1 ? 388 ? 1 388 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1NOZ ASP A 2   ? UNP P04415 LYS 2   CONFLICT 2   1 
1 1NOZ LEU A 250 ? UNP P04415 ILE 250 CONFLICT 250 2 
2 1NOZ ASP B 2   ? UNP P04415 LYS 2   CONFLICT 2   3 
2 1NOZ LEU B 250 ? UNP P04415 ILE 250 CONFLICT 250 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1NOZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.density_percent_sol   50. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'XUONG-HAMLIN MULTIWIRE' 
_diffrn_detector.pdbx_collection_date   1993-10-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1NOZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100. 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1NOZ 
_refine.ls_number_reflns_obs                     37292 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.222 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               41.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THIS STRUCTURE WAS DETERMINED AT LN2 TEMPERATURE (110K).
THE DIVALENT AND P(DT)3 WERE DETERMINED FROM TWO SEPARATE
EXPERIMENTS AT LOWER RESOLUTIONS, CONCATENATED TOGETHER
IN THIS ENTRY.  ASP 1, GLU 2, ILE 211 AND FOUR OTHER
RESIDUES WERE IDENTIFIED FROM ELECTRON DENSITY MAPS, BUT
THE AUTHORS HAVE NOT DONE DNA SEQUENCING TO CONFIRM
POSSIBLE SPONTANEOUSLY MUTATIONS.  ILE 211 WAS REPLACED BY
THR 211 IN THIS ENTRY WITHOUT ADDITIONAL REFINEMENT BY
REMOVING ATOM CD1.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5896 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             45 
_refine_hist.number_atoms_total               5941 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.54  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1NOZ 
_struct.title                     'T4 DNA POLYMERASE FRAGMENT (RESIDUES 1-388) AT 110K' 
_struct.pdbx_descriptor           'DNA POLYMERASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NOZ 
_struct_keywords.pdbx_keywords   NUCLEOTIDYLTRANSFERASE 
_struct_keywords.text            'EXONUCLEASE, DNA-BINDING, NUCLEOTIDYLTRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 40  ? LYS A 42  ? HIS A 40  LYS A 42  5 ? 3  
HELX_P HELX_P2  2  ASP A 65  ? TRP A 69  ? ASP A 65  TRP A 69  1 ? 5  
HELX_P HELX_P3  3  MET A 83  ? THR A 94  ? MET A 83  THR A 94  1 ? 12 
HELX_P HELX_P4  4  ARG A 103 ? PHE A 105 ? ARG A 103 PHE A 105 5 ? 3  
HELX_P HELX_P5  5  ALA A 161 ? ALA A 165 ? ALA A 161 ALA A 165 1 ? 5  
HELX_P HELX_P6  6  ASP A 168 ? GLU A 170 ? ASP A 168 GLU A 170 5 ? 3  
HELX_P HELX_P7  7  GLN A 177 ? ARG A 182 ? GLN A 177 ARG A 182 1 ? 6  
HELX_P HELX_P8  8  GLU A 191 ? GLN A 204 ? GLU A 191 GLN A 204 1 ? 14 
HELX_P HELX_P9  9  ASP A 219 ? LEU A 231 ? ASP A 219 LEU A 231 1 ? 13 
HELX_P HELX_P10 10 MET A 236 ? PHE A 239 ? MET A 236 PHE A 239 5 ? 4  
HELX_P HELX_P11 11 TYR A 270 ? PHE A 277 ? TYR A 270 PHE A 277 1 ? 8  
HELX_P HELX_P12 12 LEU A 287 ? GLU A 294 ? LEU A 287 GLU A 294 1 ? 8  
HELX_P HELX_P13 13 ILE A 306 ? ARG A 335 ? ILE A 306 ARG A 335 5 ? 30 
HELX_P HELX_P14 14 PHE A 337 ? ALA A 348 ? PHE A 337 ALA A 348 1 ? 12 
HELX_P HELX_P15 15 PHE A 352 ? GLY A 354 ? PHE A 352 GLY A 354 5 ? 3  
HELX_P HELX_P16 16 PRO A 358 ? SER A 369 ? PRO A 358 SER A 369 1 ? 12 
HELX_P HELX_P17 17 MET B 63  ? ARG B 67  ? MET B 63  ARG B 67  1 ? 5  
HELX_P HELX_P18 18 MET B 83  ? THR B 94  ? MET B 83  THR B 94  5 ? 12 
HELX_P HELX_P19 19 ARG B 103 ? PHE B 105 ? ARG B 103 PHE B 105 5 ? 3  
HELX_P HELX_P20 20 LEU B 163 ? ALA B 165 ? LEU B 163 ALA B 165 5 ? 3  
HELX_P HELX_P21 21 GLN B 177 ? ARG B 182 ? GLN B 177 ARG B 182 1 ? 6  
HELX_P HELX_P22 22 GLU B 191 ? GLN B 204 ? GLU B 191 GLN B 204 1 ? 14 
HELX_P HELX_P23 23 ASP B 219 ? LEU B 231 ? ASP B 219 LEU B 231 1 ? 13 
HELX_P HELX_P24 24 LYS B 237 ? PHE B 239 ? LYS B 237 PHE B 239 5 ? 3  
HELX_P HELX_P25 25 TYR B 270 ? PHE B 277 ? TYR B 270 PHE B 277 1 ? 8  
HELX_P HELX_P26 26 LEU B 287 ? THR B 295 ? LEU B 287 THR B 295 1 ? 9  
HELX_P HELX_P27 27 ARG B 316 ? ARG B 335 ? ARG B 316 ARG B 335 1 ? 20 
HELX_P HELX_P28 28 PHE B 337 ? TYR B 347 ? PHE B 337 TYR B 347 1 ? 11 
HELX_P HELX_P29 29 PHE B 352 ? GLY B 354 ? PHE B 352 GLY B 354 5 ? 3  
HELX_P HELX_P30 30 PRO B 358 ? ASN B 368 ? PRO B 358 ASN B 368 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 41 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 41 A CYS 55 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf2 disulf ? ? B CYS 41 SG ? ? ? 1_555 B CYS 55 SG ? ? B CYS 41 B CYS 55 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 3 ? 
D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 26  ? GLU A 32  ? GLU A 26  GLU A 32  
A 2 ASN A 14  ? ILE A 20  ? ASN A 14  ILE A 20  
A 3 PHE A 4   ? VAL A 11  ? PHE A 4   VAL A 11  
B 1 ILE A 209 ? THR A 211 ? ILE A 209 THR A 211 
B 2 VAL A 108 ? VAL A 115 ? VAL A 108 VAL A 115 
B 3 ILE A 130 ? ASP A 137 ? ILE A 130 ASP A 137 
B 4 ARG A 142 ? LEU A 148 ? ARG A 142 LEU A 148 
B 5 VAL A 183 ? PHE A 188 ? VAL A 183 PHE A 188 
C 1 GLU B 26  ? VAL B 31  ? GLU B 26  VAL B 31  
C 2 ILE B 15  ? ILE B 20  ? ILE B 15  ILE B 20  
C 3 PHE B 4   ? GLU B 9   ? PHE B 4   GLU B 9   
D 1 SER B 266 ? ASP B 269 ? SER B 266 ASP B 269 
D 2 ILE B 209 ? GLY B 212 ? ILE B 209 GLY B 212 
D 3 VAL B 108 ? VAL B 115 ? VAL B 108 VAL B 115 
D 4 ILE B 130 ? ASP B 137 ? ILE B 130 ASP B 137 
D 5 ARG B 142 ? LEU B 148 ? ARG B 142 LEU B 148 
D 6 VAL B 183 ? PHE B 188 ? VAL B 183 PHE B 188 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 27  ? O ARG A 27  N TYR A 19  ? N TYR A 19  
A 2 3 O ASN A 14  ? O ASN A 14  N VAL A 11  ? N VAL A 11  
B 1 2 O ILE A 209 ? O ILE A 209 N ALA A 109 ? N ALA A 109 
B 2 3 O ASN A 110 ? O ASN A 110 N TYR A 136 ? N TYR A 136 
B 3 4 O ILE A 133 ? O ILE A 133 N PHE A 146 ? N PHE A 146 
B 4 5 O PHE A 143 ? O PHE A 143 N ILE A 184 ? N ILE A 184 
C 1 2 O ARG B 27  ? O ARG B 27  N TYR B 19  ? N TYR B 19  
C 2 3 O VAL B 16  ? O VAL B 16  N GLU B 9   ? N GLU B 9   
D 1 2 O SER B 266 ? O SER B 266 N PHE B 210 ? N PHE B 210 
D 2 3 O ILE B 209 ? O ILE B 209 N ALA B 109 ? N ALA B 109 
D 3 4 O ASN B 110 ? O ASN B 110 N TYR B 136 ? N TYR B 136 
D 4 5 O ILE B 133 ? O ILE B 133 N PHE B 146 ? N PHE B 146 
D 5 6 O PHE B 143 ? O PHE B 143 N ILE B 184 ? N ILE B 184 
# 
_database_PDB_matrix.entry_id          1NOZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NOZ 
_atom_sites.fract_transf_matrix[1][1]   0.008802 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009148 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014582 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 2   ? 65.066  19.971 -23.693 1.00 60.62  ? 2   ASP A N   1 
ATOM   2    C CA  . ASP A 1 2   ? 65.125  18.833 -24.620 1.00 62.80  ? 2   ASP A CA  1 
ATOM   3    C C   . ASP A 1 2   ? 63.841  18.789 -25.446 1.00 56.90  ? 2   ASP A C   1 
ATOM   4    O O   . ASP A 1 2   ? 62.892  18.093 -25.105 1.00 56.23  ? 2   ASP A O   1 
ATOM   5    C CB  . ASP A 1 2   ? 65.348  17.508 -23.856 1.00 69.01  ? 2   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 2   ? 66.133  16.468 -24.680 1.00 72.95  ? 2   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 2   ? 67.221  16.804 -25.227 1.00 73.02  ? 2   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 2   ? 65.652  15.312 -24.776 1.00 76.13  ? 2   ASP A OD2 1 
ATOM   9    N N   . GLU A 1 3   ? 63.885  19.478 -26.578 1.00 51.13  ? 3   GLU A N   1 
ATOM   10   C CA  . GLU A 1 3   ? 62.772  19.654 -27.493 1.00 47.35  ? 3   GLU A CA  1 
ATOM   11   C C   . GLU A 1 3   ? 62.062  20.939 -27.062 1.00 45.84  ? 3   GLU A C   1 
ATOM   12   O O   . GLU A 1 3   ? 61.210  20.957 -26.159 1.00 46.47  ? 3   GLU A O   1 
ATOM   13   C CB  . GLU A 1 3   ? 61.810  18.469 -27.543 1.00 47.46  ? 3   GLU A CB  1 
ATOM   14   C CG  . GLU A 1 3   ? 61.937  17.614 -28.813 1.00 55.07  ? 3   GLU A CG  1 
ATOM   15   C CD  . GLU A 1 3   ? 61.654  18.364 -30.131 1.00 57.28  ? 3   GLU A CD  1 
ATOM   16   O OE1 . GLU A 1 3   ? 61.801  19.602 -30.175 1.00 65.20  ? 3   GLU A OE1 1 
ATOM   17   O OE2 . GLU A 1 3   ? 61.302  17.721 -31.149 1.00 55.84  ? 3   GLU A OE2 1 
ATOM   18   N N   . PHE A 1 4   ? 62.522  22.039 -27.643 1.00 41.15  ? 4   PHE A N   1 
ATOM   19   C CA  . PHE A 1 4   ? 61.979  23.348 -27.372 1.00 37.38  ? 4   PHE A CA  1 
ATOM   20   C C   . PHE A 1 4   ? 62.250  24.240 -28.567 1.00 39.06  ? 4   PHE A C   1 
ATOM   21   O O   . PHE A 1 4   ? 63.203  23.987 -29.336 1.00 37.81  ? 4   PHE A O   1 
ATOM   22   C CB  . PHE A 1 4   ? 62.547  23.940 -26.083 1.00 37.58  ? 4   PHE A CB  1 
ATOM   23   C CG  . PHE A 1 4   ? 64.042  24.120 -26.080 1.00 41.86  ? 4   PHE A CG  1 
ATOM   24   C CD1 . PHE A 1 4   ? 64.615  25.319 -26.486 1.00 45.45  ? 4   PHE A CD1 1 
ATOM   25   C CD2 . PHE A 1 4   ? 64.871  23.123 -25.572 1.00 44.28  ? 4   PHE A CD2 1 
ATOM   26   C CE1 . PHE A 1 4   ? 65.978  25.530 -26.381 1.00 43.22  ? 4   PHE A CE1 1 
ATOM   27   C CE2 . PHE A 1 4   ? 66.242  23.322 -25.460 1.00 43.33  ? 4   PHE A CE2 1 
ATOM   28   C CZ  . PHE A 1 4   ? 66.799  24.529 -25.864 1.00 45.39  ? 4   PHE A CZ  1 
ATOM   29   N N   . TYR A 1 5   ? 61.371  25.239 -28.739 1.00 37.08  ? 5   TYR A N   1 
ATOM   30   C CA  . TYR A 1 5   ? 61.420  26.204 -29.845 1.00 29.15  ? 5   TYR A CA  1 
ATOM   31   C C   . TYR A 1 5   ? 62.426  27.333 -29.695 1.00 26.11  ? 5   TYR A C   1 
ATOM   32   O O   . TYR A 1 5   ? 62.720  27.812 -28.594 1.00 24.04  ? 5   TYR A O   1 
ATOM   33   C CB  . TYR A 1 5   ? 60.025  26.805 -30.100 1.00 27.32  ? 5   TYR A CB  1 
ATOM   34   C CG  . TYR A 1 5   ? 59.494  27.648 -28.970 1.00 18.77  ? 5   TYR A CG  1 
ATOM   35   C CD1 . TYR A 1 5   ? 58.771  27.068 -27.937 1.00 21.99  ? 5   TYR A CD1 1 
ATOM   36   C CD2 . TYR A 1 5   ? 59.732  29.018 -28.924 1.00 17.23  ? 5   TYR A CD2 1 
ATOM   37   C CE1 . TYR A 1 5   ? 58.288  27.834 -26.871 1.00 21.99  ? 5   TYR A CE1 1 
ATOM   38   C CE2 . TYR A 1 5   ? 59.270  29.786 -27.870 1.00 19.65  ? 5   TYR A CE2 1 
ATOM   39   C CZ  . TYR A 1 5   ? 58.542  29.200 -26.838 1.00 26.01  ? 5   TYR A CZ  1 
ATOM   40   O OH  . TYR A 1 5   ? 58.080  29.968 -25.762 1.00 31.23  ? 5   TYR A OH  1 
ATOM   41   N N   . ILE A 1 6   ? 62.872  27.802 -30.845 1.00 26.55  ? 6   ILE A N   1 
ATOM   42   C CA  . ILE A 1 6   ? 63.832  28.886 -30.942 1.00 32.61  ? 6   ILE A CA  1 
ATOM   43   C C   . ILE A 1 6   ? 63.180  30.016 -31.727 1.00 34.32  ? 6   ILE A C   1 
ATOM   44   O O   . ILE A 1 6   ? 63.453  31.186 -31.474 1.00 38.06  ? 6   ILE A O   1 
ATOM   45   C CB  . ILE A 1 6   ? 65.204  28.399 -31.598 1.00 32.75  ? 6   ILE A CB  1 
ATOM   46   C CG1 . ILE A 1 6   ? 66.262  28.248 -30.501 1.00 33.23  ? 6   ILE A CG1 1 
ATOM   47   C CG2 . ILE A 1 6   ? 65.717  29.353 -32.718 1.00 29.42  ? 6   ILE A CG2 1 
ATOM   48   C CD1 . ILE A 1 6   ? 65.941  27.141 -29.502 1.00 33.62  ? 6   ILE A CD1 1 
ATOM   49   N N   . SER A 1 7   ? 62.343  29.659 -32.693 1.00 33.71  ? 7   SER A N   1 
ATOM   50   C CA  . SER A 1 7   ? 61.640  30.649 -33.478 1.00 37.07  ? 7   SER A CA  1 
ATOM   51   C C   . SER A 1 7   ? 60.312  30.124 -33.992 1.00 37.89  ? 7   SER A C   1 
ATOM   52   O O   . SER A 1 7   ? 60.199  28.939 -34.302 1.00 38.28  ? 7   SER A O   1 
ATOM   53   C CB  . SER A 1 7   ? 62.478  31.129 -34.657 1.00 35.57  ? 7   SER A CB  1 
ATOM   54   O OG  . SER A 1 7   ? 61.715  32.054 -35.429 1.00 38.54  ? 7   SER A OG  1 
ATOM   55   N N   . ILE A 1 8   ? 59.305  31.008 -33.968 1.00 40.70  ? 8   ILE A N   1 
ATOM   56   C CA  . ILE A 1 8   ? 57.938  30.748 -34.448 1.00 38.07  ? 8   ILE A CA  1 
ATOM   57   C C   . ILE A 1 8   ? 57.584  31.918 -35.367 1.00 38.66  ? 8   ILE A C   1 
ATOM   58   O O   . ILE A 1 8   ? 57.409  33.059 -34.913 1.00 38.06  ? 8   ILE A O   1 
ATOM   59   C CB  . ILE A 1 8   ? 56.857  30.709 -33.311 1.00 30.81  ? 8   ILE A CB  1 
ATOM   60   C CG1 . ILE A 1 8   ? 57.302  29.844 -32.132 1.00 28.58  ? 8   ILE A CG1 1 
ATOM   61   C CG2 . ILE A 1 8   ? 55.562  30.195 -33.880 1.00 23.64  ? 8   ILE A CG2 1 
ATOM   62   C CD1 . ILE A 1 8   ? 57.465  28.367 -32.435 1.00 21.74  ? 8   ILE A CD1 1 
ATOM   63   N N   . GLU A 1 9   ? 57.557  31.642 -36.664 1.00 41.25  ? 9   GLU A N   1 
ATOM   64   C CA  . GLU A 1 9   ? 57.232  32.647 -37.670 1.00 40.69  ? 9   GLU A CA  1 
ATOM   65   C C   . GLU A 1 9   ? 56.130  32.018 -38.455 1.00 40.48  ? 9   GLU A C   1 
ATOM   66   O O   . GLU A 1 9   ? 55.811  30.850 -38.233 1.00 41.93  ? 9   GLU A O   1 
ATOM   67   C CB  . GLU A 1 9   ? 58.415  32.904 -38.610 1.00 37.39  ? 9   GLU A CB  1 
ATOM   68   C CG  . GLU A 1 9   ? 59.411  33.933 -38.088 1.00 44.32  ? 9   GLU A CG  1 
ATOM   69   C CD  . GLU A 1 9   ? 58.825  35.349 -37.939 1.00 46.75  ? 9   GLU A CD  1 
ATOM   70   O OE1 . GLU A 1 9   ? 57.818  35.669 -38.614 1.00 43.35  ? 9   GLU A OE1 1 
ATOM   71   O OE2 . GLU A 1 9   ? 59.388  36.140 -37.138 1.00 49.07  ? 9   GLU A OE2 1 
ATOM   72   N N   . THR A 1 10  ? 55.536  32.776 -39.357 1.00 40.07  ? 10  THR A N   1 
ATOM   73   C CA  . THR A 1 10  ? 54.479  32.235 -40.182 1.00 46.42  ? 10  THR A CA  1 
ATOM   74   C C   . THR A 1 10  ? 54.689  32.675 -41.609 1.00 49.66  ? 10  THR A C   1 
ATOM   75   O O   . THR A 1 10  ? 55.203  33.763 -41.856 1.00 50.95  ? 10  THR A O   1 
ATOM   76   C CB  . THR A 1 10  ? 53.037  32.701 -39.733 1.00 45.99  ? 10  THR A CB  1 
ATOM   77   O OG1 . THR A 1 10  ? 53.042  34.096 -39.423 1.00 52.99  ? 10  THR A OG1 1 
ATOM   78   C CG2 . THR A 1 10  ? 52.547  31.927 -38.522 1.00 42.79  ? 10  THR A CG2 1 
ATOM   79   N N   . VAL A 1 11  ? 54.378  31.795 -42.551 1.00 53.41  ? 11  VAL A N   1 
ATOM   80   C CA  . VAL A 1 11  ? 54.452  32.147 -43.961 1.00 57.08  ? 11  VAL A CA  1 
ATOM   81   C C   . VAL A 1 11  ? 53.340  31.336 -44.638 1.00 58.30  ? 11  VAL A C   1 
ATOM   82   O O   . VAL A 1 11  ? 53.125  30.174 -44.302 1.00 52.51  ? 11  VAL A O   1 
ATOM   83   C CB  . VAL A 1 11  ? 55.864  31.900 -44.619 1.00 58.32  ? 11  VAL A CB  1 
ATOM   84   C CG1 . VAL A 1 11  ? 57.002  32.424 -43.728 1.00 54.59  ? 11  VAL A CG1 1 
ATOM   85   C CG2 . VAL A 1 11  ? 56.053  30.442 -44.995 1.00 63.99  ? 11  VAL A CG2 1 
ATOM   86   N N   . GLY A 1 12  ? 52.558  32.010 -45.482 1.00 62.48  ? 12  GLY A N   1 
ATOM   87   C CA  . GLY A 1 12  ? 51.461  31.364 -46.190 1.00 66.14  ? 12  GLY A CA  1 
ATOM   88   C C   . GLY A 1 12  ? 50.434  30.712 -45.279 1.00 68.09  ? 12  GLY A C   1 
ATOM   89   O O   . GLY A 1 12  ? 49.902  29.638 -45.615 1.00 70.32  ? 12  GLY A O   1 
ATOM   90   N N   . ASN A 1 13  ? 50.113  31.376 -44.163 1.00 64.68  ? 13  ASN A N   1 
ATOM   91   C CA  . ASN A 1 13  ? 49.158  30.844 -43.188 1.00 63.97  ? 13  ASN A CA  1 
ATOM   92   C C   . ASN A 1 13  ? 49.762  29.570 -42.559 1.00 63.62  ? 13  ASN A C   1 
ATOM   93   O O   . ASN A 1 13  ? 49.030  28.724 -42.005 1.00 63.09  ? 13  ASN A O   1 
ATOM   94   C CB  . ASN A 1 13  ? 47.793  30.494 -43.850 1.00 67.35  ? 13  ASN A CB  1 
ATOM   95   C CG  . ASN A 1 13  ? 46.774  31.662 -43.813 1.00 68.20  ? 13  ASN A CG  1 
ATOM   96   O OD1 . ASN A 1 13  ? 46.164  31.999 -44.834 1.00 67.50  ? 13  ASN A OD1 1 
ATOM   97   N ND2 . ASN A 1 13  ? 46.553  32.232 -42.633 1.00 68.56  ? 13  ASN A ND2 1 
ATOM   98   N N   . ASN A 1 14  ? 51.090  29.436 -42.677 1.00 59.41  ? 14  ASN A N   1 
ATOM   99   C CA  . ASN A 1 14  ? 51.833  28.285 -42.145 1.00 51.54  ? 14  ASN A CA  1 
ATOM   100  C C   . ASN A 1 14  ? 52.767  28.758 -41.076 1.00 47.19  ? 14  ASN A C   1 
ATOM   101  O O   . ASN A 1 14  ? 53.188  29.902 -41.095 1.00 41.58  ? 14  ASN A O   1 
ATOM   102  C CB  . ASN A 1 14  ? 52.732  27.647 -43.206 1.00 55.46  ? 14  ASN A CB  1 
ATOM   103  C CG  . ASN A 1 14  ? 51.966  26.948 -44.296 1.00 57.84  ? 14  ASN A CG  1 
ATOM   104  O OD1 . ASN A 1 14  ? 51.795  27.484 -45.401 1.00 60.62  ? 14  ASN A OD1 1 
ATOM   105  N ND2 . ASN A 1 14  ? 51.531  25.723 -44.014 1.00 56.75  ? 14  ASN A ND2 1 
ATOM   106  N N   . ILE A 1 15  ? 53.133  27.852 -40.179 1.00 44.10  ? 15  ILE A N   1 
ATOM   107  C CA  . ILE A 1 15  ? 54.071  28.149 -39.106 1.00 42.38  ? 15  ILE A CA  1 
ATOM   108  C C   . ILE A 1 15  ? 55.428  27.648 -39.550 1.00 41.09  ? 15  ILE A C   1 
ATOM   109  O O   . ILE A 1 15  ? 55.531  26.543 -40.077 1.00 42.50  ? 15  ILE A O   1 
ATOM   110  C CB  . ILE A 1 15  ? 53.710  27.388 -37.781 1.00 42.51  ? 15  ILE A CB  1 
ATOM   111  C CG1 . ILE A 1 15  ? 52.518  28.053 -37.067 1.00 40.79  ? 15  ILE A CG1 1 
ATOM   112  C CG2 . ILE A 1 15  ? 54.962  27.262 -36.851 1.00 38.49  ? 15  ILE A CG2 1 
ATOM   113  C CD1 . ILE A 1 15  ? 52.821  29.398 -36.424 1.00 34.14  ? 15  ILE A CD1 1 
ATOM   114  N N   . VAL A 1 16  ? 56.447  28.493 -39.441 1.00 42.56  ? 16  VAL A N   1 
ATOM   115  C CA  . VAL A 1 16  ? 57.816  28.076 -39.749 1.00 37.02  ? 16  VAL A CA  1 
ATOM   116  C C   . VAL A 1 16  ? 58.521  28.231 -38.414 1.00 36.34  ? 16  VAL A C   1 
ATOM   117  O O   . VAL A 1 16  ? 58.605  29.347 -37.879 1.00 33.89  ? 16  VAL A O   1 
ATOM   118  C CB  . VAL A 1 16  ? 58.491  28.946 -40.793 1.00 35.39  ? 16  VAL A CB  1 
ATOM   119  C CG1 . VAL A 1 16  ? 59.859  28.377 -41.107 1.00 33.25  ? 16  VAL A CG1 1 
ATOM   120  C CG2 . VAL A 1 16  ? 57.635  29.009 -42.055 1.00 34.18  ? 16  VAL A CG2 1 
ATOM   121  N N   . GLU A 1 17  ? 58.891  27.099 -37.815 1.00 36.10  ? 17  GLU A N   1 
ATOM   122  C CA  . GLU A 1 17  ? 59.558  27.112 -36.514 1.00 37.72  ? 17  GLU A CA  1 
ATOM   123  C C   . GLU A 1 17  ? 60.977  26.529 -36.503 1.00 35.92  ? 17  GLU A C   1 
ATOM   124  O O   . GLU A 1 17  ? 61.311  25.606 -37.276 1.00 29.02  ? 17  GLU A O   1 
ATOM   125  C CB  . GLU A 1 17  ? 58.685  26.438 -35.425 1.00 37.05  ? 17  GLU A CB  1 
ATOM   126  C CG  . GLU A 1 17  ? 58.980  24.982 -35.143 1.00 36.17  ? 17  GLU A CG  1 
ATOM   127  C CD  . GLU A 1 17  ? 58.859  24.626 -33.675 1.00 38.56  ? 17  GLU A CD  1 
ATOM   128  O OE1 . GLU A 1 17  ? 59.258  25.432 -32.811 1.00 42.32  ? 17  GLU A OE1 1 
ATOM   129  O OE2 . GLU A 1 17  ? 58.374  23.518 -33.369 1.00 40.69  ? 17  GLU A OE2 1 
ATOM   130  N N   . ARG A 1 18  ? 61.804  27.102 -35.631 1.00 34.64  ? 18  ARG A N   1 
ATOM   131  C CA  . ARG A 1 18  ? 63.187  26.682 -35.461 1.00 36.59  ? 18  ARG A CA  1 
ATOM   132  C C   . ARG A 1 18  ? 63.221  26.147 -34.062 1.00 36.30  ? 18  ARG A C   1 
ATOM   133  O O   . ARG A 1 18  ? 62.738  26.798 -33.146 1.00 33.04  ? 18  ARG A O   1 
ATOM   134  C CB  . ARG A 1 18  ? 64.149  27.869 -35.561 1.00 39.90  ? 18  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 18  ? 64.405  28.398 -36.968 1.00 42.96  ? 18  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 18  ? 65.165  29.740 -36.934 1.00 43.46  ? 18  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 18  ? 66.283  29.735 -35.994 1.00 36.96  ? 18  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 18  ? 67.048  30.788 -35.731 1.00 37.98  ? 18  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 18  ? 66.825  31.948 -36.324 1.00 37.96  ? 18  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 18  ? 68.045  30.681 -34.862 1.00 45.49  ? 18  ARG A NH2 1 
ATOM   141  N N   . TYR A 1 19  ? 63.824  24.987 -33.879 1.00 37.96  ? 19  TYR A N   1 
ATOM   142  C CA  . TYR A 1 19  ? 63.868  24.397 -32.557 1.00 41.36  ? 19  TYR A CA  1 
ATOM   143  C C   . TYR A 1 19  ? 65.105  23.523 -32.339 1.00 41.47  ? 19  TYR A C   1 
ATOM   144  O O   . TYR A 1 19  ? 65.874  23.249 -33.253 1.00 39.48  ? 19  TYR A O   1 
ATOM   145  C CB  . TYR A 1 19  ? 62.586  23.581 -32.310 1.00 39.93  ? 19  TYR A CB  1 
ATOM   146  C CG  . TYR A 1 19  ? 62.444  22.371 -33.215 1.00 38.08  ? 19  TYR A CG  1 
ATOM   147  C CD1 . TYR A 1 19  ? 62.025  22.501 -34.547 1.00 30.35  ? 19  TYR A CD1 1 
ATOM   148  C CD2 . TYR A 1 19  ? 62.788  21.095 -32.737 1.00 40.42  ? 19  TYR A CD2 1 
ATOM   149  C CE1 . TYR A 1 19  ? 61.959  21.386 -35.373 1.00 39.68  ? 19  TYR A CE1 1 
ATOM   150  C CE2 . TYR A 1 19  ? 62.735  19.970 -33.551 1.00 38.99  ? 19  TYR A CE2 1 
ATOM   151  C CZ  . TYR A 1 19  ? 62.326  20.114 -34.863 1.00 41.69  ? 19  TYR A CZ  1 
ATOM   152  O OH  . TYR A 1 19  ? 62.326  18.982 -35.655 1.00 43.55  ? 19  TYR A OH  1 
ATOM   153  N N   . ILE A 1 20  ? 65.337  23.162 -31.091 1.00 45.60  ? 20  ILE A N   1 
ATOM   154  C CA  . ILE A 1 20  ? 66.448  22.300 -30.779 1.00 48.81  ? 20  ILE A CA  1 
ATOM   155  C C   . ILE A 1 20  ? 65.768  20.971 -30.501 1.00 51.60  ? 20  ILE A C   1 
ATOM   156  O O   . ILE A 1 20  ? 65.105  20.813 -29.462 1.00 51.26  ? 20  ILE A O   1 
ATOM   157  C CB  . ILE A 1 20  ? 67.231  22.774 -29.535 1.00 45.98  ? 20  ILE A CB  1 
ATOM   158  C CG1 . ILE A 1 20  ? 67.730  24.215 -29.723 1.00 45.06  ? 20  ILE A CG1 1 
ATOM   159  C CG2 . ILE A 1 20  ? 68.381  21.845 -29.276 1.00 45.54  ? 20  ILE A CG2 1 
ATOM   160  C CD1 . ILE A 1 20  ? 68.417  24.494 -31.043 1.00 40.47  ? 20  ILE A CD1 1 
ATOM   161  N N   . ASP A 1 21  ? 65.911  20.040 -31.446 1.00 52.10  ? 21  ASP A N   1 
ATOM   162  C CA  . ASP A 1 21  ? 65.304  18.718 -31.343 1.00 54.89  ? 21  ASP A CA  1 
ATOM   163  C C   . ASP A 1 21  ? 65.731  17.870 -30.145 1.00 57.11  ? 21  ASP A C   1 
ATOM   164  O O   . ASP A 1 21  ? 66.489  18.305 -29.276 1.00 56.54  ? 21  ASP A O   1 
ATOM   165  C CB  . ASP A 1 21  ? 65.525  17.924 -32.624 1.00 53.79  ? 21  ASP A CB  1 
ATOM   166  C CG  . ASP A 1 21  ? 66.775  17.088 -32.575 1.00 54.89  ? 21  ASP A CG  1 
ATOM   167  O OD1 . ASP A 1 21  ? 67.839  17.597 -32.961 1.00 60.69  ? 21  ASP A OD1 1 
ATOM   168  O OD2 . ASP A 1 21  ? 66.699  15.925 -32.135 1.00 51.73  ? 21  ASP A OD2 1 
ATOM   169  N N   . GLU A 1 22  ? 65.265  16.621 -30.162 1.00 61.34  ? 22  GLU A N   1 
ATOM   170  C CA  . GLU A 1 22  ? 65.528  15.653 -29.101 1.00 62.87  ? 22  GLU A CA  1 
ATOM   171  C C   . GLU A 1 22  ? 66.934  15.047 -29.038 1.00 60.43  ? 22  GLU A C   1 
ATOM   172  O O   . GLU A 1 22  ? 67.150  14.051 -28.354 1.00 58.06  ? 22  GLU A O   1 
ATOM   173  C CB  . GLU A 1 22  ? 64.419  14.589 -29.067 1.00 63.33  ? 22  GLU A CB  1 
ATOM   174  C CG  . GLU A 1 22  ? 63.782  14.295 -30.420 1.00 66.78  ? 22  GLU A CG  1 
ATOM   175  C CD  . GLU A 1 22  ? 64.341  13.045 -31.062 1.00 71.41  ? 22  GLU A CD  1 
ATOM   176  O OE1 . GLU A 1 22  ? 64.212  11.966 -30.435 1.00 74.39  ? 22  GLU A OE1 1 
ATOM   177  O OE2 . GLU A 1 22  ? 64.899  13.138 -32.181 1.00 71.42  ? 22  GLU A OE2 1 
ATOM   178  N N   . ASN A 1 23  ? 67.867  15.628 -29.788 1.00 60.88  ? 23  ASN A N   1 
ATOM   179  C CA  . ASN A 1 23  ? 69.279  15.228 -29.749 1.00 62.72  ? 23  ASN A CA  1 
ATOM   180  C C   . ASN A 1 23  ? 70.179  16.458 -29.958 1.00 60.51  ? 23  ASN A C   1 
ATOM   181  O O   . ASN A 1 23  ? 71.287  16.388 -30.527 1.00 59.61  ? 23  ASN A O   1 
ATOM   182  C CB  . ASN A 1 23  ? 69.655  13.962 -30.588 1.00 66.45  ? 23  ASN A CB  1 
ATOM   183  C CG  . ASN A 1 23  ? 69.499  14.139 -32.097 1.00 69.29  ? 23  ASN A CG  1 
ATOM   184  O OD1 . ASN A 1 23  ? 68.678  13.458 -32.725 1.00 69.02  ? 23  ASN A OD1 1 
ATOM   185  N ND2 . ASN A 1 23  ? 70.339  14.981 -32.696 1.00 69.20  ? 23  ASN A ND2 1 
ATOM   186  N N   . GLY A 1 24  ? 69.635  17.581 -29.459 1.00 56.10  ? 24  GLY A N   1 
ATOM   187  C CA  . GLY A 1 24  ? 70.286  18.883 -29.441 1.00 47.61  ? 24  GLY A CA  1 
ATOM   188  C C   . GLY A 1 24  ? 70.626  19.609 -30.711 1.00 45.20  ? 24  GLY A C   1 
ATOM   189  O O   . GLY A 1 24  ? 71.340  20.605 -30.650 1.00 43.55  ? 24  GLY A O   1 
ATOM   190  N N   . LYS A 1 25  ? 70.153  19.114 -31.848 1.00 45.09  ? 25  LYS A N   1 
ATOM   191  C CA  . LYS A 1 25  ? 70.418  19.758 -33.129 1.00 48.08  ? 25  LYS A CA  1 
ATOM   192  C C   . LYS A 1 25  ? 69.307  20.749 -33.429 1.00 49.95  ? 25  LYS A C   1 
ATOM   193  O O   . LYS A 1 25  ? 68.123  20.476 -33.189 1.00 52.88  ? 25  LYS A O   1 
ATOM   194  C CB  . LYS A 1 25  ? 70.502  18.730 -34.257 1.00 50.08  ? 25  LYS A CB  1 
ATOM   195  C CG  . LYS A 1 25  ? 71.373  17.525 -33.910 1.00 60.73  ? 25  LYS A CG  1 
ATOM   196  C CD  . LYS A 1 25  ? 72.418  17.214 -34.989 1.00 63.31  ? 25  LYS A CD  1 
ATOM   197  C CE  . LYS A 1 25  ? 73.227  15.956 -34.643 1.00 64.14  ? 25  LYS A CE  1 
ATOM   198  N NZ  . LYS A 1 25  ? 72.428  14.689 -34.654 1.00 61.16  ? 25  LYS A NZ  1 
ATOM   199  N N   . GLU A 1 26  ? 69.679  21.885 -33.993 1.00 48.82  ? 26  GLU A N   1 
ATOM   200  C CA  . GLU A 1 26  ? 68.700  22.900 -34.317 1.00 48.07  ? 26  GLU A CA  1 
ATOM   201  C C   . GLU A 1 26  ? 68.107  22.636 -35.702 1.00 49.03  ? 26  GLU A C   1 
ATOM   202  O O   . GLU A 1 26  ? 68.836  22.591 -36.704 1.00 52.34  ? 26  GLU A O   1 
ATOM   203  C CB  . GLU A 1 26  ? 69.341  24.283 -34.258 1.00 45.27  ? 26  GLU A CB  1 
ATOM   204  C CG  . GLU A 1 26  ? 68.362  25.402 -34.381 1.00 45.80  ? 26  GLU A CG  1 
ATOM   205  C CD  . GLU A 1 26  ? 69.031  26.704 -34.700 1.00 47.49  ? 26  GLU A CD  1 
ATOM   206  O OE1 . GLU A 1 26  ? 69.239  26.998 -35.897 1.00 48.80  ? 26  GLU A OE1 1 
ATOM   207  O OE2 . GLU A 1 26  ? 69.339  27.441 -33.748 1.00 52.18  ? 26  GLU A OE2 1 
ATOM   208  N N   . ARG A 1 27  ? 66.793  22.447 -35.759 1.00 45.51  ? 27  ARG A N   1 
ATOM   209  C CA  . ARG A 1 27  ? 66.138  22.190 -37.021 1.00 46.03  ? 27  ARG A CA  1 
ATOM   210  C C   . ARG A 1 27  ? 65.044  23.217 -37.201 1.00 45.61  ? 27  ARG A C   1 
ATOM   211  O O   . ARG A 1 27  ? 64.660  23.893 -36.249 1.00 47.18  ? 27  ARG A O   1 
ATOM   212  C CB  . ARG A 1 27  ? 65.532  20.789 -37.028 1.00 52.28  ? 27  ARG A CB  1 
ATOM   213  C CG  . ARG A 1 27  ? 66.141  19.819 -36.019 1.00 62.50  ? 27  ARG A CG  1 
ATOM   214  C CD  . ARG A 1 27  ? 66.431  18.455 -36.651 1.00 73.17  ? 27  ARG A CD  1 
ATOM   215  N NE  . ARG A 1 27  ? 66.189  17.367 -35.704 1.00 80.76  ? 27  ARG A NE  1 
ATOM   216  C CZ  . ARG A 1 27  ? 65.507  16.254 -35.983 1.00 86.27  ? 27  ARG A CZ  1 
ATOM   217  N NH1 . ARG A 1 27  ? 65.014  16.035 -37.201 1.00 86.36  ? 27  ARG A NH1 1 
ATOM   218  N NH2 . ARG A 1 27  ? 65.336  15.336 -35.034 1.00 90.23  ? 27  ARG A NH2 1 
ATOM   219  N N   . THR A 1 28  ? 64.525  23.304 -38.418 1.00 44.66  ? 28  THR A N   1 
ATOM   220  C CA  . THR A 1 28  ? 63.459  24.224 -38.774 1.00 44.22  ? 28  THR A CA  1 
ATOM   221  C C   . THR A 1 28  ? 62.423  23.381 -39.513 1.00 46.32  ? 28  THR A C   1 
ATOM   222  O O   . THR A 1 28  ? 62.794  22.454 -40.237 1.00 43.77  ? 28  THR A O   1 
ATOM   223  C CB  . THR A 1 28  ? 63.985  25.316 -39.726 1.00 42.36  ? 28  THR A CB  1 
ATOM   224  O OG1 . THR A 1 28  ? 65.072  26.001 -39.100 1.00 47.71  ? 28  THR A OG1 1 
ATOM   225  C CG2 . THR A 1 28  ? 62.897  26.323 -40.069 1.00 41.00  ? 28  THR A CG2 1 
ATOM   226  N N   . ARG A 1 29  ? 61.137  23.687 -39.320 1.00 46.60  ? 29  ARG A N   1 
ATOM   227  C CA  . ARG A 1 29  ? 60.036  22.968 -39.994 1.00 44.87  ? 29  ARG A CA  1 
ATOM   228  C C   . ARG A 1 29  ? 58.845  23.890 -40.324 1.00 45.34  ? 29  ARG A C   1 
ATOM   229  O O   . ARG A 1 29  ? 58.518  24.798 -39.553 1.00 44.11  ? 29  ARG A O   1 
ATOM   230  C CB  . ARG A 1 29  ? 59.546  21.789 -39.130 1.00 38.63  ? 29  ARG A CB  1 
ATOM   231  C CG  . ARG A 1 29  ? 59.317  22.151 -37.671 1.00 34.75  ? 29  ARG A CG  1 
ATOM   232  C CD  . ARG A 1 29  ? 58.683  21.025 -36.884 1.00 26.48  ? 29  ARG A CD  1 
ATOM   233  N NE  . ARG A 1 29  ? 58.475  21.386 -35.481 1.00 25.00  ? 29  ARG A NE  1 
ATOM   234  C CZ  . ARG A 1 29  ? 58.723  20.564 -34.472 1.00 26.47  ? 29  ARG A CZ  1 
ATOM   235  N NH1 . ARG A 1 29  ? 59.193  19.369 -34.743 1.00 25.68  ? 29  ARG A NH1 1 
ATOM   236  N NH2 . ARG A 1 29  ? 58.520  20.912 -33.200 1.00 26.12  ? 29  ARG A NH2 1 
ATOM   237  N N   . GLU A 1 30  ? 58.267  23.726 -41.513 1.00 48.39  ? 30  GLU A N   1 
ATOM   238  C CA  . GLU A 1 30  ? 57.090  24.509 -41.885 1.00 49.25  ? 30  GLU A CA  1 
ATOM   239  C C   . GLU A 1 30  ? 55.898  23.609 -41.689 1.00 48.28  ? 30  GLU A C   1 
ATOM   240  O O   . GLU A 1 30  ? 55.728  22.626 -42.406 1.00 46.63  ? 30  GLU A O   1 
ATOM   241  C CB  . GLU A 1 30  ? 57.078  24.993 -43.339 1.00 52.02  ? 30  GLU A CB  1 
ATOM   242  C CG  . GLU A 1 30  ? 55.747  25.707 -43.687 1.00 59.28  ? 30  GLU A CG  1 
ATOM   243  C CD  . GLU A 1 30  ? 55.708  26.324 -45.084 1.00 65.92  ? 30  GLU A CD  1 
ATOM   244  O OE1 . GLU A 1 30  ? 56.312  25.745 -46.011 1.00 73.92  ? 30  GLU A OE1 1 
ATOM   245  O OE2 . GLU A 1 30  ? 55.055  27.380 -45.267 1.00 66.32  ? 30  GLU A OE2 1 
ATOM   246  N N   . VAL A 1 31  ? 55.100  23.946 -40.691 1.00 49.40  ? 31  VAL A N   1 
ATOM   247  C CA  . VAL A 1 31  ? 53.900  23.209 -40.343 1.00 49.84  ? 31  VAL A CA  1 
ATOM   248  C C   . VAL A 1 31  ? 52.645  23.813 -41.014 1.00 50.20  ? 31  VAL A C   1 
ATOM   249  O O   . VAL A 1 31  ? 52.627  24.955 -41.473 1.00 50.77  ? 31  VAL A O   1 
ATOM   250  C CB  . VAL A 1 31  ? 53.742  23.214 -38.805 1.00 48.81  ? 31  VAL A CB  1 
ATOM   251  C CG1 . VAL A 1 31  ? 52.649  22.273 -38.346 1.00 50.03  ? 31  VAL A CG1 1 
ATOM   252  C CG2 . VAL A 1 31  ? 55.058  22.834 -38.162 1.00 49.89  ? 31  VAL A CG2 1 
ATOM   253  N N   . GLU A 1 32  ? 51.631  22.983 -41.163 1.00 51.69  ? 32  GLU A N   1 
ATOM   254  C CA  . GLU A 1 32  ? 50.343  23.377 -41.720 1.00 49.58  ? 32  GLU A CA  1 
ATOM   255  C C   . GLU A 1 32  ? 49.667  23.523 -40.359 1.00 45.00  ? 32  GLU A C   1 
ATOM   256  O O   . GLU A 1 32  ? 49.680  22.578 -39.549 1.00 43.62  ? 32  GLU A O   1 
ATOM   257  C CB  . GLU A 1 32  ? 49.725  22.206 -42.495 1.00 55.74  ? 32  GLU A CB  1 
ATOM   258  C CG  . GLU A 1 32  ? 50.731  21.330 -43.292 1.00 67.69  ? 32  GLU A CG  1 
ATOM   259  C CD  . GLU A 1 32  ? 51.736  20.527 -42.410 1.00 73.06  ? 32  GLU A CD  1 
ATOM   260  O OE1 . GLU A 1 32  ? 51.332  19.986 -41.341 1.00 75.74  ? 32  GLU A OE1 1 
ATOM   261  O OE2 . GLU A 1 32  ? 52.934  20.447 -42.795 1.00 70.92  ? 32  GLU A OE2 1 
ATOM   262  N N   . TYR A 1 33  ? 49.153  24.699 -40.038 1.00 38.70  ? 33  TYR A N   1 
ATOM   263  C CA  . TYR A 1 33  ? 48.582  24.810 -38.708 1.00 36.07  ? 33  TYR A CA  1 
ATOM   264  C C   . TYR A 1 33  ? 47.355  25.718 -38.554 1.00 36.74  ? 33  TYR A C   1 
ATOM   265  O O   . TYR A 1 33  ? 47.334  26.854 -39.033 1.00 38.46  ? 33  TYR A O   1 
ATOM   266  C CB  . TYR A 1 33  ? 49.703  25.153 -37.707 1.00 27.52  ? 33  TYR A CB  1 
ATOM   267  C CG  . TYR A 1 33  ? 49.211  25.387 -36.312 1.00 28.59  ? 33  TYR A CG  1 
ATOM   268  C CD1 . TYR A 1 33  ? 49.000  24.320 -35.436 1.00 24.20  ? 33  TYR A CD1 1 
ATOM   269  C CD2 . TYR A 1 33  ? 48.860  26.681 -35.889 1.00 29.23  ? 33  TYR A CD2 1 
ATOM   270  C CE1 . TYR A 1 33  ? 48.434  24.537 -34.178 1.00 30.45  ? 33  TYR A CE1 1 
ATOM   271  C CE2 . TYR A 1 33  ? 48.296  26.910 -34.634 1.00 27.52  ? 33  TYR A CE2 1 
ATOM   272  C CZ  . TYR A 1 33  ? 48.078  25.833 -33.782 1.00 30.46  ? 33  TYR A CZ  1 
ATOM   273  O OH  . TYR A 1 33  ? 47.465  26.042 -32.557 1.00 34.16  ? 33  TYR A OH  1 
ATOM   274  N N   . LEU A 1 34  ? 46.334  25.178 -37.884 1.00 37.65  ? 34  LEU A N   1 
ATOM   275  C CA  . LEU A 1 34  ? 45.071  25.871 -37.611 1.00 34.05  ? 34  LEU A CA  1 
ATOM   276  C C   . LEU A 1 34  ? 44.924  25.877 -36.116 1.00 31.64  ? 34  LEU A C   1 
ATOM   277  O O   . LEU A 1 34  ? 45.002  24.829 -35.465 1.00 37.08  ? 34  LEU A O   1 
ATOM   278  C CB  . LEU A 1 34  ? 43.868  25.127 -38.210 1.00 38.34  ? 34  LEU A CB  1 
ATOM   279  C CG  . LEU A 1 34  ? 43.265  25.609 -39.535 1.00 35.40  ? 34  LEU A CG  1 
ATOM   280  C CD1 . LEU A 1 34  ? 41.883  24.990 -39.716 1.00 38.36  ? 34  LEU A CD1 1 
ATOM   281  C CD2 . LEU A 1 34  ? 43.151  27.104 -39.511 1.00 33.48  ? 34  LEU A CD2 1 
ATOM   282  N N   . PRO A 1 35  ? 44.746  27.053 -35.542 1.00 26.25  ? 35  PRO A N   1 
ATOM   283  C CA  . PRO A 1 35  ? 44.592  27.259 -34.110 1.00 30.74  ? 35  PRO A CA  1 
ATOM   284  C C   . PRO A 1 35  ? 43.232  26.807 -33.574 1.00 34.87  ? 35  PRO A C   1 
ATOM   285  O O   . PRO A 1 35  ? 42.242  26.798 -34.310 1.00 36.73  ? 35  PRO A O   1 
ATOM   286  C CB  . PRO A 1 35  ? 44.764  28.768 -33.982 1.00 31.23  ? 35  PRO A CB  1 
ATOM   287  C CG  . PRO A 1 35  ? 44.098  29.262 -35.233 1.00 31.99  ? 35  PRO A CG  1 
ATOM   288  C CD  . PRO A 1 35  ? 44.654  28.324 -36.274 1.00 30.56  ? 35  PRO A CD  1 
ATOM   289  N N   . THR A 1 36  ? 43.191  26.534 -32.272 1.00 35.73  ? 36  THR A N   1 
ATOM   290  C CA  . THR A 1 36  ? 41.999  26.082 -31.577 1.00 37.95  ? 36  THR A CA  1 
ATOM   291  C C   . THR A 1 36  ? 41.340  27.146 -30.655 1.00 39.81  ? 36  THR A C   1 
ATOM   292  O O   . THR A 1 36  ? 40.450  26.822 -29.868 1.00 40.65  ? 36  THR A O   1 
ATOM   293  C CB  . THR A 1 36  ? 42.362  24.813 -30.739 1.00 40.65  ? 36  THR A CB  1 
ATOM   294  O OG1 . THR A 1 36  ? 43.135  23.925 -31.546 1.00 32.69  ? 36  THR A OG1 1 
ATOM   295  C CG2 . THR A 1 36  ? 41.105  24.066 -30.263 1.00 45.38  ? 36  THR A CG2 1 
ATOM   296  N N   . MET A 1 37  ? 41.787  28.398 -30.709 1.00 38.46  ? 37  MET A N   1 
ATOM   297  C CA  . MET A 1 37  ? 41.211  29.462 -29.870 1.00 39.92  ? 37  MET A CA  1 
ATOM   298  C C   . MET A 1 37  ? 41.454  30.763 -30.593 1.00 36.94  ? 37  MET A C   1 
ATOM   299  O O   . MET A 1 37  ? 42.273  30.781 -31.504 1.00 36.77  ? 37  MET A O   1 
ATOM   300  C CB  . MET A 1 37  ? 41.879  29.538 -28.517 1.00 49.14  ? 37  MET A CB  1 
ATOM   301  C CG  . MET A 1 37  ? 41.810  28.306 -27.664 1.00 59.38  ? 37  MET A CG  1 
ATOM   302  S SD  . MET A 1 37  ? 42.668  28.722 -26.123 1.00 77.58  ? 37  MET A SD  1 
ATOM   303  C CE  . MET A 1 37  ? 41.235  29.420 -25.094 1.00 71.17  ? 37  MET A CE  1 
ATOM   304  N N   . PHE A 1 38  ? 40.845  31.870 -30.171 1.00 34.85  ? 38  PHE A N   1 
ATOM   305  C CA  . PHE A 1 38  ? 41.090  33.068 -30.956 1.00 39.56  ? 38  PHE A CA  1 
ATOM   306  C C   . PHE A 1 38  ? 41.035  34.514 -30.452 1.00 39.50  ? 38  PHE A C   1 
ATOM   307  O O   . PHE A 1 38  ? 41.745  35.381 -31.004 1.00 46.80  ? 38  PHE A O   1 
ATOM   308  C CB  . PHE A 1 38  ? 40.261  32.980 -32.232 1.00 40.32  ? 38  PHE A CB  1 
ATOM   309  C CG  . PHE A 1 38  ? 38.789  33.077 -31.992 1.00 45.39  ? 38  PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 38  ? 38.087  31.997 -31.444 1.00 49.28  ? 38  PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 38  ? 38.101  34.243 -32.298 1.00 40.43  ? 38  PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 38  ? 36.721  32.074 -31.206 1.00 47.10  ? 38  PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 38  ? 36.743  34.335 -32.066 1.00 46.82  ? 38  PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 38  ? 36.047  33.242 -31.516 1.00 47.75  ? 38  PHE A CZ  1 
ATOM   315  N N   . ARG A 1 39  ? 40.239  34.807 -29.436 1.00 34.54  ? 39  ARG A N   1 
ATOM   316  C CA  . ARG A 1 39  ? 40.108  36.208 -28.987 1.00 33.72  ? 39  ARG A CA  1 
ATOM   317  C C   . ARG A 1 39  ? 39.465  37.103 -30.052 1.00 32.30  ? 39  ARG A C   1 
ATOM   318  O O   . ARG A 1 39  ? 40.117  37.586 -30.977 1.00 29.75  ? 39  ARG A O   1 
ATOM   319  C CB  . ARG A 1 39  ? 41.424  36.821 -28.510 1.00 27.26  ? 39  ARG A CB  1 
ATOM   320  C CG  . ARG A 1 39  ? 41.609  36.702 -26.990 1.00 22.39  ? 39  ARG A CG  1 
ATOM   321  C CD  . ARG A 1 39  ? 42.561  37.746 -26.463 1.00 27.03  ? 39  ARG A CD  1 
ATOM   322  N NE  . ARG A 1 39  ? 43.911  37.540 -26.961 1.00 28.09  ? 39  ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 39  ? 45.001  37.756 -26.239 1.00 26.42  ? 39  ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 39  ? 44.906  38.267 -25.019 1.00 19.94  ? 39  ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 39  ? 46.178  37.506 -26.759 1.00 24.98  ? 39  ARG A NH2 1 
ATOM   326  N N   . HIS A 1 40  ? 38.172  37.352 -29.869 1.00 33.85  ? 40  HIS A N   1 
ATOM   327  C CA  . HIS A 1 40  ? 37.374  38.157 -30.795 1.00 37.02  ? 40  HIS A CA  1 
ATOM   328  C C   . HIS A 1 40  ? 37.840  39.614 -30.947 1.00 34.34  ? 40  HIS A C   1 
ATOM   329  O O   . HIS A 1 40  ? 37.698  40.225 -31.990 1.00 33.06  ? 40  HIS A O   1 
ATOM   330  C CB  . HIS A 1 40  ? 35.891  38.124 -30.355 1.00 43.64  ? 40  HIS A CB  1 
ATOM   331  C CG  . HIS A 1 40  ? 35.632  38.761 -29.023 1.00 46.57  ? 40  HIS A CG  1 
ATOM   332  N ND1 . HIS A 1 40  ? 35.863  38.117 -27.819 1.00 47.92  ? 40  HIS A ND1 1 
ATOM   333  C CD2 . HIS A 1 40  ? 35.190  40.006 -28.700 1.00 42.51  ? 40  HIS A CD2 1 
ATOM   334  C CE1 . HIS A 1 40  ? 35.583  38.935 -26.820 1.00 42.47  ? 40  HIS A CE1 1 
ATOM   335  N NE2 . HIS A 1 40  ? 35.178  40.081 -27.325 1.00 43.53  ? 40  HIS A NE2 1 
ATOM   336  N N   . CYS A 1 41  ? 38.363  40.194 -29.888 1.00 34.08  ? 41  CYS A N   1 
ATOM   337  C CA  . CYS A 1 41  ? 38.821  41.560 -29.978 1.00 33.46  ? 41  CYS A CA  1 
ATOM   338  C C   . CYS A 1 41  ? 40.099  41.694 -30.815 1.00 36.46  ? 41  CYS A C   1 
ATOM   339  O O   . CYS A 1 41  ? 40.485  42.805 -31.158 1.00 34.49  ? 41  CYS A O   1 
ATOM   340  C CB  . CYS A 1 41  ? 39.036  42.105 -28.573 1.00 27.54  ? 41  CYS A CB  1 
ATOM   341  S SG  . CYS A 1 41  ? 40.207  41.169 -27.562 1.00 31.91  ? 41  CYS A SG  1 
ATOM   342  N N   . LYS A 1 42  ? 40.749  40.575 -31.144 1.00 42.02  ? 42  LYS A N   1 
ATOM   343  C CA  . LYS A 1 42  ? 41.987  40.615 -31.923 1.00 48.10  ? 42  LYS A CA  1 
ATOM   344  C C   . LYS A 1 42  ? 41.696  40.662 -33.389 1.00 55.13  ? 42  LYS A C   1 
ATOM   345  O O   . LYS A 1 42  ? 42.615  40.771 -34.197 1.00 60.29  ? 42  LYS A O   1 
ATOM   346  C CB  . LYS A 1 42  ? 42.889  39.419 -31.653 1.00 42.14  ? 42  LYS A CB  1 
ATOM   347  C CG  . LYS A 1 42  ? 43.208  39.213 -30.210 1.00 43.26  ? 42  LYS A CG  1 
ATOM   348  C CD  . LYS A 1 42  ? 43.886  40.396 -29.588 1.00 42.83  ? 42  LYS A CD  1 
ATOM   349  C CE  . LYS A 1 42  ? 45.390  40.258 -29.669 1.00 46.45  ? 42  LYS A CE  1 
ATOM   350  N NZ  . LYS A 1 42  ? 46.062  41.093 -28.622 1.00 46.71  ? 42  LYS A NZ  1 
ATOM   351  N N   . GLU A 1 43  ? 40.426  40.532 -33.747 1.00 58.42  ? 43  GLU A N   1 
ATOM   352  C CA  . GLU A 1 43  ? 40.056  40.602 -35.150 1.00 62.69  ? 43  GLU A CA  1 
ATOM   353  C C   . GLU A 1 43  ? 39.899  42.073 -35.514 1.00 62.03  ? 43  GLU A C   1 
ATOM   354  O O   . GLU A 1 43  ? 40.116  42.462 -36.654 1.00 62.95  ? 43  GLU A O   1 
ATOM   355  C CB  . GLU A 1 43  ? 38.741  39.885 -35.380 1.00 68.16  ? 43  GLU A CB  1 
ATOM   356  C CG  . GLU A 1 43  ? 38.530  38.715 -34.454 1.00 75.27  ? 43  GLU A CG  1 
ATOM   357  C CD  . GLU A 1 43  ? 37.139  38.161 -34.566 1.00 79.23  ? 43  GLU A CD  1 
ATOM   358  O OE1 . GLU A 1 43  ? 36.233  38.671 -33.879 1.00 80.34  ? 43  GLU A OE1 1 
ATOM   359  O OE2 . GLU A 1 43  ? 36.948  37.235 -35.371 1.00 83.94  ? 43  GLU A OE2 1 
ATOM   360  N N   . GLY A 1 52  ? 42.506  50.696 -22.487 1.00 54.33  ? 52  GLY A N   1 
ATOM   361  C CA  . GLY A 1 52  ? 43.255  49.514 -22.062 1.00 52.81  ? 52  GLY A CA  1 
ATOM   362  C C   . GLY A 1 52  ? 42.325  48.327 -21.946 1.00 50.05  ? 52  GLY A C   1 
ATOM   363  O O   . GLY A 1 52  ? 41.930  47.913 -20.858 1.00 52.84  ? 52  GLY A O   1 
ATOM   364  N N   . LYS A 1 53  ? 41.998  47.762 -23.090 1.00 47.40  ? 53  LYS A N   1 
ATOM   365  C CA  . LYS A 1 53  ? 41.062  46.673 -23.139 1.00 46.14  ? 53  LYS A CA  1 
ATOM   366  C C   . LYS A 1 53  ? 41.627  45.462 -23.837 1.00 43.54  ? 53  LYS A C   1 
ATOM   367  O O   . LYS A 1 53  ? 42.540  45.576 -24.640 1.00 47.18  ? 53  LYS A O   1 
ATOM   368  C CB  . LYS A 1 53  ? 39.804  47.165 -23.852 1.00 48.44  ? 53  LYS A CB  1 
ATOM   369  C CG  . LYS A 1 53  ? 39.016  48.180 -23.017 1.00 56.31  ? 53  LYS A CG  1 
ATOM   370  C CD  . LYS A 1 53  ? 38.127  49.080 -23.866 1.00 62.76  ? 53  LYS A CD  1 
ATOM   371  C CE  . LYS A 1 53  ? 37.260  48.297 -24.860 1.00 67.58  ? 53  LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 53  ? 36.392  49.205 -25.700 1.00 70.47  ? 53  LYS A NZ  1 
ATOM   373  N N   . ASN A 1 54  ? 41.114  44.296 -23.475 1.00 41.00  ? 54  ASN A N   1 
ATOM   374  C CA  . ASN A 1 54  ? 41.511  43.039 -24.078 1.00 36.68  ? 54  ASN A CA  1 
ATOM   375  C C   . ASN A 1 54  ? 40.238  42.197 -24.084 1.00 37.90  ? 54  ASN A C   1 
ATOM   376  O O   . ASN A 1 54  ? 39.137  42.751 -24.064 1.00 36.61  ? 54  ASN A O   1 
ATOM   377  C CB  . ASN A 1 54  ? 42.598  42.370 -23.248 1.00 33.94  ? 54  ASN A CB  1 
ATOM   378  C CG  . ASN A 1 54  ? 43.507  41.521 -24.089 1.00 32.51  ? 54  ASN A CG  1 
ATOM   379  O OD1 . ASN A 1 54  ? 43.078  40.558 -24.716 1.00 35.83  ? 54  ASN A OD1 1 
ATOM   380  N ND2 . ASN A 1 54  ? 44.764  41.896 -24.147 1.00 39.12  ? 54  ASN A ND2 1 
ATOM   381  N N   . CYS A 1 55  ? 40.363  40.877 -24.146 1.00 35.31  ? 55  CYS A N   1 
ATOM   382  C CA  . CYS A 1 55  ? 39.183  40.036 -24.110 1.00 36.00  ? 55  CYS A CA  1 
ATOM   383  C C   . CYS A 1 55  ? 39.541  38.580 -23.869 1.00 37.96  ? 55  CYS A C   1 
ATOM   384  O O   . CYS A 1 55  ? 40.696  38.173 -24.087 1.00 38.51  ? 55  CYS A O   1 
ATOM   385  C CB  . CYS A 1 55  ? 38.373  40.175 -25.390 1.00 32.97  ? 55  CYS A CB  1 
ATOM   386  S SG  . CYS A 1 55  ? 39.217  39.529 -26.853 1.00 31.58  ? 55  CYS A SG  1 
ATOM   387  N N   . ALA A 1 56  ? 38.577  37.811 -23.350 1.00 34.58  ? 56  ALA A N   1 
ATOM   388  C CA  . ALA A 1 56  ? 38.822  36.397 -23.088 1.00 32.15  ? 56  ALA A CA  1 
ATOM   389  C C   . ALA A 1 56  ? 38.876  35.556 -24.376 1.00 27.66  ? 56  ALA A C   1 
ATOM   390  O O   . ALA A 1 56  ? 38.135  35.778 -25.343 1.00 31.94  ? 56  ALA A O   1 
ATOM   391  C CB  . ALA A 1 56  ? 37.821  35.855 -22.095 1.00 31.76  ? 56  ALA A CB  1 
ATOM   392  N N   . PRO A 1 57  ? 39.832  34.639 -24.443 1.00 25.22  ? 57  PRO A N   1 
ATOM   393  C CA  . PRO A 1 57  ? 39.940  33.816 -25.643 1.00 26.66  ? 57  PRO A CA  1 
ATOM   394  C C   . PRO A 1 57  ? 38.839  32.785 -25.652 1.00 31.59  ? 57  PRO A C   1 
ATOM   395  O O   . PRO A 1 57  ? 38.158  32.611 -24.651 1.00 38.63  ? 57  PRO A O   1 
ATOM   396  C CB  . PRO A 1 57  ? 41.289  33.140 -25.444 1.00 24.72  ? 57  PRO A CB  1 
ATOM   397  C CG  . PRO A 1 57  ? 41.352  32.939 -23.943 1.00 19.98  ? 57  PRO A CG  1 
ATOM   398  C CD  . PRO A 1 57  ? 40.776  34.209 -23.391 1.00 21.34  ? 57  PRO A CD  1 
ATOM   399  N N   . GLN A 1 58  ? 38.645  32.096 -26.767 1.00 35.97  ? 58  GLN A N   1 
ATOM   400  C CA  . GLN A 1 58  ? 37.645  31.028 -26.794 1.00 37.35  ? 58  GLN A CA  1 
ATOM   401  C C   . GLN A 1 58  ? 37.925  30.030 -27.916 1.00 38.20  ? 58  GLN A C   1 
ATOM   402  O O   . GLN A 1 58  ? 38.417  30.395 -29.004 1.00 35.62  ? 58  GLN A O   1 
ATOM   403  C CB  . GLN A 1 58  ? 36.216  31.587 -26.830 1.00 35.49  ? 58  GLN A CB  1 
ATOM   404  C CG  . GLN A 1 58  ? 35.840  32.272 -28.130 1.00 39.87  ? 58  GLN A CG  1 
ATOM   405  C CD  . GLN A 1 58  ? 34.919  33.436 -27.930 1.00 40.29  ? 58  GLN A CD  1 
ATOM   406  O OE1 . GLN A 1 58  ? 34.617  34.164 -28.878 1.00 41.40  ? 58  GLN A OE1 1 
ATOM   407  N NE2 . GLN A 1 58  ? 34.505  33.664 -26.679 1.00 43.30  ? 58  GLN A NE2 1 
ATOM   408  N N   . LYS A 1 59  ? 37.676  28.759 -27.609 1.00 40.89  ? 59  LYS A N   1 
ATOM   409  C CA  . LYS A 1 59  ? 37.913  27.670 -28.545 1.00 39.60  ? 59  LYS A CA  1 
ATOM   410  C C   . LYS A 1 59  ? 37.027  27.742 -29.781 1.00 35.56  ? 59  LYS A C   1 
ATOM   411  O O   . LYS A 1 59  ? 35.872  28.144 -29.709 1.00 34.95  ? 59  LYS A O   1 
ATOM   412  C CB  . LYS A 1 59  ? 37.693  26.328 -27.829 1.00 43.37  ? 59  LYS A CB  1 
ATOM   413  C CG  . LYS A 1 59  ? 38.805  25.262 -28.041 1.00 51.85  ? 59  LYS A CG  1 
ATOM   414  C CD  . LYS A 1 59  ? 39.869  25.283 -26.921 1.00 53.68  ? 59  LYS A CD  1 
ATOM   415  C CE  . LYS A 1 59  ? 39.375  24.559 -25.661 1.00 55.09  ? 59  LYS A CE  1 
ATOM   416  N NZ  . LYS A 1 59  ? 40.225  24.826 -24.453 1.00 56.85  ? 59  LYS A NZ  1 
ATOM   417  N N   . PHE A 1 60  ? 37.599  27.441 -30.935 1.00 34.67  ? 60  PHE A N   1 
ATOM   418  C CA  . PHE A 1 60  ? 36.794  27.412 -32.140 1.00 37.23  ? 60  PHE A CA  1 
ATOM   419  C C   . PHE A 1 60  ? 35.876  26.206 -31.935 1.00 40.26  ? 60  PHE A C   1 
ATOM   420  O O   . PHE A 1 60  ? 36.207  25.299 -31.185 1.00 41.99  ? 60  PHE A O   1 
ATOM   421  C CB  . PHE A 1 60  ? 37.661  27.202 -33.378 1.00 33.90  ? 60  PHE A CB  1 
ATOM   422  C CG  . PHE A 1 60  ? 38.395  28.433 -33.807 1.00 37.60  ? 60  PHE A CG  1 
ATOM   423  C CD1 . PHE A 1 60  ? 37.710  29.518 -34.339 1.00 33.21  ? 60  PHE A CD1 1 
ATOM   424  C CD2 . PHE A 1 60  ? 39.777  28.521 -33.670 1.00 35.96  ? 60  PHE A CD2 1 
ATOM   425  C CE1 . PHE A 1 60  ? 38.389  30.670 -34.725 1.00 31.26  ? 60  PHE A CE1 1 
ATOM   426  C CE2 . PHE A 1 60  ? 40.454  29.665 -34.055 1.00 33.76  ? 60  PHE A CE2 1 
ATOM   427  C CZ  . PHE A 1 60  ? 39.754  30.737 -34.583 1.00 31.86  ? 60  PHE A CZ  1 
ATOM   428  N N   . PRO A 1 61  ? 34.672  26.221 -32.518 1.00 41.27  ? 61  PRO A N   1 
ATOM   429  C CA  . PRO A 1 61  ? 33.784  25.067 -32.331 1.00 37.93  ? 61  PRO A CA  1 
ATOM   430  C C   . PRO A 1 61  ? 34.231  24.023 -33.306 1.00 35.95  ? 61  PRO A C   1 
ATOM   431  O O   . PRO A 1 61  ? 34.345  22.845 -32.980 1.00 31.43  ? 61  PRO A O   1 
ATOM   432  C CB  . PRO A 1 61  ? 32.425  25.607 -32.747 1.00 36.96  ? 61  PRO A CB  1 
ATOM   433  C CG  . PRO A 1 61  ? 32.563  27.080 -32.509 1.00 43.99  ? 61  PRO A CG  1 
ATOM   434  C CD  . PRO A 1 61  ? 33.929  27.371 -33.040 1.00 40.69  ? 61  PRO A CD  1 
ATOM   435  N N   . SER A 1 62  ? 34.533  24.493 -34.506 1.00 34.95  ? 62  SER A N   1 
ATOM   436  C CA  . SER A 1 62  ? 34.963  23.616 -35.556 1.00 36.31  ? 62  SER A CA  1 
ATOM   437  C C   . SER A 1 62  ? 36.167  24.148 -36.359 1.00 38.95  ? 62  SER A C   1 
ATOM   438  O O   . SER A 1 62  ? 36.463  25.365 -36.419 1.00 33.04  ? 62  SER A O   1 
ATOM   439  C CB  . SER A 1 62  ? 33.786  23.291 -36.496 1.00 32.79  ? 62  SER A CB  1 
ATOM   440  O OG  . SER A 1 62  ? 33.472  24.355 -37.401 1.00 28.70  ? 62  SER A OG  1 
ATOM   441  N N   . MET A 1 63  ? 36.794  23.179 -37.020 1.00 38.84  ? 63  MET A N   1 
ATOM   442  C CA  . MET A 1 63  ? 37.938  23.319 -37.886 1.00 35.01  ? 63  MET A CA  1 
ATOM   443  C C   . MET A 1 63  ? 37.550  24.204 -39.056 1.00 34.49  ? 63  MET A C   1 
ATOM   444  O O   . MET A 1 63  ? 38.376  24.554 -39.883 1.00 36.22  ? 63  MET A O   1 
ATOM   445  C CB  . MET A 1 63  ? 38.239  21.922 -38.372 1.00 36.76  ? 63  MET A CB  1 
ATOM   446  C CG  . MET A 1 63  ? 39.577  21.702 -38.923 1.00 42.59  ? 63  MET A CG  1 
ATOM   447  S SD  . MET A 1 63  ? 39.929  20.052 -38.437 1.00 45.09  ? 63  MET A SD  1 
ATOM   448  C CE  . MET A 1 63  ? 38.896  19.135 -39.606 1.00 44.48  ? 63  MET A CE  1 
ATOM   449  N N   . LYS A 1 64  ? 36.260  24.492 -39.163 1.00 37.66  ? 64  LYS A N   1 
ATOM   450  C CA  . LYS A 1 64  ? 35.718  25.341 -40.222 1.00 37.81  ? 64  LYS A CA  1 
ATOM   451  C C   . LYS A 1 64  ? 35.780  26.766 -39.709 1.00 35.82  ? 64  LYS A C   1 
ATOM   452  O O   . LYS A 1 64  ? 36.039  27.716 -40.441 1.00 33.95  ? 64  LYS A O   1 
ATOM   453  C CB  . LYS A 1 64  ? 34.254  24.973 -40.473 1.00 36.98  ? 64  LYS A CB  1 
ATOM   454  C CG  . LYS A 1 64  ? 33.831  25.079 -41.914 1.00 43.33  ? 64  LYS A CG  1 
ATOM   455  C CD  . LYS A 1 64  ? 33.686  26.498 -42.347 1.00 47.74  ? 64  LYS A CD  1 
ATOM   456  C CE  . LYS A 1 64  ? 33.016  26.563 -43.691 1.00 54.81  ? 64  LYS A CE  1 
ATOM   457  N NZ  . LYS A 1 64  ? 31.670  25.878 -43.630 1.00 68.55  ? 64  LYS A NZ  1 
ATOM   458  N N   . ASP A 1 65  ? 35.549  26.894 -38.419 1.00 32.58  ? 65  ASP A N   1 
ATOM   459  C CA  . ASP A 1 65  ? 35.550  28.178 -37.806 1.00 34.25  ? 65  ASP A CA  1 
ATOM   460  C C   . ASP A 1 65  ? 36.978  28.745 -37.867 1.00 34.85  ? 65  ASP A C   1 
ATOM   461  O O   . ASP A 1 65  ? 37.209  29.792 -38.493 1.00 32.05  ? 65  ASP A O   1 
ATOM   462  C CB  . ASP A 1 65  ? 34.962  28.058 -36.383 1.00 39.54  ? 65  ASP A CB  1 
ATOM   463  C CG  . ASP A 1 65  ? 33.508  27.493 -36.383 1.00 39.87  ? 65  ASP A CG  1 
ATOM   464  O OD1 . ASP A 1 65  ? 32.648  28.028 -37.106 1.00 42.25  ? 65  ASP A OD1 1 
ATOM   465  O OD2 . ASP A 1 65  ? 33.220  26.505 -35.673 1.00 35.11  ? 65  ASP A OD2 1 
ATOM   466  N N   . ALA A 1 66  ? 37.943  27.978 -37.349 1.00 36.05  ? 66  ALA A N   1 
ATOM   467  C CA  . ALA A 1 66  ? 39.353  28.390 -37.335 1.00 34.44  ? 66  ALA A CA  1 
ATOM   468  C C   . ALA A 1 66  ? 39.840  28.718 -38.721 1.00 36.74  ? 66  ALA A C   1 
ATOM   469  O O   . ALA A 1 66  ? 40.663  29.623 -38.905 1.00 42.71  ? 66  ALA A O   1 
ATOM   470  C CB  . ALA A 1 66  ? 40.230  27.299 -36.757 1.00 28.73  ? 66  ALA A CB  1 
ATOM   471  N N   . ARG A 1 67  ? 39.271  28.020 -39.697 1.00 34.86  ? 67  ARG A N   1 
ATOM   472  C CA  . ARG A 1 67  ? 39.644  28.135 -41.092 1.00 29.87  ? 67  ARG A CA  1 
ATOM   473  C C   . ARG A 1 67  ? 39.240  29.399 -41.802 1.00 33.77  ? 67  ARG A C   1 
ATOM   474  O O   . ARG A 1 67  ? 39.926  29.856 -42.697 1.00 35.50  ? 67  ARG A O   1 
ATOM   475  C CB  . ARG A 1 67  ? 39.113  26.929 -41.843 1.00 29.83  ? 67  ARG A CB  1 
ATOM   476  C CG  . ARG A 1 67  ? 39.798  26.703 -43.154 1.00 31.21  ? 67  ARG A CG  1 
ATOM   477  C CD  . ARG A 1 67  ? 39.449  25.335 -43.654 1.00 38.63  ? 67  ARG A CD  1 
ATOM   478  N NE  . ARG A 1 67  ? 39.762  24.273 -42.701 1.00 46.82  ? 67  ARG A NE  1 
ATOM   479  C CZ  . ARG A 1 67  ? 40.796  23.439 -42.819 1.00 48.79  ? 67  ARG A CZ  1 
ATOM   480  N NH1 . ARG A 1 67  ? 41.646  23.585 -43.825 1.00 51.34  ? 67  ARG A NH1 1 
ATOM   481  N NH2 . ARG A 1 67  ? 41.000  22.480 -41.918 1.00 48.75  ? 67  ARG A NH2 1 
ATOM   482  N N   . ASP A 1 68  ? 38.106  29.965 -41.447 1.00 37.19  ? 68  ASP A N   1 
ATOM   483  C CA  . ASP A 1 68  ? 37.707  31.166 -42.127 1.00 41.00  ? 68  ASP A CA  1 
ATOM   484  C C   . ASP A 1 68  ? 38.116  32.386 -41.348 1.00 41.43  ? 68  ASP A C   1 
ATOM   485  O O   . ASP A 1 68  ? 38.048  33.521 -41.826 1.00 43.97  ? 68  ASP A O   1 
ATOM   486  C CB  . ASP A 1 68  ? 36.231  31.090 -42.449 1.00 49.20  ? 68  ASP A CB  1 
ATOM   487  C CG  . ASP A 1 68  ? 35.927  29.924 -43.380 1.00 55.02  ? 68  ASP A CG  1 
ATOM   488  O OD1 . ASP A 1 68  ? 36.257  30.002 -44.593 1.00 59.76  ? 68  ASP A OD1 1 
ATOM   489  O OD2 . ASP A 1 68  ? 35.430  28.897 -42.883 1.00 56.99  ? 68  ASP A OD2 1 
ATOM   490  N N   . TRP A 1 69  ? 38.594  32.116 -40.145 1.00 39.85  ? 69  TRP A N   1 
ATOM   491  C CA  . TRP A 1 69  ? 39.112  33.111 -39.240 1.00 37.36  ? 69  TRP A CA  1 
ATOM   492  C C   . TRP A 1 69  ? 40.479  33.409 -39.803 1.00 38.16  ? 69  TRP A C   1 
ATOM   493  O O   . TRP A 1 69  ? 40.821  34.559 -40.025 1.00 34.92  ? 69  TRP A O   1 
ATOM   494  C CB  . TRP A 1 69  ? 39.273  32.474 -37.866 1.00 43.11  ? 69  TRP A CB  1 
ATOM   495  C CG  . TRP A 1 69  ? 40.420  32.996 -37.061 1.00 47.56  ? 69  TRP A CG  1 
ATOM   496  C CD1 . TRP A 1 69  ? 41.718  32.576 -37.110 1.00 49.85  ? 69  TRP A CD1 1 
ATOM   497  C CD2 . TRP A 1 69  ? 40.356  33.987 -36.052 1.00 47.86  ? 69  TRP A CD2 1 
ATOM   498  N NE1 . TRP A 1 69  ? 42.464  33.249 -36.185 1.00 51.16  ? 69  TRP A NE1 1 
ATOM   499  C CE2 . TRP A 1 69  ? 41.648  34.127 -35.522 1.00 51.71  ? 69  TRP A CE2 1 
ATOM   500  C CE3 . TRP A 1 69  ? 39.322  34.770 -35.536 1.00 55.36  ? 69  TRP A CE3 1 
ATOM   501  C CZ2 . TRP A 1 69  ? 41.938  35.023 -34.489 1.00 63.90  ? 69  TRP A CZ2 1 
ATOM   502  C CZ3 . TRP A 1 69  ? 39.603  35.653 -34.516 1.00 62.92  ? 69  TRP A CZ3 1 
ATOM   503  C CH2 . TRP A 1 69  ? 40.901  35.780 -34.000 1.00 63.57  ? 69  TRP A CH2 1 
ATOM   504  N N   . MET A 1 70  ? 41.232  32.331 -40.048 1.00 40.55  ? 70  MET A N   1 
ATOM   505  C CA  . MET A 1 70  ? 42.585  32.375 -40.587 1.00 43.27  ? 70  MET A CA  1 
ATOM   506  C C   . MET A 1 70  ? 42.588  33.058 -41.911 1.00 45.74  ? 70  MET A C   1 
ATOM   507  O O   . MET A 1 70  ? 43.636  33.499 -42.367 1.00 50.73  ? 70  MET A O   1 
ATOM   508  C CB  . MET A 1 70  ? 43.144  30.972 -40.790 1.00 45.80  ? 70  MET A CB  1 
ATOM   509  C CG  . MET A 1 70  ? 43.796  30.363 -39.582 1.00 50.30  ? 70  MET A CG  1 
ATOM   510  S SD  . MET A 1 70  ? 45.480  30.895 -39.338 1.00 63.04  ? 70  MET A SD  1 
ATOM   511  C CE  . MET A 1 70  ? 45.251  32.383 -38.322 1.00 61.89  ? 70  MET A CE  1 
ATOM   512  N N   . LYS A 1 71  ? 41.434  33.076 -42.564 1.00 46.67  ? 71  LYS A N   1 
ATOM   513  C CA  . LYS A 1 71  ? 41.327  33.724 -43.852 1.00 51.98  ? 71  LYS A CA  1 
ATOM   514  C C   . LYS A 1 71  ? 40.800  35.147 -43.732 1.00 53.34  ? 71  LYS A C   1 
ATOM   515  O O   . LYS A 1 71  ? 40.805  35.900 -44.701 1.00 57.70  ? 71  LYS A O   1 
ATOM   516  C CB  . LYS A 1 71  ? 40.484  32.895 -44.804 1.00 55.77  ? 71  LYS A CB  1 
ATOM   517  C CG  . LYS A 1 71  ? 40.862  31.413 -44.781 1.00 66.70  ? 71  LYS A CG  1 
ATOM   518  C CD  . LYS A 1 71  ? 42.389  31.169 -44.766 1.00 70.62  ? 71  LYS A CD  1 
ATOM   519  C CE  . LYS A 1 71  ? 42.747  29.668 -44.669 1.00 70.75  ? 71  LYS A CE  1 
ATOM   520  N NZ  . LYS A 1 71  ? 42.471  29.017 -43.341 1.00 66.98  ? 71  LYS A NZ  1 
ATOM   521  N N   . ARG A 1 72  ? 40.355  35.535 -42.546 1.00 53.23  ? 72  ARG A N   1 
ATOM   522  C CA  . ARG A 1 72  ? 39.885  36.896 -42.347 1.00 52.99  ? 72  ARG A CA  1 
ATOM   523  C C   . ARG A 1 72  ? 41.076  37.874 -42.326 1.00 53.39  ? 72  ARG A C   1 
ATOM   524  O O   . ARG A 1 72  ? 42.235  37.512 -42.026 1.00 50.07  ? 72  ARG A O   1 
ATOM   525  C CB  . ARG A 1 72  ? 39.076  36.989 -41.052 1.00 56.44  ? 72  ARG A CB  1 
ATOM   526  C CG  . ARG A 1 72  ? 37.569  37.069 -41.270 1.00 59.65  ? 72  ARG A CG  1 
ATOM   527  C CD  . ARG A 1 72  ? 36.779  36.879 -39.984 1.00 61.14  ? 72  ARG A CD  1 
ATOM   528  N NE  . ARG A 1 72  ? 36.600  35.465 -39.683 1.00 65.81  ? 72  ARG A NE  1 
ATOM   529  C CZ  . ARG A 1 72  ? 36.514  34.963 -38.458 1.00 66.57  ? 72  ARG A CZ  1 
ATOM   530  N NH1 . ARG A 1 72  ? 36.582  35.754 -37.406 1.00 68.71  ? 72  ARG A NH1 1 
ATOM   531  N NH2 . ARG A 1 72  ? 36.349  33.655 -38.287 1.00 71.30  ? 72  ARG A NH2 1 
ATOM   532  N N   . GLY A 1 82  ? 44.636  38.414 -34.692 1.00 52.90  ? 82  GLY A N   1 
ATOM   533  C CA  . GLY A 1 82  ? 46.019  38.450 -34.261 1.00 47.94  ? 82  GLY A CA  1 
ATOM   534  C C   . GLY A 1 82  ? 46.812  37.229 -34.717 1.00 49.11  ? 82  GLY A C   1 
ATOM   535  O O   . GLY A 1 82  ? 46.578  36.101 -34.259 1.00 46.10  ? 82  GLY A O   1 
ATOM   536  N N   . MET A 1 83  ? 47.750  37.457 -35.636 1.00 48.33  ? 83  MET A N   1 
ATOM   537  C CA  . MET A 1 83  ? 48.623  36.404 -36.144 1.00 45.79  ? 83  MET A CA  1 
ATOM   538  C C   . MET A 1 83  ? 49.512  35.994 -34.987 1.00 42.55  ? 83  MET A C   1 
ATOM   539  O O   . MET A 1 83  ? 49.973  34.866 -34.881 1.00 43.16  ? 83  MET A O   1 
ATOM   540  C CB  . MET A 1 83  ? 49.503  36.940 -37.267 1.00 48.54  ? 83  MET A CB  1 
ATOM   541  C CG  . MET A 1 83  ? 49.944  35.851 -38.195 1.00 55.38  ? 83  MET A CG  1 
ATOM   542  S SD  . MET A 1 83  ? 48.439  35.118 -38.843 1.00 61.01  ? 83  MET A SD  1 
ATOM   543  C CE  . MET A 1 83  ? 48.019  36.394 -40.019 1.00 60.92  ? 83  MET A CE  1 
ATOM   544  N N   . ASN A 1 84  ? 49.707  36.936 -34.086 1.00 40.71  ? 84  ASN A N   1 
ATOM   545  C CA  . ASN A 1 84  ? 50.525  36.736 -32.912 1.00 39.37  ? 84  ASN A CA  1 
ATOM   546  C C   . ASN A 1 84  ? 49.868  35.726 -31.973 1.00 36.91  ? 84  ASN A C   1 
ATOM   547  O O   . ASN A 1 84  ? 50.550  34.952 -31.274 1.00 31.78  ? 84  ASN A O   1 
ATOM   548  C CB  . ASN A 1 84  ? 50.697  38.085 -32.267 1.00 44.80  ? 84  ASN A CB  1 
ATOM   549  C CG  . ASN A 1 84  ? 51.408  38.011 -30.977 1.00 56.22  ? 84  ASN A CG  1 
ATOM   550  O OD1 . ASN A 1 84  ? 51.029  38.708 -30.033 1.00 69.32  ? 84  ASN A OD1 1 
ATOM   551  N ND2 . ASN A 1 84  ? 52.463  37.188 -30.901 1.00 56.85  ? 84  ASN A ND2 1 
ATOM   552  N N   . ASP A 1 85  ? 48.533  35.738 -31.974 1.00 35.69  ? 85  ASP A N   1 
ATOM   553  C CA  . ASP A 1 85  ? 47.712  34.809 -31.185 1.00 32.19  ? 85  ASP A CA  1 
ATOM   554  C C   . ASP A 1 85  ? 47.787  33.420 -31.871 1.00 27.29  ? 85  ASP A C   1 
ATOM   555  O O   . ASP A 1 85  ? 47.755  32.379 -31.209 1.00 24.17  ? 85  ASP A O   1 
ATOM   556  C CB  . ASP A 1 85  ? 46.265  35.320 -31.107 1.00 32.38  ? 85  ASP A CB  1 
ATOM   557  C CG  . ASP A 1 85  ? 45.971  36.088 -29.830 1.00 31.45  ? 85  ASP A CG  1 
ATOM   558  O OD1 . ASP A 1 85  ? 46.872  36.224 -28.990 1.00 30.06  ? 85  ASP A OD1 1 
ATOM   559  O OD2 . ASP A 1 85  ? 44.825  36.548 -29.656 1.00 31.64  ? 85  ASP A OD2 1 
ATOM   560  N N   . PHE A 1 86  ? 47.902  33.432 -33.196 1.00 24.59  ? 86  PHE A N   1 
ATOM   561  C CA  . PHE A 1 86  ? 48.067  32.211 -33.977 1.00 30.40  ? 86  PHE A CA  1 
ATOM   562  C C   . PHE A 1 86  ? 49.362  31.562 -33.472 1.00 32.41  ? 86  PHE A C   1 
ATOM   563  O O   . PHE A 1 86  ? 49.378  30.391 -33.067 1.00 38.43  ? 86  PHE A O   1 
ATOM   564  C CB  . PHE A 1 86  ? 48.233  32.590 -35.446 1.00 34.53  ? 86  PHE A CB  1 
ATOM   565  C CG  . PHE A 1 86  ? 48.456  31.423 -36.390 1.00 44.12  ? 86  PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 86  ? 47.742  30.225 -36.258 1.00 45.42  ? 86  PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 86  ? 49.331  31.566 -37.486 1.00 45.71  ? 86  PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 86  ? 47.883  29.187 -37.206 1.00 44.19  ? 86  PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 86  ? 49.482  30.537 -38.440 1.00 43.09  ? 86  PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 86  ? 48.752  29.345 -38.299 1.00 45.13  ? 86  PHE A CZ  1 
ATOM   571  N N   . LYS A 1 87  ? 50.432  32.349 -33.419 1.00 30.00  ? 87  LYS A N   1 
ATOM   572  C CA  . LYS A 1 87  ? 51.710  31.831 -32.975 1.00 29.79  ? 87  LYS A CA  1 
ATOM   573  C C   . LYS A 1 87  ? 51.626  31.388 -31.541 1.00 29.54  ? 87  LYS A C   1 
ATOM   574  O O   . LYS A 1 87  ? 52.162  30.337 -31.203 1.00 30.55  ? 87  LYS A O   1 
ATOM   575  C CB  . LYS A 1 87  ? 52.832  32.854 -33.165 1.00 34.88  ? 87  LYS A CB  1 
ATOM   576  C CG  . LYS A 1 87  ? 52.973  33.377 -34.598 1.00 39.92  ? 87  LYS A CG  1 
ATOM   577  C CD  . LYS A 1 87  ? 54.283  34.124 -34.816 1.00 42.47  ? 87  LYS A CD  1 
ATOM   578  C CE  . LYS A 1 87  ? 54.396  35.333 -33.921 1.00 43.59  ? 87  LYS A CE  1 
ATOM   579  N NZ  . LYS A 1 87  ? 54.075  36.510 -34.744 1.00 52.15  ? 87  LYS A NZ  1 
ATOM   580  N N   . LEU A 1 88  ? 50.941  32.162 -30.699 1.00 30.53  ? 88  LEU A N   1 
ATOM   581  C CA  . LEU A 1 88  ? 50.799  31.803 -29.284 1.00 33.48  ? 88  LEU A CA  1 
ATOM   582  C C   . LEU A 1 88  ? 50.129  30.446 -29.132 1.00 39.11  ? 88  LEU A C   1 
ATOM   583  O O   . LEU A 1 88  ? 50.495  29.657 -28.238 1.00 39.99  ? 88  LEU A O   1 
ATOM   584  C CB  . LEU A 1 88  ? 49.970  32.840 -28.530 1.00 32.13  ? 88  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 88  ? 50.684  34.057 -27.953 1.00 31.06  ? 88  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 88  ? 49.652  35.036 -27.433 1.00 22.59  ? 88  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 88  ? 51.629  33.630 -26.829 1.00 30.81  ? 88  LEU A CD2 1 
ATOM   588  N N   . ALA A 1 89  ? 49.131  30.200 -29.993 1.00 41.41  ? 89  ALA A N   1 
ATOM   589  C CA  . ALA A 1 89  ? 48.359  28.959 -30.005 1.00 37.25  ? 89  ALA A CA  1 
ATOM   590  C C   . ALA A 1 89  ? 49.237  27.810 -30.442 1.00 38.02  ? 89  ALA A C   1 
ATOM   591  O O   . ALA A 1 89  ? 49.301  26.790 -29.752 1.00 37.75  ? 89  ALA A O   1 
ATOM   592  C CB  . ALA A 1 89  ? 47.179  29.088 -30.929 1.00 39.63  ? 89  ALA A CB  1 
ATOM   593  N N   . TYR A 1 90  ? 49.932  27.981 -31.569 1.00 37.69  ? 90  TYR A N   1 
ATOM   594  C CA  . TYR A 1 90  ? 50.823  26.937 -32.077 1.00 38.19  ? 90  TYR A CA  1 
ATOM   595  C C   . TYR A 1 90  ? 51.711  26.450 -30.967 1.00 37.09  ? 90  TYR A C   1 
ATOM   596  O O   . TYR A 1 90  ? 51.770  25.255 -30.674 1.00 37.76  ? 90  TYR A O   1 
ATOM   597  C CB  . TYR A 1 90  ? 51.710  27.430 -33.221 1.00 44.10  ? 90  TYR A CB  1 
ATOM   598  C CG  . TYR A 1 90  ? 52.762  26.397 -33.616 1.00 50.26  ? 90  TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 90  ? 53.987  26.324 -32.947 1.00 50.49  ? 90  TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 90  ? 52.510  25.453 -34.616 1.00 52.83  ? 90  TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 90  ? 54.919  25.343 -33.254 1.00 48.94  ? 90  TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 90  ? 53.444  24.469 -34.933 1.00 51.24  ? 90  TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 90  ? 54.647  24.420 -34.244 1.00 51.18  ? 90  TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 90  ? 55.570  23.437 -34.534 1.00 49.46  ? 90  TYR A OH  1 
ATOM   605  N N   . ILE A 1 91  ? 52.396  27.390 -30.341 1.00 35.05  ? 91  ILE A N   1 
ATOM   606  C CA  . ILE A 1 91  ? 53.292  27.061 -29.250 1.00 38.23  ? 91  ILE A CA  1 
ATOM   607  C C   . ILE A 1 91  ? 52.594  26.172 -28.216 1.00 41.25  ? 91  ILE A C   1 
ATOM   608  O O   . ILE A 1 91  ? 53.059  25.055 -27.947 1.00 42.76  ? 91  ILE A O   1 
ATOM   609  C CB  . ILE A 1 91  ? 53.882  28.341 -28.572 1.00 35.55  ? 91  ILE A CB  1 
ATOM   610  C CG1 . ILE A 1 91  ? 54.632  29.191 -29.611 1.00 29.95  ? 91  ILE A CG1 1 
ATOM   611  C CG2 . ILE A 1 91  ? 54.803  27.959 -27.429 1.00 32.06  ? 91  ILE A CG2 1 
ATOM   612  C CD1 . ILE A 1 91  ? 55.095  30.522 -29.092 1.00 26.37  ? 91  ILE A CD1 1 
ATOM   613  N N   . SER A 1 92  ? 51.436  26.622 -27.727 1.00 41.00  ? 92  SER A N   1 
ATOM   614  C CA  . SER A 1 92  ? 50.675  25.888 -26.714 1.00 39.60  ? 92  SER A CA  1 
ATOM   615  C C   . SER A 1 92  ? 50.296  24.496 -27.141 1.00 37.98  ? 92  SER A C   1 
ATOM   616  O O   . SER A 1 92  ? 50.335  23.563 -26.344 1.00 38.36  ? 92  SER A O   1 
ATOM   617  C CB  . SER A 1 92  ? 49.421  26.660 -26.328 1.00 41.46  ? 92  SER A CB  1 
ATOM   618  O OG  . SER A 1 92  ? 49.774  27.889 -25.711 1.00 45.85  ? 92  SER A OG  1 
ATOM   619  N N   . ASP A 1 93  ? 49.921  24.363 -28.402 1.00 39.28  ? 93  ASP A N   1 
ATOM   620  C CA  . ASP A 1 93  ? 49.530  23.080 -28.934 1.00 40.45  ? 93  ASP A CA  1 
ATOM   621  C C   . ASP A 1 93  ? 50.769  22.231 -29.035 1.00 41.61  ? 93  ASP A C   1 
ATOM   622  O O   . ASP A 1 93  ? 50.759  21.085 -28.608 1.00 41.33  ? 93  ASP A O   1 
ATOM   623  C CB  . ASP A 1 93  ? 48.875  23.216 -30.323 1.00 43.25  ? 93  ASP A CB  1 
ATOM   624  C CG  . ASP A 1 93  ? 47.377  23.636 -30.263 1.00 46.06  ? 93  ASP A CG  1 
ATOM   625  O OD1 . ASP A 1 93  ? 46.878  24.095 -29.213 1.00 46.91  ? 93  ASP A OD1 1 
ATOM   626  O OD2 . ASP A 1 93  ? 46.701  23.521 -31.303 1.00 46.16  ? 93  ASP A OD2 1 
ATOM   627  N N   . THR A 1 94  ? 51.867  22.834 -29.490 1.00 43.48  ? 94  THR A N   1 
ATOM   628  C CA  . THR A 1 94  ? 53.118  22.099 -29.675 1.00 41.28  ? 94  THR A CA  1 
ATOM   629  C C   . THR A 1 94  ? 53.965  21.823 -28.440 1.00 42.31  ? 94  THR A C   1 
ATOM   630  O O   . THR A 1 94  ? 54.697  20.829 -28.404 1.00 43.59  ? 94  THR A O   1 
ATOM   631  C CB  . THR A 1 94  ? 53.980  22.743 -30.731 1.00 40.55  ? 94  THR A CB  1 
ATOM   632  O OG1 . THR A 1 94  ? 53.155  23.115 -31.841 1.00 42.95  ? 94  THR A OG1 1 
ATOM   633  C CG2 . THR A 1 94  ? 55.019  21.761 -31.208 1.00 34.32  ? 94  THR A CG2 1 
ATOM   634  N N   . TYR A 1 95  ? 53.832  22.643 -27.406 1.00 39.36  ? 95  TYR A N   1 
ATOM   635  C CA  . TYR A 1 95  ? 54.636  22.449 -26.211 1.00 38.64  ? 95  TYR A CA  1 
ATOM   636  C C   . TYR A 1 95  ? 53.732  22.557 -25.009 1.00 39.51  ? 95  TYR A C   1 
ATOM   637  O O   . TYR A 1 95  ? 53.959  23.360 -24.117 1.00 39.62  ? 95  TYR A O   1 
ATOM   638  C CB  . TYR A 1 95  ? 55.776  23.491 -26.171 1.00 38.63  ? 95  TYR A CB  1 
ATOM   639  C CG  . TYR A 1 95  ? 56.696  23.436 -27.380 1.00 32.80  ? 95  TYR A CG  1 
ATOM   640  C CD1 . TYR A 1 95  ? 57.773  22.534 -27.432 1.00 29.13  ? 95  TYR A CD1 1 
ATOM   641  C CD2 . TYR A 1 95  ? 56.455  24.236 -28.498 1.00 33.44  ? 95  TYR A CD2 1 
ATOM   642  C CE1 . TYR A 1 95  ? 58.584  22.428 -28.574 1.00 27.51  ? 95  TYR A CE1 1 
ATOM   643  C CE2 . TYR A 1 95  ? 57.264  24.140 -29.652 1.00 36.68  ? 95  TYR A CE2 1 
ATOM   644  C CZ  . TYR A 1 95  ? 58.326  23.227 -29.676 1.00 33.18  ? 95  TYR A CZ  1 
ATOM   645  O OH  . TYR A 1 95  ? 59.093  23.103 -30.813 1.00 30.33  ? 95  TYR A OH  1 
ATOM   646  N N   . GLY A 1 96  ? 52.722  21.695 -24.973 1.00 43.09  ? 96  GLY A N   1 
ATOM   647  C CA  . GLY A 1 96  ? 51.738  21.714 -23.901 1.00 46.28  ? 96  GLY A CA  1 
ATOM   648  C C   . GLY A 1 96  ? 52.192  21.366 -22.497 1.00 46.72  ? 96  GLY A C   1 
ATOM   649  O O   . GLY A 1 96  ? 51.485  21.581 -21.507 1.00 51.87  ? 96  GLY A O   1 
ATOM   650  N N   . SER A 1 97  ? 53.395  20.854 -22.393 1.00 45.04  ? 97  SER A N   1 
ATOM   651  C CA  . SER A 1 97  ? 53.893  20.470 -21.095 1.00 44.65  ? 97  SER A CA  1 
ATOM   652  C C   . SER A 1 97  ? 54.906  21.525 -20.684 1.00 41.22  ? 97  SER A C   1 
ATOM   653  O O   . SER A 1 97  ? 55.290  22.342 -21.510 1.00 36.75  ? 97  SER A O   1 
ATOM   654  C CB  . SER A 1 97  ? 54.538  19.074 -21.206 1.00 49.11  ? 97  SER A CB  1 
ATOM   655  O OG  . SER A 1 97  ? 54.470  18.544 -22.541 1.00 49.64  ? 97  SER A OG  1 
ATOM   656  N N   . GLU A 1 98  ? 55.327  21.511 -19.421 1.00 41.54  ? 98  GLU A N   1 
ATOM   657  C CA  . GLU A 1 98  ? 56.326  22.463 -18.945 1.00 41.48  ? 98  GLU A CA  1 
ATOM   658  C C   . GLU A 1 98  ? 57.489  22.355 -19.872 1.00 41.69  ? 98  GLU A C   1 
ATOM   659  O O   . GLU A 1 98  ? 57.865  21.258 -20.265 1.00 46.66  ? 98  GLU A O   1 
ATOM   660  C CB  . GLU A 1 98  ? 56.788  22.154 -17.523 1.00 44.98  ? 98  GLU A CB  1 
ATOM   661  C CG  . GLU A 1 98  ? 57.950  23.018 -17.058 1.00 50.70  ? 98  GLU A CG  1 
ATOM   662  C CD  . GLU A 1 98  ? 57.967  23.254 -15.553 1.00 55.56  ? 98  GLU A CD  1 
ATOM   663  O OE1 . GLU A 1 98  ? 58.309  22.326 -14.789 1.00 59.63  ? 98  GLU A OE1 1 
ATOM   664  O OE2 . GLU A 1 98  ? 57.667  24.393 -15.129 1.00 63.67  ? 98  GLU A OE2 1 
ATOM   665  N N   . ILE A 1 99  ? 57.976  23.489 -20.334 1.00 40.49  ? 99  ILE A N   1 
ATOM   666  C CA  . ILE A 1 99  ? 59.104  23.456 -21.231 1.00 42.05  ? 99  ILE A CA  1 
ATOM   667  C C   . ILE A 1 99  ? 60.440  23.234 -20.471 1.00 41.82  ? 99  ILE A C   1 
ATOM   668  O O   . ILE A 1 99  ? 60.629  23.717 -19.347 1.00 38.33  ? 99  ILE A O   1 
ATOM   669  C CB  . ILE A 1 99  ? 59.105  24.727 -22.138 1.00 39.92  ? 99  ILE A CB  1 
ATOM   670  C CG1 . ILE A 1 99  ? 57.795  24.770 -22.939 1.00 33.05  ? 99  ILE A CG1 1 
ATOM   671  C CG2 . ILE A 1 99  ? 60.369  24.769 -23.052 1.00 38.61  ? 99  ILE A CG2 1 
ATOM   672  C CD1 . ILE A 1 99  ? 57.707  25.856 -24.008 1.00 26.13  ? 99  ILE A CD1 1 
ATOM   673  N N   . VAL A 1 100 ? 61.277  22.358 -21.026 1.00 42.82  ? 100 VAL A N   1 
ATOM   674  C CA  . VAL A 1 100 ? 62.607  22.071 -20.465 1.00 45.86  ? 100 VAL A CA  1 
ATOM   675  C C   . VAL A 1 100 ? 63.510  22.620 -21.543 1.00 42.49  ? 100 VAL A C   1 
ATOM   676  O O   . VAL A 1 100 ? 63.467  22.145 -22.689 1.00 41.37  ? 100 VAL A O   1 
ATOM   677  C CB  . VAL A 1 100 ? 62.957  20.544 -20.380 1.00 48.99  ? 100 VAL A CB  1 
ATOM   678  C CG1 . VAL A 1 100 ? 64.196  20.345 -19.534 1.00 45.18  ? 100 VAL A CG1 1 
ATOM   679  C CG2 . VAL A 1 100 ? 61.798  19.717 -19.857 1.00 51.18  ? 100 VAL A CG2 1 
ATOM   680  N N   . TYR A 1 101 ? 64.310  23.620 -21.210 1.00 39.63  ? 101 TYR A N   1 
ATOM   681  C CA  . TYR A 1 101 ? 65.201  24.190 -22.218 1.00 38.57  ? 101 TYR A CA  1 
ATOM   682  C C   . TYR A 1 101 ? 66.627  24.226 -21.703 1.00 36.03  ? 101 TYR A C   1 
ATOM   683  O O   . TYR A 1 101 ? 66.862  24.086 -20.499 1.00 35.31  ? 101 TYR A O   1 
ATOM   684  C CB  . TYR A 1 101 ? 64.757  25.607 -22.585 1.00 38.08  ? 101 TYR A CB  1 
ATOM   685  C CG  . TYR A 1 101 ? 64.659  26.492 -21.386 1.00 38.65  ? 101 TYR A CG  1 
ATOM   686  C CD1 . TYR A 1 101 ? 63.622  26.321 -20.484 1.00 39.03  ? 101 TYR A CD1 1 
ATOM   687  C CD2 . TYR A 1 101 ? 65.623  27.472 -21.115 1.00 34.37  ? 101 TYR A CD2 1 
ATOM   688  C CE1 . TYR A 1 101 ? 63.530  27.081 -19.351 1.00 38.98  ? 101 TYR A CE1 1 
ATOM   689  C CE2 . TYR A 1 101 ? 65.538  28.243 -19.969 1.00 30.78  ? 101 TYR A CE2 1 
ATOM   690  C CZ  . TYR A 1 101 ? 64.477  28.036 -19.096 1.00 34.70  ? 101 TYR A CZ  1 
ATOM   691  O OH  . TYR A 1 101 ? 64.318  28.765 -17.944 1.00 45.62  ? 101 TYR A OH  1 
ATOM   692  N N   . ASP A 1 102 ? 67.568  24.447 -22.613 1.00 36.83  ? 102 ASP A N   1 
ATOM   693  C CA  . ASP A 1 102 ? 68.973  24.528 -22.254 1.00 37.77  ? 102 ASP A CA  1 
ATOM   694  C C   . ASP A 1 102 ? 69.602  25.608 -23.095 1.00 35.56  ? 102 ASP A C   1 
ATOM   695  O O   . ASP A 1 102 ? 69.656  25.489 -24.321 1.00 31.99  ? 102 ASP A O   1 
ATOM   696  C CB  . ASP A 1 102 ? 69.681  23.209 -22.524 1.00 43.41  ? 102 ASP A CB  1 
ATOM   697  C CG  . ASP A 1 102 ? 70.975  23.084 -21.762 1.00 49.55  ? 102 ASP A CG  1 
ATOM   698  O OD1 . ASP A 1 102 ? 71.621  24.123 -21.471 1.00 52.14  ? 102 ASP A OD1 1 
ATOM   699  O OD2 . ASP A 1 102 ? 71.340  21.940 -21.438 1.00 56.24  ? 102 ASP A OD2 1 
ATOM   700  N N   . ARG A 1 103 ? 70.142  26.625 -22.425 1.00 37.67  ? 103 ARG A N   1 
ATOM   701  C CA  . ARG A 1 103 ? 70.754  27.758 -23.123 1.00 40.40  ? 103 ARG A CA  1 
ATOM   702  C C   . ARG A 1 103 ? 71.921  27.375 -24.000 1.00 39.70  ? 103 ARG A C   1 
ATOM   703  O O   . ARG A 1 103 ? 72.208  28.046 -24.995 1.00 37.57  ? 103 ARG A O   1 
ATOM   704  C CB  . ARG A 1 103 ? 71.185  28.864 -22.148 1.00 40.94  ? 103 ARG A CB  1 
ATOM   705  C CG  . ARG A 1 103 ? 71.979  29.992 -22.810 1.00 40.06  ? 103 ARG A CG  1 
ATOM   706  C CD  . ARG A 1 103 ? 71.407  31.335 -22.503 1.00 42.92  ? 103 ARG A CD  1 
ATOM   707  N NE  . ARG A 1 103 ? 72.274  32.154 -21.660 1.00 47.67  ? 103 ARG A NE  1 
ATOM   708  C CZ  . ARG A 1 103 ? 73.049  33.154 -22.095 1.00 47.91  ? 103 ARG A CZ  1 
ATOM   709  N NH1 . ARG A 1 103 ? 73.144  33.454 -23.387 1.00 44.74  ? 103 ARG A NH1 1 
ATOM   710  N NH2 . ARG A 1 103 ? 73.770  33.846 -21.224 1.00 50.16  ? 103 ARG A NH2 1 
ATOM   711  N N   . LYS A 1 104 ? 72.599  26.295 -23.620 1.00 44.79  ? 104 LYS A N   1 
ATOM   712  C CA  . LYS A 1 104 ? 73.749  25.819 -24.374 1.00 43.10  ? 104 LYS A CA  1 
ATOM   713  C C   . LYS A 1 104 ? 73.314  25.467 -25.778 1.00 43.96  ? 104 LYS A C   1 
ATOM   714  O O   . LYS A 1 104 ? 74.133  25.432 -26.685 1.00 47.42  ? 104 LYS A O   1 
ATOM   715  C CB  . LYS A 1 104 ? 74.421  24.641 -23.680 1.00 39.39  ? 104 LYS A CB  1 
ATOM   716  C CG  . LYS A 1 104 ? 73.826  23.288 -23.947 1.00 40.84  ? 104 LYS A CG  1 
ATOM   717  C CD  . LYS A 1 104 ? 74.677  22.252 -23.217 1.00 47.94  ? 104 LYS A CD  1 
ATOM   718  C CE  . LYS A 1 104 ? 73.902  21.007 -22.835 1.00 51.42  ? 104 LYS A CE  1 
ATOM   719  N NZ  . LYS A 1 104 ? 74.501  20.301 -21.651 1.00 50.67  ? 104 LYS A NZ  1 
ATOM   720  N N   . PHE A 1 105 ? 72.008  25.291 -25.967 1.00 44.00  ? 105 PHE A N   1 
ATOM   721  C CA  . PHE A 1 105 ? 71.464  24.981 -27.281 1.00 39.48  ? 105 PHE A CA  1 
ATOM   722  C C   . PHE A 1 105 ? 70.968  26.204 -28.049 1.00 35.39  ? 105 PHE A C   1 
ATOM   723  O O   . PHE A 1 105 ? 70.693  26.127 -29.242 1.00 30.71  ? 105 PHE A O   1 
ATOM   724  C CB  . PHE A 1 105 ? 70.393  23.901 -27.131 1.00 44.73  ? 105 PHE A CB  1 
ATOM   725  C CG  . PHE A 1 105 ? 70.967  22.581 -26.722 1.00 45.37  ? 105 PHE A CG  1 
ATOM   726  C CD1 . PHE A 1 105 ? 71.792  21.881 -27.606 1.00 46.80  ? 105 PHE A CD1 1 
ATOM   727  C CD2 . PHE A 1 105 ? 70.803  22.103 -25.424 1.00 46.24  ? 105 PHE A CD2 1 
ATOM   728  C CE1 . PHE A 1 105 ? 72.454  20.742 -27.209 1.00 48.51  ? 105 PHE A CE1 1 
ATOM   729  C CE2 . PHE A 1 105 ? 71.459  20.957 -25.005 1.00 43.98  ? 105 PHE A CE2 1 
ATOM   730  C CZ  . PHE A 1 105 ? 72.291  20.275 -25.894 1.00 49.97  ? 105 PHE A CZ  1 
ATOM   731  N N   . VAL A 1 106 ? 70.976  27.354 -27.381 1.00 33.05  ? 106 VAL A N   1 
ATOM   732  C CA  . VAL A 1 106 ? 70.530  28.620 -27.967 1.00 32.49  ? 106 VAL A CA  1 
ATOM   733  C C   . VAL A 1 106 ? 71.686  29.561 -28.384 1.00 30.59  ? 106 VAL A C   1 
ATOM   734  O O   . VAL A 1 106 ? 72.471  30.048 -27.537 1.00 24.33  ? 106 VAL A O   1 
ATOM   735  C CB  . VAL A 1 106 ? 69.608  29.414 -26.994 1.00 34.14  ? 106 VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 106 ? 68.967  30.569 -27.724 1.00 30.07  ? 106 VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 106 ? 68.566  28.499 -26.340 1.00 33.88  ? 106 VAL A CG2 1 
ATOM   738  N N   . ARG A 1 107 ? 71.740  29.853 -29.684 1.00 27.59  ? 107 ARG A N   1 
ATOM   739  C CA  . ARG A 1 107 ? 72.745  30.744 -30.230 1.00 28.95  ? 107 ARG A CA  1 
ATOM   740  C C   . ARG A 1 107 ? 72.398  32.224 -30.094 1.00 30.61  ? 107 ARG A C   1 
ATOM   741  O O   . ARG A 1 107 ? 71.523  32.764 -30.797 1.00 24.16  ? 107 ARG A O   1 
ATOM   742  C CB  . ARG A 1 107 ? 73.029  30.430 -31.689 1.00 28.80  ? 107 ARG A CB  1 
ATOM   743  C CG  . ARG A 1 107 ? 74.035  31.392 -32.274 1.00 29.93  ? 107 ARG A CG  1 
ATOM   744  C CD  . ARG A 1 107 ? 74.076  31.318 -33.783 1.00 36.49  ? 107 ARG A CD  1 
ATOM   745  N NE  . ARG A 1 107 ? 74.887  30.198 -34.207 1.00 44.07  ? 107 ARG A NE  1 
ATOM   746  C CZ  . ARG A 1 107 ? 74.435  28.969 -34.351 1.00 42.94  ? 107 ARG A CZ  1 
ATOM   747  N NH1 . ARG A 1 107 ? 73.136  28.729 -34.193 1.00 51.79  ? 107 ARG A NH1 1 
ATOM   748  N NH2 . ARG A 1 107 ? 75.266  28.005 -34.709 1.00 42.46  ? 107 ARG A NH2 1 
ATOM   749  N N   . VAL A 1 108 ? 73.105  32.856 -29.163 1.00 33.54  ? 108 VAL A N   1 
ATOM   750  C CA  . VAL A 1 108 ? 72.991  34.274 -28.865 1.00 34.17  ? 108 VAL A CA  1 
ATOM   751  C C   . VAL A 1 108 ? 74.263  34.863 -29.434 1.00 35.92  ? 108 VAL A C   1 
ATOM   752  O O   . VAL A 1 108 ? 75.370  34.403 -29.152 1.00 37.18  ? 108 VAL A O   1 
ATOM   753  C CB  . VAL A 1 108 ? 73.026  34.566 -27.362 1.00 34.38  ? 108 VAL A CB  1 
ATOM   754  C CG1 . VAL A 1 108 ? 73.053  36.076 -27.141 1.00 29.95  ? 108 VAL A CG1 1 
ATOM   755  C CG2 . VAL A 1 108 ? 71.845  33.924 -26.664 1.00 35.27  ? 108 VAL A CG2 1 
ATOM   756  N N   . ALA A 1 109 ? 74.096  35.872 -30.255 1.00 36.62  ? 109 ALA A N   1 
ATOM   757  C CA  . ALA A 1 109 ? 75.211  36.535 -30.865 1.00 36.83  ? 109 ALA A CA  1 
ATOM   758  C C   . ALA A 1 109 ? 74.983  38.032 -30.605 1.00 38.03  ? 109 ALA A C   1 
ATOM   759  O O   . ALA A 1 109 ? 73.885  38.452 -30.199 1.00 33.61  ? 109 ALA A O   1 
ATOM   760  C CB  . ALA A 1 109 ? 75.217  36.220 -32.356 1.00 34.79  ? 109 ALA A CB  1 
ATOM   761  N N   . ASN A 1 110 ? 76.032  38.822 -30.784 1.00 34.58  ? 110 ASN A N   1 
ATOM   762  C CA  . ASN A 1 110 ? 75.936  40.253 -30.578 1.00 34.36  ? 110 ASN A CA  1 
ATOM   763  C C   . ASN A 1 110 ? 77.095  40.881 -31.314 1.00 37.07  ? 110 ASN A C   1 
ATOM   764  O O   . ASN A 1 110 ? 78.208  40.353 -31.286 1.00 41.75  ? 110 ASN A O   1 
ATOM   765  C CB  . ASN A 1 110 ? 75.936  40.608 -29.067 1.00 33.06  ? 110 ASN A CB  1 
ATOM   766  C CG  . ASN A 1 110 ? 77.315  40.466 -28.385 1.00 34.00  ? 110 ASN A CG  1 
ATOM   767  O OD1 . ASN A 1 110 ? 77.926  41.465 -28.031 1.00 32.89  ? 110 ASN A OD1 1 
ATOM   768  N ND2 . ASN A 1 110 ? 77.742  39.239 -28.109 1.00 25.74  ? 110 ASN A ND2 1 
ATOM   769  N N   . CYS A 1 111 ? 76.836  41.942 -32.063 1.00 33.41  ? 111 CYS A N   1 
ATOM   770  C CA  . CYS A 1 111 ? 77.941  42.569 -32.768 1.00 31.89  ? 111 CYS A CA  1 
ATOM   771  C C   . CYS A 1 111 ? 78.119  44.022 -32.338 1.00 35.14  ? 111 CYS A C   1 
ATOM   772  O O   . CYS A 1 111 ? 77.504  44.479 -31.352 1.00 40.83  ? 111 CYS A O   1 
ATOM   773  C CB  . CYS A 1 111 ? 77.768  42.452 -34.290 1.00 29.65  ? 111 CYS A CB  1 
ATOM   774  S SG  . CYS A 1 111 ? 76.770  43.710 -35.090 1.00 32.09  ? 111 CYS A SG  1 
ATOM   775  N N   . ASP A 1 112 ? 79.078  44.688 -32.967 1.00 30.78  ? 112 ASP A N   1 
ATOM   776  C CA  . ASP A 1 112 ? 79.340  46.089 -32.722 1.00 26.84  ? 112 ASP A CA  1 
ATOM   777  C C   . ASP A 1 112 ? 80.196  46.494 -33.895 1.00 28.25  ? 112 ASP A C   1 
ATOM   778  O O   . ASP A 1 112 ? 81.227  45.876 -34.148 1.00 31.48  ? 112 ASP A O   1 
ATOM   779  C CB  . ASP A 1 112 ? 80.062  46.312 -31.401 1.00 28.17  ? 112 ASP A CB  1 
ATOM   780  C CG  . ASP A 1 112 ? 79.929  47.746 -30.897 1.00 30.69  ? 112 ASP A CG  1 
ATOM   781  O OD1 . ASP A 1 112 ? 80.203  48.687 -31.676 1.00 40.74  ? 112 ASP A OD1 1 
ATOM   782  O OD2 . ASP A 1 112 ? 79.534  47.942 -29.727 1.00 33.69  ? 112 ASP A OD2 1 
ATOM   783  N N   . ILE A 1 113 ? 79.679  47.408 -34.707 1.00 27.37  ? 113 ILE A N   1 
ATOM   784  C CA  . ILE A 1 113 ? 80.400  47.875 -35.881 1.00 29.41  ? 113 ILE A CA  1 
ATOM   785  C C   . ILE A 1 113 ? 81.049  49.225 -35.650 1.00 29.16  ? 113 ILE A C   1 
ATOM   786  O O   . ILE A 1 113 ? 80.747  49.904 -34.673 1.00 30.99  ? 113 ILE A O   1 
ATOM   787  C CB  . ILE A 1 113 ? 79.493  47.984 -37.121 1.00 30.96  ? 113 ILE A CB  1 
ATOM   788  C CG1 . ILE A 1 113 ? 78.527  49.173 -36.979 1.00 33.84  ? 113 ILE A CG1 1 
ATOM   789  C CG2 . ILE A 1 113 ? 78.792  46.662 -37.334 1.00 32.50  ? 113 ILE A CG2 1 
ATOM   790  C CD1 . ILE A 1 113 ? 77.845  49.625 -38.258 1.00 29.18  ? 113 ILE A CD1 1 
ATOM   791  N N   . GLU A 1 114 ? 81.945  49.589 -36.561 1.00 31.05  ? 114 GLU A N   1 
ATOM   792  C CA  . GLU A 1 114 ? 82.679  50.842 -36.522 1.00 26.96  ? 114 GLU A CA  1 
ATOM   793  C C   . GLU A 1 114 ? 82.556  51.404 -37.902 1.00 25.09  ? 114 GLU A C   1 
ATOM   794  O O   . GLU A 1 114 ? 82.733  50.691 -38.867 1.00 22.33  ? 114 GLU A O   1 
ATOM   795  C CB  . GLU A 1 114 ? 84.142  50.582 -36.224 1.00 32.40  ? 114 GLU A CB  1 
ATOM   796  C CG  . GLU A 1 114 ? 84.383  50.177 -34.805 1.00 33.53  ? 114 GLU A CG  1 
ATOM   797  C CD  . GLU A 1 114 ? 84.150  51.317 -33.858 1.00 35.45  ? 114 GLU A CD  1 
ATOM   798  O OE1 . GLU A 1 114 ? 83.861  52.412 -34.366 1.00 40.54  ? 114 GLU A OE1 1 
ATOM   799  O OE2 . GLU A 1 114 ? 84.258  51.128 -32.621 1.00 36.55  ? 114 GLU A OE2 1 
ATOM   800  N N   . VAL A 1 115 ? 82.215  52.678 -37.996 1.00 28.45  ? 115 VAL A N   1 
ATOM   801  C CA  . VAL A 1 115 ? 82.044  53.341 -39.277 1.00 29.96  ? 115 VAL A CA  1 
ATOM   802  C C   . VAL A 1 115 ? 82.754  54.670 -39.182 1.00 34.67  ? 115 VAL A C   1 
ATOM   803  O O   . VAL A 1 115 ? 82.372  55.501 -38.369 1.00 36.14  ? 115 VAL A O   1 
ATOM   804  C CB  . VAL A 1 115 ? 80.539  53.586 -39.608 1.00 25.57  ? 115 VAL A CB  1 
ATOM   805  C CG1 . VAL A 1 115 ? 80.405  54.390 -40.843 1.00 17.75  ? 115 VAL A CG1 1 
ATOM   806  C CG2 . VAL A 1 115 ? 79.825  52.259 -39.807 1.00 19.04  ? 115 VAL A CG2 1 
ATOM   807  N N   . THR A 1 116 ? 83.841  54.810 -39.940 1.00 36.93  ? 116 THR A N   1 
ATOM   808  C CA  . THR A 1 116 ? 84.626  56.038 -39.981 1.00 40.33  ? 116 THR A CA  1 
ATOM   809  C C   . THR A 1 116 ? 84.052  56.884 -41.116 1.00 41.73  ? 116 THR A C   1 
ATOM   810  O O   . THR A 1 116 ? 83.803  56.384 -42.210 1.00 47.65  ? 116 THR A O   1 
ATOM   811  C CB  . THR A 1 116 ? 86.138  55.772 -40.294 1.00 36.55  ? 116 THR A CB  1 
ATOM   812  O OG1 . THR A 1 116 ? 86.727  54.988 -39.255 1.00 38.37  ? 116 THR A OG1 1 
ATOM   813  C CG2 . THR A 1 116 ? 86.900  57.062 -40.362 1.00 36.01  ? 116 THR A CG2 1 
ATOM   814  N N   . GLY A 1 117 ? 83.814  58.153 -40.850 1.00 39.58  ? 117 GLY A N   1 
ATOM   815  C CA  . GLY A 1 117 ? 83.299  59.011 -41.884 1.00 43.33  ? 117 GLY A CA  1 
ATOM   816  C C   . GLY A 1 117 ? 83.234  60.396 -41.286 1.00 49.15  ? 117 GLY A C   1 
ATOM   817  O O   . GLY A 1 117 ? 83.514  60.580 -40.092 1.00 44.97  ? 117 GLY A O   1 
ATOM   818  N N   . ASP A 1 118 ? 82.932  61.379 -42.126 1.00 54.83  ? 118 ASP A N   1 
ATOM   819  C CA  . ASP A 1 118 ? 82.783  62.756 -41.672 1.00 60.22  ? 118 ASP A CA  1 
ATOM   820  C C   . ASP A 1 118 ? 81.349  62.779 -41.126 1.00 61.60  ? 118 ASP A C   1 
ATOM   821  O O   . ASP A 1 118 ? 80.702  61.730 -40.997 1.00 62.42  ? 118 ASP A O   1 
ATOM   822  C CB  . ASP A 1 118 ? 82.899  63.734 -42.864 1.00 64.60  ? 118 ASP A CB  1 
ATOM   823  C CG  . ASP A 1 118 ? 84.194  63.554 -43.681 1.00 68.94  ? 118 ASP A CG  1 
ATOM   824  O OD1 . ASP A 1 118 ? 85.287  63.955 -43.203 1.00 70.74  ? 118 ASP A OD1 1 
ATOM   825  O OD2 . ASP A 1 118 ? 84.116  63.036 -44.823 1.00 69.74  ? 118 ASP A OD2 1 
ATOM   826  N N   . LYS A 1 119 ? 80.848  63.949 -40.773 1.00 61.74  ? 119 LYS A N   1 
ATOM   827  C CA  . LYS A 1 119 ? 79.468  64.035 -40.303 1.00 65.31  ? 119 LYS A CA  1 
ATOM   828  C C   . LYS A 1 119 ? 78.998  63.128 -39.144 1.00 63.00  ? 119 LYS A C   1 
ATOM   829  O O   . LYS A 1 119 ? 78.729  63.629 -38.042 1.00 64.98  ? 119 LYS A O   1 
ATOM   830  C CB  . LYS A 1 119 ? 78.511  63.908 -41.505 1.00 68.56  ? 119 LYS A CB  1 
ATOM   831  C CG  . LYS A 1 119 ? 78.182  65.245 -42.162 1.00 74.00  ? 119 LYS A CG  1 
ATOM   832  C CD  . LYS A 1 119 ? 79.336  66.244 -41.987 1.00 79.49  ? 119 LYS A CD  1 
ATOM   833  C CE  . LYS A 1 119 ? 78.818  67.671 -41.941 1.00 83.87  ? 119 LYS A CE  1 
ATOM   834  N NZ  . LYS A 1 119 ? 79.816  68.655 -41.450 1.00 84.26  ? 119 LYS A NZ  1 
ATOM   835  N N   . PHE A 1 120 ? 78.847  61.831 -39.402 1.00 55.94  ? 120 PHE A N   1 
ATOM   836  C CA  . PHE A 1 120 ? 78.380  60.869 -38.402 1.00 53.42  ? 120 PHE A CA  1 
ATOM   837  C C   . PHE A 1 120 ? 77.722  59.793 -39.235 1.00 52.81  ? 120 PHE A C   1 
ATOM   838  O O   . PHE A 1 120 ? 77.191  60.077 -40.294 1.00 54.74  ? 120 PHE A O   1 
ATOM   839  C CB  . PHE A 1 120 ? 77.321  61.486 -37.475 1.00 53.41  ? 120 PHE A CB  1 
ATOM   840  C CG  . PHE A 1 120 ? 76.553  60.478 -36.662 1.00 54.39  ? 120 PHE A CG  1 
ATOM   841  C CD1 . PHE A 1 120 ? 75.402  59.876 -37.176 1.00 54.79  ? 120 PHE A CD1 1 
ATOM   842  C CD2 . PHE A 1 120 ? 76.992  60.109 -35.398 1.00 53.14  ? 120 PHE A CD2 1 
ATOM   843  C CE1 . PHE A 1 120 ? 74.706  58.923 -36.449 1.00 51.44  ? 120 PHE A CE1 1 
ATOM   844  C CE2 . PHE A 1 120 ? 76.305  59.162 -34.667 1.00 52.20  ? 120 PHE A CE2 1 
ATOM   845  C CZ  . PHE A 1 120 ? 75.159  58.565 -35.193 1.00 52.58  ? 120 PHE A CZ  1 
ATOM   846  N N   . PRO A 1 121 ? 77.736  58.542 -38.765 1.00 52.30  ? 121 PRO A N   1 
ATOM   847  C CA  . PRO A 1 121 ? 77.119  57.447 -39.513 1.00 51.59  ? 121 PRO A CA  1 
ATOM   848  C C   . PRO A 1 121 ? 75.612  57.334 -39.340 1.00 50.10  ? 121 PRO A C   1 
ATOM   849  O O   . PRO A 1 121 ? 75.173  56.434 -38.631 1.00 51.44  ? 121 PRO A O   1 
ATOM   850  C CB  . PRO A 1 121 ? 77.788  56.216 -38.910 1.00 52.56  ? 121 PRO A CB  1 
ATOM   851  C CG  . PRO A 1 121 ? 79.065  56.748 -38.354 1.00 53.59  ? 121 PRO A CG  1 
ATOM   852  C CD  . PRO A 1 121 ? 78.618  58.005 -37.722 1.00 50.33  ? 121 PRO A CD  1 
ATOM   853  N N   . ASP A 1 122 ? 74.824  58.231 -39.941 1.00 47.28  ? 122 ASP A N   1 
ATOM   854  C CA  . ASP A 1 122 ? 73.358  58.136 -39.816 1.00 44.63  ? 122 ASP A CA  1 
ATOM   855  C C   . ASP A 1 122 ? 73.000  56.831 -40.487 1.00 39.43  ? 122 ASP A C   1 
ATOM   856  O O   . ASP A 1 122 ? 73.143  56.691 -41.701 1.00 37.55  ? 122 ASP A O   1 
ATOM   857  C CB  . ASP A 1 122 ? 72.607  59.301 -40.514 1.00 50.38  ? 122 ASP A CB  1 
ATOM   858  C CG  . ASP A 1 122 ? 71.058  59.101 -40.535 1.00 51.28  ? 122 ASP A CG  1 
ATOM   859  O OD1 . ASP A 1 122 ? 70.423  59.145 -39.457 1.00 58.83  ? 122 ASP A OD1 1 
ATOM   860  O OD2 . ASP A 1 122 ? 70.471  58.899 -41.621 1.00 49.30  ? 122 ASP A OD2 1 
ATOM   861  N N   . PRO A 1 123 ? 72.470  55.877 -39.709 1.00 35.88  ? 123 PRO A N   1 
ATOM   862  C CA  . PRO A 1 123 ? 72.075  54.548 -40.184 1.00 33.36  ? 123 PRO A CA  1 
ATOM   863  C C   . PRO A 1 123 ? 71.077  54.575 -41.313 1.00 34.70  ? 123 PRO A C   1 
ATOM   864  O O   . PRO A 1 123 ? 71.140  53.735 -42.204 1.00 35.52  ? 123 PRO A O   1 
ATOM   865  C CB  . PRO A 1 123 ? 71.489  53.902 -38.940 1.00 34.75  ? 123 PRO A CB  1 
ATOM   866  C CG  . PRO A 1 123 ? 72.116  54.641 -37.816 1.00 33.33  ? 123 PRO A CG  1 
ATOM   867  C CD  . PRO A 1 123 ? 72.127  56.051 -38.291 1.00 30.81  ? 123 PRO A CD  1 
ATOM   868  N N   . MET A 1 124 ? 70.178  55.555 -41.287 1.00 37.29  ? 124 MET A N   1 
ATOM   869  C CA  . MET A 1 124 ? 69.163  55.669 -42.332 1.00 44.01  ? 124 MET A CA  1 
ATOM   870  C C   . MET A 1 124 ? 69.808  55.967 -43.647 1.00 43.92  ? 124 MET A C   1 
ATOM   871  O O   . MET A 1 124 ? 69.446  55.381 -44.668 1.00 43.22  ? 124 MET A O   1 
ATOM   872  C CB  . MET A 1 124 ? 68.121  56.746 -41.999 1.00 51.45  ? 124 MET A CB  1 
ATOM   873  C CG  . MET A 1 124 ? 67.149  56.319 -40.888 1.00 66.46  ? 124 MET A CG  1 
ATOM   874  S SD  . MET A 1 124 ? 65.981  57.583 -40.269 1.00 76.68  ? 124 MET A SD  1 
ATOM   875  C CE  . MET A 1 124 ? 64.700  57.655 -41.624 1.00 75.63  ? 124 MET A CE  1 
ATOM   876  N N   . LYS A 1 125 ? 70.793  56.858 -43.618 1.00 49.44  ? 125 LYS A N   1 
ATOM   877  C CA  . LYS A 1 125 ? 71.486  57.247 -44.837 1.00 52.41  ? 125 LYS A CA  1 
ATOM   878  C C   . LYS A 1 125 ? 72.516  56.183 -45.260 1.00 51.06  ? 125 LYS A C   1 
ATOM   879  O O   . LYS A 1 125 ? 72.620  55.837 -46.442 1.00 49.42  ? 125 LYS A O   1 
ATOM   880  C CB  . LYS A 1 125 ? 72.106  58.636 -44.663 1.00 52.86  ? 125 LYS A CB  1 
ATOM   881  C CG  . LYS A 1 125 ? 72.332  59.389 -45.972 1.00 61.28  ? 125 LYS A CG  1 
ATOM   882  C CD  . LYS A 1 125 ? 72.451  60.912 -45.741 1.00 65.85  ? 125 LYS A CD  1 
ATOM   883  C CE  . LYS A 1 125 ? 73.300  61.624 -46.830 1.00 66.07  ? 125 LYS A CE  1 
ATOM   884  N NZ  . LYS A 1 125 ? 72.689  61.682 -48.194 1.00 65.50  ? 125 LYS A NZ  1 
ATOM   885  N N   . ALA A 1 126 ? 73.223  55.634 -44.271 1.00 51.02  ? 126 ALA A N   1 
ATOM   886  C CA  . ALA A 1 126 ? 74.237  54.601 -44.484 1.00 48.57  ? 126 ALA A CA  1 
ATOM   887  C C   . ALA A 1 126 ? 75.132  54.903 -45.680 1.00 49.76  ? 126 ALA A C   1 
ATOM   888  O O   . ALA A 1 126 ? 75.235  54.092 -46.596 1.00 51.49  ? 126 ALA A O   1 
ATOM   889  C CB  . ALA A 1 126 ? 73.569  53.241 -44.646 1.00 46.47  ? 126 ALA A CB  1 
ATOM   890  N N   . GLU A 1 127 ? 75.799  56.057 -45.652 1.00 50.07  ? 127 GLU A N   1 
ATOM   891  C CA  . GLU A 1 127 ? 76.676  56.476 -46.747 1.00 50.71  ? 127 GLU A CA  1 
ATOM   892  C C   . GLU A 1 127 ? 78.171  56.131 -46.595 1.00 48.87  ? 127 GLU A C   1 
ATOM   893  O O   . GLU A 1 127 ? 78.890  56.100 -47.591 1.00 50.20  ? 127 GLU A O   1 
ATOM   894  C CB  . GLU A 1 127 ? 76.547  57.982 -46.989 1.00 53.97  ? 127 GLU A CB  1 
ATOM   895  C CG  . GLU A 1 127 ? 77.111  58.818 -45.845 1.00 63.27  ? 127 GLU A CG  1 
ATOM   896  C CD  . GLU A 1 127 ? 77.372  60.270 -46.227 1.00 68.43  ? 127 GLU A CD  1 
ATOM   897  O OE1 . GLU A 1 127 ? 77.707  60.544 -47.404 1.00 71.04  ? 127 GLU A OE1 1 
ATOM   898  O OE2 . GLU A 1 127 ? 77.258  61.136 -45.331 1.00 72.01  ? 127 GLU A OE2 1 
ATOM   899  N N   . TYR A 1 128 ? 78.650  55.914 -45.370 1.00 46.24  ? 128 TYR A N   1 
ATOM   900  C CA  . TYR A 1 128 ? 80.068  55.586 -45.154 1.00 43.57  ? 128 TYR A CA  1 
ATOM   901  C C   . TYR A 1 128 ? 80.354  54.083 -45.058 1.00 44.49  ? 128 TYR A C   1 
ATOM   902  O O   . TYR A 1 128 ? 79.567  53.312 -44.478 1.00 41.91  ? 128 TYR A O   1 
ATOM   903  C CB  . TYR A 1 128 ? 80.605  56.256 -43.887 1.00 41.05  ? 128 TYR A CB  1 
ATOM   904  C CG  . TYR A 1 128 ? 80.442  57.745 -43.873 1.00 42.90  ? 128 TYR A CG  1 
ATOM   905  C CD1 . TYR A 1 128 ? 80.959  58.517 -44.897 1.00 42.78  ? 128 TYR A CD1 1 
ATOM   906  C CD2 . TYR A 1 128 ? 79.763  58.389 -42.836 1.00 39.79  ? 128 TYR A CD2 1 
ATOM   907  C CE1 . TYR A 1 128 ? 80.818  59.895 -44.898 1.00 44.61  ? 128 TYR A CE1 1 
ATOM   908  C CE2 . TYR A 1 128 ? 79.613  59.764 -42.827 1.00 40.47  ? 128 TYR A CE2 1 
ATOM   909  C CZ  . TYR A 1 128 ? 80.150  60.515 -43.865 1.00 42.32  ? 128 TYR A CZ  1 
ATOM   910  O OH  . TYR A 1 128 ? 80.058  61.890 -43.877 1.00 42.50  ? 128 TYR A OH  1 
ATOM   911  N N   . GLU A 1 129 ? 81.500  53.675 -45.601 1.00 42.87  ? 129 GLU A N   1 
ATOM   912  C CA  . GLU A 1 129 ? 81.903  52.280 -45.546 1.00 42.23  ? 129 GLU A CA  1 
ATOM   913  C C   . GLU A 1 129 ? 82.105  51.867 -44.094 1.00 42.64  ? 129 GLU A C   1 
ATOM   914  O O   . GLU A 1 129 ? 82.747  52.569 -43.299 1.00 43.08  ? 129 GLU A O   1 
ATOM   915  C CB  . GLU A 1 129 ? 83.195  52.050 -46.322 1.00 40.66  ? 129 GLU A CB  1 
ATOM   916  C CG  . GLU A 1 129 ? 83.053  52.271 -47.808 1.00 45.79  ? 129 GLU A CG  1 
ATOM   917  C CD  . GLU A 1 129 ? 84.376  52.209 -48.542 1.00 50.29  ? 129 GLU A CD  1 
ATOM   918  O OE1 . GLU A 1 129 ? 85.334  52.852 -48.054 1.00 48.49  ? 129 GLU A OE1 1 
ATOM   919  O OE2 . GLU A 1 129 ? 84.455  51.530 -49.601 1.00 50.59  ? 129 GLU A OE2 1 
ATOM   920  N N   . ILE A 1 130 ? 81.455  50.786 -43.707 1.00 42.10  ? 130 ILE A N   1 
ATOM   921  C CA  . ILE A 1 130 ? 81.642  50.318 -42.360 1.00 43.02  ? 130 ILE A CA  1 
ATOM   922  C C   . ILE A 1 130 ? 83.040  49.689 -42.421 1.00 40.74  ? 130 ILE A C   1 
ATOM   923  O O   . ILE A 1 130 ? 83.419  49.151 -43.454 1.00 39.99  ? 130 ILE A O   1 
ATOM   924  C CB  . ILE A 1 130 ? 80.499  49.361 -41.914 1.00 43.81  ? 130 ILE A CB  1 
ATOM   925  C CG1 . ILE A 1 130 ? 81.035  48.275 -41.000 1.00 47.44  ? 130 ILE A CG1 1 
ATOM   926  C CG2 . ILE A 1 130 ? 79.718  48.818 -43.098 1.00 41.65  ? 130 ILE A CG2 1 
ATOM   927  C CD1 . ILE A 1 130 ? 79.975  47.402 -40.545 1.00 55.81  ? 130 ILE A CD1 1 
ATOM   928  N N   . ASP A 1 131 ? 83.822  49.794 -41.353 1.00 39.02  ? 131 ASP A N   1 
ATOM   929  C CA  . ASP A 1 131 ? 85.182  49.265 -41.379 1.00 38.60  ? 131 ASP A CA  1 
ATOM   930  C C   . ASP A 1 131 ? 85.588  48.320 -40.241 1.00 40.24  ? 131 ASP A C   1 
ATOM   931  O O   . ASP A 1 131 ? 86.765  47.985 -40.094 1.00 41.20  ? 131 ASP A O   1 
ATOM   932  C CB  . ASP A 1 131 ? 86.158  50.438 -41.463 1.00 34.28  ? 131 ASP A CB  1 
ATOM   933  C CG  . ASP A 1 131 ? 85.929  51.461 -40.373 1.00 28.71  ? 131 ASP A CG  1 
ATOM   934  O OD1 . ASP A 1 131 ? 85.658  51.072 -39.237 1.00 27.27  ? 131 ASP A OD1 1 
ATOM   935  O OD2 . ASP A 1 131 ? 86.015  52.664 -40.646 1.00 35.14  ? 131 ASP A OD2 1 
ATOM   936  N N   . ALA A 1 132 ? 84.623  47.883 -39.441 1.00 39.62  ? 132 ALA A N   1 
ATOM   937  C CA  . ALA A 1 132 ? 84.918  46.986 -38.339 1.00 36.81  ? 132 ALA A CA  1 
ATOM   938  C C   . ALA A 1 132 ? 83.624  46.383 -37.861 1.00 36.65  ? 132 ALA A C   1 
ATOM   939  O O   . ALA A 1 132 ? 82.635  47.076 -37.735 1.00 41.07  ? 132 ALA A O   1 
ATOM   940  C CB  . ALA A 1 132 ? 85.573  47.741 -37.212 1.00 33.39  ? 132 ALA A CB  1 
ATOM   941  N N   . ILE A 1 133 ? 83.629  45.078 -37.653 1.00 38.32  ? 133 ILE A N   1 
ATOM   942  C CA  . ILE A 1 133 ? 82.476  44.337 -37.169 1.00 34.88  ? 133 ILE A CA  1 
ATOM   943  C C   . ILE A 1 133 ? 83.010  43.141 -36.387 1.00 36.02  ? 133 ILE A C   1 
ATOM   944  O O   . ILE A 1 133 ? 83.592  42.222 -36.965 1.00 41.28  ? 133 ILE A O   1 
ATOM   945  C CB  . ILE A 1 133 ? 81.600  43.736 -38.324 1.00 33.05  ? 133 ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 133 ? 81.207  44.808 -39.330 1.00 27.68  ? 133 ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 133 ? 80.337  43.066 -37.754 1.00 25.86  ? 133 ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 133 ? 80.587  44.228 -40.609 1.00 28.25  ? 133 ILE A CD1 1 
ATOM   949  N N   . THR A 1 134 ? 82.930  43.205 -35.072 1.00 32.47  ? 134 THR A N   1 
ATOM   950  C CA  . THR A 1 134 ? 83.321  42.069 -34.266 1.00 30.89  ? 134 THR A CA  1 
ATOM   951  C C   . THR A 1 134 ? 81.944  41.502 -33.899 1.00 34.75  ? 134 THR A C   1 
ATOM   952  O O   . THR A 1 134 ? 80.987  42.264 -33.639 1.00 33.23  ? 134 THR A O   1 
ATOM   953  C CB  . THR A 1 134 ? 84.192  42.490 -33.082 1.00 27.40  ? 134 THR A CB  1 
ATOM   954  O OG1 . THR A 1 134 ? 85.470  42.904 -33.593 1.00 30.79  ? 134 THR A OG1 1 
ATOM   955  C CG2 . THR A 1 134 ? 84.381  41.355 -32.104 1.00 23.29  ? 134 THR A CG2 1 
ATOM   956  N N   . HIS A 1 135 ? 81.841  40.171 -33.912 1.00 33.44  ? 135 HIS A N   1 
ATOM   957  C CA  . HIS A 1 135 ? 80.580  39.475 -33.699 1.00 25.19  ? 135 HIS A CA  1 
ATOM   958  C C   . HIS A 1 135 ? 80.782  38.208 -32.891 1.00 22.60  ? 135 HIS A C   1 
ATOM   959  O O   . HIS A 1 135 ? 81.240  37.204 -33.412 1.00 28.10  ? 135 HIS A O   1 
ATOM   960  C CB  . HIS A 1 135 ? 80.060  39.142 -35.103 1.00 29.89  ? 135 HIS A CB  1 
ATOM   961  C CG  . HIS A 1 135 ? 78.745  38.435 -35.145 1.00 35.48  ? 135 HIS A CG  1 
ATOM   962  N ND1 . HIS A 1 135 ? 78.606  37.097 -34.832 1.00 38.67  ? 135 HIS A ND1 1 
ATOM   963  C CD2 . HIS A 1 135 ? 77.526  38.851 -35.572 1.00 34.87  ? 135 HIS A CD2 1 
ATOM   964  C CE1 . HIS A 1 135 ? 77.361  36.722 -35.073 1.00 38.03  ? 135 HIS A CE1 1 
ATOM   965  N NE2 . HIS A 1 135 ? 76.688  37.769 -35.524 1.00 35.83  ? 135 HIS A NE2 1 
ATOM   966  N N   . TYR A 1 136 ? 80.463  38.249 -31.608 1.00 22.92  ? 136 TYR A N   1 
ATOM   967  C CA  . TYR A 1 136 ? 80.594  37.076 -30.743 1.00 24.20  ? 136 TYR A CA  1 
ATOM   968  C C   . TYR A 1 136 ? 79.492  36.082 -31.093 1.00 29.07  ? 136 TYR A C   1 
ATOM   969  O O   . TYR A 1 136 ? 78.479  36.451 -31.679 1.00 31.74  ? 136 TYR A O   1 
ATOM   970  C CB  . TYR A 1 136 ? 80.446  37.484 -29.281 1.00 22.84  ? 136 TYR A CB  1 
ATOM   971  C CG  . TYR A 1 136 ? 80.439  36.338 -28.317 1.00 28.47  ? 136 TYR A CG  1 
ATOM   972  C CD1 . TYR A 1 136 ? 81.634  35.811 -27.802 1.00 30.86  ? 136 TYR A CD1 1 
ATOM   973  C CD2 . TYR A 1 136 ? 79.241  35.783 -27.886 1.00 28.94  ? 136 TYR A CD2 1 
ATOM   974  C CE1 . TYR A 1 136 ? 81.623  34.744 -26.861 1.00 25.80  ? 136 TYR A CE1 1 
ATOM   975  C CE2 . TYR A 1 136 ? 79.211  34.739 -26.964 1.00 26.66  ? 136 TYR A CE2 1 
ATOM   976  C CZ  . TYR A 1 136 ? 80.398  34.218 -26.444 1.00 30.75  ? 136 TYR A CZ  1 
ATOM   977  O OH  . TYR A 1 136 ? 80.329  33.197 -25.496 1.00 28.78  ? 136 TYR A OH  1 
ATOM   978  N N   . ASP A 1 137 ? 79.698  34.821 -30.739 1.00 31.57  ? 137 ASP A N   1 
ATOM   979  C CA  . ASP A 1 137 ? 78.745  33.748 -31.007 1.00 29.34  ? 137 ASP A CA  1 
ATOM   980  C C   . ASP A 1 137 ? 78.862  32.859 -29.824 1.00 29.17  ? 137 ASP A C   1 
ATOM   981  O O   . ASP A 1 137 ? 79.913  32.278 -29.597 1.00 29.18  ? 137 ASP A O   1 
ATOM   982  C CB  . ASP A 1 137 ? 79.150  32.943 -32.221 1.00 28.98  ? 137 ASP A CB  1 
ATOM   983  C CG  . ASP A 1 137 ? 78.182  31.841 -32.527 1.00 28.20  ? 137 ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 137 ? 78.132  30.851 -31.772 1.00 26.88  ? 137 ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 137 ? 77.464  31.978 -33.529 1.00 32.93  ? 137 ASP A OD2 1 
ATOM   986  N N   . SER A 1 138 ? 77.776  32.719 -29.092 1.00 31.01  ? 138 SER A N   1 
ATOM   987  C CA  . SER A 1 138 ? 77.786  31.919 -27.882 1.00 34.47  ? 138 SER A CA  1 
ATOM   988  C C   . SER A 1 138 ? 78.094  30.418 -28.069 1.00 31.33  ? 138 SER A C   1 
ATOM   989  O O   . SER A 1 138 ? 78.683  29.793 -27.189 1.00 27.32  ? 138 SER A O   1 
ATOM   990  C CB  . SER A 1 138 ? 76.460  32.112 -27.137 1.00 33.40  ? 138 SER A CB  1 
ATOM   991  O OG  . SER A 1 138 ? 75.371  31.596 -27.894 1.00 39.35  ? 138 SER A OG  1 
ATOM   992  N N   . ILE A 1 139 ? 77.710  29.851 -29.205 1.00 27.26  ? 139 ILE A N   1 
ATOM   993  C CA  . ILE A 1 139 ? 77.947  28.444 -29.427 1.00 30.54  ? 139 ILE A CA  1 
ATOM   994  C C   . ILE A 1 139 ? 79.439  28.216 -29.637 1.00 32.57  ? 139 ILE A C   1 
ATOM   995  O O   . ILE A 1 139 ? 80.054  27.401 -28.957 1.00 32.18  ? 139 ILE A O   1 
ATOM   996  C CB  . ILE A 1 139 ? 77.145  27.918 -30.643 1.00 34.41  ? 139 ILE A CB  1 
ATOM   997  C CG1 . ILE A 1 139 ? 75.641  28.182 -30.468 1.00 29.31  ? 139 ILE A CG1 1 
ATOM   998  C CG2 . ILE A 1 139 ? 77.417  26.420 -30.843 1.00 35.55  ? 139 ILE A CG2 1 
ATOM   999  C CD1 . ILE A 1 139 ? 75.060  27.558 -29.216 1.00 29.16  ? 139 ILE A CD1 1 
ATOM   1000 N N   . ASP A 1 140 ? 80.015  28.926 -30.597 1.00 33.96  ? 140 ASP A N   1 
ATOM   1001 C CA  . ASP A 1 140 ? 81.439  28.798 -30.876 1.00 35.49  ? 140 ASP A CA  1 
ATOM   1002 C C   . ASP A 1 140 ? 82.253  29.441 -29.786 1.00 34.73  ? 140 ASP A C   1 
ATOM   1003 O O   . ASP A 1 140 ? 83.367  28.992 -29.487 1.00 33.38  ? 140 ASP A O   1 
ATOM   1004 C CB  . ASP A 1 140 ? 81.799  29.467 -32.192 1.00 39.53  ? 140 ASP A CB  1 
ATOM   1005 C CG  . ASP A 1 140 ? 81.061  28.870 -33.362 1.00 44.46  ? 140 ASP A CG  1 
ATOM   1006 O OD1 . ASP A 1 140 ? 80.873  27.632 -33.398 1.00 47.81  ? 140 ASP A OD1 1 
ATOM   1007 O OD2 . ASP A 1 140 ? 80.647  29.651 -34.231 1.00 46.51  ? 140 ASP A OD2 1 
ATOM   1008 N N   . ASP A 1 141 ? 81.678  30.484 -29.188 1.00 33.07  ? 141 ASP A N   1 
ATOM   1009 C CA  . ASP A 1 141 ? 82.328  31.260 -28.124 1.00 35.65  ? 141 ASP A CA  1 
ATOM   1010 C C   . ASP A 1 141 ? 83.524  31.992 -28.729 1.00 36.65  ? 141 ASP A C   1 
ATOM   1011 O O   . ASP A 1 141 ? 84.564  32.108 -28.093 1.00 37.79  ? 141 ASP A O   1 
ATOM   1012 C CB  . ASP A 1 141 ? 82.809  30.339 -27.008 1.00 31.27  ? 141 ASP A CB  1 
ATOM   1013 C CG  . ASP A 1 141 ? 83.269  31.085 -25.779 1.00 32.36  ? 141 ASP A CG  1 
ATOM   1014 O OD1 . ASP A 1 141 ? 82.938  32.280 -25.607 1.00 36.48  ? 141 ASP A OD1 1 
ATOM   1015 O OD2 . ASP A 1 141 ? 83.956  30.458 -24.958 1.00 32.21  ? 141 ASP A OD2 1 
ATOM   1016 N N   . ARG A 1 142 ? 83.356  32.493 -29.947 1.00 35.43  ? 142 ARG A N   1 
ATOM   1017 C CA  . ARG A 1 142 ? 84.438  33.160 -30.637 1.00 39.71  ? 142 ARG A CA  1 
ATOM   1018 C C   . ARG A 1 142 ? 84.024  34.543 -31.067 1.00 42.69  ? 142 ARG A C   1 
ATOM   1019 O O   . ARG A 1 142 ? 82.861  34.765 -31.408 1.00 48.15  ? 142 ARG A O   1 
ATOM   1020 C CB  . ARG A 1 142 ? 84.847  32.366 -31.890 1.00 41.30  ? 142 ARG A CB  1 
ATOM   1021 C CG  . ARG A 1 142 ? 85.408  30.958 -31.630 1.00 41.06  ? 142 ARG A CG  1 
ATOM   1022 C CD  . ARG A 1 142 ? 86.823  30.958 -31.015 1.00 39.81  ? 142 ARG A CD  1 
ATOM   1023 N NE  . ARG A 1 142 ? 87.272  29.603 -30.743 1.00 31.08  ? 142 ARG A NE  1 
ATOM   1024 C CZ  . ARG A 1 142 ? 87.250  29.039 -29.542 1.00 34.71  ? 142 ARG A CZ  1 
ATOM   1025 N NH1 . ARG A 1 142 ? 86.860  29.736 -28.482 1.00 35.47  ? 142 ARG A NH1 1 
ATOM   1026 N NH2 . ARG A 1 142 ? 87.661  27.784 -29.387 1.00 36.04  ? 142 ARG A NH2 1 
ATOM   1027 N N   . PHE A 1 143 ? 84.992  35.459 -31.087 1.00 39.78  ? 143 PHE A N   1 
ATOM   1028 C CA  . PHE A 1 143 ? 84.764  36.823 -31.501 1.00 32.92  ? 143 PHE A CA  1 
ATOM   1029 C C   . PHE A 1 143 ? 85.246  36.949 -32.922 1.00 34.66  ? 143 PHE A C   1 
ATOM   1030 O O   . PHE A 1 143 ? 86.433  37.158 -33.150 1.00 38.01  ? 143 PHE A O   1 
ATOM   1031 C CB  . PHE A 1 143 ? 85.541  37.783 -30.617 1.00 27.36  ? 143 PHE A CB  1 
ATOM   1032 C CG  . PHE A 1 143 ? 85.081  37.805 -29.201 1.00 26.10  ? 143 PHE A CG  1 
ATOM   1033 C CD1 . PHE A 1 143 ? 84.074  38.678 -28.803 1.00 24.32  ? 143 PHE A CD1 1 
ATOM   1034 C CD2 . PHE A 1 143 ? 85.668  36.986 -28.258 1.00 25.58  ? 143 PHE A CD2 1 
ATOM   1035 C CE1 . PHE A 1 143 ? 83.658  38.735 -27.476 1.00 29.22  ? 143 PHE A CE1 1 
ATOM   1036 C CE2 . PHE A 1 143 ? 85.258  37.032 -26.910 1.00 33.69  ? 143 PHE A CE2 1 
ATOM   1037 C CZ  . PHE A 1 143 ? 84.243  37.915 -26.519 1.00 31.29  ? 143 PHE A CZ  1 
ATOM   1038 N N   . TYR A 1 144 ? 84.345  36.749 -33.879 1.00 32.97  ? 144 TYR A N   1 
ATOM   1039 C CA  . TYR A 1 144 ? 84.703  36.865 -35.284 1.00 31.31  ? 144 TYR A CA  1 
ATOM   1040 C C   . TYR A 1 144 ? 84.894  38.336 -35.596 1.00 32.11  ? 144 TYR A C   1 
ATOM   1041 O O   . TYR A 1 144 ? 83.932  39.097 -35.620 1.00 35.62  ? 144 TYR A O   1 
ATOM   1042 C CB  . TYR A 1 144 ? 83.618  36.264 -36.179 1.00 33.41  ? 144 TYR A CB  1 
ATOM   1043 C CG  . TYR A 1 144 ? 83.376  34.784 -35.957 1.00 33.85  ? 144 TYR A CG  1 
ATOM   1044 C CD1 . TYR A 1 144 ? 82.729  34.339 -34.812 1.00 36.02  ? 144 TYR A CD1 1 
ATOM   1045 C CD2 . TYR A 1 144 ? 83.751  33.833 -36.914 1.00 30.61  ? 144 TYR A CD2 1 
ATOM   1046 C CE1 . TYR A 1 144 ? 82.450  32.995 -34.622 1.00 36.46  ? 144 TYR A CE1 1 
ATOM   1047 C CE2 . TYR A 1 144 ? 83.476  32.494 -36.733 1.00 26.32  ? 144 TYR A CE2 1 
ATOM   1048 C CZ  . TYR A 1 144 ? 82.823  32.088 -35.587 1.00 31.86  ? 144 TYR A CZ  1 
ATOM   1049 O OH  . TYR A 1 144 ? 82.494  30.775 -35.396 1.00 35.73  ? 144 TYR A OH  1 
ATOM   1050 N N   . VAL A 1 145 ? 86.144  38.735 -35.813 1.00 31.70  ? 145 VAL A N   1 
ATOM   1051 C CA  . VAL A 1 145 ? 86.491  40.131 -36.084 1.00 30.21  ? 145 VAL A CA  1 
ATOM   1052 C C   . VAL A 1 145 ? 86.587  40.247 -37.572 1.00 27.90  ? 145 VAL A C   1 
ATOM   1053 O O   . VAL A 1 145 ? 87.063  39.315 -38.204 1.00 32.35  ? 145 VAL A O   1 
ATOM   1054 C CB  . VAL A 1 145 ? 87.846  40.524 -35.382 1.00 30.29  ? 145 VAL A CB  1 
ATOM   1055 C CG1 . VAL A 1 145 ? 88.230  41.978 -35.653 1.00 25.46  ? 145 VAL A CG1 1 
ATOM   1056 C CG2 . VAL A 1 145 ? 87.740  40.277 -33.883 1.00 25.99  ? 145 VAL A CG2 1 
ATOM   1057 N N   . PHE A 1 146 ? 86.022  41.319 -38.127 1.00 29.57  ? 146 PHE A N   1 
ATOM   1058 C CA  . PHE A 1 146 ? 86.036  41.583 -39.569 1.00 33.41  ? 146 PHE A CA  1 
ATOM   1059 C C   . PHE A 1 146 ? 86.720  42.903 -39.798 1.00 35.98  ? 146 PHE A C   1 
ATOM   1060 O O   . PHE A 1 146 ? 86.107  43.945 -39.619 1.00 37.02  ? 146 PHE A O   1 
ATOM   1061 C CB  . PHE A 1 146 ? 84.618  41.671 -40.140 1.00 32.86  ? 146 PHE A CB  1 
ATOM   1062 C CG  . PHE A 1 146 ? 83.840  40.392 -40.038 1.00 27.88  ? 146 PHE A CG  1 
ATOM   1063 C CD1 . PHE A 1 146 ? 83.564  39.832 -38.803 1.00 24.81  ? 146 PHE A CD1 1 
ATOM   1064 C CD2 . PHE A 1 146 ? 83.413  39.740 -41.182 1.00 26.74  ? 146 PHE A CD2 1 
ATOM   1065 C CE1 . PHE A 1 146 ? 82.871  38.644 -38.708 1.00 33.29  ? 146 PHE A CE1 1 
ATOM   1066 C CE2 . PHE A 1 146 ? 82.715  38.547 -41.092 1.00 29.50  ? 146 PHE A CE2 1 
ATOM   1067 C CZ  . PHE A 1 146 ? 82.448  37.999 -39.858 1.00 29.51  ? 146 PHE A CZ  1 
ATOM   1068 N N   . ASP A 1 147 ? 87.982  42.865 -40.214 1.00 38.31  ? 147 ASP A N   1 
ATOM   1069 C CA  . ASP A 1 147 ? 88.742  44.091 -40.404 1.00 35.41  ? 147 ASP A CA  1 
ATOM   1070 C C   . ASP A 1 147 ? 88.928  44.560 -41.837 1.00 36.80  ? 147 ASP A C   1 
ATOM   1071 O O   . ASP A 1 147 ? 89.543  43.898 -42.656 1.00 40.75  ? 147 ASP A O   1 
ATOM   1072 C CB  . ASP A 1 147 ? 90.083  43.932 -39.727 1.00 37.18  ? 147 ASP A CB  1 
ATOM   1073 C CG  . ASP A 1 147 ? 90.821  45.235 -39.571 1.00 38.94  ? 147 ASP A CG  1 
ATOM   1074 O OD1 . ASP A 1 147 ? 90.394  46.233 -40.162 1.00 37.56  ? 147 ASP A OD1 1 
ATOM   1075 O OD2 . ASP A 1 147 ? 91.836  45.249 -38.844 1.00 35.69  ? 147 ASP A OD2 1 
ATOM   1076 N N   . LEU A 1 148 ? 88.411  45.737 -42.129 1.00 37.50  ? 148 LEU A N   1 
ATOM   1077 C CA  . LEU A 1 148 ? 88.546  46.307 -43.456 1.00 39.75  ? 148 LEU A CA  1 
ATOM   1078 C C   . LEU A 1 148 ? 89.781  47.201 -43.422 1.00 46.51  ? 148 LEU A C   1 
ATOM   1079 O O   . LEU A 1 148 ? 89.755  48.300 -42.845 1.00 47.28  ? 148 LEU A O   1 
ATOM   1080 C CB  . LEU A 1 148 ? 87.321  47.140 -43.792 1.00 36.39  ? 148 LEU A CB  1 
ATOM   1081 C CG  . LEU A 1 148 ? 87.375  47.835 -45.139 1.00 34.58  ? 148 LEU A CG  1 
ATOM   1082 C CD1 . LEU A 1 148 ? 87.620  46.798 -46.199 1.00 28.33  ? 148 LEU A CD1 1 
ATOM   1083 C CD2 . LEU A 1 148 ? 86.063  48.568 -45.385 1.00 33.96  ? 148 LEU A CD2 1 
ATOM   1084 N N   . LEU A 1 149 ? 90.882  46.696 -43.971 1.00 49.00  ? 149 LEU A N   1 
ATOM   1085 C CA  . LEU A 1 149 ? 92.140  47.440 -44.013 1.00 50.15  ? 149 LEU A CA  1 
ATOM   1086 C C   . LEU A 1 149 ? 92.338  47.794 -45.453 1.00 51.30  ? 149 LEU A C   1 
ATOM   1087 O O   . LEU A 1 149 ? 93.135  47.147 -46.110 1.00 59.57  ? 149 LEU A O   1 
ATOM   1088 C CB  . LEU A 1 149 ? 93.311  46.558 -43.542 1.00 46.28  ? 149 LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 149 ? 93.034  45.072 -43.364 1.00 44.62  ? 149 LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 149 ? 93.272  44.332 -44.645 1.00 45.26  ? 149 LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 149 ? 93.891  44.528 -42.278 1.00 42.30  ? 149 LEU A CD2 1 
ATOM   1092 N N   . ASN A 1 150 ? 91.571  48.764 -45.946 1.00 48.70  ? 150 ASN A N   1 
ATOM   1093 C CA  . ASN A 1 150 ? 91.614  49.215 -47.341 1.00 48.21  ? 150 ASN A CA  1 
ATOM   1094 C C   . ASN A 1 150 ? 90.266  49.777 -47.713 1.00 49.95  ? 150 ASN A C   1 
ATOM   1095 O O   . ASN A 1 150 ? 89.418  49.002 -48.147 1.00 50.91  ? 150 ASN A O   1 
ATOM   1096 C CB  . ASN A 1 150 ? 91.815  48.053 -48.317 1.00 47.80  ? 150 ASN A CB  1 
ATOM   1097 C CG  . ASN A 1 150 ? 93.250  47.783 -48.632 1.00 49.41  ? 150 ASN A CG  1 
ATOM   1098 O OD1 . ASN A 1 150 ? 94.084  48.681 -48.582 1.00 56.05  ? 150 ASN A OD1 1 
ATOM   1099 N ND2 . ASN A 1 150 ? 93.564  46.528 -48.919 1.00 46.68  ? 150 ASN A ND2 1 
ATOM   1100 N N   . SER A 1 151 ? 90.033  51.079 -47.525 1.00 51.51  ? 151 SER A N   1 
ATOM   1101 C CA  . SER A 1 151 ? 88.754  51.681 -47.921 1.00 51.81  ? 151 SER A CA  1 
ATOM   1102 C C   . SER A 1 151 ? 88.488  53.151 -47.637 1.00 50.46  ? 151 SER A C   1 
ATOM   1103 O O   . SER A 1 151 ? 88.171  53.518 -46.506 1.00 53.27  ? 151 SER A O   1 
ATOM   1104 C CB  . SER A 1 151 ? 87.558  50.866 -47.389 1.00 57.36  ? 151 SER A CB  1 
ATOM   1105 O OG  . SER A 1 151 ? 87.001  49.967 -48.363 1.00 60.05  ? 151 SER A OG  1 
ATOM   1106 N N   . MET A 1 152 ? 88.592  53.974 -48.674 1.00 46.26  ? 152 MET A N   1 
ATOM   1107 C CA  . MET A 1 152 ? 88.274  55.406 -48.615 1.00 50.75  ? 152 MET A CA  1 
ATOM   1108 C C   . MET A 1 152 ? 88.892  56.370 -47.613 1.00 50.02  ? 152 MET A C   1 
ATOM   1109 O O   . MET A 1 152 ? 89.042  57.546 -47.926 1.00 53.55  ? 152 MET A O   1 
ATOM   1110 C CB  . MET A 1 152 ? 86.750  55.609 -48.603 1.00 55.91  ? 152 MET A CB  1 
ATOM   1111 C CG  . MET A 1 152 ? 86.024  55.124 -49.853 1.00 59.57  ? 152 MET A CG  1 
ATOM   1112 S SD  . MET A 1 152 ? 86.188  56.216 -51.265 1.00 70.84  ? 152 MET A SD  1 
ATOM   1113 C CE  . MET A 1 152 ? 86.190  57.880 -50.409 1.00 62.92  ? 152 MET A CE  1 
ATOM   1114 N N   . TYR A 1 153 ? 89.116  55.940 -46.382 1.00 47.42  ? 153 TYR A N   1 
ATOM   1115 C CA  . TYR A 1 153 ? 89.738  56.812 -45.398 1.00 46.64  ? 153 TYR A CA  1 
ATOM   1116 C C   . TYR A 1 153 ? 91.190  56.335 -45.194 1.00 45.29  ? 153 TYR A C   1 
ATOM   1117 O O   . TYR A 1 153 ? 91.786  56.442 -44.119 1.00 44.86  ? 153 TYR A O   1 
ATOM   1118 C CB  . TYR A 1 153 ? 88.910  56.821 -44.108 1.00 46.71  ? 153 TYR A CB  1 
ATOM   1119 C CG  . TYR A 1 153 ? 87.668  57.671 -44.230 1.00 48.80  ? 153 TYR A CG  1 
ATOM   1120 C CD1 . TYR A 1 153 ? 86.530  57.207 -44.902 1.00 49.44  ? 153 TYR A CD1 1 
ATOM   1121 C CD2 . TYR A 1 153 ? 87.645  58.968 -43.718 1.00 50.53  ? 153 TYR A CD2 1 
ATOM   1122 C CE1 . TYR A 1 153 ? 85.400  58.025 -45.062 1.00 46.77  ? 153 TYR A CE1 1 
ATOM   1123 C CE2 . TYR A 1 153 ? 86.525  59.793 -43.866 1.00 49.84  ? 153 TYR A CE2 1 
ATOM   1124 C CZ  . TYR A 1 153 ? 85.407  59.318 -44.541 1.00 47.63  ? 153 TYR A CZ  1 
ATOM   1125 O OH  . TYR A 1 153 ? 84.321  60.148 -44.694 1.00 42.18  ? 153 TYR A OH  1 
ATOM   1126 N N   . GLY A 1 154 ? 91.732  55.791 -46.273 1.00 44.47  ? 154 GLY A N   1 
ATOM   1127 C CA  . GLY A 1 154 ? 93.088  55.298 -46.291 1.00 46.18  ? 154 GLY A CA  1 
ATOM   1128 C C   . GLY A 1 154 ? 93.274  53.814 -46.049 1.00 42.91  ? 154 GLY A C   1 
ATOM   1129 O O   . GLY A 1 154 ? 92.496  53.174 -45.362 1.00 41.42  ? 154 GLY A O   1 
ATOM   1130 N N   . SER A 1 155 ? 94.278  53.245 -46.690 1.00 43.47  ? 155 SER A N   1 
ATOM   1131 C CA  . SER A 1 155 ? 94.566  51.848 -46.468 1.00 46.95  ? 155 SER A CA  1 
ATOM   1132 C C   . SER A 1 155 ? 95.162  51.784 -45.056 1.00 48.54  ? 155 SER A C   1 
ATOM   1133 O O   . SER A 1 155 ? 95.638  52.804 -44.522 1.00 49.66  ? 155 SER A O   1 
ATOM   1134 C CB  . SER A 1 155 ? 95.529  51.346 -47.525 1.00 49.27  ? 155 SER A CB  1 
ATOM   1135 O OG  . SER A 1 155 ? 94.928  51.484 -48.804 1.00 58.89  ? 155 SER A OG  1 
ATOM   1136 N N   . VAL A 1 156 ? 95.172  50.596 -44.464 1.00 44.58  ? 156 VAL A N   1 
ATOM   1137 C CA  . VAL A 1 156 ? 95.638  50.454 -43.099 1.00 42.02  ? 156 VAL A CA  1 
ATOM   1138 C C   . VAL A 1 156 ? 96.233  49.059 -42.925 1.00 43.15  ? 156 VAL A C   1 
ATOM   1139 O O   . VAL A 1 156 ? 95.913  48.151 -43.681 1.00 47.46  ? 156 VAL A O   1 
ATOM   1140 C CB  . VAL A 1 156 ? 94.428  50.691 -42.127 1.00 39.71  ? 156 VAL A CB  1 
ATOM   1141 C CG1 . VAL A 1 156 ? 93.803  49.386 -41.669 1.00 37.19  ? 156 VAL A CG1 1 
ATOM   1142 C CG2 . VAL A 1 156 ? 94.816  51.556 -40.989 1.00 37.91  ? 156 VAL A CG2 1 
ATOM   1143 N N   . SER A 1 157 ? 97.077  48.884 -41.919 1.00 43.20  ? 157 SER A N   1 
ATOM   1144 C CA  . SER A 1 157 ? 97.709  47.602 -41.658 1.00 44.42  ? 157 SER A CA  1 
ATOM   1145 C C   . SER A 1 157 ? 96.849  46.690 -40.811 1.00 42.63  ? 157 SER A C   1 
ATOM   1146 O O   . SER A 1 157 ? 95.957  47.146 -40.108 1.00 45.43  ? 157 SER A O   1 
ATOM   1147 C CB  . SER A 1 157 ? 99.055  47.818 -40.964 1.00 55.12  ? 157 SER A CB  1 
ATOM   1148 O OG  . SER A 1 157 ? 99.881  48.709 -41.716 1.00 68.53  ? 157 SER A OG  1 
ATOM   1149 N N   . LYS A 1 158 ? 97.155  45.400 -40.882 1.00 43.78  ? 158 LYS A N   1 
ATOM   1150 C CA  . LYS A 1 158 ? 96.477  44.333 -40.153 1.00 42.11  ? 158 LYS A CA  1 
ATOM   1151 C C   . LYS A 1 158 ? 96.568  44.514 -38.660 1.00 40.20  ? 158 LYS A C   1 
ATOM   1152 O O   . LYS A 1 158 ? 97.637  44.845 -38.157 1.00 41.41  ? 158 LYS A O   1 
ATOM   1153 C CB  . LYS A 1 158 ? 97.131  42.988 -40.469 1.00 44.34  ? 158 LYS A CB  1 
ATOM   1154 C CG  . LYS A 1 158 ? 96.503  42.201 -41.581 1.00 47.71  ? 158 LYS A CG  1 
ATOM   1155 C CD  . LYS A 1 158 ? 96.987  40.752 -41.516 1.00 60.35  ? 158 LYS A CD  1 
ATOM   1156 C CE  . LYS A 1 158 ? 96.625  40.003 -40.175 1.00 65.03  ? 158 LYS A CE  1 
ATOM   1157 N NZ  . LYS A 1 158 ? 97.319  40.379 -38.877 1.00 65.39  ? 158 LYS A NZ  1 
ATOM   1158 N N   . TRP A 1 159 ? 95.468  44.224 -37.958 1.00 35.20  ? 159 TRP A N   1 
ATOM   1159 C CA  . TRP A 1 159 ? 95.424  44.321 -36.501 1.00 32.37  ? 159 TRP A CA  1 
ATOM   1160 C C   . TRP A 1 159 ? 96.326  43.210 -36.003 1.00 32.72  ? 159 TRP A C   1 
ATOM   1161 O O   . TRP A 1 159 ? 96.424  42.169 -36.634 1.00 34.91  ? 159 TRP A O   1 
ATOM   1162 C CB  . TRP A 1 159 ? 93.999  44.118 -35.981 1.00 30.94  ? 159 TRP A CB  1 
ATOM   1163 C CG  . TRP A 1 159 ? 93.918  43.878 -34.515 1.00 21.44  ? 159 TRP A CG  1 
ATOM   1164 C CD1 . TRP A 1 159 ? 94.065  44.806 -33.525 1.00 20.45  ? 159 TRP A CD1 1 
ATOM   1165 C CD2 . TRP A 1 159 ? 93.712  42.611 -33.857 1.00 21.61  ? 159 TRP A CD2 1 
ATOM   1166 N NE1 . TRP A 1 159 ? 93.975  44.196 -32.287 1.00 23.97  ? 159 TRP A NE1 1 
ATOM   1167 C CE2 . TRP A 1 159 ? 93.758  42.854 -32.463 1.00 21.77  ? 159 TRP A CE2 1 
ATOM   1168 C CE3 . TRP A 1 159 ? 93.501  41.301 -34.310 1.00 21.53  ? 159 TRP A CE3 1 
ATOM   1169 C CZ2 . TRP A 1 159 ? 93.599  41.819 -31.513 1.00 20.89  ? 159 TRP A CZ2 1 
ATOM   1170 C CZ3 . TRP A 1 159 ? 93.345  40.272 -33.352 1.00 15.51  ? 159 TRP A CZ3 1 
ATOM   1171 C CH2 . TRP A 1 159 ? 93.397  40.544 -31.981 1.00 17.23  ? 159 TRP A CH2 1 
ATOM   1172 N N   . ASP A 1 160 ? 96.891  43.390 -34.820 1.00 35.93  ? 160 ASP A N   1 
ATOM   1173 C CA  . ASP A 1 160 ? 97.821  42.432 -34.265 1.00 34.73  ? 160 ASP A CA  1 
ATOM   1174 C C   . ASP A 1 160 ? 97.377  41.976 -32.895 1.00 31.36  ? 160 ASP A C   1 
ATOM   1175 O O   . ASP A 1 160 ? 97.299  42.756 -31.955 1.00 33.23  ? 160 ASP A O   1 
ATOM   1176 C CB  . ASP A 1 160 ? 99.210  43.097 -34.214 1.00 45.40  ? 160 ASP A CB  1 
ATOM   1177 C CG  . ASP A 1 160 ? 100.263 42.278 -33.455 1.00 50.58  ? 160 ASP A CG  1 
ATOM   1178 O OD1 . ASP A 1 160 ? 100.249 41.029 -33.463 1.00 56.85  ? 160 ASP A OD1 1 
ATOM   1179 O OD2 . ASP A 1 160 ? 101.140 42.921 -32.865 1.00 50.31  ? 160 ASP A OD2 1 
ATOM   1180 N N   . ALA A 1 161 ? 97.142  40.687 -32.774 1.00 29.69  ? 161 ALA A N   1 
ATOM   1181 C CA  . ALA A 1 161 ? 96.710  40.103 -31.525 1.00 35.06  ? 161 ALA A CA  1 
ATOM   1182 C C   . ALA A 1 161 ? 97.757  40.206 -30.422 1.00 35.96  ? 161 ALA A C   1 
ATOM   1183 O O   . ALA A 1 161 ? 97.432  40.433 -29.257 1.00 36.42  ? 161 ALA A O   1 
ATOM   1184 C CB  . ALA A 1 161 ? 96.335  38.648 -31.756 1.00 38.47  ? 161 ALA A CB  1 
ATOM   1185 N N   . LYS A 1 162 ? 99.015  39.993 -30.794 1.00 40.98  ? 162 LYS A N   1 
ATOM   1186 C CA  . LYS A 1 162 ? 100.112 40.051 -29.832 1.00 39.99  ? 162 LYS A CA  1 
ATOM   1187 C C   . LYS A 1 162 ? 100.306 41.473 -29.334 1.00 37.42  ? 162 LYS A C   1 
ATOM   1188 O O   . LYS A 1 162 ? 100.408 41.709 -28.129 1.00 37.69  ? 162 LYS A O   1 
ATOM   1189 C CB  . LYS A 1 162 ? 101.395 39.502 -30.454 1.00 41.87  ? 162 LYS A CB  1 
ATOM   1190 C CG  . LYS A 1 162 ? 101.313 38.025 -30.827 1.00 44.66  ? 162 LYS A CG  1 
ATOM   1191 C CD  . LYS A 1 162 ? 102.324 37.710 -31.928 1.00 54.12  ? 162 LYS A CD  1 
ATOM   1192 C CE  . LYS A 1 162 ? 102.792 36.251 -31.926 1.00 53.46  ? 162 LYS A CE  1 
ATOM   1193 N NZ  . LYS A 1 162 ? 103.615 35.930 -30.705 1.00 57.41  ? 162 LYS A NZ  1 
ATOM   1194 N N   . LEU A 1 163 ? 100.323 42.438 -30.242 1.00 35.14  ? 163 LEU A N   1 
ATOM   1195 C CA  . LEU A 1 163 ? 100.489 43.815 -29.790 1.00 39.54  ? 163 LEU A CA  1 
ATOM   1196 C C   . LEU A 1 163 ? 99.314  44.179 -28.897 1.00 38.60  ? 163 LEU A C   1 
ATOM   1197 O O   . LEU A 1 163 ? 99.491  44.682 -27.788 1.00 36.54  ? 163 LEU A O   1 
ATOM   1198 C CB  . LEU A 1 163 ? 100.535 44.804 -30.954 1.00 39.45  ? 163 LEU A CB  1 
ATOM   1199 C CG  . LEU A 1 163 ? 101.599 45.890 -30.786 1.00 44.72  ? 163 LEU A CG  1 
ATOM   1200 C CD1 . LEU A 1 163 ? 101.063 47.224 -31.300 1.00 39.77  ? 163 LEU A CD1 1 
ATOM   1201 C CD2 . LEU A 1 163 ? 102.035 46.014 -29.307 1.00 42.72  ? 163 LEU A CD2 1 
ATOM   1202 N N   . ALA A 1 164 ? 98.123  43.863 -29.394 1.00 38.34  ? 164 ALA A N   1 
ATOM   1203 C CA  . ALA A 1 164 ? 96.865  44.133 -28.715 1.00 44.34  ? 164 ALA A CA  1 
ATOM   1204 C C   . ALA A 1 164 ? 96.873  43.808 -27.228 1.00 43.31  ? 164 ALA A C   1 
ATOM   1205 O O   . ALA A 1 164 ? 96.217  44.485 -26.433 1.00 43.40  ? 164 ALA A O   1 
ATOM   1206 C CB  . ALA A 1 164 ? 95.728  43.364 -29.415 1.00 49.69  ? 164 ALA A CB  1 
ATOM   1207 N N   . ALA A 1 165 ? 97.618  42.773 -26.867 1.00 43.00  ? 165 ALA A N   1 
ATOM   1208 C CA  . ALA A 1 165 ? 97.722  42.328 -25.483 1.00 45.81  ? 165 ALA A CA  1 
ATOM   1209 C C   . ALA A 1 165 ? 98.707  43.142 -24.655 1.00 47.95  ? 165 ALA A C   1 
ATOM   1210 O O   . ALA A 1 165 ? 98.541  43.275 -23.435 1.00 49.80  ? 165 ALA A O   1 
ATOM   1211 C CB  . ALA A 1 165 ? 98.135  40.856 -25.447 1.00 42.86  ? 165 ALA A CB  1 
ATOM   1212 N N   . LYS A 1 166 ? 99.737  43.671 -25.310 1.00 50.05  ? 166 LYS A N   1 
ATOM   1213 C CA  . LYS A 1 166 ? 100.779 44.423 -24.621 1.00 50.80  ? 166 LYS A CA  1 
ATOM   1214 C C   . LYS A 1 166 ? 100.283 45.690 -23.937 1.00 50.12  ? 166 LYS A C   1 
ATOM   1215 O O   . LYS A 1 166 ? 99.194  46.176 -24.247 1.00 49.89  ? 166 LYS A O   1 
ATOM   1216 C CB  . LYS A 1 166 ? 101.953 44.696 -25.573 1.00 54.20  ? 166 LYS A CB  1 
ATOM   1217 C CG  . LYS A 1 166 ? 102.577 43.410 -26.149 1.00 57.72  ? 166 LYS A CG  1 
ATOM   1218 C CD  . LYS A 1 166 ? 102.865 42.400 -25.037 1.00 62.32  ? 166 LYS A CD  1 
ATOM   1219 C CE  . LYS A 1 166 ? 103.242 40.993 -25.549 1.00 65.73  ? 166 LYS A CE  1 
ATOM   1220 N NZ  . LYS A 1 166 ? 102.103 40.089 -25.960 1.00 61.16  ? 166 LYS A NZ  1 
ATOM   1221 N N   . LEU A 1 167 ? 101.063 46.194 -22.978 1.00 48.39  ? 167 LEU A N   1 
ATOM   1222 C CA  . LEU A 1 167 ? 100.709 47.404 -22.230 1.00 46.36  ? 167 LEU A CA  1 
ATOM   1223 C C   . LEU A 1 167 ? 100.728 48.664 -23.084 1.00 46.96  ? 167 LEU A C   1 
ATOM   1224 O O   . LEU A 1 167 ? 101.501 48.767 -24.031 1.00 45.48  ? 167 LEU A O   1 
ATOM   1225 C CB  . LEU A 1 167 ? 101.610 47.550 -21.012 1.00 43.73  ? 167 LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 167 ? 101.580 46.254 -20.184 1.00 50.16  ? 167 LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 167 ? 102.643 46.263 -19.114 1.00 54.32  ? 167 LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 167 ? 100.204 46.014 -19.544 1.00 52.44  ? 167 LEU A CD2 1 
ATOM   1229 N N   . ASP A 1 168 ? 99.830  49.595 -22.782 1.00 48.49  ? 168 ASP A N   1 
ATOM   1230 C CA  . ASP A 1 168 ? 99.736  50.852 -23.527 1.00 54.48  ? 168 ASP A CA  1 
ATOM   1231 C C   . ASP A 1 168 ? 101.118 51.531 -23.632 1.00 55.90  ? 168 ASP A C   1 
ATOM   1232 O O   . ASP A 1 168 ? 101.511 52.030 -24.707 1.00 50.89  ? 168 ASP A O   1 
ATOM   1233 C CB  . ASP A 1 168 ? 98.703  51.769 -22.842 1.00 57.36  ? 168 ASP A CB  1 
ATOM   1234 C CG  . ASP A 1 168 ? 98.562  53.154 -23.505 1.00 58.95  ? 168 ASP A CG  1 
ATOM   1235 O OD1 . ASP A 1 168 ? 98.835  53.318 -24.723 1.00 61.18  ? 168 ASP A OD1 1 
ATOM   1236 O OD2 . ASP A 1 168 ? 98.138  54.085 -22.779 1.00 61.20  ? 168 ASP A OD2 1 
ATOM   1237 N N   . CYS A 1 169 ? 101.863 51.493 -22.521 1.00 58.98  ? 169 CYS A N   1 
ATOM   1238 C CA  . CYS A 1 169 ? 103.210 52.080 -22.455 1.00 59.81  ? 169 CYS A CA  1 
ATOM   1239 C C   . CYS A 1 169 ? 104.096 51.472 -23.541 1.00 58.44  ? 169 CYS A C   1 
ATOM   1240 O O   . CYS A 1 169 ? 104.922 52.171 -24.142 1.00 59.95  ? 169 CYS A O   1 
ATOM   1241 C CB  . CYS A 1 169 ? 103.853 51.888 -21.062 1.00 60.98  ? 169 CYS A CB  1 
ATOM   1242 S SG  . CYS A 1 169 ? 104.339 50.191 -20.591 1.00 59.93  ? 169 CYS A SG  1 
ATOM   1243 N N   . GLU A 1 170 ? 103.882 50.186 -23.828 1.00 53.58  ? 170 GLU A N   1 
ATOM   1244 C CA  . GLU A 1 170 ? 104.656 49.530 -24.859 1.00 48.54  ? 170 GLU A CA  1 
ATOM   1245 C C   . GLU A 1 170 ? 103.934 49.456 -26.184 1.00 47.44  ? 170 GLU A C   1 
ATOM   1246 O O   . GLU A 1 170 ? 104.292 48.656 -27.038 1.00 46.09  ? 170 GLU A O   1 
ATOM   1247 C CB  . GLU A 1 170 ? 105.126 48.159 -24.417 1.00 45.22  ? 170 GLU A CB  1 
ATOM   1248 C CG  . GLU A 1 170 ? 104.084 47.119 -24.326 1.00 45.00  ? 170 GLU A CG  1 
ATOM   1249 C CD  . GLU A 1 170 ? 104.227 46.344 -23.044 1.00 52.34  ? 170 GLU A CD  1 
ATOM   1250 O OE1 . GLU A 1 170 ? 104.655 46.968 -22.050 1.00 53.25  ? 170 GLU A OE1 1 
ATOM   1251 O OE2 . GLU A 1 170 ? 103.915 45.132 -23.016 1.00 53.78  ? 170 GLU A OE2 1 
ATOM   1252 N N   . GLY A 1 171 ? 102.947 50.333 -26.367 1.00 50.42  ? 171 GLY A N   1 
ATOM   1253 C CA  . GLY A 1 171 ? 102.199 50.384 -27.617 1.00 47.43  ? 171 GLY A CA  1 
ATOM   1254 C C   . GLY A 1 171 ? 101.129 49.322 -27.761 1.00 45.27  ? 171 GLY A C   1 
ATOM   1255 O O   . GLY A 1 171 ? 100.612 49.090 -28.856 1.00 43.70  ? 171 GLY A O   1 
ATOM   1256 N N   . GLY A 1 172 ? 100.845 48.646 -26.655 1.00 43.21  ? 172 GLY A N   1 
ATOM   1257 C CA  . GLY A 1 172 ? 99.834  47.607 -26.643 1.00 45.00  ? 172 GLY A CA  1 
ATOM   1258 C C   . GLY A 1 172 ? 98.450  48.151 -26.297 1.00 46.59  ? 172 GLY A C   1 
ATOM   1259 O O   . GLY A 1 172 ? 98.290  49.217 -25.653 1.00 45.23  ? 172 GLY A O   1 
ATOM   1260 N N   . ASP A 1 173 ? 97.438  47.385 -26.686 1.00 43.20  ? 173 ASP A N   1 
ATOM   1261 C CA  . ASP A 1 173 ? 96.067  47.789 -26.470 1.00 37.94  ? 173 ASP A CA  1 
ATOM   1262 C C   . ASP A 1 173 ? 95.514  47.348 -25.131 1.00 36.05  ? 173 ASP A C   1 
ATOM   1263 O O   . ASP A 1 173 ? 94.534  47.915 -24.669 1.00 34.80  ? 173 ASP A O   1 
ATOM   1264 C CB  . ASP A 1 173 ? 95.192  47.287 -27.624 1.00 35.80  ? 173 ASP A CB  1 
ATOM   1265 C CG  . ASP A 1 173 ? 95.616  47.859 -28.976 1.00 35.61  ? 173 ASP A CG  1 
ATOM   1266 O OD1 . ASP A 1 173 ? 96.050  49.032 -29.038 1.00 36.80  ? 173 ASP A OD1 1 
ATOM   1267 O OD2 . ASP A 1 173 ? 95.498  47.145 -29.989 1.00 38.56  ? 173 ASP A OD2 1 
ATOM   1268 N N   . GLU A 1 174 ? 96.179  46.386 -24.495 1.00 33.47  ? 174 GLU A N   1 
ATOM   1269 C CA  . GLU A 1 174 ? 95.758  45.836 -23.209 1.00 33.06  ? 174 GLU A CA  1 
ATOM   1270 C C   . GLU A 1 174 ? 94.414  45.075 -23.244 1.00 38.46  ? 174 GLU A C   1 
ATOM   1271 O O   . GLU A 1 174 ? 93.615  45.112 -22.286 1.00 44.07  ? 174 GLU A O   1 
ATOM   1272 C CB  . GLU A 1 174 ? 95.727  46.908 -22.123 1.00 28.77  ? 174 GLU A CB  1 
ATOM   1273 C CG  . GLU A 1 174 ? 97.068  47.267 -21.591 1.00 35.26  ? 174 GLU A CG  1 
ATOM   1274 C CD  . GLU A 1 174 ? 97.019  48.344 -20.526 1.00 38.49  ? 174 GLU A CD  1 
ATOM   1275 O OE1 . GLU A 1 174 ? 96.371  48.122 -19.469 1.00 41.96  ? 174 GLU A OE1 1 
ATOM   1276 O OE2 . GLU A 1 174 ? 97.667  49.402 -20.735 1.00 41.39  ? 174 GLU A OE2 1 
ATOM   1277 N N   . VAL A 1 175 ? 94.140  44.398 -24.349 1.00 37.18  ? 175 VAL A N   1 
ATOM   1278 C CA  . VAL A 1 175 ? 92.918  43.616 -24.424 1.00 35.11  ? 175 VAL A CA  1 
ATOM   1279 C C   . VAL A 1 175 ? 93.338  42.309 -23.723 1.00 37.28  ? 175 VAL A C   1 
ATOM   1280 O O   . VAL A 1 175 ? 94.419  41.774 -23.999 1.00 38.16  ? 175 VAL A O   1 
ATOM   1281 C CB  . VAL A 1 175 ? 92.519  43.303 -25.887 1.00 32.48  ? 175 VAL A CB  1 
ATOM   1282 C CG1 . VAL A 1 175 ? 91.096  42.784 -25.930 1.00 34.12  ? 175 VAL A CG1 1 
ATOM   1283 C CG2 . VAL A 1 175 ? 92.689  44.526 -26.786 1.00 28.49  ? 175 VAL A CG2 1 
ATOM   1284 N N   . PRO A 1 176 ? 92.565  41.856 -22.725 1.00 36.72  ? 176 PRO A N   1 
ATOM   1285 C CA  . PRO A 1 176 ? 92.904  40.616 -22.019 1.00 35.11  ? 176 PRO A CA  1 
ATOM   1286 C C   . PRO A 1 176 ? 93.025  39.422 -22.964 1.00 35.31  ? 176 PRO A C   1 
ATOM   1287 O O   . PRO A 1 176 ? 92.432  39.395 -24.058 1.00 32.72  ? 176 PRO A O   1 
ATOM   1288 C CB  . PRO A 1 176 ? 91.770  40.482 -21.016 1.00 37.29  ? 176 PRO A CB  1 
ATOM   1289 C CG  . PRO A 1 176 ? 91.513  41.930 -20.665 1.00 35.87  ? 176 PRO A CG  1 
ATOM   1290 C CD  . PRO A 1 176 ? 91.483  42.566 -22.037 1.00 38.80  ? 176 PRO A CD  1 
ATOM   1291 N N   . GLN A 1 177 ? 93.765  38.417 -22.512 1.00 35.66  ? 177 GLN A N   1 
ATOM   1292 C CA  . GLN A 1 177 ? 94.068  37.258 -23.342 1.00 37.92  ? 177 GLN A CA  1 
ATOM   1293 C C   . GLN A 1 177 ? 92.982  36.290 -23.740 1.00 37.73  ? 177 GLN A C   1 
ATOM   1294 O O   . GLN A 1 177 ? 93.012  35.819 -24.874 1.00 32.18  ? 177 GLN A O   1 
ATOM   1295 C CB  . GLN A 1 177 ? 95.275  36.485 -22.777 1.00 46.24  ? 177 GLN A CB  1 
ATOM   1296 C CG  . GLN A 1 177 ? 96.648  36.935 -23.312 1.00 40.26  ? 177 GLN A CG  1 
ATOM   1297 C CD  . GLN A 1 177 ? 96.874  36.495 -24.720 1.00 33.88  ? 177 GLN A CD  1 
ATOM   1298 O OE1 . GLN A 1 177 ? 97.326  37.269 -25.549 1.00 37.00  ? 177 GLN A OE1 1 
ATOM   1299 N NE2 . GLN A 1 177 ? 96.550  35.246 -25.009 1.00 30.95  ? 177 GLN A NE2 1 
ATOM   1300 N N   . GLU A 1 178 ? 92.071  35.937 -22.822 1.00 40.30  ? 178 GLU A N   1 
ATOM   1301 C CA  . GLU A 1 178 ? 90.996  35.005 -23.171 1.00 41.08  ? 178 GLU A CA  1 
ATOM   1302 C C   . GLU A 1 178 ? 90.045  35.643 -24.162 1.00 38.62  ? 178 GLU A C   1 
ATOM   1303 O O   . GLU A 1 178 ? 89.318  34.965 -24.866 1.00 37.86  ? 178 GLU A O   1 
ATOM   1304 C CB  . GLU A 1 178 ? 90.238  34.489 -21.959 1.00 47.63  ? 178 GLU A CB  1 
ATOM   1305 C CG  . GLU A 1 178 ? 90.144  32.940 -21.935 1.00 61.63  ? 178 GLU A CG  1 
ATOM   1306 C CD  . GLU A 1 178 ? 89.487  32.296 -23.194 1.00 68.10  ? 178 GLU A CD  1 
ATOM   1307 O OE1 . GLU A 1 178 ? 90.168  32.151 -24.247 1.00 68.18  ? 178 GLU A OE1 1 
ATOM   1308 O OE2 . GLU A 1 178 ? 88.300  31.890 -23.104 1.00 70.95  ? 178 GLU A OE2 1 
ATOM   1309 N N   . ILE A 1 179 ? 90.105  36.960 -24.261 1.00 36.87  ? 179 ILE A N   1 
ATOM   1310 C CA  . ILE A 1 179 ? 89.276  37.649 -25.220 1.00 37.70  ? 179 ILE A CA  1 
ATOM   1311 C C   . ILE A 1 179 ? 90.041  37.496 -26.538 1.00 38.06  ? 179 ILE A C   1 
ATOM   1312 O O   . ILE A 1 179 ? 89.502  36.958 -27.528 1.00 36.68  ? 179 ILE A O   1 
ATOM   1313 C CB  . ILE A 1 179 ? 89.077  39.153 -24.836 1.00 35.16  ? 179 ILE A CB  1 
ATOM   1314 C CG1 . ILE A 1 179 ? 88.453  39.275 -23.438 1.00 33.08  ? 179 ILE A CG1 1 
ATOM   1315 C CG2 . ILE A 1 179 ? 88.194  39.833 -25.841 1.00 31.57  ? 179 ILE A CG2 1 
ATOM   1316 C CD1 . ILE A 1 179 ? 88.174  40.722 -23.016 1.00 34.18  ? 179 ILE A CD1 1 
ATOM   1317 N N   . LEU A 1 180 ? 91.323  37.887 -26.510 1.00 37.84  ? 180 LEU A N   1 
ATOM   1318 C CA  . LEU A 1 180 ? 92.200  37.803 -27.690 1.00 37.89  ? 180 LEU A CA  1 
ATOM   1319 C C   . LEU A 1 180 ? 92.311  36.396 -28.250 1.00 39.03  ? 180 LEU A C   1 
ATOM   1320 O O   . LEU A 1 180 ? 92.438  36.221 -29.471 1.00 37.19  ? 180 LEU A O   1 
ATOM   1321 C CB  . LEU A 1 180 ? 93.599  38.310 -27.361 1.00 40.53  ? 180 LEU A CB  1 
ATOM   1322 C CG  . LEU A 1 180 ? 93.745  39.821 -27.187 1.00 38.88  ? 180 LEU A CG  1 
ATOM   1323 C CD1 . LEU A 1 180 ? 95.196  40.149 -26.864 1.00 39.18  ? 180 LEU A CD1 1 
ATOM   1324 C CD2 . LEU A 1 180 ? 93.313  40.528 -28.463 1.00 38.62  ? 180 LEU A CD2 1 
ATOM   1325 N N   . ASP A 1 181 ? 92.243  35.408 -27.343 1.00 40.02  ? 181 ASP A N   1 
ATOM   1326 C CA  . ASP A 1 181 ? 92.313  33.967 -27.639 1.00 37.69  ? 181 ASP A CA  1 
ATOM   1327 C C   . ASP A 1 181 ? 91.100  33.391 -28.383 1.00 37.59  ? 181 ASP A C   1 
ATOM   1328 O O   . ASP A 1 181 ? 91.205  32.397 -29.122 1.00 36.73  ? 181 ASP A O   1 
ATOM   1329 C CB  . ASP A 1 181 ? 92.541  33.190 -26.341 1.00 38.70  ? 181 ASP A CB  1 
ATOM   1330 C CG  . ASP A 1 181 ? 94.011  33.236 -25.865 1.00 42.94  ? 181 ASP A CG  1 
ATOM   1331 O OD1 . ASP A 1 181 ? 94.904  33.591 -26.676 1.00 41.95  ? 181 ASP A OD1 1 
ATOM   1332 O OD2 . ASP A 1 181 ? 94.274  32.898 -24.685 1.00 42.06  ? 181 ASP A OD2 1 
ATOM   1333 N N   . ARG A 1 182 ? 89.953  34.040 -28.219 1.00 35.86  ? 182 ARG A N   1 
ATOM   1334 C CA  . ARG A 1 182 ? 88.739  33.594 -28.878 1.00 28.97  ? 182 ARG A CA  1 
ATOM   1335 C C   . ARG A 1 182 ? 88.460  34.420 -30.099 1.00 26.70  ? 182 ARG A C   1 
ATOM   1336 O O   . ARG A 1 182 ? 87.432  34.232 -30.725 1.00 27.71  ? 182 ARG A O   1 
ATOM   1337 C CB  . ARG A 1 182 ? 87.580  33.648 -27.901 1.00 31.04  ? 182 ARG A CB  1 
ATOM   1338 C CG  . ARG A 1 182 ? 87.864  32.781 -26.714 1.00 32.39  ? 182 ARG A CG  1 
ATOM   1339 C CD  . ARG A 1 182 ? 86.767  32.823 -25.724 1.00 39.35  ? 182 ARG A CD  1 
ATOM   1340 N NE  . ARG A 1 182 ? 86.846  33.991 -24.869 1.00 40.87  ? 182 ARG A NE  1 
ATOM   1341 C CZ  . ARG A 1 182 ? 85.792  34.690 -24.475 1.00 44.18  ? 182 ARG A CZ  1 
ATOM   1342 N NH1 . ARG A 1 182 ? 84.573  34.347 -24.891 1.00 41.63  ? 182 ARG A NH1 1 
ATOM   1343 N NH2 . ARG A 1 182 ? 85.969  35.746 -23.686 1.00 41.34  ? 182 ARG A NH2 1 
ATOM   1344 N N   . VAL A 1 183 ? 89.382  35.325 -30.442 1.00 21.93  ? 183 VAL A N   1 
ATOM   1345 C CA  . VAL A 1 183 ? 89.256  36.190 -31.618 1.00 17.72  ? 183 VAL A CA  1 
ATOM   1346 C C   . VAL A 1 183 ? 89.551  35.425 -32.876 1.00 19.99  ? 183 VAL A C   1 
ATOM   1347 O O   . VAL A 1 183 ? 90.475  34.626 -32.904 1.00 26.42  ? 183 VAL A O   1 
ATOM   1348 C CB  . VAL A 1 183 ? 90.230  37.409 -31.546 1.00 22.69  ? 183 VAL A CB  1 
ATOM   1349 C CG1 . VAL A 1 183 ? 90.384  38.089 -32.920 1.00 19.65  ? 183 VAL A CG1 1 
ATOM   1350 C CG2 . VAL A 1 183 ? 89.742  38.415 -30.495 1.00 21.66  ? 183 VAL A CG2 1 
ATOM   1351 N N   . ILE A 1 184 ? 88.796  35.714 -33.924 1.00 22.97  ? 184 ILE A N   1 
ATOM   1352 C CA  . ILE A 1 184 ? 88.950  35.069 -35.209 1.00 21.96  ? 184 ILE A CA  1 
ATOM   1353 C C   . ILE A 1 184 ? 89.061  36.133 -36.281 1.00 25.76  ? 184 ILE A C   1 
ATOM   1354 O O   . ILE A 1 184 ? 88.122  36.418 -37.000 1.00 31.11  ? 184 ILE A O   1 
ATOM   1355 C CB  . ILE A 1 184 ? 87.773  34.135 -35.457 1.00 22.54  ? 184 ILE A CB  1 
ATOM   1356 C CG1 . ILE A 1 184 ? 87.821  33.024 -34.413 1.00 18.46  ? 184 ILE A CG1 1 
ATOM   1357 C CG2 . ILE A 1 184 ? 87.783  33.602 -36.877 1.00 18.19  ? 184 ILE A CG2 1 
ATOM   1358 C CD1 . ILE A 1 184 ? 86.821  31.966 -34.661 1.00 29.36  ? 184 ILE A CD1 1 
ATOM   1359 N N   . TYR A 1 185 ? 90.255  36.696 -36.394 1.00 31.12  ? 185 TYR A N   1 
ATOM   1360 C CA  . TYR A 1 185 ? 90.569  37.785 -37.312 1.00 30.16  ? 185 TYR A CA  1 
ATOM   1361 C C   . TYR A 1 185 ? 90.359  37.458 -38.773 1.00 33.88  ? 185 TYR A C   1 
ATOM   1362 O O   . TYR A 1 185 ? 90.831  36.432 -39.254 1.00 37.29  ? 185 TYR A O   1 
ATOM   1363 C CB  . TYR A 1 185 ? 92.009  38.225 -37.063 1.00 23.24  ? 185 TYR A CB  1 
ATOM   1364 C CG  . TYR A 1 185 ? 92.380  39.514 -37.702 1.00 22.01  ? 185 TYR A CG  1 
ATOM   1365 C CD1 . TYR A 1 185 ? 91.841  40.704 -37.256 1.00 24.30  ? 185 TYR A CD1 1 
ATOM   1366 C CD2 . TYR A 1 185 ? 93.283  39.547 -38.753 1.00 24.13  ? 185 TYR A CD2 1 
ATOM   1367 C CE1 . TYR A 1 185 ? 92.192  41.927 -37.855 1.00 33.50  ? 185 TYR A CE1 1 
ATOM   1368 C CE2 . TYR A 1 185 ? 93.646  40.756 -39.365 1.00 31.06  ? 185 TYR A CE2 1 
ATOM   1369 C CZ  . TYR A 1 185 ? 93.095  41.946 -38.916 1.00 32.00  ? 185 TYR A CZ  1 
ATOM   1370 O OH  . TYR A 1 185 ? 93.397  43.127 -39.559 1.00 27.39  ? 185 TYR A OH  1 
ATOM   1371 N N   . MET A 1 186 ? 89.657  38.350 -39.470 1.00 38.05  ? 186 MET A N   1 
ATOM   1372 C CA  . MET A 1 186 ? 89.343  38.211 -40.900 1.00 40.53  ? 186 MET A CA  1 
ATOM   1373 C C   . MET A 1 186 ? 89.459  39.585 -41.539 1.00 41.82  ? 186 MET A C   1 
ATOM   1374 O O   . MET A 1 186 ? 88.511  40.371 -41.490 1.00 41.72  ? 186 MET A O   1 
ATOM   1375 C CB  . MET A 1 186 ? 87.911  37.702 -41.106 1.00 41.51  ? 186 MET A CB  1 
ATOM   1376 C CG  . MET A 1 186 ? 87.643  36.325 -40.507 1.00 45.80  ? 186 MET A CG  1 
ATOM   1377 S SD  . MET A 1 186 ? 85.911  36.031 -40.123 1.00 44.77  ? 186 MET A SD  1 
ATOM   1378 C CE  . MET A 1 186 ? 85.263  36.065 -41.807 1.00 36.30  ? 186 MET A CE  1 
ATOM   1379 N N   . PRO A 1 187 ? 90.645  39.921 -42.089 1.00 41.75  ? 187 PRO A N   1 
ATOM   1380 C CA  . PRO A 1 187 ? 90.850  41.226 -42.729 1.00 37.49  ? 187 PRO A CA  1 
ATOM   1381 C C   . PRO A 1 187 ? 90.350  41.199 -44.163 1.00 33.75  ? 187 PRO A C   1 
ATOM   1382 O O   . PRO A 1 187 ? 90.302  40.139 -44.780 1.00 34.50  ? 187 PRO A O   1 
ATOM   1383 C CB  . PRO A 1 187 ? 92.357  41.408 -42.634 1.00 40.07  ? 187 PRO A CB  1 
ATOM   1384 C CG  . PRO A 1 187 ? 92.854  40.016 -42.846 1.00 43.90  ? 187 PRO A CG  1 
ATOM   1385 C CD  . PRO A 1 187 ? 91.909  39.161 -42.023 1.00 40.42  ? 187 PRO A CD  1 
ATOM   1386 N N   . PHE A 1 188 ? 89.952  42.354 -44.683 1.00 33.69  ? 188 PHE A N   1 
ATOM   1387 C CA  . PHE A 1 188 ? 89.416  42.450 -46.040 1.00 35.51  ? 188 PHE A CA  1 
ATOM   1388 C C   . PHE A 1 188 ? 90.017  43.600 -46.824 1.00 35.86  ? 188 PHE A C   1 
ATOM   1389 O O   . PHE A 1 188 ? 90.397  44.624 -46.274 1.00 37.71  ? 188 PHE A O   1 
ATOM   1390 C CB  . PHE A 1 188 ? 87.870  42.553 -46.021 1.00 33.68  ? 188 PHE A CB  1 
ATOM   1391 C CG  . PHE A 1 188 ? 87.193  41.311 -45.506 1.00 32.37  ? 188 PHE A CG  1 
ATOM   1392 C CD1 . PHE A 1 188 ? 87.004  41.120 -44.135 1.00 34.98  ? 188 PHE A CD1 1 
ATOM   1393 C CD2 . PHE A 1 188 ? 86.786  40.309 -46.385 1.00 29.99  ? 188 PHE A CD2 1 
ATOM   1394 C CE1 . PHE A 1 188 ? 86.410  39.943 -43.640 1.00 37.03  ? 188 PHE A CE1 1 
ATOM   1395 C CE2 . PHE A 1 188 ? 86.196  39.133 -45.912 1.00 29.99  ? 188 PHE A CE2 1 
ATOM   1396 C CZ  . PHE A 1 188 ? 86.007  38.949 -44.530 1.00 33.63  ? 188 PHE A CZ  1 
ATOM   1397 N N   . ASP A 1 189 ? 90.097  43.406 -48.124 1.00 40.05  ? 189 ASP A N   1 
ATOM   1398 C CA  . ASP A 1 189 ? 90.663  44.372 -49.034 1.00 47.94  ? 189 ASP A CA  1 
ATOM   1399 C C   . ASP A 1 189 ? 89.629  45.434 -49.368 1.00 50.63  ? 189 ASP A C   1 
ATOM   1400 O O   . ASP A 1 189 ? 89.969  46.581 -49.622 1.00 51.42  ? 189 ASP A O   1 
ATOM   1401 C CB  . ASP A 1 189 ? 91.112  43.617 -50.296 1.00 57.25  ? 189 ASP A CB  1 
ATOM   1402 C CG  . ASP A 1 189 ? 91.714  44.523 -51.374 1.00 67.87  ? 189 ASP A CG  1 
ATOM   1403 O OD1 . ASP A 1 189 ? 92.171  45.657 -51.078 1.00 74.66  ? 189 ASP A OD1 1 
ATOM   1404 O OD2 . ASP A 1 189 ? 91.739  44.072 -52.542 1.00 72.19  ? 189 ASP A OD2 1 
ATOM   1405 N N   . ASN A 1 190 ? 88.357  45.051 -49.366 1.00 54.50  ? 190 ASN A N   1 
ATOM   1406 C CA  . ASN A 1 190 ? 87.263  45.980 -49.687 1.00 52.57  ? 190 ASN A CA  1 
ATOM   1407 C C   . ASN A 1 190 ? 85.974  45.624 -48.919 1.00 50.18  ? 190 ASN A C   1 
ATOM   1408 O O   . ASN A 1 190 ? 85.798  44.482 -48.437 1.00 48.11  ? 190 ASN A O   1 
ATOM   1409 C CB  . ASN A 1 190 ? 87.003  45.961 -51.191 1.00 50.47  ? 190 ASN A CB  1 
ATOM   1410 C CG  . ASN A 1 190 ? 86.722  44.558 -51.707 1.00 55.09  ? 190 ASN A CG  1 
ATOM   1411 O OD1 . ASN A 1 190 ? 85.591  44.244 -52.080 1.00 57.51  ? 190 ASN A OD1 1 
ATOM   1412 N ND2 . ASN A 1 190 ? 87.744  43.692 -51.685 1.00 47.16  ? 190 ASN A ND2 1 
ATOM   1413 N N   . GLU A 1 191 ? 85.099  46.621 -48.793 1.00 48.49  ? 191 GLU A N   1 
ATOM   1414 C CA  . GLU A 1 191 ? 83.813  46.511 -48.092 1.00 45.77  ? 191 GLU A CA  1 
ATOM   1415 C C   . GLU A 1 191 ? 82.828  45.463 -48.670 1.00 44.10  ? 191 GLU A C   1 
ATOM   1416 O O   . GLU A 1 191 ? 82.279  44.660 -47.905 1.00 38.05  ? 191 GLU A O   1 
ATOM   1417 C CB  . GLU A 1 191 ? 83.150  47.890 -48.041 1.00 44.71  ? 191 GLU A CB  1 
ATOM   1418 C CG  . GLU A 1 191 ? 82.113  48.033 -46.957 1.00 45.06  ? 191 GLU A CG  1 
ATOM   1419 C CD  . GLU A 1 191 ? 81.064  49.081 -47.275 1.00 44.60  ? 191 GLU A CD  1 
ATOM   1420 O OE1 . GLU A 1 191 ? 80.836  49.372 -48.476 1.00 42.25  ? 191 GLU A OE1 1 
ATOM   1421 O OE2 . GLU A 1 191 ? 80.451  49.594 -46.315 1.00 38.73  ? 191 GLU A OE2 1 
ATOM   1422 N N   . ARG A 1 192 ? 82.619  45.474 -49.996 1.00 43.22  ? 192 ARG A N   1 
ATOM   1423 C CA  . ARG A 1 192 ? 81.727  44.523 -50.680 1.00 43.19  ? 192 ARG A CA  1 
ATOM   1424 C C   . ARG A 1 192 ? 81.975  43.144 -50.124 1.00 44.03  ? 192 ARG A C   1 
ATOM   1425 O O   . ARG A 1 192 ? 81.048  42.480 -49.665 1.00 43.68  ? 192 ARG A O   1 
ATOM   1426 C CB  . ARG A 1 192 ? 82.009  44.473 -52.186 1.00 44.83  ? 192 ARG A CB  1 
ATOM   1427 C CG  . ARG A 1 192 ? 80.903  45.015 -53.094 1.00 48.11  ? 192 ARG A CG  1 
ATOM   1428 C CD  . ARG A 1 192 ? 81.265  46.374 -53.714 1.00 57.10  ? 192 ARG A CD  1 
ATOM   1429 N NE  . ARG A 1 192 ? 81.486  47.441 -52.729 1.00 64.67  ? 192 ARG A NE  1 
ATOM   1430 C CZ  . ARG A 1 192 ? 82.658  47.748 -52.160 1.00 67.97  ? 192 ARG A CZ  1 
ATOM   1431 N NH1 . ARG A 1 192 ? 83.766  47.064 -52.448 1.00 67.65  ? 192 ARG A NH1 1 
ATOM   1432 N NH2 . ARG A 1 192 ? 82.723  48.746 -51.281 1.00 67.77  ? 192 ARG A NH2 1 
ATOM   1433 N N   . ASP A 1 193 ? 83.243  42.741 -50.162 1.00 46.00  ? 193 ASP A N   1 
ATOM   1434 C CA  . ASP A 1 193 ? 83.717  41.448 -49.661 1.00 51.08  ? 193 ASP A CA  1 
ATOM   1435 C C   . ASP A 1 193 ? 83.432  41.202 -48.169 1.00 48.36  ? 193 ASP A C   1 
ATOM   1436 O O   . ASP A 1 193 ? 82.998  40.095 -47.770 1.00 43.35  ? 193 ASP A O   1 
ATOM   1437 C CB  . ASP A 1 193 ? 85.240  41.324 -49.865 1.00 61.77  ? 193 ASP A CB  1 
ATOM   1438 C CG  . ASP A 1 193 ? 85.661  41.301 -51.339 1.00 69.56  ? 193 ASP A CG  1 
ATOM   1439 O OD1 . ASP A 1 193 ? 84.843  41.659 -52.227 1.00 72.47  ? 193 ASP A OD1 1 
ATOM   1440 O OD2 . ASP A 1 193 ? 86.834  40.929 -51.589 1.00 70.19  ? 193 ASP A OD2 1 
ATOM   1441 N N   . MET A 1 194 ? 83.764  42.196 -47.344 1.00 43.35  ? 194 MET A N   1 
ATOM   1442 C CA  . MET A 1 194 ? 83.554  42.081 -45.909 1.00 43.62  ? 194 MET A CA  1 
ATOM   1443 C C   . MET A 1 194 ? 82.055  41.825 -45.631 1.00 42.18  ? 194 MET A C   1 
ATOM   1444 O O   . MET A 1 194 ? 81.685  40.838 -44.986 1.00 39.77  ? 194 MET A O   1 
ATOM   1445 C CB  . MET A 1 194 ? 84.069  43.342 -45.196 1.00 41.95  ? 194 MET A CB  1 
ATOM   1446 C CG  . MET A 1 194 ? 84.379  43.161 -43.688 1.00 38.56  ? 194 MET A CG  1 
ATOM   1447 S SD  . MET A 1 194 ? 84.944  44.709 -42.875 1.00 46.62  ? 194 MET A SD  1 
ATOM   1448 C CE  . MET A 1 194 ? 83.571  45.831 -43.208 1.00 30.04  ? 194 MET A CE  1 
ATOM   1449 N N   . LEU A 1 195 ? 81.207  42.680 -46.191 1.00 39.59  ? 195 LEU A N   1 
ATOM   1450 C CA  . LEU A 1 195 ? 79.759  42.562 -46.051 1.00 36.76  ? 195 LEU A CA  1 
ATOM   1451 C C   . LEU A 1 195 ? 79.309  41.188 -46.549 1.00 38.23  ? 195 LEU A C   1 
ATOM   1452 O O   . LEU A 1 195 ? 78.714  40.411 -45.791 1.00 39.72  ? 195 LEU A O   1 
ATOM   1453 C CB  . LEU A 1 195 ? 79.077  43.663 -46.856 1.00 34.39  ? 195 LEU A CB  1 
ATOM   1454 C CG  . LEU A 1 195 ? 79.393  45.084 -46.381 1.00 34.45  ? 195 LEU A CG  1 
ATOM   1455 C CD1 . LEU A 1 195 ? 78.855  46.068 -47.382 1.00 38.34  ? 195 LEU A CD1 1 
ATOM   1456 C CD2 . LEU A 1 195 ? 78.828  45.346 -44.983 1.00 33.78  ? 195 LEU A CD2 1 
ATOM   1457 N N   . MET A 1 196 ? 79.652  40.867 -47.797 1.00 36.56  ? 196 MET A N   1 
ATOM   1458 C CA  . MET A 1 196 ? 79.302  39.586 -48.390 1.00 34.60  ? 196 MET A CA  1 
ATOM   1459 C C   . MET A 1 196 ? 79.674  38.432 -47.482 1.00 33.32  ? 196 MET A C   1 
ATOM   1460 O O   . MET A 1 196 ? 78.980  37.424 -47.456 1.00 37.47  ? 196 MET A O   1 
ATOM   1461 C CB  . MET A 1 196 ? 79.999  39.394 -49.736 1.00 40.09  ? 196 MET A CB  1 
ATOM   1462 C CG  . MET A 1 196 ? 79.210  39.754 -50.991 1.00 50.52  ? 196 MET A CG  1 
ATOM   1463 S SD  . MET A 1 196 ? 80.230  39.518 -52.535 1.00 69.03  ? 196 MET A SD  1 
ATOM   1464 C CE  . MET A 1 196 ? 80.137  41.179 -53.358 1.00 62.02  ? 196 MET A CE  1 
ATOM   1465 N N   . GLU A 1 197 ? 80.758  38.552 -46.727 1.00 34.71  ? 197 GLU A N   1 
ATOM   1466 C CA  . GLU A 1 197 ? 81.151  37.442 -45.849 1.00 33.91  ? 197 GLU A CA  1 
ATOM   1467 C C   . GLU A 1 197 ? 80.418  37.483 -44.508 1.00 31.49  ? 197 GLU A C   1 
ATOM   1468 O O   . GLU A 1 197 ? 80.245  36.459 -43.843 1.00 29.01  ? 197 GLU A O   1 
ATOM   1469 C CB  . GLU A 1 197 ? 82.681  37.408 -45.666 1.00 33.03  ? 197 GLU A CB  1 
ATOM   1470 C CG  . GLU A 1 197 ? 83.232  36.102 -45.049 1.00 38.98  ? 197 GLU A CG  1 
ATOM   1471 C CD  . GLU A 1 197 ? 83.005  34.835 -45.903 1.00 43.43  ? 197 GLU A CD  1 
ATOM   1472 O OE1 . GLU A 1 197 ? 82.840  34.923 -47.143 1.00 45.17  ? 197 GLU A OE1 1 
ATOM   1473 O OE2 . GLU A 1 197 ? 82.986  33.730 -45.323 1.00 45.73  ? 197 GLU A OE2 1 
ATOM   1474 N N   . TYR A 1 198 ? 79.965  38.673 -44.130 1.00 34.23  ? 198 TYR A N   1 
ATOM   1475 C CA  . TYR A 1 198 ? 79.225  38.853 -42.884 1.00 36.87  ? 198 TYR A CA  1 
ATOM   1476 C C   . TYR A 1 198 ? 77.840  38.173 -43.001 1.00 37.42  ? 198 TYR A C   1 
ATOM   1477 O O   . TYR A 1 198 ? 77.355  37.529 -42.058 1.00 34.75  ? 198 TYR A O   1 
ATOM   1478 C CB  . TYR A 1 198 ? 79.074  40.339 -42.572 1.00 35.86  ? 198 TYR A CB  1 
ATOM   1479 C CG  . TYR A 1 198 ? 78.520  40.552 -41.199 1.00 37.50  ? 198 TYR A CG  1 
ATOM   1480 C CD1 . TYR A 1 198 ? 79.165  39.996 -40.085 1.00 32.27  ? 198 TYR A CD1 1 
ATOM   1481 C CD2 . TYR A 1 198 ? 77.282  41.203 -41.010 1.00 36.78  ? 198 TYR A CD2 1 
ATOM   1482 C CE1 . TYR A 1 198 ? 78.589  40.068 -38.810 1.00 35.66  ? 198 TYR A CE1 1 
ATOM   1483 C CE2 . TYR A 1 198 ? 76.688  41.272 -39.731 1.00 33.21  ? 198 TYR A CE2 1 
ATOM   1484 C CZ  . TYR A 1 198 ? 77.348  40.699 -38.646 1.00 35.07  ? 198 TYR A CZ  1 
ATOM   1485 O OH  . TYR A 1 198 ? 76.748  40.687 -37.414 1.00 33.06  ? 198 TYR A OH  1 
ATOM   1486 N N   . ILE A 1 199 ? 77.227  38.319 -44.177 1.00 38.61  ? 199 ILE A N   1 
ATOM   1487 C CA  . ILE A 1 199 ? 75.945  37.708 -44.487 1.00 38.65  ? 199 ILE A CA  1 
ATOM   1488 C C   . ILE A 1 199 ? 76.122  36.206 -44.341 1.00 42.84  ? 199 ILE A C   1 
ATOM   1489 O O   . ILE A 1 199 ? 75.233  35.507 -43.847 1.00 45.76  ? 199 ILE A O   1 
ATOM   1490 C CB  . ILE A 1 199 ? 75.525  38.002 -45.919 1.00 35.83  ? 199 ILE A CB  1 
ATOM   1491 C CG1 . ILE A 1 199 ? 75.466  39.512 -46.140 1.00 35.70  ? 199 ILE A CG1 1 
ATOM   1492 C CG2 . ILE A 1 199 ? 74.181  37.345 -46.216 1.00 36.92  ? 199 ILE A CG2 1 
ATOM   1493 C CD1 . ILE A 1 199 ? 74.891  39.924 -47.479 1.00 34.05  ? 199 ILE A CD1 1 
ATOM   1494 N N   . ASN A 1 200 ? 77.307  35.724 -44.721 1.00 46.53  ? 200 ASN A N   1 
ATOM   1495 C CA  . ASN A 1 200 ? 77.639  34.300 -44.633 1.00 47.07  ? 200 ASN A CA  1 
ATOM   1496 C C   . ASN A 1 200 ? 77.665  33.795 -43.214 1.00 44.25  ? 200 ASN A C   1 
ATOM   1497 O O   . ASN A 1 200 ? 77.213  32.681 -42.944 1.00 42.91  ? 200 ASN A O   1 
ATOM   1498 C CB  . ASN A 1 200 ? 78.986  34.028 -45.265 1.00 51.71  ? 200 ASN A CB  1 
ATOM   1499 C CG  . ASN A 1 200 ? 78.888  33.832 -46.739 1.00 57.25  ? 200 ASN A CG  1 
ATOM   1500 O OD1 . ASN A 1 200 ? 78.966  32.714 -47.228 1.00 61.21  ? 200 ASN A OD1 1 
ATOM   1501 N ND2 . ASN A 1 200 ? 78.697  34.920 -47.468 1.00 60.85  ? 200 ASN A ND2 1 
ATOM   1502 N N   . LEU A 1 201 ? 78.230  34.605 -42.319 1.00 43.00  ? 201 LEU A N   1 
ATOM   1503 C CA  . LEU A 1 201 ? 78.321  34.276 -40.897 1.00 39.44  ? 201 LEU A CA  1 
ATOM   1504 C C   . LEU A 1 201 ? 76.899  34.083 -40.363 1.00 39.12  ? 201 LEU A C   1 
ATOM   1505 O O   . LEU A 1 201 ? 76.639  33.176 -39.544 1.00 34.57  ? 201 LEU A O   1 
ATOM   1506 C CB  . LEU A 1 201 ? 79.019  35.416 -40.142 1.00 34.07  ? 201 LEU A CB  1 
ATOM   1507 C CG  . LEU A 1 201 ? 79.199  35.191 -38.643 1.00 33.92  ? 201 LEU A CG  1 
ATOM   1508 C CD1 . LEU A 1 201 ? 79.963  33.910 -38.396 1.00 38.07  ? 201 LEU A CD1 1 
ATOM   1509 C CD2 . LEU A 1 201 ? 79.906  36.356 -38.017 1.00 31.50  ? 201 LEU A CD2 1 
ATOM   1510 N N   . TRP A 1 202 ? 75.997  34.961 -40.824 1.00 40.01  ? 202 TRP A N   1 
ATOM   1511 C CA  . TRP A 1 202 ? 74.604  34.896 -40.422 1.00 39.80  ? 202 TRP A CA  1 
ATOM   1512 C C   . TRP A 1 202 ? 73.986  33.632 -40.981 1.00 38.70  ? 202 TRP A C   1 
ATOM   1513 O O   . TRP A 1 202 ? 73.435  32.848 -40.220 1.00 37.58  ? 202 TRP A O   1 
ATOM   1514 C CB  . TRP A 1 202 ? 73.835  36.166 -40.813 1.00 40.61  ? 202 TRP A CB  1 
ATOM   1515 C CG  . TRP A 1 202 ? 74.036  37.271 -39.781 1.00 48.04  ? 202 TRP A CG  1 
ATOM   1516 C CD1 . TRP A 1 202 ? 75.223  37.866 -39.449 1.00 50.44  ? 202 TRP A CD1 1 
ATOM   1517 C CD2 . TRP A 1 202 ? 73.049  37.841 -38.880 1.00 50.32  ? 202 TRP A CD2 1 
ATOM   1518 N NE1 . TRP A 1 202 ? 75.046  38.747 -38.401 1.00 51.43  ? 202 TRP A NE1 1 
ATOM   1519 C CE2 . TRP A 1 202 ? 73.715  38.754 -38.037 1.00 47.95  ? 202 TRP A CE2 1 
ATOM   1520 C CE3 . TRP A 1 202 ? 71.657  37.662 -38.708 1.00 49.35  ? 202 TRP A CE3 1 
ATOM   1521 C CZ2 . TRP A 1 202 ? 73.057  39.491 -37.042 1.00 42.82  ? 202 TRP A CZ2 1 
ATOM   1522 C CZ3 . TRP A 1 202 ? 71.000  38.407 -37.704 1.00 39.67  ? 202 TRP A CZ3 1 
ATOM   1523 C CH2 . TRP A 1 202 ? 71.703  39.300 -36.898 1.00 37.69  ? 202 TRP A CH2 1 
ATOM   1524 N N   . GLU A 1 203 ? 74.210  33.350 -42.265 1.00 39.33  ? 203 GLU A N   1 
ATOM   1525 C CA  . GLU A 1 203 ? 73.644  32.152 -42.886 1.00 38.72  ? 203 GLU A CA  1 
ATOM   1526 C C   . GLU A 1 203 ? 74.028  30.808 -42.292 1.00 39.71  ? 203 GLU A C   1 
ATOM   1527 O O   . GLU A 1 203 ? 73.170  29.952 -42.096 1.00 41.74  ? 203 GLU A O   1 
ATOM   1528 C CB  . GLU A 1 203 ? 73.863  32.152 -44.387 1.00 35.46  ? 203 GLU A CB  1 
ATOM   1529 C CG  . GLU A 1 203 ? 73.029  33.204 -45.053 1.00 40.47  ? 203 GLU A CG  1 
ATOM   1530 C CD  . GLU A 1 203 ? 73.153  33.229 -46.559 1.00 42.76  ? 203 GLU A CD  1 
ATOM   1531 O OE1 . GLU A 1 203 ? 74.260  32.908 -47.079 1.00 44.58  ? 203 GLU A OE1 1 
ATOM   1532 O OE2 . GLU A 1 203 ? 72.139  33.601 -47.213 1.00 35.69  ? 203 GLU A OE2 1 
ATOM   1533 N N   . GLN A 1 204 ? 75.301  30.613 -41.976 1.00 41.16  ? 204 GLN A N   1 
ATOM   1534 C CA  . GLN A 1 204 ? 75.687  29.331 -41.424 1.00 41.50  ? 204 GLN A CA  1 
ATOM   1535 C C   . GLN A 1 204 ? 75.602  29.280 -39.913 1.00 39.91  ? 204 GLN A C   1 
ATOM   1536 O O   . GLN A 1 204 ? 75.554  28.192 -39.314 1.00 39.55  ? 204 GLN A O   1 
ATOM   1537 C CB  . GLN A 1 204 ? 77.060  28.893 -41.948 1.00 46.39  ? 204 GLN A CB  1 
ATOM   1538 C CG  . GLN A 1 204 ? 77.069  28.574 -43.458 1.00 56.01  ? 204 GLN A CG  1 
ATOM   1539 C CD  . GLN A 1 204 ? 75.867  27.710 -43.937 1.00 61.41  ? 204 GLN A CD  1 
ATOM   1540 O OE1 . GLN A 1 204 ? 75.448  26.763 -43.262 1.00 65.15  ? 204 GLN A OE1 1 
ATOM   1541 N NE2 . GLN A 1 204 ? 75.328  28.040 -45.115 1.00 59.30  ? 204 GLN A NE2 1 
ATOM   1542 N N   . LYS A 1 205 ? 75.535  30.451 -39.293 1.00 38.60  ? 205 LYS A N   1 
ATOM   1543 C CA  . LYS A 1 205 ? 75.444  30.518 -37.847 1.00 38.84  ? 205 LYS A CA  1 
ATOM   1544 C C   . LYS A 1 205 ? 74.382  31.516 -37.462 1.00 37.50  ? 205 LYS A C   1 
ATOM   1545 O O   . LYS A 1 205 ? 74.659  32.550 -36.860 1.00 39.03  ? 205 LYS A O   1 
ATOM   1546 C CB  . LYS A 1 205 ? 76.807  30.856 -37.246 1.00 44.95  ? 205 LYS A CB  1 
ATOM   1547 C CG  . LYS A 1 205 ? 77.795  29.698 -37.364 1.00 50.49  ? 205 LYS A CG  1 
ATOM   1548 C CD  . LYS A 1 205 ? 79.171  30.011 -36.821 1.00 54.38  ? 205 LYS A CD  1 
ATOM   1549 C CE  . LYS A 1 205 ? 80.102  28.810 -37.004 1.00 54.28  ? 205 LYS A CE  1 
ATOM   1550 N NZ  . LYS A 1 205 ? 80.548  28.664 -38.405 1.00 60.85  ? 205 LYS A NZ  1 
ATOM   1551 N N   . ARG A 1 206 ? 73.145  31.152 -37.773 1.00 36.42  ? 206 ARG A N   1 
ATOM   1552 C CA  . ARG A 1 206 ? 71.996  32.006 -37.514 1.00 35.38  ? 206 ARG A CA  1 
ATOM   1553 C C   . ARG A 1 206 ? 71.578  32.055 -36.071 1.00 29.43  ? 206 ARG A C   1 
ATOM   1554 O O   . ARG A 1 206 ? 71.191  31.035 -35.471 1.00 29.88  ? 206 ARG A O   1 
ATOM   1555 C CB  . ARG A 1 206 ? 70.811  31.645 -38.403 1.00 36.09  ? 206 ARG A CB  1 
ATOM   1556 C CG  . ARG A 1 206 ? 69.778  32.737 -38.451 1.00 34.16  ? 206 ARG A CG  1 
ATOM   1557 C CD  . ARG A 1 206 ? 69.066  32.632 -39.723 1.00 33.79  ? 206 ARG A CD  1 
ATOM   1558 N NE  . ARG A 1 206 ? 69.633  33.506 -40.732 1.00 30.48  ? 206 ARG A NE  1 
ATOM   1559 C CZ  . ARG A 1 206 ? 69.806  33.160 -42.001 1.00 31.09  ? 206 ARG A CZ  1 
ATOM   1560 N NH1 . ARG A 1 206 ? 69.553  31.915 -42.398 1.00 33.26  ? 206 ARG A NH1 1 
ATOM   1561 N NH2 . ARG A 1 206 ? 70.299  34.047 -42.858 1.00 30.53  ? 206 ARG A NH2 1 
ATOM   1562 N N   . PRO A 1 207 ? 71.612  33.274 -35.516 1.00 26.00  ? 207 PRO A N   1 
ATOM   1563 C CA  . PRO A 1 207 ? 71.263  33.562 -34.128 1.00 28.90  ? 207 PRO A CA  1 
ATOM   1564 C C   . PRO A 1 207 ? 69.804  33.465 -33.790 1.00 28.88  ? 207 PRO A C   1 
ATOM   1565 O O   . PRO A 1 207 ? 68.951  33.957 -34.523 1.00 32.61  ? 207 PRO A O   1 
ATOM   1566 C CB  . PRO A 1 207 ? 71.816  34.984 -33.918 1.00 28.09  ? 207 PRO A CB  1 
ATOM   1567 C CG  . PRO A 1 207 ? 71.698  35.597 -35.258 1.00 27.40  ? 207 PRO A CG  1 
ATOM   1568 C CD  . PRO A 1 207 ? 72.061  34.493 -36.221 1.00 24.78  ? 207 PRO A CD  1 
ATOM   1569 N N   . ALA A 1 208 ? 69.537  32.780 -32.687 1.00 29.93  ? 208 ALA A N   1 
ATOM   1570 C CA  . ALA A 1 208 ? 68.192  32.623 -32.141 1.00 30.76  ? 208 ALA A CA  1 
ATOM   1571 C C   . ALA A 1 208 ? 67.842  34.024 -31.606 1.00 29.87  ? 208 ALA A C   1 
ATOM   1572 O O   . ALA A 1 208 ? 66.828  34.602 -32.000 1.00 25.29  ? 208 ALA A O   1 
ATOM   1573 C CB  . ALA A 1 208 ? 68.228  31.612 -30.995 1.00 34.77  ? 208 ALA A CB  1 
ATOM   1574 N N   . ILE A 1 209 ? 68.733  34.556 -30.747 1.00 29.45  ? 209 ILE A N   1 
ATOM   1575 C CA  . ILE A 1 209 ? 68.631  35.907 -30.154 1.00 25.67  ? 209 ILE A CA  1 
ATOM   1576 C C   . ILE A 1 209 ? 69.918  36.684 -30.532 1.00 25.64  ? 209 ILE A C   1 
ATOM   1577 O O   . ILE A 1 209 ? 71.025  36.198 -30.366 1.00 22.11  ? 209 ILE A O   1 
ATOM   1578 C CB  . ILE A 1 209 ? 68.564  35.917 -28.579 1.00 23.01  ? 209 ILE A CB  1 
ATOM   1579 C CG1 . ILE A 1 209 ? 67.325  35.195 -28.035 1.00 17.52  ? 209 ILE A CG1 1 
ATOM   1580 C CG2 . ILE A 1 209 ? 68.663  37.342 -28.045 1.00 12.21  ? 209 ILE A CG2 1 
ATOM   1581 C CD1 . ILE A 1 209 ? 67.453  34.799 -26.539 1.00 17.60  ? 209 ILE A CD1 1 
ATOM   1582 N N   . PHE A 1 210 ? 69.733  37.908 -31.007 1.00 26.11  ? 210 PHE A N   1 
ATOM   1583 C CA  . PHE A 1 210 ? 70.803  38.806 -31.370 1.00 26.25  ? 210 PHE A CA  1 
ATOM   1584 C C   . PHE A 1 210 ? 70.805  40.071 -30.455 1.00 25.21  ? 210 PHE A C   1 
ATOM   1585 O O   . PHE A 1 210 ? 69.811  40.793 -30.390 1.00 25.67  ? 210 PHE A O   1 
ATOM   1586 C CB  . PHE A 1 210 ? 70.615  39.196 -32.819 1.00 25.29  ? 210 PHE A CB  1 
ATOM   1587 C CG  . PHE A 1 210 ? 71.784  39.896 -33.399 1.00 34.15  ? 210 PHE A CG  1 
ATOM   1588 C CD1 . PHE A 1 210 ? 72.989  39.214 -33.593 1.00 32.71  ? 210 PHE A CD1 1 
ATOM   1589 C CD2 . PHE A 1 210 ? 71.699  41.241 -33.746 1.00 35.40  ? 210 PHE A CD2 1 
ATOM   1590 C CE1 . PHE A 1 210 ? 74.091  39.861 -34.128 1.00 34.40  ? 210 PHE A CE1 1 
ATOM   1591 C CE2 . PHE A 1 210 ? 72.800  41.908 -34.287 1.00 39.05  ? 210 PHE A CE2 1 
ATOM   1592 C CZ  . PHE A 1 210 ? 74.001  41.219 -34.478 1.00 38.56  ? 210 PHE A CZ  1 
ATOM   1593 N N   . THR A 1 211 ? 71.868  40.276 -29.674 1.00 25.31  ? 211 THR A N   1 
ATOM   1594 C CA  . THR A 1 211 ? 71.961  41.455 -28.806 1.00 23.56  ? 211 THR A CA  1 
ATOM   1595 C C   . THR A 1 211 ? 73.040  42.415 -29.281 1.00 22.61  ? 211 THR A C   1 
ATOM   1596 O O   . THR A 1 211 ? 73.554  42.306 -30.411 1.00 18.71  ? 211 THR A O   1 
ATOM   1597 C CB  . THR A 1 211 ? 72.384  41.138 -27.366 1.00 28.14  ? 211 THR A CB  1 
ATOM   1598 O OG1 . THR A 1 211 ? 72.642  39.747 -27.208 1.00 33.83  ? 211 THR A OG1 1 
ATOM   1599 C CG2 . THR A 1 211 ? 71.391  41.635 -26.395 1.00 30.25  ? 211 THR A CG2 1 
ATOM   1600 N N   . GLY A 1 212 ? 73.446  43.294 -28.365 1.00 21.45  ? 212 GLY A N   1 
ATOM   1601 C CA  . GLY A 1 212 ? 74.458  44.282 -28.647 1.00 23.54  ? 212 GLY A CA  1 
ATOM   1602 C C   . GLY A 1 212 ? 74.116  45.439 -27.746 1.00 23.69  ? 212 GLY A C   1 
ATOM   1603 O O   . GLY A 1 212 ? 73.548  45.225 -26.677 1.00 26.72  ? 212 GLY A O   1 
ATOM   1604 N N   . TRP A 1 213 ? 74.465  46.657 -28.129 1.00 23.42  ? 213 TRP A N   1 
ATOM   1605 C CA  . TRP A 1 213 ? 74.139  47.817 -27.306 1.00 27.07  ? 213 TRP A CA  1 
ATOM   1606 C C   . TRP A 1 213 ? 73.808  48.852 -28.334 1.00 29.95  ? 213 TRP A C   1 
ATOM   1607 O O   . TRP A 1 213 ? 74.706  49.340 -29.051 1.00 28.72  ? 213 TRP A O   1 
ATOM   1608 C CB  . TRP A 1 213 ? 75.325  48.274 -26.475 1.00 28.33  ? 213 TRP A CB  1 
ATOM   1609 C CG  . TRP A 1 213 ? 74.921  49.019 -25.284 1.00 24.61  ? 213 TRP A CG  1 
ATOM   1610 C CD1 . TRP A 1 213 ? 74.825  50.387 -25.140 1.00 20.76  ? 213 TRP A CD1 1 
ATOM   1611 C CD2 . TRP A 1 213 ? 74.580  48.454 -24.032 1.00 21.79  ? 213 TRP A CD2 1 
ATOM   1612 N NE1 . TRP A 1 213 ? 74.457  50.690 -23.862 1.00 21.34  ? 213 TRP A NE1 1 
ATOM   1613 C CE2 . TRP A 1 213 ? 74.292  49.522 -23.158 1.00 19.73  ? 213 TRP A CE2 1 
ATOM   1614 C CE3 . TRP A 1 213 ? 74.486  47.136 -23.559 1.00 27.18  ? 213 TRP A CE3 1 
ATOM   1615 C CZ2 . TRP A 1 213 ? 73.912  49.318 -21.834 1.00 22.41  ? 213 TRP A CZ2 1 
ATOM   1616 C CZ3 . TRP A 1 213 ? 74.109  46.928 -22.231 1.00 25.09  ? 213 TRP A CZ3 1 
ATOM   1617 C CH2 . TRP A 1 213 ? 73.827  48.014 -21.388 1.00 25.90  ? 213 TRP A CH2 1 
ATOM   1618 N N   . ASN A 1 214 ? 72.512  49.169 -28.380 1.00 24.79  ? 214 ASN A N   1 
ATOM   1619 C CA  . ASN A 1 214 ? 71.899  50.075 -29.340 1.00 23.95  ? 214 ASN A CA  1 
ATOM   1620 C C   . ASN A 1 214 ? 71.989  49.515 -30.778 1.00 24.95  ? 214 ASN A C   1 
ATOM   1621 O O   . ASN A 1 214 ? 71.901  50.224 -31.785 1.00 25.74  ? 214 ASN A O   1 
ATOM   1622 C CB  . ASN A 1 214 ? 72.386  51.515 -29.216 1.00 27.67  ? 214 ASN A CB  1 
ATOM   1623 C CG  . ASN A 1 214 ? 71.643  52.439 -30.136 1.00 31.88  ? 214 ASN A CG  1 
ATOM   1624 O OD1 . ASN A 1 214 ? 72.254  53.122 -30.955 1.00 40.64  ? 214 ASN A OD1 1 
ATOM   1625 N ND2 . ASN A 1 214 ? 70.303  52.398 -30.080 1.00 29.74  ? 214 ASN A ND2 1 
ATOM   1626 N N   . ILE A 1 215 ? 72.103  48.200 -30.859 1.00 24.25  ? 215 ILE A N   1 
ATOM   1627 C CA  . ILE A 1 215 ? 72.138  47.542 -32.142 1.00 26.05  ? 215 ILE A CA  1 
ATOM   1628 C C   . ILE A 1 215 ? 70.882  47.934 -32.892 1.00 28.40  ? 215 ILE A C   1 
ATOM   1629 O O   . ILE A 1 215 ? 70.909  48.161 -34.088 1.00 34.14  ? 215 ILE A O   1 
ATOM   1630 C CB  . ILE A 1 215 ? 72.129  45.994 -32.001 1.00 24.07  ? 215 ILE A CB  1 
ATOM   1631 C CG1 . ILE A 1 215 ? 71.326  45.570 -30.775 1.00 22.29  ? 215 ILE A CG1 1 
ATOM   1632 C CG2 . ILE A 1 215 ? 73.525  45.457 -31.928 1.00 24.35  ? 215 ILE A CG2 1 
ATOM   1633 C CD1 . ILE A 1 215 ? 70.825  44.178 -30.871 1.00 19.31  ? 215 ILE A CD1 1 
ATOM   1634 N N   . GLU A 1 216 ? 69.771  48.034 -32.185 1.00 33.42  ? 216 GLU A N   1 
ATOM   1635 C CA  . GLU A 1 216 ? 68.500  48.353 -32.837 1.00 36.21  ? 216 GLU A CA  1 
ATOM   1636 C C   . GLU A 1 216 ? 68.503  49.764 -33.402 1.00 32.37  ? 216 GLU A C   1 
ATOM   1637 O O   . GLU A 1 216 ? 68.065  49.996 -34.529 1.00 28.15  ? 216 GLU A O   1 
ATOM   1638 C CB  . GLU A 1 216 ? 67.354  48.127 -31.849 1.00 41.87  ? 216 GLU A CB  1 
ATOM   1639 C CG  . GLU A 1 216 ? 65.939  48.232 -32.398 1.00 44.45  ? 216 GLU A CG  1 
ATOM   1640 C CD  . GLU A 1 216 ? 64.946  48.220 -31.267 1.00 45.51  ? 216 GLU A CD  1 
ATOM   1641 O OE1 . GLU A 1 216 ? 64.713  47.126 -30.721 1.00 53.91  ? 216 GLU A OE1 1 
ATOM   1642 O OE2 . GLU A 1 216 ? 64.458  49.301 -30.875 1.00 40.58  ? 216 GLU A OE2 1 
ATOM   1643 N N   . GLY A 1 217 ? 69.109  50.669 -32.636 1.00 37.18  ? 217 GLY A N   1 
ATOM   1644 C CA  . GLY A 1 217 ? 69.215  52.060 -33.033 1.00 33.71  ? 217 GLY A CA  1 
ATOM   1645 C C   . GLY A 1 217 ? 70.298  52.350 -34.054 1.00 34.28  ? 217 GLY A C   1 
ATOM   1646 O O   . GLY A 1 217 ? 70.082  53.160 -34.967 1.00 35.26  ? 217 GLY A O   1 
ATOM   1647 N N   . PHE A 1 218 ? 71.455  51.697 -33.936 1.00 31.32  ? 218 PHE A N   1 
ATOM   1648 C CA  . PHE A 1 218 ? 72.520  51.973 -34.883 1.00 26.03  ? 218 PHE A CA  1 
ATOM   1649 C C   . PHE A 1 218 ? 72.991  50.832 -35.776 1.00 23.14  ? 218 PHE A C   1 
ATOM   1650 O O   . PHE A 1 218 ? 72.823  50.867 -36.997 1.00 21.60  ? 218 PHE A O   1 
ATOM   1651 C CB  . PHE A 1 218 ? 73.722  52.636 -34.172 1.00 27.18  ? 218 PHE A CB  1 
ATOM   1652 C CG  . PHE A 1 218 ? 74.861  52.968 -35.110 1.00 32.16  ? 218 PHE A CG  1 
ATOM   1653 C CD1 . PHE A 1 218 ? 74.785  54.095 -35.937 1.00 32.45  ? 218 PHE A CD1 1 
ATOM   1654 C CD2 . PHE A 1 218 ? 75.924  52.070 -35.295 1.00 29.51  ? 218 PHE A CD2 1 
ATOM   1655 C CE1 . PHE A 1 218 ? 75.740  54.316 -36.949 1.00 34.13  ? 218 PHE A CE1 1 
ATOM   1656 C CE2 . PHE A 1 218 ? 76.880  52.275 -36.295 1.00 31.18  ? 218 PHE A CE2 1 
ATOM   1657 C CZ  . PHE A 1 218 ? 76.788  53.399 -37.132 1.00 36.57  ? 218 PHE A CZ  1 
ATOM   1658 N N   . ASP A 1 219 ? 73.606  49.837 -35.159 1.00 26.64  ? 219 ASP A N   1 
ATOM   1659 C CA  . ASP A 1 219 ? 74.195  48.705 -35.869 1.00 31.40  ? 219 ASP A CA  1 
ATOM   1660 C C   . ASP A 1 219 ? 73.336  47.968 -36.890 1.00 32.17  ? 219 ASP A C   1 
ATOM   1661 O O   . ASP A 1 219 ? 73.698  47.892 -38.069 1.00 30.42  ? 219 ASP A O   1 
ATOM   1662 C CB  . ASP A 1 219 ? 74.784  47.711 -34.866 1.00 34.37  ? 219 ASP A CB  1 
ATOM   1663 C CG  . ASP A 1 219 ? 75.649  48.389 -33.823 1.00 39.37  ? 219 ASP A CG  1 
ATOM   1664 O OD1 . ASP A 1 219 ? 76.824  48.685 -34.138 1.00 41.90  ? 219 ASP A OD1 1 
ATOM   1665 O OD2 . ASP A 1 219 ? 75.154  48.639 -32.692 1.00 37.60  ? 219 ASP A OD2 1 
ATOM   1666 N N   . VAL A 1 220 ? 72.272  47.330 -36.405 1.00 33.59  ? 220 VAL A N   1 
ATOM   1667 C CA  . VAL A 1 220 ? 71.342  46.581 -37.246 1.00 30.86  ? 220 VAL A CA  1 
ATOM   1668 C C   . VAL A 1 220 ? 70.882  47.410 -38.450 1.00 30.13  ? 220 VAL A C   1 
ATOM   1669 O O   . VAL A 1 220 ? 71.165  47.032 -39.600 1.00 34.09  ? 220 VAL A O   1 
ATOM   1670 C CB  . VAL A 1 220 ? 70.137  46.044 -36.418 1.00 31.95  ? 220 VAL A CB  1 
ATOM   1671 C CG1 . VAL A 1 220 ? 69.091  45.391 -37.337 1.00 31.44  ? 220 VAL A CG1 1 
ATOM   1672 C CG2 . VAL A 1 220 ? 70.628  45.036 -35.391 1.00 26.36  ? 220 VAL A CG2 1 
ATOM   1673 N N   . PRO A 1 221 ? 70.206  48.561 -38.223 1.00 24.59  ? 221 PRO A N   1 
ATOM   1674 C CA  . PRO A 1 221 ? 69.783  49.334 -39.399 1.00 24.60  ? 221 PRO A CA  1 
ATOM   1675 C C   . PRO A 1 221 ? 70.951  49.758 -40.327 1.00 28.81  ? 221 PRO A C   1 
ATOM   1676 O O   . PRO A 1 221 ? 70.867  49.649 -41.558 1.00 26.24  ? 221 PRO A O   1 
ATOM   1677 C CB  . PRO A 1 221 ? 69.048  50.538 -38.792 1.00 17.18  ? 221 PRO A CB  1 
ATOM   1678 C CG  . PRO A 1 221 ? 69.514  50.605 -37.388 1.00 14.96  ? 221 PRO A CG  1 
ATOM   1679 C CD  . PRO A 1 221 ? 69.698  49.175 -36.983 1.00 17.07  ? 221 PRO A CD  1 
ATOM   1680 N N   . TYR A 1 222 ? 72.063  50.197 -39.750 1.00 34.66  ? 222 TYR A N   1 
ATOM   1681 C CA  . TYR A 1 222 ? 73.196  50.604 -40.587 1.00 40.39  ? 222 TYR A CA  1 
ATOM   1682 C C   . TYR A 1 222 ? 73.771  49.416 -41.366 1.00 38.58  ? 222 TYR A C   1 
ATOM   1683 O O   . TYR A 1 222 ? 74.226  49.569 -42.502 1.00 41.72  ? 222 TYR A O   1 
ATOM   1684 C CB  . TYR A 1 222 ? 74.289  51.278 -39.753 1.00 43.03  ? 222 TYR A CB  1 
ATOM   1685 C CG  . TYR A 1 222 ? 75.230  52.130 -40.582 1.00 44.04  ? 222 TYR A CG  1 
ATOM   1686 C CD1 . TYR A 1 222 ? 76.071  51.551 -41.554 1.00 44.15  ? 222 TYR A CD1 1 
ATOM   1687 C CD2 . TYR A 1 222 ? 75.275  53.513 -40.404 1.00 42.83  ? 222 TYR A CD2 1 
ATOM   1688 C CE1 . TYR A 1 222 ? 76.936  52.342 -42.339 1.00 43.51  ? 222 TYR A CE1 1 
ATOM   1689 C CE2 . TYR A 1 222 ? 76.130  54.312 -41.178 1.00 45.06  ? 222 TYR A CE2 1 
ATOM   1690 C CZ  . TYR A 1 222 ? 76.955  53.720 -42.150 1.00 42.80  ? 222 TYR A CZ  1 
ATOM   1691 O OH  . TYR A 1 222 ? 77.737  54.511 -42.959 1.00 36.34  ? 222 TYR A OH  1 
ATOM   1692 N N   . ILE A 1 223 ? 73.737  48.229 -40.777 1.00 35.16  ? 223 ILE A N   1 
ATOM   1693 C CA  . ILE A 1 223 ? 74.239  47.081 -41.504 1.00 33.64  ? 223 ILE A CA  1 
ATOM   1694 C C   . ILE A 1 223 ? 73.242  46.730 -42.597 1.00 35.38  ? 223 ILE A C   1 
ATOM   1695 O O   . ILE A 1 223 ? 73.634  46.497 -43.731 1.00 38.81  ? 223 ILE A O   1 
ATOM   1696 C CB  . ILE A 1 223 ? 74.498  45.877 -40.597 1.00 31.24  ? 223 ILE A CB  1 
ATOM   1697 C CG1 . ILE A 1 223 ? 75.618  46.209 -39.606 1.00 31.82  ? 223 ILE A CG1 1 
ATOM   1698 C CG2 . ILE A 1 223 ? 74.916  44.688 -41.417 1.00 32.19  ? 223 ILE A CG2 1 
ATOM   1699 C CD1 . ILE A 1 223 ? 76.007  45.078 -38.719 1.00 23.68  ? 223 ILE A CD1 1 
ATOM   1700 N N   . MET A 1 224 ? 71.946  46.799 -42.303 1.00 36.95  ? 224 MET A N   1 
ATOM   1701 C CA  . MET A 1 224 ? 70.959  46.460 -43.326 1.00 37.18  ? 224 MET A CA  1 
ATOM   1702 C C   . MET A 1 224 ? 70.980  47.471 -44.462 1.00 39.02  ? 224 MET A C   1 
ATOM   1703 O O   . MET A 1 224 ? 70.937  47.112 -45.640 1.00 36.47  ? 224 MET A O   1 
ATOM   1704 C CB  . MET A 1 224 ? 69.549  46.367 -42.750 1.00 33.47  ? 224 MET A CB  1 
ATOM   1705 C CG  . MET A 1 224 ? 69.404  45.418 -41.570 1.00 34.41  ? 224 MET A CG  1 
ATOM   1706 S SD  . MET A 1 224 ? 70.268  43.845 -41.666 1.00 39.16  ? 224 MET A SD  1 
ATOM   1707 C CE  . MET A 1 224 ? 69.698  43.302 -43.132 1.00 36.78  ? 224 MET A CE  1 
ATOM   1708 N N   . ASN A 1 225 ? 71.086  48.741 -44.095 1.00 44.45  ? 225 ASN A N   1 
ATOM   1709 C CA  . ASN A 1 225 ? 71.122  49.832 -45.067 1.00 47.10  ? 225 ASN A CA  1 
ATOM   1710 C C   . ASN A 1 225 ? 72.403  49.864 -45.917 1.00 48.68  ? 225 ASN A C   1 
ATOM   1711 O O   . ASN A 1 225 ? 72.361  50.255 -47.094 1.00 50.68  ? 225 ASN A O   1 
ATOM   1712 C CB  . ASN A 1 225 ? 70.916  51.175 -44.373 1.00 47.93  ? 225 ASN A CB  1 
ATOM   1713 C CG  . ASN A 1 225 ? 69.502  51.367 -43.875 1.00 48.42  ? 225 ASN A CG  1 
ATOM   1714 O OD1 . ASN A 1 225 ? 69.293  51.767 -42.737 1.00 49.76  ? 225 ASN A OD1 1 
ATOM   1715 N ND2 . ASN A 1 225 ? 68.521  51.104 -44.736 1.00 46.76  ? 225 ASN A ND2 1 
ATOM   1716 N N   . ARG A 1 226 ? 73.542  49.474 -45.346 1.00 45.54  ? 226 ARG A N   1 
ATOM   1717 C CA  . ARG A 1 226 ? 74.765  49.471 -46.139 1.00 42.35  ? 226 ARG A CA  1 
ATOM   1718 C C   . ARG A 1 226 ? 74.768  48.225 -47.030 1.00 38.02  ? 226 ARG A C   1 
ATOM   1719 O O   . ARG A 1 226 ? 75.081  48.311 -48.210 1.00 35.59  ? 226 ARG A O   1 
ATOM   1720 C CB  . ARG A 1 226 ? 76.023  49.556 -45.268 1.00 41.92  ? 226 ARG A CB  1 
ATOM   1721 C CG  . ARG A 1 226 ? 77.231  50.084 -46.028 1.00 43.75  ? 226 ARG A CG  1 
ATOM   1722 C CD  . ARG A 1 226 ? 77.539  51.539 -45.727 1.00 44.55  ? 226 ARG A CD  1 
ATOM   1723 N NE  . ARG A 1 226 ? 77.502  52.426 -46.899 1.00 48.54  ? 226 ARG A NE  1 
ATOM   1724 C CZ  . ARG A 1 226 ? 78.449  52.532 -47.841 1.00 48.88  ? 226 ARG A CZ  1 
ATOM   1725 N NH1 . ARG A 1 226 ? 79.516  51.754 -47.834 1.00 47.26  ? 226 ARG A NH1 1 
ATOM   1726 N NH2 . ARG A 1 226 ? 78.295  53.392 -48.842 1.00 50.87  ? 226 ARG A NH2 1 
ATOM   1727 N N   . VAL A 1 227 ? 74.377  47.076 -46.492 1.00 34.91  ? 227 VAL A N   1 
ATOM   1728 C CA  . VAL A 1 227 ? 74.334  45.877 -47.317 1.00 34.88  ? 227 VAL A CA  1 
ATOM   1729 C C   . VAL A 1 227 ? 73.380  46.190 -48.455 1.00 37.98  ? 227 VAL A C   1 
ATOM   1730 O O   . VAL A 1 227 ? 73.751  46.170 -49.629 1.00 39.28  ? 227 VAL A O   1 
ATOM   1731 C CB  . VAL A 1 227 ? 73.848  44.630 -46.526 1.00 35.32  ? 227 VAL A CB  1 
ATOM   1732 C CG1 . VAL A 1 227 ? 73.395  43.521 -47.471 1.00 33.35  ? 227 VAL A CG1 1 
ATOM   1733 C CG2 . VAL A 1 227 ? 74.987  44.089 -45.668 1.00 35.83  ? 227 VAL A CG2 1 
ATOM   1734 N N   . LYS A 1 228 ? 72.174  46.593 -48.098 1.00 40.21  ? 228 LYS A N   1 
ATOM   1735 C CA  . LYS A 1 228 ? 71.160  46.930 -49.097 1.00 45.80  ? 228 LYS A CA  1 
ATOM   1736 C C   . LYS A 1 228 ? 71.708  47.906 -50.180 1.00 48.73  ? 228 LYS A C   1 
ATOM   1737 O O   . LYS A 1 228 ? 71.613  47.658 -51.387 1.00 46.70  ? 228 LYS A O   1 
ATOM   1738 C CB  . LYS A 1 228 ? 69.944  47.515 -48.367 1.00 41.84  ? 228 LYS A CB  1 
ATOM   1739 C CG  . LYS A 1 228 ? 68.744  47.793 -49.190 1.00 35.61  ? 228 LYS A CG  1 
ATOM   1740 C CD  . LYS A 1 228 ? 67.928  48.778 -48.441 1.00 35.53  ? 228 LYS A CD  1 
ATOM   1741 C CE  . LYS A 1 228 ? 66.653  49.062 -49.168 1.00 44.66  ? 228 LYS A CE  1 
ATOM   1742 N NZ  . LYS A 1 228 ? 65.606  48.007 -48.985 1.00 49.97  ? 228 LYS A NZ  1 
ATOM   1743 N N   . MET A 1 229 ? 72.354  48.973 -49.736 1.00 50.87  ? 229 MET A N   1 
ATOM   1744 C CA  . MET A 1 229 ? 72.901  49.971 -50.641 1.00 52.35  ? 229 MET A CA  1 
ATOM   1745 C C   . MET A 1 229 ? 74.069  49.496 -51.484 1.00 51.78  ? 229 MET A C   1 
ATOM   1746 O O   . MET A 1 229 ? 74.240  49.943 -52.620 1.00 53.63  ? 229 MET A O   1 
ATOM   1747 C CB  . MET A 1 229 ? 73.324  51.187 -49.826 1.00 56.47  ? 229 MET A CB  1 
ATOM   1748 C CG  . MET A 1 229 ? 74.085  52.244 -50.574 1.00 60.67  ? 229 MET A CG  1 
ATOM   1749 S SD  . MET A 1 229 ? 74.392  53.554 -49.406 1.00 69.49  ? 229 MET A SD  1 
ATOM   1750 C CE  . MET A 1 229 ? 74.648  54.915 -50.506 1.00 72.45  ? 229 MET A CE  1 
ATOM   1751 N N   . ILE A 1 230 ? 74.854  48.582 -50.927 1.00 50.89  ? 230 ILE A N   1 
ATOM   1752 C CA  . ILE A 1 230 ? 76.049  48.053 -51.574 1.00 47.67  ? 230 ILE A CA  1 
ATOM   1753 C C   . ILE A 1 230 ? 75.804  46.750 -52.326 1.00 50.76  ? 230 ILE A C   1 
ATOM   1754 O O   . ILE A 1 230 ? 76.187  46.605 -53.499 1.00 52.32  ? 230 ILE A O   1 
ATOM   1755 C CB  . ILE A 1 230 ? 77.177  47.886 -50.522 1.00 42.89  ? 230 ILE A CB  1 
ATOM   1756 C CG1 . ILE A 1 230 ? 77.655  49.260 -50.062 1.00 37.83  ? 230 ILE A CG1 1 
ATOM   1757 C CG2 . ILE A 1 230 ? 78.318  47.054 -51.055 1.00 42.46  ? 230 ILE A CG2 1 
ATOM   1758 C CD1 . ILE A 1 230 ? 78.327  50.083 -51.147 1.00 35.34  ? 230 ILE A CD1 1 
ATOM   1759 N N   . LEU A 1 231 ? 75.234  45.779 -51.627 1.00 52.30  ? 231 LEU A N   1 
ATOM   1760 C CA  . LEU A 1 231 ? 74.920  44.489 -52.224 1.00 54.18  ? 231 LEU A CA  1 
ATOM   1761 C C   . LEU A 1 231 ? 73.477  44.461 -52.750 1.00 57.18  ? 231 LEU A C   1 
ATOM   1762 O O   . LEU A 1 231 ? 73.083  43.515 -53.434 1.00 59.79  ? 231 LEU A O   1 
ATOM   1763 C CB  . LEU A 1 231 ? 75.126  43.354 -51.209 1.00 51.29  ? 231 LEU A CB  1 
ATOM   1764 C CG  . LEU A 1 231 ? 76.511  42.906 -50.730 1.00 46.18  ? 231 LEU A CG  1 
ATOM   1765 C CD1 . LEU A 1 231 ? 77.352  42.465 -51.910 1.00 46.41  ? 231 LEU A CD1 1 
ATOM   1766 C CD2 . LEU A 1 231 ? 77.179  44.014 -49.990 1.00 49.10  ? 231 LEU A CD2 1 
ATOM   1767 N N   . GLY A 1 232 ? 72.680  45.467 -52.394 1.00 58.22  ? 232 GLY A N   1 
ATOM   1768 C CA  . GLY A 1 232 ? 71.307  45.514 -52.864 1.00 61.89  ? 232 GLY A CA  1 
ATOM   1769 C C   . GLY A 1 232 ? 70.347  44.565 -52.168 1.00 65.56  ? 232 GLY A C   1 
ATOM   1770 O O   . GLY A 1 232 ? 70.782  43.550 -51.595 1.00 66.12  ? 232 GLY A O   1 
ATOM   1771 N N   . GLU A 1 233 ? 69.052  44.926 -52.174 1.00 67.57  ? 233 GLU A N   1 
ATOM   1772 C CA  . GLU A 1 233 ? 67.969  44.119 -51.580 1.00 65.33  ? 233 GLU A CA  1 
ATOM   1773 C C   . GLU A 1 233 ? 68.076  42.795 -52.314 1.00 64.41  ? 233 GLU A C   1 
ATOM   1774 O O   . GLU A 1 233 ? 68.315  42.792 -53.526 1.00 64.96  ? 233 GLU A O   1 
ATOM   1775 C CB  . GLU A 1 233 ? 66.591  44.743 -51.858 1.00 66.60  ? 233 GLU A CB  1 
ATOM   1776 C CG  . GLU A 1 233 ? 66.343  46.090 -51.183 1.00 69.11  ? 233 GLU A CG  1 
ATOM   1777 C CD  . GLU A 1 233 ? 65.953  47.225 -52.147 1.00 72.27  ? 233 GLU A CD  1 
ATOM   1778 O OE1 . GLU A 1 233 ? 66.199  47.117 -53.366 1.00 76.31  ? 233 GLU A OE1 1 
ATOM   1779 O OE2 . GLU A 1 233 ? 65.408  48.247 -51.682 1.00 71.02  ? 233 GLU A OE2 1 
ATOM   1780 N N   . ARG A 1 234 ? 67.939  41.700 -51.567 1.00 61.12  ? 234 ARG A N   1 
ATOM   1781 C CA  . ARG A 1 234 ? 68.053  40.311 -52.050 1.00 61.46  ? 234 ARG A CA  1 
ATOM   1782 C C   . ARG A 1 234 ? 69.179  39.764 -51.177 1.00 59.04  ? 234 ARG A C   1 
ATOM   1783 O O   . ARG A 1 234 ? 69.066  38.692 -50.591 1.00 58.88  ? 234 ARG A O   1 
ATOM   1784 C CB  . ARG A 1 234 ? 68.420  40.212 -53.553 1.00 63.11  ? 234 ARG A CB  1 
ATOM   1785 C CG  . ARG A 1 234 ? 68.538  38.797 -54.137 1.00 65.93  ? 234 ARG A CG  1 
ATOM   1786 C CD  . ARG A 1 234 ? 68.932  38.813 -55.643 1.00 69.40  ? 234 ARG A CD  1 
ATOM   1787 N NE  . ARG A 1 234 ? 69.843  37.710 -55.992 1.00 72.94  ? 234 ARG A NE  1 
ATOM   1788 C CZ  . ARG A 1 234 ? 69.769  36.940 -57.085 1.00 72.62  ? 234 ARG A CZ  1 
ATOM   1789 N NH1 . ARG A 1 234 ? 68.814  37.118 -58.000 1.00 70.44  ? 234 ARG A NH1 1 
ATOM   1790 N NH2 . ARG A 1 234 ? 70.663  35.968 -57.260 1.00 71.39  ? 234 ARG A NH2 1 
ATOM   1791 N N   . SER A 1 235 ? 70.254  40.538 -51.066 1.00 56.44  ? 235 SER A N   1 
ATOM   1792 C CA  . SER A 1 235 ? 71.391  40.164 -50.234 1.00 51.86  ? 235 SER A CA  1 
ATOM   1793 C C   . SER A 1 235 ? 71.007  40.480 -48.791 1.00 47.50  ? 235 SER A C   1 
ATOM   1794 O O   . SER A 1 235 ? 71.181  39.658 -47.881 1.00 43.32  ? 235 SER A O   1 
ATOM   1795 C CB  . SER A 1 235 ? 72.636  40.946 -50.664 1.00 53.53  ? 235 SER A CB  1 
ATOM   1796 O OG  . SER A 1 235 ? 73.101  40.466 -51.918 1.00 54.64  ? 235 SER A OG  1 
ATOM   1797 N N   . MET A 1 236 ? 70.411  41.652 -48.614 1.00 42.82  ? 236 MET A N   1 
ATOM   1798 C CA  . MET A 1 236 ? 69.955  42.093 -47.308 1.00 43.12  ? 236 MET A CA  1 
ATOM   1799 C C   . MET A 1 236 ? 68.951  41.112 -46.663 1.00 43.03  ? 236 MET A C   1 
ATOM   1800 O O   . MET A 1 236 ? 69.008  40.862 -45.457 1.00 45.93  ? 236 MET A O   1 
ATOM   1801 C CB  . MET A 1 236 ? 69.327  43.486 -47.425 1.00 42.82  ? 236 MET A CB  1 
ATOM   1802 C CG  . MET A 1 236 ? 68.755  44.007 -46.117 1.00 40.94  ? 236 MET A CG  1 
ATOM   1803 S SD  . MET A 1 236 ? 67.618  45.389 -46.243 1.00 39.74  ? 236 MET A SD  1 
ATOM   1804 C CE  . MET A 1 236 ? 66.074  44.501 -46.596 1.00 36.01  ? 236 MET A CE  1 
ATOM   1805 N N   . LYS A 1 237 ? 68.048  40.534 -47.450 1.00 39.51  ? 237 LYS A N   1 
ATOM   1806 C CA  . LYS A 1 237 ? 67.069  39.612 -46.880 1.00 42.83  ? 237 LYS A CA  1 
ATOM   1807 C C   . LYS A 1 237 ? 67.676  38.264 -46.496 1.00 44.96  ? 237 LYS A C   1 
ATOM   1808 O O   . LYS A 1 237 ? 67.018  37.429 -45.841 1.00 46.42  ? 237 LYS A O   1 
ATOM   1809 C CB  . LYS A 1 237 ? 65.913  39.385 -47.838 1.00 44.84  ? 237 LYS A CB  1 
ATOM   1810 C CG  . LYS A 1 237 ? 65.148  40.627 -48.202 1.00 47.20  ? 237 LYS A CG  1 
ATOM   1811 C CD  . LYS A 1 237 ? 64.475  40.397 -49.530 1.00 51.58  ? 237 LYS A CD  1 
ATOM   1812 C CE  . LYS A 1 237 ? 63.710  41.613 -49.984 1.00 58.90  ? 237 LYS A CE  1 
ATOM   1813 N NZ  . LYS A 1 237 ? 63.447  41.556 -51.461 1.00 65.10  ? 237 LYS A NZ  1 
ATOM   1814 N N   . ARG A 1 238 ? 68.924  38.052 -46.910 1.00 42.19  ? 238 ARG A N   1 
ATOM   1815 C CA  . ARG A 1 238 ? 69.635  36.816 -46.610 1.00 40.18  ? 238 ARG A CA  1 
ATOM   1816 C C   . ARG A 1 238 ? 69.949  36.765 -45.117 1.00 38.86  ? 238 ARG A C   1 
ATOM   1817 O O   . ARG A 1 238 ? 70.432  35.753 -44.597 1.00 38.36  ? 238 ARG A O   1 
ATOM   1818 C CB  . ARG A 1 238 ? 70.928  36.729 -47.428 1.00 42.97  ? 238 ARG A CB  1 
ATOM   1819 C CG  . ARG A 1 238 ? 70.756  36.944 -48.922 1.00 38.31  ? 238 ARG A CG  1 
ATOM   1820 C CD  . ARG A 1 238 ? 71.520  35.902 -49.681 1.00 38.64  ? 238 ARG A CD  1 
ATOM   1821 N NE  . ARG A 1 238 ? 72.733  35.515 -48.978 1.00 41.09  ? 238 ARG A NE  1 
ATOM   1822 C CZ  . ARG A 1 238 ? 73.901  35.335 -49.569 1.00 42.98  ? 238 ARG A CZ  1 
ATOM   1823 N NH1 . ARG A 1 238 ? 74.006  35.522 -50.876 1.00 45.72  ? 238 ARG A NH1 1 
ATOM   1824 N NH2 . ARG A 1 238 ? 74.962  34.978 -48.849 1.00 38.83  ? 238 ARG A NH2 1 
ATOM   1825 N N   . PHE A 1 239 ? 69.775  37.896 -44.443 1.00 34.10  ? 239 PHE A N   1 
ATOM   1826 C CA  . PHE A 1 239 ? 69.993  37.927 -43.017 1.00 32.95  ? 239 PHE A CA  1 
ATOM   1827 C C   . PHE A 1 239 ? 68.865  37.151 -42.337 1.00 33.31  ? 239 PHE A C   1 
ATOM   1828 O O   . PHE A 1 239 ? 69.055  36.549 -41.275 1.00 34.78  ? 239 PHE A O   1 
ATOM   1829 C CB  . PHE A 1 239 ? 70.022  39.357 -42.544 1.00 32.66  ? 239 PHE A CB  1 
ATOM   1830 C CG  . PHE A 1 239 ? 71.342  40.022 -42.763 1.00 34.36  ? 239 PHE A CG  1 
ATOM   1831 C CD1 . PHE A 1 239 ? 72.405  39.778 -41.905 1.00 32.98  ? 239 PHE A CD1 1 
ATOM   1832 C CD2 . PHE A 1 239 ? 71.520  40.907 -43.809 1.00 35.35  ? 239 PHE A CD2 1 
ATOM   1833 C CE1 . PHE A 1 239 ? 73.625  40.405 -42.087 1.00 35.29  ? 239 PHE A CE1 1 
ATOM   1834 C CE2 . PHE A 1 239 ? 72.731  41.542 -44.003 1.00 34.88  ? 239 PHE A CE2 1 
ATOM   1835 C CZ  . PHE A 1 239 ? 73.787  41.294 -43.139 1.00 34.62  ? 239 PHE A CZ  1 
ATOM   1836 N N   . SER A 1 240 ? 67.697  37.162 -42.977 1.00 33.23  ? 240 SER A N   1 
ATOM   1837 C CA  . SER A 1 240 ? 66.528  36.469 -42.482 1.00 34.05  ? 240 SER A CA  1 
ATOM   1838 C C   . SER A 1 240 ? 66.450  35.080 -43.100 1.00 34.07  ? 240 SER A C   1 
ATOM   1839 O O   . SER A 1 240 ? 66.572  34.926 -44.319 1.00 36.61  ? 240 SER A O   1 
ATOM   1840 C CB  . SER A 1 240 ? 65.259  37.255 -42.843 1.00 35.72  ? 240 SER A CB  1 
ATOM   1841 O OG  . SER A 1 240 ? 64.082  36.493 -42.565 1.00 32.33  ? 240 SER A OG  1 
ATOM   1842 N N   . PRO A 1 241 ? 66.205  34.050 -42.275 1.00 34.40  ? 241 PRO A N   1 
ATOM   1843 C CA  . PRO A 1 241 ? 66.101  32.678 -42.755 1.00 33.60  ? 241 PRO A CA  1 
ATOM   1844 C C   . PRO A 1 241 ? 64.730  32.475 -43.377 1.00 34.80  ? 241 PRO A C   1 
ATOM   1845 O O   . PRO A 1 241 ? 64.352  31.374 -43.757 1.00 36.72  ? 241 PRO A O   1 
ATOM   1846 C CB  . PRO A 1 241 ? 66.246  31.886 -41.468 1.00 32.44  ? 241 PRO A CB  1 
ATOM   1847 C CG  . PRO A 1 241 ? 65.557  32.735 -40.476 1.00 33.43  ? 241 PRO A CG  1 
ATOM   1848 C CD  . PRO A 1 241 ? 66.102  34.088 -40.805 1.00 35.26  ? 241 PRO A CD  1 
ATOM   1849 N N   . ILE A 1 242 ? 63.946  33.538 -43.355 1.00 40.04  ? 242 ILE A N   1 
ATOM   1850 C CA  . ILE A 1 242 ? 62.603  33.556 -43.912 1.00 44.28  ? 242 ILE A CA  1 
ATOM   1851 C C   . ILE A 1 242 ? 62.653  34.441 -45.141 1.00 42.82  ? 242 ILE A C   1 
ATOM   1852 O O   . ILE A 1 242 ? 61.717  34.479 -45.923 1.00 48.66  ? 242 ILE A O   1 
ATOM   1853 C CB  . ILE A 1 242 ? 61.589  34.080 -42.834 1.00 46.96  ? 242 ILE A CB  1 
ATOM   1854 C CG1 . ILE A 1 242 ? 61.164  32.925 -41.949 1.00 52.61  ? 242 ILE A CG1 1 
ATOM   1855 C CG2 . ILE A 1 242 ? 60.358  34.657 -43.431 1.00 50.28  ? 242 ILE A CG2 1 
ATOM   1856 C CD1 . ILE A 1 242 ? 60.905  31.659 -42.742 1.00 56.04  ? 242 ILE A CD1 1 
ATOM   1857 N N   . GLY A 1 243 ? 63.794  35.087 -45.348 1.00 40.70  ? 243 GLY A N   1 
ATOM   1858 C CA  . GLY A 1 243 ? 63.946  35.962 -46.483 1.00 36.80  ? 243 GLY A CA  1 
ATOM   1859 C C   . GLY A 1 243 ? 63.102  37.188 -46.259 1.00 40.08  ? 243 GLY A C   1 
ATOM   1860 O O   . GLY A 1 243 ? 62.670  37.809 -47.221 1.00 44.19  ? 243 GLY A O   1 
ATOM   1861 N N   . ARG A 1 244 ? 62.817  37.500 -44.995 1.00 42.17  ? 244 ARG A N   1 
ATOM   1862 C CA  . ARG A 1 244 ? 62.022  38.680 -44.634 1.00 41.41  ? 244 ARG A CA  1 
ATOM   1863 C C   . ARG A 1 244 ? 62.760  39.602 -43.684 1.00 39.92  ? 244 ARG A C   1 
ATOM   1864 O O   . ARG A 1 244 ? 62.917  39.277 -42.509 1.00 40.83  ? 244 ARG A O   1 
ATOM   1865 C CB  . ARG A 1 244 ? 60.714  38.294 -43.957 1.00 40.25  ? 244 ARG A CB  1 
ATOM   1866 C CG  . ARG A 1 244 ? 59.596  37.967 -44.886 1.00 42.75  ? 244 ARG A CG  1 
ATOM   1867 C CD  . ARG A 1 244 ? 58.309  38.042 -44.129 1.00 42.88  ? 244 ARG A CD  1 
ATOM   1868 N NE  . ARG A 1 244 ? 58.372  37.149 -42.993 1.00 46.68  ? 244 ARG A NE  1 
ATOM   1869 C CZ  . ARG A 1 244 ? 57.362  36.400 -42.583 1.00 46.56  ? 244 ARG A CZ  1 
ATOM   1870 N NH1 . ARG A 1 244 ? 56.209  36.445 -43.238 1.00 50.54  ? 244 ARG A NH1 1 
ATOM   1871 N NH2 . ARG A 1 244 ? 57.521  35.608 -41.527 1.00 40.87  ? 244 ARG A NH2 1 
ATOM   1872 N N   . VAL A 1 245 ? 63.199  40.748 -44.194 1.00 38.11  ? 245 VAL A N   1 
ATOM   1873 C CA  . VAL A 1 245 ? 63.905  41.760 -43.407 1.00 36.48  ? 245 VAL A CA  1 
ATOM   1874 C C   . VAL A 1 245 ? 63.200  43.054 -43.819 1.00 37.18  ? 245 VAL A C   1 
ATOM   1875 O O   . VAL A 1 245 ? 63.217  43.404 -45.000 1.00 41.08  ? 245 VAL A O   1 
ATOM   1876 C CB  . VAL A 1 245 ? 65.434  41.840 -43.799 1.00 32.79  ? 245 VAL A CB  1 
ATOM   1877 C CG1 . VAL A 1 245 ? 66.119  42.897 -42.964 1.00 25.11  ? 245 VAL A CG1 1 
ATOM   1878 C CG2 . VAL A 1 245 ? 66.139  40.465 -43.630 1.00 25.52  ? 245 VAL A CG2 1 
ATOM   1879 N N   . LYS A 1 246 ? 62.542  43.735 -42.881 1.00 40.99  ? 246 LYS A N   1 
ATOM   1880 C CA  . LYS A 1 246 ? 61.811  44.972 -43.209 1.00 41.37  ? 246 LYS A CA  1 
ATOM   1881 C C   . LYS A 1 246 ? 62.216  46.191 -42.425 1.00 37.27  ? 246 LYS A C   1 
ATOM   1882 O O   . LYS A 1 246 ? 62.548  46.109 -41.259 1.00 36.31  ? 246 LYS A O   1 
ATOM   1883 C CB  . LYS A 1 246 ? 60.302  44.792 -43.020 1.00 47.59  ? 246 LYS A CB  1 
ATOM   1884 C CG  . LYS A 1 246 ? 59.493  44.728 -44.305 1.00 56.15  ? 246 LYS A CG  1 
ATOM   1885 C CD  . LYS A 1 246 ? 59.680  43.364 -44.976 1.00 66.47  ? 246 LYS A CD  1 
ATOM   1886 C CE  . LYS A 1 246 ? 58.667  43.135 -46.097 1.00 73.27  ? 246 LYS A CE  1 
ATOM   1887 N NZ  . LYS A 1 246 ? 58.784  44.093 -47.243 1.00 75.27  ? 246 LYS A NZ  1 
ATOM   1888 N N   . SER A 1 247 ? 62.082  47.340 -43.057 1.00 42.58  ? 247 SER A N   1 
ATOM   1889 C CA  . SER A 1 247 ? 62.422  48.610 -42.442 1.00 50.68  ? 247 SER A CA  1 
ATOM   1890 C C   . SER A 1 247 ? 61.169  49.287 -41.902 1.00 56.39  ? 247 SER A C   1 
ATOM   1891 O O   . SER A 1 247 ? 60.259  49.640 -42.672 1.00 57.14  ? 247 SER A O   1 
ATOM   1892 C CB  . SER A 1 247 ? 63.058  49.526 -43.483 1.00 51.68  ? 247 SER A CB  1 
ATOM   1893 O OG  . SER A 1 247 ? 63.124  50.858 -43.013 1.00 56.56  ? 247 SER A OG  1 
ATOM   1894 N N   . LYS A 1 248 ? 61.120  49.474 -40.587 1.00 59.70  ? 248 LYS A N   1 
ATOM   1895 C CA  . LYS A 1 248 ? 59.977  50.132 -39.968 1.00 61.78  ? 248 LYS A CA  1 
ATOM   1896 C C   . LYS A 1 248 ? 60.394  51.558 -39.662 1.00 61.66  ? 248 LYS A C   1 
ATOM   1897 O O   . LYS A 1 248 ? 61.586  51.826 -39.512 1.00 59.72  ? 248 LYS A O   1 
ATOM   1898 C CB  . LYS A 1 248 ? 59.566  49.397 -38.695 1.00 67.30  ? 248 LYS A CB  1 
ATOM   1899 C CG  . LYS A 1 248 ? 58.394  48.425 -38.873 1.00 70.29  ? 248 LYS A CG  1 
ATOM   1900 C CD  . LYS A 1 248 ? 58.668  47.383 -39.937 1.00 68.75  ? 248 LYS A CD  1 
ATOM   1901 C CE  . LYS A 1 248 ? 58.622  46.009 -39.343 1.00 69.90  ? 248 LYS A CE  1 
ATOM   1902 N NZ  . LYS A 1 248 ? 59.513  45.920 -38.154 1.00 72.12  ? 248 LYS A NZ  1 
ATOM   1903 N N   . LEU A 1 249 ? 59.425  52.470 -39.600 1.00 64.84  ? 249 LEU A N   1 
ATOM   1904 C CA  . LEU A 1 249 ? 59.703  53.889 -39.330 1.00 66.00  ? 249 LEU A CA  1 
ATOM   1905 C C   . LEU A 1 249 ? 58.974  54.451 -38.101 1.00 65.08  ? 249 LEU A C   1 
ATOM   1906 O O   . LEU A 1 249 ? 59.231  54.054 -36.954 1.00 63.04  ? 249 LEU A O   1 
ATOM   1907 C CB  . LEU A 1 249 ? 59.366  54.724 -40.569 1.00 66.35  ? 249 LEU A CB  1 
ATOM   1908 C CG  . LEU A 1 249 ? 59.847  54.091 -41.886 1.00 70.42  ? 249 LEU A CG  1 
ATOM   1909 C CD1 . LEU A 1 249 ? 59.363  54.873 -43.114 1.00 70.36  ? 249 LEU A CD1 1 
ATOM   1910 C CD2 . LEU A 1 249 ? 61.374  53.957 -41.865 1.00 71.15  ? 249 LEU A CD2 1 
ATOM   1911 N N   . SER A 1 256 ? 62.402  60.611 -38.325 1.00 38.96  ? 256 SER A N   1 
ATOM   1912 C CA  . SER A 1 256 ? 63.240  60.058 -37.272 1.00 38.94  ? 256 SER A CA  1 
ATOM   1913 C C   . SER A 1 256 ? 63.685  58.630 -37.610 1.00 40.03  ? 256 SER A C   1 
ATOM   1914 O O   . SER A 1 256 ? 63.995  58.342 -38.760 1.00 40.81  ? 256 SER A O   1 
ATOM   1915 C CB  . SER A 1 256 ? 62.493  60.120 -35.934 1.00 36.22  ? 256 SER A CB  1 
ATOM   1916 N N   . LYS A 1 257 ? 63.659  57.741 -36.624 1.00 43.91  ? 257 LYS A N   1 
ATOM   1917 C CA  . LYS A 1 257 ? 64.054  56.328 -36.761 1.00 47.99  ? 257 LYS A CA  1 
ATOM   1918 C C   . LYS A 1 257 ? 63.766  55.469 -38.019 1.00 45.62  ? 257 LYS A C   1 
ATOM   1919 O O   . LYS A 1 257 ? 63.138  55.869 -38.997 1.00 46.02  ? 257 LYS A O   1 
ATOM   1920 C CB  . LYS A 1 257 ? 63.502  55.525 -35.574 1.00 52.40  ? 257 LYS A CB  1 
ATOM   1921 C CG  . LYS A 1 257 ? 64.199  55.672 -34.247 1.00 57.39  ? 257 LYS A CG  1 
ATOM   1922 C CD  . LYS A 1 257 ? 63.878  54.425 -33.409 1.00 65.60  ? 257 LYS A CD  1 
ATOM   1923 C CE  . LYS A 1 257 ? 64.128  54.627 -31.912 1.00 69.81  ? 257 LYS A CE  1 
ATOM   1924 N NZ  . LYS A 1 257 ? 63.741  53.418 -31.095 1.00 73.83  ? 257 LYS A NZ  1 
ATOM   1925 N N   . GLU A 1 258 ? 64.188  54.222 -37.869 1.00 44.51  ? 258 GLU A N   1 
ATOM   1926 C CA  . GLU A 1 258 ? 64.067  53.115 -38.807 1.00 45.36  ? 258 GLU A CA  1 
ATOM   1927 C C   . GLU A 1 258 ? 64.709  52.015 -37.940 1.00 48.44  ? 258 GLU A C   1 
ATOM   1928 O O   . GLU A 1 258 ? 65.793  52.223 -37.372 1.00 48.69  ? 258 GLU A O   1 
ATOM   1929 C CB  . GLU A 1 258 ? 64.865  53.366 -40.079 1.00 43.48  ? 258 GLU A CB  1 
ATOM   1930 C CG  . GLU A 1 258 ? 64.789  52.222 -41.040 1.00 42.14  ? 258 GLU A CG  1 
ATOM   1931 C CD  . GLU A 1 258 ? 65.292  52.609 -42.394 1.00 45.37  ? 258 GLU A CD  1 
ATOM   1932 O OE1 . GLU A 1 258 ? 64.509  53.198 -43.156 1.00 48.85  ? 258 GLU A OE1 1 
ATOM   1933 O OE2 . GLU A 1 258 ? 66.464  52.338 -42.702 1.00 48.51  ? 258 GLU A OE2 1 
ATOM   1934 N N   . ILE A 1 259 ? 64.011  50.899 -37.736 1.00 50.26  ? 259 ILE A N   1 
ATOM   1935 C CA  . ILE A 1 259 ? 64.554  49.865 -36.852 1.00 49.93  ? 259 ILE A CA  1 
ATOM   1936 C C   . ILE A 1 259 ? 64.903  48.519 -37.484 1.00 47.26  ? 259 ILE A C   1 
ATOM   1937 O O   . ILE A 1 259 ? 65.810  47.823 -37.029 1.00 46.96  ? 259 ILE A O   1 
ATOM   1938 C CB  . ILE A 1 259 ? 63.634  49.618 -35.581 1.00 48.85  ? 259 ILE A CB  1 
ATOM   1939 C CG1 . ILE A 1 259 ? 62.257  49.129 -36.001 1.00 50.49  ? 259 ILE A CG1 1 
ATOM   1940 C CG2 . ILE A 1 259 ? 63.504  50.884 -34.740 1.00 46.95  ? 259 ILE A CG2 1 
ATOM   1941 C CD1 . ILE A 1 259 ? 61.620  48.158 -35.012 1.00 54.15  ? 259 ILE A CD1 1 
ATOM   1942 N N   . TYR A 1 260 ? 64.188  48.136 -38.524 1.00 41.41  ? 260 TYR A N   1 
ATOM   1943 C CA  . TYR A 1 260 ? 64.471  46.854 -39.146 1.00 38.74  ? 260 TYR A CA  1 
ATOM   1944 C C   . TYR A 1 260 ? 64.080  45.665 -38.271 1.00 39.26  ? 260 TYR A C   1 
ATOM   1945 O O   . TYR A 1 260 ? 64.323  45.654 -37.057 1.00 42.57  ? 260 TYR A O   1 
ATOM   1946 C CB  . TYR A 1 260 ? 65.942  46.756 -39.555 1.00 27.37  ? 260 TYR A CB  1 
ATOM   1947 C CG  . TYR A 1 260 ? 66.200  47.416 -40.886 1.00 30.07  ? 260 TYR A CG  1 
ATOM   1948 C CD1 . TYR A 1 260 ? 65.864  46.768 -42.085 1.00 27.54  ? 260 TYR A CD1 1 
ATOM   1949 C CD2 . TYR A 1 260 ? 66.775  48.703 -40.967 1.00 30.89  ? 260 TYR A CD2 1 
ATOM   1950 C CE1 . TYR A 1 260 ? 66.092  47.384 -43.326 1.00 22.99  ? 260 TYR A CE1 1 
ATOM   1951 C CE2 . TYR A 1 260 ? 67.004  49.318 -42.213 1.00 23.26  ? 260 TYR A CE2 1 
ATOM   1952 C CZ  . TYR A 1 260 ? 66.658  48.649 -43.369 1.00 19.51  ? 260 TYR A CZ  1 
ATOM   1953 O OH  . TYR A 1 260 ? 66.845  49.247 -44.583 1.00 26.69  ? 260 TYR A OH  1 
ATOM   1954 N N   . SER A 1 261 ? 63.386  44.707 -38.884 1.00 37.64  ? 261 SER A N   1 
ATOM   1955 C CA  . SER A 1 261 ? 62.973  43.486 -38.209 1.00 34.58  ? 261 SER A CA  1 
ATOM   1956 C C   . SER A 1 261 ? 63.552  42.367 -39.064 1.00 32.91  ? 261 SER A C   1 
ATOM   1957 O O   . SER A 1 261 ? 63.686  42.519 -40.272 1.00 34.51  ? 261 SER A O   1 
ATOM   1958 C CB  . SER A 1 261 ? 61.439  43.413 -38.111 1.00 34.81  ? 261 SER A CB  1 
ATOM   1959 O OG  . SER A 1 261 ? 60.794  43.474 -39.374 1.00 39.63  ? 261 SER A OG  1 
ATOM   1960 N N   . ILE A 1 262 ? 64.021  41.309 -38.417 1.00 35.38  ? 262 ILE A N   1 
ATOM   1961 C CA  . ILE A 1 262 ? 64.618  40.162 -39.108 1.00 35.11  ? 262 ILE A CA  1 
ATOM   1962 C C   . ILE A 1 262 ? 63.877  38.902 -38.643 1.00 34.99  ? 262 ILE A C   1 
ATOM   1963 O O   . ILE A 1 262 ? 64.167  38.338 -37.584 1.00 35.23  ? 262 ILE A O   1 
ATOM   1964 C CB  . ILE A 1 262 ? 66.146  40.035 -38.774 1.00 35.45  ? 262 ILE A CB  1 
ATOM   1965 C CG1 . ILE A 1 262 ? 66.880  41.326 -39.161 1.00 34.47  ? 262 ILE A CG1 1 
ATOM   1966 C CG2 . ILE A 1 262 ? 66.756  38.829 -39.486 1.00 29.49  ? 262 ILE A CG2 1 
ATOM   1967 C CD1 . ILE A 1 262 ? 68.359  41.314 -38.842 1.00 31.25  ? 262 ILE A CD1 1 
ATOM   1968 N N   . ASP A 1 263 ? 62.929  38.463 -39.457 1.00 35.26  ? 263 ASP A N   1 
ATOM   1969 C CA  . ASP A 1 263 ? 62.101  37.316 -39.145 1.00 32.52  ? 263 ASP A CA  1 
ATOM   1970 C C   . ASP A 1 263 ? 62.838  36.004 -39.080 1.00 32.20  ? 263 ASP A C   1 
ATOM   1971 O O   . ASP A 1 263 ? 63.456  35.553 -40.054 1.00 32.03  ? 263 ASP A O   1 
ATOM   1972 C CB  . ASP A 1 263 ? 60.941  37.256 -40.127 1.00 37.74  ? 263 ASP A CB  1 
ATOM   1973 C CG  . ASP A 1 263 ? 60.019  38.462 -40.005 1.00 45.34  ? 263 ASP A CG  1 
ATOM   1974 O OD1 . ASP A 1 263 ? 60.084  39.178 -38.974 1.00 52.50  ? 263 ASP A OD1 1 
ATOM   1975 O OD2 . ASP A 1 263 ? 59.230  38.703 -40.937 1.00 48.59  ? 263 ASP A OD2 1 
ATOM   1976 N N   . GLY A 1 264 ? 62.688  35.362 -37.932 1.00 33.19  ? 264 GLY A N   1 
ATOM   1977 C CA  . GLY A 1 264 ? 63.346  34.100 -37.662 1.00 32.85  ? 264 GLY A CA  1 
ATOM   1978 C C   . GLY A 1 264 ? 64.343  34.340 -36.538 1.00 32.17  ? 264 GLY A C   1 
ATOM   1979 O O   . GLY A 1 264 ? 64.753  33.418 -35.853 1.00 30.36  ? 264 GLY A O   1 
ATOM   1980 N N   . VAL A 1 265 ? 64.653  35.612 -36.294 1.00 37.70  ? 265 VAL A N   1 
ATOM   1981 C CA  . VAL A 1 265 ? 65.618  36.034 -35.272 1.00 37.61  ? 265 VAL A CA  1 
ATOM   1982 C C   . VAL A 1 265 ? 65.059  37.141 -34.334 1.00 35.97  ? 265 VAL A C   1 
ATOM   1983 O O   . VAL A 1 265 ? 64.602  38.198 -34.793 1.00 32.93  ? 265 VAL A O   1 
ATOM   1984 C CB  . VAL A 1 265 ? 66.931  36.572 -35.970 1.00 39.53  ? 265 VAL A CB  1 
ATOM   1985 C CG1 . VAL A 1 265 ? 67.954  37.033 -34.919 1.00 37.76  ? 265 VAL A CG1 1 
ATOM   1986 C CG2 . VAL A 1 265 ? 67.517  35.515 -36.943 1.00 28.74  ? 265 VAL A CG2 1 
ATOM   1987 N N   . SER A 1 266 ? 65.072  36.880 -33.029 1.00 31.33  ? 266 SER A N   1 
ATOM   1988 C CA  . SER A 1 266 ? 64.608  37.861 -32.068 1.00 29.30  ? 266 SER A CA  1 
ATOM   1989 C C   . SER A 1 266 ? 65.758  38.824 -31.832 1.00 29.05  ? 266 SER A C   1 
ATOM   1990 O O   . SER A 1 266 ? 66.761  38.442 -31.253 1.00 29.76  ? 266 SER A O   1 
ATOM   1991 C CB  . SER A 1 266 ? 64.251  37.217 -30.729 1.00 24.93  ? 266 SER A CB  1 
ATOM   1992 O OG  . SER A 1 266 ? 63.533  36.024 -30.917 1.00 31.21  ? 266 SER A OG  1 
ATOM   1993 N N   . ILE A 1 267 ? 65.629  40.054 -32.300 1.00 29.37  ? 267 ILE A N   1 
ATOM   1994 C CA  . ILE A 1 267 ? 66.666  41.046 -32.087 1.00 27.95  ? 267 ILE A CA  1 
ATOM   1995 C C   . ILE A 1 267 ? 66.366  41.710 -30.757 1.00 30.23  ? 267 ILE A C   1 
ATOM   1996 O O   . ILE A 1 267 ? 65.422  42.488 -30.653 1.00 34.78  ? 267 ILE A O   1 
ATOM   1997 C CB  . ILE A 1 267 ? 66.660  42.092 -33.207 1.00 26.19  ? 267 ILE A CB  1 
ATOM   1998 C CG1 . ILE A 1 267 ? 66.789  41.386 -34.555 1.00 22.51  ? 267 ILE A CG1 1 
ATOM   1999 C CG2 . ILE A 1 267 ? 67.822  43.059 -33.016 1.00 28.20  ? 267 ILE A CG2 1 
ATOM   2000 C CD1 . ILE A 1 267 ? 66.246  42.187 -35.730 1.00 22.58  ? 267 ILE A CD1 1 
ATOM   2001 N N   . LEU A 1 268 ? 67.152  41.424 -29.732 1.00 30.09  ? 268 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 268 ? 66.880  42.026 -28.432 1.00 29.80  ? 268 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 268 ? 68.030  42.891 -27.922 1.00 30.26  ? 268 LEU A C   1 
ATOM   2004 O O   . LEU A 1 268 ? 69.015  42.388 -27.410 1.00 33.92  ? 268 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 268 ? 66.552  40.935 -27.394 1.00 30.43  ? 268 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 268 ? 65.358  40.000 -27.610 1.00 24.33  ? 268 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 268 ? 65.384  38.875 -26.603 1.00 24.82  ? 268 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 268 ? 64.090  40.776 -27.482 1.00 22.61  ? 268 LEU A CD2 1 
ATOM   2009 N N   . ASP A 1 269 ? 67.864  44.199 -27.983 1.00 30.66  ? 269 ASP A N   1 
ATOM   2010 C CA  . ASP A 1 269 ? 68.900  45.126 -27.522 1.00 28.84  ? 269 ASP A CA  1 
ATOM   2011 C C   . ASP A 1 269 ? 69.172  45.026 -26.022 1.00 26.53  ? 269 ASP A C   1 
ATOM   2012 O O   . ASP A 1 269 ? 68.258  45.161 -25.217 1.00 26.63  ? 269 ASP A O   1 
ATOM   2013 C CB  . ASP A 1 269 ? 68.495  46.561 -27.872 1.00 32.13  ? 269 ASP A CB  1 
ATOM   2014 C CG  . ASP A 1 269 ? 69.680  47.470 -28.083 1.00 24.68  ? 269 ASP A CG  1 
ATOM   2015 O OD1 . ASP A 1 269 ? 70.529  47.601 -27.191 1.00 28.91  ? 269 ASP A OD1 1 
ATOM   2016 O OD2 . ASP A 1 269 ? 69.725  48.083 -29.146 1.00 28.13  ? 269 ASP A OD2 1 
ATOM   2017 N N   . TYR A 1 270 ? 70.451  44.892 -25.656 1.00 27.26  ? 270 TYR A N   1 
ATOM   2018 C CA  . TYR A 1 270 ? 70.845  44.798 -24.253 1.00 21.06  ? 270 TYR A CA  1 
ATOM   2019 C C   . TYR A 1 270 ? 70.700  46.129 -23.571 1.00 20.65  ? 270 TYR A C   1 
ATOM   2020 O O   . TYR A 1 270 ? 70.618  46.178 -22.346 1.00 25.45  ? 270 TYR A O   1 
ATOM   2021 C CB  . TYR A 1 270 ? 72.252  44.209 -24.034 1.00 20.22  ? 270 TYR A CB  1 
ATOM   2022 C CG  . TYR A 1 270 ? 72.272  43.253 -22.851 1.00 18.25  ? 270 TYR A CG  1 
ATOM   2023 C CD1 . TYR A 1 270 ? 72.429  43.720 -21.550 1.00 24.90  ? 270 TYR A CD1 1 
ATOM   2024 C CD2 . TYR A 1 270 ? 72.042  41.892 -23.017 1.00 12.89  ? 270 TYR A CD2 1 
ATOM   2025 C CE1 . TYR A 1 270 ? 72.344  42.844 -20.425 1.00 23.70  ? 270 TYR A CE1 1 
ATOM   2026 C CE2 . TYR A 1 270 ? 71.968  41.013 -21.902 1.00 12.71  ? 270 TYR A CE2 1 
ATOM   2027 C CZ  . TYR A 1 270 ? 72.119  41.496 -20.620 1.00 17.55  ? 270 TYR A CZ  1 
ATOM   2028 O OH  . TYR A 1 270 ? 72.087  40.643 -19.521 1.00 17.91  ? 270 TYR A OH  1 
ATOM   2029 N N   . LEU A 1 271 ? 70.686  47.222 -24.331 1.00 22.18  ? 271 LEU A N   1 
ATOM   2030 C CA  . LEU A 1 271 ? 70.441  48.523 -23.689 1.00 26.92  ? 271 LEU A CA  1 
ATOM   2031 C C   . LEU A 1 271 ? 68.969  48.519 -23.127 1.00 27.38  ? 271 LEU A C   1 
ATOM   2032 O O   . LEU A 1 271 ? 68.698  49.014 -22.028 1.00 28.56  ? 271 LEU A O   1 
ATOM   2033 C CB  . LEU A 1 271 ? 70.653  49.677 -24.697 1.00 25.35  ? 271 LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 271 ? 70.262  51.139 -24.325 1.00 27.47  ? 271 LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 271 ? 70.820  51.582 -22.948 1.00 19.42  ? 271 LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 271 ? 70.653  52.121 -25.440 1.00 17.23  ? 271 LEU A CD2 1 
ATOM   2037 N N   . ASP A 1 272 ? 68.045  47.907 -23.873 1.00 28.10  ? 272 ASP A N   1 
ATOM   2038 C CA  . ASP A 1 272 ? 66.639  47.826 -23.483 1.00 28.86  ? 272 ASP A CA  1 
ATOM   2039 C C   . ASP A 1 272 ? 66.514  46.894 -22.303 1.00 28.36  ? 272 ASP A C   1 
ATOM   2040 O O   . ASP A 1 272 ? 65.915  47.242 -21.294 1.00 28.41  ? 272 ASP A O   1 
ATOM   2041 C CB  . ASP A 1 272 ? 65.796  47.310 -24.651 1.00 32.81  ? 272 ASP A CB  1 
ATOM   2042 C CG  . ASP A 1 272 ? 65.954  48.167 -25.909 1.00 44.42  ? 272 ASP A CG  1 
ATOM   2043 O OD1 . ASP A 1 272 ? 66.640  49.217 -25.860 1.00 52.07  ? 272 ASP A OD1 1 
ATOM   2044 O OD2 . ASP A 1 272 ? 65.419  47.790 -26.968 1.00 45.74  ? 272 ASP A OD2 1 
ATOM   2045 N N   . LEU A 1 273 ? 67.114  45.712 -22.409 1.00 32.33  ? 273 LEU A N   1 
ATOM   2046 C CA  . LEU A 1 273 ? 67.079  44.728 -21.316 1.00 30.82  ? 273 LEU A CA  1 
ATOM   2047 C C   . LEU A 1 273 ? 67.617  45.302 -20.021 1.00 29.46  ? 273 LEU A C   1 
ATOM   2048 O O   . LEU A 1 273 ? 67.059  45.081 -18.940 1.00 24.74  ? 273 LEU A O   1 
ATOM   2049 C CB  . LEU A 1 273 ? 67.905  43.481 -21.656 1.00 31.57  ? 273 LEU A CB  1 
ATOM   2050 C CG  . LEU A 1 273 ? 67.301  42.370 -22.508 1.00 36.79  ? 273 LEU A CG  1 
ATOM   2051 C CD1 . LEU A 1 273 ? 67.264  42.788 -23.950 1.00 41.23  ? 273 LEU A CD1 1 
ATOM   2052 C CD2 . LEU A 1 273 ? 68.143  41.123 -22.373 1.00 40.30  ? 273 LEU A CD2 1 
ATOM   2053 N N   . TYR A 1 274 ? 68.732  46.012 -20.148 1.00 30.72  ? 274 TYR A N   1 
ATOM   2054 C CA  . TYR A 1 274 ? 69.408  46.601 -19.009 1.00 29.69  ? 274 TYR A CA  1 
ATOM   2055 C C   . TYR A 1 274 ? 68.534  47.655 -18.358 1.00 29.08  ? 274 TYR A C   1 
ATOM   2056 O O   . TYR A 1 274 ? 68.435  47.714 -17.129 1.00 27.67  ? 274 TYR A O   1 
ATOM   2057 C CB  . TYR A 1 274 ? 70.754  47.186 -19.441 1.00 27.41  ? 274 TYR A CB  1 
ATOM   2058 C CG  . TYR A 1 274 ? 71.595  47.597 -18.266 1.00 28.48  ? 274 TYR A CG  1 
ATOM   2059 C CD1 . TYR A 1 274 ? 72.389  46.658 -17.592 1.00 27.86  ? 274 TYR A CD1 1 
ATOM   2060 C CD2 . TYR A 1 274 ? 71.557  48.906 -17.779 1.00 25.45  ? 274 TYR A CD2 1 
ATOM   2061 C CE1 . TYR A 1 274 ? 73.123  47.016 -16.457 1.00 29.72  ? 274 TYR A CE1 1 
ATOM   2062 C CE2 . TYR A 1 274 ? 72.277  49.271 -16.648 1.00 29.44  ? 274 TYR A CE2 1 
ATOM   2063 C CZ  . TYR A 1 274 ? 73.056  48.321 -15.993 1.00 28.08  ? 274 TYR A CZ  1 
ATOM   2064 O OH  . TYR A 1 274 ? 73.743  48.682 -14.871 1.00 27.41  ? 274 TYR A OH  1 
ATOM   2065 N N   . LYS A 1 275 ? 67.947  48.513 -19.188 1.00 32.87  ? 275 LYS A N   1 
ATOM   2066 C CA  . LYS A 1 275 ? 67.019  49.550 -18.720 1.00 35.76  ? 275 LYS A CA  1 
ATOM   2067 C C   . LYS A 1 275 ? 65.721  48.909 -18.128 1.00 37.35  ? 275 LYS A C   1 
ATOM   2068 O O   . LYS A 1 275 ? 65.195  49.407 -17.141 1.00 40.27  ? 275 LYS A O   1 
ATOM   2069 C CB  . LYS A 1 275 ? 66.629  50.495 -19.866 1.00 38.59  ? 275 LYS A CB  1 
ATOM   2070 C CG  . LYS A 1 275 ? 67.703  51.470 -20.360 1.00 40.47  ? 275 LYS A CG  1 
ATOM   2071 C CD  . LYS A 1 275 ? 67.103  52.344 -21.475 1.00 39.54  ? 275 LYS A CD  1 
ATOM   2072 C CE  . LYS A 1 275 ? 67.848  53.654 -21.707 1.00 38.45  ? 275 LYS A CE  1 
ATOM   2073 N NZ  . LYS A 1 275 ? 67.335  54.388 -22.908 1.00 34.26  ? 275 LYS A NZ  1 
ATOM   2074 N N   . LYS A 1 276 ? 65.214  47.819 -18.715 1.00 36.05  ? 276 LYS A N   1 
ATOM   2075 C CA  . LYS A 1 276 ? 64.015  47.164 -18.188 1.00 37.12  ? 276 LYS A CA  1 
ATOM   2076 C C   . LYS A 1 276 ? 64.237  46.322 -16.948 1.00 39.39  ? 276 LYS A C   1 
ATOM   2077 O O   . LYS A 1 276 ? 63.384  46.293 -16.057 1.00 42.57  ? 276 LYS A O   1 
ATOM   2078 C CB  . LYS A 1 276 ? 63.362  46.264 -19.222 1.00 37.12  ? 276 LYS A CB  1 
ATOM   2079 C CG  . LYS A 1 276 ? 62.160  46.883 -19.903 1.00 46.91  ? 276 LYS A CG  1 
ATOM   2080 C CD  . LYS A 1 276 ? 61.554  45.979 -20.994 1.00 50.09  ? 276 LYS A CD  1 
ATOM   2081 C CE  . LYS A 1 276 ? 62.593  45.328 -21.934 1.00 50.98  ? 276 LYS A CE  1 
ATOM   2082 N NZ  . LYS A 1 276 ? 63.116  44.014 -21.401 1.00 49.70  ? 276 LYS A NZ  1 
ATOM   2083 N N   . PHE A 1 277 ? 65.363  45.614 -16.885 1.00 39.68  ? 277 PHE A N   1 
ATOM   2084 C CA  . PHE A 1 277 ? 65.620  44.747 -15.748 1.00 39.61  ? 277 PHE A CA  1 
ATOM   2085 C C   . PHE A 1 277 ? 66.687  45.088 -14.722 1.00 44.29  ? 277 PHE A C   1 
ATOM   2086 O O   . PHE A 1 277 ? 66.758  44.415 -13.689 1.00 50.74  ? 277 PHE A O   1 
ATOM   2087 C CB  . PHE A 1 277 ? 65.784  43.311 -16.214 1.00 35.18  ? 277 PHE A CB  1 
ATOM   2088 C CG  . PHE A 1 277 ? 64.659  42.831 -17.072 1.00 37.94  ? 277 PHE A CG  1 
ATOM   2089 C CD1 . PHE A 1 277 ? 63.385  42.679 -16.546 1.00 35.94  ? 277 PHE A CD1 1 
ATOM   2090 C CD2 . PHE A 1 277 ? 64.873  42.557 -18.429 1.00 42.69  ? 277 PHE A CD2 1 
ATOM   2091 C CE1 . PHE A 1 277 ? 62.337  42.260 -17.349 1.00 43.34  ? 277 PHE A CE1 1 
ATOM   2092 C CE2 . PHE A 1 277 ? 63.833  42.132 -19.256 1.00 43.21  ? 277 PHE A CE2 1 
ATOM   2093 C CZ  . PHE A 1 277 ? 62.558  41.985 -18.717 1.00 46.23  ? 277 PHE A CZ  1 
ATOM   2094 N N   . ALA A 1 278 ? 67.527  46.092 -14.966 1.00 46.70  ? 278 ALA A N   1 
ATOM   2095 C CA  . ALA A 1 278 ? 68.547  46.459 -13.975 1.00 48.91  ? 278 ALA A CA  1 
ATOM   2096 C C   . ALA A 1 278 ? 68.241  47.850 -13.403 1.00 54.06  ? 278 ALA A C   1 
ATOM   2097 O O   . ALA A 1 278 ? 68.380  48.875 -14.095 1.00 59.43  ? 278 ALA A O   1 
ATOM   2098 C CB  . ALA A 1 278 ? 69.927  46.425 -14.599 1.00 45.72  ? 278 ALA A CB  1 
ATOM   2099 N N   . PHE A 1 279 ? 67.792  47.888 -12.154 1.00 54.92  ? 279 PHE A N   1 
ATOM   2100 C CA  . PHE A 1 279 ? 67.462  49.148 -11.496 1.00 59.23  ? 279 PHE A CA  1 
ATOM   2101 C C   . PHE A 1 279 ? 68.708  50.004 -11.328 1.00 59.61  ? 279 PHE A C   1 
ATOM   2102 O O   . PHE A 1 279 ? 69.421  49.851 -10.347 1.00 62.97  ? 279 PHE A O   1 
ATOM   2103 C CB  . PHE A 1 279 ? 66.841  48.867 -10.124 1.00 66.04  ? 279 PHE A CB  1 
ATOM   2104 C CG  . PHE A 1 279 ? 65.332  48.909 -10.102 1.00 69.05  ? 279 PHE A CG  1 
ATOM   2105 C CD1 . PHE A 1 279 ? 64.576  48.359 -11.139 1.00 69.63  ? 279 PHE A CD1 1 
ATOM   2106 C CD2 . PHE A 1 279 ? 64.666  49.514 -9.034  1.00 69.35  ? 279 PHE A CD2 1 
ATOM   2107 C CE1 . PHE A 1 279 ? 63.181  48.418 -11.109 1.00 69.83  ? 279 PHE A CE1 1 
ATOM   2108 C CE2 . PHE A 1 279 ? 63.274  49.575 -8.999  1.00 69.84  ? 279 PHE A CE2 1 
ATOM   2109 C CZ  . PHE A 1 279 ? 62.531  49.027 -10.036 1.00 68.63  ? 279 PHE A CZ  1 
ATOM   2110 N N   . THR A 1 280 ? 68.934  50.933 -12.260 1.00 62.46  ? 280 THR A N   1 
ATOM   2111 C CA  . THR A 1 280 ? 70.124  51.806 -12.262 1.00 62.31  ? 280 THR A CA  1 
ATOM   2112 C C   . THR A 1 280 ? 70.044  53.305 -11.941 1.00 62.03  ? 280 THR A C   1 
ATOM   2113 O O   . THR A 1 280 ? 70.609  53.776 -10.948 1.00 62.55  ? 280 THR A O   1 
ATOM   2114 C CB  . THR A 1 280 ? 70.830  51.726 -13.610 1.00 61.80  ? 280 THR A CB  1 
ATOM   2115 O OG1 . THR A 1 280 ? 69.853  51.762 -14.668 1.00 53.38  ? 280 THR A OG1 1 
ATOM   2116 C CG2 . THR A 1 280 ? 71.679  50.475 -13.666 1.00 63.32  ? 280 THR A CG2 1 
ATOM   2117 N N   . ASN A 1 281 ? 69.463  54.049 -12.878 1.00 61.40  ? 281 ASN A N   1 
ATOM   2118 C CA  . ASN A 1 281 ? 69.307  55.501 -12.799 1.00 62.70  ? 281 ASN A CA  1 
ATOM   2119 C C   . ASN A 1 281 ? 70.628  56.172 -13.154 1.00 60.85  ? 281 ASN A C   1 
ATOM   2120 O O   . ASN A 1 281 ? 71.001  57.205 -12.595 1.00 63.93  ? 281 ASN A O   1 
ATOM   2121 C CB  . ASN A 1 281 ? 68.806  55.965 -11.417 1.00 69.09  ? 281 ASN A CB  1 
ATOM   2122 C CG  . ASN A 1 281 ? 68.430  57.453 -11.394 1.00 73.06  ? 281 ASN A CG  1 
ATOM   2123 O OD1 . ASN A 1 281 ? 67.804  57.949 -12.336 1.00 76.76  ? 281 ASN A OD1 1 
ATOM   2124 N ND2 . ASN A 1 281 ? 68.794  58.160 -10.316 1.00 69.52  ? 281 ASN A ND2 1 
ATOM   2125 N N   . LEU A 1 282 ? 71.337  55.568 -14.096 1.00 56.22  ? 282 LEU A N   1 
ATOM   2126 C CA  . LEU A 1 282 ? 72.603  56.110 -14.550 1.00 53.18  ? 282 LEU A CA  1 
ATOM   2127 C C   . LEU A 1 282 ? 72.336  57.352 -15.407 1.00 51.30  ? 282 LEU A C   1 
ATOM   2128 O O   . LEU A 1 282 ? 71.358  57.394 -16.147 1.00 48.38  ? 282 LEU A O   1 
ATOM   2129 C CB  . LEU A 1 282 ? 73.373  55.050 -15.360 1.00 49.22  ? 282 LEU A CB  1 
ATOM   2130 C CG  . LEU A 1 282 ? 74.421  54.156 -14.677 1.00 45.17  ? 282 LEU A CG  1 
ATOM   2131 C CD1 . LEU A 1 282 ? 74.169  53.995 -13.162 1.00 40.39  ? 282 LEU A CD1 1 
ATOM   2132 C CD2 . LEU A 1 282 ? 74.455  52.815 -15.400 1.00 42.05  ? 282 LEU A CD2 1 
ATOM   2133 N N   . PRO A 1 283 ? 73.201  58.386 -15.302 1.00 52.11  ? 283 PRO A N   1 
ATOM   2134 C CA  . PRO A 1 283 ? 73.037  59.619 -16.086 1.00 51.53  ? 283 PRO A CA  1 
ATOM   2135 C C   . PRO A 1 283 ? 73.266  59.353 -17.581 1.00 50.46  ? 283 PRO A C   1 
ATOM   2136 O O   . PRO A 1 283 ? 72.775  60.079 -18.460 1.00 47.52  ? 283 PRO A O   1 
ATOM   2137 C CB  . PRO A 1 283 ? 74.120  60.541 -15.501 1.00 51.83  ? 283 PRO A CB  1 
ATOM   2138 C CG  . PRO A 1 283 ? 75.177  59.589 -15.025 1.00 51.65  ? 283 PRO A CG  1 
ATOM   2139 C CD  . PRO A 1 283 ? 74.366  58.490 -14.394 1.00 50.03  ? 283 PRO A CD  1 
ATOM   2140 N N   . SER A 1 284 ? 74.050  58.311 -17.843 1.00 49.65  ? 284 SER A N   1 
ATOM   2141 C CA  . SER A 1 284 ? 74.389  57.888 -19.191 1.00 46.63  ? 284 SER A CA  1 
ATOM   2142 C C   . SER A 1 284 ? 74.296  56.384 -19.171 1.00 42.56  ? 284 SER A C   1 
ATOM   2143 O O   . SER A 1 284 ? 74.709  55.744 -18.203 1.00 42.16  ? 284 SER A O   1 
ATOM   2144 C CB  . SER A 1 284 ? 75.831  58.282 -19.536 1.00 46.08  ? 284 SER A CB  1 
ATOM   2145 O OG  . SER A 1 284 ? 76.109  58.179 -20.927 1.00 46.30  ? 284 SER A OG  1 
ATOM   2146 N N   . PHE A 1 285 ? 73.648  55.847 -20.194 1.00 43.33  ? 285 PHE A N   1 
ATOM   2147 C CA  . PHE A 1 285 ? 73.511  54.409 -20.379 1.00 44.08  ? 285 PHE A CA  1 
ATOM   2148 C C   . PHE A 1 285 ? 74.420  54.000 -21.530 1.00 42.58  ? 285 PHE A C   1 
ATOM   2149 O O   . PHE A 1 285 ? 74.114  53.082 -22.290 1.00 45.27  ? 285 PHE A O   1 
ATOM   2150 C CB  . PHE A 1 285 ? 72.053  54.002 -20.619 1.00 41.64  ? 285 PHE A CB  1 
ATOM   2151 C CG  . PHE A 1 285 ? 71.274  53.876 -19.351 1.00 44.03  ? 285 PHE A CG  1 
ATOM   2152 C CD1 . PHE A 1 285 ? 71.331  52.705 -18.605 1.00 45.23  ? 285 PHE A CD1 1 
ATOM   2153 C CD2 . PHE A 1 285 ? 70.580  54.961 -18.827 1.00 46.00  ? 285 PHE A CD2 1 
ATOM   2154 C CE1 . PHE A 1 285 ? 70.709  52.618 -17.342 1.00 44.95  ? 285 PHE A CE1 1 
ATOM   2155 C CE2 . PHE A 1 285 ? 69.959  54.877 -17.563 1.00 43.12  ? 285 PHE A CE2 1 
ATOM   2156 C CZ  . PHE A 1 285 ? 70.029  53.705 -16.826 1.00 40.91  ? 285 PHE A CZ  1 
ATOM   2157 N N   . SER A 1 286 ? 75.555  54.698 -21.636 1.00 38.51  ? 286 SER A N   1 
ATOM   2158 C CA  . SER A 1 286 ? 76.552  54.420 -22.665 1.00 35.53  ? 286 SER A CA  1 
ATOM   2159 C C   . SER A 1 286 ? 77.141  53.057 -22.345 1.00 29.72  ? 286 SER A C   1 
ATOM   2160 O O   . SER A 1 286 ? 77.061  52.593 -21.210 1.00 33.60  ? 286 SER A O   1 
ATOM   2161 C CB  . SER A 1 286 ? 77.674  55.461 -22.639 1.00 33.83  ? 286 SER A CB  1 
ATOM   2162 O OG  . SER A 1 286 ? 78.559  55.162 -21.575 1.00 32.79  ? 286 SER A OG  1 
ATOM   2163 N N   . LEU A 1 287 ? 77.736  52.426 -23.343 1.00 28.63  ? 287 LEU A N   1 
ATOM   2164 C CA  . LEU A 1 287 ? 78.352  51.110 -23.183 1.00 29.37  ? 287 LEU A CA  1 
ATOM   2165 C C   . LEU A 1 287 ? 79.404  51.243 -22.085 1.00 29.26  ? 287 LEU A C   1 
ATOM   2166 O O   . LEU A 1 287 ? 79.430  50.484 -21.099 1.00 23.87  ? 287 LEU A O   1 
ATOM   2167 C CB  . LEU A 1 287 ? 79.005  50.722 -24.519 1.00 29.87  ? 287 LEU A CB  1 
ATOM   2168 C CG  . LEU A 1 287 ? 79.515  49.299 -24.676 1.00 28.71  ? 287 LEU A CG  1 
ATOM   2169 C CD1 . LEU A 1 287 ? 78.755  48.396 -23.723 1.00 29.35  ? 287 LEU A CD1 1 
ATOM   2170 C CD2 . LEU A 1 287 ? 79.343  48.873 -26.119 1.00 24.30  ? 287 LEU A CD2 1 
ATOM   2171 N N   . GLU A 1 288 ? 80.167  52.328 -22.220 1.00 32.15  ? 288 GLU A N   1 
ATOM   2172 C CA  . GLU A 1 288 ? 81.241  52.665 -21.304 1.00 33.41  ? 288 GLU A CA  1 
ATOM   2173 C C   . GLU A 1 288 ? 80.756  52.776 -19.884 1.00 27.47  ? 288 GLU A C   1 
ATOM   2174 O O   . GLU A 1 288 ? 81.203  52.011 -19.055 1.00 25.95  ? 288 GLU A O   1 
ATOM   2175 C CB  . GLU A 1 288 ? 81.928  53.965 -21.732 1.00 40.21  ? 288 GLU A CB  1 
ATOM   2176 C CG  . GLU A 1 288 ? 82.717  53.846 -23.035 1.00 46.52  ? 288 GLU A CG  1 
ATOM   2177 C CD  . GLU A 1 288 ? 81.832  53.883 -24.263 1.00 53.09  ? 288 GLU A CD  1 
ATOM   2178 O OE1 . GLU A 1 288 ? 80.731  54.478 -24.178 1.00 58.65  ? 288 GLU A OE1 1 
ATOM   2179 O OE2 . GLU A 1 288 ? 82.238  53.334 -25.315 1.00 53.35  ? 288 GLU A OE2 1 
ATOM   2180 N N   . SER A 1 289 ? 79.797  53.667 -19.629 1.00 26.19  ? 289 SER A N   1 
ATOM   2181 C CA  . SER A 1 289 ? 79.251  53.879 -18.280 1.00 30.55  ? 289 SER A CA  1 
ATOM   2182 C C   . SER A 1 289 ? 78.665  52.629 -17.695 1.00 26.99  ? 289 SER A C   1 
ATOM   2183 O O   . SER A 1 289 ? 78.886  52.305 -16.530 1.00 31.30  ? 289 SER A O   1 
ATOM   2184 C CB  . SER A 1 289 ? 78.135  54.941 -18.262 1.00 38.15  ? 289 SER A CB  1 
ATOM   2185 O OG  . SER A 1 289 ? 78.291  55.935 -19.260 1.00 48.19  ? 289 SER A OG  1 
ATOM   2186 N N   . VAL A 1 290 ? 77.859  51.952 -18.493 1.00 28.98  ? 290 VAL A N   1 
ATOM   2187 C CA  . VAL A 1 290 ? 77.231  50.725 -18.033 1.00 30.09  ? 290 VAL A CA  1 
ATOM   2188 C C   . VAL A 1 290 ? 78.327  49.698 -17.704 1.00 30.17  ? 290 VAL A C   1 
ATOM   2189 O O   . VAL A 1 290 ? 78.423  49.184 -16.571 1.00 23.51  ? 290 VAL A O   1 
ATOM   2190 C CB  . VAL A 1 290 ? 76.223  50.148 -19.099 1.00 28.53  ? 290 VAL A CB  1 
ATOM   2191 C CG1 . VAL A 1 290 ? 75.546  48.865 -18.535 1.00 19.44  ? 290 VAL A CG1 1 
ATOM   2192 C CG2 . VAL A 1 290 ? 75.166  51.235 -19.490 1.00 26.88  ? 290 VAL A CG2 1 
ATOM   2193 N N   . ALA A 1 291 ? 79.193  49.468 -18.689 1.00 31.58  ? 291 ALA A N   1 
ATOM   2194 C CA  . ALA A 1 291 ? 80.296  48.517 -18.545 1.00 33.83  ? 291 ALA A CA  1 
ATOM   2195 C C   . ALA A 1 291 ? 81.234  48.874 -17.395 1.00 30.42  ? 291 ALA A C   1 
ATOM   2196 O O   . ALA A 1 291 ? 81.649  48.006 -16.641 1.00 32.04  ? 291 ALA A O   1 
ATOM   2197 C CB  . ALA A 1 291 ? 81.059  48.408 -19.848 1.00 32.72  ? 291 ALA A CB  1 
ATOM   2198 N N   . GLN A 1 292 ? 81.491  50.158 -17.207 1.00 33.24  ? 292 GLN A N   1 
ATOM   2199 C CA  . GLN A 1 292 ? 82.381  50.595 -16.146 1.00 38.77  ? 292 GLN A CA  1 
ATOM   2200 C C   . GLN A 1 292 ? 81.699  50.350 -14.825 1.00 39.68  ? 292 GLN A C   1 
ATOM   2201 O O   . GLN A 1 292 ? 82.356  50.005 -13.843 1.00 41.88  ? 292 GLN A O   1 
ATOM   2202 C CB  . GLN A 1 292 ? 82.699  52.088 -16.270 1.00 41.43  ? 292 GLN A CB  1 
ATOM   2203 C CG  . GLN A 1 292 ? 83.450  52.659 -15.070 1.00 45.60  ? 292 GLN A CG  1 
ATOM   2204 C CD  . GLN A 1 292 ? 84.904  52.246 -15.048 1.00 50.31  ? 292 GLN A CD  1 
ATOM   2205 O OE1 . GLN A 1 292 ? 85.633  52.469 -16.012 1.00 55.58  ? 292 GLN A OE1 1 
ATOM   2206 N NE2 . GLN A 1 292 ? 85.339  51.654 -13.948 1.00 49.24  ? 292 GLN A NE2 1 
ATOM   2207 N N   . HIS A 1 293 ? 80.388  50.589 -14.803 1.00 38.38  ? 293 HIS A N   1 
ATOM   2208 C CA  . HIS A 1 293 ? 79.571  50.411 -13.606 1.00 38.60  ? 293 HIS A CA  1 
ATOM   2209 C C   . HIS A 1 293 ? 79.419  48.923 -13.233 1.00 38.54  ? 293 HIS A C   1 
ATOM   2210 O O   . HIS A 1 293 ? 79.440  48.537 -12.058 1.00 37.25  ? 293 HIS A O   1 
ATOM   2211 C CB  . HIS A 1 293 ? 78.192  51.052 -13.838 1.00 39.64  ? 293 HIS A CB  1 
ATOM   2212 C CG  . HIS A 1 293 ? 77.284  50.959 -12.666 1.00 39.92  ? 293 HIS A CG  1 
ATOM   2213 N ND1 . HIS A 1 293 ? 76.344  49.956 -12.526 1.00 43.22  ? 293 HIS A ND1 1 
ATOM   2214 C CD2 . HIS A 1 293 ? 77.208  51.701 -11.523 1.00 41.45  ? 293 HIS A CD2 1 
ATOM   2215 C CE1 . HIS A 1 293 ? 75.739  50.085 -11.359 1.00 45.72  ? 293 HIS A CE1 1 
ATOM   2216 N NE2 . HIS A 1 293 ? 76.239  51.124 -10.735 1.00 41.15  ? 293 HIS A NE2 1 
ATOM   2217 N N   . GLU A 1 294 ? 79.303  48.089 -14.252 1.00 39.24  ? 294 GLU A N   1 
ATOM   2218 C CA  . GLU A 1 294 ? 79.123  46.660 -14.063 1.00 38.40  ? 294 GLU A CA  1 
ATOM   2219 C C   . GLU A 1 294 ? 80.382  45.861 -13.849 1.00 36.10  ? 294 GLU A C   1 
ATOM   2220 O O   . GLU A 1 294 ? 80.598  45.278 -12.802 1.00 38.63  ? 294 GLU A O   1 
ATOM   2221 C CB  . GLU A 1 294 ? 78.380  46.082 -15.275 1.00 40.74  ? 294 GLU A CB  1 
ATOM   2222 C CG  . GLU A 1 294 ? 77.100  45.361 -14.938 1.00 42.61  ? 294 GLU A CG  1 
ATOM   2223 C CD  . GLU A 1 294 ? 76.121  46.240 -14.184 1.00 42.61  ? 294 GLU A CD  1 
ATOM   2224 O OE1 . GLU A 1 294 ? 75.989  47.431 -14.541 1.00 43.84  ? 294 GLU A OE1 1 
ATOM   2225 O OE2 . GLU A 1 294 ? 75.513  45.736 -13.221 1.00 44.36  ? 294 GLU A OE2 1 
ATOM   2226 N N   . THR A 1 295 ? 81.198  45.803 -14.884 1.00 39.84  ? 295 THR A N   1 
ATOM   2227 C CA  . THR A 1 295 ? 82.416  45.010 -14.854 1.00 42.56  ? 295 THR A CA  1 
ATOM   2228 C C   . THR A 1 295 ? 83.570  45.649 -14.107 1.00 45.68  ? 295 THR A C   1 
ATOM   2229 O O   . THR A 1 295 ? 84.566  44.979 -13.834 1.00 49.08  ? 295 THR A O   1 
ATOM   2230 C CB  . THR A 1 295 ? 82.860  44.680 -16.280 1.00 39.91  ? 295 THR A CB  1 
ATOM   2231 O OG1 . THR A 1 295 ? 83.465  45.833 -16.879 1.00 35.47  ? 295 THR A OG1 1 
ATOM   2232 C CG2 . THR A 1 295 ? 81.649  44.300 -17.120 1.00 41.82  ? 295 THR A CG2 1 
ATOM   2233 N N   . LYS A 1 296 ? 83.450  46.950 -13.839 1.00 46.13  ? 296 LYS A N   1 
ATOM   2234 C CA  . LYS A 1 296 ? 84.462  47.724 -13.132 1.00 47.03  ? 296 LYS A CA  1 
ATOM   2235 C C   . LYS A 1 296 ? 85.740  47.895 -13.934 1.00 48.96  ? 296 LYS A C   1 
ATOM   2236 O O   . LYS A 1 296 ? 86.709  48.487 -13.453 1.00 47.88  ? 296 LYS A O   1 
ATOM   2237 C CB  . LYS A 1 296 ? 84.796  47.089 -11.785 1.00 53.03  ? 296 LYS A CB  1 
ATOM   2238 C CG  . LYS A 1 296 ? 83.701  47.178 -10.739 1.00 56.46  ? 296 LYS A CG  1 
ATOM   2239 C CD  . LYS A 1 296 ? 83.443  48.615 -10.347 1.00 61.77  ? 296 LYS A CD  1 
ATOM   2240 C CE  . LYS A 1 296 ? 82.118  48.757 -9.634  1.00 66.09  ? 296 LYS A CE  1 
ATOM   2241 N NZ  . LYS A 1 296 ? 81.738  50.178 -9.447  1.00 69.98  ? 296 LYS A NZ  1 
ATOM   2242 N N   . LYS A 1 297 ? 85.767  47.320 -15.131 1.00 51.41  ? 297 LYS A N   1 
ATOM   2243 C CA  . LYS A 1 297 ? 86.930  47.415 -15.999 1.00 51.29  ? 297 LYS A CA  1 
ATOM   2244 C C   . LYS A 1 297 ? 86.598  48.542 -16.949 1.00 53.23  ? 297 LYS A C   1 
ATOM   2245 O O   . LYS A 1 297 ? 85.426  48.877 -17.129 1.00 51.44  ? 297 LYS A O   1 
ATOM   2246 C CB  . LYS A 1 297 ? 87.160  46.102 -16.781 1.00 50.42  ? 297 LYS A CB  1 
ATOM   2247 C CG  . LYS A 1 297 ? 87.280  44.799 -15.940 1.00 48.23  ? 297 LYS A CG  1 
ATOM   2248 C CD  . LYS A 1 297 ? 88.572  44.722 -15.125 1.00 53.45  ? 297 LYS A CD  1 
ATOM   2249 C CE  . LYS A 1 297 ? 88.504  45.504 -13.804 1.00 54.06  ? 297 LYS A CE  1 
ATOM   2250 N NZ  . LYS A 1 297 ? 89.852  45.720 -13.180 1.00 53.50  ? 297 LYS A NZ  1 
ATOM   2251 N N   . GLY A 1 298 ? 87.634  49.095 -17.577 1.00 58.86  ? 298 GLY A N   1 
ATOM   2252 C CA  . GLY A 1 298 ? 87.512  50.220 -18.513 1.00 56.89  ? 298 GLY A CA  1 
ATOM   2253 C C   . GLY A 1 298 ? 88.412  50.067 -19.736 1.00 52.93  ? 298 GLY A C   1 
ATOM   2254 O O   . GLY A 1 298 ? 89.134  49.082 -19.889 1.00 54.35  ? 298 GLY A O   1 
ATOM   2255 N N   . LYS A 1 299 ? 88.406  51.094 -20.566 1.00 45.94  ? 299 LYS A N   1 
ATOM   2256 C CA  . LYS A 1 299 ? 89.188  51.114 -21.779 1.00 43.46  ? 299 LYS A CA  1 
ATOM   2257 C C   . LYS A 1 299 ? 90.274  52.165 -21.615 1.00 48.48  ? 299 LYS A C   1 
ATOM   2258 O O   . LYS A 1 299 ? 90.097  53.166 -20.896 1.00 52.77  ? 299 LYS A O   1 
ATOM   2259 C CB  . LYS A 1 299 ? 88.294  51.490 -22.955 1.00 37.74  ? 299 LYS A CB  1 
ATOM   2260 C CG  . LYS A 1 299 ? 88.131  50.425 -23.977 1.00 33.08  ? 299 LYS A CG  1 
ATOM   2261 C CD  . LYS A 1 299 ? 86.790  50.482 -24.694 1.00 34.38  ? 299 LYS A CD  1 
ATOM   2262 C CE  . LYS A 1 299 ? 86.441  51.863 -25.193 1.00 38.42  ? 299 LYS A CE  1 
ATOM   2263 N NZ  . LYS A 1 299 ? 85.475  51.748 -26.311 1.00 39.42  ? 299 LYS A NZ  1 
ATOM   2264 N N   . LEU A 1 300 ? 91.415  51.914 -22.252 1.00 48.14  ? 300 LEU A N   1 
ATOM   2265 C CA  . LEU A 1 300 ? 92.544  52.824 -22.214 1.00 41.60  ? 300 LEU A CA  1 
ATOM   2266 C C   . LEU A 1 300 ? 92.102  54.123 -22.850 1.00 41.66  ? 300 LEU A C   1 
ATOM   2267 O O   . LEU A 1 300 ? 91.372  54.122 -23.835 1.00 45.11  ? 300 LEU A O   1 
ATOM   2268 C CB  . LEU A 1 300 ? 93.707  52.238 -23.033 1.00 41.81  ? 300 LEU A CB  1 
ATOM   2269 C CG  . LEU A 1 300 ? 94.622  51.195 -22.374 1.00 39.35  ? 300 LEU A CG  1 
ATOM   2270 C CD1 . LEU A 1 300 ? 95.520  50.508 -23.398 1.00 32.98  ? 300 LEU A CD1 1 
ATOM   2271 C CD2 . LEU A 1 300 ? 95.445  51.920 -21.308 1.00 40.54  ? 300 LEU A CD2 1 
ATOM   2272 N N   . PRO A 1 301 ? 92.472  55.253 -22.256 1.00 38.96  ? 301 PRO A N   1 
ATOM   2273 C CA  . PRO A 1 301 ? 92.085  56.534 -22.844 1.00 37.99  ? 301 PRO A CA  1 
ATOM   2274 C C   . PRO A 1 301 ? 92.903  56.630 -24.118 1.00 37.19  ? 301 PRO A C   1 
ATOM   2275 O O   . PRO A 1 301 ? 93.753  55.795 -24.365 1.00 40.85  ? 301 PRO A O   1 
ATOM   2276 C CB  . PRO A 1 301 ? 92.625  57.545 -21.837 1.00 40.54  ? 301 PRO A CB  1 
ATOM   2277 C CG  . PRO A 1 301 ? 92.696  56.776 -20.553 1.00 41.49  ? 301 PRO A CG  1 
ATOM   2278 C CD  . PRO A 1 301 ? 93.194  55.433 -20.994 1.00 41.31  ? 301 PRO A CD  1 
ATOM   2279 N N   . TYR A 1 302 ? 92.705  57.667 -24.905 1.00 40.51  ? 302 TYR A N   1 
ATOM   2280 C CA  . TYR A 1 302 ? 93.493  57.823 -26.117 1.00 43.23  ? 302 TYR A CA  1 
ATOM   2281 C C   . TYR A 1 302 ? 93.679  59.298 -26.454 1.00 45.86  ? 302 TYR A C   1 
ATOM   2282 O O   . TYR A 1 302 ? 92.744  59.947 -26.924 1.00 51.26  ? 302 TYR A O   1 
ATOM   2283 C CB  . TYR A 1 302 ? 92.842  57.106 -27.286 1.00 37.47  ? 302 TYR A CB  1 
ATOM   2284 C CG  . TYR A 1 302 ? 93.589  57.285 -28.582 1.00 37.50  ? 302 TYR A CG  1 
ATOM   2285 C CD1 . TYR A 1 302 ? 93.418  58.425 -29.369 1.00 36.15  ? 302 TYR A CD1 1 
ATOM   2286 C CD2 . TYR A 1 302 ? 94.456  56.303 -29.036 1.00 40.55  ? 302 TYR A CD2 1 
ATOM   2287 C CE1 . TYR A 1 302 ? 94.082  58.575 -30.566 1.00 34.06  ? 302 TYR A CE1 1 
ATOM   2288 C CE2 . TYR A 1 302 ? 95.121  56.443 -30.234 1.00 36.28  ? 302 TYR A CE2 1 
ATOM   2289 C CZ  . TYR A 1 302 ? 94.932  57.575 -30.984 1.00 35.88  ? 302 TYR A CZ  1 
ATOM   2290 O OH  . TYR A 1 302 ? 95.604  57.681 -32.161 1.00 44.19  ? 302 TYR A OH  1 
ATOM   2291 N N   . ASP A 1 303 ? 94.863  59.844 -26.205 1.00 45.95  ? 303 ASP A N   1 
ATOM   2292 C CA  . ASP A 1 303 ? 95.050  61.239 -26.524 1.00 49.26  ? 303 ASP A CA  1 
ATOM   2293 C C   . ASP A 1 303 ? 95.130  61.341 -28.033 1.00 52.06  ? 303 ASP A C   1 
ATOM   2294 O O   . ASP A 1 303 ? 96.104  60.908 -28.640 1.00 56.78  ? 303 ASP A O   1 
ATOM   2295 C CB  . ASP A 1 303 ? 96.290  61.830 -25.853 1.00 47.62  ? 303 ASP A CB  1 
ATOM   2296 C CG  . ASP A 1 303 ? 96.498  63.287 -26.214 1.00 44.57  ? 303 ASP A CG  1 
ATOM   2297 O OD1 . ASP A 1 303 ? 95.558  63.997 -26.539 1.00 45.70  ? 303 ASP A OD1 1 
ATOM   2298 O OD2 . ASP A 1 303 ? 97.740  63.726 -26.197 1.00 48.97  ? 303 ASP A OD2 1 
ATOM   2299 N N   . GLY A 1 304 ? 94.013  61.735 -28.627 1.00 53.87  ? 304 GLY A N   1 
ATOM   2300 C CA  . GLY A 1 304 ? 93.936  61.914 -30.058 1.00 57.97  ? 304 GLY A CA  1 
ATOM   2301 C C   . GLY A 1 304 ? 92.503  61.917 -30.549 1.00 59.77  ? 304 GLY A C   1 
ATOM   2302 O O   . GLY A 1 304 ? 91.663  61.234 -29.975 1.00 59.16  ? 304 GLY A O   1 
ATOM   2303 N N   . PRO A 1 305 ? 92.183  62.730 -31.573 1.00 62.26  ? 305 PRO A N   1 
ATOM   2304 C CA  . PRO A 1 305 ? 90.853  62.844 -32.172 1.00 62.54  ? 305 PRO A CA  1 
ATOM   2305 C C   . PRO A 1 305 ? 90.319  61.445 -32.424 1.00 62.28  ? 305 PRO A C   1 
ATOM   2306 O O   . PRO A 1 305 ? 90.675  60.791 -33.410 1.00 61.01  ? 305 PRO A O   1 
ATOM   2307 C CB  . PRO A 1 305 ? 91.153  63.551 -33.489 1.00 62.44  ? 305 PRO A CB  1 
ATOM   2308 C CG  . PRO A 1 305 ? 92.201  64.490 -33.101 1.00 64.83  ? 305 PRO A CG  1 
ATOM   2309 C CD  . PRO A 1 305 ? 93.118  63.652 -32.233 1.00 65.48  ? 305 PRO A CD  1 
ATOM   2310 N N   . ILE A 1 306 ? 89.465  60.994 -31.514 1.00 63.31  ? 306 ILE A N   1 
ATOM   2311 C CA  . ILE A 1 306 ? 88.894  59.658 -31.596 1.00 62.28  ? 306 ILE A CA  1 
ATOM   2312 C C   . ILE A 1 306 ? 88.193  59.490 -32.920 1.00 58.91  ? 306 ILE A C   1 
ATOM   2313 O O   . ILE A 1 306 ? 88.246  58.420 -33.506 1.00 59.78  ? 306 ILE A O   1 
ATOM   2314 C CB  . ILE A 1 306 ? 87.915  59.314 -30.422 1.00 64.94  ? 306 ILE A CB  1 
ATOM   2315 C CG1 . ILE A 1 306 ? 88.176  60.203 -29.187 1.00 69.46  ? 306 ILE A CG1 1 
ATOM   2316 C CG2 . ILE A 1 306 ? 88.096  57.848 -30.021 1.00 58.67  ? 306 ILE A CG2 1 
ATOM   2317 C CD1 . ILE A 1 306 ? 87.542  61.635 -29.241 1.00 72.93  ? 306 ILE A CD1 1 
ATOM   2318 N N   . ASN A 1 307 ? 87.598  60.557 -33.435 1.00 55.02  ? 307 ASN A N   1 
ATOM   2319 C CA  . ASN A 1 307 ? 86.916  60.443 -34.715 1.00 55.38  ? 307 ASN A CA  1 
ATOM   2320 C C   . ASN A 1 307 ? 87.853  59.979 -35.846 1.00 55.15  ? 307 ASN A C   1 
ATOM   2321 O O   . ASN A 1 307 ? 87.398  59.417 -36.847 1.00 57.58  ? 307 ASN A O   1 
ATOM   2322 C CB  . ASN A 1 307 ? 86.164  61.737 -35.079 1.00 54.92  ? 307 ASN A CB  1 
ATOM   2323 C CG  . ASN A 1 307 ? 87.058  62.976 -35.065 1.00 57.00  ? 307 ASN A CG  1 
ATOM   2324 O OD1 . ASN A 1 307 ? 87.349  63.533 -34.007 1.00 57.22  ? 307 ASN A OD1 1 
ATOM   2325 N ND2 . ASN A 1 307 ? 87.474  63.426 -36.243 1.00 57.77  ? 307 ASN A ND2 1 
ATOM   2326 N N   . LYS A 1 308 ? 89.160  60.154 -35.665 1.00 51.22  ? 308 LYS A N   1 
ATOM   2327 C CA  . LYS A 1 308 ? 90.123  59.740 -36.683 1.00 46.69  ? 308 LYS A CA  1 
ATOM   2328 C C   . LYS A 1 308 ? 91.044  58.594 -36.269 1.00 44.72  ? 308 LYS A C   1 
ATOM   2329 O O   . LYS A 1 308 ? 91.994  58.284 -36.979 1.00 46.62  ? 308 LYS A O   1 
ATOM   2330 C CB  . LYS A 1 308 ? 90.962  60.935 -37.126 1.00 48.18  ? 308 LYS A CB  1 
ATOM   2331 C CG  . LYS A 1 308 ? 90.279  61.834 -38.139 1.00 50.96  ? 308 LYS A CG  1 
ATOM   2332 C CD  . LYS A 1 308 ? 90.957  63.191 -38.203 1.00 52.93  ? 308 LYS A CD  1 
ATOM   2333 C CE  . LYS A 1 308 ? 90.595  63.959 -39.472 1.00 55.20  ? 308 LYS A CE  1 
ATOM   2334 N NZ  . LYS A 1 308 ? 91.118  63.306 -40.728 1.00 58.29  ? 308 LYS A NZ  1 
ATOM   2335 N N   . LEU A 1 309 ? 90.739  57.941 -35.150 1.00 42.50  ? 309 LEU A N   1 
ATOM   2336 C CA  . LEU A 1 309 ? 91.531  56.819 -34.627 1.00 36.68  ? 309 LEU A CA  1 
ATOM   2337 C C   . LEU A 1 309 ? 91.837  55.650 -35.559 1.00 37.04  ? 309 LEU A C   1 
ATOM   2338 O O   . LEU A 1 309 ? 92.722  54.863 -35.258 1.00 38.44  ? 309 LEU A O   1 
ATOM   2339 C CB  . LEU A 1 309 ? 90.892  56.267 -33.356 1.00 33.89  ? 309 LEU A CB  1 
ATOM   2340 C CG  . LEU A 1 309 ? 91.457  55.003 -32.704 1.00 31.10  ? 309 LEU A CG  1 
ATOM   2341 C CD1 . LEU A 1 309 ? 92.754  55.290 -32.015 1.00 28.37  ? 309 LEU A CD1 1 
ATOM   2342 C CD2 . LEU A 1 309 ? 90.468  54.521 -31.673 1.00 32.22  ? 309 LEU A CD2 1 
ATOM   2343 N N   . ARG A 1 310 ? 91.059  55.431 -36.612 1.00 37.93  ? 310 ARG A N   1 
ATOM   2344 C CA  . ARG A 1 310 ? 91.416  54.328 -37.489 1.00 42.03  ? 310 ARG A CA  1 
ATOM   2345 C C   . ARG A 1 310 ? 92.658  54.803 -38.252 1.00 45.95  ? 310 ARG A C   1 
ATOM   2346 O O   . ARG A 1 310 ? 93.623  54.046 -38.424 1.00 50.66  ? 310 ARG A O   1 
ATOM   2347 C CB  . ARG A 1 310 ? 90.294  53.928 -38.462 1.00 37.59  ? 310 ARG A CB  1 
ATOM   2348 C CG  . ARG A 1 310 ? 90.559  52.524 -39.040 1.00 41.87  ? 310 ARG A CG  1 
ATOM   2349 C CD  . ARG A 1 310 ? 89.601  52.087 -40.153 1.00 46.39  ? 310 ARG A CD  1 
ATOM   2350 N NE  . ARG A 1 310 ? 89.748  52.865 -41.382 1.00 51.48  ? 310 ARG A NE  1 
ATOM   2351 C CZ  . ARG A 1 310 ? 90.302  52.433 -42.513 1.00 50.38  ? 310 ARG A CZ  1 
ATOM   2352 N NH1 . ARG A 1 310 ? 90.737  51.190 -42.630 1.00 50.61  ? 310 ARG A NH1 1 
ATOM   2353 N NH2 . ARG A 1 310 ? 90.379  53.252 -43.555 1.00 52.80  ? 310 ARG A NH2 1 
ATOM   2354 N N   . GLU A 1 311 ? 92.643  56.089 -38.611 1.00 46.47  ? 311 GLU A N   1 
ATOM   2355 C CA  . GLU A 1 311 ? 93.733  56.754 -39.326 1.00 46.72  ? 311 GLU A CA  1 
ATOM   2356 C C   . GLU A 1 311 ? 94.960  56.909 -38.455 1.00 46.60  ? 311 GLU A C   1 
ATOM   2357 O O   . GLU A 1 311 ? 96.083  56.766 -38.922 1.00 46.93  ? 311 GLU A O   1 
ATOM   2358 C CB  . GLU A 1 311 ? 93.315  58.156 -39.761 1.00 49.10  ? 311 GLU A CB  1 
ATOM   2359 C CG  . GLU A 1 311 ? 94.472  59.040 -40.200 1.00 48.47  ? 311 GLU A CG  1 
ATOM   2360 C CD  . GLU A 1 311 ? 94.115  60.506 -40.178 1.00 52.41  ? 311 GLU A CD  1 
ATOM   2361 O OE1 . GLU A 1 311 ? 94.118  61.105 -39.075 1.00 51.05  ? 311 GLU A OE1 1 
ATOM   2362 O OE2 . GLU A 1 311 ? 93.836  61.056 -41.264 1.00 55.04  ? 311 GLU A OE2 1 
ATOM   2363 N N   . THR A 1 312 ? 94.737  57.316 -37.214 1.00 46.29  ? 312 THR A N   1 
ATOM   2364 C CA  . THR A 1 312 ? 95.828  57.502 -36.283 1.00 46.72  ? 312 THR A CA  1 
ATOM   2365 C C   . THR A 1 312 ? 96.331  56.219 -35.616 1.00 43.10  ? 312 THR A C   1 
ATOM   2366 O O   . THR A 1 312 ? 97.526  56.065 -35.396 1.00 48.53  ? 312 THR A O   1 
ATOM   2367 C CB  . THR A 1 312 ? 95.498  58.603 -35.248 1.00 49.33  ? 312 THR A CB  1 
ATOM   2368 O OG1 . THR A 1 312 ? 94.078  58.675 -35.032 1.00 56.63  ? 312 THR A OG1 1 
ATOM   2369 C CG2 . THR A 1 312 ? 95.965  59.947 -35.751 1.00 52.40  ? 312 THR A CG2 1 
ATOM   2370 N N   . ASN A 1 313 ? 95.448  55.271 -35.352 1.00 35.91  ? 313 ASN A N   1 
ATOM   2371 C CA  . ASN A 1 313 ? 95.871  54.033 -34.715 1.00 30.41  ? 313 ASN A CA  1 
ATOM   2372 C C   . ASN A 1 313 ? 94.845  52.899 -34.873 1.00 32.11  ? 313 ASN A C   1 
ATOM   2373 O O   . ASN A 1 313 ? 94.145  52.512 -33.931 1.00 33.34  ? 313 ASN A O   1 
ATOM   2374 C CB  . ASN A 1 313 ? 96.190  54.301 -33.252 1.00 26.44  ? 313 ASN A CB  1 
ATOM   2375 C CG  . ASN A 1 313 ? 96.821  53.122 -32.562 1.00 27.26  ? 313 ASN A CG  1 
ATOM   2376 O OD1 . ASN A 1 313 ? 97.135  53.233 -31.360 1.00 31.44  ? 313 ASN A OD1 1 
ATOM   2377 N ND2 . ASN A 1 313 ? 96.999  52.065 -33.187 1.00 30.28  ? 313 ASN A ND2 1 
ATOM   2378 N N   . HIS A 1 314 ? 94.794  52.357 -36.083 1.00 31.31  ? 314 HIS A N   1 
ATOM   2379 C CA  . HIS A 1 314 ? 93.902  51.270 -36.430 1.00 33.89  ? 314 HIS A CA  1 
ATOM   2380 C C   . HIS A 1 314 ? 94.046  50.015 -35.558 1.00 36.13  ? 314 HIS A C   1 
ATOM   2381 O O   . HIS A 1 314 ? 93.092  49.245 -35.383 1.00 37.47  ? 314 HIS A O   1 
ATOM   2382 C CB  . HIS A 1 314 ? 94.094  50.933 -37.895 1.00 34.21  ? 314 HIS A CB  1 
ATOM   2383 C CG  . HIS A 1 314 ? 93.450  49.651 -38.316 1.00 38.66  ? 314 HIS A CG  1 
ATOM   2384 N ND1 . HIS A 1 314 ? 94.131  48.457 -38.352 1.00 37.67  ? 314 HIS A ND1 1 
ATOM   2385 C CD2 . HIS A 1 314 ? 92.208  49.389 -38.782 1.00 37.91  ? 314 HIS A CD2 1 
ATOM   2386 C CE1 . HIS A 1 314 ? 93.343  47.514 -38.829 1.00 33.01  ? 314 HIS A CE1 1 
ATOM   2387 N NE2 . HIS A 1 314 ? 92.168  48.054 -39.099 1.00 34.03  ? 314 HIS A NE2 1 
ATOM   2388 N N   . GLN A 1 315 ? 95.232  49.793 -35.020 1.00 31.41  ? 315 GLN A N   1 
ATOM   2389 C CA  . GLN A 1 315 ? 95.453  48.639 -34.168 1.00 28.68  ? 315 GLN A CA  1 
ATOM   2390 C C   . GLN A 1 315 ? 94.579  48.764 -32.922 1.00 29.49  ? 315 GLN A C   1 
ATOM   2391 O O   . GLN A 1 315 ? 94.024  47.786 -32.433 1.00 30.92  ? 315 GLN A O   1 
ATOM   2392 C CB  . GLN A 1 315 ? 96.926  48.602 -33.758 1.00 25.24  ? 315 GLN A CB  1 
ATOM   2393 C CG  . GLN A 1 315 ? 97.277  47.698 -32.576 1.00 22.28  ? 315 GLN A CG  1 
ATOM   2394 C CD  . GLN A 1 315 ? 97.349  46.239 -32.930 1.00 23.12  ? 315 GLN A CD  1 
ATOM   2395 O OE1 . GLN A 1 315 ? 97.673  45.924 -34.100 1.00 30.81  ? 315 GLN A OE1 1 
ATOM   2396 N NE2 . GLN A 1 315 ? 97.111  45.416 -32.023 1.00 24.32  ? 315 GLN A NE2 1 
ATOM   2397 N N   . ARG A 1 316 ? 94.544  49.978 -32.386 1.00 32.82  ? 316 ARG A N   1 
ATOM   2398 C CA  . ARG A 1 316 ? 93.810  50.335 -31.172 1.00 34.26  ? 316 ARG A CA  1 
ATOM   2399 C C   . ARG A 1 316 ? 92.309  50.310 -31.475 1.00 37.33  ? 316 ARG A C   1 
ATOM   2400 O O   . ARG A 1 316 ? 91.467  49.906 -30.649 1.00 35.14  ? 316 ARG A O   1 
ATOM   2401 C CB  . ARG A 1 316 ? 94.232  51.753 -30.784 1.00 31.77  ? 316 ARG A CB  1 
ATOM   2402 C CG  . ARG A 1 316 ? 93.487  52.350 -29.631 1.00 30.34  ? 316 ARG A CG  1 
ATOM   2403 C CD  . ARG A 1 316 ? 93.882  51.654 -28.384 1.00 34.49  ? 316 ARG A CD  1 
ATOM   2404 N NE  . ARG A 1 316 ? 94.365  52.645 -27.446 1.00 40.71  ? 316 ARG A NE  1 
ATOM   2405 C CZ  . ARG A 1 316 ? 95.461  52.518 -26.714 1.00 43.62  ? 316 ARG A CZ  1 
ATOM   2406 N NH1 . ARG A 1 316 ? 96.205  51.428 -26.798 1.00 48.86  ? 316 ARG A NH1 1 
ATOM   2407 N NH2 . ARG A 1 316 ? 95.810  53.494 -25.884 1.00 49.88  ? 316 ARG A NH2 1 
ATOM   2408 N N   . TYR A 1 317 ? 92.012  50.801 -32.674 1.00 36.04  ? 317 TYR A N   1 
ATOM   2409 C CA  . TYR A 1 317 ? 90.681  50.895 -33.225 1.00 31.76  ? 317 TYR A CA  1 
ATOM   2410 C C   . TYR A 1 317 ? 90.000  49.539 -33.149 1.00 30.99  ? 317 TYR A C   1 
ATOM   2411 O O   . TYR A 1 317 ? 88.898  49.433 -32.588 1.00 28.88  ? 317 TYR A O   1 
ATOM   2412 C CB  . TYR A 1 317 ? 90.836  51.349 -34.661 1.00 30.76  ? 317 TYR A CB  1 
ATOM   2413 C CG  . TYR A 1 317 ? 89.598  51.741 -35.383 1.00 29.97  ? 317 TYR A CG  1 
ATOM   2414 C CD1 . TYR A 1 317 ? 88.888  52.892 -35.014 1.00 29.79  ? 317 TYR A CD1 1 
ATOM   2415 C CD2 . TYR A 1 317 ? 89.167  51.001 -36.488 1.00 29.44  ? 317 TYR A CD2 1 
ATOM   2416 C CE1 . TYR A 1 317 ? 87.765  53.304 -35.736 1.00 33.99  ? 317 TYR A CE1 1 
ATOM   2417 C CE2 . TYR A 1 317 ? 88.059  51.396 -37.221 1.00 35.59  ? 317 TYR A CE2 1 
ATOM   2418 C CZ  . TYR A 1 317 ? 87.354  52.552 -36.849 1.00 37.78  ? 317 TYR A CZ  1 
ATOM   2419 O OH  . TYR A 1 317 ? 86.277  52.964 -37.617 1.00 35.57  ? 317 TYR A OH  1 
ATOM   2420 N N   . ILE A 1 318 ? 90.702  48.500 -33.620 1.00 29.66  ? 318 ILE A N   1 
ATOM   2421 C CA  . ILE A 1 318 ? 90.169  47.138 -33.636 1.00 27.72  ? 318 ILE A CA  1 
ATOM   2422 C C   . ILE A 1 318 ? 90.046  46.538 -32.255 1.00 30.47  ? 318 ILE A C   1 
ATOM   2423 O O   . ILE A 1 318 ? 89.117  45.778 -31.993 1.00 30.88  ? 318 ILE A O   1 
ATOM   2424 C CB  . ILE A 1 318 ? 90.950  46.195 -34.563 1.00 24.50  ? 318 ILE A CB  1 
ATOM   2425 C CG1 . ILE A 1 318 ? 90.768  46.609 -36.023 1.00 25.70  ? 318 ILE A CG1 1 
ATOM   2426 C CG2 . ILE A 1 318 ? 90.448  44.771 -34.413 1.00 23.76  ? 318 ILE A CG2 1 
ATOM   2427 C CD1 . ILE A 1 318 ? 89.402  46.328 -36.623 1.00 22.43  ? 318 ILE A CD1 1 
ATOM   2428 N N   . SER A 1 319 ? 90.946  46.910 -31.354 1.00 33.22  ? 319 SER A N   1 
ATOM   2429 C CA  . SER A 1 319 ? 90.886  46.400 -29.984 1.00 34.52  ? 319 SER A CA  1 
ATOM   2430 C C   . SER A 1 319 ? 89.742  47.015 -29.197 1.00 31.62  ? 319 SER A C   1 
ATOM   2431 O O   . SER A 1 319 ? 89.132  46.346 -28.387 1.00 32.94  ? 319 SER A O   1 
ATOM   2432 C CB  . SER A 1 319 ? 92.219  46.610 -29.274 1.00 32.01  ? 319 SER A CB  1 
ATOM   2433 O OG  . SER A 1 319 ? 93.220  45.864 -29.938 1.00 32.92  ? 319 SER A OG  1 
ATOM   2434 N N   . TYR A 1 320 ? 89.473  48.296 -29.420 1.00 33.14  ? 320 TYR A N   1 
ATOM   2435 C CA  . TYR A 1 320 ? 88.354  48.992 -28.765 1.00 33.11  ? 320 TYR A CA  1 
ATOM   2436 C C   . TYR A 1 320 ? 87.073  48.272 -29.182 1.00 31.43  ? 320 TYR A C   1 
ATOM   2437 O O   . TYR A 1 320 ? 86.227  47.957 -28.346 1.00 31.64  ? 320 TYR A O   1 
ATOM   2438 C CB  . TYR A 1 320 ? 88.281  50.468 -29.221 1.00 30.00  ? 320 TYR A CB  1 
ATOM   2439 C CG  . TYR A 1 320 ? 89.224  51.408 -28.481 1.00 29.28  ? 320 TYR A CG  1 
ATOM   2440 C CD1 . TYR A 1 320 ? 89.689  51.094 -27.191 1.00 27.38  ? 320 TYR A CD1 1 
ATOM   2441 C CD2 . TYR A 1 320 ? 89.652  52.592 -29.055 1.00 25.57  ? 320 TYR A CD2 1 
ATOM   2442 C CE1 . TYR A 1 320 ? 90.533  51.931 -26.505 1.00 21.58  ? 320 TYR A CE1 1 
ATOM   2443 C CE2 . TYR A 1 320 ? 90.505  53.444 -28.372 1.00 26.37  ? 320 TYR A CE2 1 
ATOM   2444 C CZ  . TYR A 1 320 ? 90.943  53.103 -27.103 1.00 25.50  ? 320 TYR A CZ  1 
ATOM   2445 O OH  . TYR A 1 320 ? 91.778  53.945 -26.415 1.00 28.58  ? 320 TYR A OH  1 
ATOM   2446 N N   . ASN A 1 321 ? 86.981  47.989 -30.482 1.00 31.04  ? 321 ASN A N   1 
ATOM   2447 C CA  . ASN A 1 321 ? 85.856  47.292 -31.104 1.00 32.31  ? 321 ASN A CA  1 
ATOM   2448 C C   . ASN A 1 321 ? 85.621  45.911 -30.466 1.00 34.78  ? 321 ASN A C   1 
ATOM   2449 O O   . ASN A 1 321 ? 84.483  45.538 -30.158 1.00 32.57  ? 321 ASN A O   1 
ATOM   2450 C CB  . ASN A 1 321 ? 86.099  47.153 -32.620 1.00 33.19  ? 321 ASN A CB  1 
ATOM   2451 C CG  . ASN A 1 321 ? 84.899  46.593 -33.350 1.00 32.22  ? 321 ASN A CG  1 
ATOM   2452 O OD1 . ASN A 1 321 ? 83.787  47.008 -33.093 1.00 37.58  ? 321 ASN A OD1 1 
ATOM   2453 N ND2 . ASN A 1 321 ? 85.119  45.671 -34.276 1.00 31.24  ? 321 ASN A ND2 1 
ATOM   2454 N N   . ILE A 1 322 ? 86.695  45.158 -30.224 1.00 34.53  ? 322 ILE A N   1 
ATOM   2455 C CA  . ILE A 1 322 ? 86.512  43.850 -29.609 1.00 34.73  ? 322 ILE A CA  1 
ATOM   2456 C C   . ILE A 1 322 ? 86.211  43.939 -28.096 1.00 32.09  ? 322 ILE A C   1 
ATOM   2457 O O   . ILE A 1 322 ? 85.521  43.092 -27.520 1.00 30.18  ? 322 ILE A O   1 
ATOM   2458 C CB  . ILE A 1 322 ? 87.670  42.794 -29.966 1.00 36.57  ? 322 ILE A CB  1 
ATOM   2459 C CG1 . ILE A 1 322 ? 88.516  42.440 -28.772 1.00 33.30  ? 322 ILE A CG1 1 
ATOM   2460 C CG2 . ILE A 1 322 ? 88.536  43.225 -31.114 1.00 37.58  ? 322 ILE A CG2 1 
ATOM   2461 C CD1 . ILE A 1 322 ? 88.780  40.983 -28.789 1.00 40.75  ? 322 ILE A CD1 1 
ATOM   2462 N N   . ILE A 1 323 ? 86.686  44.995 -27.458 1.00 33.00  ? 323 ILE A N   1 
ATOM   2463 C CA  . ILE A 1 323 ? 86.431  45.177 -26.037 1.00 33.12  ? 323 ILE A CA  1 
ATOM   2464 C C   . ILE A 1 323 ? 84.938  45.443 -25.855 1.00 31.26  ? 323 ILE A C   1 
ATOM   2465 O O   . ILE A 1 323 ? 84.298  44.838 -25.007 1.00 32.07  ? 323 ILE A O   1 
ATOM   2466 C CB  . ILE A 1 323 ? 87.219  46.376 -25.477 1.00 33.00  ? 323 ILE A CB  1 
ATOM   2467 C CG1 . ILE A 1 323 ? 88.714  46.041 -25.392 1.00 38.39  ? 323 ILE A CG1 1 
ATOM   2468 C CG2 . ILE A 1 323 ? 86.678  46.758 -24.135 1.00 28.61  ? 323 ILE A CG2 1 
ATOM   2469 C CD1 . ILE A 1 323 ? 89.641  47.281 -25.208 1.00 40.84  ? 323 ILE A CD1 1 
ATOM   2470 N N   . ASP A 1 324 ? 84.399  46.343 -26.673 1.00 26.94  ? 324 ASP A N   1 
ATOM   2471 C CA  . ASP A 1 324 ? 82.989  46.728 -26.631 1.00 24.30  ? 324 ASP A CA  1 
ATOM   2472 C C   . ASP A 1 324 ? 82.066  45.520 -26.694 1.00 22.63  ? 324 ASP A C   1 
ATOM   2473 O O   . ASP A 1 324 ? 81.206  45.327 -25.853 1.00 23.66  ? 324 ASP A O   1 
ATOM   2474 C CB  . ASP A 1 324 ? 82.720  47.644 -27.805 1.00 23.07  ? 324 ASP A CB  1 
ATOM   2475 C CG  . ASP A 1 324 ? 83.285  49.031 -27.603 1.00 27.09  ? 324 ASP A CG  1 
ATOM   2476 O OD1 . ASP A 1 324 ? 83.657  49.390 -26.438 1.00 25.86  ? 324 ASP A OD1 1 
ATOM   2477 O OD2 . ASP A 1 324 ? 83.341  49.755 -28.616 1.00 22.77  ? 324 ASP A OD2 1 
ATOM   2478 N N   . VAL A 1 325 ? 82.312  44.682 -27.689 1.00 25.76  ? 325 VAL A N   1 
ATOM   2479 C CA  . VAL A 1 325 ? 81.573  43.441 -27.933 1.00 23.11  ? 325 VAL A CA  1 
ATOM   2480 C C   . VAL A 1 325 ? 81.679  42.411 -26.781 1.00 26.05  ? 325 VAL A C   1 
ATOM   2481 O O   . VAL A 1 325 ? 80.784  41.592 -26.576 1.00 30.34  ? 325 VAL A O   1 
ATOM   2482 C CB  . VAL A 1 325 ? 82.030  42.841 -29.286 1.00 18.16  ? 325 VAL A CB  1 
ATOM   2483 C CG1 . VAL A 1 325 ? 81.166  41.647 -29.683 1.00 19.89  ? 325 VAL A CG1 1 
ATOM   2484 C CG2 . VAL A 1 325 ? 81.964  43.906 -30.366 1.00 9.41   ? 325 VAL A CG2 1 
ATOM   2485 N N   . GLU A 1 326 ? 82.746  42.450 -26.001 1.00 26.47  ? 326 GLU A N   1 
ATOM   2486 C CA  . GLU A 1 326 ? 82.839  41.520 -24.895 1.00 27.63  ? 326 GLU A CA  1 
ATOM   2487 C C   . GLU A 1 326 ? 82.196  42.165 -23.667 1.00 29.39  ? 326 GLU A C   1 
ATOM   2488 O O   . GLU A 1 326 ? 81.802  41.474 -22.735 1.00 31.66  ? 326 GLU A O   1 
ATOM   2489 C CB  . GLU A 1 326 ? 84.297  41.132 -24.616 1.00 29.64  ? 326 GLU A CB  1 
ATOM   2490 C CG  . GLU A 1 326 ? 84.463  40.030 -23.540 1.00 24.62  ? 326 GLU A CG  1 
ATOM   2491 C CD  . GLU A 1 326 ? 84.421  40.554 -22.104 1.00 30.92  ? 326 GLU A CD  1 
ATOM   2492 O OE1 . GLU A 1 326 ? 84.447  41.796 -21.895 1.00 29.87  ? 326 GLU A OE1 1 
ATOM   2493 O OE2 . GLU A 1 326 ? 84.371  39.713 -21.170 1.00 36.45  ? 326 GLU A OE2 1 
ATOM   2494 N N   . SER A 1 327 ? 82.096  43.494 -23.659 1.00 33.52  ? 327 SER A N   1 
ATOM   2495 C CA  . SER A 1 327 ? 81.474  44.206 -22.540 1.00 32.89  ? 327 SER A CA  1 
ATOM   2496 C C   . SER A 1 327 ? 80.063  43.688 -22.358 1.00 29.33  ? 327 SER A C   1 
ATOM   2497 O O   . SER A 1 327 ? 79.661  43.347 -21.252 1.00 30.28  ? 327 SER A O   1 
ATOM   2498 C CB  . SER A 1 327 ? 81.433  45.713 -22.788 1.00 35.61  ? 327 SER A CB  1 
ATOM   2499 O OG  . SER A 1 327 ? 82.670  46.323 -22.437 1.00 43.51  ? 327 SER A OG  1 
ATOM   2500 N N   . VAL A 1 328 ? 79.361  43.533 -23.474 1.00 25.27  ? 328 VAL A N   1 
ATOM   2501 C CA  . VAL A 1 328 ? 78.001  43.034 -23.466 1.00 24.40  ? 328 VAL A CA  1 
ATOM   2502 C C   . VAL A 1 328 ? 77.882  41.646 -22.837 1.00 27.97  ? 328 VAL A C   1 
ATOM   2503 O O   . VAL A 1 328 ? 77.044  41.421 -21.924 1.00 28.59  ? 328 VAL A O   1 
ATOM   2504 C CB  . VAL A 1 328 ? 77.419  43.069 -24.860 1.00 24.90  ? 328 VAL A CB  1 
ATOM   2505 C CG1 . VAL A 1 328 ? 76.097  42.313 -24.910 1.00 23.34  ? 328 VAL A CG1 1 
ATOM   2506 C CG2 . VAL A 1 328 ? 77.254  44.529 -25.281 1.00 21.95  ? 328 VAL A CG2 1 
ATOM   2507 N N   . GLN A 1 329 ? 78.722  40.718 -23.284 1.00 25.26  ? 329 GLN A N   1 
ATOM   2508 C CA  . GLN A 1 329 ? 78.687  39.380 -22.715 1.00 25.53  ? 329 GLN A CA  1 
ATOM   2509 C C   . GLN A 1 329 ? 79.086  39.404 -21.221 1.00 28.42  ? 329 GLN A C   1 
ATOM   2510 O O   . GLN A 1 329 ? 78.616  38.596 -20.410 1.00 28.71  ? 329 GLN A O   1 
ATOM   2511 C CB  . GLN A 1 329 ? 79.586  38.441 -23.522 1.00 27.98  ? 329 GLN A CB  1 
ATOM   2512 C CG  . GLN A 1 329 ? 79.026  38.091 -24.907 1.00 33.59  ? 329 GLN A CG  1 
ATOM   2513 C CD  . GLN A 1 329 ? 77.596  37.504 -24.855 1.00 36.71  ? 329 GLN A CD  1 
ATOM   2514 O OE1 . GLN A 1 329 ? 77.248  36.752 -23.951 1.00 41.21  ? 329 GLN A OE1 1 
ATOM   2515 N NE2 . GLN A 1 329 ? 76.769  37.865 -25.836 1.00 32.08  ? 329 GLN A NE2 1 
ATOM   2516 N N   . ALA A 1 330 ? 79.925  40.368 -20.854 1.00 27.65  ? 330 ALA A N   1 
ATOM   2517 C CA  . ALA A 1 330 ? 80.388  40.484 -19.490 1.00 24.74  ? 330 ALA A CA  1 
ATOM   2518 C C   . ALA A 1 330 ? 79.221  40.917 -18.654 1.00 24.61  ? 330 ALA A C   1 
ATOM   2519 O O   . ALA A 1 330 ? 78.906  40.305 -17.636 1.00 28.13  ? 330 ALA A O   1 
ATOM   2520 C CB  . ALA A 1 330 ? 81.488  41.503 -19.417 1.00 28.63  ? 330 ALA A CB  1 
ATOM   2521 N N   . ILE A 1 331 ? 78.628  42.031 -19.050 1.00 26.38  ? 331 ILE A N   1 
ATOM   2522 C CA  . ILE A 1 331 ? 77.452  42.594 -18.370 1.00 30.43  ? 331 ILE A CA  1 
ATOM   2523 C C   . ILE A 1 331 ? 76.368  41.503 -18.278 1.00 27.77  ? 331 ILE A C   1 
ATOM   2524 O O   . ILE A 1 331 ? 75.795  41.257 -17.196 1.00 22.51  ? 331 ILE A O   1 
ATOM   2525 C CB  . ILE A 1 331 ? 76.876  43.854 -19.145 1.00 31.52  ? 331 ILE A CB  1 
ATOM   2526 C CG1 . ILE A 1 331 ? 77.814  45.066 -18.997 1.00 23.35  ? 331 ILE A CG1 1 
ATOM   2527 C CG2 . ILE A 1 331 ? 75.476  44.209 -18.632 1.00 33.65  ? 331 ILE A CG2 1 
ATOM   2528 C CD1 . ILE A 1 331 ? 77.516  46.160 -19.996 1.00 14.73  ? 331 ILE A CD1 1 
ATOM   2529 N N   . ASP A 1 332 ? 76.138  40.814 -19.392 1.00 23.21  ? 332 ASP A N   1 
ATOM   2530 C CA  . ASP A 1 332 ? 75.158  39.773 -19.365 1.00 31.18  ? 332 ASP A CA  1 
ATOM   2531 C C   . ASP A 1 332 ? 75.531  38.721 -18.338 1.00 39.14  ? 332 ASP A C   1 
ATOM   2532 O O   . ASP A 1 332 ? 74.662  38.208 -17.616 1.00 42.17  ? 332 ASP A O   1 
ATOM   2533 C CB  . ASP A 1 332 ? 74.978  39.109 -20.714 1.00 29.84  ? 332 ASP A CB  1 
ATOM   2534 C CG  . ASP A 1 332 ? 73.847  38.078 -20.692 1.00 38.24  ? 332 ASP A CG  1 
ATOM   2535 O OD1 . ASP A 1 332 ? 72.856  38.291 -19.949 1.00 33.92  ? 332 ASP A OD1 1 
ATOM   2536 O OD2 . ASP A 1 332 ? 73.961  37.043 -21.389 1.00 40.89  ? 332 ASP A OD2 1 
ATOM   2537 N N   . LYS A 1 333 ? 76.827  38.416 -18.257 1.00 43.39  ? 333 LYS A N   1 
ATOM   2538 C CA  . LYS A 1 333 ? 77.317  37.408 -17.328 1.00 42.98  ? 333 LYS A CA  1 
ATOM   2539 C C   . LYS A 1 333 ? 77.013  37.791 -15.901 1.00 40.46  ? 333 LYS A C   1 
ATOM   2540 O O   . LYS A 1 333 ? 76.664  36.952 -15.079 1.00 43.75  ? 333 LYS A O   1 
ATOM   2541 C CB  . LYS A 1 333 ? 78.811  37.172 -17.533 1.00 45.48  ? 333 LYS A CB  1 
ATOM   2542 C CG  . LYS A 1 333 ? 79.417  36.179 -16.561 1.00 52.14  ? 333 LYS A CG  1 
ATOM   2543 C CD  . LYS A 1 333 ? 80.421  35.297 -17.271 1.00 61.03  ? 333 LYS A CD  1 
ATOM   2544 C CE  . LYS A 1 333 ? 81.428  36.115 -18.104 1.00 65.98  ? 333 LYS A CE  1 
ATOM   2545 N NZ  . LYS A 1 333 ? 82.400  36.972 -17.314 1.00 68.60  ? 333 LYS A NZ  1 
ATOM   2546 N N   . ILE A 1 334 ? 77.128  39.073 -15.612 1.00 40.96  ? 334 ILE A N   1 
ATOM   2547 C CA  . ILE A 1 334 ? 76.854  39.562 -14.278 1.00 39.75  ? 334 ILE A CA  1 
ATOM   2548 C C   . ILE A 1 334 ? 75.354  39.569 -14.039 1.00 41.17  ? 334 ILE A C   1 
ATOM   2549 O O   . ILE A 1 334 ? 74.870  38.901 -13.123 1.00 43.31  ? 334 ILE A O   1 
ATOM   2550 C CB  . ILE A 1 334 ? 77.408  40.983 -14.098 1.00 40.34  ? 334 ILE A CB  1 
ATOM   2551 C CG1 . ILE A 1 334 ? 78.932  40.949 -14.149 1.00 37.98  ? 334 ILE A CG1 1 
ATOM   2552 C CG2 . ILE A 1 334 ? 76.925  41.584 -12.788 1.00 37.14  ? 334 ILE A CG2 1 
ATOM   2553 C CD1 . ILE A 1 334 ? 79.543  42.249 -14.601 1.00 39.40  ? 334 ILE A CD1 1 
ATOM   2554 N N   . ARG A 1 335 ? 74.618  40.237 -14.930 1.00 41.03  ? 335 ARG A N   1 
ATOM   2555 C CA  . ARG A 1 335 ? 73.161  40.386 -14.796 1.00 38.77  ? 335 ARG A CA  1 
ATOM   2556 C C   . ARG A 1 335 ? 72.180  39.247 -15.093 1.00 39.27  ? 335 ARG A C   1 
ATOM   2557 O O   . ARG A 1 335 ? 71.091  39.228 -14.519 1.00 39.38  ? 335 ARG A O   1 
ATOM   2558 C CB  . ARG A 1 335 ? 72.715  41.650 -15.495 1.00 30.28  ? 335 ARG A CB  1 
ATOM   2559 C CG  . ARG A 1 335 ? 73.248  42.867 -14.833 1.00 22.84  ? 335 ARG A CG  1 
ATOM   2560 C CD  . ARG A 1 335 ? 72.878  42.898 -13.367 1.00 28.36  ? 335 ARG A CD  1 
ATOM   2561 N NE  . ARG A 1 335 ? 73.111  44.229 -12.833 1.00 36.90  ? 335 ARG A NE  1 
ATOM   2562 C CZ  . ARG A 1 335 ? 72.187  44.999 -12.264 1.00 44.00  ? 335 ARG A CZ  1 
ATOM   2563 N NH1 . ARG A 1 335 ? 70.939  44.568 -12.131 1.00 51.30  ? 335 ARG A NH1 1 
ATOM   2564 N NH2 . ARG A 1 335 ? 72.513  46.212 -11.819 1.00 46.83  ? 335 ARG A NH2 1 
ATOM   2565 N N   . GLY A 1 336 ? 72.555  38.321 -15.975 1.00 40.51  ? 336 GLY A N   1 
ATOM   2566 C CA  . GLY A 1 336 ? 71.705  37.182 -16.315 1.00 35.85  ? 336 GLY A CA  1 
ATOM   2567 C C   . GLY A 1 336 ? 70.405  37.461 -17.051 1.00 37.45  ? 336 GLY A C   1 
ATOM   2568 O O   . GLY A 1 336 ? 69.498  36.634 -17.040 1.00 42.68  ? 336 GLY A O   1 
ATOM   2569 N N   . PHE A 1 337 ? 70.341  38.566 -17.783 1.00 32.22  ? 337 PHE A N   1 
ATOM   2570 C CA  . PHE A 1 337 ? 69.125  38.916 -18.491 1.00 27.38  ? 337 PHE A CA  1 
ATOM   2571 C C   . PHE A 1 337 ? 68.709  38.006 -19.644 1.00 29.12  ? 337 PHE A C   1 
ATOM   2572 O O   . PHE A 1 337 ? 67.518  37.751 -19.822 1.00 37.46  ? 337 PHE A O   1 
ATOM   2573 C CB  . PHE A 1 337 ? 69.157  40.387 -18.914 1.00 26.19  ? 337 PHE A CB  1 
ATOM   2574 C CG  . PHE A 1 337 ? 69.274  41.351 -17.752 1.00 19.36  ? 337 PHE A CG  1 
ATOM   2575 C CD1 . PHE A 1 337 ? 68.891  40.971 -16.485 1.00 19.04  ? 337 PHE A CD1 1 
ATOM   2576 C CD2 . PHE A 1 337 ? 69.777  42.629 -17.943 1.00 21.99  ? 337 PHE A CD2 1 
ATOM   2577 C CE1 . PHE A 1 337 ? 69.006  41.840 -15.416 1.00 21.99  ? 337 PHE A CE1 1 
ATOM   2578 C CE2 . PHE A 1 337 ? 69.896  43.512 -16.890 1.00 20.05  ? 337 PHE A CE2 1 
ATOM   2579 C CZ  . PHE A 1 337 ? 69.513  43.123 -15.622 1.00 22.13  ? 337 PHE A CZ  1 
ATOM   2580 N N   . ILE A 1 338 ? 69.657  37.530 -20.440 1.00 28.19  ? 338 ILE A N   1 
ATOM   2581 C CA  . ILE A 1 338 ? 69.327  36.626 -21.537 1.00 30.86  ? 338 ILE A CA  1 
ATOM   2582 C C   . ILE A 1 338 ? 68.654  35.370 -20.920 1.00 31.68  ? 338 ILE A C   1 
ATOM   2583 O O   . ILE A 1 338 ? 67.686  34.818 -21.462 1.00 31.49  ? 338 ILE A O   1 
ATOM   2584 C CB  . ILE A 1 338 ? 70.601  36.255 -22.403 1.00 30.05  ? 338 ILE A CB  1 
ATOM   2585 C CG1 . ILE A 1 338 ? 71.149  37.492 -23.128 1.00 24.44  ? 338 ILE A CG1 1 
ATOM   2586 C CG2 . ILE A 1 338 ? 70.258  35.190 -23.466 1.00 29.68  ? 338 ILE A CG2 1 
ATOM   2587 C CD1 . ILE A 1 338 ? 70.186  38.117 -24.100 1.00 23.58  ? 338 ILE A CD1 1 
ATOM   2588 N N   . ASP A 1 339 ? 69.141  34.949 -19.761 1.00 32.61  ? 339 ASP A N   1 
ATOM   2589 C CA  . ASP A 1 339 ? 68.551  33.809 -19.064 1.00 37.96  ? 339 ASP A CA  1 
ATOM   2590 C C   . ASP A 1 339 ? 67.084  34.097 -18.662 1.00 37.16  ? 339 ASP A C   1 
ATOM   2591 O O   . ASP A 1 339 ? 66.220  33.221 -18.789 1.00 37.12  ? 339 ASP A O   1 
ATOM   2592 C CB  . ASP A 1 339 ? 69.368  33.451 -17.812 1.00 39.69  ? 339 ASP A CB  1 
ATOM   2593 C CG  . ASP A 1 339 ? 70.626  32.623 -18.128 1.00 46.01  ? 339 ASP A CG  1 
ATOM   2594 O OD1 . ASP A 1 339 ? 70.820  32.205 -19.307 1.00 42.15  ? 339 ASP A OD1 1 
ATOM   2595 O OD2 . ASP A 1 339 ? 71.406  32.381 -17.174 1.00 45.61  ? 339 ASP A OD2 1 
ATOM   2596 N N   . LEU A 1 340 ? 66.825  35.297 -18.139 1.00 35.41  ? 340 LEU A N   1 
ATOM   2597 C CA  . LEU A 1 340 ? 65.470  35.699 -17.742 1.00 34.45  ? 340 LEU A CA  1 
ATOM   2598 C C   . LEU A 1 340 ? 64.510  35.646 -18.955 1.00 31.48  ? 340 LEU A C   1 
ATOM   2599 O O   . LEU A 1 340 ? 63.472  34.997 -18.897 1.00 27.88  ? 340 LEU A O   1 
ATOM   2600 C CB  . LEU A 1 340 ? 65.508  37.099 -17.111 1.00 32.76  ? 340 LEU A CB  1 
ATOM   2601 C CG  . LEU A 1 340 ? 64.192  37.652 -16.550 1.00 28.09  ? 340 LEU A CG  1 
ATOM   2602 C CD1 . LEU A 1 340 ? 63.580  36.614 -15.642 1.00 26.10  ? 340 LEU A CD1 1 
ATOM   2603 C CD2 . LEU A 1 340 ? 64.451  38.952 -15.810 1.00 20.36  ? 340 LEU A CD2 1 
ATOM   2604 N N   . VAL A 1 341 ? 64.924  36.232 -20.080 1.00 28.70  ? 341 VAL A N   1 
ATOM   2605 C CA  . VAL A 1 341 ? 64.117  36.234 -21.294 1.00 27.69  ? 341 VAL A CA  1 
ATOM   2606 C C   . VAL A 1 341 ? 63.645  34.814 -21.622 1.00 29.86  ? 341 VAL A C   1 
ATOM   2607 O O   . VAL A 1 341 ? 62.512  34.618 -22.046 1.00 36.34  ? 341 VAL A O   1 
ATOM   2608 C CB  . VAL A 1 341 ? 64.924  36.762 -22.542 1.00 28.49  ? 341 VAL A CB  1 
ATOM   2609 C CG1 . VAL A 1 341 ? 64.054  36.700 -23.816 1.00 24.71  ? 341 VAL A CG1 1 
ATOM   2610 C CG2 . VAL A 1 341 ? 65.449  38.191 -22.317 1.00 27.39  ? 341 VAL A CG2 1 
ATOM   2611 N N   . LEU A 1 342 ? 64.538  33.846 -21.451 1.00 30.83  ? 342 LEU A N   1 
ATOM   2612 C CA  . LEU A 1 342 ? 64.304  32.437 -21.747 1.00 27.35  ? 342 LEU A CA  1 
ATOM   2613 C C   . LEU A 1 342 ? 63.400  31.789 -20.748 1.00 25.66  ? 342 LEU A C   1 
ATOM   2614 O O   . LEU A 1 342 ? 62.638  30.909 -21.094 1.00 26.80  ? 342 LEU A O   1 
ATOM   2615 C CB  . LEU A 1 342 ? 65.632  31.666 -21.725 1.00 27.14  ? 342 LEU A CB  1 
ATOM   2616 C CG  . LEU A 1 342 ? 66.718  31.904 -22.765 1.00 22.89  ? 342 LEU A CG  1 
ATOM   2617 C CD1 . LEU A 1 342 ? 67.855  30.954 -22.429 1.00 30.20  ? 342 LEU A CD1 1 
ATOM   2618 C CD2 . LEU A 1 342 ? 66.214  31.620 -24.196 1.00 17.26  ? 342 LEU A CD2 1 
ATOM   2619 N N   . SER A 1 343 ? 63.618  32.089 -19.480 1.00 27.42  ? 343 SER A N   1 
ATOM   2620 C CA  . SER A 1 343 ? 62.757  31.522 -18.463 1.00 36.21  ? 343 SER A CA  1 
ATOM   2621 C C   . SER A 1 343 ? 61.355  32.121 -18.736 1.00 38.02  ? 343 SER A C   1 
ATOM   2622 O O   . SER A 1 343 ? 60.445  31.407 -19.178 1.00 41.66  ? 343 SER A O   1 
ATOM   2623 C CB  . SER A 1 343 ? 63.283  31.852 -17.056 1.00 35.41  ? 343 SER A CB  1 
ATOM   2624 O OG  . SER A 1 343 ? 63.623  33.222 -16.936 1.00 46.28  ? 343 SER A OG  1 
ATOM   2625 N N   . MET A 1 344 ? 61.239  33.444 -18.612 1.00 35.68  ? 344 MET A N   1 
ATOM   2626 C CA  . MET A 1 344 ? 60.002  34.152 -18.877 1.00 33.49  ? 344 MET A CA  1 
ATOM   2627 C C   . MET A 1 344 ? 59.307  33.689 -20.170 1.00 34.27  ? 344 MET A C   1 
ATOM   2628 O O   . MET A 1 344 ? 58.101  33.425 -20.181 1.00 37.19  ? 344 MET A O   1 
ATOM   2629 C CB  . MET A 1 344 ? 60.264  35.653 -18.938 1.00 31.14  ? 344 MET A CB  1 
ATOM   2630 C CG  . MET A 1 344 ? 60.195  36.356 -17.616 1.00 27.84  ? 344 MET A CG  1 
ATOM   2631 S SD  . MET A 1 344 ? 60.572  38.107 -17.816 1.00 27.20  ? 344 MET A SD  1 
ATOM   2632 C CE  . MET A 1 344 ? 58.923  38.846 -18.311 1.00 29.27  ? 344 MET A CE  1 
ATOM   2633 N N   . SER A 1 345 ? 60.053  33.556 -21.254 1.00 32.03  ? 345 SER A N   1 
ATOM   2634 C CA  . SER A 1 345 ? 59.428  33.124 -22.482 1.00 32.47  ? 345 SER A CA  1 
ATOM   2635 C C   . SER A 1 345 ? 58.884  31.704 -22.409 1.00 35.26  ? 345 SER A C   1 
ATOM   2636 O O   . SER A 1 345 ? 57.682  31.488 -22.630 1.00 38.25  ? 345 SER A O   1 
ATOM   2637 C CB  . SER A 1 345 ? 60.363  33.261 -23.684 1.00 24.27  ? 345 SER A CB  1 
ATOM   2638 O OG  . SER A 1 345 ? 60.615  34.612 -23.952 1.00 21.47  ? 345 SER A OG  1 
ATOM   2639 N N   . TYR A 1 346 ? 59.733  30.744 -22.055 1.00 34.67  ? 346 TYR A N   1 
ATOM   2640 C CA  . TYR A 1 346 ? 59.286  29.356 -22.025 1.00 35.14  ? 346 TYR A CA  1 
ATOM   2641 C C   . TYR A 1 346 ? 58.136  29.079 -21.054 1.00 34.59  ? 346 TYR A C   1 
ATOM   2642 O O   . TYR A 1 346 ? 57.281  28.227 -21.338 1.00 35.50  ? 346 TYR A O   1 
ATOM   2643 C CB  . TYR A 1 346 ? 60.468  28.384 -21.856 1.00 26.61  ? 346 TYR A CB  1 
ATOM   2644 C CG  . TYR A 1 346 ? 61.398  28.397 -23.064 1.00 31.28  ? 346 TYR A CG  1 
ATOM   2645 C CD1 . TYR A 1 346 ? 60.876  28.366 -24.356 1.00 27.39  ? 346 TYR A CD1 1 
ATOM   2646 C CD2 . TYR A 1 346 ? 62.799  28.505 -22.917 1.00 28.61  ? 346 TYR A CD2 1 
ATOM   2647 C CE1 . TYR A 1 346 ? 61.705  28.449 -25.481 1.00 33.29  ? 346 TYR A CE1 1 
ATOM   2648 C CE2 . TYR A 1 346 ? 63.644  28.586 -24.035 1.00 24.76  ? 346 TYR A CE2 1 
ATOM   2649 C CZ  . TYR A 1 346 ? 63.091  28.562 -25.317 1.00 34.25  ? 346 TYR A CZ  1 
ATOM   2650 O OH  . TYR A 1 346 ? 63.882  28.670 -26.451 1.00 32.75  ? 346 TYR A OH  1 
ATOM   2651 N N   . TYR A 1 347 ? 58.071  29.871 -19.980 1.00 33.05  ? 347 TYR A N   1 
ATOM   2652 C CA  . TYR A 1 347 ? 57.039  29.749 -18.951 1.00 35.11  ? 347 TYR A CA  1 
ATOM   2653 C C   . TYR A 1 347 ? 55.697  30.272 -19.426 1.00 37.13  ? 347 TYR A C   1 
ATOM   2654 O O   . TYR A 1 347 ? 54.656  29.650 -19.213 1.00 39.93  ? 347 TYR A O   1 
ATOM   2655 C CB  . TYR A 1 347 ? 57.446  30.522 -17.704 1.00 36.70  ? 347 TYR A CB  1 
ATOM   2656 C CG  . TYR A 1 347 ? 56.497  30.376 -16.535 1.00 41.82  ? 347 TYR A CG  1 
ATOM   2657 C CD1 . TYR A 1 347 ? 56.595  29.290 -15.673 1.00 42.66  ? 347 TYR A CD1 1 
ATOM   2658 C CD2 . TYR A 1 347 ? 55.551  31.363 -16.236 1.00 46.85  ? 347 TYR A CD2 1 
ATOM   2659 C CE1 . TYR A 1 347 ? 55.792  29.184 -14.533 1.00 42.16  ? 347 TYR A CE1 1 
ATOM   2660 C CE2 . TYR A 1 347 ? 54.729  31.261 -15.086 1.00 45.36  ? 347 TYR A CE2 1 
ATOM   2661 C CZ  . TYR A 1 347 ? 54.869  30.168 -14.242 1.00 42.20  ? 347 TYR A CZ  1 
ATOM   2662 O OH  . TYR A 1 347 ? 54.134  30.057 -13.088 1.00 38.99  ? 347 TYR A OH  1 
ATOM   2663 N N   . ALA A 1 348 ? 55.716  31.467 -19.989 1.00 35.33  ? 348 ALA A N   1 
ATOM   2664 C CA  . ALA A 1 348 ? 54.503  32.061 -20.479 1.00 32.95  ? 348 ALA A CA  1 
ATOM   2665 C C   . ALA A 1 348 ? 54.127  31.309 -21.729 1.00 35.15  ? 348 ALA A C   1 
ATOM   2666 O O   . ALA A 1 348 ? 52.953  31.269 -22.093 1.00 38.14  ? 348 ALA A O   1 
ATOM   2667 C CB  . ALA A 1 348 ? 54.718  33.550 -20.774 1.00 28.41  ? 348 ALA A CB  1 
ATOM   2668 N N   . LYS A 1 349 ? 55.121  30.659 -22.338 1.00 37.73  ? 349 LYS A N   1 
ATOM   2669 C CA  . LYS A 1 349 ? 54.945  29.916 -23.591 1.00 37.49  ? 349 LYS A CA  1 
ATOM   2670 C C   . LYS A 1 349 ? 54.637  30.943 -24.684 1.00 36.27  ? 349 LYS A C   1 
ATOM   2671 O O   . LYS A 1 349 ? 53.642  30.856 -25.418 1.00 35.81  ? 349 LYS A O   1 
ATOM   2672 C CB  . LYS A 1 349 ? 53.824  28.866 -23.476 1.00 39.25  ? 349 LYS A CB  1 
ATOM   2673 C CG  . LYS A 1 349 ? 54.021  27.896 -22.329 1.00 37.24  ? 349 LYS A CG  1 
ATOM   2674 C CD  . LYS A 1 349 ? 53.654  26.459 -22.702 1.00 33.51  ? 349 LYS A CD  1 
ATOM   2675 C CE  . LYS A 1 349 ? 53.827  25.561 -21.485 1.00 30.47  ? 349 LYS A CE  1 
ATOM   2676 N NZ  . LYS A 1 349 ? 53.527  24.155 -21.816 1.00 33.72  ? 349 LYS A NZ  1 
ATOM   2677 N N   . MET A 1 350 ? 55.539  31.912 -24.795 1.00 37.46  ? 350 MET A N   1 
ATOM   2678 C CA  . MET A 1 350 ? 55.420  33.005 -25.753 1.00 33.95  ? 350 MET A CA  1 
ATOM   2679 C C   . MET A 1 350 ? 56.782  33.295 -26.378 1.00 33.18  ? 350 MET A C   1 
ATOM   2680 O O   . MET A 1 350 ? 57.797  32.796 -25.935 1.00 36.74  ? 350 MET A O   1 
ATOM   2681 C CB  . MET A 1 350 ? 54.940  34.246 -25.014 1.00 31.39  ? 350 MET A CB  1 
ATOM   2682 C CG  . MET A 1 350 ? 55.780  34.546 -23.812 1.00 30.34  ? 350 MET A CG  1 
ATOM   2683 S SD  . MET A 1 350 ? 55.218  35.991 -22.950 1.00 34.33  ? 350 MET A SD  1 
ATOM   2684 C CE  . MET A 1 350 ? 55.065  37.068 -24.352 1.00 29.54  ? 350 MET A CE  1 
ATOM   2685 N N   . PRO A 1 351 ? 56.789  33.986 -27.509 1.00 32.05  ? 351 PRO A N   1 
ATOM   2686 C CA  . PRO A 1 351 ? 58.013  34.360 -28.228 1.00 32.91  ? 351 PRO A CA  1 
ATOM   2687 C C   . PRO A 1 351 ? 58.836  35.312 -27.366 1.00 33.96  ? 351 PRO A C   1 
ATOM   2688 O O   . PRO A 1 351 ? 58.263  36.194 -26.738 1.00 31.20  ? 351 PRO A O   1 
ATOM   2689 C CB  . PRO A 1 351 ? 57.462  35.063 -29.451 1.00 36.70  ? 351 PRO A CB  1 
ATOM   2690 C CG  . PRO A 1 351 ? 56.166  34.208 -29.751 1.00 35.82  ? 351 PRO A CG  1 
ATOM   2691 C CD  . PRO A 1 351 ? 55.587  34.104 -28.362 1.00 32.48  ? 351 PRO A CD  1 
ATOM   2692 N N   . PHE A 1 352 ? 60.172  35.172 -27.398 1.00 37.31  ? 352 PHE A N   1 
ATOM   2693 C CA  . PHE A 1 352 ? 61.114  35.970 -26.576 1.00 34.85  ? 352 PHE A CA  1 
ATOM   2694 C C   . PHE A 1 352 ? 60.836  37.475 -26.510 1.00 34.64  ? 352 PHE A C   1 
ATOM   2695 O O   . PHE A 1 352 ? 61.028  38.106 -25.477 1.00 32.90  ? 352 PHE A O   1 
ATOM   2696 C CB  . PHE A 1 352 ? 62.587  35.778 -27.029 1.00 33.93  ? 352 PHE A CB  1 
ATOM   2697 C CG  . PHE A 1 352 ? 63.027  34.335 -27.163 1.00 28.10  ? 352 PHE A CG  1 
ATOM   2698 C CD1 . PHE A 1 352 ? 62.679  33.386 -26.215 1.00 27.05  ? 352 PHE A CD1 1 
ATOM   2699 C CD2 . PHE A 1 352 ? 63.789  33.938 -28.256 1.00 27.79  ? 352 PHE A CD2 1 
ATOM   2700 C CE1 . PHE A 1 352 ? 63.080  32.062 -26.350 1.00 30.19  ? 352 PHE A CE1 1 
ATOM   2701 C CE2 . PHE A 1 352 ? 64.205  32.609 -28.408 1.00 29.70  ? 352 PHE A CE2 1 
ATOM   2702 C CZ  . PHE A 1 352 ? 63.850  31.667 -27.454 1.00 31.23  ? 352 PHE A CZ  1 
ATOM   2703 N N   . SER A 1 353 ? 60.385  38.043 -27.620 1.00 36.43  ? 353 SER A N   1 
ATOM   2704 C CA  . SER A 1 353 ? 60.116  39.478 -27.721 1.00 40.85  ? 353 SER A CA  1 
ATOM   2705 C C   . SER A 1 353 ? 59.003  40.061 -26.837 1.00 39.15  ? 353 SER A C   1 
ATOM   2706 O O   . SER A 1 353 ? 58.909  41.278 -26.662 1.00 41.61  ? 353 SER A O   1 
ATOM   2707 C CB  . SER A 1 353 ? 59.864  39.811 -29.186 1.00 43.74  ? 353 SER A CB  1 
ATOM   2708 O OG  . SER A 1 353 ? 60.673  38.964 -30.010 1.00 54.15  ? 353 SER A OG  1 
ATOM   2709 N N   . GLY A 1 354 ? 58.182  39.196 -26.257 1.00 39.05  ? 354 GLY A N   1 
ATOM   2710 C CA  . GLY A 1 354 ? 57.097  39.669 -25.412 1.00 42.03  ? 354 GLY A CA  1 
ATOM   2711 C C   . GLY A 1 354 ? 57.548  40.069 -24.024 1.00 40.30  ? 354 GLY A C   1 
ATOM   2712 O O   . GLY A 1 354 ? 56.978  40.966 -23.404 1.00 38.78  ? 354 GLY A O   1 
ATOM   2713 N N   . VAL A 1 355 ? 58.549  39.344 -23.532 1.00 42.25  ? 355 VAL A N   1 
ATOM   2714 C CA  . VAL A 1 355 ? 59.205  39.537 -22.226 1.00 40.91  ? 355 VAL A CA  1 
ATOM   2715 C C   . VAL A 1 355 ? 59.470  41.045 -21.968 1.00 35.92  ? 355 VAL A C   1 
ATOM   2716 O O   . VAL A 1 355 ? 59.474  41.536 -20.837 1.00 32.56  ? 355 VAL A O   1 
ATOM   2717 C CB  . VAL A 1 355 ? 60.584  38.727 -22.247 1.00 41.06  ? 355 VAL A CB  1 
ATOM   2718 C CG1 . VAL A 1 355 ? 61.611  39.304 -21.302 1.00 43.86  ? 355 VAL A CG1 1 
ATOM   2719 C CG2 . VAL A 1 355 ? 60.355  37.269 -21.926 1.00 39.97  ? 355 VAL A CG2 1 
ATOM   2720 N N   . MET A 1 356 ? 59.659  41.760 -23.060 1.00 34.75  ? 356 MET A N   1 
ATOM   2721 C CA  . MET A 1 356 ? 59.954  43.172 -23.028 1.00 42.76  ? 356 MET A CA  1 
ATOM   2722 C C   . MET A 1 356 ? 58.794  44.115 -22.691 1.00 45.04  ? 356 MET A C   1 
ATOM   2723 O O   . MET A 1 356 ? 58.905  45.324 -22.951 1.00 49.54  ? 356 MET A O   1 
ATOM   2724 C CB  . MET A 1 356 ? 60.568  43.564 -24.379 1.00 45.70  ? 356 MET A CB  1 
ATOM   2725 C CG  . MET A 1 356 ? 61.651  42.600 -24.856 1.00 55.06  ? 356 MET A CG  1 
ATOM   2726 S SD  . MET A 1 356 ? 63.192  42.694 -23.869 1.00 60.97  ? 356 MET A SD  1 
ATOM   2727 C CE  . MET A 1 356 ? 64.189  43.817 -24.901 1.00 55.04  ? 356 MET A CE  1 
ATOM   2728 N N   . SER A 1 357 ? 57.677  43.600 -22.179 1.00 41.13  ? 357 SER A N   1 
ATOM   2729 C CA  . SER A 1 357 ? 56.562  44.478 -21.834 1.00 37.42  ? 357 SER A CA  1 
ATOM   2730 C C   . SER A 1 357 ? 55.488  43.808 -21.034 1.00 34.89  ? 357 SER A C   1 
ATOM   2731 O O   . SER A 1 357 ? 55.110  42.666 -21.310 1.00 34.84  ? 357 SER A O   1 
ATOM   2732 C CB  . SER A 1 357 ? 55.921  45.125 -23.070 1.00 40.28  ? 357 SER A CB  1 
ATOM   2733 O OG  . SER A 1 357 ? 55.286  44.178 -23.894 1.00 41.76  ? 357 SER A OG  1 
ATOM   2734 N N   . PRO A 1 358 ? 54.991  44.506 -20.005 1.00 33.23  ? 358 PRO A N   1 
ATOM   2735 C CA  . PRO A 1 358 ? 53.942  43.972 -19.152 1.00 33.94  ? 358 PRO A CA  1 
ATOM   2736 C C   . PRO A 1 358 ? 52.771  43.528 -19.998 1.00 35.40  ? 358 PRO A C   1 
ATOM   2737 O O   . PRO A 1 358 ? 52.441  42.343 -20.022 1.00 34.59  ? 358 PRO A O   1 
ATOM   2738 C CB  . PRO A 1 358 ? 53.619  45.158 -18.249 1.00 32.60  ? 358 PRO A CB  1 
ATOM   2739 C CG  . PRO A 1 358 ? 54.999  45.712 -18.023 1.00 27.88  ? 358 PRO A CG  1 
ATOM   2740 C CD  . PRO A 1 358 ? 55.499  45.773 -19.445 1.00 29.06  ? 358 PRO A CD  1 
ATOM   2741 N N   . ILE A 1 359 ? 52.269  44.458 -20.812 1.00 39.11  ? 359 ILE A N   1 
ATOM   2742 C CA  . ILE A 1 359 ? 51.122  44.204 -21.678 1.00 37.33  ? 359 ILE A CA  1 
ATOM   2743 C C   . ILE A 1 359 ? 51.272  43.003 -22.598 1.00 37.29  ? 359 ILE A C   1 
ATOM   2744 O O   . ILE A 1 359 ? 50.359  42.187 -22.681 1.00 35.91  ? 359 ILE A O   1 
ATOM   2745 C CB  . ILE A 1 359 ? 50.772  45.429 -22.489 1.00 36.80  ? 359 ILE A CB  1 
ATOM   2746 C CG1 . ILE A 1 359 ? 50.445  46.591 -21.548 1.00 42.45  ? 359 ILE A CG1 1 
ATOM   2747 C CG2 . ILE A 1 359 ? 49.547  45.138 -23.332 1.00 44.75  ? 359 ILE A CG2 1 
ATOM   2748 C CD1 . ILE A 1 359 ? 50.380  47.967 -22.235 1.00 45.64  ? 359 ILE A CD1 1 
ATOM   2749 N N   . LYS A 1 360 ? 52.398  42.908 -23.308 1.00 37.57  ? 360 LYS A N   1 
ATOM   2750 C CA  . LYS A 1 360 ? 52.653  41.776 -24.203 1.00 30.40  ? 360 LYS A CA  1 
ATOM   2751 C C   . LYS A 1 360 ? 52.605  40.482 -23.449 1.00 29.35  ? 360 LYS A C   1 
ATOM   2752 O O   . LYS A 1 360 ? 51.990  39.524 -23.901 1.00 30.95  ? 360 LYS A O   1 
ATOM   2753 C CB  . LYS A 1 360 ? 54.009  41.881 -24.889 1.00 32.35  ? 360 LYS A CB  1 
ATOM   2754 C CG  . LYS A 1 360 ? 53.973  42.754 -26.123 1.00 38.32  ? 360 LYS A CG  1 
ATOM   2755 C CD  . LYS A 1 360 ? 55.338  42.984 -26.708 1.00 44.69  ? 360 LYS A CD  1 
ATOM   2756 C CE  . LYS A 1 360 ? 55.219  43.215 -28.199 1.00 46.87  ? 360 LYS A CE  1 
ATOM   2757 N NZ  . LYS A 1 360 ? 54.730  41.957 -28.884 1.00 53.36  ? 360 LYS A NZ  1 
ATOM   2758 N N   . THR A 1 361 ? 53.235  40.472 -22.284 1.00 24.67  ? 361 THR A N   1 
ATOM   2759 C CA  . THR A 1 361 ? 53.293  39.289 -21.448 1.00 30.14  ? 361 THR A CA  1 
ATOM   2760 C C   . THR A 1 361 ? 51.924  38.909 -20.893 1.00 31.88  ? 361 THR A C   1 
ATOM   2761 O O   . THR A 1 361 ? 51.509  37.743 -20.969 1.00 31.15  ? 361 THR A O   1 
ATOM   2762 C CB  . THR A 1 361 ? 54.271  39.510 -20.277 1.00 29.08  ? 361 THR A CB  1 
ATOM   2763 O OG1 . THR A 1 361 ? 55.566  39.812 -20.801 1.00 29.60  ? 361 THR A OG1 1 
ATOM   2764 C CG2 . THR A 1 361 ? 54.358  38.257 -19.408 1.00 24.39  ? 361 THR A CG2 1 
ATOM   2765 N N   . TRP A 1 362 ? 51.256  39.913 -20.321 1.00 34.73  ? 362 TRP A N   1 
ATOM   2766 C CA  . TRP A 1 362 ? 49.931  39.816 -19.712 1.00 31.13  ? 362 TRP A CA  1 
ATOM   2767 C C   . TRP A 1 362 ? 48.943  39.313 -20.754 1.00 30.90  ? 362 TRP A C   1 
ATOM   2768 O O   . TRP A 1 362 ? 48.216  38.351 -20.506 1.00 31.58  ? 362 TRP A O   1 
ATOM   2769 C CB  . TRP A 1 362 ? 49.553  41.193 -19.185 1.00 29.27  ? 362 TRP A CB  1 
ATOM   2770 C CG  . TRP A 1 362 ? 48.142  41.340 -18.683 1.00 34.13  ? 362 TRP A CG  1 
ATOM   2771 C CD1 . TRP A 1 362 ? 47.642  40.968 -17.456 1.00 29.14  ? 362 TRP A CD1 1 
ATOM   2772 C CD2 . TRP A 1 362 ? 47.083  42.035 -19.359 1.00 31.57  ? 362 TRP A CD2 1 
ATOM   2773 N NE1 . TRP A 1 362 ? 46.347  41.408 -17.326 1.00 26.03  ? 362 TRP A NE1 1 
ATOM   2774 C CE2 . TRP A 1 362 ? 45.981  42.062 -18.479 1.00 31.61  ? 362 TRP A CE2 1 
ATOM   2775 C CE3 . TRP A 1 362 ? 46.970  42.641 -20.617 1.00 28.76  ? 362 TRP A CE3 1 
ATOM   2776 C CZ2 . TRP A 1 362 ? 44.777  42.674 -18.818 1.00 37.94  ? 362 TRP A CZ2 1 
ATOM   2777 C CZ3 . TRP A 1 362 ? 45.788  43.246 -20.957 1.00 38.62  ? 362 TRP A CZ3 1 
ATOM   2778 C CH2 . TRP A 1 362 ? 44.699  43.262 -20.062 1.00 39.96  ? 362 TRP A CH2 1 
ATOM   2779 N N   . ASP A 1 363 ? 49.029  39.901 -21.945 1.00 23.49  ? 363 ASP A N   1 
ATOM   2780 C CA  . ASP A 1 363 ? 48.216  39.557 -23.096 1.00 23.66  ? 363 ASP A CA  1 
ATOM   2781 C C   . ASP A 1 363 ? 48.396  38.090 -23.558 1.00 26.82  ? 363 ASP A C   1 
ATOM   2782 O O   . ASP A 1 363 ? 47.482  37.503 -24.160 1.00 27.13  ? 363 ASP A O   1 
ATOM   2783 C CB  . ASP A 1 363 ? 48.555  40.500 -24.241 1.00 19.95  ? 363 ASP A CB  1 
ATOM   2784 C CG  . ASP A 1 363 ? 47.911  40.092 -25.543 1.00 25.98  ? 363 ASP A CG  1 
ATOM   2785 O OD1 . ASP A 1 363 ? 48.402  39.159 -26.224 1.00 25.96  ? 363 ASP A OD1 1 
ATOM   2786 O OD2 . ASP A 1 363 ? 46.903  40.718 -25.892 1.00 33.37  ? 363 ASP A OD2 1 
ATOM   2787 N N   . ALA A 1 364 ? 49.592  37.536 -23.363 1.00 24.16  ? 364 ALA A N   1 
ATOM   2788 C CA  . ALA A 1 364 ? 49.872  36.159 -23.726 1.00 21.69  ? 364 ALA A CA  1 
ATOM   2789 C C   . ALA A 1 364 ? 49.367  35.284 -22.597 1.00 25.08  ? 364 ALA A C   1 
ATOM   2790 O O   . ALA A 1 364 ? 48.939  34.168 -22.836 1.00 32.11  ? 364 ALA A O   1 
ATOM   2791 C CB  . ALA A 1 364 ? 51.331  35.953 -23.895 1.00 27.33  ? 364 ALA A CB  1 
ATOM   2792 N N   . ILE A 1 365 ? 49.456  35.759 -21.355 1.00 25.63  ? 365 ILE A N   1 
ATOM   2793 C CA  . ILE A 1 365 ? 48.947  34.993 -20.212 1.00 23.44  ? 365 ILE A CA  1 
ATOM   2794 C C   . ILE A 1 365 ? 47.417  34.836 -20.341 1.00 25.74  ? 365 ILE A C   1 
ATOM   2795 O O   . ILE A 1 365 ? 46.873  33.757 -20.133 1.00 25.10  ? 365 ILE A O   1 
ATOM   2796 C CB  . ILE A 1 365 ? 49.302  35.677 -18.881 1.00 26.26  ? 365 ILE A CB  1 
ATOM   2797 C CG1 . ILE A 1 365 ? 50.831  35.715 -18.727 1.00 34.21  ? 365 ILE A CG1 1 
ATOM   2798 C CG2 . ILE A 1 365 ? 48.677  34.948 -17.694 1.00 23.96  ? 365 ILE A CG2 1 
ATOM   2799 C CD1 . ILE A 1 365 ? 51.538  34.379 -18.986 1.00 27.75  ? 365 ILE A CD1 1 
ATOM   2800 N N   . ILE A 1 366 ? 46.741  35.917 -20.716 1.00 23.07  ? 366 ILE A N   1 
ATOM   2801 C CA  . ILE A 1 366 ? 45.315  35.907 -20.918 1.00 23.39  ? 366 ILE A CA  1 
ATOM   2802 C C   . ILE A 1 366 ? 44.919  34.793 -21.893 1.00 25.60  ? 366 ILE A C   1 
ATOM   2803 O O   . ILE A 1 366 ? 44.062  33.965 -21.589 1.00 28.68  ? 366 ILE A O   1 
ATOM   2804 C CB  . ILE A 1 366 ? 44.832  37.262 -21.492 1.00 24.89  ? 366 ILE A CB  1 
ATOM   2805 C CG1 . ILE A 1 366 ? 44.865  38.342 -20.410 1.00 18.60  ? 366 ILE A CG1 1 
ATOM   2806 C CG2 . ILE A 1 366 ? 43.421  37.118 -22.138 1.00 29.93  ? 366 ILE A CG2 1 
ATOM   2807 C CD1 . ILE A 1 366 ? 44.402  39.687 -20.928 1.00 11.60  ? 366 ILE A CD1 1 
ATOM   2808 N N   . PHE A 1 367 ? 45.597  34.712 -23.024 1.00 23.86  ? 367 PHE A N   1 
ATOM   2809 C CA  . PHE A 1 367 ? 45.261  33.725 -24.029 1.00 26.57  ? 367 PHE A CA  1 
ATOM   2810 C C   . PHE A 1 367 ? 45.707  32.320 -23.634 1.00 34.33  ? 367 PHE A C   1 
ATOM   2811 O O   . PHE A 1 367 ? 44.901  31.374 -23.643 1.00 36.40  ? 367 PHE A O   1 
ATOM   2812 C CB  . PHE A 1 367 ? 45.890  34.156 -25.350 1.00 23.95  ? 367 PHE A CB  1 
ATOM   2813 C CG  . PHE A 1 367 ? 45.525  33.306 -26.533 1.00 25.41  ? 367 PHE A CG  1 
ATOM   2814 C CD1 . PHE A 1 367 ? 44.404  33.583 -27.279 1.00 22.65  ? 367 PHE A CD1 1 
ATOM   2815 C CD2 . PHE A 1 367 ? 46.365  32.273 -26.953 1.00 26.86  ? 367 PHE A CD2 1 
ATOM   2816 C CE1 . PHE A 1 367 ? 44.120  32.866 -28.428 1.00 22.65  ? 367 PHE A CE1 1 
ATOM   2817 C CE2 . PHE A 1 367 ? 46.085  31.544 -28.109 1.00 25.63  ? 367 PHE A CE2 1 
ATOM   2818 C CZ  . PHE A 1 367 ? 44.955  31.849 -28.846 1.00 26.31  ? 367 PHE A CZ  1 
ATOM   2819 N N   . ASN A 1 368 ? 46.969  32.185 -23.237 1.00 37.11  ? 368 ASN A N   1 
ATOM   2820 C CA  . ASN A 1 368 ? 47.523  30.872 -22.874 1.00 38.57  ? 368 ASN A CA  1 
ATOM   2821 C C   . ASN A 1 368 ? 46.883  30.267 -21.639 1.00 37.33  ? 368 ASN A C   1 
ATOM   2822 O O   . ASN A 1 368 ? 47.041  29.088 -21.382 1.00 37.80  ? 368 ASN A O   1 
ATOM   2823 C CB  . ASN A 1 368 ? 49.054  30.939 -22.671 1.00 40.89  ? 368 ASN A CB  1 
ATOM   2824 C CG  . ASN A 1 368 ? 49.827  31.196 -23.968 1.00 40.54  ? 368 ASN A CG  1 
ATOM   2825 O OD1 . ASN A 1 368 ? 49.411  30.787 -25.073 1.00 34.91  ? 368 ASN A OD1 1 
ATOM   2826 N ND2 . ASN A 1 368 ? 50.956  31.890 -23.837 1.00 35.73  ? 368 ASN A ND2 1 
ATOM   2827 N N   . SER A 1 369 ? 46.158  31.074 -20.879 1.00 39.05  ? 369 SER A N   1 
ATOM   2828 C CA  . SER A 1 369 ? 45.498  30.600 -19.665 1.00 40.13  ? 369 SER A CA  1 
ATOM   2829 C C   . SER A 1 369 ? 44.370  29.612 -19.931 1.00 41.14  ? 369 SER A C   1 
ATOM   2830 O O   . SER A 1 369 ? 44.131  28.702 -19.135 1.00 42.85  ? 369 SER A O   1 
ATOM   2831 C CB  . SER A 1 369 ? 44.900  31.780 -18.885 1.00 42.30  ? 369 SER A CB  1 
ATOM   2832 O OG  . SER A 1 369 ? 43.775  32.331 -19.565 1.00 38.38  ? 369 SER A OG  1 
ATOM   2833 N N   . LEU A 1 370 ? 43.654  29.804 -21.027 1.00 39.62  ? 370 LEU A N   1 
ATOM   2834 C CA  . LEU A 1 370 ? 42.526  28.943 -21.309 1.00 41.89  ? 370 LEU A CA  1 
ATOM   2835 C C   . LEU A 1 370 ? 42.725  27.993 -22.478 1.00 42.89  ? 370 LEU A C   1 
ATOM   2836 O O   . LEU A 1 370 ? 43.110  26.826 -22.285 1.00 42.62  ? 370 LEU A O   1 
ATOM   2837 C CB  . LEU A 1 370 ? 41.266  29.806 -21.484 1.00 50.06  ? 370 LEU A CB  1 
ATOM   2838 C CG  . LEU A 1 370 ? 40.795  30.643 -20.252 1.00 51.45  ? 370 LEU A CG  1 
ATOM   2839 C CD1 . LEU A 1 370 ? 40.184  31.982 -20.693 1.00 49.47  ? 370 LEU A CD1 1 
ATOM   2840 C CD2 . LEU A 1 370 ? 39.786  29.849 -19.376 1.00 50.81  ? 370 LEU A CD2 1 
ATOM   2841 N N   . ASP B 1 2   ? 45.538  17.873 -7.215  1.00 67.98  ? 2   ASP B N   1 
ATOM   2842 C CA  . ASP B 1 2   ? 44.410  18.177 -6.341  1.00 68.59  ? 2   ASP B CA  1 
ATOM   2843 C C   . ASP B 1 2   ? 44.876  18.922 -5.101  1.00 65.40  ? 2   ASP B C   1 
ATOM   2844 O O   . ASP B 1 2   ? 45.535  18.349 -4.225  1.00 63.69  ? 2   ASP B O   1 
ATOM   2845 C CB  . ASP B 1 2   ? 43.682  16.893 -5.897  1.00 74.83  ? 2   ASP B CB  1 
ATOM   2846 C CG  . ASP B 1 2   ? 43.361  15.959 -7.054  1.00 79.58  ? 2   ASP B CG  1 
ATOM   2847 O OD1 . ASP B 1 2   ? 43.297  16.432 -8.227  1.00 81.01  ? 2   ASP B OD1 1 
ATOM   2848 O OD2 . ASP B 1 2   ? 43.183  14.744 -6.770  1.00 78.94  ? 2   ASP B OD2 1 
ATOM   2849 N N   . GLU B 1 3   ? 44.494  20.190 -5.049  1.00 63.57  ? 3   GLU B N   1 
ATOM   2850 C CA  . GLU B 1 3   ? 44.793  21.137 -3.977  1.00 63.57  ? 3   GLU B CA  1 
ATOM   2851 C C   . GLU B 1 3   ? 45.186  22.404 -4.714  1.00 60.44  ? 3   GLU B C   1 
ATOM   2852 O O   . GLU B 1 3   ? 45.964  22.357 -5.686  1.00 58.66  ? 3   GLU B O   1 
ATOM   2853 C CB  . GLU B 1 3   ? 45.965  20.709 -3.068  1.00 67.45  ? 3   GLU B CB  1 
ATOM   2854 C CG  . GLU B 1 3   ? 47.360  20.862 -3.703  1.00 76.54  ? 3   GLU B CG  1 
ATOM   2855 C CD  . GLU B 1 3   ? 48.505  20.874 -2.695  1.00 81.67  ? 3   GLU B CD  1 
ATOM   2856 O OE1 . GLU B 1 3   ? 48.240  21.081 -1.489  1.00 86.11  ? 3   GLU B OE1 1 
ATOM   2857 O OE2 . GLU B 1 3   ? 49.676  20.698 -3.117  1.00 82.64  ? 3   GLU B OE2 1 
ATOM   2858 N N   . PHE B 1 4   ? 44.603  23.519 -4.293  1.00 54.65  ? 4   PHE B N   1 
ATOM   2859 C CA  . PHE B 1 4   ? 44.911  24.793 -4.902  1.00 49.67  ? 4   PHE B CA  1 
ATOM   2860 C C   . PHE B 1 4   ? 44.628  25.929 -3.978  1.00 45.78  ? 4   PHE B C   1 
ATOM   2861 O O   . PHE B 1 4   ? 43.853  25.778 -3.043  1.00 46.60  ? 4   PHE B O   1 
ATOM   2862 C CB  . PHE B 1 4   ? 44.211  24.980 -6.246  1.00 52.79  ? 4   PHE B CB  1 
ATOM   2863 C CG  . PHE B 1 4   ? 42.768  24.601 -6.261  1.00 54.84  ? 4   PHE B CG  1 
ATOM   2864 C CD1 . PHE B 1 4   ? 42.387  23.316 -6.619  1.00 53.11  ? 4   PHE B CD1 1 
ATOM   2865 C CD2 . PHE B 1 4   ? 41.780  25.570 -6.055  1.00 54.81  ? 4   PHE B CD2 1 
ATOM   2866 C CE1 . PHE B 1 4   ? 41.049  22.999 -6.785  1.00 56.65  ? 4   PHE B CE1 1 
ATOM   2867 C CE2 . PHE B 1 4   ? 40.436  25.264 -6.218  1.00 57.46  ? 4   PHE B CE2 1 
ATOM   2868 C CZ  . PHE B 1 4   ? 40.064  23.979 -6.587  1.00 57.61  ? 4   PHE B CZ  1 
ATOM   2869 N N   . TYR B 1 5   ? 45.312  27.045 -4.184  1.00 41.63  ? 5   TYR B N   1 
ATOM   2870 C CA  . TYR B 1 5   ? 45.103  28.179 -3.309  1.00 40.42  ? 5   TYR B CA  1 
ATOM   2871 C C   . TYR B 1 5   ? 43.817  28.915 -3.645  1.00 40.13  ? 5   TYR B C   1 
ATOM   2872 O O   . TYR B 1 5   ? 43.341  28.909 -4.793  1.00 36.30  ? 5   TYR B O   1 
ATOM   2873 C CB  . TYR B 1 5   ? 46.315  29.140 -3.275  1.00 36.63  ? 5   TYR B CB  1 
ATOM   2874 C CG  . TYR B 1 5   ? 46.705  29.678 -4.632  1.00 38.25  ? 5   TYR B CG  1 
ATOM   2875 C CD1 . TYR B 1 5   ? 47.262  28.821 -5.601  1.00 32.86  ? 5   TYR B CD1 1 
ATOM   2876 C CD2 . TYR B 1 5   ? 46.500  31.032 -4.968  1.00 35.19  ? 5   TYR B CD2 1 
ATOM   2877 C CE1 . TYR B 1 5   ? 47.600  29.270 -6.853  1.00 26.36  ? 5   TYR B CE1 1 
ATOM   2878 C CE2 . TYR B 1 5   ? 46.842  31.504 -6.240  1.00 31.88  ? 5   TYR B CE2 1 
ATOM   2879 C CZ  . TYR B 1 5   ? 47.389  30.610 -7.175  1.00 31.66  ? 5   TYR B CZ  1 
ATOM   2880 O OH  . TYR B 1 5   ? 47.698  31.015 -8.453  1.00 31.70  ? 5   TYR B OH  1 
ATOM   2881 N N   . ILE B 1 6   ? 43.243  29.465 -2.580  1.00 41.46  ? 6   ILE B N   1 
ATOM   2882 C CA  . ILE B 1 6   ? 42.020  30.247 -2.590  1.00 38.17  ? 6   ILE B CA  1 
ATOM   2883 C C   . ILE B 1 6   ? 42.536  31.629 -2.199  1.00 37.49  ? 6   ILE B C   1 
ATOM   2884 O O   . ILE B 1 6   ? 42.424  32.583 -2.952  1.00 37.95  ? 6   ILE B O   1 
ATOM   2885 C CB  . ILE B 1 6   ? 41.005  29.686 -1.533  1.00 32.61  ? 6   ILE B CB  1 
ATOM   2886 C CG1 . ILE B 1 6   ? 40.313  28.445 -2.072  1.00 28.32  ? 6   ILE B CG1 1 
ATOM   2887 C CG2 . ILE B 1 6   ? 39.981  30.699 -1.141  1.00 33.47  ? 6   ILE B CG2 1 
ATOM   2888 C CD1 . ILE B 1 6   ? 39.905  28.576 -3.509  1.00 25.94  ? 6   ILE B CD1 1 
ATOM   2889 N N   . SER B 1 7   ? 43.196  31.707 -1.060  1.00 39.17  ? 7   SER B N   1 
ATOM   2890 C CA  . SER B 1 7   ? 43.728  32.973 -0.611  1.00 43.20  ? 7   SER B CA  1 
ATOM   2891 C C   . SER B 1 7   ? 45.091  32.721 -0.023  1.00 45.44  ? 7   SER B C   1 
ATOM   2892 O O   . SER B 1 7   ? 45.335  31.653 0.537   1.00 47.84  ? 7   SER B O   1 
ATOM   2893 C CB  . SER B 1 7   ? 42.818  33.610 0.443   1.00 43.25  ? 7   SER B CB  1 
ATOM   2894 O OG  . SER B 1 7   ? 43.553  34.528 1.244   1.00 46.50  ? 7   SER B OG  1 
ATOM   2895 N N   . ILE B 1 8   ? 45.966  33.709 -0.172  1.00 46.85  ? 8   ILE B N   1 
ATOM   2896 C CA  . ILE B 1 8   ? 47.327  33.671 0.337   1.00 46.36  ? 8   ILE B CA  1 
ATOM   2897 C C   . ILE B 1 8   ? 47.500  35.024 0.995   1.00 43.94  ? 8   ILE B C   1 
ATOM   2898 O O   . ILE B 1 8   ? 47.379  36.042 0.318   1.00 40.72  ? 8   ILE B O   1 
ATOM   2899 C CB  . ILE B 1 8   ? 48.373  33.598 -0.807  1.00 47.40  ? 8   ILE B CB  1 
ATOM   2900 C CG1 . ILE B 1 8   ? 48.146  32.365 -1.689  1.00 47.01  ? 8   ILE B CG1 1 
ATOM   2901 C CG2 . ILE B 1 8   ? 49.792  33.603 -0.228  1.00 50.06  ? 8   ILE B CG2 1 
ATOM   2902 C CD1 . ILE B 1 8   ? 48.315  31.044 -0.987  1.00 38.67  ? 8   ILE B CD1 1 
ATOM   2903 N N   . GLU B 1 9   ? 47.701  35.040 2.309   1.00 45.84  ? 9   GLU B N   1 
ATOM   2904 C CA  . GLU B 1 9   ? 47.909  36.288 3.032   1.00 49.61  ? 9   GLU B CA  1 
ATOM   2905 C C   . GLU B 1 9   ? 49.024  36.141 4.072   1.00 49.93  ? 9   GLU B C   1 
ATOM   2906 O O   . GLU B 1 9   ? 49.560  35.055 4.283   1.00 46.00  ? 9   GLU B O   1 
ATOM   2907 C CB  . GLU B 1 9   ? 46.602  36.786 3.664   1.00 53.35  ? 9   GLU B CB  1 
ATOM   2908 C CG  . GLU B 1 9   ? 46.676  38.217 4.224   1.00 56.31  ? 9   GLU B CG  1 
ATOM   2909 C CD  . GLU B 1 9   ? 47.438  39.188 3.315   1.00 58.09  ? 9   GLU B CD  1 
ATOM   2910 O OE1 . GLU B 1 9   ? 47.026  39.355 2.152   1.00 61.34  ? 9   GLU B OE1 1 
ATOM   2911 O OE2 . GLU B 1 9   ? 48.443  39.790 3.765   1.00 56.16  ? 9   GLU B OE2 1 
ATOM   2912 N N   . THR B 1 10  ? 49.342  37.222 4.760   1.00 53.93  ? 10  THR B N   1 
ATOM   2913 C CA  . THR B 1 10  ? 50.422  37.198 5.714   1.00 63.23  ? 10  THR B CA  1 
ATOM   2914 C C   . THR B 1 10  ? 50.116  37.948 7.006   1.00 67.01  ? 10  THR B C   1 
ATOM   2915 O O   . THR B 1 10  ? 49.743  39.118 6.971   1.00 70.00  ? 10  THR B O   1 
ATOM   2916 C CB  . THR B 1 10  ? 51.689  37.802 5.028   1.00 65.28  ? 10  THR B CB  1 
ATOM   2917 O OG1 . THR B 1 10  ? 52.216  36.865 4.068   1.00 64.85  ? 10  THR B OG1 1 
ATOM   2918 C CG2 . THR B 1 10  ? 52.758  38.206 6.046   1.00 65.91  ? 10  THR B CG2 1 
ATOM   2919 N N   . VAL B 1 11  ? 50.263  37.265 8.140   1.00 71.26  ? 11  VAL B N   1 
ATOM   2920 C CA  . VAL B 1 11  ? 50.060  37.888 9.450   1.00 75.57  ? 11  VAL B CA  1 
ATOM   2921 C C   . VAL B 1 11  ? 51.459  38.086 10.042  1.00 76.11  ? 11  VAL B C   1 
ATOM   2922 O O   . VAL B 1 11  ? 52.097  37.114 10.453  1.00 72.66  ? 11  VAL B O   1 
ATOM   2923 C CB  . VAL B 1 11  ? 49.260  36.976 10.389  1.00 78.57  ? 11  VAL B CB  1 
ATOM   2924 C CG1 . VAL B 1 11  ? 49.007  37.678 11.734  1.00 77.80  ? 11  VAL B CG1 1 
ATOM   2925 C CG2 . VAL B 1 11  ? 47.960  36.559 9.720   1.00 81.82  ? 11  VAL B CG2 1 
ATOM   2926 N N   . GLY B 1 12  ? 51.931  39.335 10.062  1.00 77.99  ? 12  GLY B N   1 
ATOM   2927 C CA  . GLY B 1 12  ? 53.267  39.631 10.568  1.00 80.87  ? 12  GLY B CA  1 
ATOM   2928 C C   . GLY B 1 12  ? 54.340  39.077 9.634   1.00 81.76  ? 12  GLY B C   1 
ATOM   2929 O O   . GLY B 1 12  ? 54.417  39.446 8.459   1.00 81.16  ? 12  GLY B O   1 
ATOM   2930 N N   . ASN B 1 13  ? 55.186  38.198 10.153  1.00 83.34  ? 13  ASN B N   1 
ATOM   2931 C CA  . ASN B 1 13  ? 56.226  37.586 9.330   1.00 86.56  ? 13  ASN B CA  1 
ATOM   2932 C C   . ASN B 1 13  ? 55.775  36.184 8.958   1.00 85.12  ? 13  ASN B C   1 
ATOM   2933 O O   . ASN B 1 13  ? 56.590  35.331 8.594   1.00 82.23  ? 13  ASN B O   1 
ATOM   2934 C CB  . ASN B 1 13  ? 57.553  37.515 10.093  1.00 92.96  ? 13  ASN B CB  1 
ATOM   2935 C CG  . ASN B 1 13  ? 58.458  38.715 9.811   1.00 99.72  ? 13  ASN B CG  1 
ATOM   2936 O OD1 . ASN B 1 13  ? 58.282  39.800 10.383  1.00 100.69 ? 13  ASN B OD1 1 
ATOM   2937 N ND2 . ASN B 1 13  ? 59.435  38.521 8.921   1.00 104.33 ? 13  ASN B ND2 1 
ATOM   2938 N N   . ASN B 1 14  ? 54.462  35.974 9.026   1.00 85.68  ? 14  ASN B N   1 
ATOM   2939 C CA  . ASN B 1 14  ? 53.853  34.678 8.751   1.00 85.58  ? 14  ASN B CA  1 
ATOM   2940 C C   . ASN B 1 14  ? 53.015  34.640 7.487   1.00 80.34  ? 14  ASN B C   1 
ATOM   2941 O O   . ASN B 1 14  ? 52.825  35.655 6.837   1.00 76.56  ? 14  ASN B O   1 
ATOM   2942 C CB  . ASN B 1 14  ? 52.968  34.274 9.935   1.00 92.92  ? 14  ASN B CB  1 
ATOM   2943 C CG  . ASN B 1 14  ? 53.697  34.351 11.258  1.00 99.80  ? 14  ASN B CG  1 
ATOM   2944 O OD1 . ASN B 1 14  ? 53.792  35.421 11.872  1.00 103.54 ? 14  ASN B OD1 1 
ATOM   2945 N ND2 . ASN B 1 14  ? 54.247  33.221 11.694  1.00 102.27 ? 14  ASN B ND2 1 
ATOM   2946 N N   . ILE B 1 15  ? 52.514  33.450 7.162   1.00 76.44  ? 15  ILE B N   1 
ATOM   2947 C CA  . ILE B 1 15  ? 51.656  33.222 6.006   1.00 72.25  ? 15  ILE B CA  1 
ATOM   2948 C C   . ILE B 1 15  ? 50.527  32.269 6.403   1.00 70.97  ? 15  ILE B C   1 
ATOM   2949 O O   . ILE B 1 15  ? 50.768  31.258 7.056   1.00 73.09  ? 15  ILE B O   1 
ATOM   2950 C CB  . ILE B 1 15  ? 52.463  32.649 4.793   1.00 72.30  ? 15  ILE B CB  1 
ATOM   2951 C CG1 . ILE B 1 15  ? 52.811  33.794 3.831   1.00 71.03  ? 15  ILE B CG1 1 
ATOM   2952 C CG2 . ILE B 1 15  ? 51.688  31.535 4.066   1.00 70.59  ? 15  ILE B CG2 1 
ATOM   2953 C CD1 . ILE B 1 15  ? 53.613  33.388 2.640   1.00 65.31  ? 15  ILE B CD1 1 
ATOM   2954 N N   . VAL B 1 16  ? 49.290  32.632 6.076   1.00 67.40  ? 16  VAL B N   1 
ATOM   2955 C CA  . VAL B 1 16  ? 48.128  31.790 6.363   1.00 60.20  ? 16  VAL B CA  1 
ATOM   2956 C C   . VAL B 1 16  ? 47.474  31.498 5.005   1.00 56.71  ? 16  VAL B C   1 
ATOM   2957 O O   . VAL B 1 16  ? 47.173  32.422 4.242   1.00 57.91  ? 16  VAL B O   1 
ATOM   2958 C CB  . VAL B 1 16  ? 47.165  32.493 7.331   1.00 59.33  ? 16  VAL B CB  1 
ATOM   2959 C CG1 . VAL B 1 16  ? 47.952  33.029 8.516   1.00 62.48  ? 16  VAL B CG1 1 
ATOM   2960 C CG2 . VAL B 1 16  ? 46.438  33.633 6.655   1.00 60.29  ? 16  VAL B CG2 1 
ATOM   2961 N N   . GLU B 1 17  ? 47.305  30.225 4.663   1.00 51.67  ? 17  GLU B N   1 
ATOM   2962 C CA  . GLU B 1 17  ? 46.742  29.894 3.361   1.00 46.80  ? 17  GLU B CA  1 
ATOM   2963 C C   . GLU B 1 17  ? 45.390  29.158 3.257   1.00 47.28  ? 17  GLU B C   1 
ATOM   2964 O O   . GLU B 1 17  ? 45.217  28.032 3.740   1.00 41.56  ? 17  GLU B O   1 
ATOM   2965 C CB  . GLU B 1 17  ? 47.778  29.141 2.552   1.00 44.29  ? 17  GLU B CB  1 
ATOM   2966 C CG  . GLU B 1 17  ? 47.260  28.717 1.208   1.00 47.75  ? 17  GLU B CG  1 
ATOM   2967 C CD  . GLU B 1 17  ? 47.615  27.302 0.858   1.00 52.50  ? 17  GLU B CD  1 
ATOM   2968 O OE1 . GLU B 1 17  ? 48.308  26.658 1.671   1.00 53.02  ? 17  GLU B OE1 1 
ATOM   2969 O OE2 . GLU B 1 17  ? 47.201  26.838 -0.232  1.00 49.09  ? 17  GLU B OE2 1 
ATOM   2970 N N   . ARG B 1 18  ? 44.463  29.778 2.538   1.00 45.85  ? 18  ARG B N   1 
ATOM   2971 C CA  . ARG B 1 18  ? 43.157  29.199 2.317   1.00 48.18  ? 18  ARG B CA  1 
ATOM   2972 C C   . ARG B 1 18  ? 43.254  28.374 1.057   1.00 49.52  ? 18  ARG B C   1 
ATOM   2973 O O   . ARG B 1 18  ? 43.798  28.872 0.069   1.00 51.31  ? 18  ARG B O   1 
ATOM   2974 C CB  . ARG B 1 18  ? 42.133  30.299 2.113   1.00 49.95  ? 18  ARG B CB  1 
ATOM   2975 C CG  . ARG B 1 18  ? 41.425  30.719 3.370   1.00 51.04  ? 18  ARG B CG  1 
ATOM   2976 C CD  . ARG B 1 18  ? 39.930  30.823 3.092   1.00 53.97  ? 18  ARG B CD  1 
ATOM   2977 N NE  . ARG B 1 18  ? 39.451  32.195 2.906   1.00 53.82  ? 18  ARG B NE  1 
ATOM   2978 C CZ  . ARG B 1 18  ? 38.541  32.549 2.010   1.00 47.16  ? 18  ARG B CZ  1 
ATOM   2979 N NH1 . ARG B 1 18  ? 38.048  31.638 1.183   1.00 45.91  ? 18  ARG B NH1 1 
ATOM   2980 N NH2 . ARG B 1 18  ? 38.156  33.817 1.926   1.00 42.84  ? 18  ARG B NH2 1 
ATOM   2981 N N   . TYR B 1 19  ? 42.675  27.165 1.059   1.00 50.07  ? 19  TYR B N   1 
ATOM   2982 C CA  . TYR B 1 19  ? 42.721  26.270 -0.110  1.00 49.82  ? 19  TYR B CA  1 
ATOM   2983 C C   . TYR B 1 19  ? 41.653  25.157 -0.152  1.00 50.87  ? 19  TYR B C   1 
ATOM   2984 O O   . TYR B 1 19  ? 40.904  24.948 0.797   1.00 49.91  ? 19  TYR B O   1 
ATOM   2985 C CB  . TYR B 1 19  ? 44.091  25.587 -0.162  1.00 47.51  ? 19  TYR B CB  1 
ATOM   2986 C CG  . TYR B 1 19  ? 44.381  24.758 1.072   1.00 45.90  ? 19  TYR B CG  1 
ATOM   2987 C CD1 . TYR B 1 19  ? 44.700  25.383 2.281   1.00 45.73  ? 19  TYR B CD1 1 
ATOM   2988 C CD2 . TYR B 1 19  ? 44.309  23.353 1.042   1.00 41.15  ? 19  TYR B CD2 1 
ATOM   2989 C CE1 . TYR B 1 19  ? 44.942  24.648 3.427   1.00 43.90  ? 19  TYR B CE1 1 
ATOM   2990 C CE2 . TYR B 1 19  ? 44.548  22.598 2.199   1.00 39.58  ? 19  TYR B CE2 1 
ATOM   2991 C CZ  . TYR B 1 19  ? 44.864  23.266 3.391   1.00 43.96  ? 19  TYR B CZ  1 
ATOM   2992 O OH  . TYR B 1 19  ? 45.085  22.588 4.579   1.00 50.33  ? 19  TYR B OH  1 
ATOM   2993 N N   . ILE B 1 20  ? 41.576  24.471 -1.287  1.00 49.86  ? 20  ILE B N   1 
ATOM   2994 C CA  . ILE B 1 20  ? 40.697  23.326 -1.448  1.00 52.33  ? 20  ILE B CA  1 
ATOM   2995 C C   . ILE B 1 20  ? 41.710  22.210 -1.180  1.00 60.93  ? 20  ILE B C   1 
ATOM   2996 O O   . ILE B 1 20  ? 42.823  22.241 -1.734  1.00 59.80  ? 20  ILE B O   1 
ATOM   2997 C CB  . ILE B 1 20  ? 40.107  23.242 -2.898  1.00 47.60  ? 20  ILE B CB  1 
ATOM   2998 C CG1 . ILE B 1 20  ? 38.832  24.082 -2.989  1.00 46.38  ? 20  ILE B CG1 1 
ATOM   2999 C CG2 . ILE B 1 20  ? 39.763  21.795 -3.287  1.00 36.12  ? 20  ILE B CG2 1 
ATOM   3000 C CD1 . ILE B 1 20  ? 38.840  25.313 -2.098  1.00 44.62  ? 20  ILE B CD1 1 
ATOM   3001 N N   . ASP B 1 21  ? 41.366  21.296 -0.266  1.00 68.72  ? 21  ASP B N   1 
ATOM   3002 C CA  . ASP B 1 21  ? 42.249  20.193 0.126   1.00 73.74  ? 21  ASP B CA  1 
ATOM   3003 C C   . ASP B 1 21  ? 42.254  18.975 -0.794  1.00 76.56  ? 21  ASP B C   1 
ATOM   3004 O O   . ASP B 1 21  ? 41.588  18.972 -1.831  1.00 79.66  ? 21  ASP B O   1 
ATOM   3005 C CB  . ASP B 1 21  ? 41.974  19.759 1.587   1.00 74.03  ? 21  ASP B CB  1 
ATOM   3006 C CG  . ASP B 1 21  ? 40.638  19.040 1.764   1.00 73.24  ? 21  ASP B CG  1 
ATOM   3007 O OD1 . ASP B 1 21  ? 39.996  18.687 0.768   1.00 73.30  ? 21  ASP B OD1 1 
ATOM   3008 O OD2 . ASP B 1 21  ? 40.230  18.808 2.921   1.00 72.00  ? 21  ASP B OD2 1 
ATOM   3009 N N   . GLU B 1 22  ? 42.956  17.929 -0.350  1.00 78.80  ? 22  GLU B N   1 
ATOM   3010 C CA  . GLU B 1 22  ? 43.092  16.658 -1.057  1.00 78.44  ? 22  GLU B CA  1 
ATOM   3011 C C   . GLU B 1 22  ? 41.745  16.272 -1.652  1.00 78.86  ? 22  GLU B C   1 
ATOM   3012 O O   . GLU B 1 22  ? 41.662  15.914 -2.831  1.00 79.60  ? 22  GLU B O   1 
ATOM   3013 C CB  . GLU B 1 22  ? 43.615  15.585 -0.100  1.00 80.91  ? 22  GLU B CB  1 
ATOM   3014 C CG  . GLU B 1 22  ? 44.966  15.953 0.570   1.00 84.94  ? 22  GLU B CG  1 
ATOM   3015 C CD  . GLU B 1 22  ? 44.836  16.569 1.980   1.00 86.94  ? 22  GLU B CD  1 
ATOM   3016 O OE1 . GLU B 1 22  ? 44.513  15.806 2.918   1.00 90.39  ? 22  GLU B OE1 1 
ATOM   3017 O OE2 . GLU B 1 22  ? 45.086  17.795 2.157   1.00 81.52  ? 22  GLU B OE2 1 
ATOM   3018 N N   . ASN B 1 23  ? 40.697  16.328 -0.831  1.00 77.57  ? 23  ASN B N   1 
ATOM   3019 C CA  . ASN B 1 23  ? 39.344  16.076 -1.310  1.00 75.80  ? 23  ASN B CA  1 
ATOM   3020 C C   . ASN B 1 23  ? 38.392  17.225 -0.992  1.00 73.70  ? 23  ASN B C   1 
ATOM   3021 O O   . ASN B 1 23  ? 37.788  17.305 0.087   1.00 72.14  ? 23  ASN B O   1 
ATOM   3022 C CB  . ASN B 1 23  ? 38.747  14.710 -0.909  1.00 79.47  ? 23  ASN B CB  1 
ATOM   3023 C CG  . ASN B 1 23  ? 39.253  14.184 0.428   1.00 82.52  ? 23  ASN B CG  1 
ATOM   3024 O OD1 . ASN B 1 23  ? 39.480  14.939 1.384   1.00 84.65  ? 23  ASN B OD1 1 
ATOM   3025 N ND2 . ASN B 1 23  ? 39.431  12.862 0.497   1.00 80.55  ? 23  ASN B ND2 1 
ATOM   3026 N N   . GLY B 1 24  ? 38.508  18.220 -1.868  1.00 71.71  ? 24  GLY B N   1 
ATOM   3027 C CA  . GLY B 1 24  ? 37.687  19.424 -1.892  1.00 66.39  ? 24  GLY B CA  1 
ATOM   3028 C C   . GLY B 1 24  ? 37.244  20.300 -0.742  1.00 61.85  ? 24  GLY B C   1 
ATOM   3029 O O   . GLY B 1 24  ? 36.366  21.149 -0.952  1.00 58.30  ? 24  GLY B O   1 
ATOM   3030 N N   . LYS B 1 25  ? 37.776  20.113 0.454   1.00 58.52  ? 25  LYS B N   1 
ATOM   3031 C CA  . LYS B 1 25  ? 37.357  20.978 1.538   1.00 60.48  ? 25  LYS B CA  1 
ATOM   3032 C C   . LYS B 1 25  ? 38.221  22.216 1.737   1.00 59.39  ? 25  LYS B C   1 
ATOM   3033 O O   . LYS B 1 25  ? 39.448  22.142 1.788   1.00 57.57  ? 25  LYS B O   1 
ATOM   3034 C CB  . LYS B 1 25  ? 37.181  20.201 2.851   1.00 63.21  ? 25  LYS B CB  1 
ATOM   3035 C CG  . LYS B 1 25  ? 35.759  19.616 3.058   1.00 65.82  ? 25  LYS B CG  1 
ATOM   3036 C CD  . LYS B 1 25  ? 34.757  20.627 3.676   1.00 70.62  ? 25  LYS B CD  1 
ATOM   3037 C CE  . LYS B 1 25  ? 34.451  21.855 2.784   1.00 71.91  ? 25  LYS B CE  1 
ATOM   3038 N NZ  . LYS B 1 25  ? 34.247  23.122 3.578   1.00 70.69  ? 25  LYS B NZ  1 
ATOM   3039 N N   . GLU B 1 26  ? 37.564  23.368 1.778   1.00 58.15  ? 26  GLU B N   1 
ATOM   3040 C CA  . GLU B 1 26  ? 38.270  24.598 2.000   1.00 61.27  ? 26  GLU B CA  1 
ATOM   3041 C C   . GLU B 1 26  ? 38.913  24.439 3.368   1.00 64.73  ? 26  GLU B C   1 
ATOM   3042 O O   . GLU B 1 26  ? 38.256  24.005 4.332   1.00 67.13  ? 26  GLU B O   1 
ATOM   3043 C CB  . GLU B 1 26  ? 37.320  25.794 2.007   1.00 63.74  ? 26  GLU B CB  1 
ATOM   3044 C CG  . GLU B 1 26  ? 37.882  27.002 1.239   1.00 67.59  ? 26  GLU B CG  1 
ATOM   3045 C CD  . GLU B 1 26  ? 37.713  28.333 1.950   1.00 64.70  ? 26  GLU B CD  1 
ATOM   3046 O OE1 . GLU B 1 26  ? 38.165  28.445 3.109   1.00 64.84  ? 26  GLU B OE1 1 
ATOM   3047 O OE2 . GLU B 1 26  ? 37.154  29.267 1.331   1.00 62.99  ? 26  GLU B OE2 1 
ATOM   3048 N N   . ARG B 1 27  ? 40.203  24.759 3.438   1.00 65.13  ? 27  ARG B N   1 
ATOM   3049 C CA  . ARG B 1 27  ? 40.975  24.659 4.667   1.00 61.53  ? 27  ARG B CA  1 
ATOM   3050 C C   . ARG B 1 27  ? 41.845  25.872 4.754   1.00 55.62  ? 27  ARG B C   1 
ATOM   3051 O O   . ARG B 1 27  ? 42.043  26.547 3.757   1.00 54.47  ? 27  ARG B O   1 
ATOM   3052 C CB  . ARG B 1 27  ? 41.897  23.452 4.607   1.00 67.24  ? 27  ARG B CB  1 
ATOM   3053 C CG  . ARG B 1 27  ? 41.229  22.117 4.579   1.00 78.63  ? 27  ARG B CG  1 
ATOM   3054 C CD  . ARG B 1 27  ? 41.900  21.234 5.604   1.00 89.91  ? 27  ARG B CD  1 
ATOM   3055 N NE  . ARG B 1 27  ? 42.085  19.868 5.128   1.00 99.47  ? 27  ARG B NE  1 
ATOM   3056 C CZ  . ARG B 1 27  ? 42.899  18.990 5.704   1.00 103.68 ? 27  ARG B CZ  1 
ATOM   3057 N NH1 . ARG B 1 27  ? 43.609  19.345 6.771   1.00 107.12 ? 27  ARG B NH1 1 
ATOM   3058 N NH2 . ARG B 1 27  ? 43.006  17.761 5.214   1.00 106.00 ? 27  ARG B NH2 1 
ATOM   3059 N N   . THR B 1 28  ? 42.417  26.109 5.926   1.00 54.75  ? 28  THR B N   1 
ATOM   3060 C CA  . THR B 1 28  ? 43.320  27.229 6.109   1.00 58.17  ? 28  THR B CA  1 
ATOM   3061 C C   . THR B 1 28  ? 44.584  26.761 6.824   1.00 60.09  ? 28  THR B C   1 
ATOM   3062 O O   . THR B 1 28  ? 44.492  26.059 7.821   1.00 62.53  ? 28  THR B O   1 
ATOM   3063 C CB  . THR B 1 28  ? 42.660  28.342 6.900   1.00 56.32  ? 28  THR B CB  1 
ATOM   3064 O OG1 . THR B 1 28  ? 41.388  28.627 6.313   1.00 58.44  ? 28  THR B OG1 1 
ATOM   3065 C CG2 . THR B 1 28  ? 43.512  29.594 6.841   1.00 59.06  ? 28  THR B CG2 1 
ATOM   3066 N N   . ARG B 1 29  ? 45.746  27.034 6.232   1.00 62.71  ? 29  ARG B N   1 
ATOM   3067 C CA  . ARG B 1 29  ? 47.043  26.672 6.818   1.00 62.80  ? 29  ARG B CA  1 
ATOM   3068 C C   . ARG B 1 29  ? 47.657  27.970 7.383   1.00 65.93  ? 29  ARG B C   1 
ATOM   3069 O O   . ARG B 1 29  ? 47.264  29.070 7.003   1.00 64.07  ? 29  ARG B O   1 
ATOM   3070 C CB  . ARG B 1 29  ? 48.033  26.155 5.740   1.00 60.06  ? 29  ARG B CB  1 
ATOM   3071 C CG  . ARG B 1 29  ? 47.658  24.927 4.889   1.00 54.14  ? 29  ARG B CG  1 
ATOM   3072 C CD  . ARG B 1 29  ? 48.632  24.757 3.687   1.00 48.69  ? 29  ARG B CD  1 
ATOM   3073 N NE  . ARG B 1 29  ? 48.365  23.527 2.936   1.00 49.48  ? 29  ARG B NE  1 
ATOM   3074 C CZ  . ARG B 1 29  ? 48.533  23.335 1.619   1.00 50.91  ? 29  ARG B CZ  1 
ATOM   3075 N NH1 . ARG B 1 29  ? 48.980  24.277 0.796   1.00 45.60  ? 29  ARG B NH1 1 
ATOM   3076 N NH2 . ARG B 1 29  ? 48.240  22.147 1.115   1.00 51.85  ? 29  ARG B NH2 1 
ATOM   3077 N N   . GLU B 1 30  ? 48.588  27.837 8.317   1.00 70.01  ? 30  GLU B N   1 
ATOM   3078 C CA  . GLU B 1 30  ? 49.314  28.981 8.840   1.00 74.11  ? 30  GLU B CA  1 
ATOM   3079 C C   . GLU B 1 30  ? 50.716  28.405 8.855   1.00 74.55  ? 30  GLU B C   1 
ATOM   3080 O O   . GLU B 1 30  ? 51.004  27.492 9.623   1.00 75.67  ? 30  GLU B O   1 
ATOM   3081 C CB  . GLU B 1 30  ? 48.883  29.404 10.240  1.00 82.62  ? 30  GLU B CB  1 
ATOM   3082 C CG  . GLU B 1 30  ? 49.688  30.643 10.708  1.00 96.39  ? 30  GLU B CG  1 
ATOM   3083 C CD  . GLU B 1 30  ? 49.286  31.181 12.080  1.00 104.90 ? 30  GLU B CD  1 
ATOM   3084 O OE1 . GLU B 1 30  ? 49.250  30.393 13.055  1.00 112.11 ? 30  GLU B OE1 1 
ATOM   3085 O OE2 . GLU B 1 30  ? 49.035  32.403 12.183  1.00 108.94 ? 30  GLU B OE2 1 
ATOM   3086 N N   . VAL B 1 31  ? 51.538  28.864 7.914   1.00 74.93  ? 31  VAL B N   1 
ATOM   3087 C CA  . VAL B 1 31  ? 52.905  28.384 7.732   1.00 71.93  ? 31  VAL B CA  1 
ATOM   3088 C C   . VAL B 1 31  ? 54.046  29.344 8.021   1.00 68.04  ? 31  VAL B C   1 
ATOM   3089 O O   . VAL B 1 31  ? 53.958  30.553 7.788   1.00 60.46  ? 31  VAL B O   1 
ATOM   3090 C CB  . VAL B 1 31  ? 53.104  27.846 6.272   1.00 73.78  ? 31  VAL B CB  1 
ATOM   3091 C CG1 . VAL B 1 31  ? 54.497  27.243 6.086   1.00 72.71  ? 31  VAL B CG1 1 
ATOM   3092 C CG2 . VAL B 1 31  ? 52.024  26.806 5.934   1.00 74.21  ? 31  VAL B CG2 1 
ATOM   3093 N N   . GLU B 1 32  ? 55.118  28.748 8.541   1.00 70.04  ? 32  GLU B N   1 
ATOM   3094 C CA  . GLU B 1 32  ? 56.383  29.413 8.855   1.00 71.32  ? 32  GLU B CA  1 
ATOM   3095 C C   . GLU B 1 32  ? 56.993  29.409 7.453   1.00 70.86  ? 32  GLU B C   1 
ATOM   3096 O O   . GLU B 1 32  ? 57.209  28.337 6.878   1.00 73.61  ? 32  GLU B O   1 
ATOM   3097 C CB  . GLU B 1 32  ? 57.248  28.523 9.769   1.00 71.80  ? 32  GLU B CB  1 
ATOM   3098 C CG  . GLU B 1 32  ? 56.499  27.383 10.479  1.00 76.44  ? 32  GLU B CG  1 
ATOM   3099 C CD  . GLU B 1 32  ? 57.117  25.997 10.235  1.00 78.00  ? 32  GLU B CD  1 
ATOM   3100 O OE1 . GLU B 1 32  ? 56.867  25.401 9.162   1.00 78.93  ? 32  GLU B OE1 1 
ATOM   3101 O OE2 . GLU B 1 32  ? 57.830  25.495 11.130  1.00 76.20  ? 32  GLU B OE2 1 
ATOM   3102 N N   . TYR B 1 33  ? 57.264  30.572 6.879   1.00 67.23  ? 33  TYR B N   1 
ATOM   3103 C CA  . TYR B 1 33  ? 57.778  30.556 5.522   1.00 62.17  ? 33  TYR B CA  1 
ATOM   3104 C C   . TYR B 1 33  ? 59.002  31.408 5.200   1.00 63.95  ? 33  TYR B C   1 
ATOM   3105 O O   . TYR B 1 33  ? 59.115  32.568 5.635   1.00 61.24  ? 33  TYR B O   1 
ATOM   3106 C CB  . TYR B 1 33  ? 56.629  30.872 4.563   1.00 54.71  ? 33  TYR B CB  1 
ATOM   3107 C CG  . TYR B 1 33  ? 57.061  31.033 3.142   1.00 47.86  ? 33  TYR B CG  1 
ATOM   3108 C CD1 . TYR B 1 33  ? 57.478  29.942 2.390   1.00 46.08  ? 33  TYR B CD1 1 
ATOM   3109 C CD2 . TYR B 1 33  ? 57.134  32.293 2.570   1.00 43.79  ? 33  TYR B CD2 1 
ATOM   3110 C CE1 . TYR B 1 33  ? 57.968  30.118 1.105   1.00 45.44  ? 33  TYR B CE1 1 
ATOM   3111 C CE2 . TYR B 1 33  ? 57.623  32.479 1.305   1.00 42.17  ? 33  TYR B CE2 1 
ATOM   3112 C CZ  . TYR B 1 33  ? 58.042  31.394 0.584   1.00 41.37  ? 33  TYR B CZ  1 
ATOM   3113 O OH  . TYR B 1 33  ? 58.597  31.611 -0.636  1.00 48.39  ? 33  TYR B OH  1 
ATOM   3114 N N   . LEU B 1 34  ? 59.924  30.809 4.437   1.00 65.29  ? 34  LEU B N   1 
ATOM   3115 C CA  . LEU B 1 34  ? 61.135  31.507 3.999   1.00 64.79  ? 34  LEU B CA  1 
ATOM   3116 C C   . LEU B 1 34  ? 61.218  31.487 2.467   1.00 62.54  ? 34  LEU B C   1 
ATOM   3117 O O   . LEU B 1 34  ? 61.089  30.430 1.813   1.00 57.33  ? 34  LEU B O   1 
ATOM   3118 C CB  . LEU B 1 34  ? 62.416  30.934 4.631   1.00 67.14  ? 34  LEU B CB  1 
ATOM   3119 C CG  . LEU B 1 34  ? 63.183  29.783 3.958   1.00 70.67  ? 34  LEU B CG  1 
ATOM   3120 C CD1 . LEU B 1 34  ? 64.635  30.198 3.748   1.00 70.88  ? 34  LEU B CD1 1 
ATOM   3121 C CD2 . LEU B 1 34  ? 63.098  28.504 4.792   1.00 72.51  ? 34  LEU B CD2 1 
ATOM   3122 N N   . PRO B 1 35  ? 61.372  32.681 1.880   1.00 61.91  ? 35  PRO B N   1 
ATOM   3123 C CA  . PRO B 1 35  ? 61.475  32.942 0.443   1.00 64.36  ? 35  PRO B CA  1 
ATOM   3124 C C   . PRO B 1 35  ? 62.644  32.236 -0.269  1.00 67.22  ? 35  PRO B C   1 
ATOM   3125 O O   . PRO B 1 35  ? 63.807  32.491 0.039   1.00 69.68  ? 35  PRO B O   1 
ATOM   3126 C CB  . PRO B 1 35  ? 61.642  34.461 0.400   1.00 64.75  ? 35  PRO B CB  1 
ATOM   3127 C CG  . PRO B 1 35  ? 60.924  34.927 1.643   1.00 61.21  ? 35  PRO B CG  1 
ATOM   3128 C CD  . PRO B 1 35  ? 61.386  33.940 2.649   1.00 58.21  ? 35  PRO B CD  1 
ATOM   3129 N N   . THR B 1 36  ? 62.329  31.388 -1.246  1.00 67.76  ? 36  THR B N   1 
ATOM   3130 C CA  . THR B 1 36  ? 63.338  30.671 -2.030  1.00 66.66  ? 36  THR B CA  1 
ATOM   3131 C C   . THR B 1 36  ? 64.028  31.571 -3.065  1.00 67.19  ? 36  THR B C   1 
ATOM   3132 O O   . THR B 1 36  ? 65.051  31.192 -3.646  1.00 64.89  ? 36  THR B O   1 
ATOM   3133 C CB  . THR B 1 36  ? 62.701  29.466 -2.743  1.00 68.99  ? 36  THR B CB  1 
ATOM   3134 O OG1 . THR B 1 36  ? 62.492  28.409 -1.801  1.00 73.74  ? 36  THR B OG1 1 
ATOM   3135 C CG2 . THR B 1 36  ? 63.562  28.946 -3.875  1.00 72.42  ? 36  THR B CG2 1 
ATOM   3136 N N   . MET B 1 37  ? 63.461  32.762 -3.271  1.00 68.60  ? 37  MET B N   1 
ATOM   3137 C CA  . MET B 1 37  ? 63.953  33.775 -4.220  1.00 67.38  ? 37  MET B CA  1 
ATOM   3138 C C   . MET B 1 37  ? 63.551  35.147 -3.679  1.00 63.88  ? 37  MET B C   1 
ATOM   3139 O O   . MET B 1 37  ? 62.679  35.231 -2.820  1.00 62.49  ? 37  MET B O   1 
ATOM   3140 C CB  . MET B 1 37  ? 63.372  33.535 -5.621  1.00 72.29  ? 37  MET B CB  1 
ATOM   3141 C CG  . MET B 1 37  ? 64.046  32.374 -6.368  1.00 79.10  ? 37  MET B CG  1 
ATOM   3142 S SD  . MET B 1 37  ? 63.238  31.742 -7.862  1.00 86.00  ? 37  MET B SD  1 
ATOM   3143 C CE  . MET B 1 37  ? 62.735  30.091 -7.327  1.00 81.65  ? 37  MET B CE  1 
ATOM   3144 N N   . PHE B 1 38  ? 64.086  36.229 -4.234  1.00 63.69  ? 38  PHE B N   1 
ATOM   3145 C CA  . PHE B 1 38  ? 63.764  37.528 -3.651  1.00 66.53  ? 38  PHE B CA  1 
ATOM   3146 C C   . PHE B 1 38  ? 63.683  38.827 -4.466  1.00 69.84  ? 38  PHE B C   1 
ATOM   3147 O O   . PHE B 1 38  ? 62.938  39.732 -4.066  1.00 74.61  ? 38  PHE B O   1 
ATOM   3148 C CB  . PHE B 1 38  ? 64.732  37.783 -2.510  1.00 61.35  ? 38  PHE B CB  1 
ATOM   3149 C CG  . PHE B 1 38  ? 66.134  38.014 -2.981  1.00 58.36  ? 38  PHE B CG  1 
ATOM   3150 C CD1 . PHE B 1 38  ? 66.872  36.966 -3.558  1.00 54.86  ? 38  PHE B CD1 1 
ATOM   3151 C CD2 . PHE B 1 38  ? 66.713  39.276 -2.875  1.00 52.17  ? 38  PHE B CD2 1 
ATOM   3152 C CE1 . PHE B 1 38  ? 68.153  37.166 -4.014  1.00 50.00  ? 38  PHE B CE1 1 
ATOM   3153 C CE2 . PHE B 1 38  ? 68.002  39.489 -3.331  1.00 50.89  ? 38  PHE B CE2 1 
ATOM   3154 C CZ  . PHE B 1 38  ? 68.727  38.424 -3.902  1.00 50.55  ? 38  PHE B CZ  1 
ATOM   3155 N N   . ARG B 1 39  ? 64.494  38.989 -5.514  1.00 66.96  ? 39  ARG B N   1 
ATOM   3156 C CA  . ARG B 1 39  ? 64.462  40.241 -6.305  1.00 64.35  ? 39  ARG B CA  1 
ATOM   3157 C C   . ARG B 1 39  ? 64.851  41.441 -5.446  1.00 59.87  ? 39  ARG B C   1 
ATOM   3158 O O   . ARG B 1 39  ? 64.029  42.079 -4.799  1.00 55.47  ? 39  ARG B O   1 
ATOM   3159 C CB  . ARG B 1 39  ? 63.084  40.493 -6.926  1.00 65.22  ? 39  ARG B CB  1 
ATOM   3160 C CG  . ARG B 1 39  ? 62.647  39.420 -7.892  1.00 65.19  ? 39  ARG B CG  1 
ATOM   3161 C CD  . ARG B 1 39  ? 62.640  39.941 -9.296  1.00 66.21  ? 39  ARG B CD  1 
ATOM   3162 N NE  . ARG B 1 39  ? 61.309  39.841 -9.880  1.00 67.66  ? 39  ARG B NE  1 
ATOM   3163 C CZ  . ARG B 1 39  ? 60.285  40.609 -9.527  1.00 64.89  ? 39  ARG B CZ  1 
ATOM   3164 N NH1 . ARG B 1 39  ? 60.441  41.537 -8.599  1.00 64.46  ? 39  ARG B NH1 1 
ATOM   3165 N NH2 . ARG B 1 39  ? 59.102  40.446 -10.110 1.00 65.02  ? 39  ARG B NH2 1 
ATOM   3166 N N   . HIS B 1 40  ? 66.127  41.769 -5.527  1.00 59.74  ? 40  HIS B N   1 
ATOM   3167 C CA  . HIS B 1 40  ? 66.723  42.847 -4.763  1.00 59.93  ? 40  HIS B CA  1 
ATOM   3168 C C   . HIS B 1 40  ? 66.012  44.185 -4.906  1.00 61.04  ? 40  HIS B C   1 
ATOM   3169 O O   . HIS B 1 40  ? 65.916  44.951 -3.948  1.00 62.53  ? 40  HIS B O   1 
ATOM   3170 C CB  . HIS B 1 40  ? 68.187  42.985 -5.181  1.00 57.19  ? 40  HIS B CB  1 
ATOM   3171 C CG  . HIS B 1 40  ? 68.370  43.049 -6.663  1.00 51.80  ? 40  HIS B CG  1 
ATOM   3172 N ND1 . HIS B 1 40  ? 68.332  41.924 -7.453  1.00 50.98  ? 40  HIS B ND1 1 
ATOM   3173 C CD2 . HIS B 1 40  ? 68.495  44.103 -7.503  1.00 48.85  ? 40  HIS B CD2 1 
ATOM   3174 C CE1 . HIS B 1 40  ? 68.415  42.280 -8.724  1.00 52.24  ? 40  HIS B CE1 1 
ATOM   3175 N NE2 . HIS B 1 40  ? 68.515  43.600 -8.781  1.00 50.48  ? 40  HIS B NE2 1 
ATOM   3176 N N   . CYS B 1 41  ? 65.489  44.451 -6.094  1.00 62.51  ? 41  CYS B N   1 
ATOM   3177 C CA  . CYS B 1 41  ? 64.812  45.711 -6.362  1.00 63.80  ? 41  CYS B CA  1 
ATOM   3178 C C   . CYS B 1 41  ? 63.475  45.910 -5.577  1.00 64.29  ? 41  CYS B C   1 
ATOM   3179 O O   . CYS B 1 41  ? 62.787  46.923 -5.747  1.00 64.86  ? 41  CYS B O   1 
ATOM   3180 C CB  . CYS B 1 41  ? 64.627  45.868 -7.884  1.00 62.20  ? 41  CYS B CB  1 
ATOM   3181 S SG  . CYS B 1 41  ? 63.374  44.779 -8.677  1.00 60.40  ? 41  CYS B SG  1 
ATOM   3182 N N   . LYS B 1 42  ? 63.125  44.962 -4.707  1.00 63.48  ? 42  LYS B N   1 
ATOM   3183 C CA  . LYS B 1 42  ? 61.901  45.059 -3.911  1.00 64.22  ? 42  LYS B CA  1 
ATOM   3184 C C   . LYS B 1 42  ? 62.170  45.845 -2.639  1.00 67.03  ? 42  LYS B C   1 
ATOM   3185 O O   . LYS B 1 42  ? 62.085  45.297 -1.544  1.00 68.97  ? 42  LYS B O   1 
ATOM   3186 C CB  . LYS B 1 42  ? 61.396  43.661 -3.536  1.00 63.95  ? 42  LYS B CB  1 
ATOM   3187 C CG  . LYS B 1 42  ? 60.102  43.233 -4.219  1.00 58.61  ? 42  LYS B CG  1 
ATOM   3188 C CD  . LYS B 1 42  ? 60.266  43.142 -5.736  1.00 58.76  ? 42  LYS B CD  1 
ATOM   3189 C CE  . LYS B 1 42  ? 58.915  43.045 -6.434  1.00 54.46  ? 42  LYS B CE  1 
ATOM   3190 N NZ  . LYS B 1 42  ? 58.912  43.649 -7.804  1.00 52.12  ? 42  LYS B NZ  1 
ATOM   3191 N N   . GLU B 1 43  ? 62.466  47.134 -2.773  1.00 70.59  ? 43  GLU B N   1 
ATOM   3192 C CA  . GLU B 1 43  ? 62.766  47.976 -1.613  1.00 73.08  ? 43  GLU B CA  1 
ATOM   3193 C C   . GLU B 1 43  ? 62.120  49.352 -1.693  1.00 74.87  ? 43  GLU B C   1 
ATOM   3194 O O   . GLU B 1 43  ? 62.027  49.945 -2.767  1.00 76.68  ? 43  GLU B O   1 
ATOM   3195 C CB  . GLU B 1 43  ? 64.290  48.110 -1.411  1.00 73.57  ? 43  GLU B CB  1 
ATOM   3196 C CG  . GLU B 1 43  ? 65.141  48.237 -2.691  1.00 75.21  ? 43  GLU B CG  1 
ATOM   3197 C CD  . GLU B 1 43  ? 64.767  49.436 -3.564  1.00 78.80  ? 43  GLU B CD  1 
ATOM   3198 O OE1 . GLU B 1 43  ? 64.693  50.571 -3.037  1.00 80.63  ? 43  GLU B OE1 1 
ATOM   3199 O OE2 . GLU B 1 43  ? 64.538  49.244 -4.780  1.00 79.24  ? 43  GLU B OE2 1 
ATOM   3200 N N   . GLY B 1 52  ? 57.233  49.182 -16.835 1.00 59.04  ? 52  GLY B N   1 
ATOM   3201 C CA  . GLY B 1 52  ? 58.169  48.245 -17.439 1.00 60.80  ? 52  GLY B CA  1 
ATOM   3202 C C   . GLY B 1 52  ? 59.577  48.279 -16.842 1.00 59.47  ? 52  GLY B C   1 
ATOM   3203 O O   . GLY B 1 52  ? 60.567  48.211 -17.575 1.00 59.74  ? 52  GLY B O   1 
ATOM   3204 N N   . LYS B 1 53  ? 59.664  48.406 -15.518 1.00 57.02  ? 53  LYS B N   1 
ATOM   3205 C CA  . LYS B 1 53  ? 60.937  48.426 -14.821 1.00 54.68  ? 53  LYS B CA  1 
ATOM   3206 C C   . LYS B 1 53  ? 60.805  47.450 -13.665 1.00 52.97  ? 53  LYS B C   1 
ATOM   3207 O O   . LYS B 1 53  ? 59.998  47.659 -12.758 1.00 52.77  ? 53  LYS B O   1 
ATOM   3208 C CB  . LYS B 1 53  ? 61.244  49.818 -14.271 1.00 58.08  ? 53  LYS B CB  1 
ATOM   3209 C CG  . LYS B 1 53  ? 61.249  50.909 -15.321 1.00 65.78  ? 53  LYS B CG  1 
ATOM   3210 C CD  . LYS B 1 53  ? 62.491  50.860 -16.184 1.00 70.33  ? 53  LYS B CD  1 
ATOM   3211 C CE  . LYS B 1 53  ? 62.286  51.587 -17.508 1.00 71.97  ? 53  LYS B CE  1 
ATOM   3212 N NZ  . LYS B 1 53  ? 61.430  50.763 -18.417 1.00 75.37  ? 53  LYS B NZ  1 
ATOM   3213 N N   . ASN B 1 54  ? 61.548  46.353 -13.741 1.00 49.17  ? 54  ASN B N   1 
ATOM   3214 C CA  . ASN B 1 54  ? 61.541  45.341 -12.701 1.00 46.06  ? 54  ASN B CA  1 
ATOM   3215 C C   . ASN B 1 54  ? 62.991  44.855 -12.555 1.00 47.89  ? 54  ASN B C   1 
ATOM   3216 O O   . ASN B 1 54  ? 63.943  45.633 -12.747 1.00 42.68  ? 54  ASN B O   1 
ATOM   3217 C CB  . ASN B 1 54  ? 60.599  44.201 -13.100 1.00 46.19  ? 54  ASN B CB  1 
ATOM   3218 C CG  . ASN B 1 54  ? 60.281  43.250 -11.945 1.00 48.62  ? 54  ASN B CG  1 
ATOM   3219 O OD1 . ASN B 1 54  ? 60.639  42.085 -11.983 1.00 51.11  ? 54  ASN B OD1 1 
ATOM   3220 N ND2 . ASN B 1 54  ? 59.592  43.741 -10.934 1.00 50.43  ? 54  ASN B ND2 1 
ATOM   3221 N N   . CYS B 1 55  ? 63.173  43.583 -12.223 1.00 45.98  ? 55  CYS B N   1 
ATOM   3222 C CA  . CYS B 1 55  ? 64.508  43.073 -12.077 1.00 45.26  ? 55  CYS B CA  1 
ATOM   3223 C C   . CYS B 1 55  ? 64.541  41.557 -12.040 1.00 45.91  ? 55  CYS B C   1 
ATOM   3224 O O   . CYS B 1 55  ? 63.535  40.886 -11.818 1.00 40.27  ? 55  CYS B O   1 
ATOM   3225 C CB  . CYS B 1 55  ? 65.162  43.660 -10.834 1.00 46.30  ? 55  CYS B CB  1 
ATOM   3226 S SG  . CYS B 1 55  ? 64.371  43.119 -9.291  1.00 54.79  ? 55  CYS B SG  1 
ATOM   3227 N N   . ALA B 1 56  ? 65.740  41.040 -12.267 1.00 49.74  ? 56  ALA B N   1 
ATOM   3228 C CA  . ALA B 1 56  ? 66.006  39.618 -12.318 1.00 47.28  ? 56  ALA B CA  1 
ATOM   3229 C C   . ALA B 1 56  ? 65.920  38.873 -10.999 1.00 46.31  ? 56  ALA B C   1 
ATOM   3230 O O   . ALA B 1 56  ? 66.441  39.325 -9.994  1.00 46.06  ? 56  ALA B O   1 
ATOM   3231 C CB  . ALA B 1 56  ? 67.359  39.407 -12.935 1.00 50.23  ? 56  ALA B CB  1 
ATOM   3232 N N   . PRO B 1 57  ? 65.139  37.787 -10.964 1.00 50.76  ? 57  PRO B N   1 
ATOM   3233 C CA  . PRO B 1 57  ? 65.042  37.024 -9.725  1.00 53.69  ? 57  PRO B CA  1 
ATOM   3234 C C   . PRO B 1 57  ? 66.246  36.081 -9.678  1.00 55.83  ? 57  PRO B C   1 
ATOM   3235 O O   . PRO B 1 57  ? 66.770  35.673 -10.727 1.00 52.44  ? 57  PRO B O   1 
ATOM   3236 C CB  . PRO B 1 57  ? 63.722  36.256 -9.884  1.00 53.09  ? 57  PRO B CB  1 
ATOM   3237 C CG  . PRO B 1 57  ? 63.598  36.081 -11.341 1.00 52.81  ? 57  PRO B CG  1 
ATOM   3238 C CD  . PRO B 1 57  ? 64.083  37.389 -11.914 1.00 55.89  ? 57  PRO B CD  1 
ATOM   3239 N N   . GLN B 1 58  ? 66.724  35.822 -8.464  1.00 59.23  ? 58  GLN B N   1 
ATOM   3240 C CA  . GLN B 1 58  ? 67.849  34.927 -8.240  1.00 63.68  ? 58  GLN B CA  1 
ATOM   3241 C C   . GLN B 1 58  ? 67.506  34.123 -6.995  1.00 64.47  ? 58  GLN B C   1 
ATOM   3242 O O   . GLN B 1 58  ? 67.136  34.681 -5.953  1.00 63.33  ? 58  GLN B O   1 
ATOM   3243 C CB  . GLN B 1 58  ? 69.148  35.707 -7.999  1.00 68.80  ? 58  GLN B CB  1 
ATOM   3244 C CG  . GLN B 1 58  ? 69.159  37.152 -8.487  1.00 72.34  ? 58  GLN B CG  1 
ATOM   3245 C CD  . GLN B 1 58  ? 69.890  38.090 -7.524  1.00 75.82  ? 58  GLN B CD  1 
ATOM   3246 O OE1 . GLN B 1 58  ? 69.502  39.256 -7.359  1.00 77.21  ? 58  GLN B OE1 1 
ATOM   3247 N NE2 . GLN B 1 58  ? 70.946  37.586 -6.880  1.00 75.34  ? 58  GLN B NE2 1 
ATOM   3248 N N   . LYS B 1 59  ? 67.629  32.811 -7.109  1.00 66.93  ? 59  LYS B N   1 
ATOM   3249 C CA  . LYS B 1 59  ? 67.329  31.914 -6.008  1.00 70.85  ? 59  LYS B CA  1 
ATOM   3250 C C   . LYS B 1 59  ? 68.351  32.049 -4.868  1.00 70.00  ? 59  LYS B C   1 
ATOM   3251 O O   . LYS B 1 59  ? 69.372  32.728 -5.000  1.00 70.81  ? 59  LYS B O   1 
ATOM   3252 C CB  . LYS B 1 59  ? 67.277  30.473 -6.540  1.00 74.22  ? 59  LYS B CB  1 
ATOM   3253 C CG  . LYS B 1 59  ? 66.446  29.515 -5.696  1.00 80.07  ? 59  LYS B CG  1 
ATOM   3254 C CD  . LYS B 1 59  ? 65.776  28.446 -6.559  1.00 85.31  ? 59  LYS B CD  1 
ATOM   3255 C CE  . LYS B 1 59  ? 66.664  27.228 -6.796  1.00 90.49  ? 59  LYS B CE  1 
ATOM   3256 N NZ  . LYS B 1 59  ? 67.880  27.515 -7.601  1.00 95.56  ? 59  LYS B NZ  1 
ATOM   3257 N N   . PHE B 1 60  ? 68.033  31.458 -3.727  1.00 69.17  ? 60  PHE B N   1 
ATOM   3258 C CA  . PHE B 1 60  ? 68.919  31.472 -2.575  1.00 69.14  ? 60  PHE B CA  1 
ATOM   3259 C C   . PHE B 1 60  ? 69.403  30.034 -2.412  1.00 70.24  ? 60  PHE B C   1 
ATOM   3260 O O   . PHE B 1 60  ? 68.588  29.125 -2.232  1.00 70.29  ? 60  PHE B O   1 
ATOM   3261 C CB  . PHE B 1 60  ? 68.144  31.865 -1.328  1.00 70.20  ? 60  PHE B CB  1 
ATOM   3262 C CG  . PHE B 1 60  ? 67.994  33.343 -1.132  1.00 72.22  ? 60  PHE B CG  1 
ATOM   3263 C CD1 . PHE B 1 60  ? 69.117  34.173 -1.064  1.00 71.39  ? 60  PHE B CD1 1 
ATOM   3264 C CD2 . PHE B 1 60  ? 66.736  33.892 -0.880  1.00 70.82  ? 60  PHE B CD2 1 
ATOM   3265 C CE1 . PHE B 1 60  ? 68.984  35.529 -0.726  1.00 71.29  ? 60  PHE B CE1 1 
ATOM   3266 C CE2 . PHE B 1 60  ? 66.598  35.243 -0.542  1.00 70.26  ? 60  PHE B CE2 1 
ATOM   3267 C CZ  . PHE B 1 60  ? 67.721  36.061 -0.462  1.00 67.03  ? 60  PHE B CZ  1 
ATOM   3268 N N   . PRO B 1 61  ? 70.728  29.795 -2.498  1.00 70.93  ? 61  PRO B N   1 
ATOM   3269 C CA  . PRO B 1 61  ? 71.213  28.421 -2.343  1.00 71.28  ? 61  PRO B CA  1 
ATOM   3270 C C   . PRO B 1 61  ? 71.074  27.844 -0.927  1.00 72.91  ? 61  PRO B C   1 
ATOM   3271 O O   . PRO B 1 61  ? 70.870  26.637 -0.777  1.00 75.39  ? 61  PRO B O   1 
ATOM   3272 C CB  . PRO B 1 61  ? 72.671  28.522 -2.789  1.00 68.22  ? 61  PRO B CB  1 
ATOM   3273 C CG  . PRO B 1 61  ? 73.052  29.899 -2.383  1.00 68.29  ? 61  PRO B CG  1 
ATOM   3274 C CD  . PRO B 1 61  ? 71.846  30.700 -2.830  1.00 70.80  ? 61  PRO B CD  1 
ATOM   3275 N N   . SER B 1 62  ? 71.143  28.696 0.098   1.00 74.25  ? 62  SER B N   1 
ATOM   3276 C CA  . SER B 1 62  ? 71.048  28.238 1.492   1.00 74.75  ? 62  SER B CA  1 
ATOM   3277 C C   . SER B 1 62  ? 70.113  29.063 2.374   1.00 71.78  ? 62  SER B C   1 
ATOM   3278 O O   . SER B 1 62  ? 70.349  30.243 2.592   1.00 67.47  ? 62  SER B O   1 
ATOM   3279 C CB  . SER B 1 62  ? 72.436  28.218 2.141   1.00 76.51  ? 62  SER B CB  1 
ATOM   3280 O OG  . SER B 1 62  ? 73.337  27.382 1.428   1.00 82.90  ? 62  SER B OG  1 
ATOM   3281 N N   . MET B 1 63  ? 69.116  28.408 2.964   1.00 70.62  ? 63  MET B N   1 
ATOM   3282 C CA  . MET B 1 63  ? 68.144  29.065 3.842   1.00 71.14  ? 63  MET B CA  1 
ATOM   3283 C C   . MET B 1 63  ? 68.793  30.071 4.794   1.00 70.26  ? 63  MET B C   1 
ATOM   3284 O O   . MET B 1 63  ? 68.111  30.957 5.323   1.00 71.49  ? 63  MET B O   1 
ATOM   3285 C CB  . MET B 1 63  ? 67.366  28.021 4.673   1.00 73.31  ? 63  MET B CB  1 
ATOM   3286 C CG  . MET B 1 63  ? 66.421  27.075 3.901   1.00 70.37  ? 63  MET B CG  1 
ATOM   3287 S SD  . MET B 1 63  ? 65.740  25.716 4.941   1.00 67.65  ? 63  MET B SD  1 
ATOM   3288 C CE  . MET B 1 63  ? 65.349  24.545 3.705   1.00 60.92  ? 63  MET B CE  1 
ATOM   3289 N N   . LYS B 1 64  ? 70.092  29.892 5.047   1.00 67.55  ? 64  LYS B N   1 
ATOM   3290 C CA  . LYS B 1 64  ? 70.856  30.775 5.930   1.00 63.61  ? 64  LYS B CA  1 
ATOM   3291 C C   . LYS B 1 64  ? 71.016  32.131 5.242   1.00 61.99  ? 64  LYS B C   1 
ATOM   3292 O O   . LYS B 1 64  ? 70.625  33.174 5.785   1.00 57.56  ? 64  LYS B O   1 
ATOM   3293 C CB  . LYS B 1 64  ? 72.237  30.161 6.276   1.00 59.54  ? 64  LYS B CB  1 
ATOM   3294 C CG  . LYS B 1 64  ? 73.118  29.818 5.064   1.00 56.32  ? 64  LYS B CG  1 
ATOM   3295 C CD  . LYS B 1 64  ? 74.620  29.723 5.415   1.00 54.95  ? 64  LYS B CD  1 
ATOM   3296 C CE  . LYS B 1 64  ? 75.550  29.712 4.168   1.00 47.20  ? 64  LYS B CE  1 
ATOM   3297 N NZ  . LYS B 1 64  ? 75.856  28.383 3.570   1.00 37.70  ? 64  LYS B NZ  1 
ATOM   3298 N N   . ASP B 1 65  ? 71.480  32.080 3.994   1.00 62.66  ? 65  ASP B N   1 
ATOM   3299 C CA  . ASP B 1 65  ? 71.699  33.266 3.181   1.00 65.41  ? 65  ASP B CA  1 
ATOM   3300 C C   . ASP B 1 65  ? 70.392  33.928 2.730   1.00 65.47  ? 65  ASP B C   1 
ATOM   3301 O O   . ASP B 1 65  ? 70.400  34.983 2.108   1.00 67.94  ? 65  ASP B O   1 
ATOM   3302 C CB  . ASP B 1 65  ? 72.645  32.958 1.988   1.00 68.79  ? 65  ASP B CB  1 
ATOM   3303 C CG  . ASP B 1 65  ? 72.190  31.765 1.113   1.00 70.11  ? 65  ASP B CG  1 
ATOM   3304 O OD1 . ASP B 1 65  ? 71.016  31.741 0.678   1.00 69.63  ? 65  ASP B OD1 1 
ATOM   3305 O OD2 . ASP B 1 65  ? 73.035  30.882 0.808   1.00 62.15  ? 65  ASP B OD2 1 
ATOM   3306 N N   . ALA B 1 66  ? 69.279  33.310 3.099   1.00 65.39  ? 66  ALA B N   1 
ATOM   3307 C CA  . ALA B 1 66  ? 67.946  33.787 2.774   1.00 65.14  ? 66  ALA B CA  1 
ATOM   3308 C C   . ALA B 1 66  ? 67.419  34.486 4.006   1.00 67.37  ? 66  ALA B C   1 
ATOM   3309 O O   . ALA B 1 66  ? 67.078  35.668 3.967   1.00 67.28  ? 66  ALA B O   1 
ATOM   3310 C CB  . ALA B 1 66  ? 67.033  32.605 2.426   1.00 62.70  ? 66  ALA B CB  1 
ATOM   3311 N N   . ARG B 1 67  ? 67.379  33.736 5.104   1.00 70.32  ? 67  ARG B N   1 
ATOM   3312 C CA  . ARG B 1 67  ? 66.897  34.213 6.392   1.00 72.73  ? 67  ARG B CA  1 
ATOM   3313 C C   . ARG B 1 67  ? 67.715  35.431 6.809   1.00 72.24  ? 67  ARG B C   1 
ATOM   3314 O O   . ARG B 1 67  ? 67.222  36.307 7.525   1.00 71.93  ? 67  ARG B O   1 
ATOM   3315 C CB  . ARG B 1 67  ? 66.991  33.076 7.421   1.00 77.23  ? 67  ARG B CB  1 
ATOM   3316 C CG  . ARG B 1 67  ? 66.210  33.297 8.713   1.00 85.72  ? 67  ARG B CG  1 
ATOM   3317 C CD  . ARG B 1 67  ? 65.968  31.964 9.430   1.00 92.27  ? 67  ARG B CD  1 
ATOM   3318 N NE  . ARG B 1 67  ? 65.313  32.133 10.730  1.00 100.28 ? 67  ARG B NE  1 
ATOM   3319 C CZ  . ARG B 1 67  ? 63.998  32.036 10.954  1.00 102.39 ? 67  ARG B CZ  1 
ATOM   3320 N NH1 . ARG B 1 67  ? 63.151  31.796 9.951   1.00 102.59 ? 67  ARG B NH1 1 
ATOM   3321 N NH2 . ARG B 1 67  ? 63.521  32.204 12.185  1.00 102.09 ? 67  ARG B NH2 1 
ATOM   3322 N N   . ASP B 1 68  ? 68.967  35.484 6.359   1.00 72.11  ? 68  ASP B N   1 
ATOM   3323 C CA  . ASP B 1 68  ? 69.813  36.628 6.664   1.00 73.25  ? 68  ASP B CA  1 
ATOM   3324 C C   . ASP B 1 68  ? 69.306  37.840 5.914   1.00 75.52  ? 68  ASP B C   1 
ATOM   3325 O O   . ASP B 1 68  ? 69.617  38.968 6.282   1.00 80.13  ? 68  ASP B O   1 
ATOM   3326 C CB  . ASP B 1 68  ? 71.267  36.370 6.292   1.00 71.74  ? 68  ASP B CB  1 
ATOM   3327 C CG  . ASP B 1 68  ? 72.031  35.706 7.405   1.00 71.51  ? 68  ASP B CG  1 
ATOM   3328 O OD1 . ASP B 1 68  ? 72.120  36.299 8.510   1.00 67.27  ? 68  ASP B OD1 1 
ATOM   3329 O OD2 . ASP B 1 68  ? 72.533  34.587 7.168   1.00 72.39  ? 68  ASP B OD2 1 
ATOM   3330 N N   . TRP B 1 69  ? 68.565  37.604 4.834   1.00 76.93  ? 69  TRP B N   1 
ATOM   3331 C CA  . TRP B 1 69  ? 68.001  38.698 4.044   1.00 78.11  ? 69  TRP B CA  1 
ATOM   3332 C C   . TRP B 1 69  ? 66.617  39.140 4.549   1.00 77.36  ? 69  TRP B C   1 
ATOM   3333 O O   . TRP B 1 69  ? 66.289  40.332 4.511   1.00 77.51  ? 69  TRP B O   1 
ATOM   3334 C CB  . TRP B 1 69  ? 67.937  38.345 2.541   1.00 76.85  ? 69  TRP B CB  1 
ATOM   3335 C CG  . TRP B 1 69  ? 67.707  39.558 1.649   1.00 75.10  ? 69  TRP B CG  1 
ATOM   3336 C CD1 . TRP B 1 69  ? 66.809  39.665 0.626   1.00 71.40  ? 69  TRP B CD1 1 
ATOM   3337 C CD2 . TRP B 1 69  ? 68.356  40.845 1.753   1.00 75.90  ? 69  TRP B CD2 1 
ATOM   3338 N NE1 . TRP B 1 69  ? 66.850  40.935 0.094   1.00 72.45  ? 69  TRP B NE1 1 
ATOM   3339 C CE2 . TRP B 1 69  ? 67.785  41.676 0.763   1.00 75.55  ? 69  TRP B CE2 1 
ATOM   3340 C CE3 . TRP B 1 69  ? 69.356  41.376 2.591   1.00 75.31  ? 69  TRP B CE3 1 
ATOM   3341 C CZ2 . TRP B 1 69  ? 68.185  43.021 0.594   1.00 77.14  ? 69  TRP B CZ2 1 
ATOM   3342 C CZ3 . TRP B 1 69  ? 69.747  42.712 2.419   1.00 72.28  ? 69  TRP B CZ3 1 
ATOM   3343 C CH2 . TRP B 1 69  ? 69.161  43.514 1.431   1.00 72.23  ? 69  TRP B CH2 1 
ATOM   3344 N N   . MET B 1 70  ? 65.817  38.194 5.034   1.00 75.45  ? 70  MET B N   1 
ATOM   3345 C CA  . MET B 1 70  ? 64.487  38.522 5.511   1.00 75.93  ? 70  MET B CA  1 
ATOM   3346 C C   . MET B 1 70  ? 64.475  39.755 6.402   1.00 76.19  ? 70  MET B C   1 
ATOM   3347 O O   . MET B 1 70  ? 65.463  40.065 7.067   1.00 72.99  ? 70  MET B O   1 
ATOM   3348 C CB  . MET B 1 70  ? 63.795  37.316 6.151   1.00 78.91  ? 70  MET B CB  1 
ATOM   3349 C CG  . MET B 1 70  ? 63.107  36.356 5.130   1.00 81.82  ? 70  MET B CG  1 
ATOM   3350 S SD  . MET B 1 70  ? 61.632  36.994 4.186   1.00 79.98  ? 70  MET B SD  1 
ATOM   3351 C CE  . MET B 1 70  ? 60.585  37.565 5.546   1.00 77.37  ? 70  MET B CE  1 
ATOM   3352 N N   . LYS B 1 71  ? 63.367  40.494 6.286   1.00 79.35  ? 71  LYS B N   1 
ATOM   3353 C CA  . LYS B 1 71  ? 63.071  41.790 6.938   1.00 79.85  ? 71  LYS B CA  1 
ATOM   3354 C C   . LYS B 1 71  ? 63.762  42.877 6.123   1.00 81.60  ? 71  LYS B C   1 
ATOM   3355 O O   . LYS B 1 71  ? 63.601  44.070 6.392   1.00 82.31  ? 71  LYS B O   1 
ATOM   3356 C CB  . LYS B 1 71  ? 63.538  41.903 8.399   1.00 76.96  ? 71  LYS B CB  1 
ATOM   3357 C CG  . LYS B 1 71  ? 62.993  43.185 9.059   1.00 69.08  ? 71  LYS B CG  1 
ATOM   3358 C CD  . LYS B 1 71  ? 63.822  43.714 10.216  1.00 63.09  ? 71  LYS B CD  1 
ATOM   3359 C CE  . LYS B 1 71  ? 65.187  44.214 9.758   1.00 58.01  ? 71  LYS B CE  1 
ATOM   3360 N NZ  . LYS B 1 71  ? 65.169  44.976 8.483   1.00 53.31  ? 71  LYS B NZ  1 
ATOM   3361 N N   . ARG B 1 72  ? 64.538  42.435 5.133   1.00 82.08  ? 72  ARG B N   1 
ATOM   3362 C CA  . ARG B 1 72  ? 65.296  43.299 4.248   1.00 81.44  ? 72  ARG B CA  1 
ATOM   3363 C C   . ARG B 1 72  ? 65.198  42.689 2.860   1.00 77.98  ? 72  ARG B C   1 
ATOM   3364 O O   . ARG B 1 72  ? 65.103  43.401 1.870   1.00 76.78  ? 72  ARG B O   1 
ATOM   3365 C CB  . ARG B 1 72  ? 66.762  43.349 4.700   1.00 84.57  ? 72  ARG B CB  1 
ATOM   3366 C CG  . ARG B 1 72  ? 66.916  43.596 6.191   1.00 90.63  ? 72  ARG B CG  1 
ATOM   3367 C CD  . ARG B 1 72  ? 68.320  44.011 6.612   1.00 98.36  ? 72  ARG B CD  1 
ATOM   3368 N NE  . ARG B 1 72  ? 68.351  44.399 8.029   1.00 103.65 ? 72  ARG B NE  1 
ATOM   3369 C CZ  . ARG B 1 72  ? 69.263  45.194 8.596   1.00 103.82 ? 72  ARG B CZ  1 
ATOM   3370 N NH1 . ARG B 1 72  ? 70.241  45.748 7.884   1.00 101.41 ? 72  ARG B NH1 1 
ATOM   3371 N NH2 . ARG B 1 72  ? 69.170  45.456 9.897   1.00 103.54 ? 72  ARG B NH2 1 
ATOM   3372 N N   . GLY B 1 82  ? 58.052  45.138 -2.457  1.00 83.16  ? 82  GLY B N   1 
ATOM   3373 C CA  . GLY B 1 82  ? 56.884  44.754 -1.686  1.00 85.72  ? 82  GLY B CA  1 
ATOM   3374 C C   . GLY B 1 82  ? 56.858  43.293 -1.267  1.00 85.89  ? 82  GLY B C   1 
ATOM   3375 O O   . GLY B 1 82  ? 57.323  42.422 -2.003  1.00 88.36  ? 82  GLY B O   1 
ATOM   3376 N N   . MET B 1 83  ? 56.292  43.021 -0.091  1.00 85.18  ? 83  MET B N   1 
ATOM   3377 C CA  . MET B 1 83  ? 56.183  41.661 0.428   1.00 83.18  ? 83  MET B CA  1 
ATOM   3378 C C   . MET B 1 83  ? 55.292  40.711 -0.389  1.00 80.14  ? 83  MET B C   1 
ATOM   3379 O O   . MET B 1 83  ? 55.162  39.541 -0.048  1.00 77.88  ? 83  MET B O   1 
ATOM   3380 C CB  . MET B 1 83  ? 55.735  41.688 1.887   1.00 87.84  ? 83  MET B CB  1 
ATOM   3381 C CG  . MET B 1 83  ? 56.856  41.377 2.872   1.00 93.84  ? 83  MET B CG  1 
ATOM   3382 S SD  . MET B 1 83  ? 57.236  39.597 3.053   1.00 98.26  ? 83  MET B SD  1 
ATOM   3383 C CE  . MET B 1 83  ? 56.697  39.313 4.833   1.00 92.65  ? 83  MET B CE  1 
ATOM   3384 N N   . ASN B 1 84  ? 54.721  41.193 -1.494  1.00 77.25  ? 84  ASN B N   1 
ATOM   3385 C CA  . ASN B 1 84  ? 53.898  40.345 -2.358  1.00 74.32  ? 84  ASN B CA  1 
ATOM   3386 C C   . ASN B 1 84  ? 54.890  39.541 -3.208  1.00 72.48  ? 84  ASN B C   1 
ATOM   3387 O O   . ASN B 1 84  ? 54.545  38.940 -4.225  1.00 75.76  ? 84  ASN B O   1 
ATOM   3388 C CB  . ASN B 1 84  ? 52.959  41.189 -3.233  1.00 76.80  ? 84  ASN B CB  1 
ATOM   3389 C CG  . ASN B 1 84  ? 51.908  40.342 -3.969  1.00 77.85  ? 84  ASN B CG  1 
ATOM   3390 O OD1 . ASN B 1 84  ? 51.526  39.265 -3.516  1.00 78.16  ? 84  ASN B OD1 1 
ATOM   3391 N ND2 . ASN B 1 84  ? 51.441  40.838 -5.103  1.00 77.62  ? 84  ASN B ND2 1 
ATOM   3392 N N   . ASP B 1 85  ? 56.133  39.562 -2.740  1.00 68.10  ? 85  ASP B N   1 
ATOM   3393 C CA  . ASP B 1 85  ? 57.300  38.884 -3.282  1.00 64.97  ? 85  ASP B CA  1 
ATOM   3394 C C   . ASP B 1 85  ? 57.152  37.552 -2.513  1.00 59.68  ? 85  ASP B C   1 
ATOM   3395 O O   . ASP B 1 85  ? 57.193  36.436 -3.071  1.00 51.15  ? 85  ASP B O   1 
ATOM   3396 C CB  . ASP B 1 85  ? 58.528  39.678 -2.751  1.00 73.45  ? 85  ASP B CB  1 
ATOM   3397 C CG  . ASP B 1 85  ? 59.796  39.523 -3.604  1.00 76.52  ? 85  ASP B CG  1 
ATOM   3398 O OD1 . ASP B 1 85  ? 59.956  40.317 -4.564  1.00 71.85  ? 85  ASP B OD1 1 
ATOM   3399 O OD2 . ASP B 1 85  ? 60.647  38.650 -3.276  1.00 74.22  ? 85  ASP B OD2 1 
ATOM   3400 N N   . PHE B 1 86  ? 56.894  37.736 -1.218  1.00 55.57  ? 86  PHE B N   1 
ATOM   3401 C CA  . PHE B 1 86  ? 56.677  36.676 -0.244  1.00 52.32  ? 86  PHE B CA  1 
ATOM   3402 C C   . PHE B 1 86  ? 55.528  35.794 -0.744  1.00 48.43  ? 86  PHE B C   1 
ATOM   3403 O O   . PHE B 1 86  ? 55.705  34.578 -0.904  1.00 44.99  ? 86  PHE B O   1 
ATOM   3404 C CB  . PHE B 1 86  ? 56.299  37.327 1.094   1.00 50.18  ? 86  PHE B CB  1 
ATOM   3405 C CG  . PHE B 1 86  ? 56.525  36.461 2.291   1.00 48.92  ? 86  PHE B CG  1 
ATOM   3406 C CD1 . PHE B 1 86  ? 57.657  35.668 2.395   1.00 47.68  ? 86  PHE B CD1 1 
ATOM   3407 C CD2 . PHE B 1 86  ? 55.627  36.483 3.348   1.00 51.25  ? 86  PHE B CD2 1 
ATOM   3408 C CE1 . PHE B 1 86  ? 57.900  34.913 3.536   1.00 46.07  ? 86  PHE B CE1 1 
ATOM   3409 C CE2 . PHE B 1 86  ? 55.857  35.730 4.493   1.00 52.38  ? 86  PHE B CE2 1 
ATOM   3410 C CZ  . PHE B 1 86  ? 57.001  34.945 4.586   1.00 51.27  ? 86  PHE B CZ  1 
ATOM   3411 N N   . LYS B 1 87  ? 54.389  36.437 -1.037  1.00 44.61  ? 87  LYS B N   1 
ATOM   3412 C CA  . LYS B 1 87  ? 53.178  35.772 -1.539  1.00 42.62  ? 87  LYS B CA  1 
ATOM   3413 C C   . LYS B 1 87  ? 53.402  35.018 -2.829  1.00 40.36  ? 87  LYS B C   1 
ATOM   3414 O O   . LYS B 1 87  ? 53.067  33.835 -2.936  1.00 37.53  ? 87  LYS B O   1 
ATOM   3415 C CB  . LYS B 1 87  ? 52.061  36.775 -1.762  1.00 44.88  ? 87  LYS B CB  1 
ATOM   3416 C CG  . LYS B 1 87  ? 51.095  36.884 -0.594  1.00 52.94  ? 87  LYS B CG  1 
ATOM   3417 C CD  . LYS B 1 87  ? 51.355  38.088 0.307   1.00 54.10  ? 87  LYS B CD  1 
ATOM   3418 C CE  . LYS B 1 87  ? 50.254  39.129 0.129   1.00 55.63  ? 87  LYS B CE  1 
ATOM   3419 N NZ  . LYS B 1 87  ? 48.937  38.440 0.205   1.00 60.25  ? 87  LYS B NZ  1 
ATOM   3420 N N   . LEU B 1 88  ? 53.921  35.717 -3.831  1.00 40.90  ? 88  LEU B N   1 
ATOM   3421 C CA  . LEU B 1 88  ? 54.210  35.089 -5.111  1.00 42.40  ? 88  LEU B CA  1 
ATOM   3422 C C   . LEU B 1 88  ? 55.178  33.912 -4.939  1.00 45.92  ? 88  LEU B C   1 
ATOM   3423 O O   . LEU B 1 88  ? 55.055  32.874 -5.607  1.00 46.67  ? 88  LEU B O   1 
ATOM   3424 C CB  . LEU B 1 88  ? 54.768  36.129 -6.073  1.00 37.93  ? 88  LEU B CB  1 
ATOM   3425 C CG  . LEU B 1 88  ? 53.707  36.933 -6.814  1.00 36.95  ? 88  LEU B CG  1 
ATOM   3426 C CD1 . LEU B 1 88  ? 54.384  37.983 -7.677  1.00 35.59  ? 88  LEU B CD1 1 
ATOM   3427 C CD2 . LEU B 1 88  ? 52.860  35.995 -7.696  1.00 31.40  ? 88  LEU B CD2 1 
ATOM   3428 N N   . ALA B 1 89  ? 56.116  34.066 -4.005  1.00 49.32  ? 89  ALA B N   1 
ATOM   3429 C CA  . ALA B 1 89  ? 57.103  33.027 -3.717  1.00 46.74  ? 89  ALA B CA  1 
ATOM   3430 C C   . ALA B 1 89  ? 56.451  31.839 -2.996  1.00 47.09  ? 89  ALA B C   1 
ATOM   3431 O O   . ALA B 1 89  ? 56.668  30.678 -3.384  1.00 44.63  ? 89  ALA B O   1 
ATOM   3432 C CB  . ALA B 1 89  ? 58.239  33.605 -2.883  1.00 48.12  ? 89  ALA B CB  1 
ATOM   3433 N N   . TYR B 1 90  ? 55.667  32.122 -1.947  1.00 45.32  ? 90  TYR B N   1 
ATOM   3434 C CA  . TYR B 1 90  ? 54.977  31.071 -1.203  1.00 46.38  ? 90  TYR B CA  1 
ATOM   3435 C C   . TYR B 1 90  ? 54.213  30.198 -2.187  1.00 45.13  ? 90  TYR B C   1 
ATOM   3436 O O   . TYR B 1 90  ? 54.398  28.991 -2.208  1.00 44.29  ? 90  TYR B O   1 
ATOM   3437 C CB  . TYR B 1 90  ? 53.997  31.656 -0.164  1.00 53.40  ? 90  TYR B CB  1 
ATOM   3438 C CG  . TYR B 1 90  ? 53.123  30.598 0.509   1.00 58.06  ? 90  TYR B CG  1 
ATOM   3439 C CD1 . TYR B 1 90  ? 51.976  30.114 -0.125  1.00 58.16  ? 90  TYR B CD1 1 
ATOM   3440 C CD2 . TYR B 1 90  ? 53.512  29.988 1.712   1.00 58.00  ? 90  TYR B CD2 1 
ATOM   3441 C CE1 . TYR B 1 90  ? 51.256  29.047 0.399   1.00 58.82  ? 90  TYR B CE1 1 
ATOM   3442 C CE2 . TYR B 1 90  ? 52.792  28.919 2.245   1.00 57.55  ? 90  TYR B CE2 1 
ATOM   3443 C CZ  . TYR B 1 90  ? 51.668  28.453 1.575   1.00 59.62  ? 90  TYR B CZ  1 
ATOM   3444 O OH  . TYR B 1 90  ? 50.970  27.360 2.036   1.00 62.25  ? 90  TYR B OH  1 
ATOM   3445 N N   . ILE B 1 91  ? 53.368  30.830 -2.998  1.00 45.32  ? 91  ILE B N   1 
ATOM   3446 C CA  . ILE B 1 91  ? 52.563  30.137 -4.004  1.00 50.46  ? 91  ILE B CA  1 
ATOM   3447 C C   . ILE B 1 91  ? 53.418  29.206 -4.869  1.00 52.24  ? 91  ILE B C   1 
ATOM   3448 O O   . ILE B 1 91  ? 53.060  28.051 -5.079  1.00 51.57  ? 91  ILE B O   1 
ATOM   3449 C CB  . ILE B 1 91  ? 51.852  31.136 -4.975  1.00 49.76  ? 91  ILE B CB  1 
ATOM   3450 C CG1 . ILE B 1 91  ? 50.918  32.068 -4.215  1.00 48.22  ? 91  ILE B CG1 1 
ATOM   3451 C CG2 . ILE B 1 91  ? 51.101  30.379 -6.072  1.00 46.00  ? 91  ILE B CG2 1 
ATOM   3452 C CD1 . ILE B 1 91  ? 50.239  33.087 -5.116  1.00 48.14  ? 91  ILE B CD1 1 
ATOM   3453 N N   . SER B 1 92  ? 54.496  29.745 -5.431  1.00 54.26  ? 92  SER B N   1 
ATOM   3454 C CA  . SER B 1 92  ? 55.394  28.974 -6.283  1.00 56.37  ? 92  SER B CA  1 
ATOM   3455 C C   . SER B 1 92  ? 56.005  27.795 -5.523  1.00 54.60  ? 92  SER B C   1 
ATOM   3456 O O   . SER B 1 92  ? 55.860  26.637 -5.929  1.00 53.21  ? 92  SER B O   1 
ATOM   3457 C CB  . SER B 1 92  ? 56.501  29.886 -6.824  1.00 62.19  ? 92  SER B CB  1 
ATOM   3458 O OG  . SER B 1 92  ? 57.083  30.689 -5.796  1.00 69.43  ? 92  SER B OG  1 
ATOM   3459 N N   . ASP B 1 93  ? 56.676  28.102 -4.414  1.00 50.24  ? 93  ASP B N   1 
ATOM   3460 C CA  . ASP B 1 93  ? 57.304  27.084 -3.574  1.00 51.73  ? 93  ASP B CA  1 
ATOM   3461 C C   . ASP B 1 93  ? 56.346  25.943 -3.232  1.00 51.69  ? 93  ASP B C   1 
ATOM   3462 O O   . ASP B 1 93  ? 56.600  24.769 -3.530  1.00 50.49  ? 93  ASP B O   1 
ATOM   3463 C CB  . ASP B 1 93  ? 57.809  27.705 -2.260  1.00 47.03  ? 93  ASP B CB  1 
ATOM   3464 C CG  . ASP B 1 93  ? 59.041  28.563 -2.454  1.00 49.91  ? 93  ASP B CG  1 
ATOM   3465 O OD1 . ASP B 1 93  ? 59.697  28.471 -3.523  1.00 47.56  ? 93  ASP B OD1 1 
ATOM   3466 O OD2 . ASP B 1 93  ? 59.356  29.335 -1.527  1.00 48.16  ? 93  ASP B OD2 1 
ATOM   3467 N N   . THR B 1 94  ? 55.240  26.318 -2.602  1.00 52.52  ? 94  THR B N   1 
ATOM   3468 C CA  . THR B 1 94  ? 54.220  25.385 -2.166  1.00 51.47  ? 94  THR B CA  1 
ATOM   3469 C C   . THR B 1 94  ? 53.537  24.738 -3.346  1.00 49.11  ? 94  THR B C   1 
ATOM   3470 O O   . THR B 1 94  ? 53.323  23.535 -3.385  1.00 49.89  ? 94  THR B O   1 
ATOM   3471 C CB  . THR B 1 94  ? 53.192  26.116 -1.338  1.00 52.47  ? 94  THR B CB  1 
ATOM   3472 O OG1 . THR B 1 94  ? 52.592  27.135 -2.143  1.00 61.61  ? 94  THR B OG1 1 
ATOM   3473 C CG2 . THR B 1 94  ? 53.869  26.780 -0.136  1.00 51.86  ? 94  THR B CG2 1 
ATOM   3474 N N   . TYR B 1 95  ? 53.193  25.547 -4.321  1.00 51.04  ? 95  TYR B N   1 
ATOM   3475 C CA  . TYR B 1 95  ? 52.533  25.015 -5.481  1.00 53.32  ? 95  TYR B CA  1 
ATOM   3476 C C   . TYR B 1 95  ? 53.477  24.867 -6.638  1.00 53.93  ? 95  TYR B C   1 
ATOM   3477 O O   . TYR B 1 95  ? 53.771  25.812 -7.376  1.00 56.06  ? 95  TYR B O   1 
ATOM   3478 C CB  . TYR B 1 95  ? 51.272  25.830 -5.847  1.00 52.72  ? 95  TYR B CB  1 
ATOM   3479 C CG  . TYR B 1 95  ? 50.170  25.647 -4.832  1.00 45.92  ? 95  TYR B CG  1 
ATOM   3480 C CD1 . TYR B 1 95  ? 49.271  24.586 -4.937  1.00 39.86  ? 95  TYR B CD1 1 
ATOM   3481 C CD2 . TYR B 1 95  ? 50.113  26.450 -3.691  1.00 45.07  ? 95  TYR B CD2 1 
ATOM   3482 C CE1 . TYR B 1 95  ? 48.360  24.311 -3.924  1.00 39.57  ? 95  TYR B CE1 1 
ATOM   3483 C CE2 . TYR B 1 95  ? 49.201  26.185 -2.673  1.00 46.58  ? 95  TYR B CE2 1 
ATOM   3484 C CZ  . TYR B 1 95  ? 48.334  25.110 -2.796  1.00 42.73  ? 95  TYR B CZ  1 
ATOM   3485 O OH  . TYR B 1 95  ? 47.494  24.810 -1.755  1.00 47.97  ? 95  TYR B OH  1 
ATOM   3486 N N   . GLY B 1 96  ? 54.091  23.703 -6.680  1.00 55.11  ? 96  GLY B N   1 
ATOM   3487 C CA  . GLY B 1 96  ? 54.960  23.409 -7.789  1.00 57.16  ? 96  GLY B CA  1 
ATOM   3488 C C   . GLY B 1 96  ? 54.003  22.694 -8.718  1.00 57.97  ? 96  GLY B C   1 
ATOM   3489 O O   . GLY B 1 96  ? 52.836  22.464 -8.360  1.00 58.63  ? 96  GLY B O   1 
ATOM   3490 N N   . SER B 1 97  ? 54.463  22.378 -9.918  1.00 59.58  ? 97  SER B N   1 
ATOM   3491 C CA  . SER B 1 97  ? 53.630  21.652 -10.867 1.00 63.07  ? 97  SER B CA  1 
ATOM   3492 C C   . SER B 1 97  ? 52.420  22.464 -11.368 1.00 61.51  ? 97  SER B C   1 
ATOM   3493 O O   . SER B 1 97  ? 51.887  23.315 -10.650 1.00 60.06  ? 97  SER B O   1 
ATOM   3494 C CB  . SER B 1 97  ? 53.137  20.346 -10.207 1.00 67.55  ? 97  SER B CB  1 
ATOM   3495 O OG  . SER B 1 97  ? 54.077  19.811 -9.269  1.00 71.69  ? 97  SER B OG  1 
ATOM   3496 N N   . GLU B 1 98  ? 52.001  22.197 -12.607 1.00 60.02  ? 98  GLU B N   1 
ATOM   3497 C CA  . GLU B 1 98  ? 50.843  22.868 -13.196 1.00 60.35  ? 98  GLU B CA  1 
ATOM   3498 C C   . GLU B 1 98  ? 49.720  22.805 -12.181 1.00 59.99  ? 98  GLU B C   1 
ATOM   3499 O O   . GLU B 1 98  ? 49.592  21.819 -11.458 1.00 62.67  ? 98  GLU B O   1 
ATOM   3500 C CB  . GLU B 1 98  ? 50.366  22.152 -14.454 1.00 61.44  ? 98  GLU B CB  1 
ATOM   3501 C CG  . GLU B 1 98  ? 50.845  22.744 -15.768 1.00 67.11  ? 98  GLU B CG  1 
ATOM   3502 C CD  . GLU B 1 98  ? 49.962  22.335 -16.950 1.00 71.82  ? 98  GLU B CD  1 
ATOM   3503 O OE1 . GLU B 1 98  ? 48.802  21.929 -16.695 1.00 75.54  ? 98  GLU B OE1 1 
ATOM   3504 O OE2 . GLU B 1 98  ? 50.414  22.432 -18.124 1.00 71.13  ? 98  GLU B OE2 1 
ATOM   3505 N N   . ILE B 1 99  ? 48.894  23.840 -12.138 1.00 58.64  ? 99  ILE B N   1 
ATOM   3506 C CA  . ILE B 1 99  ? 47.794  23.863 -11.192 1.00 54.96  ? 99  ILE B CA  1 
ATOM   3507 C C   . ILE B 1 99  ? 46.535  23.361 -11.897 1.00 53.87  ? 99  ILE B C   1 
ATOM   3508 O O   . ILE B 1 99  ? 46.302  23.652 -13.078 1.00 53.93  ? 99  ILE B O   1 
ATOM   3509 C CB  . ILE B 1 99  ? 47.596  25.295 -10.575 1.00 53.80  ? 99  ILE B CB  1 
ATOM   3510 C CG1 . ILE B 1 99  ? 48.940  25.868 -10.106 1.00 48.94  ? 99  ILE B CG1 1 
ATOM   3511 C CG2 . ILE B 1 99  ? 46.666  25.253 -9.345  1.00 50.95  ? 99  ILE B CG2 1 
ATOM   3512 C CD1 . ILE B 1 99  ? 48.803  26.933 -9.022  1.00 45.85  ? 99  ILE B CD1 1 
ATOM   3513 N N   . VAL B 1 100 ? 45.811  22.478 -11.227 1.00 53.54  ? 100 VAL B N   1 
ATOM   3514 C CA  . VAL B 1 100 ? 44.563  21.967 -11.782 1.00 53.57  ? 100 VAL B CA  1 
ATOM   3515 C C   . VAL B 1 100 ? 43.572  22.446 -10.748 1.00 51.21  ? 100 VAL B C   1 
ATOM   3516 O O   . VAL B 1 100 ? 43.818  22.338 -9.534  1.00 47.82  ? 100 VAL B O   1 
ATOM   3517 C CB  . VAL B 1 100 ? 44.540  20.390 -11.915 1.00 57.45  ? 100 VAL B CB  1 
ATOM   3518 C CG1 . VAL B 1 100 ? 45.889  19.877 -12.456 1.00 56.37  ? 100 VAL B CG1 1 
ATOM   3519 C CG2 . VAL B 1 100 ? 44.179  19.694 -10.588 1.00 56.15  ? 100 VAL B CG2 1 
ATOM   3520 N N   . TYR B 1 101 ? 42.488  23.043 -11.206 1.00 49.80  ? 101 TYR B N   1 
ATOM   3521 C CA  . TYR B 1 101 ? 41.498  23.540 -10.263 1.00 51.36  ? 101 TYR B CA  1 
ATOM   3522 C C   . TYR B 1 101 ? 40.099  23.270 -10.787 1.00 51.71  ? 101 TYR B C   1 
ATOM   3523 O O   . TYR B 1 101 ? 39.927  22.891 -11.950 1.00 50.20  ? 101 TYR B O   1 
ATOM   3524 C CB  . TYR B 1 101 ? 41.680  25.044 -10.079 1.00 49.03  ? 101 TYR B CB  1 
ATOM   3525 C CG  . TYR B 1 101 ? 41.515  25.790 -11.376 1.00 54.93  ? 101 TYR B CG  1 
ATOM   3526 C CD1 . TYR B 1 101 ? 42.423  25.613 -12.422 1.00 56.97  ? 101 TYR B CD1 1 
ATOM   3527 C CD2 . TYR B 1 101 ? 40.442  26.660 -11.576 1.00 58.67  ? 101 TYR B CD2 1 
ATOM   3528 C CE1 . TYR B 1 101 ? 42.272  26.280 -13.631 1.00 56.23  ? 101 TYR B CE1 1 
ATOM   3529 C CE2 . TYR B 1 101 ? 40.283  27.337 -12.795 1.00 58.98  ? 101 TYR B CE2 1 
ATOM   3530 C CZ  . TYR B 1 101 ? 41.208  27.135 -13.809 1.00 57.12  ? 101 TYR B CZ  1 
ATOM   3531 O OH  . TYR B 1 101 ? 41.062  27.789 -15.001 1.00 63.40  ? 101 TYR B OH  1 
ATOM   3532 N N   . ASP B 1 102 ? 39.115  23.374 -9.900  1.00 53.57  ? 102 ASP B N   1 
ATOM   3533 C CA  . ASP B 1 102 ? 37.732  23.228 -10.313 1.00 56.34  ? 102 ASP B CA  1 
ATOM   3534 C C   . ASP B 1 102 ? 36.902  24.332 -9.694  1.00 56.37  ? 102 ASP B C   1 
ATOM   3535 O O   . ASP B 1 102 ? 37.057  24.683 -8.521  1.00 54.38  ? 102 ASP B O   1 
ATOM   3536 C CB  . ASP B 1 102 ? 37.119  21.862 -9.985  1.00 57.15  ? 102 ASP B CB  1 
ATOM   3537 C CG  . ASP B 1 102 ? 35.912  21.540 -10.889 1.00 56.38  ? 102 ASP B CG  1 
ATOM   3538 O OD1 . ASP B 1 102 ? 34.929  22.311 -10.902 1.00 50.50  ? 102 ASP B OD1 1 
ATOM   3539 O OD2 . ASP B 1 102 ? 35.970  20.537 -11.634 1.00 57.47  ? 102 ASP B OD2 1 
ATOM   3540 N N   . ARG B 1 103 ? 36.027  24.877 -10.526 1.00 57.69  ? 103 ARG B N   1 
ATOM   3541 C CA  . ARG B 1 103 ? 35.126  25.961 -10.170 1.00 56.19  ? 103 ARG B CA  1 
ATOM   3542 C C   . ARG B 1 103 ? 34.231  25.588 -9.002  1.00 53.29  ? 103 ARG B C   1 
ATOM   3543 O O   . ARG B 1 103 ? 34.079  26.341 -8.045  1.00 47.16  ? 103 ARG B O   1 
ATOM   3544 C CB  . ARG B 1 103 ? 34.256  26.270 -11.382 1.00 58.91  ? 103 ARG B CB  1 
ATOM   3545 C CG  . ARG B 1 103 ? 33.651  27.652 -11.386 1.00 59.85  ? 103 ARG B CG  1 
ATOM   3546 C CD  . ARG B 1 103 ? 34.512  28.686 -12.103 1.00 55.75  ? 103 ARG B CD  1 
ATOM   3547 N NE  . ARG B 1 103 ? 33.688  29.844 -12.403 1.00 52.27  ? 103 ARG B NE  1 
ATOM   3548 C CZ  . ARG B 1 103 ? 33.045  30.527 -11.472 1.00 52.01  ? 103 ARG B CZ  1 
ATOM   3549 N NH1 . ARG B 1 103 ? 33.172  30.168 -10.196 1.00 49.29  ? 103 ARG B NH1 1 
ATOM   3550 N NH2 . ARG B 1 103 ? 32.186  31.481 -11.815 1.00 51.20  ? 103 ARG B NH2 1 
ATOM   3551 N N   . LYS B 1 104 ? 33.717  24.367 -9.077  1.00 57.30  ? 104 LYS B N   1 
ATOM   3552 C CA  . LYS B 1 104 ? 32.794  23.797 -8.098  1.00 56.85  ? 104 LYS B CA  1 
ATOM   3553 C C   . LYS B 1 104 ? 33.136  24.024 -6.654  1.00 54.98  ? 104 LYS B C   1 
ATOM   3554 O O   . LYS B 1 104 ? 32.237  24.042 -5.812  1.00 59.37  ? 104 LYS B O   1 
ATOM   3555 C CB  . LYS B 1 104 ? 32.598  22.296 -8.362  1.00 59.11  ? 104 LYS B CB  1 
ATOM   3556 C CG  . LYS B 1 104 ? 31.634  21.983 -9.536  1.00 65.67  ? 104 LYS B CG  1 
ATOM   3557 C CD  . LYS B 1 104 ? 31.895  22.843 -10.795 1.00 65.58  ? 104 LYS B CD  1 
ATOM   3558 C CE  . LYS B 1 104 ? 30.786  22.721 -11.830 1.00 65.84  ? 104 LYS B CE  1 
ATOM   3559 N NZ  . LYS B 1 104 ? 30.608  21.309 -12.317 1.00 68.33  ? 104 LYS B NZ  1 
ATOM   3560 N N   . PHE B 1 105 ? 34.401  24.303 -6.375  1.00 50.54  ? 105 PHE B N   1 
ATOM   3561 C CA  . PHE B 1 105 ? 34.823  24.496 -4.998  1.00 48.44  ? 105 PHE B CA  1 
ATOM   3562 C C   . PHE B 1 105 ? 35.161  25.938 -4.642  1.00 48.51  ? 105 PHE B C   1 
ATOM   3563 O O   . PHE B 1 105 ? 35.302  26.296 -3.461  1.00 47.19  ? 105 PHE B O   1 
ATOM   3564 C CB  . PHE B 1 105 ? 36.014  23.595 -4.742  1.00 54.11  ? 105 PHE B CB  1 
ATOM   3565 C CG  . PHE B 1 105 ? 35.802  22.189 -5.201  1.00 58.57  ? 105 PHE B CG  1 
ATOM   3566 C CD1 . PHE B 1 105 ? 36.029  21.840 -6.530  1.00 57.88  ? 105 PHE B CD1 1 
ATOM   3567 C CD2 . PHE B 1 105 ? 35.342  21.219 -4.312  1.00 61.41  ? 105 PHE B CD2 1 
ATOM   3568 C CE1 . PHE B 1 105 ? 35.798  20.546 -6.973  1.00 61.03  ? 105 PHE B CE1 1 
ATOM   3569 C CE2 . PHE B 1 105 ? 35.107  19.919 -4.742  1.00 63.15  ? 105 PHE B CE2 1 
ATOM   3570 C CZ  . PHE B 1 105 ? 35.334  19.579 -6.079  1.00 63.12  ? 105 PHE B CZ  1 
ATOM   3571 N N   . VAL B 1 106 ? 35.291  26.783 -5.656  1.00 47.57  ? 106 VAL B N   1 
ATOM   3572 C CA  . VAL B 1 106 ? 35.633  28.160 -5.384  1.00 48.50  ? 106 VAL B CA  1 
ATOM   3573 C C   . VAL B 1 106 ? 34.363  28.934 -5.028  1.00 47.84  ? 106 VAL B C   1 
ATOM   3574 O O   . VAL B 1 106 ? 33.453  29.125 -5.849  1.00 50.15  ? 106 VAL B O   1 
ATOM   3575 C CB  . VAL B 1 106 ? 36.437  28.831 -6.564  1.00 47.83  ? 106 VAL B CB  1 
ATOM   3576 C CG1 . VAL B 1 106 ? 36.775  30.273 -6.214  1.00 46.62  ? 106 VAL B CG1 1 
ATOM   3577 C CG2 . VAL B 1 106 ? 37.739  28.078 -6.826  1.00 45.97  ? 106 VAL B CG2 1 
ATOM   3578 N N   . ARG B 1 107 ? 34.276  29.334 -3.772  1.00 44.33  ? 107 ARG B N   1 
ATOM   3579 C CA  . ARG B 1 107 ? 33.125  30.080 -3.350  1.00 39.70  ? 107 ARG B CA  1 
ATOM   3580 C C   . ARG B 1 107 ? 33.116  31.490 -3.923  1.00 37.58  ? 107 ARG B C   1 
ATOM   3581 O O   . ARG B 1 107 ? 33.865  32.362 -3.492  1.00 37.57  ? 107 ARG B O   1 
ATOM   3582 C CB  . ARG B 1 107 ? 33.040  30.114 -1.833  1.00 39.76  ? 107 ARG B CB  1 
ATOM   3583 C CG  . ARG B 1 107 ? 31.640  30.400 -1.355  1.00 45.68  ? 107 ARG B CG  1 
ATOM   3584 C CD  . ARG B 1 107 ? 31.450  30.150 0.134   1.00 48.87  ? 107 ARG B CD  1 
ATOM   3585 N NE  . ARG B 1 107 ? 30.144  29.526 0.331   1.00 51.13  ? 107 ARG B NE  1 
ATOM   3586 C CZ  . ARG B 1 107 ? 29.899  28.488 1.119   1.00 49.32  ? 107 ARG B CZ  1 
ATOM   3587 N NH1 . ARG B 1 107 ? 30.869  27.926 1.826   1.00 45.89  ? 107 ARG B NH1 1 
ATOM   3588 N NH2 . ARG B 1 107 ? 28.665  28.017 1.200   1.00 54.47  ? 107 ARG B NH2 1 
ATOM   3589 N N   . VAL B 1 108 ? 32.295  31.685 -4.938  1.00 39.69  ? 108 VAL B N   1 
ATOM   3590 C CA  . VAL B 1 108 ? 32.107  32.995 -5.565  1.00 40.33  ? 108 VAL B CA  1 
ATOM   3591 C C   . VAL B 1 108 ? 30.748  33.610 -5.101  1.00 40.60  ? 108 VAL B C   1 
ATOM   3592 O O   . VAL B 1 108 ? 29.663  33.066 -5.344  1.00 37.39  ? 108 VAL B O   1 
ATOM   3593 C CB  . VAL B 1 108 ? 32.119  32.892 -7.105  1.00 41.17  ? 108 VAL B CB  1 
ATOM   3594 C CG1 . VAL B 1 108 ? 32.233  34.274 -7.719  1.00 40.92  ? 108 VAL B CG1 1 
ATOM   3595 C CG2 . VAL B 1 108 ? 33.245  31.985 -7.560  1.00 37.92  ? 108 VAL B CG2 1 
ATOM   3596 N N   . ALA B 1 109 ? 30.839  34.693 -4.347  1.00 40.41  ? 109 ALA B N   1 
ATOM   3597 C CA  . ALA B 1 109 ? 29.680  35.389 -3.850  1.00 39.60  ? 109 ALA B CA  1 
ATOM   3598 C C   . ALA B 1 109 ? 29.547  36.616 -4.728  1.00 42.79  ? 109 ALA B C   1 
ATOM   3599 O O   . ALA B 1 109 ? 30.436  36.904 -5.543  1.00 43.16  ? 109 ALA B O   1 
ATOM   3600 C CB  . ALA B 1 109 ? 29.880  35.793 -2.426  1.00 36.47  ? 109 ALA B CB  1 
ATOM   3601 N N   . ASN B 1 110 ? 28.414  37.300 -4.589  1.00 44.24  ? 110 ASN B N   1 
ATOM   3602 C CA  . ASN B 1 110 ? 28.075  38.496 -5.362  1.00 46.19  ? 110 ASN B CA  1 
ATOM   3603 C C   . ASN B 1 110 ? 26.860  39.092 -4.646  1.00 49.24  ? 110 ASN B C   1 
ATOM   3604 O O   . ASN B 1 110 ? 25.987  38.359 -4.176  1.00 48.36  ? 110 ASN B O   1 
ATOM   3605 C CB  . ASN B 1 110 ? 27.834  38.109 -6.852  1.00 39.46  ? 110 ASN B CB  1 
ATOM   3606 C CG  . ASN B 1 110 ? 26.525  38.637 -7.444  1.00 39.39  ? 110 ASN B CG  1 
ATOM   3607 O OD1 . ASN B 1 110 ? 26.277  39.855 -7.546  1.00 37.08  ? 110 ASN B OD1 1 
ATOM   3608 N ND2 . ASN B 1 110 ? 25.721  37.708 -7.937  1.00 36.85  ? 110 ASN B ND2 1 
ATOM   3609 N N   . CYS B 1 111 ? 26.876  40.400 -4.431  1.00 52.12  ? 111 CYS B N   1 
ATOM   3610 C CA  . CYS B 1 111 ? 25.777  41.032 -3.732  1.00 53.70  ? 111 CYS B CA  1 
ATOM   3611 C C   . CYS B 1 111 ? 25.405  42.384 -4.323  1.00 55.10  ? 111 CYS B C   1 
ATOM   3612 O O   . CYS B 1 111 ? 26.195  43.009 -5.049  1.00 54.49  ? 111 CYS B O   1 
ATOM   3613 C CB  . CYS B 1 111 ? 26.086  41.144 -2.219  1.00 51.71  ? 111 CYS B CB  1 
ATOM   3614 S SG  . CYS B 1 111 ? 26.336  42.827 -1.551  1.00 53.73  ? 111 CYS B SG  1 
ATOM   3615 N N   . ASP B 1 112 ? 24.159  42.774 -4.064  1.00 54.80  ? 112 ASP B N   1 
ATOM   3616 C CA  . ASP B 1 112 ? 23.603  44.042 -4.506  1.00 53.28  ? 112 ASP B CA  1 
ATOM   3617 C C   . ASP B 1 112 ? 22.739  44.496 -3.343  1.00 52.68  ? 112 ASP B C   1 
ATOM   3618 O O   . ASP B 1 112 ? 22.127  43.679 -2.663  1.00 53.94  ? 112 ASP B O   1 
ATOM   3619 C CB  . ASP B 1 112 ? 22.743  43.842 -5.750  1.00 53.37  ? 112 ASP B CB  1 
ATOM   3620 C CG  . ASP B 1 112 ? 22.843  44.995 -6.724  1.00 56.26  ? 112 ASP B CG  1 
ATOM   3621 O OD1 . ASP B 1 112 ? 22.236  46.058 -6.460  1.00 60.16  ? 112 ASP B OD1 1 
ATOM   3622 O OD2 . ASP B 1 112 ? 23.524  44.831 -7.765  1.00 58.65  ? 112 ASP B OD2 1 
ATOM   3623 N N   . ILE B 1 113 ? 22.704  45.787 -3.086  1.00 51.10  ? 113 ILE B N   1 
ATOM   3624 C CA  . ILE B 1 113 ? 21.909  46.274 -1.985  1.00 52.42  ? 113 ILE B CA  1 
ATOM   3625 C C   . ILE B 1 113 ? 20.962  47.368 -2.437  1.00 55.93  ? 113 ILE B C   1 
ATOM   3626 O O   . ILE B 1 113 ? 21.122  47.921 -3.533  1.00 57.46  ? 113 ILE B O   1 
ATOM   3627 C CB  . ILE B 1 113 ? 22.793  46.872 -0.884  1.00 51.73  ? 113 ILE B CB  1 
ATOM   3628 C CG1 . ILE B 1 113 ? 23.591  48.056 -1.435  1.00 46.33  ? 113 ILE B CG1 1 
ATOM   3629 C CG2 . ILE B 1 113 ? 23.641  45.792 -0.230  1.00 48.72  ? 113 ILE B CG2 1 
ATOM   3630 C CD1 . ILE B 1 113 ? 23.793  49.148 -0.417  1.00 41.51  ? 113 ILE B CD1 1 
ATOM   3631 N N   . GLU B 1 114 ? 19.973  47.667 -1.594  1.00 57.54  ? 114 GLU B N   1 
ATOM   3632 C CA  . GLU B 1 114 ? 19.016  48.731 -1.863  1.00 58.28  ? 114 GLU B CA  1 
ATOM   3633 C C   . GLU B 1 114 ? 19.031  49.573 -0.599  1.00 60.05  ? 114 GLU B C   1 
ATOM   3634 O O   . GLU B 1 114 ? 19.112  49.029 0.506   1.00 60.08  ? 114 GLU B O   1 
ATOM   3635 C CB  . GLU B 1 114 ? 17.599  48.185 -2.076  1.00 57.05  ? 114 GLU B CB  1 
ATOM   3636 C CG  . GLU B 1 114 ? 17.461  47.061 -3.098  1.00 65.45  ? 114 GLU B CG  1 
ATOM   3637 C CD  . GLU B 1 114 ? 17.815  47.481 -4.528  1.00 71.97  ? 114 GLU B CD  1 
ATOM   3638 O OE1 . GLU B 1 114 ? 18.014  48.701 -4.746  1.00 74.30  ? 114 GLU B OE1 1 
ATOM   3639 O OE2 . GLU B 1 114 ? 17.889  46.591 -5.425  1.00 69.77  ? 114 GLU B OE2 1 
ATOM   3640 N N   . VAL B 1 115 ? 19.051  50.891 -0.763  1.00 62.42  ? 115 VAL B N   1 
ATOM   3641 C CA  . VAL B 1 115 ? 19.027  51.816 0.365   1.00 65.02  ? 115 VAL B CA  1 
ATOM   3642 C C   . VAL B 1 115 ? 18.066  52.943 -0.027  1.00 68.36  ? 115 VAL B C   1 
ATOM   3643 O O   . VAL B 1 115 ? 17.968  53.308 -1.212  1.00 68.19  ? 115 VAL B O   1 
ATOM   3644 C CB  . VAL B 1 115 ? 20.428  52.417 0.673   1.00 64.94  ? 115 VAL B CB  1 
ATOM   3645 C CG1 . VAL B 1 115 ? 20.363  53.336 1.900   1.00 62.13  ? 115 VAL B CG1 1 
ATOM   3646 C CG2 . VAL B 1 115 ? 21.435  51.312 0.912   1.00 62.62  ? 115 VAL B CG2 1 
ATOM   3647 N N   . THR B 1 116 ? 17.323  53.447 0.955   1.00 69.92  ? 116 THR B N   1 
ATOM   3648 C CA  . THR B 1 116 ? 16.372  54.527 0.722   1.00 70.63  ? 116 THR B CA  1 
ATOM   3649 C C   . THR B 1 116 ? 16.770  55.730 1.593   1.00 69.81  ? 116 THR B C   1 
ATOM   3650 O O   . THR B 1 116 ? 17.081  55.577 2.774   1.00 69.20  ? 116 THR B O   1 
ATOM   3651 C CB  . THR B 1 116 ? 14.893  54.053 0.998   1.00 72.13  ? 116 THR B CB  1 
ATOM   3652 O OG1 . THR B 1 116 ? 14.540  53.006 0.076   1.00 66.60  ? 116 THR B OG1 1 
ATOM   3653 C CG2 . THR B 1 116 ? 13.893  55.201 0.819   1.00 73.91  ? 116 THR B CG2 1 
ATOM   3654 N N   . GLY B 1 117 ? 16.820  56.902 0.972   1.00 68.55  ? 117 GLY B N   1 
ATOM   3655 C CA  . GLY B 1 117 ? 17.182  58.127 1.653   1.00 72.08  ? 117 GLY B CA  1 
ATOM   3656 C C   . GLY B 1 117 ? 17.566  59.077 0.547   1.00 76.65  ? 117 GLY B C   1 
ATOM   3657 O O   . GLY B 1 117 ? 17.377  58.726 -0.615  1.00 76.90  ? 117 GLY B O   1 
ATOM   3658 N N   . ASP B 1 118 ? 18.095  60.255 0.877   1.00 83.72  ? 118 ASP B N   1 
ATOM   3659 C CA  . ASP B 1 118 ? 18.515  61.231 -0.147  1.00 90.41  ? 118 ASP B CA  1 
ATOM   3660 C C   . ASP B 1 118 ? 19.390  60.481 -1.168  1.00 92.70  ? 118 ASP B C   1 
ATOM   3661 O O   . ASP B 1 118 ? 20.348  59.794 -0.787  1.00 92.91  ? 118 ASP B O   1 
ATOM   3662 C CB  . ASP B 1 118 ? 19.328  62.385 0.476   1.00 92.66  ? 118 ASP B CB  1 
ATOM   3663 C CG  . ASP B 1 118 ? 18.599  63.090 1.626   1.00 95.52  ? 118 ASP B CG  1 
ATOM   3664 O OD1 . ASP B 1 118 ? 17.720  62.475 2.278   1.00 95.85  ? 118 ASP B OD1 1 
ATOM   3665 O OD2 . ASP B 1 118 ? 18.940  64.271 1.895   1.00 97.51  ? 118 ASP B OD2 1 
ATOM   3666 N N   . LYS B 1 119 ? 19.065  60.619 -2.453  1.00 93.03  ? 119 LYS B N   1 
ATOM   3667 C CA  . LYS B 1 119 ? 19.791  59.898 -3.489  1.00 92.56  ? 119 LYS B CA  1 
ATOM   3668 C C   . LYS B 1 119 ? 21.311  59.831 -3.444  1.00 93.54  ? 119 LYS B C   1 
ATOM   3669 O O   . LYS B 1 119 ? 21.993  60.700 -2.879  1.00 90.43  ? 119 LYS B O   1 
ATOM   3670 C CB  . LYS B 1 119 ? 19.282  60.230 -4.889  1.00 91.93  ? 119 LYS B CB  1 
ATOM   3671 C CG  . LYS B 1 119 ? 18.399  59.121 -5.464  1.00 90.10  ? 119 LYS B CG  1 
ATOM   3672 C CD  . LYS B 1 119 ? 19.066  57.748 -5.309  1.00 89.34  ? 119 LYS B CD  1 
ATOM   3673 C CE  . LYS B 1 119 ? 18.269  56.630 -5.974  1.00 90.61  ? 119 LYS B CE  1 
ATOM   3674 N NZ  . LYS B 1 119 ? 18.303  56.686 -7.461  1.00 91.83  ? 119 LYS B NZ  1 
ATOM   3675 N N   . PHE B 1 120 ? 21.806  58.748 -4.052  1.00 95.58  ? 120 PHE B N   1 
ATOM   3676 C CA  . PHE B 1 120 ? 23.215  58.381 -4.104  1.00 95.00  ? 120 PHE B CA  1 
ATOM   3677 C C   . PHE B 1 120 ? 23.712  58.361 -2.657  1.00 93.04  ? 120 PHE B C   1 
ATOM   3678 O O   . PHE B 1 120 ? 24.745  58.963 -2.351  1.00 91.93  ? 120 PHE B O   1 
ATOM   3679 C CB  . PHE B 1 120 ? 24.028  59.340 -4.990  1.00 97.22  ? 120 PHE B CB  1 
ATOM   3680 C CG  . PHE B 1 120 ? 25.466  58.899 -5.240  1.00 103.84 ? 120 PHE B CG  1 
ATOM   3681 C CD1 . PHE B 1 120 ? 26.044  57.842 -4.514  1.00 105.10 ? 120 PHE B CD1 1 
ATOM   3682 C CD2 . PHE B 1 120 ? 26.252  59.565 -6.193  1.00 105.54 ? 120 PHE B CD2 1 
ATOM   3683 C CE1 . PHE B 1 120 ? 27.378  57.465 -4.718  1.00 107.66 ? 120 PHE B CE1 1 
ATOM   3684 C CE2 . PHE B 1 120 ? 27.595  59.199 -6.414  1.00 107.01 ? 120 PHE B CE2 1 
ATOM   3685 C CZ  . PHE B 1 120 ? 28.159  58.147 -5.674  1.00 109.65 ? 120 PHE B CZ  1 
ATOM   3686 N N   . PRO B 1 121 ? 22.961  57.682 -1.746  1.00 91.13  ? 121 PRO B N   1 
ATOM   3687 C CA  . PRO B 1 121 ? 23.396  57.629 -0.349  1.00 89.28  ? 121 PRO B CA  1 
ATOM   3688 C C   . PRO B 1 121 ? 24.876  57.269 -0.269  1.00 88.63  ? 121 PRO B C   1 
ATOM   3689 O O   . PRO B 1 121 ? 25.285  56.117 -0.433  1.00 87.75  ? 121 PRO B O   1 
ATOM   3690 C CB  . PRO B 1 121 ? 22.467  56.569 0.276   1.00 88.91  ? 121 PRO B CB  1 
ATOM   3691 C CG  . PRO B 1 121 ? 21.874  55.839 -0.886  1.00 89.23  ? 121 PRO B CG  1 
ATOM   3692 C CD  . PRO B 1 121 ? 21.721  56.903 -1.922  1.00 89.64  ? 121 PRO B CD  1 
ATOM   3693 N N   . ASP B 1 122 ? 25.668  58.323 -0.127  1.00 87.72  ? 122 ASP B N   1 
ATOM   3694 C CA  . ASP B 1 122 ? 27.116  58.253 -0.053  1.00 85.45  ? 122 ASP B CA  1 
ATOM   3695 C C   . ASP B 1 122 ? 27.647  57.208 0.930   1.00 83.65  ? 122 ASP B C   1 
ATOM   3696 O O   . ASP B 1 122 ? 27.312  57.222 2.125   1.00 84.14  ? 122 ASP B O   1 
ATOM   3697 C CB  . ASP B 1 122 ? 27.658  59.645 0.282   1.00 84.33  ? 122 ASP B CB  1 
ATOM   3698 C CG  . ASP B 1 122 ? 29.145  59.654 0.489   1.00 82.94  ? 122 ASP B CG  1 
ATOM   3699 O OD1 . ASP B 1 122 ? 29.888  59.344 -0.464  1.00 84.27  ? 122 ASP B OD1 1 
ATOM   3700 O OD2 . ASP B 1 122 ? 29.569  59.985 1.606   1.00 80.36  ? 122 ASP B OD2 1 
ATOM   3701 N N   . PRO B 1 123 ? 28.460  56.266 0.425   1.00 80.09  ? 123 PRO B N   1 
ATOM   3702 C CA  . PRO B 1 123 ? 29.055  55.194 1.232   1.00 77.24  ? 123 PRO B CA  1 
ATOM   3703 C C   . PRO B 1 123 ? 30.014  55.711 2.301   1.00 73.96  ? 123 PRO B C   1 
ATOM   3704 O O   . PRO B 1 123 ? 30.287  55.018 3.274   1.00 72.65  ? 123 PRO B O   1 
ATOM   3705 C CB  . PRO B 1 123 ? 29.766  54.343 0.182   1.00 78.76  ? 123 PRO B CB  1 
ATOM   3706 C CG  . PRO B 1 123 ? 28.908  54.521 -1.031  1.00 76.98  ? 123 PRO B CG  1 
ATOM   3707 C CD  . PRO B 1 123 ? 28.640  56.003 -1.014  1.00 77.13  ? 123 PRO B CD  1 
ATOM   3708 N N   . MET B 1 124 ? 30.574  56.898 2.081   1.00 70.88  ? 124 MET B N   1 
ATOM   3709 C CA  . MET B 1 124 ? 31.479  57.494 3.051   1.00 69.13  ? 124 MET B CA  1 
ATOM   3710 C C   . MET B 1 124 ? 30.585  57.830 4.240   1.00 69.31  ? 124 MET B C   1 
ATOM   3711 O O   . MET B 1 124 ? 30.723  57.262 5.315   1.00 67.38  ? 124 MET B O   1 
ATOM   3712 C CB  . MET B 1 124 ? 32.097  58.766 2.481   1.00 68.31  ? 124 MET B CB  1 
ATOM   3713 C CG  . MET B 1 124 ? 33.059  58.558 1.339   1.00 69.89  ? 124 MET B CG  1 
ATOM   3714 S SD  . MET B 1 124 ? 34.687  58.114 1.938   1.00 79.69  ? 124 MET B SD  1 
ATOM   3715 C CE  . MET B 1 124 ? 35.464  59.720 2.253   1.00 77.06  ? 124 MET B CE  1 
ATOM   3716 N N   . LYS B 1 125 ? 29.684  58.782 4.029   1.00 72.10  ? 125 LYS B N   1 
ATOM   3717 C CA  . LYS B 1 125 ? 28.710  59.200 5.034   1.00 78.19  ? 125 LYS B CA  1 
ATOM   3718 C C   . LYS B 1 125 ? 28.019  57.988 5.675   1.00 80.24  ? 125 LYS B C   1 
ATOM   3719 O O   . LYS B 1 125 ? 28.169  57.749 6.871   1.00 82.57  ? 125 LYS B O   1 
ATOM   3720 C CB  . LYS B 1 125 ? 27.649  60.108 4.386   1.00 80.11  ? 125 LYS B CB  1 
ATOM   3721 C CG  . LYS B 1 125 ? 27.670  61.568 4.840   1.00 82.99  ? 125 LYS B CG  1 
ATOM   3722 C CD  . LYS B 1 125 ? 28.963  62.261 4.429   1.00 86.60  ? 125 LYS B CD  1 
ATOM   3723 C CE  . LYS B 1 125 ? 29.294  63.437 5.344   1.00 89.60  ? 125 LYS B CE  1 
ATOM   3724 N NZ  . LYS B 1 125 ? 29.464  63.044 6.788   1.00 91.74  ? 125 LYS B NZ  1 
ATOM   3725 N N   . ALA B 1 126 ? 27.284  57.227 4.862   1.00 79.74  ? 126 ALA B N   1 
ATOM   3726 C CA  . ALA B 1 126 ? 26.560  56.038 5.311   1.00 79.16  ? 126 ALA B CA  1 
ATOM   3727 C C   . ALA B 1 126 ? 25.493  56.410 6.313   1.00 77.67  ? 126 ALA B C   1 
ATOM   3728 O O   . ALA B 1 126 ? 25.451  55.867 7.404   1.00 77.60  ? 126 ALA B O   1 
ATOM   3729 C CB  . ALA B 1 126 ? 27.520  55.011 5.927   1.00 81.27  ? 126 ALA B CB  1 
ATOM   3730 N N   . GLU B 1 127 ? 24.595  57.294 5.896   1.00 76.96  ? 127 GLU B N   1 
ATOM   3731 C CA  . GLU B 1 127 ? 23.515  57.790 6.745   1.00 75.56  ? 127 GLU B CA  1 
ATOM   3732 C C   . GLU B 1 127 ? 22.364  56.813 6.981   1.00 73.86  ? 127 GLU B C   1 
ATOM   3733 O O   . GLU B 1 127 ? 22.032  56.428 8.109   1.00 72.91  ? 127 GLU B O   1 
ATOM   3734 C CB  . GLU B 1 127 ? 22.894  59.047 6.114   1.00 76.56  ? 127 GLU B CB  1 
ATOM   3735 C CG  . GLU B 1 127 ? 23.839  60.196 5.780   1.00 84.13  ? 127 GLU B CG  1 
ATOM   3736 C CD  . GLU B 1 127 ? 23.099  61.424 5.215   1.00 87.06  ? 127 GLU B CD  1 
ATOM   3737 O OE1 . GLU B 1 127 ? 21.955  61.687 5.648   1.00 89.63  ? 127 GLU B OE1 1 
ATOM   3738 O OE2 . GLU B 1 127 ? 23.662  62.129 4.345   1.00 86.34  ? 127 GLU B OE2 1 
ATOM   3739 N N   . TYR B 1 128 ? 21.751  56.440 5.875   1.00 71.25  ? 128 TYR B N   1 
ATOM   3740 C CA  . TYR B 1 128 ? 20.567  55.617 5.865   1.00 70.65  ? 128 TYR B CA  1 
ATOM   3741 C C   . TYR B 1 128 ? 20.695  54.152 6.206   1.00 69.85  ? 128 TYR B C   1 
ATOM   3742 O O   . TYR B 1 128 ? 21.765  53.567 6.112   1.00 67.66  ? 128 TYR B O   1 
ATOM   3743 C CB  . TYR B 1 128 ? 19.881  55.808 4.510   1.00 73.13  ? 128 TYR B CB  1 
ATOM   3744 C CG  . TYR B 1 128 ? 19.961  57.252 4.042   1.00 73.04  ? 128 TYR B CG  1 
ATOM   3745 C CD1 . TYR B 1 128 ? 19.709  58.294 4.929   1.00 72.26  ? 128 TYR B CD1 1 
ATOM   3746 C CD2 . TYR B 1 128 ? 20.378  57.576 2.748   1.00 72.62  ? 128 TYR B CD2 1 
ATOM   3747 C CE1 . TYR B 1 128 ? 19.872  59.606 4.556   1.00 72.35  ? 128 TYR B CE1 1 
ATOM   3748 C CE2 . TYR B 1 128 ? 20.543  58.903 2.362   1.00 69.59  ? 128 TYR B CE2 1 
ATOM   3749 C CZ  . TYR B 1 128 ? 20.290  59.906 3.279   1.00 70.95  ? 128 TYR B CZ  1 
ATOM   3750 O OH  . TYR B 1 128 ? 20.462  61.223 2.949   1.00 72.50  ? 128 TYR B OH  1 
ATOM   3751 N N   . GLU B 1 129 ? 19.560  53.581 6.608   1.00 72.75  ? 129 GLU B N   1 
ATOM   3752 C CA  . GLU B 1 129 ? 19.435  52.171 6.962   1.00 72.97  ? 129 GLU B CA  1 
ATOM   3753 C C   . GLU B 1 129 ? 19.292  51.377 5.665   1.00 71.99  ? 129 GLU B C   1 
ATOM   3754 O O   . GLU B 1 129 ? 18.274  51.494 4.978   1.00 73.21  ? 129 GLU B O   1 
ATOM   3755 C CB  . GLU B 1 129 ? 18.169  51.925 7.798   1.00 73.37  ? 129 GLU B CB  1 
ATOM   3756 C CG  . GLU B 1 129 ? 17.944  52.851 8.998   1.00 76.46  ? 129 GLU B CG  1 
ATOM   3757 C CD  . GLU B 1 129 ? 16.671  52.498 9.777   1.00 75.42  ? 129 GLU B CD  1 
ATOM   3758 O OE1 . GLU B 1 129 ? 16.621  51.381 10.340  1.00 77.37  ? 129 GLU B OE1 1 
ATOM   3759 O OE2 . GLU B 1 129 ? 15.721  53.317 9.812   1.00 69.80  ? 129 GLU B OE2 1 
ATOM   3760 N N   . ILE B 1 130 ? 20.292  50.572 5.316   1.00 68.59  ? 130 ILE B N   1 
ATOM   3761 C CA  . ILE B 1 130 ? 20.184  49.795 4.086   1.00 61.91  ? 130 ILE B CA  1 
ATOM   3762 C C   . ILE B 1 130 ? 18.921  48.917 4.163   1.00 57.73  ? 130 ILE B C   1 
ATOM   3763 O O   . ILE B 1 130 ? 18.686  48.175 5.126   1.00 50.16  ? 130 ILE B O   1 
ATOM   3764 C CB  . ILE B 1 130 ? 21.515  49.003 3.714   1.00 58.49  ? 130 ILE B CB  1 
ATOM   3765 C CG1 . ILE B 1 130 ? 21.507  47.568 4.232   1.00 54.66  ? 130 ILE B CG1 1 
ATOM   3766 C CG2 . ILE B 1 130 ? 22.754  49.753 4.203   1.00 59.56  ? 130 ILE B CG2 1 
ATOM   3767 C CD1 . ILE B 1 130 ? 20.944  46.598 3.257   1.00 48.88  ? 130 ILE B CD1 1 
ATOM   3768 N N   . ASP B 1 131 ? 18.064  49.111 3.174   1.00 56.36  ? 131 ASP B N   1 
ATOM   3769 C CA  . ASP B 1 131 ? 16.803  48.397 3.101   1.00 55.57  ? 131 ASP B CA  1 
ATOM   3770 C C   . ASP B 1 131 ? 16.967  46.902 2.906   1.00 52.55  ? 131 ASP B C   1 
ATOM   3771 O O   . ASP B 1 131 ? 16.282  46.125 3.551   1.00 52.34  ? 131 ASP B O   1 
ATOM   3772 C CB  . ASP B 1 131 ? 15.931  48.921 1.943   1.00 56.16  ? 131 ASP B CB  1 
ATOM   3773 C CG  . ASP B 1 131 ? 15.829  50.433 1.902   1.00 54.53  ? 131 ASP B CG  1 
ATOM   3774 O OD1 . ASP B 1 131 ? 15.614  51.086 2.946   1.00 53.32  ? 131 ASP B OD1 1 
ATOM   3775 O OD2 . ASP B 1 131 ? 15.936  50.961 0.787   1.00 56.59  ? 131 ASP B OD2 1 
ATOM   3776 N N   . ALA B 1 132 ? 17.819  46.495 1.973   1.00 50.64  ? 132 ALA B N   1 
ATOM   3777 C CA  . ALA B 1 132 ? 17.961  45.074 1.709   1.00 51.12  ? 132 ALA B CA  1 
ATOM   3778 C C   . ALA B 1 132 ? 19.225  44.690 0.995   1.00 51.65  ? 132 ALA B C   1 
ATOM   3779 O O   . ALA B 1 132 ? 19.837  45.514 0.307   1.00 52.39  ? 132 ALA B O   1 
ATOM   3780 C CB  . ALA B 1 132 ? 16.789  44.589 0.909   1.00 51.69  ? 132 ALA B CB  1 
ATOM   3781 N N   . ILE B 1 133 ? 19.547  43.399 1.102   1.00 49.90  ? 133 ILE B N   1 
ATOM   3782 C CA  . ILE B 1 133 ? 20.726  42.813 0.490   1.00 46.90  ? 133 ILE B CA  1 
ATOM   3783 C C   . ILE B 1 133 ? 20.389  41.423 -0.020  1.00 46.15  ? 133 ILE B C   1 
ATOM   3784 O O   . ILE B 1 133 ? 19.953  40.578 0.755   1.00 45.12  ? 133 ILE B O   1 
ATOM   3785 C CB  . ILE B 1 133 ? 21.894  42.569 1.529   1.00 45.42  ? 133 ILE B CB  1 
ATOM   3786 C CG1 . ILE B 1 133 ? 22.130  43.773 2.428   1.00 44.01  ? 133 ILE B CG1 1 
ATOM   3787 C CG2 . ILE B 1 133 ? 23.201  42.210 0.809   1.00 40.25  ? 133 ILE B CG2 1 
ATOM   3788 C CD1 . ILE B 1 133 ? 22.728  43.405 3.786   1.00 42.23  ? 133 ILE B CD1 1 
ATOM   3789 N N   . THR B 1 134 ? 20.505  41.197 -1.322  1.00 48.64  ? 134 THR B N   1 
ATOM   3790 C CA  . THR B 1 134 ? 20.347  39.842 -1.834  1.00 49.37  ? 134 THR B CA  1 
ATOM   3791 C C   . THR B 1 134 ? 21.815  39.484 -2.132  1.00 49.33  ? 134 THR B C   1 
ATOM   3792 O O   . THR B 1 134 ? 22.587  40.270 -2.720  1.00 46.93  ? 134 THR B O   1 
ATOM   3793 C CB  . THR B 1 134 ? 19.391  39.690 -3.052  1.00 49.13  ? 134 THR B CB  1 
ATOM   3794 O OG1 . THR B 1 134 ? 18.053  39.959 -2.627  1.00 45.58  ? 134 THR B OG1 1 
ATOM   3795 C CG2 . THR B 1 134 ? 19.410  38.251 -3.563  1.00 50.60  ? 134 THR B CG2 1 
ATOM   3796 N N   . HIS B 1 135 ? 22.203  38.312 -1.663  1.00 46.69  ? 135 HIS B N   1 
ATOM   3797 C CA  . HIS B 1 135 ? 23.565  37.867 -1.758  1.00 45.24  ? 135 HIS B CA  1 
ATOM   3798 C C   . HIS B 1 135 ? 23.590  36.417 -2.252  1.00 42.50  ? 135 HIS B C   1 
ATOM   3799 O O   . HIS B 1 135 ? 23.185  35.508 -1.545  1.00 39.77  ? 135 HIS B O   1 
ATOM   3800 C CB  . HIS B 1 135 ? 24.155  38.037 -0.335  1.00 46.62  ? 135 HIS B CB  1 
ATOM   3801 C CG  . HIS B 1 135 ? 25.584  37.613 -0.170  1.00 50.65  ? 135 HIS B CG  1 
ATOM   3802 N ND1 . HIS B 1 135 ? 26.023  36.330 -0.443  1.00 55.39  ? 135 HIS B ND1 1 
ATOM   3803 C CD2 . HIS B 1 135 ? 26.641  38.259 0.379   1.00 49.37  ? 135 HIS B CD2 1 
ATOM   3804 C CE1 . HIS B 1 135 ? 27.281  36.207 -0.047  1.00 51.81  ? 135 HIS B CE1 1 
ATOM   3805 N NE2 . HIS B 1 135 ? 27.674  37.361 0.454   1.00 51.25  ? 135 HIS B NE2 1 
ATOM   3806 N N   . TYR B 1 136 ? 24.033  36.214 -3.487  1.00 40.52  ? 136 TYR B N   1 
ATOM   3807 C CA  . TYR B 1 136 ? 24.148  34.872 -4.037  1.00 40.27  ? 136 TYR B CA  1 
ATOM   3808 C C   . TYR B 1 136 ? 25.441  34.230 -3.528  1.00 39.96  ? 136 TYR B C   1 
ATOM   3809 O O   . TYR B 1 136 ? 26.386  34.932 -3.166  1.00 36.99  ? 136 TYR B O   1 
ATOM   3810 C CB  . TYR B 1 136 ? 24.164  34.912 -5.563  1.00 38.17  ? 136 TYR B CB  1 
ATOM   3811 C CG  . TYR B 1 136 ? 24.362  33.559 -6.222  1.00 39.88  ? 136 TYR B CG  1 
ATOM   3812 C CD1 . TYR B 1 136 ? 23.276  32.742 -6.544  1.00 38.57  ? 136 TYR B CD1 1 
ATOM   3813 C CD2 . TYR B 1 136 ? 25.631  33.126 -6.592  1.00 40.95  ? 136 TYR B CD2 1 
ATOM   3814 C CE1 . TYR B 1 136 ? 23.453  31.532 -7.230  1.00 34.02  ? 136 TYR B CE1 1 
ATOM   3815 C CE2 . TYR B 1 136 ? 25.814  31.925 -7.277  1.00 38.77  ? 136 TYR B CE2 1 
ATOM   3816 C CZ  . TYR B 1 136 ? 24.724  31.138 -7.599  1.00 37.30  ? 136 TYR B CZ  1 
ATOM   3817 O OH  . TYR B 1 136 ? 24.919  30.008 -8.350  1.00 32.65  ? 136 TYR B OH  1 
ATOM   3818 N N   . ASP B 1 137 ? 25.438  32.896 -3.484  1.00 42.31  ? 137 ASP B N   1 
ATOM   3819 C CA  . ASP B 1 137 ? 26.561  32.069 -3.050  1.00 42.44  ? 137 ASP B CA  1 
ATOM   3820 C C   . ASP B 1 137 ? 26.637  30.916 -4.032  1.00 42.87  ? 137 ASP B C   1 
ATOM   3821 O O   . ASP B 1 137 ? 25.809  30.012 -3.988  1.00 47.41  ? 137 ASP B O   1 
ATOM   3822 C CB  . ASP B 1 137 ? 26.323  31.507 -1.639  1.00 45.29  ? 137 ASP B CB  1 
ATOM   3823 C CG  . ASP B 1 137 ? 27.556  30.784 -1.071  1.00 48.92  ? 137 ASP B CG  1 
ATOM   3824 O OD1 . ASP B 1 137 ? 27.761  29.588 -1.382  1.00 46.45  ? 137 ASP B OD1 1 
ATOM   3825 O OD2 . ASP B 1 137 ? 28.323  31.423 -0.307  1.00 51.31  ? 137 ASP B OD2 1 
ATOM   3826 N N   . SER B 1 138 ? 27.657  30.914 -4.875  1.00 41.23  ? 138 SER B N   1 
ATOM   3827 C CA  . SER B 1 138 ? 27.835  29.874 -5.881  1.00 41.23  ? 138 SER B CA  1 
ATOM   3828 C C   . SER B 1 138 ? 27.813  28.442 -5.361  1.00 39.25  ? 138 SER B C   1 
ATOM   3829 O O   . SER B 1 138 ? 27.348  27.536 -6.054  1.00 39.15  ? 138 SER B O   1 
ATOM   3830 C CB  . SER B 1 138 ? 29.174  30.091 -6.576  1.00 42.29  ? 138 SER B CB  1 
ATOM   3831 O OG  . SER B 1 138 ? 30.216  30.049 -5.612  1.00 48.60  ? 138 SER B OG  1 
ATOM   3832 N N   . ILE B 1 139 ? 28.389  28.249 -4.173  1.00 41.05  ? 139 ILE B N   1 
ATOM   3833 C CA  . ILE B 1 139 ? 28.514  26.930 -3.531  1.00 41.39  ? 139 ILE B CA  1 
ATOM   3834 C C   . ILE B 1 139 ? 27.189  26.274 -3.224  1.00 43.66  ? 139 ILE B C   1 
ATOM   3835 O O   . ILE B 1 139 ? 26.981  25.094 -3.530  1.00 44.37  ? 139 ILE B O   1 
ATOM   3836 C CB  . ILE B 1 139 ? 29.443  26.967 -2.254  1.00 38.80  ? 139 ILE B CB  1 
ATOM   3837 C CG1 . ILE B 1 139 ? 30.912  26.827 -2.676  1.00 32.15  ? 139 ILE B CG1 1 
ATOM   3838 C CG2 . ILE B 1 139 ? 29.074  25.875 -1.260  1.00 38.02  ? 139 ILE B CG2 1 
ATOM   3839 C CD1 . ILE B 1 139 ? 31.105  25.732 -3.748  1.00 29.77  ? 139 ILE B CD1 1 
ATOM   3840 N N   . ASP B 1 140 ? 26.295  27.007 -2.587  1.00 41.80  ? 140 ASP B N   1 
ATOM   3841 C CA  . ASP B 1 140 ? 25.029  26.386 -2.339  1.00 45.43  ? 140 ASP B CA  1 
ATOM   3842 C C   . ASP B 1 140 ? 23.933  26.992 -3.172  1.00 46.06  ? 140 ASP B C   1 
ATOM   3843 O O   . ASP B 1 140 ? 22.839  27.175 -2.701  1.00 50.77  ? 140 ASP B O   1 
ATOM   3844 C CB  . ASP B 1 140 ? 24.691  26.278 -0.848  1.00 44.76  ? 140 ASP B CB  1 
ATOM   3845 C CG  . ASP B 1 140 ? 24.913  27.551 -0.090  1.00 42.56  ? 140 ASP B CG  1 
ATOM   3846 O OD1 . ASP B 1 140 ? 24.795  28.641 -0.693  1.00 47.71  ? 140 ASP B OD1 1 
ATOM   3847 O OD2 . ASP B 1 140 ? 25.173  27.449 1.129   1.00 39.01  ? 140 ASP B OD2 1 
ATOM   3848 N N   . ASP B 1 141 ? 24.268  27.313 -4.420  1.00 45.29  ? 141 ASP B N   1 
ATOM   3849 C CA  . ASP B 1 141 ? 23.352  27.860 -5.429  1.00 43.32  ? 141 ASP B CA  1 
ATOM   3850 C C   . ASP B 1 141 ? 22.039  28.578 -4.990  1.00 43.33  ? 141 ASP B C   1 
ATOM   3851 O O   . ASP B 1 141 ? 21.052  28.582 -5.727  1.00 38.88  ? 141 ASP B O   1 
ATOM   3852 C CB  . ASP B 1 141 ? 23.044  26.732 -6.433  1.00 43.58  ? 141 ASP B CB  1 
ATOM   3853 C CG  . ASP B 1 141 ? 22.494  27.244 -7.750  1.00 49.27  ? 141 ASP B CG  1 
ATOM   3854 O OD1 . ASP B 1 141 ? 22.471  28.479 -7.937  1.00 51.30  ? 141 ASP B OD1 1 
ATOM   3855 O OD2 . ASP B 1 141 ? 22.090  26.414 -8.607  1.00 54.16  ? 141 ASP B OD2 1 
ATOM   3856 N N   . ARG B 1 142 ? 22.041  29.216 -3.822  1.00 45.92  ? 142 ARG B N   1 
ATOM   3857 C CA  . ARG B 1 142 ? 20.861  29.935 -3.321  1.00 49.76  ? 142 ARG B CA  1 
ATOM   3858 C C   . ARG B 1 142 ? 21.151  31.421 -3.255  1.00 50.05  ? 142 ARG B C   1 
ATOM   3859 O O   . ARG B 1 142 ? 22.297  31.832 -2.998  1.00 46.31  ? 142 ARG B O   1 
ATOM   3860 C CB  . ARG B 1 142 ? 20.484  29.539 -1.873  1.00 53.86  ? 142 ARG B CB  1 
ATOM   3861 C CG  . ARG B 1 142 ? 19.856  28.174 -1.627  1.00 57.86  ? 142 ARG B CG  1 
ATOM   3862 C CD  . ARG B 1 142 ? 20.854  27.277 -0.928  1.00 68.10  ? 142 ARG B CD  1 
ATOM   3863 N NE  . ARG B 1 142 ? 20.478  26.832 0.415   1.00 75.70  ? 142 ARG B NE  1 
ATOM   3864 C CZ  . ARG B 1 142 ? 20.779  25.626 0.899   1.00 77.34  ? 142 ARG B CZ  1 
ATOM   3865 N NH1 . ARG B 1 142 ? 21.472  24.758 0.160   1.00 75.18  ? 142 ARG B NH1 1 
ATOM   3866 N NH2 . ARG B 1 142 ? 20.400  25.287 2.130   1.00 80.75  ? 142 ARG B NH2 1 
ATOM   3867 N N   . PHE B 1 143 ? 20.107  32.223 -3.449  1.00 48.81  ? 143 PHE B N   1 
ATOM   3868 C CA  . PHE B 1 143 ? 20.238  33.667 -3.318  1.00 46.82  ? 143 PHE B CA  1 
ATOM   3869 C C   . PHE B 1 143 ? 19.697  33.934 -1.913  1.00 43.62  ? 143 PHE B C   1 
ATOM   3870 O O   . PHE B 1 143 ? 18.711  33.352 -1.515  1.00 46.11  ? 143 PHE B O   1 
ATOM   3871 C CB  . PHE B 1 143 ? 19.422  34.417 -4.361  1.00 44.10  ? 143 PHE B CB  1 
ATOM   3872 C CG  . PHE B 1 143 ? 19.776  34.082 -5.792  1.00 44.05  ? 143 PHE B CG  1 
ATOM   3873 C CD1 . PHE B 1 143 ? 19.520  32.817 -6.314  1.00 41.82  ? 143 PHE B CD1 1 
ATOM   3874 C CD2 . PHE B 1 143 ? 20.222  35.083 -6.663  1.00 42.54  ? 143 PHE B CD2 1 
ATOM   3875 C CE1 . PHE B 1 143 ? 19.685  32.566 -7.679  1.00 39.19  ? 143 PHE B CE1 1 
ATOM   3876 C CE2 . PHE B 1 143 ? 20.387  34.833 -8.025  1.00 40.27  ? 143 PHE B CE2 1 
ATOM   3877 C CZ  . PHE B 1 143 ? 20.114  33.576 -8.534  1.00 40.78  ? 143 PHE B CZ  1 
ATOM   3878 N N   . TYR B 1 144 ? 20.397  34.754 -1.149  1.00 44.47  ? 144 TYR B N   1 
ATOM   3879 C CA  . TYR B 1 144 ? 20.027  35.085 0.213   1.00 45.31  ? 144 TYR B CA  1 
ATOM   3880 C C   . TYR B 1 144 ? 19.437  36.495 0.245   1.00 47.60  ? 144 TYR B C   1 
ATOM   3881 O O   . TYR B 1 144 ? 20.125  37.472 -0.050  1.00 44.90  ? 144 TYR B O   1 
ATOM   3882 C CB  . TYR B 1 144 ? 21.267  34.962 1.128   1.00 45.22  ? 144 TYR B CB  1 
ATOM   3883 C CG  . TYR B 1 144 ? 21.729  33.524 1.327   1.00 45.51  ? 144 TYR B CG  1 
ATOM   3884 C CD1 . TYR B 1 144 ? 22.527  32.865 0.377   1.00 43.85  ? 144 TYR B CD1 1 
ATOM   3885 C CD2 . TYR B 1 144 ? 21.281  32.787 2.421   1.00 47.43  ? 144 TYR B CD2 1 
ATOM   3886 C CE1 . TYR B 1 144 ? 22.847  31.508 0.521   1.00 39.36  ? 144 TYR B CE1 1 
ATOM   3887 C CE2 . TYR B 1 144 ? 21.590  31.436 2.566   1.00 45.49  ? 144 TYR B CE2 1 
ATOM   3888 C CZ  . TYR B 1 144 ? 22.362  30.806 1.621   1.00 42.86  ? 144 TYR B CZ  1 
ATOM   3889 O OH  . TYR B 1 144 ? 22.595  29.460 1.792   1.00 47.06  ? 144 TYR B OH  1 
ATOM   3890 N N   . VAL B 1 145 ? 18.164  36.604 0.620   1.00 49.97  ? 145 VAL B N   1 
ATOM   3891 C CA  . VAL B 1 145 ? 17.493  37.899 0.634   1.00 50.25  ? 145 VAL B CA  1 
ATOM   3892 C C   . VAL B 1 145 ? 17.211  38.490 2.004   1.00 52.08  ? 145 VAL B C   1 
ATOM   3893 O O   . VAL B 1 145 ? 16.337  38.009 2.719   1.00 57.05  ? 145 VAL B O   1 
ATOM   3894 C CB  . VAL B 1 145 ? 16.179  37.874 -0.191  1.00 46.51  ? 145 VAL B CB  1 
ATOM   3895 C CG1 . VAL B 1 145 ? 15.647  39.305 -0.355  1.00 43.78  ? 145 VAL B CG1 1 
ATOM   3896 C CG2 . VAL B 1 145 ? 16.429  37.257 -1.547  1.00 39.83  ? 145 VAL B CG2 1 
ATOM   3897 N N   . PHE B 1 146 ? 17.922  39.566 2.334   1.00 50.42  ? 146 PHE B N   1 
ATOM   3898 C CA  . PHE B 1 146 ? 17.762  40.248 3.609   1.00 50.45  ? 146 PHE B CA  1 
ATOM   3899 C C   . PHE B 1 146 ? 16.891  41.461 3.349   1.00 53.08  ? 146 PHE B C   1 
ATOM   3900 O O   . PHE B 1 146 ? 17.242  42.320 2.537   1.00 50.35  ? 146 PHE B O   1 
ATOM   3901 C CB  . PHE B 1 146 ? 19.121  40.655 4.171   1.00 50.76  ? 146 PHE B CB  1 
ATOM   3902 C CG  . PHE B 1 146 ? 20.046  39.491 4.408   1.00 49.45  ? 146 PHE B CG  1 
ATOM   3903 C CD1 . PHE B 1 146 ? 20.438  38.657 3.344   1.00 49.58  ? 146 PHE B CD1 1 
ATOM   3904 C CD2 . PHE B 1 146 ? 20.545  39.238 5.681   1.00 48.10  ? 146 PHE B CD2 1 
ATOM   3905 C CE1 . PHE B 1 146 ? 21.319  37.592 3.541   1.00 46.56  ? 146 PHE B CE1 1 
ATOM   3906 C CE2 . PHE B 1 146 ? 21.426  38.179 5.895   1.00 50.99  ? 146 PHE B CE2 1 
ATOM   3907 C CZ  . PHE B 1 146 ? 21.814  37.350 4.812   1.00 48.84  ? 146 PHE B CZ  1 
ATOM   3908 N N   . ASP B 1 147 ? 15.768  41.517 4.066   1.00 54.79  ? 147 ASP B N   1 
ATOM   3909 C CA  . ASP B 1 147 ? 14.751  42.561 3.929   1.00 52.10  ? 147 ASP B CA  1 
ATOM   3910 C C   . ASP B 1 147 ? 14.587  43.378 5.199   1.00 53.43  ? 147 ASP B C   1 
ATOM   3911 O O   . ASP B 1 147 ? 14.352  42.817 6.270   1.00 52.66  ? 147 ASP B O   1 
ATOM   3912 C CB  . ASP B 1 147 ? 13.414  41.876 3.630   1.00 51.87  ? 147 ASP B CB  1 
ATOM   3913 C CG  . ASP B 1 147 ? 12.450  42.758 2.859   1.00 54.03  ? 147 ASP B CG  1 
ATOM   3914 O OD1 . ASP B 1 147 ? 12.614  44.003 2.883   1.00 53.07  ? 147 ASP B OD1 1 
ATOM   3915 O OD2 . ASP B 1 147 ? 11.526  42.191 2.220   1.00 54.53  ? 147 ASP B OD2 1 
ATOM   3916 N N   . LEU B 1 148 ? 14.693  44.697 5.080   1.00 57.30  ? 148 LEU B N   1 
ATOM   3917 C CA  . LEU B 1 148 ? 14.510  45.579 6.231   1.00 59.61  ? 148 LEU B CA  1 
ATOM   3918 C C   . LEU B 1 148 ? 13.096  46.142 6.248   1.00 63.41  ? 148 LEU B C   1 
ATOM   3919 O O   . LEU B 1 148 ? 12.754  47.013 5.421   1.00 63.12  ? 148 LEU B O   1 
ATOM   3920 C CB  . LEU B 1 148 ? 15.492  46.761 6.244   1.00 56.94  ? 148 LEU B CB  1 
ATOM   3921 C CG  . LEU B 1 148 ? 15.220  47.773 7.379   1.00 56.83  ? 148 LEU B CG  1 
ATOM   3922 C CD1 . LEU B 1 148 ? 15.159  47.012 8.708   1.00 54.05  ? 148 LEU B CD1 1 
ATOM   3923 C CD2 . LEU B 1 148 ? 16.230  48.949 7.436   1.00 49.97  ? 148 LEU B CD2 1 
ATOM   3924 N N   . LEU B 1 149 ? 12.278  45.591 7.153   1.00 64.68  ? 149 LEU B N   1 
ATOM   3925 C CA  . LEU B 1 149 ? 10.897  46.030 7.388   1.00 62.49  ? 149 LEU B CA  1 
ATOM   3926 C C   . LEU B 1 149 ? 11.132  47.009 8.543   1.00 65.22  ? 149 LEU B C   1 
ATOM   3927 O O   . LEU B 1 149 ? 11.975  46.741 9.421   1.00 64.51  ? 149 LEU B O   1 
ATOM   3928 C CB  . LEU B 1 149 ? 10.024  44.867 7.872   1.00 53.30  ? 149 LEU B CB  1 
ATOM   3929 C CG  . LEU B 1 149 ? 10.184  43.523 7.162   1.00 49.23  ? 149 LEU B CG  1 
ATOM   3930 C CD1 . LEU B 1 149 ? 9.731   42.421 8.063   1.00 46.91  ? 149 LEU B CD1 1 
ATOM   3931 C CD2 . LEU B 1 149 ? 9.439   43.489 5.846   1.00 50.29  ? 149 LEU B CD2 1 
ATOM   3932 N N   . ASN B 1 150 ? 10.460  48.157 8.500   1.00 66.67  ? 150 ASN B N   1 
ATOM   3933 C CA  . ASN B 1 150 ? 10.606  49.198 9.528   1.00 70.35  ? 150 ASN B CA  1 
ATOM   3934 C C   . ASN B 1 150 ? 11.752  50.129 9.139   1.00 68.76  ? 150 ASN B C   1 
ATOM   3935 O O   . ASN B 1 150 ? 12.375  50.780 9.969   1.00 68.00  ? 150 ASN B O   1 
ATOM   3936 C CB  . ASN B 1 150 ? 10.905  48.603 10.909  1.00 75.27  ? 150 ASN B CB  1 
ATOM   3937 C CG  . ASN B 1 150 ? 9.682   48.064 11.602  1.00 75.86  ? 150 ASN B CG  1 
ATOM   3938 O OD1 . ASN B 1 150 ? 8.988   47.175 11.097  1.00 74.95  ? 150 ASN B OD1 1 
ATOM   3939 N ND2 . ASN B 1 150 ? 9.433   48.575 12.801  1.00 78.96  ? 150 ASN B ND2 1 
ATOM   3940 N N   . SER B 1 151 ? 12.018  50.185 7.851   1.00 69.99  ? 151 SER B N   1 
ATOM   3941 C CA  . SER B 1 151 ? 13.070  51.017 7.305   1.00 71.39  ? 151 SER B CA  1 
ATOM   3942 C C   . SER B 1 151 ? 12.715  52.498 7.470   1.00 70.86  ? 151 SER B C   1 
ATOM   3943 O O   . SER B 1 151 ? 12.289  53.128 6.507   1.00 70.46  ? 151 SER B O   1 
ATOM   3944 C CB  . SER B 1 151 ? 13.225  50.652 5.820   1.00 74.39  ? 151 SER B CB  1 
ATOM   3945 O OG  . SER B 1 151 ? 12.325  49.602 5.457   1.00 74.19  ? 151 SER B OG  1 
ATOM   3946 N N   . MET B 1 152 ? 12.930  53.053 8.666   1.00 70.20  ? 152 MET B N   1 
ATOM   3947 C CA  . MET B 1 152 ? 12.600  54.458 8.970   1.00 71.58  ? 152 MET B CA  1 
ATOM   3948 C C   . MET B 1 152 ? 11.381  54.949 8.196   1.00 70.93  ? 152 MET B C   1 
ATOM   3949 O O   . MET B 1 152 ? 10.260  54.965 8.712   1.00 71.97  ? 152 MET B O   1 
ATOM   3950 C CB  . MET B 1 152 ? 13.783  55.414 8.697   1.00 74.17  ? 152 MET B CB  1 
ATOM   3951 C CG  . MET B 1 152 ? 13.515  56.944 8.953   1.00 73.26  ? 152 MET B CG  1 
ATOM   3952 S SD  . MET B 1 152 ? 12.567  57.911 7.676   1.00 73.73  ? 152 MET B SD  1 
ATOM   3953 C CE  . MET B 1 152 ? 11.597  59.090 8.678   1.00 70.03  ? 152 MET B CE  1 
ATOM   3954 N N   . TYR B 1 153 ? 11.629  55.301 6.938   1.00 68.11  ? 153 TYR B N   1 
ATOM   3955 C CA  . TYR B 1 153 ? 10.626  55.815 6.026   1.00 69.05  ? 153 TYR B CA  1 
ATOM   3956 C C   . TYR B 1 153 ? 9.306   55.089 6.172   1.00 69.75  ? 153 TYR B C   1 
ATOM   3957 O O   . TYR B 1 153 ? 8.231   55.715 6.112   1.00 70.96  ? 153 TYR B O   1 
ATOM   3958 C CB  . TYR B 1 153 ? 11.149  55.767 4.590   1.00 66.46  ? 153 TYR B CB  1 
ATOM   3959 C CG  . TYR B 1 153 ? 12.291  56.740 4.347   1.00 61.94  ? 153 TYR B CG  1 
ATOM   3960 C CD1 . TYR B 1 153 ? 13.465  56.680 5.095   1.00 59.92  ? 153 TYR B CD1 1 
ATOM   3961 C CD2 . TYR B 1 153 ? 12.187  57.729 3.379   1.00 63.29  ? 153 TYR B CD2 1 
ATOM   3962 C CE1 . TYR B 1 153 ? 14.498  57.585 4.887   1.00 58.32  ? 153 TYR B CE1 1 
ATOM   3963 C CE2 . TYR B 1 153 ? 13.216  58.634 3.157   1.00 61.25  ? 153 TYR B CE2 1 
ATOM   3964 C CZ  . TYR B 1 153 ? 14.366  58.560 3.913   1.00 58.65  ? 153 TYR B CZ  1 
ATOM   3965 O OH  . TYR B 1 153 ? 15.372  59.472 3.682   1.00 55.06  ? 153 TYR B OH  1 
ATOM   3966 N N   . GLY B 1 154 ? 9.375   53.787 6.432   1.00 67.99  ? 154 GLY B N   1 
ATOM   3967 C CA  . GLY B 1 154 ? 8.144   53.058 6.616   1.00 65.93  ? 154 GLY B CA  1 
ATOM   3968 C C   . GLY B 1 154 ? 8.241   51.606 6.989   1.00 62.99  ? 154 GLY B C   1 
ATOM   3969 O O   . GLY B 1 154 ? 9.276   50.971 6.826   1.00 60.79  ? 154 GLY B O   1 
ATOM   3970 N N   . SER B 1 155 ? 7.174   51.126 7.616   1.00 64.93  ? 155 SER B N   1 
ATOM   3971 C CA  . SER B 1 155 ? 7.030   49.722 7.977   1.00 65.10  ? 155 SER B CA  1 
ATOM   3972 C C   . SER B 1 155 ? 6.399   49.202 6.688   1.00 63.06  ? 155 SER B C   1 
ATOM   3973 O O   . SER B 1 155 ? 5.573   49.896 6.080   1.00 66.84  ? 155 SER B O   1 
ATOM   3974 C CB  . SER B 1 155 ? 6.048   49.565 9.143   1.00 66.30  ? 155 SER B CB  1 
ATOM   3975 O OG  . SER B 1 155 ? 6.510   50.263 10.292  1.00 71.08  ? 155 SER B OG  1 
ATOM   3976 N N   . VAL B 1 156 ? 6.814   48.037 6.217   1.00 58.63  ? 156 VAL B N   1 
ATOM   3977 C CA  . VAL B 1 156 ? 6.244   47.551 4.983   1.00 52.49  ? 156 VAL B CA  1 
ATOM   3978 C C   . VAL B 1 156 ? 5.981   46.079 5.035   1.00 53.45  ? 156 VAL B C   1 
ATOM   3979 O O   . VAL B 1 156 ? 6.340   45.394 5.990   1.00 53.84  ? 156 VAL B O   1 
ATOM   3980 C CB  . VAL B 1 156 ? 7.123   47.872 3.801   1.00 51.48  ? 156 VAL B CB  1 
ATOM   3981 C CG1 . VAL B 1 156 ? 8.244   46.858 3.696   1.00 49.32  ? 156 VAL B CG1 1 
ATOM   3982 C CG2 . VAL B 1 156 ? 6.290   47.979 2.544   1.00 50.87  ? 156 VAL B CG2 1 
ATOM   3983 N N   . SER B 1 157 ? 5.320   45.604 3.998   1.00 56.21  ? 157 SER B N   1 
ATOM   3984 C CA  . SER B 1 157 ? 4.946   44.215 3.891   1.00 58.36  ? 157 SER B CA  1 
ATOM   3985 C C   . SER B 1 157 ? 6.131   43.303 3.692   1.00 57.74  ? 157 SER B C   1 
ATOM   3986 O O   . SER B 1 157 ? 7.222   43.733 3.329   1.00 56.70  ? 157 SER B O   1 
ATOM   3987 C CB  . SER B 1 157 ? 3.997   44.056 2.700   1.00 58.05  ? 157 SER B CB  1 
ATOM   3988 O OG  . SER B 1 157 ? 3.638   45.326 2.176   1.00 60.88  ? 157 SER B OG  1 
ATOM   3989 N N   . LYS B 1 158 ? 5.898   42.025 3.937   1.00 60.84  ? 158 LYS B N   1 
ATOM   3990 C CA  . LYS B 1 158 ? 6.918   41.040 3.676   1.00 60.99  ? 158 LYS B CA  1 
ATOM   3991 C C   . LYS B 1 158 ? 6.894   41.034 2.151   1.00 59.40  ? 158 LYS B C   1 
ATOM   3992 O O   . LYS B 1 158 ? 6.151   41.791 1.503   1.00 60.04  ? 158 LYS B O   1 
ATOM   3993 C CB  . LYS B 1 158 ? 6.542   39.635 4.195   1.00 61.45  ? 158 LYS B CB  1 
ATOM   3994 C CG  . LYS B 1 158 ? 5.503   38.881 3.345   1.00 60.31  ? 158 LYS B CG  1 
ATOM   3995 C CD  . LYS B 1 158 ? 4.075   39.351 3.644   1.00 59.21  ? 158 LYS B CD  1 
ATOM   3996 C CE  . LYS B 1 158 ? 3.091   38.745 2.682   1.00 60.53  ? 158 LYS B CE  1 
ATOM   3997 N NZ  . LYS B 1 158 ? 3.258   37.268 2.597   1.00 59.43  ? 158 LYS B NZ  1 
ATOM   3998 N N   . TRP B 1 159 ? 7.677   40.144 1.586   1.00 58.13  ? 159 TRP B N   1 
ATOM   3999 C CA  . TRP B 1 159 ? 7.774   40.033 0.158   1.00 54.15  ? 159 TRP B CA  1 
ATOM   4000 C C   . TRP B 1 159 ? 7.240   38.644 -0.073  1.00 54.06  ? 159 TRP B C   1 
ATOM   4001 O O   . TRP B 1 159 ? 7.305   37.788 0.823   1.00 50.38  ? 159 TRP B O   1 
ATOM   4002 C CB  . TRP B 1 159 ? 9.255   40.201 -0.254  1.00 51.07  ? 159 TRP B CB  1 
ATOM   4003 C CG  . TRP B 1 159 ? 9.549   39.938 -1.681  1.00 40.27  ? 159 TRP B CG  1 
ATOM   4004 C CD1 . TRP B 1 159 ? 9.453   40.820 -2.711  1.00 34.63  ? 159 TRP B CD1 1 
ATOM   4005 C CD2 . TRP B 1 159 ? 9.964   38.697 -2.241  1.00 31.78  ? 159 TRP B CD2 1 
ATOM   4006 N NE1 . TRP B 1 159 ? 9.775   40.196 -3.891  1.00 35.22  ? 159 TRP B NE1 1 
ATOM   4007 C CE2 . TRP B 1 159 ? 10.091  38.888 -3.628  1.00 33.04  ? 159 TRP B CE2 1 
ATOM   4008 C CE3 . TRP B 1 159 ? 10.237  37.443 -1.703  1.00 34.62  ? 159 TRP B CE3 1 
ATOM   4009 C CZ2 . TRP B 1 159 ? 10.481  37.861 -4.493  1.00 35.02  ? 159 TRP B CZ2 1 
ATOM   4010 C CZ3 . TRP B 1 159 ? 10.627  36.411 -2.566  1.00 35.88  ? 159 TRP B CZ3 1 
ATOM   4011 C CH2 . TRP B 1 159 ? 10.743  36.633 -3.945  1.00 36.79  ? 159 TRP B CH2 1 
ATOM   4012 N N   . ASP B 1 160 ? 6.622   38.455 -1.228  1.00 57.15  ? 160 ASP B N   1 
ATOM   4013 C CA  . ASP B 1 160 ? 6.055   37.171 -1.549  1.00 60.84  ? 160 ASP B CA  1 
ATOM   4014 C C   . ASP B 1 160 ? 6.607   36.689 -2.846  1.00 60.65  ? 160 ASP B C   1 
ATOM   4015 O O   . ASP B 1 160 ? 6.414   37.325 -3.885  1.00 58.01  ? 160 ASP B O   1 
ATOM   4016 C CB  . ASP B 1 160 ? 4.532   37.236 -1.623  1.00 66.10  ? 160 ASP B CB  1 
ATOM   4017 C CG  . ASP B 1 160 ? 3.896   36.027 -1.001  1.00 73.71  ? 160 ASP B CG  1 
ATOM   4018 O OD1 . ASP B 1 160 ? 3.788   34.993 -1.690  1.00 77.96  ? 160 ASP B OD1 1 
ATOM   4019 O OD2 . ASP B 1 160 ? 3.573   36.085 0.205   1.00 78.44  ? 160 ASP B OD2 1 
ATOM   4020 N N   . ALA B 1 161 ? 7.287   35.550 -2.775  1.00 62.15  ? 161 ALA B N   1 
ATOM   4021 C CA  . ALA B 1 161 ? 7.893   34.957 -3.954  1.00 65.67  ? 161 ALA B CA  1 
ATOM   4022 C C   . ALA B 1 161 ? 6.791   34.612 -4.943  1.00 66.64  ? 161 ALA B C   1 
ATOM   4023 O O   . ALA B 1 161 ? 6.990   34.676 -6.162  1.00 69.35  ? 161 ALA B O   1 
ATOM   4024 C CB  . ALA B 1 161 ? 8.710   33.714 -3.568  1.00 64.53  ? 161 ALA B CB  1 
ATOM   4025 N N   . LYS B 1 162 ? 5.604   34.345 -4.399  1.00 64.51  ? 162 LYS B N   1 
ATOM   4026 C CA  . LYS B 1 162 ? 4.452   33.989 -5.205  1.00 62.85  ? 162 LYS B CA  1 
ATOM   4027 C C   . LYS B 1 162 ? 4.049   35.149 -6.114  1.00 62.52  ? 162 LYS B C   1 
ATOM   4028 O O   . LYS B 1 162 ? 4.060   35.012 -7.344  1.00 64.06  ? 162 LYS B O   1 
ATOM   4029 C CB  . LYS B 1 162 ? 3.295   33.575 -4.307  1.00 59.40  ? 162 LYS B CB  1 
ATOM   4030 C CG  . LYS B 1 162 ? 3.657   32.491 -3.308  1.00 63.22  ? 162 LYS B CG  1 
ATOM   4031 C CD  . LYS B 1 162 ? 4.026   31.173 -3.985  1.00 68.18  ? 162 LYS B CD  1 
ATOM   4032 C CE  . LYS B 1 162 ? 4.136   30.034 -2.955  1.00 70.07  ? 162 LYS B CE  1 
ATOM   4033 N NZ  . LYS B 1 162 ? 4.648   28.748 -3.546  1.00 72.87  ? 162 LYS B NZ  1 
ATOM   4034 N N   . LEU B 1 163 ? 3.744   36.302 -5.522  1.00 59.84  ? 163 LEU B N   1 
ATOM   4035 C CA  . LEU B 1 163 ? 3.334   37.462 -6.308  1.00 56.75  ? 163 LEU B CA  1 
ATOM   4036 C C   . LEU B 1 163 ? 4.448   37.913 -7.235  1.00 58.38  ? 163 LEU B C   1 
ATOM   4037 O O   . LEU B 1 163 ? 4.190   38.417 -8.336  1.00 58.94  ? 163 LEU B O   1 
ATOM   4038 C CB  . LEU B 1 163 ? 2.934   38.624 -5.400  1.00 51.97  ? 163 LEU B CB  1 
ATOM   4039 C CG  . LEU B 1 163 ? 2.107   39.786 -5.981  1.00 45.97  ? 163 LEU B CG  1 
ATOM   4040 C CD1 . LEU B 1 163 ? 2.871   41.072 -5.867  1.00 46.76  ? 163 LEU B CD1 1 
ATOM   4041 C CD2 . LEU B 1 163 ? 1.643   39.527 -7.405  1.00 40.71  ? 163 LEU B CD2 1 
ATOM   4042 N N   . ALA B 1 164 ? 5.684   37.699 -6.785  1.00 59.54  ? 164 ALA B N   1 
ATOM   4043 C CA  . ALA B 1 164 ? 6.872   38.095 -7.522  1.00 58.06  ? 164 ALA B CA  1 
ATOM   4044 C C   . ALA B 1 164 ? 7.156   37.233 -8.743  1.00 57.01  ? 164 ALA B C   1 
ATOM   4045 O O   . ALA B 1 164 ? 8.136   37.440 -9.438  1.00 59.08  ? 164 ALA B O   1 
ATOM   4046 C CB  . ALA B 1 164 ? 8.054   38.126 -6.601  1.00 58.44  ? 164 ALA B CB  1 
ATOM   4047 N N   . ALA B 1 165 ? 6.284   36.287 -9.033  1.00 57.00  ? 165 ALA B N   1 
ATOM   4048 C CA  . ALA B 1 165 ? 6.472   35.454 -10.199 1.00 57.43  ? 165 ALA B CA  1 
ATOM   4049 C C   . ALA B 1 165 ? 5.354   35.715 -11.197 1.00 59.49  ? 165 ALA B C   1 
ATOM   4050 O O   . ALA B 1 165 ? 5.465   35.366 -12.379 1.00 59.48  ? 165 ALA B O   1 
ATOM   4051 C CB  . ALA B 1 165 ? 6.470   33.996 -9.790  1.00 57.71  ? 165 ALA B CB  1 
ATOM   4052 N N   . LYS B 1 166 ? 4.305   36.397 -10.743 1.00 61.37  ? 166 LYS B N   1 
ATOM   4053 C CA  . LYS B 1 166 ? 3.157   36.621 -11.604 1.00 63.74  ? 166 LYS B CA  1 
ATOM   4054 C C   . LYS B 1 166 ? 2.914   37.959 -12.305 1.00 62.79  ? 166 LYS B C   1 
ATOM   4055 O O   . LYS B 1 166 ? 2.653   38.992 -11.682 1.00 58.52  ? 166 LYS B O   1 
ATOM   4056 C CB  . LYS B 1 166 ? 1.875   36.086 -10.945 1.00 66.81  ? 166 LYS B CB  1 
ATOM   4057 C CG  . LYS B 1 166 ? 1.764   34.551 -11.002 1.00 69.76  ? 166 LYS B CG  1 
ATOM   4058 C CD  . LYS B 1 166 ? 0.327   34.066 -10.795 1.00 70.07  ? 166 LYS B CD  1 
ATOM   4059 C CE  . LYS B 1 166 ? 0.214   32.534 -10.728 1.00 69.77  ? 166 LYS B CE  1 
ATOM   4060 N NZ  . LYS B 1 166 ? 0.381   31.796 -12.017 1.00 67.38  ? 166 LYS B NZ  1 
ATOM   4061 N N   . LEU B 1 167 ? 2.898   37.836 -13.634 1.00 61.76  ? 167 LEU B N   1 
ATOM   4062 C CA  . LEU B 1 167 ? 2.700   38.884 -14.621 1.00 57.95  ? 167 LEU B CA  1 
ATOM   4063 C C   . LEU B 1 167 ? 2.366   40.289 -14.263 1.00 58.18  ? 167 LEU B C   1 
ATOM   4064 O O   . LEU B 1 167 ? 1.718   40.579 -13.258 1.00 56.50  ? 167 LEU B O   1 
ATOM   4065 C CB  . LEU B 1 167 ? 1.711   38.455 -15.682 1.00 57.79  ? 167 LEU B CB  1 
ATOM   4066 C CG  . LEU B 1 167 ? 2.323   37.683 -16.831 1.00 63.36  ? 167 LEU B CG  1 
ATOM   4067 C CD1 . LEU B 1 167 ? 2.435   36.183 -16.487 1.00 65.13  ? 167 LEU B CD1 1 
ATOM   4068 C CD2 . LEU B 1 167 ? 1.448   37.908 -18.052 1.00 67.65  ? 167 LEU B CD2 1 
ATOM   4069 N N   . ASP B 1 168 ? 2.739   41.152 -15.200 1.00 59.27  ? 168 ASP B N   1 
ATOM   4070 C CA  . ASP B 1 168 ? 2.494   42.573 -15.100 1.00 61.65  ? 168 ASP B CA  1 
ATOM   4071 C C   . ASP B 1 168 ? 0.978   42.749 -15.141 1.00 63.29  ? 168 ASP B C   1 
ATOM   4072 O O   . ASP B 1 168 ? 0.441   43.710 -14.597 1.00 61.73  ? 168 ASP B O   1 
ATOM   4073 C CB  . ASP B 1 168 ? 3.152   43.264 -16.293 1.00 60.23  ? 168 ASP B CB  1 
ATOM   4074 C CG  . ASP B 1 168 ? 3.550   44.692 -15.998 1.00 59.74  ? 168 ASP B CG  1 
ATOM   4075 O OD1 . ASP B 1 168 ? 3.687   45.058 -14.807 1.00 55.19  ? 168 ASP B OD1 1 
ATOM   4076 O OD2 . ASP B 1 168 ? 3.742   45.446 -16.973 1.00 61.31  ? 168 ASP B OD2 1 
ATOM   4077 N N   . CYS B 1 169 ? 0.314   41.783 -15.788 1.00 69.10  ? 169 CYS B N   1 
ATOM   4078 C CA  . CYS B 1 169 ? -1.151  41.719 -15.951 1.00 72.05  ? 169 CYS B CA  1 
ATOM   4079 C C   . CYS B 1 169 ? -1.824  41.720 -14.593 1.00 73.01  ? 169 CYS B C   1 
ATOM   4080 O O   . CYS B 1 169 ? -2.996  42.097 -14.465 1.00 76.12  ? 169 CYS B O   1 
ATOM   4081 C CB  . CYS B 1 169 ? -1.553  40.419 -16.640 1.00 71.30  ? 169 CYS B CB  1 
ATOM   4082 S SG  . CYS B 1 169 ? -1.298  38.989 -15.565 1.00 74.99  ? 169 CYS B SG  1 
ATOM   4083 N N   . GLU B 1 170 ? -1.115  41.159 -13.621 1.00 69.17  ? 170 GLU B N   1 
ATOM   4084 C CA  . GLU B 1 170 ? -1.588  41.091 -12.258 1.00 68.85  ? 170 GLU B CA  1 
ATOM   4085 C C   . GLU B 1 170 ? -0.782  42.132 -11.486 1.00 71.52  ? 170 GLU B C   1 
ATOM   4086 O O   . GLU B 1 170 ? -0.281  43.104 -12.068 1.00 72.54  ? 170 GLU B O   1 
ATOM   4087 C CB  . GLU B 1 170 ? -1.341  39.684 -11.716 1.00 66.50  ? 170 GLU B CB  1 
ATOM   4088 C CG  . GLU B 1 170 ? -1.885  38.618 -12.650 1.00 67.85  ? 170 GLU B CG  1 
ATOM   4089 C CD  . GLU B 1 170 ? -1.265  37.252 -12.449 1.00 68.51  ? 170 GLU B CD  1 
ATOM   4090 O OE1 . GLU B 1 170 ? -1.323  36.729 -11.318 1.00 71.14  ? 170 GLU B OE1 1 
ATOM   4091 O OE2 . GLU B 1 170 ? -0.734  36.692 -13.432 1.00 65.99  ? 170 GLU B OE2 1 
ATOM   4092 N N   . GLY B 1 171 ? -0.713  41.965 -10.170 1.00 74.07  ? 171 GLY B N   1 
ATOM   4093 C CA  . GLY B 1 171 ? 0.055   42.880 -9.343  1.00 74.79  ? 171 GLY B CA  1 
ATOM   4094 C C   . GLY B 1 171 ? 1.429   42.296 -9.042  1.00 73.53  ? 171 GLY B C   1 
ATOM   4095 O O   . GLY B 1 171 ? 2.007   42.554 -7.986  1.00 69.24  ? 171 GLY B O   1 
ATOM   4096 N N   . GLY B 1 172 ? 1.942   41.500 -9.974  1.00 74.33  ? 172 GLY B N   1 
ATOM   4097 C CA  . GLY B 1 172 ? 3.234   40.887 -9.782  1.00 73.87  ? 172 GLY B CA  1 
ATOM   4098 C C   . GLY B 1 172 ? 4.395   41.478 -10.563 1.00 74.83  ? 172 GLY B C   1 
ATOM   4099 O O   . GLY B 1 172 ? 4.272   42.385 -11.420 1.00 72.78  ? 172 GLY B O   1 
ATOM   4100 N N   . ASP B 1 173 ? 5.557   40.954 -10.199 1.00 72.90  ? 173 ASP B N   1 
ATOM   4101 C CA  . ASP B 1 173 ? 6.838   41.309 -10.780 1.00 68.72  ? 173 ASP B CA  1 
ATOM   4102 C C   . ASP B 1 173 ? 7.149   39.978 -11.433 1.00 68.07  ? 173 ASP B C   1 
ATOM   4103 O O   . ASP B 1 173 ? 6.875   38.931 -10.851 1.00 67.11  ? 173 ASP B O   1 
ATOM   4104 C CB  . ASP B 1 173 ? 7.804   41.628 -9.645  1.00 67.56  ? 173 ASP B CB  1 
ATOM   4105 C CG  . ASP B 1 173 ? 7.109   42.337 -8.472  1.00 65.28  ? 173 ASP B CG  1 
ATOM   4106 O OD1 . ASP B 1 173 ? 6.715   43.507 -8.620  1.00 59.34  ? 173 ASP B OD1 1 
ATOM   4107 O OD2 . ASP B 1 173 ? 6.923   41.708 -7.411  1.00 66.22  ? 173 ASP B OD2 1 
ATOM   4108 N N   . GLU B 1 174 ? 7.630   39.986 -12.664 1.00 67.26  ? 174 GLU B N   1 
ATOM   4109 C CA  . GLU B 1 174 ? 7.876   38.710 -13.330 1.00 65.79  ? 174 GLU B CA  1 
ATOM   4110 C C   . GLU B 1 174 ? 9.235   38.048 -13.075 1.00 63.00  ? 174 GLU B C   1 
ATOM   4111 O O   . GLU B 1 174 ? 9.923   37.626 -14.018 1.00 64.48  ? 174 GLU B O   1 
ATOM   4112 C CB  . GLU B 1 174 ? 7.580   38.841 -14.822 1.00 67.28  ? 174 GLU B CB  1 
ATOM   4113 C CG  . GLU B 1 174 ? 6.130   39.176 -15.092 1.00 72.92  ? 174 GLU B CG  1 
ATOM   4114 C CD  . GLU B 1 174 ? 5.889   39.733 -16.482 1.00 77.71  ? 174 GLU B CD  1 
ATOM   4115 O OE1 . GLU B 1 174 ? 6.302   39.076 -17.470 1.00 80.53  ? 174 GLU B OE1 1 
ATOM   4116 O OE2 . GLU B 1 174 ? 5.277   40.825 -16.579 1.00 78.26  ? 174 GLU B OE2 1 
ATOM   4117 N N   . VAL B 1 175 ? 9.608   37.930 -11.802 1.00 55.60  ? 175 VAL B N   1 
ATOM   4118 C CA  . VAL B 1 175 ? 10.873  37.307 -11.466 1.00 50.27  ? 175 VAL B CA  1 
ATOM   4119 C C   . VAL B 1 175 ? 10.831  35.838 -11.881 1.00 52.78  ? 175 VAL B C   1 
ATOM   4120 O O   . VAL B 1 175 ? 10.029  35.055 -11.376 1.00 52.49  ? 175 VAL B O   1 
ATOM   4121 C CB  . VAL B 1 175 ? 11.185  37.416 -9.992  1.00 46.62  ? 175 VAL B CB  1 
ATOM   4122 C CG1 . VAL B 1 175 ? 12.434  36.611 -9.678  1.00 43.96  ? 175 VAL B CG1 1 
ATOM   4123 C CG2 . VAL B 1 175 ? 11.364  38.869 -9.616  1.00 40.45  ? 175 VAL B CG2 1 
ATOM   4124 N N   . PRO B 1 176 ? 11.701  35.450 -12.821 1.00 52.87  ? 176 PRO B N   1 
ATOM   4125 C CA  . PRO B 1 176 ? 11.727  34.067 -13.287 1.00 52.87  ? 176 PRO B CA  1 
ATOM   4126 C C   . PRO B 1 176 ? 11.655  33.040 -12.159 1.00 53.17  ? 176 PRO B C   1 
ATOM   4127 O O   . PRO B 1 176 ? 12.192  33.262 -11.074 1.00 55.40  ? 176 PRO B O   1 
ATOM   4128 C CB  . PRO B 1 176 ? 13.027  34.012 -14.088 1.00 53.17  ? 176 PRO B CB  1 
ATOM   4129 C CG  . PRO B 1 176 ? 13.098  35.384 -14.671 1.00 49.55  ? 176 PRO B CG  1 
ATOM   4130 C CD  . PRO B 1 176 ? 12.731  36.256 -13.503 1.00 49.63  ? 176 PRO B CD  1 
ATOM   4131 N N   . GLN B 1 177 ? 10.996  31.916 -12.438 1.00 50.66  ? 177 GLN B N   1 
ATOM   4132 C CA  . GLN B 1 177 ? 10.804  30.856 -11.459 1.00 47.62  ? 177 GLN B CA  1 
ATOM   4133 C C   . GLN B 1 177 ? 12.097  30.185 -11.035 1.00 45.87  ? 177 GLN B C   1 
ATOM   4134 O O   . GLN B 1 177 ? 12.317  29.955 -9.844  1.00 41.54  ? 177 GLN B O   1 
ATOM   4135 C CB  . GLN B 1 177 ? 9.822   29.803 -11.985 1.00 47.12  ? 177 GLN B CB  1 
ATOM   4136 C CG  . GLN B 1 177 ? 9.148   28.996 -10.867 1.00 49.36  ? 177 GLN B CG  1 
ATOM   4137 C CD  . GLN B 1 177 ? 8.139   29.830 -10.063 1.00 52.97  ? 177 GLN B CD  1 
ATOM   4138 O OE1 . GLN B 1 177 ? 7.091   30.225 -10.604 1.00 54.10  ? 177 GLN B OE1 1 
ATOM   4139 N NE2 . GLN B 1 177 ? 8.452   30.111 -8.772  1.00 46.53  ? 177 GLN B NE2 1 
ATOM   4140 N N   . GLU B 1 178 ? 12.941  29.864 -12.012 1.00 48.82  ? 178 GLU B N   1 
ATOM   4141 C CA  . GLU B 1 178 ? 14.223  29.212 -11.746 1.00 52.64  ? 178 GLU B CA  1 
ATOM   4142 C C   . GLU B 1 178 ? 14.985  30.037 -10.705 1.00 50.03  ? 178 GLU B C   1 
ATOM   4143 O O   . GLU B 1 178 ? 15.560  29.503 -9.774  1.00 49.76  ? 178 GLU B O   1 
ATOM   4144 C CB  . GLU B 1 178 ? 15.051  29.100 -13.033 1.00 59.56  ? 178 GLU B CB  1 
ATOM   4145 C CG  . GLU B 1 178 ? 14.300  28.550 -14.267 1.00 68.58  ? 178 GLU B CG  1 
ATOM   4146 C CD  . GLU B 1 178 ? 13.831  27.095 -14.145 1.00 75.39  ? 178 GLU B CD  1 
ATOM   4147 O OE1 . GLU B 1 178 ? 14.125  26.431 -13.125 1.00 78.64  ? 178 GLU B OE1 1 
ATOM   4148 O OE2 . GLU B 1 178 ? 13.149  26.613 -15.085 1.00 78.77  ? 178 GLU B OE2 1 
ATOM   4149 N N   . ILE B 1 179 ? 14.934  31.351 -10.846 1.00 45.74  ? 179 ILE B N   1 
ATOM   4150 C CA  . ILE B 1 179 ? 15.587  32.242 -9.910  1.00 46.09  ? 179 ILE B CA  1 
ATOM   4151 C C   . ILE B 1 179 ? 14.863  32.191 -8.538  1.00 49.38  ? 179 ILE B C   1 
ATOM   4152 O O   . ILE B 1 179 ? 15.493  32.228 -7.452  1.00 45.52  ? 179 ILE B O   1 
ATOM   4153 C CB  . ILE B 1 179 ? 15.570  33.685 -10.471 1.00 44.65  ? 179 ILE B CB  1 
ATOM   4154 C CG1 . ILE B 1 179 ? 16.151  33.717 -11.888 1.00 45.92  ? 179 ILE B CG1 1 
ATOM   4155 C CG2 . ILE B 1 179 ? 16.405  34.572 -9.629  1.00 45.36  ? 179 ILE B CG2 1 
ATOM   4156 C CD1 . ILE B 1 179 ? 16.038  35.083 -12.589 1.00 42.21  ? 179 ILE B CD1 1 
ATOM   4157 N N   . LEU B 1 180 ? 13.536  32.052 -8.597  1.00 53.63  ? 180 LEU B N   1 
ATOM   4158 C CA  . LEU B 1 180 ? 12.684  32.002 -7.399  1.00 55.34  ? 180 LEU B CA  1 
ATOM   4159 C C   . LEU B 1 180 ? 12.789  30.719 -6.574  1.00 53.36  ? 180 LEU B C   1 
ATOM   4160 O O   . LEU B 1 180 ? 12.625  30.728 -5.347  1.00 54.37  ? 180 LEU B O   1 
ATOM   4161 C CB  . LEU B 1 180 ? 11.225  32.283 -7.767  1.00 55.49  ? 180 LEU B CB  1 
ATOM   4162 C CG  . LEU B 1 180 ? 10.952  33.771 -7.969  1.00 55.42  ? 180 LEU B CG  1 
ATOM   4163 C CD1 . LEU B 1 180 ? 9.513   33.967 -8.414  1.00 56.33  ? 180 LEU B CD1 1 
ATOM   4164 C CD2 . LEU B 1 180 ? 11.247  34.529 -6.673  1.00 52.06  ? 180 LEU B CD2 1 
ATOM   4165 N N   . ASP B 1 181 ? 13.091  29.617 -7.230  1.00 51.34  ? 181 ASP B N   1 
ATOM   4166 C CA  . ASP B 1 181 ? 13.231  28.384 -6.496  1.00 51.01  ? 181 ASP B CA  1 
ATOM   4167 C C   . ASP B 1 181 ? 14.532  28.389 -5.712  1.00 48.36  ? 181 ASP B C   1 
ATOM   4168 O O   . ASP B 1 181 ? 14.803  27.429 -4.994  1.00 47.14  ? 181 ASP B O   1 
ATOM   4169 C CB  . ASP B 1 181 ? 13.201  27.202 -7.455  1.00 56.92  ? 181 ASP B CB  1 
ATOM   4170 C CG  . ASP B 1 181 ? 11.941  27.176 -8.294  1.00 63.23  ? 181 ASP B CG  1 
ATOM   4171 O OD1 . ASP B 1 181 ? 10.853  27.461 -7.728  1.00 64.19  ? 181 ASP B OD1 1 
ATOM   4172 O OD2 . ASP B 1 181 ? 12.045  26.894 -9.516  1.00 66.38  ? 181 ASP B OD2 1 
ATOM   4173 N N   . ARG B 1 182 ? 15.294  29.487 -5.807  1.00 46.19  ? 182 ARG B N   1 
ATOM   4174 C CA  . ARG B 1 182 ? 16.594  29.625 -5.131  1.00 46.98  ? 182 ARG B CA  1 
ATOM   4175 C C   . ARG B 1 182 ? 16.714  30.700 -4.051  1.00 49.65  ? 182 ARG B C   1 
ATOM   4176 O O   . ARG B 1 182 ? 17.715  30.770 -3.321  1.00 46.81  ? 182 ARG B O   1 
ATOM   4177 C CB  . ARG B 1 182 ? 17.700  29.854 -6.162  1.00 39.87  ? 182 ARG B CB  1 
ATOM   4178 C CG  . ARG B 1 182 ? 18.314  28.601 -6.698  1.00 32.93  ? 182 ARG B CG  1 
ATOM   4179 C CD  . ARG B 1 182 ? 18.454  28.652 -8.198  1.00 35.57  ? 182 ARG B CD  1 
ATOM   4180 N NE  . ARG B 1 182 ? 18.744  29.984 -8.725  1.00 42.85  ? 182 ARG B NE  1 
ATOM   4181 C CZ  . ARG B 1 182 ? 19.133  30.221 -9.979  1.00 47.12  ? 182 ARG B CZ  1 
ATOM   4182 N NH1 . ARG B 1 182 ? 19.292  29.208 -10.820 1.00 53.66  ? 182 ARG B NH1 1 
ATOM   4183 N NH2 . ARG B 1 182 ? 19.371  31.460 -10.399 1.00 41.41  ? 182 ARG B NH2 1 
ATOM   4184 N N   . VAL B 1 183 ? 15.670  31.495 -3.905  1.00 52.75  ? 183 VAL B N   1 
ATOM   4185 C CA  . VAL B 1 183 ? 15.669  32.594 -2.947  1.00 53.02  ? 183 VAL B CA  1 
ATOM   4186 C C   . VAL B 1 183 ? 15.399  32.307 -1.451  1.00 54.08  ? 183 VAL B C   1 
ATOM   4187 O O   . VAL B 1 183 ? 14.268  32.033 -1.053  1.00 60.13  ? 183 VAL B O   1 
ATOM   4188 C CB  . VAL B 1 183 ? 14.709  33.685 -3.482  1.00 52.25  ? 183 VAL B CB  1 
ATOM   4189 C CG1 . VAL B 1 183 ? 14.531  34.827 -2.480  1.00 53.39  ? 183 VAL B CG1 1 
ATOM   4190 C CG2 . VAL B 1 183 ? 15.220  34.180 -4.846  1.00 45.88  ? 183 VAL B CG2 1 
ATOM   4191 N N   . ILE B 1 184 ? 16.437  32.306 -0.627  1.00 49.94  ? 184 ILE B N   1 
ATOM   4192 C CA  . ILE B 1 184 ? 16.227  32.126 0.811   1.00 50.83  ? 184 ILE B CA  1 
ATOM   4193 C C   . ILE B 1 184 ? 15.786  33.525 1.278   1.00 52.02  ? 184 ILE B C   1 
ATOM   4194 O O   . ILE B 1 184 ? 16.556  34.481 1.186   1.00 53.15  ? 184 ILE B O   1 
ATOM   4195 C CB  . ILE B 1 184 ? 17.533  31.743 1.590   1.00 49.23  ? 184 ILE B CB  1 
ATOM   4196 C CG1 . ILE B 1 184 ? 18.140  30.451 1.053   1.00 47.12  ? 184 ILE B CG1 1 
ATOM   4197 C CG2 . ILE B 1 184 ? 17.260  31.641 3.074   1.00 43.25  ? 184 ILE B CG2 1 
ATOM   4198 C CD1 . ILE B 1 184 ? 17.150  29.362 0.830   1.00 48.82  ? 184 ILE B CD1 1 
ATOM   4199 N N   . TYR B 1 185 ? 14.558  33.650 1.774   1.00 50.09  ? 185 TYR B N   1 
ATOM   4200 C CA  . TYR B 1 185 ? 14.056  34.949 2.205   1.00 45.94  ? 185 TYR B CA  1 
ATOM   4201 C C   . TYR B 1 185 ? 14.167  35.171 3.715   1.00 44.87  ? 185 TYR B C   1 
ATOM   4202 O O   . TYR B 1 185 ? 13.624  34.419 4.501   1.00 45.08  ? 185 TYR B O   1 
ATOM   4203 C CB  . TYR B 1 185 ? 12.623  35.153 1.684   1.00 43.19  ? 185 TYR B CB  1 
ATOM   4204 C CG  . TYR B 1 185 ? 11.995  36.470 2.071   1.00 40.07  ? 185 TYR B CG  1 
ATOM   4205 C CD1 . TYR B 1 185 ? 12.347  37.641 1.429   1.00 39.22  ? 185 TYR B CD1 1 
ATOM   4206 C CD2 . TYR B 1 185 ? 11.025  36.537 3.060   1.00 41.30  ? 185 TYR B CD2 1 
ATOM   4207 C CE1 . TYR B 1 185 ? 11.750  38.857 1.755   1.00 41.91  ? 185 TYR B CE1 1 
ATOM   4208 C CE2 . TYR B 1 185 ? 10.417  37.742 3.393   1.00 41.28  ? 185 TYR B CE2 1 
ATOM   4209 C CZ  . TYR B 1 185 ? 10.779  38.897 2.736   1.00 43.98  ? 185 TYR B CZ  1 
ATOM   4210 O OH  . TYR B 1 185 ? 10.151  40.090 3.043   1.00 44.44  ? 185 TYR B OH  1 
ATOM   4211 N N   . MET B 1 186 ? 14.890  36.207 4.115   1.00 45.37  ? 186 MET B N   1 
ATOM   4212 C CA  . MET B 1 186 ? 15.071  36.506 5.521   1.00 50.76  ? 186 MET B CA  1 
ATOM   4213 C C   . MET B 1 186 ? 14.554  37.917 5.798   1.00 57.38  ? 186 MET B C   1 
ATOM   4214 O O   . MET B 1 186 ? 15.150  38.908 5.367   1.00 59.23  ? 186 MET B O   1 
ATOM   4215 C CB  . MET B 1 186 ? 16.546  36.366 5.910   1.00 53.08  ? 186 MET B CB  1 
ATOM   4216 C CG  . MET B 1 186 ? 17.080  34.917 5.793   1.00 57.61  ? 186 MET B CG  1 
ATOM   4217 S SD  . MET B 1 186 ? 18.909  34.709 5.625   1.00 54.68  ? 186 MET B SD  1 
ATOM   4218 C CE  . MET B 1 186 ? 19.041  34.578 3.826   1.00 47.20  ? 186 MET B CE  1 
ATOM   4219 N N   . PRO B 1 187 ? 13.369  38.019 6.437   1.00 60.56  ? 187 PRO B N   1 
ATOM   4220 C CA  . PRO B 1 187 ? 12.747  39.305 6.773   1.00 58.15  ? 187 PRO B CA  1 
ATOM   4221 C C   . PRO B 1 187 ? 13.271  39.788 8.121   1.00 59.59  ? 187 PRO B C   1 
ATOM   4222 O O   . PRO B 1 187 ? 13.396  38.999 9.065   1.00 59.45  ? 187 PRO B O   1 
ATOM   4223 C CB  . PRO B 1 187 ? 11.278  38.937 6.856   1.00 58.13  ? 187 PRO B CB  1 
ATOM   4224 C CG  . PRO B 1 187 ? 11.345  37.586 7.521   1.00 61.32  ? 187 PRO B CG  1 
ATOM   4225 C CD  . PRO B 1 187 ? 12.474  36.895 6.788   1.00 58.98  ? 187 PRO B CD  1 
ATOM   4226 N N   . PHE B 1 188 ? 13.588  41.075 8.212   1.00 61.00  ? 188 PHE B N   1 
ATOM   4227 C CA  . PHE B 1 188 ? 14.118  41.644 9.444   1.00 64.41  ? 188 PHE B CA  1 
ATOM   4228 C C   . PHE B 1 188 ? 13.270  42.843 9.790   1.00 66.07  ? 188 PHE B C   1 
ATOM   4229 O O   . PHE B 1 188 ? 12.743  43.486 8.893   1.00 66.40  ? 188 PHE B O   1 
ATOM   4230 C CB  . PHE B 1 188 ? 15.602  42.044 9.261   1.00 63.23  ? 188 PHE B CB  1 
ATOM   4231 C CG  . PHE B 1 188 ? 16.530  40.862 9.133   1.00 57.11  ? 188 PHE B CG  1 
ATOM   4232 C CD1 . PHE B 1 188 ? 16.644  40.174 7.928   1.00 55.81  ? 188 PHE B CD1 1 
ATOM   4233 C CD2 . PHE B 1 188 ? 17.205  40.373 10.246  1.00 57.02  ? 188 PHE B CD2 1 
ATOM   4234 C CE1 . PHE B 1 188 ? 17.402  39.009 7.835   1.00 52.78  ? 188 PHE B CE1 1 
ATOM   4235 C CE2 . PHE B 1 188 ? 17.971  39.209 10.169  1.00 57.34  ? 188 PHE B CE2 1 
ATOM   4236 C CZ  . PHE B 1 188 ? 18.067  38.524 8.961   1.00 56.56  ? 188 PHE B CZ  1 
ATOM   4237 N N   . ASP B 1 189 ? 13.112  43.122 11.082  1.00 70.29  ? 189 ASP B N   1 
ATOM   4238 C CA  . ASP B 1 189 ? 12.301  44.259 11.523  1.00 74.01  ? 189 ASP B CA  1 
ATOM   4239 C C   . ASP B 1 189 ? 13.146  45.431 12.013  1.00 74.46  ? 189 ASP B C   1 
ATOM   4240 O O   . ASP B 1 189 ? 12.631  46.471 12.441  1.00 70.89  ? 189 ASP B O   1 
ATOM   4241 C CB  . ASP B 1 189 ? 11.272  43.814 12.567  1.00 79.14  ? 189 ASP B CB  1 
ATOM   4242 C CG  . ASP B 1 189 ? 10.071  43.076 11.935  1.00 84.11  ? 189 ASP B CG  1 
ATOM   4243 O OD1 . ASP B 1 189 ? 10.201  41.868 11.612  1.00 83.55  ? 189 ASP B OD1 1 
ATOM   4244 O OD2 . ASP B 1 189 ? 8.999   43.713 11.759  1.00 84.34  ? 189 ASP B OD2 1 
ATOM   4245 N N   . ASN B 1 190 ? 14.463  45.250 11.937  1.00 77.36  ? 190 ASN B N   1 
ATOM   4246 C CA  . ASN B 1 190 ? 15.413  46.286 12.323  1.00 75.89  ? 190 ASN B CA  1 
ATOM   4247 C C   . ASN B 1 190 ? 16.751  46.084 11.605  1.00 73.49  ? 190 ASN B C   1 
ATOM   4248 O O   . ASN B 1 190 ? 17.148  44.952 11.298  1.00 71.80  ? 190 ASN B O   1 
ATOM   4249 C CB  . ASN B 1 190 ? 15.586  46.361 13.853  1.00 75.43  ? 190 ASN B CB  1 
ATOM   4250 C CG  . ASN B 1 190 ? 16.302  45.157 14.433  1.00 70.89  ? 190 ASN B CG  1 
ATOM   4251 O OD1 . ASN B 1 190 ? 17.270  44.688 13.882  1.00 71.24  ? 190 ASN B OD1 1 
ATOM   4252 N ND2 . ASN B 1 190 ? 15.852  44.695 15.582  1.00 72.21  ? 190 ASN B ND2 1 
ATOM   4253 N N   . GLU B 1 191 ? 17.404  47.203 11.310  1.00 71.62  ? 191 GLU B N   1 
ATOM   4254 C CA  . GLU B 1 191 ? 18.684  47.229 10.620  1.00 69.93  ? 191 GLU B CA  1 
ATOM   4255 C C   . GLU B 1 191 ? 19.726  46.320 11.253  1.00 70.01  ? 191 GLU B C   1 
ATOM   4256 O O   . GLU B 1 191 ? 20.288  45.449 10.581  1.00 69.73  ? 191 GLU B O   1 
ATOM   4257 C CB  . GLU B 1 191 ? 19.195  48.666 10.581  1.00 67.57  ? 191 GLU B CB  1 
ATOM   4258 C CG  . GLU B 1 191 ? 20.594  48.814 10.065  1.00 64.61  ? 191 GLU B CG  1 
ATOM   4259 C CD  . GLU B 1 191 ? 20.691  49.851 8.974   1.00 62.15  ? 191 GLU B CD  1 
ATOM   4260 O OE1 . GLU B 1 191 ? 20.478  49.471 7.810   1.00 56.30  ? 191 GLU B OE1 1 
ATOM   4261 O OE2 . GLU B 1 191 ? 20.981  51.033 9.281   1.00 64.12  ? 191 GLU B OE2 1 
ATOM   4262 N N   . ARG B 1 192 ? 19.947  46.512 12.551  1.00 70.80  ? 192 ARG B N   1 
ATOM   4263 C CA  . ARG B 1 192 ? 20.922  45.744 13.310  1.00 71.76  ? 192 ARG B CA  1 
ATOM   4264 C C   . ARG B 1 192 ? 20.744  44.242 13.170  1.00 69.60  ? 192 ARG B C   1 
ATOM   4265 O O   . ARG B 1 192 ? 21.689  43.536 12.832  1.00 70.30  ? 192 ARG B O   1 
ATOM   4266 C CB  . ARG B 1 192 ? 20.924  46.174 14.773  1.00 77.32  ? 192 ARG B CB  1 
ATOM   4267 C CG  . ARG B 1 192 ? 21.214  47.678 14.946  1.00 88.03  ? 192 ARG B CG  1 
ATOM   4268 C CD  . ARG B 1 192 ? 22.035  47.991 16.208  1.00 94.16  ? 192 ARG B CD  1 
ATOM   4269 N NE  . ARG B 1 192 ? 21.432  47.414 17.405  1.00 102.17 ? 192 ARG B NE  1 
ATOM   4270 C CZ  . ARG B 1 192 ? 22.095  46.732 18.338  1.00 104.16 ? 192 ARG B CZ  1 
ATOM   4271 N NH1 . ARG B 1 192 ? 23.409  46.558 18.243  1.00 103.21 ? 192 ARG B NH1 1 
ATOM   4272 N NH2 . ARG B 1 192 ? 21.436  46.239 19.384  1.00 106.65 ? 192 ARG B NH2 1 
ATOM   4273 N N   . ASP B 1 193 ? 19.540  43.753 13.419  1.00 67.44  ? 193 ASP B N   1 
ATOM   4274 C CA  . ASP B 1 193 ? 19.259  42.325 13.275  1.00 66.55  ? 193 ASP B CA  1 
ATOM   4275 C C   . ASP B 1 193 ? 19.671  41.820 11.889  1.00 62.27  ? 193 ASP B C   1 
ATOM   4276 O O   . ASP B 1 193 ? 20.209  40.720 11.753  1.00 62.26  ? 193 ASP B O   1 
ATOM   4277 C CB  . ASP B 1 193 ? 17.765  42.022 13.499  1.00 70.73  ? 193 ASP B CB  1 
ATOM   4278 C CG  . ASP B 1 193 ? 17.386  41.911 14.983  1.00 72.87  ? 193 ASP B CG  1 
ATOM   4279 O OD1 . ASP B 1 193 ? 17.885  42.707 15.816  1.00 73.45  ? 193 ASP B OD1 1 
ATOM   4280 O OD2 . ASP B 1 193 ? 16.569  41.018 15.304  1.00 72.28  ? 193 ASP B OD2 1 
ATOM   4281 N N   . MET B 1 194 ? 19.437  42.617 10.856  1.00 58.57  ? 194 MET B N   1 
ATOM   4282 C CA  . MET B 1 194 ? 19.806  42.180 9.518   1.00 56.54  ? 194 MET B CA  1 
ATOM   4283 C C   . MET B 1 194 ? 21.304  42.322 9.230   1.00 57.36  ? 194 MET B C   1 
ATOM   4284 O O   . MET B 1 194 ? 21.886  41.514 8.487   1.00 57.16  ? 194 MET B O   1 
ATOM   4285 C CB  . MET B 1 194 ? 18.993  42.935 8.482   1.00 54.81  ? 194 MET B CB  1 
ATOM   4286 C CG  . MET B 1 194 ? 19.094  42.370 7.090   1.00 43.33  ? 194 MET B CG  1 
ATOM   4287 S SD  . MET B 1 194 ? 18.389  43.521 5.924   1.00 47.55  ? 194 MET B SD  1 
ATOM   4288 C CE  . MET B 1 194 ? 18.652  45.150 6.753   1.00 25.43  ? 194 MET B CE  1 
ATOM   4289 N N   . LEU B 1 195 ? 21.916  43.362 9.794   1.00 55.01  ? 195 LEU B N   1 
ATOM   4290 C CA  . LEU B 1 195 ? 23.340  43.601 9.610   1.00 53.56  ? 195 LEU B CA  1 
ATOM   4291 C C   . LEU B 1 195 ? 24.172  42.550 10.354  1.00 53.83  ? 195 LEU B C   1 
ATOM   4292 O O   . LEU B 1 195 ? 25.143  42.021 9.814   1.00 54.34  ? 195 LEU B O   1 
ATOM   4293 C CB  . LEU B 1 195 ? 23.713  45.006 10.086  1.00 51.16  ? 195 LEU B CB  1 
ATOM   4294 C CG  . LEU B 1 195 ? 23.213  46.233 9.327   1.00 49.86  ? 195 LEU B CG  1 
ATOM   4295 C CD1 . LEU B 1 195 ? 23.709  47.476 10.062  1.00 49.93  ? 195 LEU B CD1 1 
ATOM   4296 C CD2 . LEU B 1 195 ? 23.710  46.244 7.888   1.00 51.44  ? 195 LEU B CD2 1 
ATOM   4297 N N   . MET B 1 196 ? 23.797  42.250 11.589  1.00 53.73  ? 196 MET B N   1 
ATOM   4298 C CA  . MET B 1 196 ? 24.507  41.251 12.366  1.00 58.71  ? 196 MET B CA  1 
ATOM   4299 C C   . MET B 1 196 ? 24.470  39.933 11.604  1.00 57.79  ? 196 MET B C   1 
ATOM   4300 O O   . MET B 1 196 ? 25.485  39.241 11.452  1.00 56.55  ? 196 MET B O   1 
ATOM   4301 C CB  . MET B 1 196 ? 23.837  41.075 13.736  1.00 65.12  ? 196 MET B CB  1 
ATOM   4302 C CG  . MET B 1 196 ? 24.289  42.060 14.822  1.00 72.44  ? 196 MET B CG  1 
ATOM   4303 S SD  . MET B 1 196 ? 25.919  41.615 15.511  1.00 80.35  ? 196 MET B SD  1 
ATOM   4304 C CE  . MET B 1 196 ? 25.660  39.784 15.740  1.00 78.66  ? 196 MET B CE  1 
ATOM   4305 N N   . GLU B 1 197 ? 23.288  39.619 11.085  1.00 58.97  ? 197 GLU B N   1 
ATOM   4306 C CA  . GLU B 1 197 ? 23.087  38.389 10.337  1.00 60.48  ? 197 GLU B CA  1 
ATOM   4307 C C   . GLU B 1 197 ? 23.856  38.412 9.017   1.00 59.05  ? 197 GLU B C   1 
ATOM   4308 O O   . GLU B 1 197 ? 24.303  37.364 8.542   1.00 59.10  ? 197 GLU B O   1 
ATOM   4309 C CB  . GLU B 1 197 ? 21.592  38.128 10.091  1.00 62.34  ? 197 GLU B CB  1 
ATOM   4310 C CG  . GLU B 1 197 ? 21.253  36.638 10.032  1.00 64.64  ? 197 GLU B CG  1 
ATOM   4311 C CD  . GLU B 1 197 ? 21.714  35.907 11.291  1.00 69.12  ? 197 GLU B CD  1 
ATOM   4312 O OE1 . GLU B 1 197 ? 21.514  36.453 12.403  1.00 72.13  ? 197 GLU B OE1 1 
ATOM   4313 O OE2 . GLU B 1 197 ? 22.307  34.810 11.172  1.00 66.68  ? 197 GLU B OE2 1 
ATOM   4314 N N   . TYR B 1 198 ? 24.011  39.599 8.429   1.00 56.81  ? 198 TYR B N   1 
ATOM   4315 C CA  . TYR B 1 198 ? 24.743  39.718 7.182   1.00 53.84  ? 198 TYR B CA  1 
ATOM   4316 C C   . TYR B 1 198 ? 26.185  39.271 7.392   1.00 52.88  ? 198 TYR B C   1 
ATOM   4317 O O   . TYR B 1 198 ? 26.722  38.480 6.607   1.00 50.29  ? 198 TYR B O   1 
ATOM   4318 C CB  . TYR B 1 198 ? 24.704  41.139 6.625   1.00 51.45  ? 198 TYR B CB  1 
ATOM   4319 C CG  . TYR B 1 198 ? 25.257  41.126 5.238   1.00 54.22  ? 198 TYR B CG  1 
ATOM   4320 C CD1 . TYR B 1 198 ? 25.079  39.997 4.437   1.00 57.10  ? 198 TYR B CD1 1 
ATOM   4321 C CD2 . TYR B 1 198 ? 26.058  42.153 4.768   1.00 54.92  ? 198 TYR B CD2 1 
ATOM   4322 C CE1 . TYR B 1 198 ? 25.690  39.876 3.214   1.00 58.92  ? 198 TYR B CE1 1 
ATOM   4323 C CE2 . TYR B 1 198 ? 26.684  42.046 3.532   1.00 59.97  ? 198 TYR B CE2 1 
ATOM   4324 C CZ  . TYR B 1 198 ? 26.500  40.893 2.761   1.00 61.13  ? 198 TYR B CZ  1 
ATOM   4325 O OH  . TYR B 1 198 ? 27.156  40.718 1.553   1.00 63.92  ? 198 TYR B OH  1 
ATOM   4326 N N   . ILE B 1 199 ? 26.789  39.753 8.479   1.00 54.96  ? 199 ILE B N   1 
ATOM   4327 C CA  . ILE B 1 199 ? 28.162  39.399 8.845   1.00 56.04  ? 199 ILE B CA  1 
ATOM   4328 C C   . ILE B 1 199 ? 28.230  37.891 9.062   1.00 55.56  ? 199 ILE B C   1 
ATOM   4329 O O   . ILE B 1 199 ? 29.211  37.225 8.714   1.00 56.51  ? 199 ILE B O   1 
ATOM   4330 C CB  . ILE B 1 199 ? 28.609  40.121 10.131  1.00 55.82  ? 199 ILE B CB  1 
ATOM   4331 C CG1 . ILE B 1 199 ? 28.757  41.625 9.846   1.00 55.45  ? 199 ILE B CG1 1 
ATOM   4332 C CG2 . ILE B 1 199 ? 29.919  39.510 10.641  1.00 57.05  ? 199 ILE B CG2 1 
ATOM   4333 C CD1 . ILE B 1 199 ? 28.873  42.506 11.073  1.00 52.32  ? 199 ILE B CD1 1 
ATOM   4334 N N   . ASN B 1 200 ? 27.154  37.368 9.625   1.00 54.95  ? 200 ASN B N   1 
ATOM   4335 C CA  . ASN B 1 200 ? 27.030  35.949 9.873   1.00 52.83  ? 200 ASN B CA  1 
ATOM   4336 C C   . ASN B 1 200 ? 27.149  35.155 8.604   1.00 51.01  ? 200 ASN B C   1 
ATOM   4337 O O   . ASN B 1 200 ? 27.778  34.103 8.594   1.00 52.23  ? 200 ASN B O   1 
ATOM   4338 C CB  . ASN B 1 200 ? 25.676  35.651 10.480  1.00 56.68  ? 200 ASN B CB  1 
ATOM   4339 C CG  . ASN B 1 200 ? 25.782  35.196 11.877  1.00 60.46  ? 200 ASN B CG  1 
ATOM   4340 O OD1 . ASN B 1 200 ? 25.405  35.918 12.793  1.00 68.97  ? 200 ASN B OD1 1 
ATOM   4341 N ND2 . ASN B 1 200 ? 26.339  34.010 12.075  1.00 61.49  ? 200 ASN B ND2 1 
ATOM   4342 N N   . LEU B 1 201 ? 26.520  35.637 7.538   1.00 51.56  ? 201 LEU B N   1 
ATOM   4343 C CA  . LEU B 1 201 ? 26.560  34.932 6.264   1.00 52.86  ? 201 LEU B CA  1 
ATOM   4344 C C   . LEU B 1 201 ? 27.990  34.791 5.792   1.00 52.95  ? 201 LEU B C   1 
ATOM   4345 O O   . LEU B 1 201 ? 28.399  33.708 5.413   1.00 54.72  ? 201 LEU B O   1 
ATOM   4346 C CB  . LEU B 1 201 ? 25.730  35.635 5.188   1.00 55.45  ? 201 LEU B CB  1 
ATOM   4347 C CG  . LEU B 1 201 ? 25.285  34.660 4.086   1.00 54.26  ? 201 LEU B CG  1 
ATOM   4348 C CD1 . LEU B 1 201 ? 24.438  33.582 4.715   1.00 54.49  ? 201 LEU B CD1 1 
ATOM   4349 C CD2 . LEU B 1 201 ? 24.506  35.365 2.987   1.00 51.79  ? 201 LEU B CD2 1 
ATOM   4350 N N   . TRP B 1 202 ? 28.761  35.874 5.854   1.00 54.52  ? 202 TRP B N   1 
ATOM   4351 C CA  . TRP B 1 202 ? 30.164  35.814 5.437   1.00 54.13  ? 202 TRP B CA  1 
ATOM   4352 C C   . TRP B 1 202 ? 30.897  34.846 6.337   1.00 53.65  ? 202 TRP B C   1 
ATOM   4353 O O   . TRP B 1 202 ? 31.501  33.895 5.849   1.00 56.38  ? 202 TRP B O   1 
ATOM   4354 C CB  . TRP B 1 202 ? 30.843  37.178 5.494   1.00 52.37  ? 202 TRP B CB  1 
ATOM   4355 C CG  . TRP B 1 202 ? 30.499  38.068 4.346   1.00 50.30  ? 202 TRP B CG  1 
ATOM   4356 C CD1 . TRP B 1 202 ? 29.265  38.548 4.028   1.00 51.68  ? 202 TRP B CD1 1 
ATOM   4357 C CD2 . TRP B 1 202 ? 31.412  38.671 3.416   1.00 50.46  ? 202 TRP B CD2 1 
ATOM   4358 N NE1 . TRP B 1 202 ? 29.352  39.424 2.976   1.00 53.07  ? 202 TRP B NE1 1 
ATOM   4359 C CE2 . TRP B 1 202 ? 30.659  39.522 2.581   1.00 51.87  ? 202 TRP B CE2 1 
ATOM   4360 C CE3 . TRP B 1 202 ? 32.801  38.588 3.223   1.00 49.99  ? 202 TRP B CE3 1 
ATOM   4361 C CZ2 . TRP B 1 202 ? 31.242  40.292 1.566   1.00 50.49  ? 202 TRP B CZ2 1 
ATOM   4362 C CZ3 . TRP B 1 202 ? 33.380  39.360 2.212   1.00 47.01  ? 202 TRP B CZ3 1 
ATOM   4363 C CH2 . TRP B 1 202 ? 32.602  40.197 1.403   1.00 48.14  ? 202 TRP B CH2 1 
ATOM   4364 N N   . GLU B 1 203 ? 30.785  35.043 7.647   1.00 50.88  ? 203 GLU B N   1 
ATOM   4365 C CA  . GLU B 1 203 ? 31.443  34.161 8.601   1.00 50.26  ? 203 GLU B CA  1 
ATOM   4366 C C   . GLU B 1 203 ? 31.120  32.684 8.391   1.00 50.67  ? 203 GLU B C   1 
ATOM   4367 O O   . GLU B 1 203 ? 31.949  31.822 8.677   1.00 54.06  ? 203 GLU B O   1 
ATOM   4368 C CB  . GLU B 1 203 ? 31.093  34.541 10.029  1.00 48.54  ? 203 GLU B CB  1 
ATOM   4369 C CG  . GLU B 1 203 ? 31.490  35.938 10.429  1.00 48.60  ? 203 GLU B CG  1 
ATOM   4370 C CD  . GLU B 1 203 ? 31.494  36.122 11.936  1.00 49.86  ? 203 GLU B CD  1 
ATOM   4371 O OE1 . GLU B 1 203 ? 30.644  35.473 12.614  1.00 45.63  ? 203 GLU B OE1 1 
ATOM   4372 O OE2 . GLU B 1 203 ? 32.351  36.906 12.438  1.00 47.85  ? 203 GLU B OE2 1 
ATOM   4373 N N   . GLN B 1 204 ? 29.935  32.395 7.868   1.00 48.99  ? 204 GLN B N   1 
ATOM   4374 C CA  . GLN B 1 204 ? 29.520  31.016 7.657   1.00 51.18  ? 204 GLN B CA  1 
ATOM   4375 C C   . GLN B 1 204 ? 29.764  30.504 6.243   1.00 50.05  ? 204 GLN B C   1 
ATOM   4376 O O   . GLN B 1 204 ? 29.822  29.293 5.999   1.00 48.48  ? 204 GLN B O   1 
ATOM   4377 C CB  . GLN B 1 204 ? 28.053  30.867 8.056   1.00 59.26  ? 204 GLN B CB  1 
ATOM   4378 C CG  . GLN B 1 204 ? 27.793  31.332 9.492   1.00 65.69  ? 204 GLN B CG  1 
ATOM   4379 C CD  . GLN B 1 204 ? 26.336  31.201 9.916   1.00 69.57  ? 204 GLN B CD  1 
ATOM   4380 O OE1 . GLN B 1 204 ? 25.778  32.107 10.542  1.00 66.75  ? 204 GLN B OE1 1 
ATOM   4381 N NE2 . GLN B 1 204 ? 25.720  30.060 9.601   1.00 71.22  ? 204 GLN B NE2 1 
ATOM   4382 N N   . LYS B 1 205 ? 29.873  31.432 5.303   1.00 49.96  ? 205 LYS B N   1 
ATOM   4383 C CA  . LYS B 1 205 ? 30.135  31.097 3.908   1.00 49.51  ? 205 LYS B CA  1 
ATOM   4384 C C   . LYS B 1 205 ? 31.001  32.207 3.358   1.00 47.95  ? 205 LYS B C   1 
ATOM   4385 O O   . LYS B 1 205 ? 30.507  33.086 2.648   1.00 48.26  ? 205 LYS B O   1 
ATOM   4386 C CB  . LYS B 1 205 ? 28.845  30.976 3.085   1.00 52.00  ? 205 LYS B CB  1 
ATOM   4387 C CG  . LYS B 1 205 ? 27.620  31.668 3.657   1.00 55.21  ? 205 LYS B CG  1 
ATOM   4388 C CD  . LYS B 1 205 ? 26.375  31.439 2.817   1.00 60.00  ? 205 LYS B CD  1 
ATOM   4389 C CE  . LYS B 1 205 ? 26.220  29.990 2.391   1.00 65.89  ? 205 LYS B CE  1 
ATOM   4390 N NZ  . LYS B 1 205 ? 26.351  28.978 3.484   1.00 69.43  ? 205 LYS B NZ  1 
ATOM   4391 N N   . ARG B 1 206 ? 32.276  32.178 3.764   1.00 48.07  ? 206 ARG B N   1 
ATOM   4392 C CA  . ARG B 1 206 ? 33.304  33.162 3.369   1.00 44.68  ? 206 ARG B CA  1 
ATOM   4393 C C   . ARG B 1 206 ? 33.552  33.032 1.895   1.00 43.28  ? 206 ARG B C   1 
ATOM   4394 O O   . ARG B 1 206 ? 33.973  31.957 1.428   1.00 46.85  ? 206 ARG B O   1 
ATOM   4395 C CB  . ARG B 1 206 ? 34.624  32.892 4.068   1.00 40.72  ? 206 ARG B CB  1 
ATOM   4396 C CG  . ARG B 1 206 ? 35.237  34.138 4.603   1.00 35.65  ? 206 ARG B CG  1 
ATOM   4397 C CD  . ARG B 1 206 ? 35.107  34.119 6.103   1.00 33.46  ? 206 ARG B CD  1 
ATOM   4398 N NE  . ARG B 1 206 ? 34.826  35.438 6.650   1.00 28.49  ? 206 ARG B NE  1 
ATOM   4399 C CZ  . ARG B 1 206 ? 34.815  35.694 7.947   1.00 26.64  ? 206 ARG B CZ  1 
ATOM   4400 N NH1 . ARG B 1 206 ? 35.069  34.726 8.805   1.00 29.62  ? 206 ARG B NH1 1 
ATOM   4401 N NH2 . ARG B 1 206 ? 34.544  36.908 8.385   1.00 27.52  ? 206 ARG B NH2 1 
ATOM   4402 N N   . PRO B 1 207 ? 33.358  34.132 1.145   1.00 38.29  ? 207 PRO B N   1 
ATOM   4403 C CA  . PRO B 1 207 ? 33.577  34.036 -0.298  1.00 36.64  ? 207 PRO B CA  1 
ATOM   4404 C C   . PRO B 1 207 ? 35.069  34.015 -0.637  1.00 38.81  ? 207 PRO B C   1 
ATOM   4405 O O   . PRO B 1 207 ? 35.901  34.649 0.033   1.00 37.94  ? 207 PRO B O   1 
ATOM   4406 C CB  . PRO B 1 207 ? 32.892  35.302 -0.844  1.00 29.66  ? 207 PRO B CB  1 
ATOM   4407 C CG  . PRO B 1 207 ? 32.247  35.985 0.389   1.00 31.25  ? 207 PRO B CG  1 
ATOM   4408 C CD  . PRO B 1 207 ? 33.083  35.518 1.544   1.00 32.43  ? 207 PRO B CD  1 
ATOM   4409 N N   . ALA B 1 208 ? 35.417  33.178 -1.597  1.00 37.53  ? 208 ALA B N   1 
ATOM   4410 C CA  . ALA B 1 208 ? 36.790  33.126 -2.056  1.00 40.10  ? 208 ALA B CA  1 
ATOM   4411 C C   . ALA B 1 208 ? 36.923  34.431 -2.859  1.00 39.20  ? 208 ALA B C   1 
ATOM   4412 O O   . ALA B 1 208 ? 37.835  35.266 -2.636  1.00 36.58  ? 208 ALA B O   1 
ATOM   4413 C CB  . ALA B 1 208 ? 36.995  31.908 -2.961  1.00 39.95  ? 208 ALA B CB  1 
ATOM   4414 N N   . ILE B 1 209 ? 35.974  34.605 -3.772  1.00 33.94  ? 209 ILE B N   1 
ATOM   4415 C CA  . ILE B 1 209 ? 35.942  35.789 -4.594  1.00 34.56  ? 209 ILE B CA  1 
ATOM   4416 C C   . ILE B 1 209 ? 34.629  36.460 -4.270  1.00 33.36  ? 209 ILE B C   1 
ATOM   4417 O O   . ILE B 1 209 ? 33.664  35.790 -3.947  1.00 37.03  ? 209 ILE B O   1 
ATOM   4418 C CB  . ILE B 1 209 ? 36.053  35.457 -6.117  1.00 34.57  ? 209 ILE B CB  1 
ATOM   4419 C CG1 . ILE B 1 209 ? 37.422  34.802 -6.432  1.00 30.15  ? 209 ILE B CG1 1 
ATOM   4420 C CG2 . ILE B 1 209 ? 35.918  36.741 -6.958  1.00 35.65  ? 209 ILE B CG2 1 
ATOM   4421 C CD1 . ILE B 1 209 ? 37.580  34.304 -7.867  1.00 20.91  ? 209 ILE B CD1 1 
ATOM   4422 N N   . PHE B 1 210 ? 34.649  37.784 -4.203  1.00 35.64  ? 210 PHE B N   1 
ATOM   4423 C CA  . PHE B 1 210 ? 33.463  38.578 -3.945  1.00 33.52  ? 210 PHE B CA  1 
ATOM   4424 C C   . PHE B 1 210 ? 33.293  39.572 -5.083  1.00 32.34  ? 210 PHE B C   1 
ATOM   4425 O O   . PHE B 1 210 ? 33.976  40.591 -5.130  1.00 34.12  ? 210 PHE B O   1 
ATOM   4426 C CB  . PHE B 1 210 ? 33.557  39.329 -2.613  1.00 38.09  ? 210 PHE B CB  1 
ATOM   4427 C CG  . PHE B 1 210 ? 32.255  39.941 -2.188  1.00 42.50  ? 210 PHE B CG  1 
ATOM   4428 C CD1 . PHE B 1 210 ? 31.073  39.180 -2.214  1.00 40.74  ? 210 PHE B CD1 1 
ATOM   4429 C CD2 . PHE B 1 210 ? 32.182  41.283 -1.841  1.00 44.11  ? 210 PHE B CD2 1 
ATOM   4430 C CE1 . PHE B 1 210 ? 29.849  39.743 -1.911  1.00 40.52  ? 210 PHE B CE1 1 
ATOM   4431 C CE2 . PHE B 1 210 ? 30.940  41.860 -1.530  1.00 50.49  ? 210 PHE B CE2 1 
ATOM   4432 C CZ  . PHE B 1 210 ? 29.774  41.084 -1.571  1.00 46.57  ? 210 PHE B CZ  1 
ATOM   4433 N N   . THR B 1 211 ? 32.368  39.267 -5.984  1.00 34.16  ? 211 THR B N   1 
ATOM   4434 C CA  . THR B 1 211 ? 32.071  40.097 -7.146  1.00 36.17  ? 211 THR B CA  1 
ATOM   4435 C C   . THR B 1 211 ? 30.735  40.842 -6.997  1.00 36.09  ? 211 THR B C   1 
ATOM   4436 O O   . THR B 1 211 ? 30.022  40.719 -5.990  1.00 35.26  ? 211 THR B O   1 
ATOM   4437 C CB  . THR B 1 211 ? 32.042  39.212 -8.426  1.00 40.39  ? 211 THR B CB  1 
ATOM   4438 O OG1 . THR B 1 211 ? 31.922  40.021 -9.612  1.00 39.38  ? 211 THR B OG1 1 
ATOM   4439 C CG2 . THR B 1 211 ? 30.896  38.192 -8.349  1.00 43.91  ? 211 THR B CG2 1 
ATOM   4440 N N   . GLY B 1 212 ? 30.417  41.638 -8.003  1.00 34.41  ? 212 GLY B N   1 
ATOM   4441 C CA  . GLY B 1 212 ? 29.186  42.396 -8.008  1.00 33.41  ? 212 GLY B CA  1 
ATOM   4442 C C   . GLY B 1 212 ? 29.263  43.395 -9.148  1.00 37.57  ? 212 GLY B C   1 
ATOM   4443 O O   . GLY B 1 212 ? 30.103  43.293 -10.048 1.00 39.16  ? 212 GLY B O   1 
ATOM   4444 N N   . TRP B 1 213 ? 28.380  44.371 -9.148  1.00 36.35  ? 213 TRP B N   1 
ATOM   4445 C CA  . TRP B 1 213 ? 28.438  45.355 -10.194 1.00 36.87  ? 213 TRP B CA  1 
ATOM   4446 C C   . TRP B 1 213 ? 28.547  46.653 -9.413  1.00 40.59  ? 213 TRP B C   1 
ATOM   4447 O O   . TRP B 1 213 ? 27.633  47.015 -8.677  1.00 45.79  ? 213 TRP B O   1 
ATOM   4448 C CB  . TRP B 1 213 ? 27.182  45.302 -11.061 1.00 31.08  ? 213 TRP B CB  1 
ATOM   4449 C CG  . TRP B 1 213 ? 27.395  45.952 -12.361 1.00 30.52  ? 213 TRP B CG  1 
ATOM   4450 C CD1 . TRP B 1 213 ? 27.203  47.279 -12.665 1.00 30.38  ? 213 TRP B CD1 1 
ATOM   4451 C CD2 . TRP B 1 213 ? 27.873  45.333 -13.557 1.00 25.39  ? 213 TRP B CD2 1 
ATOM   4452 N NE1 . TRP B 1 213 ? 27.529  47.509 -13.975 1.00 29.73  ? 213 TRP B NE1 1 
ATOM   4453 C CE2 . TRP B 1 213 ? 27.938  46.331 -14.546 1.00 25.16  ? 213 TRP B CE2 1 
ATOM   4454 C CE3 . TRP B 1 213 ? 28.247  44.029 -13.891 1.00 22.62  ? 213 TRP B CE3 1 
ATOM   4455 C CZ2 . TRP B 1 213 ? 28.351  46.063 -15.847 1.00 24.24  ? 213 TRP B CZ2 1 
ATOM   4456 C CZ3 . TRP B 1 213 ? 28.654  43.762 -15.189 1.00 19.70  ? 213 TRP B CZ3 1 
ATOM   4457 C CH2 . TRP B 1 213 ? 28.701  44.771 -16.150 1.00 19.63  ? 213 TRP B CH2 1 
ATOM   4458 N N   . ASN B 1 214 ? 29.720  47.278 -9.474  1.00 39.95  ? 214 ASN B N   1 
ATOM   4459 C CA  . ASN B 1 214 ? 29.987  48.522 -8.756  1.00 39.75  ? 214 ASN B CA  1 
ATOM   4460 C C   . ASN B 1 214 ? 30.050  48.294 -7.239  1.00 37.33  ? 214 ASN B C   1 
ATOM   4461 O O   . ASN B 1 214 ? 29.763  49.193 -6.436  1.00 33.19  ? 214 ASN B O   1 
ATOM   4462 C CB  . ASN B 1 214 ? 28.961  49.601 -9.113  1.00 44.24  ? 214 ASN B CB  1 
ATOM   4463 C CG  . ASN B 1 214 ? 29.302  50.951 -8.505  1.00 55.10  ? 214 ASN B CG  1 
ATOM   4464 O OD1 . ASN B 1 214 ? 30.416  51.170 -8.001  1.00 55.90  ? 214 ASN B OD1 1 
ATOM   4465 N ND2 . ASN B 1 214 ? 28.338  51.867 -8.537  1.00 60.79  ? 214 ASN B ND2 1 
ATOM   4466 N N   . ILE B 1 215 ? 30.437  47.083 -6.843  1.00 36.86  ? 215 ILE B N   1 
ATOM   4467 C CA  . ILE B 1 215 ? 30.550  46.782 -5.424  1.00 38.48  ? 215 ILE B CA  1 
ATOM   4468 C C   . ILE B 1 215 ? 31.587  47.691 -4.804  1.00 45.63  ? 215 ILE B C   1 
ATOM   4469 O O   . ILE B 1 215 ? 31.330  48.312 -3.758  1.00 46.50  ? 215 ILE B O   1 
ATOM   4470 C CB  . ILE B 1 215 ? 30.977  45.332 -5.135  1.00 37.11  ? 215 ILE B CB  1 
ATOM   4471 C CG1 . ILE B 1 215 ? 31.969  44.823 -6.179  1.00 33.66  ? 215 ILE B CG1 1 
ATOM   4472 C CG2 . ILE B 1 215 ? 29.774  44.460 -4.978  1.00 34.69  ? 215 ILE B CG2 1 
ATOM   4473 C CD1 . ILE B 1 215 ? 32.454  43.404 -5.903  1.00 33.94  ? 215 ILE B CD1 1 
ATOM   4474 N N   . GLU B 1 216 ? 32.741  47.784 -5.475  1.00 49.44  ? 216 GLU B N   1 
ATOM   4475 C CA  . GLU B 1 216 ? 33.858  48.588 -5.009  1.00 54.51  ? 216 GLU B CA  1 
ATOM   4476 C C   . GLU B 1 216 ? 33.486  50.034 -4.680  1.00 55.25  ? 216 GLU B C   1 
ATOM   4477 O O   . GLU B 1 216 ? 33.920  50.571 -3.657  1.00 57.45  ? 216 GLU B O   1 
ATOM   4478 C CB  . GLU B 1 216 ? 35.004  48.561 -6.025  1.00 60.34  ? 216 GLU B CB  1 
ATOM   4479 C CG  . GLU B 1 216 ? 36.224  49.415 -5.594  1.00 70.49  ? 216 GLU B CG  1 
ATOM   4480 C CD  . GLU B 1 216 ? 37.132  49.809 -6.751  1.00 74.33  ? 216 GLU B CD  1 
ATOM   4481 O OE1 . GLU B 1 216 ? 36.786  50.790 -7.462  1.00 78.19  ? 216 GLU B OE1 1 
ATOM   4482 O OE2 . GLU B 1 216 ? 38.179  49.138 -6.941  1.00 71.63  ? 216 GLU B OE2 1 
ATOM   4483 N N   . GLY B 1 217 ? 32.702  50.656 -5.562  1.00 55.43  ? 217 GLY B N   1 
ATOM   4484 C CA  . GLY B 1 217 ? 32.281  52.035 -5.368  1.00 50.97  ? 217 GLY B CA  1 
ATOM   4485 C C   . GLY B 1 217 ? 31.186  52.236 -4.341  1.00 49.23  ? 217 GLY B C   1 
ATOM   4486 O O   . GLY B 1 217 ? 31.320  53.068 -3.444  1.00 47.55  ? 217 GLY B O   1 
ATOM   4487 N N   . PHE B 1 218 ? 30.120  51.452 -4.426  1.00 45.76  ? 218 PHE B N   1 
ATOM   4488 C CA  . PHE B 1 218 ? 29.025  51.624 -3.483  1.00 44.82  ? 218 PHE B CA  1 
ATOM   4489 C C   . PHE B 1 218 ? 28.777  50.487 -2.506  1.00 43.91  ? 218 PHE B C   1 
ATOM   4490 O O   . PHE B 1 218 ? 28.946  50.650 -1.298  1.00 43.13  ? 218 PHE B O   1 
ATOM   4491 C CB  . PHE B 1 218 ? 27.705  51.932 -4.239  1.00 45.58  ? 218 PHE B CB  1 
ATOM   4492 C CG  . PHE B 1 218 ? 26.529  52.259 -3.335  1.00 45.00  ? 218 PHE B CG  1 
ATOM   4493 C CD1 . PHE B 1 218 ? 26.391  53.526 -2.775  1.00 43.40  ? 218 PHE B CD1 1 
ATOM   4494 C CD2 . PHE B 1 218 ? 25.566  51.303 -3.042  1.00 45.23  ? 218 PHE B CD2 1 
ATOM   4495 C CE1 . PHE B 1 218 ? 25.330  53.829 -1.948  1.00 39.68  ? 218 PHE B CE1 1 
ATOM   4496 C CE2 . PHE B 1 218 ? 24.498  51.600 -2.212  1.00 42.31  ? 218 PHE B CE2 1 
ATOM   4497 C CZ  . PHE B 1 218 ? 24.380  52.867 -1.664  1.00 42.74  ? 218 PHE B CZ  1 
ATOM   4498 N N   . ASP B 1 219 ? 28.357  49.346 -3.041  1.00 44.67  ? 219 ASP B N   1 
ATOM   4499 C CA  . ASP B 1 219 ? 27.963  48.214 -2.221  1.00 43.25  ? 219 ASP B CA  1 
ATOM   4500 C C   . ASP B 1 219 ? 28.842  47.952 -1.042  1.00 45.29  ? 219 ASP B C   1 
ATOM   4501 O O   . ASP B 1 219 ? 28.364  47.979 0.090   1.00 49.05  ? 219 ASP B O   1 
ATOM   4502 C CB  . ASP B 1 219 ? 27.769  46.942 -3.058  1.00 45.62  ? 219 ASP B CB  1 
ATOM   4503 C CG  . ASP B 1 219 ? 26.782  47.136 -4.207  1.00 47.69  ? 219 ASP B CG  1 
ATOM   4504 O OD1 . ASP B 1 219 ? 25.717  47.741 -3.966  1.00 50.66  ? 219 ASP B OD1 1 
ATOM   4505 O OD2 . ASP B 1 219 ? 27.067  46.680 -5.346  1.00 52.48  ? 219 ASP B OD2 1 
ATOM   4506 N N   . VAL B 1 220 ? 30.140  47.808 -1.280  1.00 44.39  ? 220 VAL B N   1 
ATOM   4507 C CA  . VAL B 1 220 ? 31.051  47.509 -0.183  1.00 43.81  ? 220 VAL B CA  1 
ATOM   4508 C C   . VAL B 1 220 ? 31.254  48.630 0.854   1.00 45.09  ? 220 VAL B C   1 
ATOM   4509 O O   . VAL B 1 220 ? 30.862  48.466 2.023   1.00 38.80  ? 220 VAL B O   1 
ATOM   4510 C CB  . VAL B 1 220 ? 32.417  46.921 -0.703  1.00 45.42  ? 220 VAL B CB  1 
ATOM   4511 C CG1 . VAL B 1 220 ? 33.383  46.656 0.472   1.00 43.19  ? 220 VAL B CG1 1 
ATOM   4512 C CG2 . VAL B 1 220 ? 32.174  45.627 -1.493  1.00 37.34  ? 220 VAL B CG2 1 
ATOM   4513 N N   . PRO B 1 221 ? 31.829  49.791 0.442   1.00 47.89  ? 221 PRO B N   1 
ATOM   4514 C CA  . PRO B 1 221 ? 32.055  50.890 1.393   1.00 49.22  ? 221 PRO B CA  1 
ATOM   4515 C C   . PRO B 1 221 ? 30.835  51.372 2.161   1.00 50.71  ? 221 PRO B C   1 
ATOM   4516 O O   . PRO B 1 221 ? 30.981  51.988 3.223   1.00 50.28  ? 221 PRO B O   1 
ATOM   4517 C CB  . PRO B 1 221 ? 32.696  51.995 0.535   1.00 48.97  ? 221 PRO B CB  1 
ATOM   4518 C CG  . PRO B 1 221 ? 32.300  51.672 -0.863  1.00 46.15  ? 221 PRO B CG  1 
ATOM   4519 C CD  . PRO B 1 221 ? 32.322  50.158 -0.899  1.00 50.07  ? 221 PRO B CD  1 
ATOM   4520 N N   . TYR B 1 222 ? 29.640  51.085 1.643   1.00 51.59  ? 222 TYR B N   1 
ATOM   4521 C CA  . TYR B 1 222 ? 28.420  51.476 2.340   1.00 52.39  ? 222 TYR B CA  1 
ATOM   4522 C C   . TYR B 1 222 ? 28.135  50.492 3.483   1.00 49.03  ? 222 TYR B C   1 
ATOM   4523 O O   . TYR B 1 222 ? 27.795  50.913 4.591   1.00 47.96  ? 222 TYR B O   1 
ATOM   4524 C CB  . TYR B 1 222 ? 27.229  51.565 1.387   1.00 56.41  ? 222 TYR B CB  1 
ATOM   4525 C CG  . TYR B 1 222 ? 26.123  52.396 1.980   1.00 61.87  ? 222 TYR B CG  1 
ATOM   4526 C CD1 . TYR B 1 222 ? 25.390  51.921 3.069   1.00 65.77  ? 222 TYR B CD1 1 
ATOM   4527 C CD2 . TYR B 1 222 ? 25.882  53.700 1.539   1.00 61.23  ? 222 TYR B CD2 1 
ATOM   4528 C CE1 . TYR B 1 222 ? 24.464  52.718 3.717   1.00 68.16  ? 222 TYR B CE1 1 
ATOM   4529 C CE2 . TYR B 1 222 ? 24.951  54.507 2.178   1.00 64.46  ? 222 TYR B CE2 1 
ATOM   4530 C CZ  . TYR B 1 222 ? 24.252  54.007 3.273   1.00 66.91  ? 222 TYR B CZ  1 
ATOM   4531 O OH  . TYR B 1 222 ? 23.380  54.797 3.977   1.00 71.32  ? 222 TYR B OH  1 
ATOM   4532 N N   . ILE B 1 223 ? 28.321  49.197 3.217   1.00 47.76  ? 223 ILE B N   1 
ATOM   4533 C CA  . ILE B 1 223 ? 28.114  48.134 4.207   1.00 45.44  ? 223 ILE B CA  1 
ATOM   4534 C C   . ILE B 1 223 ? 29.118  48.268 5.333   1.00 46.44  ? 223 ILE B C   1 
ATOM   4535 O O   . ILE B 1 223 ? 28.750  48.198 6.493   1.00 45.01  ? 223 ILE B O   1 
ATOM   4536 C CB  . ILE B 1 223 ? 28.276  46.706 3.577   1.00 44.33  ? 223 ILE B CB  1 
ATOM   4537 C CG1 . ILE B 1 223 ? 27.146  46.429 2.569   1.00 44.68  ? 223 ILE B CG1 1 
ATOM   4538 C CG2 . ILE B 1 223 ? 28.296  45.621 4.659   1.00 38.29  ? 223 ILE B CG2 1 
ATOM   4539 C CD1 . ILE B 1 223 ? 27.309  45.146 1.793   1.00 39.58  ? 223 ILE B CD1 1 
ATOM   4540 N N   . MET B 1 224 ? 30.382  48.492 4.980   1.00 51.05  ? 224 MET B N   1 
ATOM   4541 C CA  . MET B 1 224 ? 31.465  48.631 5.968   1.00 54.93  ? 224 MET B CA  1 
ATOM   4542 C C   . MET B 1 224 ? 31.294  49.829 6.878   1.00 58.22  ? 224 MET B C   1 
ATOM   4543 O O   . MET B 1 224 ? 31.510  49.741 8.094   1.00 59.04  ? 224 MET B O   1 
ATOM   4544 C CB  . MET B 1 224 ? 32.812  48.734 5.269   1.00 51.47  ? 224 MET B CB  1 
ATOM   4545 C CG  . MET B 1 224 ? 33.144  47.519 4.469   1.00 52.18  ? 224 MET B CG  1 
ATOM   4546 S SD  . MET B 1 224 ? 32.934  46.055 5.474   1.00 51.15  ? 224 MET B SD  1 
ATOM   4547 C CE  . MET B 1 224 ? 32.747  44.803 4.166   1.00 52.97  ? 224 MET B CE  1 
ATOM   4548 N N   . ASN B 1 225 ? 30.922  50.955 6.286   1.00 60.91  ? 225 ASN B N   1 
ATOM   4549 C CA  . ASN B 1 225 ? 30.703  52.161 7.058   1.00 63.41  ? 225 ASN B CA  1 
ATOM   4550 C C   . ASN B 1 225 ? 29.419  52.139 7.867   1.00 63.32  ? 225 ASN B C   1 
ATOM   4551 O O   . ASN B 1 225 ? 29.346  52.773 8.916   1.00 62.88  ? 225 ASN B O   1 
ATOM   4552 C CB  . ASN B 1 225 ? 30.788  53.384 6.172   1.00 67.62  ? 225 ASN B CB  1 
ATOM   4553 C CG  . ASN B 1 225 ? 32.190  53.920 6.093   1.00 70.07  ? 225 ASN B CG  1 
ATOM   4554 O OD1 . ASN B 1 225 ? 33.152  53.155 5.981   1.00 72.46  ? 225 ASN B OD1 1 
ATOM   4555 N ND2 . ASN B 1 225 ? 32.327  55.229 6.228   1.00 72.91  ? 225 ASN B ND2 1 
ATOM   4556 N N   . ARG B 1 226 ? 28.419  51.400 7.387   1.00 63.22  ? 226 ARG B N   1 
ATOM   4557 C CA  . ARG B 1 226 ? 27.152  51.240 8.097   1.00 61.85  ? 226 ARG B CA  1 
ATOM   4558 C C   . ARG B 1 226 ? 27.471  50.356 9.302   1.00 60.72  ? 226 ARG B C   1 
ATOM   4559 O O   . ARG B 1 226 ? 27.182  50.720 10.435  1.00 62.39  ? 226 ARG B O   1 
ATOM   4560 C CB  . ARG B 1 226 ? 26.139  50.520 7.212   1.00 66.92  ? 226 ARG B CB  1 
ATOM   4561 C CG  . ARG B 1 226 ? 24.706  50.465 7.743   1.00 70.93  ? 226 ARG B CG  1 
ATOM   4562 C CD  . ARG B 1 226 ? 23.924  51.716 7.366   1.00 73.08  ? 226 ARG B CD  1 
ATOM   4563 N NE  . ARG B 1 226 ? 24.438  52.891 8.055   1.00 75.96  ? 226 ARG B NE  1 
ATOM   4564 C CZ  . ARG B 1 226 ? 23.689  53.777 8.706   1.00 77.80  ? 226 ARG B CZ  1 
ATOM   4565 N NH1 . ARG B 1 226 ? 22.358  53.667 8.741   1.00 74.41  ? 226 ARG B NH1 1 
ATOM   4566 N NH2 . ARG B 1 226 ? 24.278  54.792 9.312   1.00 80.74  ? 226 ARG B NH2 1 
ATOM   4567 N N   . VAL B 1 227 ? 28.070  49.193 9.050   1.00 58.73  ? 227 VAL B N   1 
ATOM   4568 C CA  . VAL B 1 227 ? 28.457  48.264 10.117  1.00 57.43  ? 227 VAL B CA  1 
ATOM   4569 C C   . VAL B 1 227 ? 29.431  48.934 11.090  1.00 58.59  ? 227 VAL B C   1 
ATOM   4570 O O   . VAL B 1 227 ? 29.348  48.741 12.296  1.00 56.57  ? 227 VAL B O   1 
ATOM   4571 C CB  . VAL B 1 227 ? 29.092  46.942 9.560   1.00 54.48  ? 227 VAL B CB  1 
ATOM   4572 C CG1 . VAL B 1 227 ? 29.699  46.120 10.690  1.00 46.30  ? 227 VAL B CG1 1 
ATOM   4573 C CG2 . VAL B 1 227 ? 28.033  46.110 8.831   1.00 48.61  ? 227 VAL B CG2 1 
ATOM   4574 N N   . LYS B 1 228 ? 30.341  49.743 10.580  1.00 61.89  ? 228 LYS B N   1 
ATOM   4575 C CA  . LYS B 1 228 ? 31.271  50.409 11.476  1.00 67.51  ? 228 LYS B CA  1 
ATOM   4576 C C   . LYS B 1 228 ? 30.487  51.446 12.300  1.00 69.34  ? 228 LYS B C   1 
ATOM   4577 O O   . LYS B 1 228 ? 30.380  51.333 13.523  1.00 67.75  ? 228 LYS B O   1 
ATOM   4578 C CB  . LYS B 1 228 ? 32.391  51.073 10.678  1.00 69.01  ? 228 LYS B CB  1 
ATOM   4579 C CG  . LYS B 1 228 ? 33.639  51.412 11.480  1.00 71.58  ? 228 LYS B CG  1 
ATOM   4580 C CD  . LYS B 1 228 ? 34.721  51.914 10.534  1.00 74.99  ? 228 LYS B CD  1 
ATOM   4581 C CE  . LYS B 1 228 ? 35.942  52.445 11.279  1.00 79.69  ? 228 LYS B CE  1 
ATOM   4582 N NZ  . LYS B 1 228 ? 37.084  52.681 10.331  1.00 81.04  ? 228 LYS B NZ  1 
ATOM   4583 N N   . MET B 1 229 ? 29.879  52.406 11.606  1.00 71.43  ? 229 MET B N   1 
ATOM   4584 C CA  . MET B 1 229 ? 29.107  53.479 12.234  1.00 71.48  ? 229 MET B CA  1 
ATOM   4585 C C   . MET B 1 229 ? 27.951  53.047 13.142  1.00 69.80  ? 229 MET B C   1 
ATOM   4586 O O   . MET B 1 229 ? 27.773  53.594 14.238  1.00 68.29  ? 229 MET B O   1 
ATOM   4587 C CB  . MET B 1 229 ? 28.580  54.423 11.158  1.00 73.75  ? 229 MET B CB  1 
ATOM   4588 C CG  . MET B 1 229 ? 27.590  55.438 11.660  1.00 75.99  ? 229 MET B CG  1 
ATOM   4589 S SD  . MET B 1 229 ? 26.613  55.983 10.305  1.00 75.06  ? 229 MET B SD  1 
ATOM   4590 C CE  . MET B 1 229 ? 27.597  57.328 9.724   1.00 76.15  ? 229 MET B CE  1 
ATOM   4591 N N   . ILE B 1 230 ? 27.120  52.132 12.657  1.00 67.79  ? 230 ILE B N   1 
ATOM   4592 C CA  . ILE B 1 230 ? 25.989  51.661 13.447  1.00 66.86  ? 230 ILE B CA  1 
ATOM   4593 C C   . ILE B 1 230 ? 26.305  50.478 14.372  1.00 65.87  ? 230 ILE B C   1 
ATOM   4594 O O   . ILE B 1 230 ? 25.875  50.457 15.527  1.00 66.18  ? 230 ILE B O   1 
ATOM   4595 C CB  . ILE B 1 230 ? 24.722  51.442 12.556  1.00 66.56  ? 230 ILE B CB  1 
ATOM   4596 C CG1 . ILE B 1 230 ? 23.630  52.430 12.983  1.00 69.81  ? 230 ILE B CG1 1 
ATOM   4597 C CG2 . ILE B 1 230 ? 24.239  49.980 12.557  1.00 59.89  ? 230 ILE B CG2 1 
ATOM   4598 C CD1 . ILE B 1 230 ? 23.219  52.357 14.460  1.00 71.81  ? 230 ILE B CD1 1 
ATOM   4599 N N   . LEU B 1 231 ? 27.100  49.532 13.894  1.00 64.57  ? 231 LEU B N   1 
ATOM   4600 C CA  . LEU B 1 231 ? 27.449  48.368 14.702  1.00 66.44  ? 231 LEU B CA  1 
ATOM   4601 C C   . LEU B 1 231 ? 28.870  48.420 15.318  1.00 67.12  ? 231 LEU B C   1 
ATOM   4602 O O   . LEU B 1 231 ? 29.185  47.676 16.258  1.00 65.46  ? 231 LEU B O   1 
ATOM   4603 C CB  . LEU B 1 231 ? 27.275  47.088 13.861  1.00 69.78  ? 231 LEU B CB  1 
ATOM   4604 C CG  . LEU B 1 231 ? 26.107  46.120 14.100  1.00 68.19  ? 231 LEU B CG  1 
ATOM   4605 C CD1 . LEU B 1 231 ? 24.800  46.830 13.868  1.00 67.11  ? 231 LEU B CD1 1 
ATOM   4606 C CD2 . LEU B 1 231 ? 26.234  44.900 13.189  1.00 62.66  ? 231 LEU B CD2 1 
ATOM   4607 N N   . GLY B 1 232 ? 29.750  49.235 14.749  1.00 66.07  ? 232 GLY B N   1 
ATOM   4608 C CA  . GLY B 1 232 ? 31.095  49.339 15.287  1.00 67.40  ? 232 GLY B CA  1 
ATOM   4609 C C   . GLY B 1 232 ? 32.211  48.511 14.660  1.00 66.59  ? 232 GLY B C   1 
ATOM   4610 O O   . GLY B 1 232 ? 31.978  47.472 14.042  1.00 65.81  ? 232 GLY B O   1 
ATOM   4611 N N   . GLU B 1 233 ? 33.442  48.998 14.837  1.00 67.84  ? 233 GLU B N   1 
ATOM   4612 C CA  . GLU B 1 233 ? 34.670  48.363 14.343  1.00 65.53  ? 233 GLU B CA  1 
ATOM   4613 C C   . GLU B 1 233 ? 34.893  47.086 15.153  1.00 63.50  ? 233 GLU B C   1 
ATOM   4614 O O   . GLU B 1 233 ? 34.849  47.103 16.380  1.00 62.36  ? 233 GLU B O   1 
ATOM   4615 C CB  . GLU B 1 233 ? 35.849  49.340 14.494  1.00 66.55  ? 233 GLU B CB  1 
ATOM   4616 C CG  . GLU B 1 233 ? 37.174  48.868 13.923  1.00 67.46  ? 233 GLU B CG  1 
ATOM   4617 C CD  . GLU B 1 233 ? 38.006  50.013 13.334  1.00 70.64  ? 233 GLU B CD  1 
ATOM   4618 O OE1 . GLU B 1 233 ? 38.215  51.036 14.015  1.00 71.22  ? 233 GLU B OE1 1 
ATOM   4619 O OE2 . GLU B 1 233 ? 38.453  49.899 12.173  1.00 74.49  ? 233 GLU B OE2 1 
ATOM   4620 N N   . ARG B 1 234 ? 35.103  45.995 14.429  1.00 64.23  ? 234 ARG B N   1 
ATOM   4621 C CA  . ARG B 1 234 ? 35.279  44.628 14.938  1.00 68.64  ? 234 ARG B CA  1 
ATOM   4622 C C   . ARG B 1 234 ? 34.083  43.878 14.390  1.00 69.49  ? 234 ARG B C   1 
ATOM   4623 O O   . ARG B 1 234 ? 34.165  42.685 14.105  1.00 69.78  ? 234 ARG B O   1 
ATOM   4624 C CB  . ARG B 1 234 ? 35.279  44.495 16.464  1.00 74.58  ? 234 ARG B CB  1 
ATOM   4625 C CG  . ARG B 1 234 ? 35.036  43.044 16.962  1.00 82.72  ? 234 ARG B CG  1 
ATOM   4626 C CD  . ARG B 1 234 ? 36.043  42.036 16.374  1.00 86.29  ? 234 ARG B CD  1 
ATOM   4627 N NE  . ARG B 1 234 ? 35.386  40.849 15.814  1.00 91.90  ? 234 ARG B NE  1 
ATOM   4628 C CZ  . ARG B 1 234 ? 35.061  39.754 16.507  1.00 95.09  ? 234 ARG B CZ  1 
ATOM   4629 N NH1 . ARG B 1 234 ? 35.323  39.659 17.806  1.00 94.61  ? 234 ARG B NH1 1 
ATOM   4630 N NH2 . ARG B 1 234 ? 34.484  38.730 15.884  1.00 96.66  ? 234 ARG B NH2 1 
ATOM   4631 N N   . SER B 1 235 ? 32.954  44.577 14.315  1.00 69.62  ? 235 SER B N   1 
ATOM   4632 C CA  . SER B 1 235 ? 31.740  44.017 13.748  1.00 67.27  ? 235 SER B CA  1 
ATOM   4633 C C   . SER B 1 235 ? 32.065  44.071 12.247  1.00 66.00  ? 235 SER B C   1 
ATOM   4634 O O   . SER B 1 235 ? 31.800  43.123 11.506  1.00 66.20  ? 235 SER B O   1 
ATOM   4635 C CB  . SER B 1 235 ? 30.522  44.883 14.121  1.00 69.54  ? 235 SER B CB  1 
ATOM   4636 O OG  . SER B 1 235 ? 30.354  44.998 15.537  1.00 60.78  ? 235 SER B OG  1 
ATOM   4637 N N   . MET B 1 236 ? 32.728  45.152 11.831  1.00 64.15  ? 236 MET B N   1 
ATOM   4638 C CA  . MET B 1 236 ? 33.171  45.312 10.442  1.00 64.67  ? 236 MET B CA  1 
ATOM   4639 C C   . MET B 1 236 ? 34.295  44.304 10.169  1.00 64.27  ? 236 MET B C   1 
ATOM   4640 O O   . MET B 1 236 ? 34.273  43.580 9.166   1.00 62.91  ? 236 MET B O   1 
ATOM   4641 C CB  . MET B 1 236 ? 33.707  46.727 10.193  1.00 64.42  ? 236 MET B CB  1 
ATOM   4642 C CG  . MET B 1 236 ? 34.529  46.849 8.905   1.00 59.83  ? 236 MET B CG  1 
ATOM   4643 S SD  . MET B 1 236 ? 35.045  48.531 8.517   1.00 60.21  ? 236 MET B SD  1 
ATOM   4644 C CE  . MET B 1 236 ? 36.553  48.647 9.418   1.00 57.78  ? 236 MET B CE  1 
ATOM   4645 N N   . LYS B 1 237 ? 35.288  44.297 11.065  1.00 62.46  ? 237 LYS B N   1 
ATOM   4646 C CA  . LYS B 1 237 ? 36.426  43.385 10.981  1.00 59.61  ? 237 LYS B CA  1 
ATOM   4647 C C   . LYS B 1 237 ? 35.992  41.922 11.101  1.00 61.46  ? 237 LYS B C   1 
ATOM   4648 O O   . LYS B 1 237 ? 36.774  41.017 10.779  1.00 61.95  ? 237 LYS B O   1 
ATOM   4649 C CB  . LYS B 1 237 ? 37.451  43.707 12.057  1.00 55.09  ? 237 LYS B CB  1 
ATOM   4650 C CG  . LYS B 1 237 ? 38.214  44.998 11.873  1.00 52.29  ? 237 LYS B CG  1 
ATOM   4651 C CD  . LYS B 1 237 ? 39.077  45.204 13.112  1.00 52.77  ? 237 LYS B CD  1 
ATOM   4652 C CE  . LYS B 1 237 ? 40.287  46.088 12.882  1.00 51.43  ? 237 LYS B CE  1 
ATOM   4653 N NZ  . LYS B 1 237 ? 39.947  47.525 12.896  1.00 56.43  ? 237 LYS B NZ  1 
ATOM   4654 N N   . ARG B 1 238 ? 34.756  41.698 11.567  1.00 61.96  ? 238 ARG B N   1 
ATOM   4655 C CA  . ARG B 1 238 ? 34.189  40.353 11.683  1.00 62.42  ? 238 ARG B CA  1 
ATOM   4656 C C   . ARG B 1 238 ? 34.111  39.769 10.285  1.00 63.44  ? 238 ARG B C   1 
ATOM   4657 O O   . ARG B 1 238 ? 34.003  38.558 10.138  1.00 64.06  ? 238 ARG B O   1 
ATOM   4658 C CB  . ARG B 1 238 ? 32.768  40.379 12.257  1.00 64.36  ? 238 ARG B CB  1 
ATOM   4659 C CG  . ARG B 1 238 ? 32.661  40.339 13.776  1.00 66.08  ? 238 ARG B CG  1 
ATOM   4660 C CD  . ARG B 1 238 ? 31.757  39.188 14.264  1.00 66.92  ? 238 ARG B CD  1 
ATOM   4661 N NE  . ARG B 1 238 ? 30.358  39.561 14.502  1.00 65.76  ? 238 ARG B NE  1 
ATOM   4662 C CZ  . ARG B 1 238 ? 29.318  38.811 14.140  1.00 66.56  ? 238 ARG B CZ  1 
ATOM   4663 N NH1 . ARG B 1 238 ? 29.507  37.663 13.518  1.00 63.59  ? 238 ARG B NH1 1 
ATOM   4664 N NH2 . ARG B 1 238 ? 28.079  39.196 14.421  1.00 67.06  ? 238 ARG B NH2 1 
ATOM   4665 N N   . PHE B 1 239 ? 34.114  40.655 9.276   1.00 64.48  ? 239 PHE B N   1 
ATOM   4666 C CA  . PHE B 1 239 ? 34.059  40.313 7.835   1.00 62.57  ? 239 PHE B CA  1 
ATOM   4667 C C   . PHE B 1 239 ? 35.311  39.644 7.228   1.00 59.54  ? 239 PHE B C   1 
ATOM   4668 O O   . PHE B 1 239 ? 35.208  38.850 6.297   1.00 57.90  ? 239 PHE B O   1 
ATOM   4669 C CB  . PHE B 1 239 ? 33.717  41.563 7.001   1.00 59.01  ? 239 PHE B CB  1 
ATOM   4670 C CG  . PHE B 1 239 ? 32.245  41.770 6.793   1.00 59.61  ? 239 PHE B CG  1 
ATOM   4671 C CD1 . PHE B 1 239 ? 31.459  40.768 6.230   1.00 58.45  ? 239 PHE B CD1 1 
ATOM   4672 C CD2 . PHE B 1 239 ? 31.639  42.966 7.152   1.00 62.38  ? 239 PHE B CD2 1 
ATOM   4673 C CE1 . PHE B 1 239 ? 30.092  40.949 6.022   1.00 56.46  ? 239 PHE B CE1 1 
ATOM   4674 C CE2 . PHE B 1 239 ? 30.265  43.159 6.949   1.00 61.38  ? 239 PHE B CE2 1 
ATOM   4675 C CZ  . PHE B 1 239 ? 29.494  42.142 6.381   1.00 57.97  ? 239 PHE B CZ  1 
ATOM   4676 N N   . SER B 1 240 ? 36.485  40.019 7.722   1.00 57.24  ? 240 SER B N   1 
ATOM   4677 C CA  . SER B 1 240 ? 37.755  39.483 7.240   1.00 55.33  ? 240 SER B CA  1 
ATOM   4678 C C   . SER B 1 240 ? 38.083  38.160 7.954   1.00 53.03  ? 240 SER B C   1 
ATOM   4679 O O   . SER B 1 240 ? 37.994  38.070 9.178   1.00 51.45  ? 240 SER B O   1 
ATOM   4680 C CB  . SER B 1 240 ? 38.851  40.532 7.483   1.00 54.79  ? 240 SER B CB  1 
ATOM   4681 O OG  . SER B 1 240 ? 40.102  40.163 6.937   1.00 53.07  ? 240 SER B OG  1 
ATOM   4682 N N   . PRO B 1 241 ? 38.517  37.139 7.196   1.00 50.83  ? 241 PRO B N   1 
ATOM   4683 C CA  . PRO B 1 241 ? 38.873  35.805 7.714   1.00 52.69  ? 241 PRO B CA  1 
ATOM   4684 C C   . PRO B 1 241 ? 40.013  35.827 8.755   1.00 54.40  ? 241 PRO B C   1 
ATOM   4685 O O   . PRO B 1 241 ? 40.213  34.861 9.497   1.00 54.65  ? 241 PRO B O   1 
ATOM   4686 C CB  . PRO B 1 241 ? 39.329  35.046 6.456   1.00 52.33  ? 241 PRO B CB  1 
ATOM   4687 C CG  . PRO B 1 241 ? 38.670  35.790 5.326   1.00 52.84  ? 241 PRO B CG  1 
ATOM   4688 C CD  . PRO B 1 241 ? 38.760  37.227 5.747   1.00 50.01  ? 241 PRO B CD  1 
ATOM   4689 N N   . ILE B 1 242 ? 40.828  36.877 8.720   1.00 54.61  ? 242 ILE B N   1 
ATOM   4690 C CA  . ILE B 1 242 ? 41.936  37.005 9.647   1.00 52.87  ? 242 ILE B CA  1 
ATOM   4691 C C   . ILE B 1 242 ? 41.523  38.097 10.614  1.00 54.95  ? 242 ILE B C   1 
ATOM   4692 O O   . ILE B 1 242 ? 41.650  37.929 11.819  1.00 61.02  ? 242 ILE B O   1 
ATOM   4693 C CB  . ILE B 1 242 ? 43.284  37.391 8.953   1.00 52.80  ? 242 ILE B CB  1 
ATOM   4694 C CG1 . ILE B 1 242 ? 43.428  36.736 7.580   1.00 49.47  ? 242 ILE B CG1 1 
ATOM   4695 C CG2 . ILE B 1 242 ? 44.456  36.866 9.777   1.00 53.88  ? 242 ILE B CG2 1 
ATOM   4696 C CD1 . ILE B 1 242 ? 44.111  37.668 6.573   1.00 52.05  ? 242 ILE B CD1 1 
ATOM   4697 N N   . GLY B 1 243 ? 41.019  39.215 10.107  1.00 54.70  ? 243 GLY B N   1 
ATOM   4698 C CA  . GLY B 1 243 ? 40.570  40.245 11.021  1.00 54.75  ? 243 GLY B CA  1 
ATOM   4699 C C   . GLY B 1 243 ? 40.794  41.682 10.617  1.00 58.13  ? 243 GLY B C   1 
ATOM   4700 O O   . GLY B 1 243 ? 40.540  42.586 11.417  1.00 57.59  ? 243 GLY B O   1 
ATOM   4701 N N   . ARG B 1 244 ? 41.232  41.917 9.382   1.00 59.96  ? 244 ARG B N   1 
ATOM   4702 C CA  . ARG B 1 244 ? 41.479  43.286 8.941   1.00 60.90  ? 244 ARG B CA  1 
ATOM   4703 C C   . ARG B 1 244 ? 40.681  43.727 7.751   1.00 59.13  ? 244 ARG B C   1 
ATOM   4704 O O   . ARG B 1 244 ? 40.755  43.118 6.684   1.00 58.27  ? 244 ARG B O   1 
ATOM   4705 C CB  . ARG B 1 244 ? 42.966  43.516 8.644   1.00 66.73  ? 244 ARG B CB  1 
ATOM   4706 C CG  . ARG B 1 244 ? 43.707  42.267 8.139   1.00 69.59  ? 244 ARG B CG  1 
ATOM   4707 C CD  . ARG B 1 244 ? 45.204  42.515 8.040   1.00 69.24  ? 244 ARG B CD  1 
ATOM   4708 N NE  . ARG B 1 244 ? 45.957  41.272 8.068   1.00 66.62  ? 244 ARG B NE  1 
ATOM   4709 C CZ  . ARG B 1 244 ? 46.705  40.822 7.068   1.00 65.85  ? 244 ARG B CZ  1 
ATOM   4710 N NH1 . ARG B 1 244 ? 46.832  41.508 5.943   1.00 66.04  ? 244 ARG B NH1 1 
ATOM   4711 N NH2 . ARG B 1 244 ? 47.346  39.671 7.208   1.00 66.80  ? 244 ARG B NH2 1 
ATOM   4712 N N   . VAL B 1 245 ? 39.846  44.733 7.976   1.00 58.31  ? 245 VAL B N   1 
ATOM   4713 C CA  . VAL B 1 245 ? 39.060  45.318 6.911   1.00 58.35  ? 245 VAL B CA  1 
ATOM   4714 C C   . VAL B 1 245 ? 39.471  46.783 7.004   1.00 64.16  ? 245 VAL B C   1 
ATOM   4715 O O   . VAL B 1 245 ? 39.210  47.441 8.017   1.00 67.28  ? 245 VAL B O   1 
ATOM   4716 C CB  . VAL B 1 245 ? 37.533  45.147 7.111   1.00 49.44  ? 245 VAL B CB  1 
ATOM   4717 C CG1 . VAL B 1 245 ? 36.805  45.744 5.938   1.00 48.56  ? 245 VAL B CG1 1 
ATOM   4718 C CG2 . VAL B 1 245 ? 37.163  43.687 7.207   1.00 42.44  ? 245 VAL B CG2 1 
ATOM   4719 N N   . LYS B 1 246 ? 40.190  47.273 5.995   1.00 68.13  ? 246 LYS B N   1 
ATOM   4720 C CA  . LYS B 1 246 ? 40.655  48.653 6.028   1.00 71.31  ? 246 LYS B CA  1 
ATOM   4721 C C   . LYS B 1 246 ? 40.163  49.605 4.961   1.00 70.71  ? 246 LYS B C   1 
ATOM   4722 O O   . LYS B 1 246 ? 39.744  49.193 3.881   1.00 67.89  ? 246 LYS B O   1 
ATOM   4723 C CB  . LYS B 1 246 ? 42.177  48.699 6.123   1.00 74.55  ? 246 LYS B CB  1 
ATOM   4724 C CG  . LYS B 1 246 ? 42.682  48.236 7.470   1.00 83.69  ? 246 LYS B CG  1 
ATOM   4725 C CD  . LYS B 1 246 ? 41.971  48.959 8.636   1.00 88.20  ? 246 LYS B CD  1 
ATOM   4726 C CE  . LYS B 1 246 ? 42.658  48.658 9.983   1.00 93.84  ? 246 LYS B CE  1 
ATOM   4727 N NZ  . LYS B 1 246 ? 43.002  47.193 10.187  1.00 97.13  ? 246 LYS B NZ  1 
ATOM   4728 N N   . SER B 1 247 ? 40.244  50.888 5.293   1.00 75.48  ? 247 SER B N   1 
ATOM   4729 C CA  . SER B 1 247 ? 39.805  51.967 4.427   1.00 81.05  ? 247 SER B CA  1 
ATOM   4730 C C   . SER B 1 247 ? 40.950  52.656 3.676   1.00 82.83  ? 247 SER B C   1 
ATOM   4731 O O   . SER B 1 247 ? 42.137  52.351 3.882   1.00 80.77  ? 247 SER B O   1 
ATOM   4732 C CB  . SER B 1 247 ? 39.037  53.007 5.259   1.00 82.81  ? 247 SER B CB  1 
ATOM   4733 O OG  . SER B 1 247 ? 39.882  53.659 6.206   1.00 84.07  ? 247 SER B OG  1 
ATOM   4734 N N   . LYS B 1 248 ? 40.566  53.610 2.828   1.00 84.61  ? 248 LYS B N   1 
ATOM   4735 C CA  . LYS B 1 248 ? 41.493  54.399 2.029   1.00 85.47  ? 248 LYS B CA  1 
ATOM   4736 C C   . LYS B 1 248 ? 40.796  55.709 1.702   1.00 85.54  ? 248 LYS B C   1 
ATOM   4737 O O   . LYS B 1 248 ? 39.928  55.735 0.845   1.00 84.14  ? 248 LYS B O   1 
ATOM   4738 C CB  . LYS B 1 248 ? 41.850  53.677 0.725   1.00 85.14  ? 248 LYS B CB  1 
ATOM   4739 C CG  . LYS B 1 248 ? 43.225  53.022 0.722   1.00 85.19  ? 248 LYS B CG  1 
ATOM   4740 C CD  . LYS B 1 248 ? 43.696  52.667 -0.695  1.00 81.40  ? 248 LYS B CD  1 
ATOM   4741 C CE  . LYS B 1 248 ? 43.895  53.915 -1.545  1.00 78.99  ? 248 LYS B CE  1 
ATOM   4742 N NZ  . LYS B 1 248 ? 44.434  53.600 -2.880  1.00 75.54  ? 248 LYS B NZ  1 
ATOM   4743 N N   . LEU B 1 249 ? 41.152  56.786 2.399   1.00 88.53  ? 249 LEU B N   1 
ATOM   4744 C CA  . LEU B 1 249 ? 40.524  58.093 2.165   1.00 91.23  ? 249 LEU B CA  1 
ATOM   4745 C C   . LEU B 1 249 ? 41.363  59.246 2.725   1.00 90.43  ? 249 LEU B C   1 
ATOM   4746 O O   . LEU B 1 249 ? 40.846  60.303 3.104   1.00 88.20  ? 249 LEU B O   1 
ATOM   4747 C CB  . LEU B 1 249 ? 39.104  58.116 2.766   1.00 94.80  ? 249 LEU B CB  1 
ATOM   4748 C CG  . LEU B 1 249 ? 38.889  57.839 4.270   1.00 98.21  ? 249 LEU B CG  1 
ATOM   4749 C CD1 . LEU B 1 249 ? 37.443  58.158 4.648   1.00 99.14  ? 249 LEU B CD1 1 
ATOM   4750 C CD2 . LEU B 1 249 ? 39.251  56.400 4.658   1.00 95.93  ? 249 LEU B CD2 1 
ATOM   4751 N N   . SER B 1 256 ? 37.756  62.097 -1.744  1.00 82.49  ? 256 SER B N   1 
ATOM   4752 C CA  . SER B 1 256 ? 36.789  61.822 -0.689  1.00 80.60  ? 256 SER B CA  1 
ATOM   4753 C C   . SER B 1 256 ? 35.906  60.627 -1.049  1.00 79.70  ? 256 SER B C   1 
ATOM   4754 O O   . SER B 1 256 ? 34.676  60.670 -0.934  1.00 78.43  ? 256 SER B O   1 
ATOM   4755 C CB  . SER B 1 256 ? 35.945  63.053 -0.421  1.00 82.41  ? 256 SER B CB  1 
ATOM   4756 N N   . LYS B 1 257 ? 36.548  59.573 -1.532  1.00 77.34  ? 257 LYS B N   1 
ATOM   4757 C CA  . LYS B 1 257 ? 35.853  58.356 -1.897  1.00 76.26  ? 257 LYS B CA  1 
ATOM   4758 C C   . LYS B 1 257 ? 36.793  57.290 -1.383  1.00 75.86  ? 257 LYS B C   1 
ATOM   4759 O O   . LYS B 1 257 ? 37.922  57.182 -1.860  1.00 78.36  ? 257 LYS B O   1 
ATOM   4760 C CB  . LYS B 1 257 ? 35.699  58.256 -3.415  1.00 76.81  ? 257 LYS B CB  1 
ATOM   4761 C CG  . LYS B 1 257 ? 34.603  57.303 -3.859  1.00 79.52  ? 257 LYS B CG  1 
ATOM   4762 C CD  . LYS B 1 257 ? 34.494  57.208 -5.381  1.00 82.67  ? 257 LYS B CD  1 
ATOM   4763 C CE  . LYS B 1 257 ? 33.398  56.216 -5.790  1.00 85.38  ? 257 LYS B CE  1 
ATOM   4764 N NZ  . LYS B 1 257 ? 33.322  55.921 -7.260  1.00 84.17  ? 257 LYS B NZ  1 
ATOM   4765 N N   . GLU B 1 258 ? 36.368  56.585 -0.340  1.00 74.46  ? 258 GLU B N   1 
ATOM   4766 C CA  . GLU B 1 258 ? 37.190  55.540 0.260   1.00 71.11  ? 258 GLU B CA  1 
ATOM   4767 C C   . GLU B 1 258 ? 36.952  54.159 -0.323  1.00 67.49  ? 258 GLU B C   1 
ATOM   4768 O O   . GLU B 1 258 ? 35.815  53.781 -0.604  1.00 65.78  ? 258 GLU B O   1 
ATOM   4769 C CB  . GLU B 1 258 ? 37.005  55.494 1.785   1.00 71.59  ? 258 GLU B CB  1 
ATOM   4770 C CG  . GLU B 1 258 ? 35.613  55.105 2.243   1.00 75.58  ? 258 GLU B CG  1 
ATOM   4771 C CD  . GLU B 1 258 ? 35.462  55.137 3.753   1.00 76.07  ? 258 GLU B CD  1 
ATOM   4772 O OE1 . GLU B 1 258 ? 36.141  54.332 4.423   1.00 77.99  ? 258 GLU B OE1 1 
ATOM   4773 O OE2 . GLU B 1 258 ? 34.665  55.957 4.266   1.00 76.25  ? 258 GLU B OE2 1 
ATOM   4774 N N   . ILE B 1 259 ? 38.039  53.426 -0.545  1.00 65.05  ? 259 ILE B N   1 
ATOM   4775 C CA  . ILE B 1 259 ? 37.935  52.081 -1.072  1.00 62.10  ? 259 ILE B CA  1 
ATOM   4776 C C   . ILE B 1 259 ? 38.372  51.054 -0.001  1.00 62.29  ? 259 ILE B C   1 
ATOM   4777 O O   . ILE B 1 259 ? 39.419  51.219 0.661   1.00 59.21  ? 259 ILE B O   1 
ATOM   4778 C CB  . ILE B 1 259 ? 38.662  51.917 -2.470  1.00 61.20  ? 259 ILE B CB  1 
ATOM   4779 C CG1 . ILE B 1 259 ? 40.048  51.284 -2.333  1.00 65.41  ? 259 ILE B CG1 1 
ATOM   4780 C CG2 . ILE B 1 259 ? 38.715  53.239 -3.222  1.00 56.08  ? 259 ILE B CG2 1 
ATOM   4781 C CD1 . ILE B 1 259 ? 40.063  49.769 -2.658  1.00 67.19  ? 259 ILE B CD1 1 
ATOM   4782 N N   . TYR B 1 260 ? 37.505  50.049 0.196   1.00 60.74  ? 260 TYR B N   1 
ATOM   4783 C CA  . TYR B 1 260 ? 37.665  48.956 1.174   1.00 56.04  ? 260 TYR B CA  1 
ATOM   4784 C C   . TYR B 1 260 ? 38.326  47.662 0.707   1.00 51.03  ? 260 TYR B C   1 
ATOM   4785 O O   . TYR B 1 260 ? 38.139  47.228 -0.436  1.00 48.93  ? 260 TYR B O   1 
ATOM   4786 C CB  . TYR B 1 260 ? 36.297  48.584 1.745   1.00 55.45  ? 260 TYR B CB  1 
ATOM   4787 C CG  . TYR B 1 260 ? 36.061  49.160 3.101   1.00 57.20  ? 260 TYR B CG  1 
ATOM   4788 C CD1 . TYR B 1 260 ? 35.517  50.438 3.257   1.00 56.40  ? 260 TYR B CD1 1 
ATOM   4789 C CD2 . TYR B 1 260 ? 36.464  48.461 4.243   1.00 58.04  ? 260 TYR B CD2 1 
ATOM   4790 C CE1 . TYR B 1 260 ? 35.392  51.010 4.526   1.00 57.76  ? 260 TYR B CE1 1 
ATOM   4791 C CE2 . TYR B 1 260 ? 36.339  49.023 5.516   1.00 55.09  ? 260 TYR B CE2 1 
ATOM   4792 C CZ  . TYR B 1 260 ? 35.810  50.297 5.646   1.00 57.25  ? 260 TYR B CZ  1 
ATOM   4793 O OH  . TYR B 1 260 ? 35.737  50.867 6.892   1.00 62.39  ? 260 TYR B OH  1 
ATOM   4794 N N   . SER B 1 261 ? 39.034  47.014 1.625   1.00 44.28  ? 261 SER B N   1 
ATOM   4795 C CA  . SER B 1 261 ? 39.673  45.740 1.315   1.00 44.05  ? 261 SER B CA  1 
ATOM   4796 C C   . SER B 1 261 ? 39.473  44.809 2.507   1.00 40.53  ? 261 SER B C   1 
ATOM   4797 O O   . SER B 1 261 ? 39.591  45.235 3.643   1.00 39.71  ? 261 SER B O   1 
ATOM   4798 C CB  . SER B 1 261 ? 41.171  45.917 0.951   1.00 45.54  ? 261 SER B CB  1 
ATOM   4799 O OG  . SER B 1 261 ? 41.957  46.405 2.026   1.00 48.61  ? 261 SER B OG  1 
ATOM   4800 N N   . ILE B 1 262 ? 39.072  43.573 2.234   1.00 40.18  ? 262 ILE B N   1 
ATOM   4801 C CA  . ILE B 1 262 ? 38.806  42.570 3.258   1.00 39.56  ? 262 ILE B CA  1 
ATOM   4802 C C   . ILE B 1 262 ? 39.887  41.539 3.036   1.00 41.93  ? 262 ILE B C   1 
ATOM   4803 O O   . ILE B 1 262 ? 39.824  40.784 2.056   1.00 43.86  ? 262 ILE B O   1 
ATOM   4804 C CB  . ILE B 1 262 ? 37.361  41.883 3.043   1.00 42.16  ? 262 ILE B CB  1 
ATOM   4805 C CG1 . ILE B 1 262 ? 36.200  42.772 3.553   1.00 40.89  ? 262 ILE B CG1 1 
ATOM   4806 C CG2 . ILE B 1 262 ? 37.252  40.545 3.789   1.00 33.88  ? 262 ILE B CG2 1 
ATOM   4807 C CD1 . ILE B 1 262 ? 35.894  44.043 2.742   1.00 37.94  ? 262 ILE B CD1 1 
ATOM   4808 N N   . ASP B 1 263 ? 40.887  41.498 3.908   1.00 42.99  ? 263 ASP B N   1 
ATOM   4809 C CA  . ASP B 1 263 ? 41.971  40.527 3.725   1.00 47.81  ? 263 ASP B CA  1 
ATOM   4810 C C   . ASP B 1 263 ? 41.579  39.077 3.975   1.00 49.21  ? 263 ASP B C   1 
ATOM   4811 O O   . ASP B 1 263 ? 41.154  38.710 5.072   1.00 55.17  ? 263 ASP B O   1 
ATOM   4812 C CB  . ASP B 1 263 ? 43.189  40.927 4.544   1.00 48.20  ? 263 ASP B CB  1 
ATOM   4813 C CG  . ASP B 1 263 ? 43.646  42.328 4.225   1.00 51.37  ? 263 ASP B CG  1 
ATOM   4814 O OD1 . ASP B 1 263 ? 43.219  42.877 3.176   1.00 54.72  ? 263 ASP B OD1 1 
ATOM   4815 O OD2 . ASP B 1 263 ? 44.424  42.898 5.021   1.00 53.84  ? 263 ASP B OD2 1 
ATOM   4816 N N   . GLY B 1 264 ? 41.740  38.252 2.950   1.00 48.25  ? 264 GLY B N   1 
ATOM   4817 C CA  . GLY B 1 264 ? 41.373  36.856 3.050   1.00 44.61  ? 264 GLY B CA  1 
ATOM   4818 C C   . GLY B 1 264 ? 40.353  36.575 1.961   1.00 45.12  ? 264 GLY B C   1 
ATOM   4819 O O   . GLY B 1 264 ? 40.139  35.418 1.560   1.00 46.19  ? 264 GLY B O   1 
ATOM   4820 N N   . VAL B 1 265 ? 39.795  37.659 1.418   1.00 41.49  ? 265 VAL B N   1 
ATOM   4821 C CA  . VAL B 1 265 ? 38.777  37.585 0.370   1.00 36.51  ? 265 VAL B CA  1 
ATOM   4822 C C   . VAL B 1 265 ? 39.147  38.463 -0.847  1.00 36.78  ? 265 VAL B C   1 
ATOM   4823 O O   . VAL B 1 265 ? 39.511  39.635 -0.691  1.00 35.57  ? 265 VAL B O   1 
ATOM   4824 C CB  . VAL B 1 265 ? 37.420  38.083 0.945   1.00 34.23  ? 265 VAL B CB  1 
ATOM   4825 C CG1 . VAL B 1 265 ? 36.276  37.745 -0.010  1.00 29.92  ? 265 VAL B CG1 1 
ATOM   4826 C CG2 . VAL B 1 265 ? 37.208  37.519 2.350   1.00 25.51  ? 265 VAL B CG2 1 
ATOM   4827 N N   . SER B 1 266 ? 39.049  37.914 -2.054  1.00 36.66  ? 266 SER B N   1 
ATOM   4828 C CA  . SER B 1 266 ? 39.364  38.713 -3.232  1.00 36.34  ? 266 SER B CA  1 
ATOM   4829 C C   . SER B 1 266 ? 38.126  39.429 -3.747  1.00 35.11  ? 266 SER B C   1 
ATOM   4830 O O   . SER B 1 266 ? 37.236  38.823 -4.329  1.00 35.05  ? 266 SER B O   1 
ATOM   4831 C CB  . SER B 1 266 ? 39.962  37.855 -4.339  1.00 39.58  ? 266 SER B CB  1 
ATOM   4832 O OG  . SER B 1 266 ? 39.072  36.825 -4.732  1.00 49.97  ? 266 SER B OG  1 
ATOM   4833 N N   . ILE B 1 267 ? 38.047  40.723 -3.514  1.00 33.33  ? 267 ILE B N   1 
ATOM   4834 C CA  . ILE B 1 267 ? 36.900  41.451 -3.970  1.00 32.24  ? 267 ILE B CA  1 
ATOM   4835 C C   . ILE B 1 267 ? 37.138  41.759 -5.432  1.00 35.24  ? 267 ILE B C   1 
ATOM   4836 O O   . ILE B 1 267 ? 38.006  42.566 -5.774  1.00 34.23  ? 267 ILE B O   1 
ATOM   4837 C CB  . ILE B 1 267 ? 36.712  42.712 -3.129  1.00 35.53  ? 267 ILE B CB  1 
ATOM   4838 C CG1 . ILE B 1 267 ? 36.652  42.328 -1.651  1.00 34.58  ? 267 ILE B CG1 1 
ATOM   4839 C CG2 . ILE B 1 267 ? 35.401  43.370 -3.439  1.00 42.90  ? 267 ILE B CG2 1 
ATOM   4840 C CD1 . ILE B 1 267 ? 36.628  43.495 -0.762  1.00 36.04  ? 267 ILE B CD1 1 
ATOM   4841 N N   . LEU B 1 268 ? 36.398  41.084 -6.306  1.00 35.74  ? 268 LEU B N   1 
ATOM   4842 C CA  . LEU B 1 268 ? 36.539  41.287 -7.746  1.00 34.60  ? 268 LEU B CA  1 
ATOM   4843 C C   . LEU B 1 268 ? 35.274  41.853 -8.388  1.00 35.36  ? 268 LEU B C   1 
ATOM   4844 O O   . LEU B 1 268 ? 34.373  41.109 -8.731  1.00 39.14  ? 268 LEU B O   1 
ATOM   4845 C CB  . LEU B 1 268 ? 36.946  39.961 -8.400  1.00 36.06  ? 268 LEU B CB  1 
ATOM   4846 C CG  . LEU B 1 268 ? 38.429  39.863 -8.806  1.00 37.93  ? 268 LEU B CG  1 
ATOM   4847 C CD1 . LEU B 1 268 ? 39.394  40.185 -7.681  1.00 35.27  ? 268 LEU B CD1 1 
ATOM   4848 C CD2 . LEU B 1 268 ? 38.705  38.501 -9.310  1.00 41.29  ? 268 LEU B CD2 1 
ATOM   4849 N N   . ASP B 1 269 ? 35.220  43.173 -8.558  1.00 37.55  ? 269 ASP B N   1 
ATOM   4850 C CA  . ASP B 1 269 ? 34.065  43.860 -9.149  1.00 35.40  ? 269 ASP B CA  1 
ATOM   4851 C C   . ASP B 1 269 ? 33.847  43.535 -10.635 1.00 34.70  ? 269 ASP B C   1 
ATOM   4852 O O   . ASP B 1 269 ? 34.709  43.817 -11.478 1.00 38.36  ? 269 ASP B O   1 
ATOM   4853 C CB  . ASP B 1 269 ? 34.195  45.357 -8.931  1.00 34.08  ? 269 ASP B CB  1 
ATOM   4854 C CG  . ASP B 1 269 ? 32.905  46.118 -9.237  1.00 39.59  ? 269 ASP B CG  1 
ATOM   4855 O OD1 . ASP B 1 269 ? 31.973  45.558 -9.889  1.00 37.52  ? 269 ASP B OD1 1 
ATOM   4856 O OD2 . ASP B 1 269 ? 32.836  47.307 -8.830  1.00 40.02  ? 269 ASP B OD2 1 
ATOM   4857 N N   . TYR B 1 270 ? 32.652  43.026 -10.954 1.00 29.11  ? 270 TYR B N   1 
ATOM   4858 C CA  . TYR B 1 270 ? 32.321  42.601 -12.305 1.00 23.33  ? 270 TYR B CA  1 
ATOM   4859 C C   . TYR B 1 270 ? 32.221  43.695 -13.335 1.00 22.49  ? 270 TYR B C   1 
ATOM   4860 O O   . TYR B 1 270 ? 32.279  43.432 -14.538 1.00 24.97  ? 270 TYR B O   1 
ATOM   4861 C CB  . TYR B 1 270 ? 31.072  41.749 -12.306 1.00 23.62  ? 270 TYR B CB  1 
ATOM   4862 C CG  . TYR B 1 270 ? 31.158  40.635 -13.298 1.00 26.37  ? 270 TYR B CG  1 
ATOM   4863 C CD1 . TYR B 1 270 ? 30.943  40.875 -14.653 1.00 26.37  ? 270 TYR B CD1 1 
ATOM   4864 C CD2 . TYR B 1 270 ? 31.498  39.327 -12.895 1.00 27.46  ? 270 TYR B CD2 1 
ATOM   4865 C CE1 . TYR B 1 270 ? 31.062  39.846 -15.600 1.00 24.56  ? 270 TYR B CE1 1 
ATOM   4866 C CE2 . TYR B 1 270 ? 31.618  38.296 -13.832 1.00 23.58  ? 270 TYR B CE2 1 
ATOM   4867 C CZ  . TYR B 1 270 ? 31.401  38.568 -15.182 1.00 23.99  ? 270 TYR B CZ  1 
ATOM   4868 O OH  . TYR B 1 270 ? 31.536  37.583 -16.128 1.00 22.68  ? 270 TYR B OH  1 
ATOM   4869 N N   . LEU B 1 271 ? 32.013  44.911 -12.869 1.00 21.11  ? 271 LEU B N   1 
ATOM   4870 C CA  . LEU B 1 271 ? 31.977  46.071 -13.745 1.00 26.36  ? 271 LEU B CA  1 
ATOM   4871 C C   . LEU B 1 271 ? 33.390  46.245 -14.371 1.00 27.13  ? 271 LEU B C   1 
ATOM   4872 O O   . LEU B 1 271 ? 33.554  46.469 -15.581 1.00 30.04  ? 271 LEU B O   1 
ATOM   4873 C CB  . LEU B 1 271 ? 31.609  47.295 -12.899 1.00 28.53  ? 271 LEU B CB  1 
ATOM   4874 C CG  . LEU B 1 271 ? 31.391  48.682 -13.491 1.00 27.84  ? 271 LEU B CG  1 
ATOM   4875 C CD1 . LEU B 1 271 ? 30.452  48.639 -14.697 1.00 32.74  ? 271 LEU B CD1 1 
ATOM   4876 C CD2 . LEU B 1 271 ? 30.804  49.534 -12.389 1.00 33.23  ? 271 LEU B CD2 1 
ATOM   4877 N N   . ASP B 1 272 ? 34.414  46.134 -13.532 1.00 30.87  ? 272 ASP B N   1 
ATOM   4878 C CA  . ASP B 1 272 ? 35.815  46.250 -13.969 1.00 30.18  ? 272 ASP B CA  1 
ATOM   4879 C C   . ASP B 1 272 ? 36.248  45.109 -14.878 1.00 27.78  ? 272 ASP B C   1 
ATOM   4880 O O   . ASP B 1 272 ? 36.901  45.348 -15.904 1.00 29.93  ? 272 ASP B O   1 
ATOM   4881 C CB  . ASP B 1 272 ? 36.689  46.339 -12.738 1.00 28.41  ? 272 ASP B CB  1 
ATOM   4882 C CG  . ASP B 1 272 ? 36.384  47.561 -11.952 1.00 31.65  ? 272 ASP B CG  1 
ATOM   4883 O OD1 . ASP B 1 272 ? 35.961  48.544 -12.582 1.00 32.89  ? 272 ASP B OD1 1 
ATOM   4884 O OD2 . ASP B 1 272 ? 36.538  47.553 -10.723 1.00 42.40  ? 272 ASP B OD2 1 
ATOM   4885 N N   . LEU B 1 273 ? 35.858  43.884 -14.514 1.00 24.84  ? 273 LEU B N   1 
ATOM   4886 C CA  . LEU B 1 273 ? 36.168  42.691 -15.304 1.00 26.66  ? 273 LEU B CA  1 
ATOM   4887 C C   . LEU B 1 273 ? 35.548  42.810 -16.679 1.00 30.48  ? 273 LEU B C   1 
ATOM   4888 O O   . LEU B 1 273 ? 36.163  42.448 -17.687 1.00 31.61  ? 273 LEU B O   1 
ATOM   4889 C CB  . LEU B 1 273 ? 35.615  41.429 -14.664 1.00 22.37  ? 273 LEU B CB  1 
ATOM   4890 C CG  . LEU B 1 273 ? 35.688  41.254 -13.155 1.00 28.86  ? 273 LEU B CG  1 
ATOM   4891 C CD1 . LEU B 1 273 ? 35.637  39.770 -12.886 1.00 26.64  ? 273 LEU B CD1 1 
ATOM   4892 C CD2 . LEU B 1 273 ? 36.955  41.859 -12.562 1.00 32.94  ? 273 LEU B CD2 1 
ATOM   4893 N N   . TYR B 1 274 ? 34.303  43.284 -16.694 1.00 35.22  ? 274 TYR B N   1 
ATOM   4894 C CA  . TYR B 1 274 ? 33.512  43.477 -17.911 1.00 34.33  ? 274 TYR B CA  1 
ATOM   4895 C C   . TYR B 1 274 ? 34.073  44.535 -18.870 1.00 28.11  ? 274 TYR B C   1 
ATOM   4896 O O   . TYR B 1 274 ? 34.009  44.362 -20.086 1.00 24.52  ? 274 TYR B O   1 
ATOM   4897 C CB  . TYR B 1 274 ? 32.050  43.835 -17.543 1.00 38.98  ? 274 TYR B CB  1 
ATOM   4898 C CG  . TYR B 1 274 ? 31.120  43.801 -18.737 1.00 38.44  ? 274 TYR B CG  1 
ATOM   4899 C CD1 . TYR B 1 274 ? 30.597  42.578 -19.219 1.00 38.26  ? 274 TYR B CD1 1 
ATOM   4900 C CD2 . TYR B 1 274 ? 30.828  44.966 -19.436 1.00 36.72  ? 274 TYR B CD2 1 
ATOM   4901 C CE1 . TYR B 1 274 ? 29.812  42.528 -20.371 1.00 37.18  ? 274 TYR B CE1 1 
ATOM   4902 C CE2 . TYR B 1 274 ? 30.051  44.928 -20.584 1.00 38.69  ? 274 TYR B CE2 1 
ATOM   4903 C CZ  . TYR B 1 274 ? 29.545  43.713 -21.051 1.00 39.42  ? 274 TYR B CZ  1 
ATOM   4904 O OH  . TYR B 1 274 ? 28.789  43.722 -22.204 1.00 38.29  ? 274 TYR B OH  1 
ATOM   4905 N N   . LYS B 1 275 ? 34.529  45.662 -18.334 1.00 27.57  ? 275 LYS B N   1 
ATOM   4906 C CA  . LYS B 1 275 ? 35.080  46.725 -19.181 1.00 32.25  ? 275 LYS B CA  1 
ATOM   4907 C C   . LYS B 1 275 ? 36.411  46.264 -19.738 1.00 31.40  ? 275 LYS B C   1 
ATOM   4908 O O   . LYS B 1 275 ? 36.870  46.690 -20.794 1.00 33.12  ? 275 LYS B O   1 
ATOM   4909 C CB  . LYS B 1 275 ? 35.398  47.975 -18.360 1.00 36.39  ? 275 LYS B CB  1 
ATOM   4910 C CG  . LYS B 1 275 ? 34.275  48.686 -17.656 1.00 37.26  ? 275 LYS B CG  1 
ATOM   4911 C CD  . LYS B 1 275 ? 34.909  49.515 -16.552 1.00 40.71  ? 275 LYS B CD  1 
ATOM   4912 C CE  . LYS B 1 275 ? 34.047  50.681 -16.156 1.00 48.32  ? 275 LYS B CE  1 
ATOM   4913 N NZ  . LYS B 1 275 ? 34.499  51.283 -14.870 1.00 53.81  ? 275 LYS B NZ  1 
ATOM   4914 N N   . LYS B 1 276 ? 37.078  45.472 -18.926 1.00 33.10  ? 276 LYS B N   1 
ATOM   4915 C CA  . LYS B 1 276 ? 38.382  44.986 -19.253 1.00 30.12  ? 276 LYS B CA  1 
ATOM   4916 C C   . LYS B 1 276 ? 38.388  43.796 -20.197 1.00 28.16  ? 276 LYS B C   1 
ATOM   4917 O O   . LYS B 1 276 ? 39.139  43.781 -21.166 1.00 25.37  ? 276 LYS B O   1 
ATOM   4918 C CB  . LYS B 1 276 ? 39.112  44.702 -17.927 1.00 30.73  ? 276 LYS B CB  1 
ATOM   4919 C CG  . LYS B 1 276 ? 40.483  44.078 -18.051 1.00 33.61  ? 276 LYS B CG  1 
ATOM   4920 C CD  . LYS B 1 276 ? 41.491  44.810 -17.193 1.00 36.25  ? 276 LYS B CD  1 
ATOM   4921 C CE  . LYS B 1 276 ? 42.001  46.048 -17.887 1.00 34.85  ? 276 LYS B CE  1 
ATOM   4922 N NZ  . LYS B 1 276 ? 42.490  45.715 -19.254 1.00 38.93  ? 276 LYS B NZ  1 
ATOM   4923 N N   . PHE B 1 277 ? 37.504  42.837 -19.970 1.00 25.86  ? 277 PHE B N   1 
ATOM   4924 C CA  . PHE B 1 277 ? 37.526  41.642 -20.785 1.00 29.26  ? 277 PHE B CA  1 
ATOM   4925 C C   . PHE B 1 277 ? 36.460  41.432 -21.846 1.00 36.11  ? 277 PHE B C   1 
ATOM   4926 O O   . PHE B 1 277 ? 36.475  40.428 -22.598 1.00 37.59  ? 277 PHE B O   1 
ATOM   4927 C CB  . PHE B 1 277 ? 37.698  40.427 -19.889 1.00 30.87  ? 277 PHE B CB  1 
ATOM   4928 C CG  . PHE B 1 277 ? 39.038  40.386 -19.208 1.00 32.07  ? 277 PHE B CG  1 
ATOM   4929 C CD1 . PHE B 1 277 ? 40.211  40.449 -19.964 1.00 25.96  ? 277 PHE B CD1 1 
ATOM   4930 C CD2 . PHE B 1 277 ? 39.136  40.360 -17.807 1.00 33.94  ? 277 PHE B CD2 1 
ATOM   4931 C CE1 . PHE B 1 277 ? 41.455  40.493 -19.335 1.00 26.95  ? 277 PHE B CE1 1 
ATOM   4932 C CE2 . PHE B 1 277 ? 40.392  40.404 -17.163 1.00 32.44  ? 277 PHE B CE2 1 
ATOM   4933 C CZ  . PHE B 1 277 ? 41.549  40.473 -17.930 1.00 28.79  ? 277 PHE B CZ  1 
ATOM   4934 N N   . ALA B 1 278 ? 35.535  42.374 -21.927 1.00 38.94  ? 278 ALA B N   1 
ATOM   4935 C CA  . ALA B 1 278 ? 34.504  42.318 -22.945 1.00 40.84  ? 278 ALA B CA  1 
ATOM   4936 C C   . ALA B 1 278 ? 34.982  43.366 -23.968 1.00 46.51  ? 278 ALA B C   1 
ATOM   4937 O O   . ALA B 1 278 ? 35.769  44.280 -23.646 1.00 52.23  ? 278 ALA B O   1 
ATOM   4938 C CB  . ALA B 1 278 ? 33.163  42.688 -22.335 1.00 38.77  ? 278 ALA B CB  1 
ATOM   4939 N N   . PHE B 1 279 ? 34.580  43.229 -25.212 1.00 47.04  ? 279 PHE B N   1 
ATOM   4940 C CA  . PHE B 1 279 ? 35.008  44.208 -26.208 1.00 44.05  ? 279 PHE B CA  1 
ATOM   4941 C C   . PHE B 1 279 ? 33.647  44.533 -26.808 1.00 46.29  ? 279 PHE B C   1 
ATOM   4942 O O   . PHE B 1 279 ? 33.172  43.843 -27.723 1.00 48.20  ? 279 PHE B O   1 
ATOM   4943 C CB  . PHE B 1 279 ? 35.915  43.499 -27.197 1.00 39.31  ? 279 PHE B CB  1 
ATOM   4944 C CG  . PHE B 1 279 ? 36.994  44.344 -27.725 1.00 33.70  ? 279 PHE B CG  1 
ATOM   4945 C CD1 . PHE B 1 279 ? 38.006  44.794 -26.884 1.00 37.05  ? 279 PHE B CD1 1 
ATOM   4946 C CD2 . PHE B 1 279 ? 37.048  44.643 -29.075 1.00 36.09  ? 279 PHE B CD2 1 
ATOM   4947 C CE1 . PHE B 1 279 ? 39.075  45.531 -27.377 1.00 34.40  ? 279 PHE B CE1 1 
ATOM   4948 C CE2 . PHE B 1 279 ? 38.105  45.374 -29.591 1.00 37.38  ? 279 PHE B CE2 1 
ATOM   4949 C CZ  . PHE B 1 279 ? 39.129  45.822 -28.734 1.00 36.19  ? 279 PHE B CZ  1 
ATOM   4950 N N   . THR B 1 280 ? 32.996  45.541 -26.236 1.00 48.98  ? 280 THR B N   1 
ATOM   4951 C CA  . THR B 1 280 ? 31.611  45.881 -26.594 1.00 49.77  ? 280 THR B CA  1 
ATOM   4952 C C   . THR B 1 280 ? 31.134  47.011 -27.514 1.00 52.90  ? 280 THR B C   1 
ATOM   4953 O O   . THR B 1 280 ? 30.608  46.757 -28.616 1.00 54.74  ? 280 THR B O   1 
ATOM   4954 C CB  . THR B 1 280 ? 30.823  46.045 -25.315 1.00 47.68  ? 280 THR B CB  1 
ATOM   4955 O OG1 . THR B 1 280 ? 31.478  47.031 -24.503 1.00 44.46  ? 280 THR B OG1 1 
ATOM   4956 C CG2 . THR B 1 280 ? 30.727  44.715 -24.578 1.00 44.66  ? 280 THR B CG2 1 
ATOM   4957 N N   . ASN B 1 281 ? 31.205  48.231 -26.980 1.00 51.72  ? 281 ASN B N   1 
ATOM   4958 C CA  . ASN B 1 281 ? 30.735  49.460 -27.632 1.00 51.14  ? 281 ASN B CA  1 
ATOM   4959 C C   . ASN B 1 281 ? 29.312  49.564 -27.131 1.00 47.44  ? 281 ASN B C   1 
ATOM   4960 O O   . ASN B 1 281 ? 28.399  49.022 -27.731 1.00 49.70  ? 281 ASN B O   1 
ATOM   4961 C CB  . ASN B 1 281 ? 30.746  49.397 -29.176 1.00 53.46  ? 281 ASN B CB  1 
ATOM   4962 C CG  . ASN B 1 281 ? 30.446  50.748 -29.825 1.00 56.40  ? 281 ASN B CG  1 
ATOM   4963 O OD1 . ASN B 1 281 ? 29.527  51.454 -29.413 1.00 62.52  ? 281 ASN B OD1 1 
ATOM   4964 N ND2 . ASN B 1 281 ? 31.246  51.126 -30.821 1.00 58.93  ? 281 ASN B ND2 1 
ATOM   4965 N N   . LEU B 1 282 ? 29.170  50.095 -25.928 1.00 43.03  ? 282 LEU B N   1 
ATOM   4966 C CA  . LEU B 1 282 ? 27.869  50.279 -25.312 1.00 40.54  ? 282 LEU B CA  1 
ATOM   4967 C C   . LEU B 1 282 ? 27.942  51.703 -24.801 1.00 42.08  ? 282 LEU B C   1 
ATOM   4968 O O   . LEU B 1 282 ? 28.920  52.081 -24.163 1.00 38.49  ? 282 LEU B O   1 
ATOM   4969 C CB  . LEU B 1 282 ? 27.638  49.299 -24.146 1.00 35.57  ? 282 LEU B CB  1 
ATOM   4970 C CG  . LEU B 1 282 ? 27.628  47.771 -24.345 1.00 37.14  ? 282 LEU B CG  1 
ATOM   4971 C CD1 . LEU B 1 282 ? 27.293  47.049 -23.014 1.00 28.55  ? 282 LEU B CD1 1 
ATOM   4972 C CD2 . LEU B 1 282 ? 26.656  47.381 -25.441 1.00 29.28  ? 282 LEU B CD2 1 
ATOM   4973 N N   . PRO B 1 283 ? 26.900  52.510 -25.068 1.00 46.92  ? 283 PRO B N   1 
ATOM   4974 C CA  . PRO B 1 283 ? 26.825  53.916 -24.652 1.00 47.38  ? 283 PRO B CA  1 
ATOM   4975 C C   . PRO B 1 283 ? 26.793  54.064 -23.135 1.00 46.55  ? 283 PRO B C   1 
ATOM   4976 O O   . PRO B 1 283 ? 27.127  55.121 -22.585 1.00 46.77  ? 283 PRO B O   1 
ATOM   4977 C CB  . PRO B 1 283 ? 25.507  54.374 -25.283 1.00 49.01  ? 283 PRO B CB  1 
ATOM   4978 C CG  . PRO B 1 283 ? 24.642  53.136 -25.144 1.00 47.97  ? 283 PRO B CG  1 
ATOM   4979 C CD  . PRO B 1 283 ? 25.607  52.067 -25.633 1.00 49.86  ? 283 PRO B CD  1 
ATOM   4980 N N   . SER B 1 284 ? 26.382  52.989 -22.471 1.00 46.89  ? 284 SER B N   1 
ATOM   4981 C CA  . SER B 1 284 ? 26.268  52.963 -21.022 1.00 41.06  ? 284 SER B CA  1 
ATOM   4982 C C   . SER B 1 284 ? 26.613  51.579 -20.509 1.00 38.36  ? 284 SER B C   1 
ATOM   4983 O O   . SER B 1 284 ? 26.289  50.580 -21.144 1.00 37.29  ? 284 SER B O   1 
ATOM   4984 C CB  . SER B 1 284 ? 24.847  53.330 -20.621 1.00 35.73  ? 284 SER B CB  1 
ATOM   4985 O OG  . SER B 1 284 ? 24.601  52.962 -19.289 1.00 31.51  ? 284 SER B OG  1 
ATOM   4986 N N   . PHE B 1 285 ? 27.327  51.544 -19.388 1.00 39.12  ? 285 PHE B N   1 
ATOM   4987 C CA  . PHE B 1 285 ? 27.740  50.301 -18.738 1.00 41.72  ? 285 PHE B CA  1 
ATOM   4988 C C   . PHE B 1 285 ? 27.065  50.025 -17.403 1.00 40.26  ? 285 PHE B C   1 
ATOM   4989 O O   . PHE B 1 285 ? 27.641  49.370 -16.519 1.00 42.15  ? 285 PHE B O   1 
ATOM   4990 C CB  . PHE B 1 285 ? 29.263  50.245 -18.599 1.00 46.17  ? 285 PHE B CB  1 
ATOM   4991 C CG  . PHE B 1 285 ? 29.931  49.745 -19.821 1.00 50.17  ? 285 PHE B CG  1 
ATOM   4992 C CD1 . PHE B 1 285 ? 29.788  50.435 -21.022 1.00 54.46  ? 285 PHE B CD1 1 
ATOM   4993 C CD2 . PHE B 1 285 ? 30.574  48.509 -19.821 1.00 50.82  ? 285 PHE B CD2 1 
ATOM   4994 C CE1 . PHE B 1 285 ? 30.259  49.893 -22.203 1.00 59.16  ? 285 PHE B CE1 1 
ATOM   4995 C CE2 . PHE B 1 285 ? 31.051  47.959 -20.999 1.00 56.54  ? 285 PHE B CE2 1 
ATOM   4996 C CZ  . PHE B 1 285 ? 30.889  48.649 -22.194 1.00 58.83  ? 285 PHE B CZ  1 
ATOM   4997 N N   . SER B 1 286 ? 25.862  50.572 -17.246 1.00 36.37  ? 286 SER B N   1 
ATOM   4998 C CA  . SER B 1 286 ? 25.058  50.351 -16.057 1.00 30.83  ? 286 SER B CA  1 
ATOM   4999 C C   . SER B 1 286 ? 24.713  48.866 -16.072 1.00 27.46  ? 286 SER B C   1 
ATOM   5000 O O   . SER B 1 286 ? 24.857  48.185 -17.090 1.00 26.07  ? 286 SER B O   1 
ATOM   5001 C CB  . SER B 1 286 ? 23.763  51.148 -16.131 1.00 25.90  ? 286 SER B CB  1 
ATOM   5002 O OG  . SER B 1 286 ? 22.994  50.742 -17.256 1.00 31.50  ? 286 SER B OG  1 
ATOM   5003 N N   . LEU B 1 287 ? 24.261  48.372 -14.937 1.00 27.06  ? 287 LEU B N   1 
ATOM   5004 C CA  . LEU B 1 287 ? 23.878  46.989 -14.818 1.00 29.79  ? 287 LEU B CA  1 
ATOM   5005 C C   . LEU B 1 287 ? 22.736  46.715 -15.794 1.00 35.22  ? 287 LEU B C   1 
ATOM   5006 O O   . LEU B 1 287 ? 22.741  45.707 -16.519 1.00 41.21  ? 287 LEU B O   1 
ATOM   5007 C CB  . LEU B 1 287 ? 23.439  46.741 -13.384 1.00 31.39  ? 287 LEU B CB  1 
ATOM   5008 C CG  . LEU B 1 287 ? 23.274  45.308 -12.902 1.00 35.39  ? 287 LEU B CG  1 
ATOM   5009 C CD1 . LEU B 1 287 ? 21.842  45.169 -12.448 1.00 36.94  ? 287 LEU B CD1 1 
ATOM   5010 C CD2 . LEU B 1 287 ? 23.669  44.249 -13.964 1.00 32.16  ? 287 LEU B CD2 1 
ATOM   5011 N N   . GLU B 1 288 ? 21.805  47.664 -15.883 1.00 35.98  ? 288 GLU B N   1 
ATOM   5012 C CA  . GLU B 1 288 ? 20.642  47.526 -16.756 1.00 34.45  ? 288 GLU B CA  1 
ATOM   5013 C C   . GLU B 1 288 ? 21.097  47.384 -18.190 1.00 33.85  ? 288 GLU B C   1 
ATOM   5014 O O   . GLU B 1 288 ? 20.879  46.344 -18.838 1.00 31.45  ? 288 GLU B O   1 
ATOM   5015 C CB  . GLU B 1 288 ? 19.719  48.735 -16.592 1.00 37.54  ? 288 GLU B CB  1 
ATOM   5016 C CG  . GLU B 1 288 ? 18.995  48.809 -15.230 1.00 40.76  ? 288 GLU B CG  1 
ATOM   5017 C CD  . GLU B 1 288 ? 19.904  49.099 -14.023 1.00 48.19  ? 288 GLU B CD  1 
ATOM   5018 O OE1 . GLU B 1 288 ? 20.916  49.828 -14.168 1.00 50.77  ? 288 GLU B OE1 1 
ATOM   5019 O OE2 . GLU B 1 288 ? 19.579  48.616 -12.905 1.00 52.98  ? 288 GLU B OE2 1 
ATOM   5020 N N   . SER B 1 289 ? 21.826  48.400 -18.640 1.00 35.94  ? 289 SER B N   1 
ATOM   5021 C CA  . SER B 1 289 ? 22.367  48.435 -19.990 1.00 36.31  ? 289 SER B CA  1 
ATOM   5022 C C   . SER B 1 289 ? 23.026  47.101 -20.339 1.00 35.26  ? 289 SER B C   1 
ATOM   5023 O O   . SER B 1 289 ? 22.570  46.386 -21.239 1.00 35.15  ? 289 SER B O   1 
ATOM   5024 C CB  . SER B 1 289 ? 23.388  49.569 -20.105 1.00 34.88  ? 289 SER B CB  1 
ATOM   5025 O OG  . SER B 1 289 ? 23.748  49.805 -21.457 1.00 38.30  ? 289 SER B OG  1 
ATOM   5026 N N   . VAL B 1 290 ? 24.048  46.740 -19.569 1.00 34.87  ? 290 VAL B N   1 
ATOM   5027 C CA  . VAL B 1 290 ? 24.806  45.504 -19.781 1.00 34.70  ? 290 VAL B CA  1 
ATOM   5028 C C   . VAL B 1 290 ? 23.978  44.211 -19.841 1.00 30.48  ? 290 VAL B C   1 
ATOM   5029 O O   . VAL B 1 290 ? 24.043  43.473 -20.835 1.00 26.98  ? 290 VAL B O   1 
ATOM   5030 C CB  . VAL B 1 290 ? 25.918  45.372 -18.718 1.00 34.01  ? 290 VAL B CB  1 
ATOM   5031 C CG1 . VAL B 1 290 ? 26.684  44.085 -18.903 1.00 33.27  ? 290 VAL B CG1 1 
ATOM   5032 C CG2 . VAL B 1 290 ? 26.848  46.536 -18.844 1.00 35.06  ? 290 VAL B CG2 1 
ATOM   5033 N N   . ALA B 1 291 ? 23.221  43.941 -18.778 1.00 29.25  ? 291 ALA B N   1 
ATOM   5034 C CA  . ALA B 1 291 ? 22.390  42.740 -18.710 1.00 30.81  ? 291 ALA B CA  1 
ATOM   5035 C C   . ALA B 1 291 ? 21.427  42.680 -19.903 1.00 30.08  ? 291 ALA B C   1 
ATOM   5036 O O   . ALA B 1 291 ? 21.257  41.629 -20.532 1.00 25.31  ? 291 ALA B O   1 
ATOM   5037 C CB  . ALA B 1 291 ? 21.630  42.684 -17.373 1.00 33.53  ? 291 ALA B CB  1 
ATOM   5038 N N   . GLN B 1 292 ? 20.845  43.817 -20.270 1.00 32.27  ? 292 GLN B N   1 
ATOM   5039 C CA  . GLN B 1 292 ? 19.956  43.817 -21.423 1.00 35.86  ? 292 GLN B CA  1 
ATOM   5040 C C   . GLN B 1 292 ? 20.771  43.301 -22.576 1.00 35.31  ? 292 GLN B C   1 
ATOM   5041 O O   . GLN B 1 292 ? 20.443  42.299 -23.162 1.00 38.73  ? 292 GLN B O   1 
ATOM   5042 C CB  . GLN B 1 292 ? 19.495  45.221 -21.781 1.00 43.28  ? 292 GLN B CB  1 
ATOM   5043 C CG  . GLN B 1 292 ? 18.057  45.464 -21.503 1.00 52.58  ? 292 GLN B CG  1 
ATOM   5044 C CD  . GLN B 1 292 ? 17.846  46.050 -20.129 1.00 61.62  ? 292 GLN B CD  1 
ATOM   5045 O OE1 . GLN B 1 292 ? 17.449  47.208 -20.013 1.00 68.71  ? 292 GLN B OE1 1 
ATOM   5046 N NE2 . GLN B 1 292 ? 18.107  45.261 -19.073 1.00 64.78  ? 292 GLN B NE2 1 
ATOM   5047 N N   . HIS B 1 293 ? 21.898  43.951 -22.833 1.00 35.47  ? 293 HIS B N   1 
ATOM   5048 C CA  . HIS B 1 293 ? 22.772  43.574 -23.919 1.00 28.22  ? 293 HIS B CA  1 
ATOM   5049 C C   . HIS B 1 293 ? 23.179  42.107 -23.949 1.00 31.53  ? 293 HIS B C   1 
ATOM   5050 O O   . HIS B 1 293 ? 23.188  41.470 -25.014 1.00 33.12  ? 293 HIS B O   1 
ATOM   5051 C CB  . HIS B 1 293 ? 24.029  44.401 -23.862 1.00 32.00  ? 293 HIS B CB  1 
ATOM   5052 C CG  . HIS B 1 293 ? 24.998  44.037 -24.930 1.00 32.28  ? 293 HIS B CG  1 
ATOM   5053 N ND1 . HIS B 1 293 ? 26.231  43.488 -24.663 1.00 32.51  ? 293 HIS B ND1 1 
ATOM   5054 C CD2 . HIS B 1 293 ? 24.855  44.014 -26.273 1.00 35.96  ? 293 HIS B CD2 1 
ATOM   5055 C CE1 . HIS B 1 293 ? 26.803  43.132 -25.799 1.00 41.95  ? 293 HIS B CE1 1 
ATOM   5056 N NE2 . HIS B 1 293 ? 25.986  43.443 -26.792 1.00 41.74  ? 293 HIS B NE2 1 
ATOM   5057 N N   . GLU B 1 294 ? 23.578  41.597 -22.790 1.00 33.44  ? 294 GLU B N   1 
ATOM   5058 C CA  . GLU B 1 294 ? 24.025  40.211 -22.662 1.00 38.18  ? 294 GLU B CA  1 
ATOM   5059 C C   . GLU B 1 294 ? 22.934  39.129 -22.704 1.00 38.32  ? 294 GLU B C   1 
ATOM   5060 O O   . GLU B 1 294 ? 23.020  38.151 -23.461 1.00 33.63  ? 294 GLU B O   1 
ATOM   5061 C CB  . GLU B 1 294 ? 24.836  40.053 -21.370 1.00 38.70  ? 294 GLU B CB  1 
ATOM   5062 C CG  . GLU B 1 294 ? 26.126  40.854 -21.318 1.00 37.15  ? 294 GLU B CG  1 
ATOM   5063 C CD  . GLU B 1 294 ? 27.120  40.465 -22.393 1.00 38.38  ? 294 GLU B CD  1 
ATOM   5064 O OE1 . GLU B 1 294 ? 27.249  39.267 -22.746 1.00 34.01  ? 294 GLU B OE1 1 
ATOM   5065 O OE2 . GLU B 1 294 ? 27.784  41.388 -22.889 1.00 38.86  ? 294 GLU B OE2 1 
ATOM   5066 N N   . THR B 1 295 ? 21.934  39.292 -21.848 1.00 38.12  ? 295 THR B N   1 
ATOM   5067 C CA  . THR B 1 295 ? 20.853  38.330 -21.756 1.00 40.39  ? 295 THR B CA  1 
ATOM   5068 C C   . THR B 1 295 ? 19.720  38.664 -22.726 1.00 42.01  ? 295 THR B C   1 
ATOM   5069 O O   . THR B 1 295 ? 18.851  37.831 -23.014 1.00 38.29  ? 295 THR B O   1 
ATOM   5070 C CB  . THR B 1 295 ? 20.327  38.315 -20.343 1.00 37.90  ? 295 THR B CB  1 
ATOM   5071 O OG1 . THR B 1 295 ? 19.815  39.614 -20.045 1.00 40.81  ? 295 THR B OG1 1 
ATOM   5072 C CG2 . THR B 1 295 ? 21.470  38.001 -19.357 1.00 39.08  ? 295 THR B CG2 1 
ATOM   5073 N N   . LYS B 1 296 ? 19.796  39.868 -23.281 1.00 47.03  ? 296 LYS B N   1 
ATOM   5074 C CA  . LYS B 1 296 ? 18.806  40.390 -24.214 1.00 51.27  ? 296 LYS B CA  1 
ATOM   5075 C C   . LYS B 1 296 ? 17.439  40.296 -23.574 1.00 51.21  ? 296 LYS B C   1 
ATOM   5076 O O   . LYS B 1 296 ? 16.416  40.367 -24.239 1.00 53.63  ? 296 LYS B O   1 
ATOM   5077 C CB  . LYS B 1 296 ? 18.873  39.653 -25.542 1.00 53.95  ? 296 LYS B CB  1 
ATOM   5078 C CG  . LYS B 1 296 ? 19.829  40.313 -26.492 1.00 60.35  ? 296 LYS B CG  1 
ATOM   5079 C CD  . LYS B 1 296 ? 19.296  40.265 -27.920 1.00 65.95  ? 296 LYS B CD  1 
ATOM   5080 C CE  . LYS B 1 296 ? 19.470  38.899 -28.572 1.00 63.16  ? 296 LYS B CE  1 
ATOM   5081 N NZ  . LYS B 1 296 ? 19.362  39.061 -30.051 1.00 62.12  ? 296 LYS B NZ  1 
ATOM   5082 N N   . LYS B 1 297 ? 17.469  40.337 -22.249 1.00 51.74  ? 297 LYS B N   1 
ATOM   5083 C CA  . LYS B 1 297 ? 16.312  40.194 -21.405 1.00 53.83  ? 297 LYS B CA  1 
ATOM   5084 C C   . LYS B 1 297 ? 16.380  41.343 -20.438 1.00 54.22  ? 297 LYS B C   1 
ATOM   5085 O O   . LYS B 1 297 ? 17.143  41.333 -19.476 1.00 52.77  ? 297 LYS B O   1 
ATOM   5086 C CB  . LYS B 1 297 ? 16.426  38.830 -20.713 1.00 57.87  ? 297 LYS B CB  1 
ATOM   5087 C CG  . LYS B 1 297 ? 15.588  38.552 -19.495 1.00 64.94  ? 297 LYS B CG  1 
ATOM   5088 C CD  . LYS B 1 297 ? 15.955  37.147 -18.981 1.00 72.30  ? 297 LYS B CD  1 
ATOM   5089 C CE  . LYS B 1 297 ? 15.608  36.944 -17.497 1.00 75.26  ? 297 LYS B CE  1 
ATOM   5090 N NZ  . LYS B 1 297 ? 16.027  35.597 -16.966 1.00 76.24  ? 297 LYS B NZ  1 
ATOM   5091 N N   . GLY B 1 298 ? 15.620  42.375 -20.765 1.00 59.54  ? 298 GLY B N   1 
ATOM   5092 C CA  . GLY B 1 298 ? 15.547  43.596 -19.973 1.00 65.75  ? 298 GLY B CA  1 
ATOM   5093 C C   . GLY B 1 298 ? 14.643  43.471 -18.754 1.00 66.74  ? 298 GLY B C   1 
ATOM   5094 O O   . GLY B 1 298 ? 13.840  42.539 -18.651 1.00 67.65  ? 298 GLY B O   1 
ATOM   5095 N N   . LYS B 1 299 ? 14.735  44.457 -17.869 1.00 65.69  ? 299 LYS B N   1 
ATOM   5096 C CA  . LYS B 1 299 ? 13.920  44.483 -16.665 1.00 66.13  ? 299 LYS B CA  1 
ATOM   5097 C C   . LYS B 1 299 ? 12.523  44.982 -17.036 1.00 69.83  ? 299 LYS B C   1 
ATOM   5098 O O   . LYS B 1 299 ? 12.354  45.635 -18.076 1.00 71.15  ? 299 LYS B O   1 
ATOM   5099 C CB  . LYS B 1 299 ? 14.541  45.443 -15.659 1.00 61.17  ? 299 LYS B CB  1 
ATOM   5100 C CG  . LYS B 1 299 ? 13.880  45.421 -14.316 1.00 55.61  ? 299 LYS B CG  1 
ATOM   5101 C CD  . LYS B 1 299 ? 14.522  44.401 -13.414 1.00 52.70  ? 299 LYS B CD  1 
ATOM   5102 C CE  . LYS B 1 299 ? 15.838  44.910 -12.842 1.00 50.34  ? 299 LYS B CE  1 
ATOM   5103 N NZ  . LYS B 1 299 ? 15.706  46.034 -11.891 1.00 47.34  ? 299 LYS B NZ  1 
ATOM   5104 N N   . LEU B 1 300 ? 11.528  44.665 -16.201 1.00 72.88  ? 300 LEU B N   1 
ATOM   5105 C CA  . LEU B 1 300 ? 10.153  45.120 -16.433 1.00 73.39  ? 300 LEU B CA  1 
ATOM   5106 C C   . LEU B 1 300 ? 10.189  46.633 -16.263 1.00 77.60  ? 300 LEU B C   1 
ATOM   5107 O O   . LEU B 1 300 ? 10.403  47.144 -15.160 1.00 74.45  ? 300 LEU B O   1 
ATOM   5108 C CB  . LEU B 1 300 ? 9.170   44.475 -15.434 1.00 69.46  ? 300 LEU B CB  1 
ATOM   5109 C CG  . LEU B 1 300 ? 7.645   44.710 -15.506 1.00 62.54  ? 300 LEU B CG  1 
ATOM   5110 C CD1 . LEU B 1 300 ? 7.156   44.755 -16.950 1.00 64.67  ? 300 LEU B CD1 1 
ATOM   5111 C CD2 . LEU B 1 300 ? 6.908   43.604 -14.746 1.00 56.44  ? 300 LEU B CD2 1 
ATOM   5112 N N   . PRO B 1 301 ? 10.044  47.366 -17.374 1.00 84.16  ? 301 PRO B N   1 
ATOM   5113 C CA  . PRO B 1 301 ? 10.061  48.832 -17.400 1.00 87.08  ? 301 PRO B CA  1 
ATOM   5114 C C   . PRO B 1 301 ? 9.479   49.464 -16.162 1.00 86.10  ? 301 PRO B C   1 
ATOM   5115 O O   . PRO B 1 301 ? 8.432   49.045 -15.663 1.00 84.65  ? 301 PRO B O   1 
ATOM   5116 C CB  . PRO B 1 301 ? 9.244   49.152 -18.645 1.00 90.96  ? 301 PRO B CB  1 
ATOM   5117 C CG  . PRO B 1 301 ? 9.713   48.058 -19.593 1.00 92.49  ? 301 PRO B CG  1 
ATOM   5118 C CD  . PRO B 1 301 ? 9.690   46.819 -18.700 1.00 87.51  ? 301 PRO B CD  1 
ATOM   5119 N N   . TYR B 1 302 ? 10.186  50.458 -15.651 1.00 87.24  ? 302 TYR B N   1 
ATOM   5120 C CA  . TYR B 1 302 ? 9.726   51.142 -14.461 1.00 91.73  ? 302 TYR B CA  1 
ATOM   5121 C C   . TYR B 1 302 ? 8.382   51.844 -14.658 1.00 92.71  ? 302 TYR B C   1 
ATOM   5122 O O   . TYR B 1 302 ? 8.065   52.314 -15.756 1.00 94.48  ? 302 TYR B O   1 
ATOM   5123 C CB  . TYR B 1 302 ? 10.768  52.140 -13.966 1.00 92.74  ? 302 TYR B CB  1 
ATOM   5124 C CG  . TYR B 1 302 ? 10.460  52.599 -12.567 1.00 92.03  ? 302 TYR B CG  1 
ATOM   5125 C CD1 . TYR B 1 302 ? 10.797  51.801 -11.471 1.00 90.32  ? 302 TYR B CD1 1 
ATOM   5126 C CD2 . TYR B 1 302 ? 9.753   53.783 -12.340 1.00 90.11  ? 302 TYR B CD2 1 
ATOM   5127 C CE1 . TYR B 1 302 ? 10.437  52.164 -10.190 1.00 90.48  ? 302 TYR B CE1 1 
ATOM   5128 C CE2 . TYR B 1 302 ? 9.384   54.152 -11.065 1.00 89.42  ? 302 TYR B CE2 1 
ATOM   5129 C CZ  . TYR B 1 302 ? 9.727   53.342 -9.987  1.00 89.71  ? 302 TYR B CZ  1 
ATOM   5130 O OH  . TYR B 1 302 ? 9.369   53.698 -8.705  1.00 86.94  ? 302 TYR B OH  1 
ATOM   5131 N N   . ASP B 1 303 ? 7.631   51.967 -13.567 1.00 91.54  ? 303 ASP B N   1 
ATOM   5132 C CA  . ASP B 1 303 ? 6.318   52.601 -13.595 1.00 89.28  ? 303 ASP B CA  1 
ATOM   5133 C C   . ASP B 1 303 ? 6.002   53.289 -12.265 1.00 87.78  ? 303 ASP B C   1 
ATOM   5134 O O   . ASP B 1 303 ? 5.978   52.638 -11.217 1.00 85.75  ? 303 ASP B O   1 
ATOM   5135 C CB  . ASP B 1 303 ? 5.255   51.546 -13.887 1.00 90.74  ? 303 ASP B CB  1 
ATOM   5136 C CG  . ASP B 1 303 ? 3.885   52.139 -14.103 1.00 91.86  ? 303 ASP B CG  1 
ATOM   5137 O OD1 . ASP B 1 303 ? 3.744   53.191 -14.737 1.00 93.83  ? 303 ASP B OD1 1 
ATOM   5138 O OD2 . ASP B 1 303 ? 2.860   51.474 -13.569 1.00 91.83  ? 303 ASP B OD2 1 
ATOM   5139 N N   . GLY B 1 304 ? 5.772   54.600 -12.309 1.00 86.51  ? 304 GLY B N   1 
ATOM   5140 C CA  . GLY B 1 304 ? 5.456   55.334 -11.097 1.00 86.48  ? 304 GLY B CA  1 
ATOM   5141 C C   . GLY B 1 304 ? 6.461   56.405 -10.694 1.00 87.66  ? 304 GLY B C   1 
ATOM   5142 O O   . GLY B 1 304 ? 6.516   57.444 -11.348 1.00 86.17  ? 304 GLY B O   1 
ATOM   5143 N N   . PRO B 1 305 ? 7.192   56.228 -9.569  1.00 89.16  ? 305 PRO B N   1 
ATOM   5144 C CA  . PRO B 1 305 ? 8.200   57.147 -9.024  1.00 90.41  ? 305 PRO B CA  1 
ATOM   5145 C C   . PRO B 1 305 ? 9.625   56.660 -9.325  1.00 93.63  ? 305 PRO B C   1 
ATOM   5146 O O   . PRO B 1 305 ? 10.073  56.740 -10.464 1.00 94.66  ? 305 PRO B O   1 
ATOM   5147 C CB  . PRO B 1 305 ? 7.903   57.095 -7.533  1.00 89.74  ? 305 PRO B CB  1 
ATOM   5148 C CG  . PRO B 1 305 ? 7.633   55.610 -7.323  1.00 87.75  ? 305 PRO B CG  1 
ATOM   5149 C CD  . PRO B 1 305 ? 6.874   55.171 -8.582  1.00 89.97  ? 305 PRO B CD  1 
ATOM   5150 N N   . ILE B 1 306 ? 10.310  56.155 -8.291  1.00 96.57  ? 306 ILE B N   1 
ATOM   5151 C CA  . ILE B 1 306 ? 11.672  55.597 -8.330  1.00 99.17  ? 306 ILE B CA  1 
ATOM   5152 C C   . ILE B 1 306 ? 12.221  55.530 -6.901  1.00 101.15 ? 306 ILE B C   1 
ATOM   5153 O O   . ILE B 1 306 ? 12.330  54.450 -6.315  1.00 103.63 ? 306 ILE B O   1 
ATOM   5154 C CB  . ILE B 1 306 ? 12.666  56.380 -9.274  1.00 99.05  ? 306 ILE B CB  1 
ATOM   5155 C CG1 . ILE B 1 306 ? 12.750  55.683 -10.641 1.00 97.96  ? 306 ILE B CG1 1 
ATOM   5156 C CG2 . ILE B 1 306 ? 14.096  56.448 -8.669  1.00 96.44  ? 306 ILE B CG2 1 
ATOM   5157 C CD1 . ILE B 1 306 ? 13.335  54.272 -10.583 1.00 99.51  ? 306 ILE B CD1 1 
ATOM   5158 N N   . ASN B 1 307 ? 12.481  56.698 -6.319  1.00 100.99 ? 307 ASN B N   1 
ATOM   5159 C CA  . ASN B 1 307 ? 13.028  56.793 -4.969  1.00 98.71  ? 307 ASN B CA  1 
ATOM   5160 C C   . ASN B 1 307 ? 12.061  56.360 -3.858  1.00 95.74  ? 307 ASN B C   1 
ATOM   5161 O O   . ASN B 1 307 ? 12.504  55.940 -2.783  1.00 94.28  ? 307 ASN B O   1 
ATOM   5162 C CB  . ASN B 1 307 ? 13.557  58.207 -4.717  1.00 101.58 ? 307 ASN B CB  1 
ATOM   5163 C CG  . ASN B 1 307 ? 14.267  58.336 -3.387  1.00 103.33 ? 307 ASN B CG  1 
ATOM   5164 O OD1 . ASN B 1 307 ? 13.943  59.211 -2.585  1.00 105.70 ? 307 ASN B OD1 1 
ATOM   5165 N ND2 . ASN B 1 307 ? 15.228  57.458 -3.138  1.00 102.62 ? 307 ASN B ND2 1 
ATOM   5166 N N   . LYS B 1 308 ? 10.752  56.473 -4.103  1.00 91.52  ? 308 LYS B N   1 
ATOM   5167 C CA  . LYS B 1 308 ? 9.783   56.040 -3.102  1.00 86.59  ? 308 LYS B CA  1 
ATOM   5168 C C   . LYS B 1 308 ? 9.273   54.641 -3.409  1.00 83.15  ? 308 LYS B C   1 
ATOM   5169 O O   . LYS B 1 308 ? 8.312   54.185 -2.793  1.00 84.57  ? 308 LYS B O   1 
ATOM   5170 C CB  . LYS B 1 308 ? 8.601   57.013 -2.938  1.00 87.33  ? 308 LYS B CB  1 
ATOM   5171 C CG  . LYS B 1 308 ? 7.653   56.580 -1.782  1.00 89.86  ? 308 LYS B CG  1 
ATOM   5172 C CD  . LYS B 1 308 ? 6.650   57.624 -1.279  1.00 93.87  ? 308 LYS B CD  1 
ATOM   5173 C CE  . LYS B 1 308 ? 7.352   58.863 -0.718  1.00 96.24  ? 308 LYS B CE  1 
ATOM   5174 N NZ  . LYS B 1 308 ? 6.533   59.663 0.240   1.00 94.33  ? 308 LYS B NZ  1 
ATOM   5175 N N   . LEU B 1 309 ? 9.942   53.924 -4.309  1.00 77.73  ? 309 LEU B N   1 
ATOM   5176 C CA  . LEU B 1 309 ? 9.490   52.580 -4.633  1.00 73.10  ? 309 LEU B CA  1 
ATOM   5177 C C   . LEU B 1 309 ? 9.566   51.655 -3.417  1.00 72.14  ? 309 LEU B C   1 
ATOM   5178 O O   . LEU B 1 309 ? 8.902   50.626 -3.385  1.00 71.70  ? 309 LEU B O   1 
ATOM   5179 C CB  . LEU B 1 309 ? 10.255  51.979 -5.806  1.00 73.16  ? 309 LEU B CB  1 
ATOM   5180 C CG  . LEU B 1 309 ? 9.443   50.832 -6.421  1.00 72.00  ? 309 LEU B CG  1 
ATOM   5181 C CD1 . LEU B 1 309 ? 8.220   51.401 -7.113  1.00 72.78  ? 309 LEU B CD1 1 
ATOM   5182 C CD2 . LEU B 1 309 ? 10.273  50.024 -7.390  1.00 74.08  ? 309 LEU B CD2 1 
ATOM   5183 N N   . ARG B 1 310 ? 10.370  52.015 -2.416  1.00 71.24  ? 310 ARG B N   1 
ATOM   5184 C CA  . ARG B 1 310 ? 10.464  51.212 -1.193  1.00 70.06  ? 310 ARG B CA  1 
ATOM   5185 C C   . ARG B 1 310 ? 9.039   51.243 -0.640  1.00 68.37  ? 310 ARG B C   1 
ATOM   5186 O O   . ARG B 1 310 ? 8.432   50.201 -0.382  1.00 62.97  ? 310 ARG B O   1 
ATOM   5187 C CB  . ARG B 1 310 ? 11.398  51.895 -0.184  1.00 72.57  ? 310 ARG B CB  1 
ATOM   5188 C CG  . ARG B 1 310 ? 12.307  50.981 0.686   1.00 76.42  ? 310 ARG B CG  1 
ATOM   5189 C CD  . ARG B 1 310 ? 11.666  49.712 1.260   1.00 75.27  ? 310 ARG B CD  1 
ATOM   5190 N NE  . ARG B 1 310 ? 10.260  49.863 1.623   1.00 81.10  ? 310 ARG B NE  1 
ATOM   5191 C CZ  . ARG B 1 310 ? 9.800   50.388 2.759   1.00 82.52  ? 310 ARG B CZ  1 
ATOM   5192 N NH1 . ARG B 1 310 ? 10.625  50.817 3.708   1.00 81.13  ? 310 ARG B NH1 1 
ATOM   5193 N NH2 . ARG B 1 310 ? 8.491   50.465 2.948   1.00 83.48  ? 310 ARG B NH2 1 
ATOM   5194 N N   . GLU B 1 311 ? 8.510   52.466 -0.537  1.00 69.23  ? 311 GLU B N   1 
ATOM   5195 C CA  . GLU B 1 311 ? 7.162   52.734 -0.032  1.00 70.47  ? 311 GLU B CA  1 
ATOM   5196 C C   . GLU B 1 311 ? 6.068   52.330 -1.015  1.00 66.39  ? 311 GLU B C   1 
ATOM   5197 O O   . GLU B 1 311 ? 5.399   51.325 -0.804  1.00 64.76  ? 311 GLU B O   1 
ATOM   5198 C CB  . GLU B 1 311 ? 7.006   54.218 0.327   1.00 74.23  ? 311 GLU B CB  1 
ATOM   5199 C CG  . GLU B 1 311 ? 8.182   54.795 1.108   1.00 83.13  ? 311 GLU B CG  1 
ATOM   5200 C CD  . GLU B 1 311 ? 7.760   55.537 2.367   1.00 87.00  ? 311 GLU B CD  1 
ATOM   5201 O OE1 . GLU B 1 311 ? 7.607   54.876 3.417   1.00 90.43  ? 311 GLU B OE1 1 
ATOM   5202 O OE2 . GLU B 1 311 ? 7.597   56.777 2.313   1.00 89.82  ? 311 GLU B OE2 1 
ATOM   5203 N N   . THR B 1 312 ? 5.908   53.100 -2.092  1.00 62.99  ? 312 THR B N   1 
ATOM   5204 C CA  . THR B 1 312 ? 4.879   52.818 -3.086  1.00 62.29  ? 312 THR B CA  1 
ATOM   5205 C C   . THR B 1 312 ? 4.843   51.368 -3.514  1.00 63.17  ? 312 THR B C   1 
ATOM   5206 O O   . THR B 1 312 ? 3.774   50.737 -3.513  1.00 65.51  ? 312 THR B O   1 
ATOM   5207 C CB  . THR B 1 312 ? 5.028   53.641 -4.383  1.00 61.18  ? 312 THR B CB  1 
ATOM   5208 O OG1 . THR B 1 312 ? 6.304   53.386 -4.972  1.00 62.03  ? 312 THR B OG1 1 
ATOM   5209 C CG2 . THR B 1 312 ? 4.818   55.138 -4.137  1.00 65.14  ? 312 THR B CG2 1 
ATOM   5210 N N   . ASN B 1 313 ? 5.994   50.840 -3.917  1.00 60.27  ? 313 ASN B N   1 
ATOM   5211 C CA  . ASN B 1 313 ? 6.021   49.462 -4.359  1.00 56.97  ? 313 ASN B CA  1 
ATOM   5212 C C   . ASN B 1 313 ? 7.198   48.646 -3.882  1.00 58.36  ? 313 ASN B C   1 
ATOM   5213 O O   . ASN B 1 313 ? 8.104   48.304 -4.651  1.00 58.53  ? 313 ASN B O   1 
ATOM   5214 C CB  . ASN B 1 313 ? 5.881   49.368 -5.879  1.00 50.64  ? 313 ASN B CB  1 
ATOM   5215 C CG  . ASN B 1 313 ? 5.526   47.961 -6.370  1.00 47.40  ? 313 ASN B CG  1 
ATOM   5216 O OD1 . ASN B 1 313 ? 5.223   47.852 -7.572  1.00 47.52  ? 313 ASN B OD1 1 
ATOM   5217 N ND2 . ASN B 1 313 ? 5.538   46.970 -5.601  1.00 43.93  ? 313 ASN B ND2 1 
ATOM   5218 N N   . HIS B 1 314 ? 7.182   48.347 -2.590  1.00 59.06  ? 314 HIS B N   1 
ATOM   5219 C CA  . HIS B 1 314 ? 8.166   47.467 -1.979  1.00 59.66  ? 314 HIS B CA  1 
ATOM   5220 C C   . HIS B 1 314 ? 7.810   46.157 -2.691  1.00 59.47  ? 314 HIS B C   1 
ATOM   5221 O O   . HIS B 1 314 ? 6.969   46.149 -3.590  1.00 57.63  ? 314 HIS B O   1 
ATOM   5222 C CB  . HIS B 1 314 ? 7.837   47.353 -0.488  1.00 64.41  ? 314 HIS B CB  1 
ATOM   5223 C CG  . HIS B 1 314 ? 8.666   46.355 0.270   1.00 67.96  ? 314 HIS B CG  1 
ATOM   5224 N ND1 . HIS B 1 314 ? 8.273   45.046 0.457   1.00 66.20  ? 314 HIS B ND1 1 
ATOM   5225 C CD2 . HIS B 1 314 ? 9.800   46.509 0.992   1.00 67.84  ? 314 HIS B CD2 1 
ATOM   5226 C CE1 . HIS B 1 314 ? 9.121   44.440 1.268   1.00 62.91  ? 314 HIS B CE1 1 
ATOM   5227 N NE2 . HIS B 1 314 ? 10.058  45.309 1.607   1.00 65.01  ? 314 HIS B NE2 1 
ATOM   5228 N N   . GLN B 1 315 ? 8.401   45.037 -2.301  1.00 60.55  ? 315 GLN B N   1 
ATOM   5229 C CA  . GLN B 1 315 ? 8.062   43.778 -2.963  1.00 62.49  ? 315 GLN B CA  1 
ATOM   5230 C C   . GLN B 1 315 ? 8.616   43.786 -4.400  1.00 63.59  ? 315 GLN B C   1 
ATOM   5231 O O   . GLN B 1 315 ? 9.437   42.923 -4.737  1.00 63.08  ? 315 GLN B O   1 
ATOM   5232 C CB  . GLN B 1 315 ? 6.544   43.557 -2.928  1.00 59.81  ? 315 GLN B CB  1 
ATOM   5233 C CG  . GLN B 1 315 ? 6.125   42.112 -2.752  1.00 58.03  ? 315 GLN B CG  1 
ATOM   5234 C CD  . GLN B 1 315 ? 6.049   41.366 -4.055  1.00 54.61  ? 315 GLN B CD  1 
ATOM   5235 O OE1 . GLN B 1 315 ? 6.339   40.142 -4.054  1.00 52.47  ? 315 GLN B OE1 1 
ATOM   5236 N NE2 . GLN B 1 315 ? 5.688   42.013 -5.071  1.00 51.53  ? 315 GLN B NE2 1 
ATOM   5237 N N   . ARG B 1 316 ? 8.163   44.717 -5.251  1.00 63.07  ? 316 ARG B N   1 
ATOM   5238 C CA  . ARG B 1 316 ? 8.740   44.838 -6.598  1.00 61.83  ? 316 ARG B CA  1 
ATOM   5239 C C   . ARG B 1 316 ? 10.192  45.222 -6.333  1.00 62.41  ? 316 ARG B C   1 
ATOM   5240 O O   . ARG B 1 316 ? 11.112  44.736 -6.991  1.00 62.44  ? 316 ARG B O   1 
ATOM   5241 C CB  . ARG B 1 316 ? 8.093   45.955 -7.409  1.00 57.38  ? 316 ARG B CB  1 
ATOM   5242 C CG  . ARG B 1 316 ? 8.939   46.340 -8.602  1.00 54.79  ? 316 ARG B CG  1 
ATOM   5243 C CD  . ARG B 1 316 ? 8.116   46.745 -9.781  1.00 56.76  ? 316 ARG B CD  1 
ATOM   5244 N NE  . ARG B 1 316 ? 7.105   45.752 -10.113 1.00 59.38  ? 316 ARG B NE  1 
ATOM   5245 C CZ  . ARG B 1 316 ? 6.890   45.275 -11.331 1.00 58.97  ? 316 ARG B CZ  1 
ATOM   5246 N NH1 . ARG B 1 316 ? 7.645   45.671 -12.337 1.00 61.92  ? 316 ARG B NH1 1 
ATOM   5247 N NH2 . ARG B 1 316 ? 5.931   44.375 -11.534 1.00 61.40  ? 316 ARG B NH2 1 
ATOM   5248 N N   . TYR B 1 317 ? 10.350  46.119 -5.360  1.00 62.14  ? 317 TYR B N   1 
ATOM   5249 C CA  . TYR B 1 317 ? 11.637  46.613 -4.872  1.00 64.30  ? 317 TYR B CA  1 
ATOM   5250 C C   . TYR B 1 317 ? 12.577  45.430 -4.562  1.00 63.95  ? 317 TYR B C   1 
ATOM   5251 O O   . TYR B 1 317 ? 13.716  45.376 -5.049  1.00 64.59  ? 317 TYR B O   1 
ATOM   5252 C CB  . TYR B 1 317 ? 11.388  47.391 -3.584  1.00 61.59  ? 317 TYR B CB  1 
ATOM   5253 C CG  . TYR B 1 317 ? 12.525  48.252 -3.144  1.00 59.25  ? 317 TYR B CG  1 
ATOM   5254 C CD1 . TYR B 1 317 ? 12.998  49.267 -3.963  1.00 58.99  ? 317 TYR B CD1 1 
ATOM   5255 C CD2 . TYR B 1 317 ? 13.097  48.091 -1.882  1.00 62.76  ? 317 TYR B CD2 1 
ATOM   5256 C CE1 . TYR B 1 317 ? 14.020  50.122 -3.537  1.00 63.32  ? 317 TYR B CE1 1 
ATOM   5257 C CE2 . TYR B 1 317 ? 14.129  48.946 -1.436  1.00 65.41  ? 317 TYR B CE2 1 
ATOM   5258 C CZ  . TYR B 1 317 ? 14.580  49.959 -2.273  1.00 63.36  ? 317 TYR B CZ  1 
ATOM   5259 O OH  . TYR B 1 317 ? 15.569  50.813 -1.856  1.00 61.75  ? 317 TYR B OH  1 
ATOM   5260 N N   . ILE B 1 318 ? 12.085  44.508 -3.734  1.00 59.26  ? 318 ILE B N   1 
ATOM   5261 C CA  . ILE B 1 318 ? 12.819  43.315 -3.346  1.00 55.65  ? 318 ILE B CA  1 
ATOM   5262 C C   . ILE B 1 318 ? 12.956  42.285 -4.469  1.00 58.30  ? 318 ILE B C   1 
ATOM   5263 O O   . ILE B 1 318 ? 13.950  41.545 -4.524  1.00 59.31  ? 318 ILE B O   1 
ATOM   5264 C CB  . ILE B 1 318 ? 12.204  42.685 -2.102  1.00 51.05  ? 318 ILE B CB  1 
ATOM   5265 C CG1 . ILE B 1 318 ? 12.463  43.605 -0.930  1.00 48.78  ? 318 ILE B CG1 1 
ATOM   5266 C CG2 . ILE B 1 318 ? 12.834  41.347 -1.799  1.00 45.39  ? 318 ILE B CG2 1 
ATOM   5267 C CD1 . ILE B 1 318 ? 13.924  43.899 -0.769  1.00 50.36  ? 318 ILE B CD1 1 
ATOM   5268 N N   . SER B 1 319 ? 11.991  42.257 -5.381  1.00 59.11  ? 319 SER B N   1 
ATOM   5269 C CA  . SER B 1 319 ? 12.053  41.325 -6.497  1.00 59.78  ? 319 SER B CA  1 
ATOM   5270 C C   . SER B 1 319 ? 13.177  41.782 -7.409  1.00 58.24  ? 319 SER B C   1 
ATOM   5271 O O   . SER B 1 319 ? 13.991  40.971 -7.864  1.00 58.63  ? 319 SER B O   1 
ATOM   5272 C CB  . SER B 1 319 ? 10.729  41.307 -7.262  1.00 61.07  ? 319 SER B CB  1 
ATOM   5273 O OG  . SER B 1 319 ? 9.704   40.690 -6.507  1.00 63.11  ? 319 SER B OG  1 
ATOM   5274 N N   . TYR B 1 320 ? 13.233  43.092 -7.638  1.00 55.77  ? 320 TYR B N   1 
ATOM   5275 C CA  . TYR B 1 320 ? 14.257  43.697 -8.480  1.00 54.39  ? 320 TYR B CA  1 
ATOM   5276 C C   . TYR B 1 320 ? 15.630  43.368 -7.935  1.00 51.18  ? 320 TYR B C   1 
ATOM   5277 O O   . TYR B 1 320 ? 16.489  42.910 -8.677  1.00 50.16  ? 320 TYR B O   1 
ATOM   5278 C CB  . TYR B 1 320 ? 14.096  45.216 -8.536  1.00 55.21  ? 320 TYR B CB  1 
ATOM   5279 C CG  . TYR B 1 320 ? 13.143  45.724 -9.604  1.00 55.44  ? 320 TYR B CG  1 
ATOM   5280 C CD1 . TYR B 1 320 ? 12.584  44.855 -10.569 1.00 49.34  ? 320 TYR B CD1 1 
ATOM   5281 C CD2 . TYR B 1 320 ? 12.804  47.081 -9.659  1.00 53.02  ? 320 TYR B CD2 1 
ATOM   5282 C CE1 . TYR B 1 320 ? 11.712  45.339 -11.553 1.00 48.64  ? 320 TYR B CE1 1 
ATOM   5283 C CE2 . TYR B 1 320 ? 11.935  47.573 -10.639 1.00 53.43  ? 320 TYR B CE2 1 
ATOM   5284 C CZ  . TYR B 1 320 ? 11.395  46.699 -11.576 1.00 50.38  ? 320 TYR B CZ  1 
ATOM   5285 O OH  . TYR B 1 320 ? 10.527  47.221 -12.500 1.00 49.30  ? 320 TYR B OH  1 
ATOM   5286 N N   . ASN B 1 321 ? 15.808  43.582 -6.634  1.00 48.87  ? 321 ASN B N   1 
ATOM   5287 C CA  . ASN B 1 321 ? 17.068  43.319 -5.933  1.00 49.90  ? 321 ASN B CA  1 
ATOM   5288 C C   . ASN B 1 321 ? 17.635  41.951 -6.305  1.00 48.79  ? 321 ASN B C   1 
ATOM   5289 O O   . ASN B 1 321 ? 18.800  41.827 -6.704  1.00 49.84  ? 321 ASN B O   1 
ATOM   5290 C CB  . ASN B 1 321 ? 16.841  43.385 -4.411  1.00 50.94  ? 321 ASN B CB  1 
ATOM   5291 C CG  . ASN B 1 321 ? 18.137  43.444 -3.602  1.00 47.65  ? 321 ASN B CG  1 
ATOM   5292 O OD1 . ASN B 1 321 ? 18.873  44.422 -3.660  1.00 48.87  ? 321 ASN B OD1 1 
ATOM   5293 N ND2 . ASN B 1 321 ? 18.368  42.432 -2.786  1.00 44.50  ? 321 ASN B ND2 1 
ATOM   5294 N N   . ILE B 1 322 ? 16.788  40.936 -6.246  1.00 44.98  ? 322 ILE B N   1 
ATOM   5295 C CA  . ILE B 1 322 ? 17.243  39.600 -6.556  1.00 43.25  ? 322 ILE B CA  1 
ATOM   5296 C C   . ILE B 1 322 ? 17.676  39.543 -7.991  1.00 42.88  ? 322 ILE B C   1 
ATOM   5297 O O   . ILE B 1 322 ? 18.708  38.960 -8.324  1.00 43.83  ? 322 ILE B O   1 
ATOM   5298 C CB  . ILE B 1 322 ? 16.193  38.497 -6.223  1.00 41.52  ? 322 ILE B CB  1 
ATOM   5299 C CG1 . ILE B 1 322 ? 15.723  37.793 -7.485  1.00 40.33  ? 322 ILE B CG1 1 
ATOM   5300 C CG2 . ILE B 1 322 ? 15.064  39.057 -5.380  1.00 43.53  ? 322 ILE B CG2 1 
ATOM   5301 C CD1 . ILE B 1 322 ? 15.678  36.343 -7.299  1.00 38.92  ? 322 ILE B CD1 1 
ATOM   5302 N N   . ILE B 1 323 ? 16.920  40.248 -8.815  1.00 44.52  ? 323 ILE B N   1 
ATOM   5303 C CA  . ILE B 1 323 ? 17.171  40.330 -10.245 1.00 45.38  ? 323 ILE B CA  1 
ATOM   5304 C C   . ILE B 1 323 ? 18.538  40.933 -10.643 1.00 46.14  ? 323 ILE B C   1 
ATOM   5305 O O   . ILE B 1 323 ? 19.217  40.391 -11.514 1.00 43.43  ? 323 ILE B O   1 
ATOM   5306 C CB  . ILE B 1 323 ? 16.015  41.059 -10.899 1.00 41.47  ? 323 ILE B CB  1 
ATOM   5307 C CG1 . ILE B 1 323 ? 14.965  40.026 -11.289 1.00 42.63  ? 323 ILE B CG1 1 
ATOM   5308 C CG2 . ILE B 1 323 ? 16.488  41.921 -12.029 1.00 40.99  ? 323 ILE B CG2 1 
ATOM   5309 C CD1 . ILE B 1 323 ? 13.599  40.601 -11.508 1.00 47.94  ? 323 ILE B CD1 1 
ATOM   5310 N N   . ASP B 1 324 ? 18.905  42.063 -10.036 1.00 47.59  ? 324 ASP B N   1 
ATOM   5311 C CA  . ASP B 1 324 ? 20.190  42.734 -10.276 1.00 44.63  ? 324 ASP B CA  1 
ATOM   5312 C C   . ASP B 1 324 ? 21.297  41.738 -9.970  1.00 44.63  ? 324 ASP B C   1 
ATOM   5313 O O   . ASP B 1 324 ? 22.272  41.614 -10.716 1.00 44.03  ? 324 ASP B O   1 
ATOM   5314 C CB  . ASP B 1 324 ? 20.361  43.920 -9.327  1.00 44.30  ? 324 ASP B CB  1 
ATOM   5315 C CG  . ASP B 1 324 ? 19.486  45.113 -9.693  1.00 45.97  ? 324 ASP B CG  1 
ATOM   5316 O OD1 . ASP B 1 324 ? 18.991  45.191 -10.853 1.00 42.61  ? 324 ASP B OD1 1 
ATOM   5317 O OD2 . ASP B 1 324 ? 19.326  45.983 -8.804  1.00 48.17  ? 324 ASP B OD2 1 
ATOM   5318 N N   . VAL B 1 325 ? 21.137  41.051 -8.840  1.00 41.36  ? 325 VAL B N   1 
ATOM   5319 C CA  . VAL B 1 325 ? 22.078  40.042 -8.404  1.00 39.47  ? 325 VAL B CA  1 
ATOM   5320 C C   . VAL B 1 325 ? 22.156  38.833 -9.351  1.00 40.29  ? 325 VAL B C   1 
ATOM   5321 O O   . VAL B 1 325 ? 23.242  38.290 -9.586  1.00 45.76  ? 325 VAL B O   1 
ATOM   5322 C CB  . VAL B 1 325 ? 21.783  39.606 -6.953  1.00 39.56  ? 325 VAL B CB  1 
ATOM   5323 C CG1 . VAL B 1 325 ? 22.607  38.376 -6.562  1.00 37.53  ? 325 VAL B CG1 1 
ATOM   5324 C CG2 . VAL B 1 325 ? 22.109  40.731 -6.005  1.00 36.04  ? 325 VAL B CG2 1 
ATOM   5325 N N   . GLU B 1 326 ? 21.045  38.408 -9.934  1.00 38.57  ? 326 GLU B N   1 
ATOM   5326 C CA  . GLU B 1 326 ? 21.152  37.265 -10.825 1.00 34.32  ? 326 GLU B CA  1 
ATOM   5327 C C   . GLU B 1 326 ? 21.641  37.681 -12.179 1.00 32.90  ? 326 GLU B C   1 
ATOM   5328 O O   . GLU B 1 326 ? 22.257  36.887 -12.868 1.00 35.38  ? 326 GLU B O   1 
ATOM   5329 C CB  . GLU B 1 326 ? 19.835  36.518 -10.968 1.00 33.89  ? 326 GLU B CB  1 
ATOM   5330 C CG  . GLU B 1 326 ? 19.980  35.150 -11.645 1.00 32.67  ? 326 GLU B CG  1 
ATOM   5331 C CD  . GLU B 1 326 ? 19.817  35.179 -13.161 1.00 37.38  ? 326 GLU B CD  1 
ATOM   5332 O OE1 . GLU B 1 326 ? 19.328  36.210 -13.687 1.00 33.95  ? 326 GLU B OE1 1 
ATOM   5333 O OE2 . GLU B 1 326 ? 20.162  34.157 -13.825 1.00 37.43  ? 326 GLU B OE2 1 
ATOM   5334 N N   . SER B 1 327 ? 21.376  38.914 -12.583 1.00 32.51  ? 327 SER B N   1 
ATOM   5335 C CA  . SER B 1 327 ? 21.840  39.339 -13.893 1.00 37.14  ? 327 SER B CA  1 
ATOM   5336 C C   . SER B 1 327 ? 23.361  39.168 -13.960 1.00 40.73  ? 327 SER B C   1 
ATOM   5337 O O   . SER B 1 327 ? 23.860  38.576 -14.916 1.00 42.41  ? 327 SER B O   1 
ATOM   5338 C CB  . SER B 1 327 ? 21.427  40.786 -14.203 1.00 33.95  ? 327 SER B CB  1 
ATOM   5339 O OG  . SER B 1 327 ? 21.714  41.645 -13.124 1.00 39.79  ? 327 SER B OG  1 
ATOM   5340 N N   . VAL B 1 328 ? 24.071  39.587 -12.899 1.00 40.64  ? 328 VAL B N   1 
ATOM   5341 C CA  . VAL B 1 328 ? 25.539  39.477 -12.806 1.00 38.65  ? 328 VAL B CA  1 
ATOM   5342 C C   . VAL B 1 328 ? 26.003  38.032 -13.084 1.00 35.91  ? 328 VAL B C   1 
ATOM   5343 O O   . VAL B 1 328 ? 26.801  37.773 -13.980 1.00 33.44  ? 328 VAL B O   1 
ATOM   5344 C CB  . VAL B 1 328 ? 26.051  39.973 -11.412 1.00 38.61  ? 328 VAL B CB  1 
ATOM   5345 C CG1 . VAL B 1 328 ? 27.526  39.663 -11.237 1.00 36.85  ? 328 VAL B CG1 1 
ATOM   5346 C CG2 . VAL B 1 328 ? 25.833  41.452 -11.280 1.00 28.29  ? 328 VAL B CG2 1 
ATOM   5347 N N   . GLN B 1 329 ? 25.446  37.088 -12.350 1.00 35.90  ? 329 GLN B N   1 
ATOM   5348 C CA  . GLN B 1 329 ? 25.787  35.685 -12.552 1.00 39.32  ? 329 GLN B CA  1 
ATOM   5349 C C   . GLN B 1 329 ? 25.395  35.249 -13.960 1.00 37.73  ? 329 GLN B C   1 
ATOM   5350 O O   . GLN B 1 329 ? 26.046  34.412 -14.571 1.00 37.56  ? 329 GLN B O   1 
ATOM   5351 C CB  . GLN B 1 329 ? 25.077  34.808 -11.501 1.00 40.67  ? 329 GLN B CB  1 
ATOM   5352 C CG  . GLN B 1 329 ? 25.653  34.920 -10.067 1.00 41.10  ? 329 GLN B CG  1 
ATOM   5353 C CD  . GLN B 1 329 ? 26.928  34.082 -9.867  1.00 42.49  ? 329 GLN B CD  1 
ATOM   5354 O OE1 . GLN B 1 329 ? 27.181  33.121 -10.596 1.00 39.00  ? 329 GLN B OE1 1 
ATOM   5355 N NE2 . GLN B 1 329 ? 27.730  34.455 -8.881  1.00 41.02  ? 329 GLN B NE2 1 
ATOM   5356 N N   . ALA B 1 330 ? 24.336  35.853 -14.481 1.00 40.25  ? 330 ALA B N   1 
ATOM   5357 C CA  . ALA B 1 330 ? 23.834  35.514 -15.803 1.00 43.98  ? 330 ALA B CA  1 
ATOM   5358 C C   . ALA B 1 330 ? 24.845  35.963 -16.829 1.00 45.52  ? 330 ALA B C   1 
ATOM   5359 O O   . ALA B 1 330 ? 25.199  35.225 -17.761 1.00 46.29  ? 330 ALA B O   1 
ATOM   5360 C CB  . ALA B 1 330 ? 22.478  36.207 -16.048 1.00 41.19  ? 330 ALA B CB  1 
ATOM   5361 N N   . ILE B 1 331 ? 25.291  37.201 -16.636 1.00 47.25  ? 331 ILE B N   1 
ATOM   5362 C CA  . ILE B 1 331 ? 26.263  37.860 -17.490 1.00 46.25  ? 331 ILE B CA  1 
ATOM   5363 C C   . ILE B 1 331 ? 27.512  36.998 -17.456 1.00 44.94  ? 331 ILE B C   1 
ATOM   5364 O O   . ILE B 1 331 ? 28.085  36.689 -18.507 1.00 43.01  ? 331 ILE B O   1 
ATOM   5365 C CB  . ILE B 1 331 ? 26.549  39.325 -16.980 1.00 43.32  ? 331 ILE B CB  1 
ATOM   5366 C CG1 . ILE B 1 331 ? 25.357  40.229 -17.322 1.00 39.81  ? 331 ILE B CG1 1 
ATOM   5367 C CG2 . ILE B 1 331 ? 27.864  39.885 -17.547 1.00 39.52  ? 331 ILE B CG2 1 
ATOM   5368 C CD1 . ILE B 1 331 ? 25.408  41.594 -16.656 1.00 38.29  ? 331 ILE B CD1 1 
ATOM   5369 N N   . ASP B 1 332 ? 27.853  36.510 -16.263 1.00 43.14  ? 332 ASP B N   1 
ATOM   5370 C CA  . ASP B 1 332 ? 29.038  35.691 -16.118 1.00 44.99  ? 332 ASP B CA  1 
ATOM   5371 C C   . ASP B 1 332 ? 28.984  34.353 -16.824 1.00 46.49  ? 332 ASP B C   1 
ATOM   5372 O O   . ASP B 1 332 ? 30.011  33.888 -17.299 1.00 50.60  ? 332 ASP B O   1 
ATOM   5373 C CB  . ASP B 1 332 ? 29.424  35.506 -14.668 1.00 44.24  ? 332 ASP B CB  1 
ATOM   5374 C CG  . ASP B 1 332 ? 30.761  34.841 -14.523 1.00 48.22  ? 332 ASP B CG  1 
ATOM   5375 O OD1 . ASP B 1 332 ? 31.621  35.006 -15.411 1.00 48.12  ? 332 ASP B OD1 1 
ATOM   5376 O OD2 . ASP B 1 332 ? 30.954  34.136 -13.521 1.00 55.78  ? 332 ASP B OD2 1 
ATOM   5377 N N   . LYS B 1 333 ? 27.799  33.749 -16.915 1.00 46.54  ? 333 LYS B N   1 
ATOM   5378 C CA  . LYS B 1 333 ? 27.630  32.465 -17.597 1.00 40.27  ? 333 LYS B CA  1 
ATOM   5379 C C   . LYS B 1 333 ? 27.951  32.595 -19.063 1.00 35.70  ? 333 LYS B C   1 
ATOM   5380 O O   . LYS B 1 333 ? 28.425  31.668 -19.684 1.00 36.96  ? 333 LYS B O   1 
ATOM   5381 C CB  . LYS B 1 333 ? 26.198  31.972 -17.479 1.00 42.59  ? 333 LYS B CB  1 
ATOM   5382 C CG  . LYS B 1 333 ? 25.757  31.766 -16.073 1.00 49.88  ? 333 LYS B CG  1 
ATOM   5383 C CD  . LYS B 1 333 ? 24.619  30.767 -16.011 1.00 59.71  ? 333 LYS B CD  1 
ATOM   5384 C CE  . LYS B 1 333 ? 24.020  30.669 -14.600 1.00 60.00  ? 333 LYS B CE  1 
ATOM   5385 N NZ  . LYS B 1 333 ? 23.218  31.885 -14.235 1.00 62.89  ? 333 LYS B NZ  1 
ATOM   5386 N N   . ILE B 1 334 ? 27.643  33.745 -19.624 1.00 35.30  ? 334 ILE B N   1 
ATOM   5387 C CA  . ILE B 1 334 ? 27.891  33.993 -21.028 1.00 37.29  ? 334 ILE B CA  1 
ATOM   5388 C C   . ILE B 1 334 ? 29.335  34.423 -21.241 1.00 38.31  ? 334 ILE B C   1 
ATOM   5389 O O   . ILE B 1 334 ? 30.015  33.881 -22.113 1.00 40.17  ? 334 ILE B O   1 
ATOM   5390 C CB  . ILE B 1 334 ? 26.978  35.149 -21.545 1.00 40.39  ? 334 ILE B CB  1 
ATOM   5391 C CG1 . ILE B 1 334 ? 25.506  34.841 -21.285 1.00 36.19  ? 334 ILE B CG1 1 
ATOM   5392 C CG2 . ILE B 1 334 ? 27.210  35.408 -23.027 1.00 43.48  ? 334 ILE B CG2 1 
ATOM   5393 C CD1 . ILE B 1 334 ? 24.648  36.022 -21.523 1.00 30.41  ? 334 ILE B CD1 1 
ATOM   5394 N N   . ARG B 1 335 ? 29.781  35.414 -20.461 1.00 38.80  ? 335 ARG B N   1 
ATOM   5395 C CA  . ARG B 1 335 ? 31.120  35.987 -20.597 1.00 39.23  ? 335 ARG B CA  1 
ATOM   5396 C C   . ARG B 1 335 ? 32.266  35.130 -20.081 1.00 41.32  ? 335 ARG B C   1 
ATOM   5397 O O   . ARG B 1 335 ? 33.332  35.095 -20.685 1.00 47.92  ? 335 ARG B O   1 
ATOM   5398 C CB  . ARG B 1 335 ? 31.191  37.390 -19.980 1.00 36.21  ? 335 ARG B CB  1 
ATOM   5399 C CG  . ARG B 1 335 ? 30.435  38.454 -20.732 1.00 36.55  ? 335 ARG B CG  1 
ATOM   5400 C CD  . ARG B 1 335 ? 30.264  38.115 -22.240 1.00 38.34  ? 335 ARG B CD  1 
ATOM   5401 N NE  . ARG B 1 335 ? 31.367  38.527 -23.110 1.00 42.12  ? 335 ARG B NE  1 
ATOM   5402 C CZ  . ARG B 1 335 ? 31.407  39.648 -23.843 1.00 45.45  ? 335 ARG B CZ  1 
ATOM   5403 N NH1 . ARG B 1 335 ? 30.403  40.517 -23.832 1.00 50.50  ? 335 ARG B NH1 1 
ATOM   5404 N NH2 . ARG B 1 335 ? 32.464  39.920 -24.600 1.00 48.94  ? 335 ARG B NH2 1 
ATOM   5405 N N   . GLY B 1 336 ? 32.086  34.521 -18.921 1.00 38.51  ? 336 GLY B N   1 
ATOM   5406 C CA  . GLY B 1 336 ? 33.121  33.659 -18.393 1.00 35.30  ? 336 GLY B CA  1 
ATOM   5407 C C   . GLY B 1 336 ? 34.329  34.328 -17.787 1.00 34.85  ? 336 GLY B C   1 
ATOM   5408 O O   . GLY B 1 336 ? 35.401  33.724 -17.719 1.00 33.52  ? 336 GLY B O   1 
ATOM   5409 N N   . PHE B 1 337 ? 34.156  35.530 -17.258 1.00 32.25  ? 337 PHE B N   1 
ATOM   5410 C CA  . PHE B 1 337 ? 35.290  36.217 -16.667 1.00 31.88  ? 337 PHE B CA  1 
ATOM   5411 C C   . PHE B 1 337 ? 35.781  35.584 -15.385 1.00 33.53  ? 337 PHE B C   1 
ATOM   5412 O O   . PHE B 1 337 ? 36.984  35.549 -15.155 1.00 39.19  ? 337 PHE B O   1 
ATOM   5413 C CB  . PHE B 1 337 ? 35.023  37.711 -16.512 1.00 26.04  ? 337 PHE B CB  1 
ATOM   5414 C CG  . PHE B 1 337 ? 34.697  38.372 -17.799 1.00 24.36  ? 337 PHE B CG  1 
ATOM   5415 C CD1 . PHE B 1 337 ? 35.031  37.765 -18.993 1.00 25.04  ? 337 PHE B CD1 1 
ATOM   5416 C CD2 . PHE B 1 337 ? 33.995  39.562 -17.834 1.00 31.12  ? 337 PHE B CD2 1 
ATOM   5417 C CE1 . PHE B 1 337 ? 34.664  38.324 -20.211 1.00 28.30  ? 337 PHE B CE1 1 
ATOM   5418 C CE2 . PHE B 1 337 ? 33.622  40.131 -19.054 1.00 29.79  ? 337 PHE B CE2 1 
ATOM   5419 C CZ  . PHE B 1 337 ? 33.961  39.503 -20.237 1.00 28.82  ? 337 PHE B CZ  1 
ATOM   5420 N N   . ILE B 1 338 ? 34.882  35.061 -14.554 1.00 34.42  ? 338 ILE B N   1 
ATOM   5421 C CA  . ILE B 1 338 ? 35.347  34.429 -13.330 1.00 32.28  ? 338 ILE B CA  1 
ATOM   5422 C C   . ILE B 1 338 ? 36.217  33.224 -13.695 1.00 32.96  ? 338 ILE B C   1 
ATOM   5423 O O   . ILE B 1 338 ? 37.141  32.908 -12.974 1.00 36.88  ? 338 ILE B O   1 
ATOM   5424 C CB  . ILE B 1 338 ? 34.222  34.010 -12.396 1.00 32.22  ? 338 ILE B CB  1 
ATOM   5425 C CG1 . ILE B 1 338 ? 33.390  35.232 -12.004 1.00 31.10  ? 338 ILE B CG1 1 
ATOM   5426 C CG2 . ILE B 1 338 ? 34.828  33.399 -11.127 1.00 30.58  ? 338 ILE B CG2 1 
ATOM   5427 C CD1 . ILE B 1 338 ? 34.066  36.171 -11.035 1.00 33.68  ? 338 ILE B CD1 1 
ATOM   5428 N N   . ASP B 1 339 ? 35.941  32.576 -14.825 1.00 32.10  ? 339 ASP B N   1 
ATOM   5429 C CA  . ASP B 1 339 ? 36.760  31.455 -15.279 1.00 34.40  ? 339 ASP B CA  1 
ATOM   5430 C C   . ASP B 1 339 ? 38.180  31.999 -15.572 1.00 36.07  ? 339 ASP B C   1 
ATOM   5431 O O   . ASP B 1 339 ? 39.171  31.554 -15.003 1.00 32.24  ? 339 ASP B O   1 
ATOM   5432 C CB  . ASP B 1 339 ? 36.194  30.874 -16.584 1.00 41.01  ? 339 ASP B CB  1 
ATOM   5433 C CG  . ASP B 1 339 ? 34.989  29.953 -16.369 1.00 46.43  ? 339 ASP B CG  1 
ATOM   5434 O OD1 . ASP B 1 339 ? 34.909  29.315 -15.299 1.00 51.05  ? 339 ASP B OD1 1 
ATOM   5435 O OD2 . ASP B 1 339 ? 34.135  29.853 -17.282 1.00 45.97  ? 339 ASP B OD2 1 
ATOM   5436 N N   . LEU B 1 340 ? 38.243  33.002 -16.442 1.00 35.83  ? 340 LEU B N   1 
ATOM   5437 C CA  . LEU B 1 340 ? 39.481  33.643 -16.864 1.00 35.70  ? 340 LEU B CA  1 
ATOM   5438 C C   . LEU B 1 340 ? 40.326  34.036 -15.661 1.00 34.49  ? 340 LEU B C   1 
ATOM   5439 O O   . LEU B 1 340 ? 41.531  33.853 -15.672 1.00 32.39  ? 340 LEU B O   1 
ATOM   5440 C CB  . LEU B 1 340 ? 39.144  34.874 -17.727 1.00 38.88  ? 340 LEU B CB  1 
ATOM   5441 C CG  . LEU B 1 340 ? 40.224  35.719 -18.424 1.00 39.79  ? 340 LEU B CG  1 
ATOM   5442 C CD1 . LEU B 1 340 ? 41.067  34.878 -19.389 1.00 33.55  ? 340 LEU B CD1 1 
ATOM   5443 C CD2 . LEU B 1 340 ? 39.552  36.867 -19.166 1.00 36.41  ? 340 LEU B CD2 1 
ATOM   5444 N N   . VAL B 1 341 ? 39.669  34.527 -14.613 1.00 35.45  ? 341 VAL B N   1 
ATOM   5445 C CA  . VAL B 1 341 ? 40.321  34.961 -13.378 1.00 32.64  ? 341 VAL B CA  1 
ATOM   5446 C C   . VAL B 1 341 ? 41.083  33.827 -12.703 1.00 38.04  ? 341 VAL B C   1 
ATOM   5447 O O   . VAL B 1 341 ? 42.256  33.993 -12.369 1.00 41.85  ? 341 VAL B O   1 
ATOM   5448 C CB  . VAL B 1 341 ? 39.301  35.592 -12.396 1.00 26.72  ? 341 VAL B CB  1 
ATOM   5449 C CG1 . VAL B 1 341 ? 39.907  35.823 -11.066 1.00 23.99  ? 341 VAL B CG1 1 
ATOM   5450 C CG2 . VAL B 1 341 ? 38.825  36.901 -12.933 1.00 23.93  ? 341 VAL B CG2 1 
ATOM   5451 N N   . LEU B 1 342 ? 40.432  32.677 -12.522 1.00 39.37  ? 342 LEU B N   1 
ATOM   5452 C CA  . LEU B 1 342 ? 41.056  31.517 -11.884 1.00 34.56  ? 342 LEU B CA  1 
ATOM   5453 C C   . LEU B 1 342 ? 42.114  30.913 -12.808 1.00 34.77  ? 342 LEU B C   1 
ATOM   5454 O O   . LEU B 1 342 ? 43.156  30.476 -12.349 1.00 33.12  ? 342 LEU B O   1 
ATOM   5455 C CB  . LEU B 1 342 ? 39.993  30.488 -11.528 1.00 36.07  ? 342 LEU B CB  1 
ATOM   5456 C CG  . LEU B 1 342 ? 38.831  30.946 -10.629 1.00 38.12  ? 342 LEU B CG  1 
ATOM   5457 C CD1 . LEU B 1 342 ? 37.782  29.815 -10.436 1.00 40.22  ? 342 LEU B CD1 1 
ATOM   5458 C CD2 . LEU B 1 342 ? 39.370  31.413 -9.275  1.00 37.86  ? 342 LEU B CD2 1 
ATOM   5459 N N   . SER B 1 343 ? 41.832  30.888 -14.107 1.00 33.84  ? 343 SER B N   1 
ATOM   5460 C CA  . SER B 1 343 ? 42.768  30.406 -15.115 1.00 34.06  ? 343 SER B CA  1 
ATOM   5461 C C   . SER B 1 343 ? 44.057  31.241 -15.043 1.00 36.59  ? 343 SER B C   1 
ATOM   5462 O O   . SER B 1 343 ? 45.090  30.741 -14.615 1.00 40.04  ? 343 SER B O   1 
ATOM   5463 C CB  . SER B 1 343 ? 42.185  30.594 -16.515 1.00 33.20  ? 343 SER B CB  1 
ATOM   5464 O OG  . SER B 1 343 ? 41.299  29.564 -16.847 1.00 41.91  ? 343 SER B OG  1 
ATOM   5465 N N   . MET B 1 344 ? 43.990  32.500 -15.486 1.00 34.32  ? 344 MET B N   1 
ATOM   5466 C CA  . MET B 1 344 ? 45.135  33.401 -15.470 1.00 34.45  ? 344 MET B CA  1 
ATOM   5467 C C   . MET B 1 344 ? 45.939  33.336 -14.171 1.00 38.55  ? 344 MET B C   1 
ATOM   5468 O O   . MET B 1 344 ? 47.164  33.216 -14.216 1.00 42.03  ? 344 MET B O   1 
ATOM   5469 C CB  . MET B 1 344 ? 44.695  34.848 -15.720 1.00 30.08  ? 344 MET B CB  1 
ATOM   5470 C CG  . MET B 1 344 ? 44.322  35.150 -17.150 1.00 26.93  ? 344 MET B CG  1 
ATOM   5471 S SD  . MET B 1 344 ? 44.059  36.909 -17.503 1.00 30.31  ? 344 MET B SD  1 
ATOM   5472 C CE  . MET B 1 344 ? 45.379  37.643 -16.707 1.00 28.73  ? 344 MET B CE  1 
ATOM   5473 N N   . SER B 1 345 ? 45.257  33.444 -13.028 1.00 37.20  ? 345 SER B N   1 
ATOM   5474 C CA  . SER B 1 345 ? 45.901  33.393 -11.713 1.00 35.56  ? 345 SER B CA  1 
ATOM   5475 C C   . SER B 1 345 ? 46.580  32.059 -11.381 1.00 36.12  ? 345 SER B C   1 
ATOM   5476 O O   . SER B 1 345 ? 47.555  32.036 -10.662 1.00 38.60  ? 345 SER B O   1 
ATOM   5477 C CB  . SER B 1 345 ? 44.902  33.717 -10.608 1.00 33.16  ? 345 SER B CB  1 
ATOM   5478 O OG  . SER B 1 345 ? 44.271  34.964 -10.827 1.00 37.10  ? 345 SER B OG  1 
ATOM   5479 N N   . TYR B 1 346 ? 46.041  30.943 -11.848 1.00 35.64  ? 346 TYR B N   1 
ATOM   5480 C CA  . TYR B 1 346 ? 46.659  29.658 -11.555 1.00 37.46  ? 346 TYR B CA  1 
ATOM   5481 C C   . TYR B 1 346 ? 47.766  29.371 -12.553 1.00 38.28  ? 346 TYR B C   1 
ATOM   5482 O O   . TYR B 1 346 ? 48.751  28.705 -12.221 1.00 42.73  ? 346 TYR B O   1 
ATOM   5483 C CB  . TYR B 1 346 ? 45.618  28.523 -11.546 1.00 37.26  ? 346 TYR B CB  1 
ATOM   5484 C CG  . TYR B 1 346 ? 44.696  28.615 -10.368 1.00 34.41  ? 346 TYR B CG  1 
ATOM   5485 C CD1 . TYR B 1 346 ? 45.201  28.902 -9.114  1.00 35.32  ? 346 TYR B CD1 1 
ATOM   5486 C CD2 . TYR B 1 346 ? 43.318  28.490 -10.516 1.00 38.41  ? 346 TYR B CD2 1 
ATOM   5487 C CE1 . TYR B 1 346 ? 44.371  29.075 -8.022  1.00 40.06  ? 346 TYR B CE1 1 
ATOM   5488 C CE2 . TYR B 1 346 ? 42.458  28.661 -9.430  1.00 38.89  ? 346 TYR B CE2 1 
ATOM   5489 C CZ  . TYR B 1 346 ? 42.996  28.954 -8.181  1.00 44.54  ? 346 TYR B CZ  1 
ATOM   5490 O OH  . TYR B 1 346 ? 42.191  29.120 -7.074  1.00 43.54  ? 346 TYR B OH  1 
ATOM   5491 N N   . TYR B 1 347 ? 47.596  29.892 -13.770 1.00 38.85  ? 347 TYR B N   1 
ATOM   5492 C CA  . TYR B 1 347 ? 48.553  29.729 -14.867 1.00 34.92  ? 347 TYR B CA  1 
ATOM   5493 C C   . TYR B 1 347 ? 49.815  30.544 -14.587 1.00 35.74  ? 347 TYR B C   1 
ATOM   5494 O O   . TYR B 1 347 ? 50.920  30.127 -14.910 1.00 42.23  ? 347 TYR B O   1 
ATOM   5495 C CB  . TYR B 1 347 ? 47.941  30.186 -16.181 1.00 29.50  ? 347 TYR B CB  1 
ATOM   5496 C CG  . TYR B 1 347 ? 48.874  30.031 -17.365 1.00 39.22  ? 347 TYR B CG  1 
ATOM   5497 C CD1 . TYR B 1 347 ? 49.949  30.917 -17.568 1.00 40.20  ? 347 TYR B CD1 1 
ATOM   5498 C CD2 . TYR B 1 347 ? 48.677  29.018 -18.306 1.00 35.42  ? 347 TYR B CD2 1 
ATOM   5499 C CE1 . TYR B 1 347 ? 50.787  30.796 -18.674 1.00 33.40  ? 347 TYR B CE1 1 
ATOM   5500 C CE2 . TYR B 1 347 ? 49.508  28.895 -19.412 1.00 34.81  ? 347 TYR B CE2 1 
ATOM   5501 C CZ  . TYR B 1 347 ? 50.562  29.787 -19.588 1.00 33.20  ? 347 TYR B CZ  1 
ATOM   5502 O OH  . TYR B 1 347 ? 51.376  29.652 -20.684 1.00 36.14  ? 347 TYR B OH  1 
ATOM   5503 N N   . ALA B 1 348 ? 49.631  31.718 -14.016 1.00 31.59  ? 348 ALA B N   1 
ATOM   5504 C CA  . ALA B 1 348 ? 50.720  32.578 -13.691 1.00 29.42  ? 348 ALA B CA  1 
ATOM   5505 C C   . ALA B 1 348 ? 51.160  32.348 -12.261 1.00 32.67  ? 348 ALA B C   1 
ATOM   5506 O O   . ALA B 1 348 ? 52.187  32.893 -11.860 1.00 38.30  ? 348 ALA B O   1 
ATOM   5507 C CB  . ALA B 1 348 ? 50.297  34.014 -13.878 1.00 24.95  ? 348 ALA B CB  1 
ATOM   5508 N N   . LYS B 1 349 ? 50.407  31.538 -11.508 1.00 33.41  ? 349 LYS B N   1 
ATOM   5509 C CA  . LYS B 1 349 ? 50.671  31.253 -10.079 1.00 35.05  ? 349 LYS B CA  1 
ATOM   5510 C C   . LYS B 1 349 ? 50.738  32.532 -9.254  1.00 36.76  ? 349 LYS B C   1 
ATOM   5511 O O   . LYS B 1 349 ? 51.707  32.789 -8.519  1.00 37.80  ? 349 LYS B O   1 
ATOM   5512 C CB  . LYS B 1 349 ? 51.946  30.423 -9.856  1.00 36.70  ? 349 LYS B CB  1 
ATOM   5513 C CG  . LYS B 1 349 ? 51.862  29.004 -10.396 1.00 39.79  ? 349 LYS B CG  1 
ATOM   5514 C CD  . LYS B 1 349 ? 53.198  28.302 -10.342 1.00 43.20  ? 349 LYS B CD  1 
ATOM   5515 C CE  . LYS B 1 349 ? 53.087  26.954 -11.055 1.00 47.52  ? 349 LYS B CE  1 
ATOM   5516 N NZ  . LYS B 1 349 ? 54.368  26.445 -11.684 1.00 51.91  ? 349 LYS B NZ  1 
ATOM   5517 N N   . MET B 1 350 ? 49.675  33.317 -9.361  1.00 33.53  ? 350 MET B N   1 
ATOM   5518 C CA  . MET B 1 350 ? 49.572  34.584 -8.653  1.00 33.95  ? 350 MET B CA  1 
ATOM   5519 C C   . MET B 1 350 ? 48.186  34.716 -8.030  1.00 34.22  ? 350 MET B C   1 
ATOM   5520 O O   . MET B 1 350 ? 47.289  33.907 -8.283  1.00 31.49  ? 350 MET B O   1 
ATOM   5521 C CB  . MET B 1 350 ? 49.773  35.759 -9.631  1.00 29.11  ? 350 MET B CB  1 
ATOM   5522 C CG  . MET B 1 350 ? 48.714  35.815 -10.729 1.00 25.79  ? 350 MET B CG  1 
ATOM   5523 S SD  . MET B 1 350 ? 48.769  37.235 -11.810 1.00 24.89  ? 350 MET B SD  1 
ATOM   5524 C CE  . MET B 1 350 ? 47.669  36.768 -13.072 1.00 26.43  ? 350 MET B CE  1 
ATOM   5525 N N   . PRO B 1 351 ? 48.018  35.711 -7.153  1.00 36.72  ? 351 PRO B N   1 
ATOM   5526 C CA  . PRO B 1 351 ? 46.730  35.950 -6.500  1.00 40.40  ? 351 PRO B CA  1 
ATOM   5527 C C   . PRO B 1 351 ? 45.732  36.575 -7.491  1.00 38.90  ? 351 PRO B C   1 
ATOM   5528 O O   . PRO B 1 351 ? 46.102  37.388 -8.334  1.00 39.34  ? 351 PRO B O   1 
ATOM   5529 C CB  . PRO B 1 351 ? 47.106  36.907 -5.374  1.00 43.06  ? 351 PRO B CB  1 
ATOM   5530 C CG  . PRO B 1 351 ? 48.541  36.492 -5.046  1.00 38.68  ? 351 PRO B CG  1 
ATOM   5531 C CD  . PRO B 1 351 ? 49.093  36.418 -6.435  1.00 37.79  ? 351 PRO B CD  1 
ATOM   5532 N N   . PHE B 1 352 ? 44.471  36.185 -7.367  1.00 39.16  ? 352 PHE B N   1 
ATOM   5533 C CA  . PHE B 1 352 ? 43.387  36.637 -8.239  1.00 39.51  ? 352 PHE B CA  1 
ATOM   5534 C C   . PHE B 1 352 ? 43.374  38.135 -8.612  1.00 37.98  ? 352 PHE B C   1 
ATOM   5535 O O   . PHE B 1 352 ? 42.930  38.507 -9.702  1.00 35.56  ? 352 PHE B O   1 
ATOM   5536 C CB  . PHE B 1 352 ? 42.033  36.253 -7.599  1.00 41.03  ? 352 PHE B CB  1 
ATOM   5537 C CG  . PHE B 1 352 ? 41.907  34.780 -7.233  1.00 38.54  ? 352 PHE B CG  1 
ATOM   5538 C CD1 . PHE B 1 352 ? 42.377  33.783 -8.088  1.00 33.40  ? 352 PHE B CD1 1 
ATOM   5539 C CD2 . PHE B 1 352 ? 41.298  34.401 -6.038  1.00 32.36  ? 352 PHE B CD2 1 
ATOM   5540 C CE1 . PHE B 1 352 ? 42.236  32.441 -7.756  1.00 29.69  ? 352 PHE B CE1 1 
ATOM   5541 C CE2 . PHE B 1 352 ? 41.155  33.053 -5.701  1.00 30.22  ? 352 PHE B CE2 1 
ATOM   5542 C CZ  . PHE B 1 352 ? 41.623  32.076 -6.560  1.00 27.29  ? 352 PHE B CZ  1 
ATOM   5543 N N   . SER B 1 353 ? 43.872  38.983 -7.718  1.00 38.11  ? 353 SER B N   1 
ATOM   5544 C CA  . SER B 1 353 ? 43.894  40.434 -7.935  1.00 41.08  ? 353 SER B CA  1 
ATOM   5545 C C   . SER B 1 353 ? 44.795  40.990 -9.032  1.00 41.16  ? 353 SER B C   1 
ATOM   5546 O O   . SER B 1 353 ? 44.676  42.167 -9.370  1.00 47.25  ? 353 SER B O   1 
ATOM   5547 C CB  . SER B 1 353 ? 44.264  41.152 -6.632  1.00 41.53  ? 353 SER B CB  1 
ATOM   5548 O OG  . SER B 1 353 ? 45.662  41.411 -6.563  1.00 47.38  ? 353 SER B OG  1 
ATOM   5549 N N   . GLY B 1 354 ? 45.726  40.186 -9.540  1.00 41.72  ? 354 GLY B N   1 
ATOM   5550 C CA  . GLY B 1 354 ? 46.650  40.670 -10.551 1.00 36.17  ? 354 GLY B CA  1 
ATOM   5551 C C   . GLY B 1 354 ? 46.281  40.539 -12.011 1.00 35.52  ? 354 GLY B C   1 
ATOM   5552 O O   . GLY B 1 354 ? 46.975  41.109 -12.848 1.00 31.60  ? 354 GLY B O   1 
ATOM   5553 N N   . VAL B 1 355 ? 45.203  39.822 -12.326 1.00 37.00  ? 355 VAL B N   1 
ATOM   5554 C CA  . VAL B 1 355 ? 44.758  39.613 -13.723 1.00 37.12  ? 355 VAL B CA  1 
ATOM   5555 C C   . VAL B 1 355 ? 44.221  40.886 -14.439 1.00 35.25  ? 355 VAL B C   1 
ATOM   5556 O O   . VAL B 1 355 ? 44.101  40.954 -15.662 1.00 37.12  ? 355 VAL B O   1 
ATOM   5557 C CB  . VAL B 1 355 ? 43.787  38.377 -13.842 1.00 34.99  ? 355 VAL B CB  1 
ATOM   5558 C CG1 . VAL B 1 355 ? 43.600  37.727 -12.514 1.00 42.04  ? 355 VAL B CG1 1 
ATOM   5559 C CG2 . VAL B 1 355 ? 42.441  38.752 -14.386 1.00 36.55  ? 355 VAL B CG2 1 
ATOM   5560 N N   . MET B 1 356 ? 43.978  41.920 -13.661 1.00 34.42  ? 356 MET B N   1 
ATOM   5561 C CA  . MET B 1 356 ? 43.520  43.188 -14.192 1.00 36.48  ? 356 MET B CA  1 
ATOM   5562 C C   . MET B 1 356 ? 44.734  44.091 -14.448 1.00 36.92  ? 356 MET B C   1 
ATOM   5563 O O   . MET B 1 356 ? 44.640  45.102 -15.141 1.00 35.35  ? 356 MET B O   1 
ATOM   5564 C CB  . MET B 1 356 ? 42.628  43.836 -13.139 1.00 40.42  ? 356 MET B CB  1 
ATOM   5565 C CG  . MET B 1 356 ? 41.398  43.006 -12.798 1.00 42.40  ? 356 MET B CG  1 
ATOM   5566 S SD  . MET B 1 356 ? 40.121  43.432 -13.958 1.00 44.78  ? 356 MET B SD  1 
ATOM   5567 C CE  . MET B 1 356 ? 39.868  45.123 -13.481 1.00 43.24  ? 356 MET B CE  1 
ATOM   5568 N N   . SER B 1 357 ? 45.880  43.681 -13.904 1.00 37.99  ? 357 SER B N   1 
ATOM   5569 C CA  . SER B 1 357 ? 47.135  44.424 -13.990 1.00 33.04  ? 357 SER B CA  1 
ATOM   5570 C C   . SER B 1 357 ? 48.267  43.815 -14.795 1.00 27.45  ? 357 SER B C   1 
ATOM   5571 O O   . SER B 1 357 ? 48.827  42.811 -14.374 1.00 28.06  ? 357 SER B O   1 
ATOM   5572 C CB  . SER B 1 357 ? 47.671  44.659 -12.582 1.00 33.65  ? 357 SER B CB  1 
ATOM   5573 O OG  . SER B 1 357 ? 48.928  45.319 -12.627 1.00 36.42  ? 357 SER B OG  1 
ATOM   5574 N N   . PRO B 1 358 ? 48.608  44.399 -15.960 1.00 27.67  ? 358 PRO B N   1 
ATOM   5575 C CA  . PRO B 1 358 ? 49.699  43.907 -16.809 1.00 30.65  ? 358 PRO B CA  1 
ATOM   5576 C C   . PRO B 1 358 ? 51.019  43.882 -16.009 1.00 34.43  ? 358 PRO B C   1 
ATOM   5577 O O   . PRO B 1 358 ? 51.720  42.846 -15.971 1.00 37.71  ? 358 PRO B O   1 
ATOM   5578 C CB  . PRO B 1 358 ? 49.730  44.921 -17.952 1.00 27.65  ? 358 PRO B CB  1 
ATOM   5579 C CG  . PRO B 1 358 ? 48.270  45.214 -18.150 1.00 26.61  ? 358 PRO B CG  1 
ATOM   5580 C CD  . PRO B 1 358 ? 47.769  45.361 -16.710 1.00 27.24  ? 358 PRO B CD  1 
ATOM   5581 N N   . ILE B 1 359 ? 51.317  44.986 -15.318 1.00 32.59  ? 359 ILE B N   1 
ATOM   5582 C CA  . ILE B 1 359 ? 52.518  45.081 -14.484 1.00 31.52  ? 359 ILE B CA  1 
ATOM   5583 C C   . ILE B 1 359 ? 52.605  43.873 -13.576 1.00 35.75  ? 359 ILE B C   1 
ATOM   5584 O O   . ILE B 1 359 ? 53.613  43.182 -13.562 1.00 40.30  ? 359 ILE B O   1 
ATOM   5585 C CB  . ILE B 1 359 ? 52.456  46.283 -13.558 1.00 27.76  ? 359 ILE B CB  1 
ATOM   5586 C CG1 . ILE B 1 359 ? 52.349  47.555 -14.368 1.00 31.59  ? 359 ILE B CG1 1 
ATOM   5587 C CG2 . ILE B 1 359 ? 53.674  46.363 -12.741 1.00 29.70  ? 359 ILE B CG2 1 
ATOM   5588 C CD1 . ILE B 1 359 ? 53.443  47.713 -15.400 1.00 38.79  ? 359 ILE B CD1 1 
ATOM   5589 N N   . LYS B 1 360 ? 51.522  43.647 -12.829 1.00 40.96  ? 360 LYS B N   1 
ATOM   5590 C CA  . LYS B 1 360 ? 51.361  42.551 -11.853 1.00 38.30  ? 360 LYS B CA  1 
ATOM   5591 C C   . LYS B 1 360 ? 51.462  41.164 -12.405 1.00 31.16  ? 360 LYS B C   1 
ATOM   5592 O O   . LYS B 1 360 ? 51.948  40.288 -11.728 1.00 28.76  ? 360 LYS B O   1 
ATOM   5593 C CB  . LYS B 1 360 ? 50.021  42.665 -11.107 1.00 43.43  ? 360 LYS B CB  1 
ATOM   5594 C CG  . LYS B 1 360 ? 49.966  43.821 -10.102 1.00 46.37  ? 360 LYS B CG  1 
ATOM   5595 C CD  . LYS B 1 360 ? 48.680  43.797 -9.273  1.00 50.29  ? 360 LYS B CD  1 
ATOM   5596 C CE  . LYS B 1 360 ? 48.755  44.774 -8.116  1.00 51.85  ? 360 LYS B CE  1 
ATOM   5597 N NZ  . LYS B 1 360 ? 47.432  44.955 -7.473  1.00 54.68  ? 360 LYS B NZ  1 
ATOM   5598 N N   . THR B 1 361 ? 50.903  40.945 -13.584 1.00 29.97  ? 361 THR B N   1 
ATOM   5599 C CA  . THR B 1 361 ? 50.966  39.646 -14.217 1.00 33.62  ? 361 THR B CA  1 
ATOM   5600 C C   . THR B 1 361 ? 52.433  39.440 -14.681 1.00 38.37  ? 361 THR B C   1 
ATOM   5601 O O   . THR B 1 361 ? 53.106  38.454 -14.295 1.00 32.76  ? 361 THR B O   1 
ATOM   5602 C CB  . THR B 1 361 ? 49.972  39.584 -15.412 1.00 32.67  ? 361 THR B CB  1 
ATOM   5603 O OG1 . THR B 1 361 ? 48.646  39.869 -14.942 1.00 33.11  ? 361 THR B OG1 1 
ATOM   5604 C CG2 . THR B 1 361 ? 49.984  38.193 -16.084 1.00 28.26  ? 361 THR B CG2 1 
ATOM   5605 N N   . TRP B 1 362 ? 52.922  40.397 -15.476 1.00 39.26  ? 362 TRP B N   1 
ATOM   5606 C CA  . TRP B 1 362 ? 54.292  40.398 -16.010 1.00 41.27  ? 362 TRP B CA  1 
ATOM   5607 C C   . TRP B 1 362 ? 55.269  40.165 -14.859 1.00 41.04  ? 362 TRP B C   1 
ATOM   5608 O O   . TRP B 1 362 ? 56.120  39.295 -14.925 1.00 44.85  ? 362 TRP B O   1 
ATOM   5609 C CB  . TRP B 1 362 ? 54.560  41.759 -16.639 1.00 43.71  ? 362 TRP B CB  1 
ATOM   5610 C CG  . TRP B 1 362 ? 55.898  41.969 -17.261 1.00 42.17  ? 362 TRP B CG  1 
ATOM   5611 C CD1 . TRP B 1 362 ? 56.384  41.351 -18.359 1.00 42.31  ? 362 TRP B CD1 1 
ATOM   5612 C CD2 . TRP B 1 362 ? 56.864  42.971 -16.898 1.00 45.83  ? 362 TRP B CD2 1 
ATOM   5613 N NE1 . TRP B 1 362 ? 57.579  41.911 -18.730 1.00 46.96  ? 362 TRP B NE1 1 
ATOM   5614 C CE2 . TRP B 1 362 ? 57.900  42.911 -17.846 1.00 46.26  ? 362 TRP B CE2 1 
ATOM   5615 C CE3 . TRP B 1 362 ? 56.954  43.913 -15.860 1.00 49.07  ? 362 TRP B CE3 1 
ATOM   5616 C CZ2 . TRP B 1 362 ? 59.020  43.758 -17.799 1.00 41.70  ? 362 TRP B CZ2 1 
ATOM   5617 C CZ3 . TRP B 1 362 ? 58.073  44.756 -15.812 1.00 43.56  ? 362 TRP B CZ3 1 
ATOM   5618 C CH2 . TRP B 1 362 ? 59.085  44.667 -16.778 1.00 38.66  ? 362 TRP B CH2 1 
ATOM   5619 N N   . ASP B 1 363 ? 55.112  40.938 -13.796 1.00 39.28  ? 363 ASP B N   1 
ATOM   5620 C CA  . ASP B 1 363 ? 55.938  40.840 -12.597 1.00 37.48  ? 363 ASP B CA  1 
ATOM   5621 C C   . ASP B 1 363 ? 55.855  39.451 -11.942 1.00 32.64  ? 363 ASP B C   1 
ATOM   5622 O O   . ASP B 1 363 ? 56.815  38.995 -11.332 1.00 32.69  ? 363 ASP B O   1 
ATOM   5623 C CB  . ASP B 1 363 ? 55.500  41.944 -11.633 1.00 38.54  ? 363 ASP B CB  1 
ATOM   5624 C CG  . ASP B 1 363 ? 56.181  41.875 -10.290 1.00 38.92  ? 363 ASP B CG  1 
ATOM   5625 O OD1 . ASP B 1 363 ? 55.774  41.046 -9.459  1.00 43.78  ? 363 ASP B OD1 1 
ATOM   5626 O OD2 . ASP B 1 363 ? 57.085  42.695 -10.045 1.00 43.15  ? 363 ASP B OD2 1 
ATOM   5627 N N   . ALA B 1 364 ? 54.716  38.780 -12.083 1.00 31.32  ? 364 ALA B N   1 
ATOM   5628 C CA  . ALA B 1 364 ? 54.532  37.452 -11.503 1.00 31.01  ? 364 ALA B CA  1 
ATOM   5629 C C   . ALA B 1 364 ? 55.250  36.441 -12.363 1.00 31.26  ? 364 ALA B C   1 
ATOM   5630 O O   . ALA B 1 364 ? 55.835  35.469 -11.860 1.00 31.82  ? 364 ALA B O   1 
ATOM   5631 C CB  . ALA B 1 364 ? 53.052  37.089 -11.419 1.00 29.37  ? 364 ALA B CB  1 
ATOM   5632 N N   . ILE B 1 365 ? 55.127  36.625 -13.669 1.00 31.85  ? 365 ILE B N   1 
ATOM   5633 C CA  . ILE B 1 365 ? 55.789  35.748 -14.624 1.00 36.11  ? 365 ILE B CA  1 
ATOM   5634 C C   . ILE B 1 365 ? 57.335  35.807 -14.463 1.00 38.37  ? 365 ILE B C   1 
ATOM   5635 O O   . ILE B 1 365 ? 58.006  34.770 -14.442 1.00 40.35  ? 365 ILE B O   1 
ATOM   5636 C CB  . ILE B 1 365 ? 55.363  36.124 -16.048 1.00 32.74  ? 365 ILE B CB  1 
ATOM   5637 C CG1 . ILE B 1 365 ? 53.885  35.821 -16.205 1.00 28.07  ? 365 ILE B CG1 1 
ATOM   5638 C CG2 . ILE B 1 365 ? 56.224  35.405 -17.075 1.00 31.59  ? 365 ILE B CG2 1 
ATOM   5639 C CD1 . ILE B 1 365 ? 53.529  34.424 -15.835 1.00 22.96  ? 365 ILE B CD1 1 
ATOM   5640 N N   . ILE B 1 366 ? 57.865  37.021 -14.302 1.00 37.66  ? 366 ILE B N   1 
ATOM   5641 C CA  . ILE B 1 366 ? 59.279  37.261 -14.102 1.00 35.46  ? 366 ILE B CA  1 
ATOM   5642 C C   . ILE B 1 366 ? 59.675  36.383 -12.922 1.00 39.50  ? 366 ILE B C   1 
ATOM   5643 O O   . ILE B 1 366 ? 60.526  35.496 -13.053 1.00 40.24  ? 366 ILE B O   1 
ATOM   5644 C CB  . ILE B 1 366 ? 59.555  38.769 -13.780 1.00 28.51  ? 366 ILE B CB  1 
ATOM   5645 C CG1 . ILE B 1 366 ? 59.459  39.609 -15.046 1.00 27.34  ? 366 ILE B CG1 1 
ATOM   5646 C CG2 . ILE B 1 366 ? 60.945  38.960 -13.152 1.00 30.08  ? 366 ILE B CG2 1 
ATOM   5647 C CD1 . ILE B 1 366 ? 59.775  41.075 -14.835 1.00 24.35  ? 366 ILE B CD1 1 
ATOM   5648 N N   . PHE B 1 367 ? 58.985  36.572 -11.802 1.00 42.59  ? 367 PHE B N   1 
ATOM   5649 C CA  . PHE B 1 367 ? 59.253  35.792 -10.597 1.00 47.25  ? 367 PHE B CA  1 
ATOM   5650 C C   . PHE B 1 367 ? 59.253  34.289 -10.863 1.00 52.09  ? 367 PHE B C   1 
ATOM   5651 O O   . PHE B 1 367 ? 60.297  33.629 -10.805 1.00 53.43  ? 367 PHE B O   1 
ATOM   5652 C CB  . PHE B 1 367 ? 58.191  36.080 -9.541  1.00 49.56  ? 367 PHE B CB  1 
ATOM   5653 C CG  . PHE B 1 367 ? 58.723  36.760 -8.334  1.00 50.32  ? 367 PHE B CG  1 
ATOM   5654 C CD1 . PHE B 1 367 ? 59.305  36.019 -7.309  1.00 45.55  ? 367 PHE B CD1 1 
ATOM   5655 C CD2 . PHE B 1 367 ? 58.685  38.152 -8.237  1.00 53.02  ? 367 PHE B CD2 1 
ATOM   5656 C CE1 . PHE B 1 367 ? 59.848  36.644 -6.214  1.00 46.63  ? 367 PHE B CE1 1 
ATOM   5657 C CE2 . PHE B 1 367 ? 59.225  38.794 -7.141  1.00 52.23  ? 367 PHE B CE2 1 
ATOM   5658 C CZ  . PHE B 1 367 ? 59.811  38.027 -6.130  1.00 52.16  ? 367 PHE B CZ  1 
ATOM   5659 N N   . ASN B 1 368 ? 58.064  33.775 -11.180 1.00 55.34  ? 368 ASN B N   1 
ATOM   5660 C CA  . ASN B 1 368 ? 57.818  32.355 -11.436 1.00 52.41  ? 368 ASN B CA  1 
ATOM   5661 C C   . ASN B 1 368 ? 58.610  31.668 -12.533 1.00 49.01  ? 368 ASN B C   1 
ATOM   5662 O O   . ASN B 1 368 ? 58.649  30.429 -12.579 1.00 46.04  ? 368 ASN B O   1 
ATOM   5663 C CB  . ASN B 1 368 ? 56.330  32.134 -11.692 1.00 55.85  ? 368 ASN B CB  1 
ATOM   5664 C CG  . ASN B 1 368 ? 55.560  31.914 -10.424 1.00 61.41  ? 368 ASN B CG  1 
ATOM   5665 O OD1 . ASN B 1 368 ? 55.284  30.761 -10.046 1.00 64.70  ? 368 ASN B OD1 1 
ATOM   5666 N ND2 . ASN B 1 368 ? 55.216  33.010 -9.735  1.00 59.34  ? 368 ASN B ND2 1 
ATOM   5667 N N   . SER B 1 369 ? 59.208  32.450 -13.429 1.00 44.22  ? 369 SER B N   1 
ATOM   5668 C CA  . SER B 1 369 ? 59.969  31.869 -14.521 1.00 43.76  ? 369 SER B CA  1 
ATOM   5669 C C   . SER B 1 369 ? 61.248  31.197 -14.017 1.00 47.57  ? 369 SER B C   1 
ATOM   5670 O O   . SER B 1 369 ? 61.824  30.343 -14.713 1.00 51.63  ? 369 SER B O   1 
ATOM   5671 C CB  . SER B 1 369 ? 60.306  32.928 -15.551 1.00 35.33  ? 369 SER B CB  1 
ATOM   5672 O OG  . SER B 1 369 ? 61.040  33.953 -14.929 1.00 32.16  ? 369 SER B OG  1 
ATOM   5673 N N   . LEU B 1 370 ? 61.697  31.599 -12.830 1.00 47.80  ? 370 LEU B N   1 
ATOM   5674 C CA  . LEU B 1 370 ? 62.895  31.044 -12.209 1.00 50.77  ? 370 LEU B CA  1 
ATOM   5675 C C   . LEU B 1 370 ? 62.740  29.586 -11.804 1.00 55.03  ? 370 LEU B C   1 
ATOM   5676 O O   . LEU B 1 370 ? 62.010  29.274 -10.855 1.00 61.66  ? 370 LEU B O   1 
ATOM   5677 C CB  . LEU B 1 370 ? 63.231  31.848 -10.972 1.00 52.13  ? 370 LEU B CB  1 
ATOM   5678 C CG  . LEU B 1 370 ? 64.402  32.776 -11.182 1.00 56.58  ? 370 LEU B CG  1 
ATOM   5679 C CD1 . LEU B 1 370 ? 65.715  31.989 -11.033 1.00 58.96  ? 370 LEU B CD1 1 
ATOM   5680 C CD2 . LEU B 1 370 ? 64.271  33.374 -12.573 1.00 58.49  ? 370 LEU B CD2 1 
HETATM 5681 O O   . HOH C 2 .   ? 92.701  34.467 -31.446 1.00 15.04  ? 389 HOH A O   1 
HETATM 5682 O O   . HOH C 2 .   ? 85.723  43.706 -23.057 1.00 38.88  ? 390 HOH A O   1 
HETATM 5683 O O   . HOH C 2 .   ? 42.497  44.768 -30.155 1.00 56.93  ? 391 HOH A O   1 
HETATM 5684 O O   . HOH C 2 .   ? 89.691  49.172 -40.499 1.00 32.04  ? 392 HOH A O   1 
HETATM 5685 O O   . HOH C 2 .   ? 83.041  48.838 -23.863 1.00 26.19  ? 393 HOH A O   1 
HETATM 5686 O O   . HOH C 2 .   ? 62.480  34.804 -34.344 1.00 30.66  ? 394 HOH A O   1 
HETATM 5687 O O   . HOH C 2 .   ? 95.429  44.646 -48.887 1.00 41.14  ? 395 HOH A O   1 
HETATM 5688 O O   . HOH C 2 .   ? 51.414  38.306 -26.268 1.00 31.75  ? 396 HOH A O   1 
HETATM 5689 O O   . HOH C 2 .   ? 72.840  28.277 -37.886 1.00 41.05  ? 397 HOH A O   1 
HETATM 5690 O O   . HOH C 2 .   ? 62.406  40.574 -31.872 1.00 36.23  ? 398 HOH A O   1 
HETATM 5691 O O   . HOH C 2 .   ? 48.594  38.269 -28.857 1.00 43.63  ? 399 HOH A O   1 
HETATM 5692 O O   . HOH C 2 .   ? 67.097  51.887 -25.365 1.00 86.65  ? 400 HOH A O   1 
HETATM 5693 O O   . HOH C 2 .   ? 99.921  56.062 -23.079 1.00 39.03  ? 401 HOH A O   1 
HETATM 5694 O O   . HOH C 2 .   ? 65.837  45.758 -34.473 1.00 26.15  ? 402 HOH A O   1 
HETATM 5695 O O   . HOH C 2 .   ? 77.755  44.089 -28.674 1.00 22.52  ? 403 HOH A O   1 
HETATM 5696 O O   . HOH C 2 .   ? 93.553  35.601 -33.582 1.00 38.23  ? 404 HOH A O   1 
HETATM 5697 O O   . HOH C 2 .   ? 63.424  30.342 -39.539 1.00 29.20  ? 405 HOH A O   1 
HETATM 5698 O O   . HOH C 2 .   ? 70.094  27.821 -31.048 1.00 34.12  ? 406 HOH A O   1 
HETATM 5699 O O   . HOH C 2 .   ? 64.530  33.460 -32.137 1.00 23.59  ? 407 HOH A O   1 
HETATM 5700 O O   . HOH C 2 .   ? 76.202  47.011 -30.592 1.00 31.42  ? 408 HOH A O   1 
HETATM 5701 O O   . HOH C 2 .   ? 61.286  30.818 -37.758 1.00 26.44  ? 409 HOH A O   1 
HETATM 5702 O O   . HOH C 2 .   ? 87.018  51.331 -32.117 1.00 25.56  ? 410 HOH A O   1 
HETATM 5703 O O   . HOH C 2 .   ? 68.480  35.938 -14.082 1.00 31.69  ? 411 HOH A O   1 
HETATM 5704 O O   . HOH C 2 .   ? 86.673  53.639 -43.534 1.00 26.69  ? 412 HOH A O   1 
HETATM 5705 O O   . HOH C 2 .   ? 84.640  54.995 -36.389 1.00 34.68  ? 413 HOH A O   1 
HETATM 5706 O O   . HOH C 2 .   ? 98.329  37.666 -28.021 1.00 39.68  ? 414 HOH A O   1 
HETATM 5707 O O   . HOH C 2 .   ? 66.715  30.957 -17.105 1.00 45.63  ? 415 HOH A O   1 
HETATM 5708 O O   . HOH C 2 .   ? 65.272  45.489 -28.209 1.00 25.49  ? 416 HOH A O   1 
HETATM 5709 O O   . HOH C 2 .   ? 79.044  46.108 -27.901 1.00 46.15  ? 417 HOH A O   1 
HETATM 5710 O O   . HOH C 2 .   ? 44.228  36.782 -38.190 1.00 27.31  ? 418 HOH A O   1 
HETATM 5711 O O   . HOH C 2 .   ? 46.516  42.703 -32.876 1.00 32.50  ? 419 HOH A O   1 
HETATM 5712 O O   . HOH C 2 .   ? 67.434  47.370 -35.436 1.00 34.44  ? 420 HOH A O   1 
HETATM 5713 O O   . HOH C 2 .   ? 85.931  53.253 -28.526 1.00 43.46  ? 421 HOH A O   1 
HETATM 5714 O O   . HOH C 2 .   ? 94.143  43.120 -19.219 1.00 51.62  ? 422 HOH A O   1 
HETATM 5715 O O   . HOH D 2 .   ? 49.038  47.792 -14.863 1.00 27.58  ? 389 HOH B O   1 
HETATM 5716 O O   . HOH D 2 .   ? 19.075  36.187 -16.241 1.00 35.13  ? 390 HOH B O   1 
HETATM 5717 O O   . HOH D 2 .   ? 32.878  32.105 -15.371 1.00 33.11  ? 391 HOH B O   1 
HETATM 5718 O O   . HOH D 2 .   ? 52.350  27.642 -16.108 1.00 32.38  ? 392 HOH B O   1 
HETATM 5719 O O   . HOH D 2 .   ? 21.528  47.813 -23.572 1.00 31.97  ? 393 HOH B O   1 
HETATM 5720 O O   . HOH D 2 .   ? 18.250  38.383 -12.723 1.00 28.78  ? 394 HOH B O   1 
HETATM 5721 O O   . HOH D 2 .   ? 15.306  48.514 -6.114  1.00 34.12  ? 395 HOH B O   1 
HETATM 5722 O O   . HOH D 2 .   ? 52.237  23.175 2.314   1.00 40.22  ? 396 HOH B O   1 
HETATM 5723 O O   . HOH D 2 .   ? 23.223  50.004 -23.903 1.00 40.90  ? 397 HOH B O   1 
HETATM 5724 O O   . HOH D 2 .   ? 25.289  42.264 -7.962  1.00 51.71  ? 398 HOH B O   1 
HETATM 5725 O O   . HOH D 2 .   ? 35.751  32.598 -20.253 1.00 48.05  ? 399 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  MET 37  37  37  MET MET A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  GLU 44  44  ?   ?   ?   A . n 
A 1 45  SER 45  45  ?   ?   ?   A . n 
A 1 46  LYS 46  46  ?   ?   ?   A . n 
A 1 47  TYR 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  ?   ?   ?   A . n 
A 1 49  ASP 49  49  ?   ?   ?   A . n 
A 1 50  ILE 50  50  ?   ?   ?   A . n 
A 1 51  TYR 51  51  ?   ?   ?   A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  CYS 55  55  55  CYS CYS A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  TRP 69  69  69  TRP TRP A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  MET 73  73  ?   ?   ?   A . n 
A 1 74  GLU 74  74  ?   ?   ?   A . n 
A 1 75  ASP 75  75  ?   ?   ?   A . n 
A 1 76  ILE 76  76  ?   ?   ?   A . n 
A 1 77  GLY 77  77  ?   ?   ?   A . n 
A 1 78  LEU 78  78  ?   ?   ?   A . n 
A 1 79  GLU 79  79  ?   ?   ?   A . n 
A 1 80  ALA 80  80  ?   ?   ?   A . n 
A 1 81  LEU 81  81  ?   ?   ?   A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 PHE 105 105 105 PHE PHE A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 CYS 111 111 111 CYS CYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 MET 124 124 124 MET MET A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 HIS 135 135 135 HIS HIS A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 TRP 159 159 159 TRP TRP A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 CYS 169 169 169 CYS CYS A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 GLN 177 177 177 GLN GLN A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 TYR 185 185 185 TYR TYR A . n 
A 1 186 MET 186 186 186 MET MET A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 MET 196 196 196 MET MET A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 TRP 202 202 202 TRP TRP A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 ILE 209 209 209 ILE ILE A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 TRP 213 213 213 TRP TRP A . n 
A 1 214 ASN 214 214 214 ASN ASN A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 PHE 218 218 218 PHE PHE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 MET 224 224 224 MET MET A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 MET 236 236 236 MET MET A . n 
A 1 237 LYS 237 237 237 LYS LYS A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 PRO 241 241 241 PRO PRO A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 GLY 243 243 243 GLY GLY A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 LEU 250 250 ?   ?   ?   A . n 
A 1 251 GLN 251 251 ?   ?   ?   A . n 
A 1 252 ASN 252 252 ?   ?   ?   A . n 
A 1 253 MET 253 253 ?   ?   ?   A . n 
A 1 254 TYR 254 254 ?   ?   ?   A . n 
A 1 255 GLY 255 255 ?   ?   ?   A . n 
A 1 256 SER 256 256 256 SER SER A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 ILE 259 259 259 ILE ILE A . n 
A 1 260 TYR 260 260 260 TYR TYR A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 VAL 265 265 265 VAL VAL A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 ASP 269 269 269 ASP ASP A . n 
A 1 270 TYR 270 270 270 TYR TYR A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 LYS 276 276 276 LYS LYS A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 PHE 279 279 279 PHE PHE A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 ASN 281 281 281 ASN ASN A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 PHE 285 285 285 PHE PHE A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 VAL 290 290 290 VAL VAL A . n 
A 1 291 ALA 291 291 291 ALA ALA A . n 
A 1 292 GLN 292 292 292 GLN GLN A . n 
A 1 293 HIS 293 293 293 HIS HIS A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 LYS 299 299 299 LYS LYS A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 TYR 302 302 302 TYR TYR A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 PRO 305 305 305 PRO PRO A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 ASN 307 307 307 ASN ASN A . n 
A 1 308 LYS 308 308 308 LYS LYS A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ARG 310 310 310 ARG ARG A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 THR 312 312 312 THR THR A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 HIS 314 314 314 HIS HIS A . n 
A 1 315 GLN 315 315 315 GLN GLN A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 TYR 317 317 317 TYR TYR A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 SER 319 319 319 SER SER A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 ASN 321 321 321 ASN ASN A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 ILE 323 323 323 ILE ILE A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 GLU 326 326 326 GLU GLU A . n 
A 1 327 SER 327 327 327 SER SER A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 ILE 331 331 331 ILE ILE A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 LYS 333 333 333 LYS LYS A . n 
A 1 334 ILE 334 334 334 ILE ILE A . n 
A 1 335 ARG 335 335 335 ARG ARG A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 ILE 338 338 338 ILE ILE A . n 
A 1 339 ASP 339 339 339 ASP ASP A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 LEU 342 342 342 LEU LEU A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 MET 344 344 344 MET MET A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 TYR 346 346 346 TYR TYR A . n 
A 1 347 TYR 347 347 347 TYR TYR A . n 
A 1 348 ALA 348 348 348 ALA ALA A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 MET 350 350 350 MET MET A . n 
A 1 351 PRO 351 351 351 PRO PRO A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 SER 353 353 353 SER SER A . n 
A 1 354 GLY 354 354 354 GLY GLY A . n 
A 1 355 VAL 355 355 355 VAL VAL A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 PRO 358 358 358 PRO PRO A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 LYS 360 360 360 LYS LYS A . n 
A 1 361 THR 361 361 361 THR THR A . n 
A 1 362 TRP 362 362 362 TRP TRP A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 ILE 366 366 366 ILE ILE A . n 
A 1 367 PHE 367 367 367 PHE PHE A . n 
A 1 368 ASN 368 368 368 ASN ASN A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 LYS 371 371 ?   ?   ?   A . n 
A 1 372 GLY 372 372 ?   ?   ?   A . n 
A 1 373 GLU 373 373 ?   ?   ?   A . n 
A 1 374 HIS 374 374 ?   ?   ?   A . n 
A 1 375 LYS 375 375 ?   ?   ?   A . n 
A 1 376 VAL 376 376 ?   ?   ?   A . n 
A 1 377 ILE 377 377 ?   ?   ?   A . n 
A 1 378 PRO 378 378 ?   ?   ?   A . n 
A 1 379 GLN 379 379 ?   ?   ?   A . n 
A 1 380 GLN 380 380 ?   ?   ?   A . n 
A 1 381 GLY 381 381 ?   ?   ?   A . n 
A 1 382 SER 382 382 ?   ?   ?   A . n 
A 1 383 HIS 383 383 ?   ?   ?   A . n 
A 1 384 VAL 384 384 ?   ?   ?   A . n 
A 1 385 LYS 385 385 ?   ?   ?   A . n 
A 1 386 GLN 386 386 ?   ?   ?   A . n 
A 1 387 SER 387 387 ?   ?   ?   A . n 
A 1 388 PHE 388 388 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   PHE 4   4   4   PHE PHE B . n 
B 1 5   TYR 5   5   5   TYR TYR B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   SER 7   7   7   SER SER B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  ASN 14  14  14  ASN ASN B . n 
B 1 15  ILE 15  15  15  ILE ILE B . n 
B 1 16  VAL 16  16  16  VAL VAL B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  TYR 19  19  19  TYR TYR B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  ASN 23  23  23  ASN ASN B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  LYS 25  25  25  LYS LYS B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  ARG 27  27  27  ARG ARG B . n 
B 1 28  THR 28  28  28  THR THR B . n 
B 1 29  ARG 29  29  29  ARG ARG B . n 
B 1 30  GLU 30  30  30  GLU GLU B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  GLU 32  32  32  GLU GLU B . n 
B 1 33  TYR 33  33  33  TYR TYR B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  PRO 35  35  35  PRO PRO B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  MET 37  37  37  MET MET B . n 
B 1 38  PHE 38  38  38  PHE PHE B . n 
B 1 39  ARG 39  39  39  ARG ARG B . n 
B 1 40  HIS 40  40  40  HIS HIS B . n 
B 1 41  CYS 41  41  41  CYS CYS B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  GLU 44  44  ?   ?   ?   B . n 
B 1 45  SER 45  45  ?   ?   ?   B . n 
B 1 46  LYS 46  46  ?   ?   ?   B . n 
B 1 47  TYR 47  47  ?   ?   ?   B . n 
B 1 48  LYS 48  48  ?   ?   ?   B . n 
B 1 49  ASP 49  49  ?   ?   ?   B . n 
B 1 50  ILE 50  50  ?   ?   ?   B . n 
B 1 51  TYR 51  51  ?   ?   ?   B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ASN 54  54  54  ASN ASN B . n 
B 1 55  CYS 55  55  55  CYS CYS B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  PRO 57  57  57  PRO PRO B . n 
B 1 58  GLN 58  58  58  GLN GLN B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  PHE 60  60  60  PHE PHE B . n 
B 1 61  PRO 61  61  61  PRO PRO B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  MET 63  63  63  MET MET B . n 
B 1 64  LYS 64  64  64  LYS LYS B . n 
B 1 65  ASP 65  65  65  ASP ASP B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  ARG 67  67  67  ARG ARG B . n 
B 1 68  ASP 68  68  68  ASP ASP B . n 
B 1 69  TRP 69  69  69  TRP TRP B . n 
B 1 70  MET 70  70  70  MET MET B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  MET 73  73  ?   ?   ?   B . n 
B 1 74  GLU 74  74  ?   ?   ?   B . n 
B 1 75  ASP 75  75  ?   ?   ?   B . n 
B 1 76  ILE 76  76  ?   ?   ?   B . n 
B 1 77  GLY 77  77  ?   ?   ?   B . n 
B 1 78  LEU 78  78  ?   ?   ?   B . n 
B 1 79  GLU 79  79  ?   ?   ?   B . n 
B 1 80  ALA 80  80  ?   ?   ?   B . n 
B 1 81  LEU 81  81  ?   ?   ?   B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  MET 83  83  83  MET MET B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  PHE 86  86  86  PHE PHE B . n 
B 1 87  LYS 87  87  87  LYS LYS B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  TYR 90  90  90  TYR TYR B . n 
B 1 91  ILE 91  91  91  ILE ILE B . n 
B 1 92  SER 92  92  92  SER SER B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  THR 94  94  94  THR THR B . n 
B 1 95  TYR 95  95  95  TYR TYR B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  SER 97  97  97  SER SER B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 VAL 100 100 100 VAL VAL B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 PHE 105 105 105 PHE PHE B . n 
B 1 106 VAL 106 106 106 VAL VAL B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 CYS 111 111 111 CYS CYS B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 GLU 114 114 114 GLU GLU B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 THR 116 116 116 THR THR B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 PRO 121 121 121 PRO PRO B . n 
B 1 122 ASP 122 122 122 ASP ASP B . n 
B 1 123 PRO 123 123 123 PRO PRO B . n 
B 1 124 MET 124 124 124 MET MET B . n 
B 1 125 LYS 125 125 125 LYS LYS B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 GLU 127 127 127 GLU GLU B . n 
B 1 128 TYR 128 128 128 TYR TYR B . n 
B 1 129 GLU 129 129 129 GLU GLU B . n 
B 1 130 ILE 130 130 130 ILE ILE B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 THR 134 134 134 THR THR B . n 
B 1 135 HIS 135 135 135 HIS HIS B . n 
B 1 136 TYR 136 136 136 TYR TYR B . n 
B 1 137 ASP 137 137 137 ASP ASP B . n 
B 1 138 SER 138 138 138 SER SER B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 ASP 141 141 141 ASP ASP B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 PHE 143 143 143 PHE PHE B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 PHE 146 146 146 PHE PHE B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 MET 152 152 152 MET MET B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 SER 155 155 155 SER SER B . n 
B 1 156 VAL 156 156 156 VAL VAL B . n 
B 1 157 SER 157 157 157 SER SER B . n 
B 1 158 LYS 158 158 158 LYS LYS B . n 
B 1 159 TRP 159 159 159 TRP TRP B . n 
B 1 160 ASP 160 160 160 ASP ASP B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 LYS 162 162 162 LYS LYS B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 ALA 165 165 165 ALA ALA B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 LEU 167 167 167 LEU LEU B . n 
B 1 168 ASP 168 168 168 ASP ASP B . n 
B 1 169 CYS 169 169 169 CYS CYS B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 PRO 176 176 176 PRO PRO B . n 
B 1 177 GLN 177 177 177 GLN GLN B . n 
B 1 178 GLU 178 178 178 GLU GLU B . n 
B 1 179 ILE 179 179 179 ILE ILE B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 ILE 184 184 184 ILE ILE B . n 
B 1 185 TYR 185 185 185 TYR TYR B . n 
B 1 186 MET 186 186 186 MET MET B . n 
B 1 187 PRO 187 187 187 PRO PRO B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 ASP 189 189 189 ASP ASP B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 ARG 192 192 192 ARG ARG B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 MET 194 194 194 MET MET B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 MET 196 196 196 MET MET B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 TYR 198 198 198 TYR TYR B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 LEU 201 201 201 LEU LEU B . n 
B 1 202 TRP 202 202 202 TRP TRP B . n 
B 1 203 GLU 203 203 203 GLU GLU B . n 
B 1 204 GLN 204 204 204 GLN GLN B . n 
B 1 205 LYS 205 205 205 LYS LYS B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 PRO 207 207 207 PRO PRO B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 ILE 209 209 209 ILE ILE B . n 
B 1 210 PHE 210 210 210 PHE PHE B . n 
B 1 211 THR 211 211 211 THR THR B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 TRP 213 213 213 TRP TRP B . n 
B 1 214 ASN 214 214 214 ASN ASN B . n 
B 1 215 ILE 215 215 215 ILE ILE B . n 
B 1 216 GLU 216 216 216 GLU GLU B . n 
B 1 217 GLY 217 217 217 GLY GLY B . n 
B 1 218 PHE 218 218 218 PHE PHE B . n 
B 1 219 ASP 219 219 219 ASP ASP B . n 
B 1 220 VAL 220 220 220 VAL VAL B . n 
B 1 221 PRO 221 221 221 PRO PRO B . n 
B 1 222 TYR 222 222 222 TYR TYR B . n 
B 1 223 ILE 223 223 223 ILE ILE B . n 
B 1 224 MET 224 224 224 MET MET B . n 
B 1 225 ASN 225 225 225 ASN ASN B . n 
B 1 226 ARG 226 226 226 ARG ARG B . n 
B 1 227 VAL 227 227 227 VAL VAL B . n 
B 1 228 LYS 228 228 228 LYS LYS B . n 
B 1 229 MET 229 229 229 MET MET B . n 
B 1 230 ILE 230 230 230 ILE ILE B . n 
B 1 231 LEU 231 231 231 LEU LEU B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 GLU 233 233 233 GLU GLU B . n 
B 1 234 ARG 234 234 234 ARG ARG B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 MET 236 236 236 MET MET B . n 
B 1 237 LYS 237 237 237 LYS LYS B . n 
B 1 238 ARG 238 238 238 ARG ARG B . n 
B 1 239 PHE 239 239 239 PHE PHE B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 PRO 241 241 241 PRO PRO B . n 
B 1 242 ILE 242 242 242 ILE ILE B . n 
B 1 243 GLY 243 243 243 GLY GLY B . n 
B 1 244 ARG 244 244 244 ARG ARG B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 LYS 246 246 246 LYS LYS B . n 
B 1 247 SER 247 247 247 SER SER B . n 
B 1 248 LYS 248 248 248 LYS LYS B . n 
B 1 249 LEU 249 249 249 LEU LEU B . n 
B 1 250 LEU 250 250 ?   ?   ?   B . n 
B 1 251 GLN 251 251 ?   ?   ?   B . n 
B 1 252 ASN 252 252 ?   ?   ?   B . n 
B 1 253 MET 253 253 ?   ?   ?   B . n 
B 1 254 TYR 254 254 ?   ?   ?   B . n 
B 1 255 GLY 255 255 ?   ?   ?   B . n 
B 1 256 SER 256 256 256 SER SER B . n 
B 1 257 LYS 257 257 257 LYS LYS B . n 
B 1 258 GLU 258 258 258 GLU GLU B . n 
B 1 259 ILE 259 259 259 ILE ILE B . n 
B 1 260 TYR 260 260 260 TYR TYR B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 ILE 262 262 262 ILE ILE B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 GLY 264 264 264 GLY GLY B . n 
B 1 265 VAL 265 265 265 VAL VAL B . n 
B 1 266 SER 266 266 266 SER SER B . n 
B 1 267 ILE 267 267 267 ILE ILE B . n 
B 1 268 LEU 268 268 268 LEU LEU B . n 
B 1 269 ASP 269 269 269 ASP ASP B . n 
B 1 270 TYR 270 270 270 TYR TYR B . n 
B 1 271 LEU 271 271 271 LEU LEU B . n 
B 1 272 ASP 272 272 272 ASP ASP B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 TYR 274 274 274 TYR TYR B . n 
B 1 275 LYS 275 275 275 LYS LYS B . n 
B 1 276 LYS 276 276 276 LYS LYS B . n 
B 1 277 PHE 277 277 277 PHE PHE B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 PHE 279 279 279 PHE PHE B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 ASN 281 281 281 ASN ASN B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 PRO 283 283 283 PRO PRO B . n 
B 1 284 SER 284 284 284 SER SER B . n 
B 1 285 PHE 285 285 285 PHE PHE B . n 
B 1 286 SER 286 286 286 SER SER B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 SER 289 289 289 SER SER B . n 
B 1 290 VAL 290 290 290 VAL VAL B . n 
B 1 291 ALA 291 291 291 ALA ALA B . n 
B 1 292 GLN 292 292 292 GLN GLN B . n 
B 1 293 HIS 293 293 293 HIS HIS B . n 
B 1 294 GLU 294 294 294 GLU GLU B . n 
B 1 295 THR 295 295 295 THR THR B . n 
B 1 296 LYS 296 296 296 LYS LYS B . n 
B 1 297 LYS 297 297 297 LYS LYS B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 LYS 299 299 299 LYS LYS B . n 
B 1 300 LEU 300 300 300 LEU LEU B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 TYR 302 302 302 TYR TYR B . n 
B 1 303 ASP 303 303 303 ASP ASP B . n 
B 1 304 GLY 304 304 304 GLY GLY B . n 
B 1 305 PRO 305 305 305 PRO PRO B . n 
B 1 306 ILE 306 306 306 ILE ILE B . n 
B 1 307 ASN 307 307 307 ASN ASN B . n 
B 1 308 LYS 308 308 308 LYS LYS B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 ARG 310 310 310 ARG ARG B . n 
B 1 311 GLU 311 311 311 GLU GLU B . n 
B 1 312 THR 312 312 312 THR THR B . n 
B 1 313 ASN 313 313 313 ASN ASN B . n 
B 1 314 HIS 314 314 314 HIS HIS B . n 
B 1 315 GLN 315 315 315 GLN GLN B . n 
B 1 316 ARG 316 316 316 ARG ARG B . n 
B 1 317 TYR 317 317 317 TYR TYR B . n 
B 1 318 ILE 318 318 318 ILE ILE B . n 
B 1 319 SER 319 319 319 SER SER B . n 
B 1 320 TYR 320 320 320 TYR TYR B . n 
B 1 321 ASN 321 321 321 ASN ASN B . n 
B 1 322 ILE 322 322 322 ILE ILE B . n 
B 1 323 ILE 323 323 323 ILE ILE B . n 
B 1 324 ASP 324 324 324 ASP ASP B . n 
B 1 325 VAL 325 325 325 VAL VAL B . n 
B 1 326 GLU 326 326 326 GLU GLU B . n 
B 1 327 SER 327 327 327 SER SER B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLN 329 329 329 GLN GLN B . n 
B 1 330 ALA 330 330 330 ALA ALA B . n 
B 1 331 ILE 331 331 331 ILE ILE B . n 
B 1 332 ASP 332 332 332 ASP ASP B . n 
B 1 333 LYS 333 333 333 LYS LYS B . n 
B 1 334 ILE 334 334 334 ILE ILE B . n 
B 1 335 ARG 335 335 335 ARG ARG B . n 
B 1 336 GLY 336 336 336 GLY GLY B . n 
B 1 337 PHE 337 337 337 PHE PHE B . n 
B 1 338 ILE 338 338 338 ILE ILE B . n 
B 1 339 ASP 339 339 339 ASP ASP B . n 
B 1 340 LEU 340 340 340 LEU LEU B . n 
B 1 341 VAL 341 341 341 VAL VAL B . n 
B 1 342 LEU 342 342 342 LEU LEU B . n 
B 1 343 SER 343 343 343 SER SER B . n 
B 1 344 MET 344 344 344 MET MET B . n 
B 1 345 SER 345 345 345 SER SER B . n 
B 1 346 TYR 346 346 346 TYR TYR B . n 
B 1 347 TYR 347 347 347 TYR TYR B . n 
B 1 348 ALA 348 348 348 ALA ALA B . n 
B 1 349 LYS 349 349 349 LYS LYS B . n 
B 1 350 MET 350 350 350 MET MET B . n 
B 1 351 PRO 351 351 351 PRO PRO B . n 
B 1 352 PHE 352 352 352 PHE PHE B . n 
B 1 353 SER 353 353 353 SER SER B . n 
B 1 354 GLY 354 354 354 GLY GLY B . n 
B 1 355 VAL 355 355 355 VAL VAL B . n 
B 1 356 MET 356 356 356 MET MET B . n 
B 1 357 SER 357 357 357 SER SER B . n 
B 1 358 PRO 358 358 358 PRO PRO B . n 
B 1 359 ILE 359 359 359 ILE ILE B . n 
B 1 360 LYS 360 360 360 LYS LYS B . n 
B 1 361 THR 361 361 361 THR THR B . n 
B 1 362 TRP 362 362 362 TRP TRP B . n 
B 1 363 ASP 363 363 363 ASP ASP B . n 
B 1 364 ALA 364 364 364 ALA ALA B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 ILE 366 366 366 ILE ILE B . n 
B 1 367 PHE 367 367 367 PHE PHE B . n 
B 1 368 ASN 368 368 368 ASN ASN B . n 
B 1 369 SER 369 369 369 SER SER B . n 
B 1 370 LEU 370 370 370 LEU LEU B . n 
B 1 371 LYS 371 371 ?   ?   ?   B . n 
B 1 372 GLY 372 372 ?   ?   ?   B . n 
B 1 373 GLU 373 373 ?   ?   ?   B . n 
B 1 374 HIS 374 374 ?   ?   ?   B . n 
B 1 375 LYS 375 375 ?   ?   ?   B . n 
B 1 376 VAL 376 376 ?   ?   ?   B . n 
B 1 377 ILE 377 377 ?   ?   ?   B . n 
B 1 378 PRO 378 378 ?   ?   ?   B . n 
B 1 379 GLN 379 379 ?   ?   ?   B . n 
B 1 380 GLN 380 380 ?   ?   ?   B . n 
B 1 381 GLY 381 381 ?   ?   ?   B . n 
B 1 382 SER 382 382 ?   ?   ?   B . n 
B 1 383 HIS 383 383 ?   ?   ?   B . n 
B 1 384 VAL 384 384 ?   ?   ?   B . n 
B 1 385 LYS 385 385 ?   ?   ?   B . n 
B 1 386 GLN 386 386 ?   ?   ?   B . n 
B 1 387 SER 387 387 ?   ?   ?   B . n 
B 1 388 PHE 388 388 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2810  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  30840 ? 
2 'ABSA (A^2)' 7980  ? 
2 MORE         -59   ? 
2 'SSA (A^2)'  59320 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 113.6170000000 0.0000000000 -1.0000000000 
0.0000000000 109.3090000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-10-14 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DCREDUCE  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
X-PLOR    'model building'  . ? 3 
X-PLOR    refinement        . ? 4 
DCREDUCE  'data reduction'  . ? 5 
X-PLOR    phasing           . ? 6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N A GLU 32  ? ? CA A GLU 32  ? ? C A GLU 32  ? ? 94.39  111.00 -16.61 2.70 N 
2 1 N B GLY 24  ? ? CA B GLY 24  ? ? C B GLY 24  ? ? 129.13 113.10 16.03  2.50 N 
3 1 N B THR 280 ? ? CA B THR 280 ? ? C B THR 280 ? ? 127.56 111.00 16.56  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 3   ? ? 91.41   89.69   
2  1 ASP A 21  ? ? -60.20  -173.28 
3  1 ASN A 23  ? ? -145.46 32.00   
4  1 PHE A 38  ? ? -153.11 -28.20  
5  1 ARG A 39  ? ? 64.90   99.99   
6  1 ASN A 54  ? ? -145.69 -157.52 
7  1 ASP A 112 ? ? -164.37 116.59  
8  1 LYS A 119 ? ? 53.42   -71.83  
9  1 PHE A 120 ? ? 152.56  149.92  
10 1 LEU A 149 ? ? -109.87 74.30   
11 1 ASN A 150 ? ? 152.80  90.28   
12 1 SER A 151 ? ? 177.13  103.17  
13 1 MET A 152 ? ? 54.67   -37.36  
14 1 THR A 211 ? ? -111.27 -161.74 
15 1 ARG A 234 ? ? 121.76  -46.74  
16 1 LYS A 257 ? ? -37.26  -178.03 
17 1 GLU A 258 ? ? -177.68 125.96  
18 1 TYR A 260 ? ? 69.72   132.54  
19 1 PHE A 279 ? ? -64.66  96.11   
20 1 THR A 280 ? ? -109.08 -71.26  
21 1 ASN A 281 ? ? 78.48   35.85   
22 1 LYS A 296 ? ? 68.07   -0.69   
23 1 PRO A 305 ? ? -47.15  99.61   
24 1 ASN A 313 ? ? -162.29 74.29   
25 1 GLU B 3   ? ? 136.07  131.89  
26 1 PHE B 38  ? ? -148.89 -33.26  
27 1 ARG B 39  ? ? 62.27   95.11   
28 1 CYS B 41  ? ? -66.89  3.28    
29 1 ASN B 54  ? ? -141.28 -147.23 
30 1 LYS B 71  ? ? 81.06   -5.67   
31 1 MET B 83  ? ? -64.62  1.02    
32 1 SER B 97  ? ? 67.05   149.35  
33 1 LYS B 119 ? ? -44.29  153.52  
34 1 PRO B 121 ? ? -47.35  97.54   
35 1 ASP B 141 ? ? 21.88   30.27   
36 1 ASN B 150 ? ? 88.47   25.04   
37 1 SER B 151 ? ? -67.80  80.21   
38 1 MET B 152 ? ? 32.18   -80.20  
39 1 TYR B 153 ? ? -39.93  -36.19  
40 1 LEU B 167 ? ? -5.20   155.07  
41 1 GLU B 170 ? ? -105.58 -158.60 
42 1 ARG B 234 ? ? 115.57  -35.42  
43 1 THR B 280 ? ? -101.06 -74.66  
44 1 ASN B 281 ? ? 91.76   81.89   
45 1 PRO B 301 ? ? -33.22  134.42  
46 1 PRO B 305 ? ? -102.48 -106.69 
47 1 ILE B 306 ? ? 163.09  -68.93  
48 1 GLU B 311 ? ? -72.82  -73.06  
49 1 HIS B 314 ? ? -65.45  -172.74 
50 1 GLN B 315 ? ? 69.84   -61.88  
51 1 SER B 343 ? ? -58.67  -71.82  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A SER 256 ? OG ? A SER 256 OG 
2 1 Y 1 B SER 256 ? OG ? B SER 256 OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 44  ? A GLU 44  
3  1 Y 1 A SER 45  ? A SER 45  
4  1 Y 1 A LYS 46  ? A LYS 46  
5  1 Y 1 A TYR 47  ? A TYR 47  
6  1 Y 1 A LYS 48  ? A LYS 48  
7  1 Y 1 A ASP 49  ? A ASP 49  
8  1 Y 1 A ILE 50  ? A ILE 50  
9  1 Y 1 A TYR 51  ? A TYR 51  
10 1 Y 1 A MET 73  ? A MET 73  
11 1 Y 1 A GLU 74  ? A GLU 74  
12 1 Y 1 A ASP 75  ? A ASP 75  
13 1 Y 1 A ILE 76  ? A ILE 76  
14 1 Y 1 A GLY 77  ? A GLY 77  
15 1 Y 1 A LEU 78  ? A LEU 78  
16 1 Y 1 A GLU 79  ? A GLU 79  
17 1 Y 1 A ALA 80  ? A ALA 80  
18 1 Y 1 A LEU 81  ? A LEU 81  
19 1 Y 1 A LEU 250 ? A LEU 250 
20 1 Y 1 A GLN 251 ? A GLN 251 
21 1 Y 1 A ASN 252 ? A ASN 252 
22 1 Y 1 A MET 253 ? A MET 253 
23 1 Y 1 A TYR 254 ? A TYR 254 
24 1 Y 1 A GLY 255 ? A GLY 255 
25 1 Y 1 A LYS 371 ? A LYS 371 
26 1 Y 1 A GLY 372 ? A GLY 372 
27 1 Y 1 A GLU 373 ? A GLU 373 
28 1 Y 1 A HIS 374 ? A HIS 374 
29 1 Y 1 A LYS 375 ? A LYS 375 
30 1 Y 1 A VAL 376 ? A VAL 376 
31 1 Y 1 A ILE 377 ? A ILE 377 
32 1 Y 1 A PRO 378 ? A PRO 378 
33 1 Y 1 A GLN 379 ? A GLN 379 
34 1 Y 1 A GLN 380 ? A GLN 380 
35 1 Y 1 A GLY 381 ? A GLY 381 
36 1 Y 1 A SER 382 ? A SER 382 
37 1 Y 1 A HIS 383 ? A HIS 383 
38 1 Y 1 A VAL 384 ? A VAL 384 
39 1 Y 1 A LYS 385 ? A LYS 385 
40 1 Y 1 A GLN 386 ? A GLN 386 
41 1 Y 1 A SER 387 ? A SER 387 
42 1 Y 1 A PHE 388 ? A PHE 388 
43 1 Y 1 B MET 1   ? B MET 1   
44 1 Y 1 B GLU 44  ? B GLU 44  
45 1 Y 1 B SER 45  ? B SER 45  
46 1 Y 1 B LYS 46  ? B LYS 46  
47 1 Y 1 B TYR 47  ? B TYR 47  
48 1 Y 1 B LYS 48  ? B LYS 48  
49 1 Y 1 B ASP 49  ? B ASP 49  
50 1 Y 1 B ILE 50  ? B ILE 50  
51 1 Y 1 B TYR 51  ? B TYR 51  
52 1 Y 1 B MET 73  ? B MET 73  
53 1 Y 1 B GLU 74  ? B GLU 74  
54 1 Y 1 B ASP 75  ? B ASP 75  
55 1 Y 1 B ILE 76  ? B ILE 76  
56 1 Y 1 B GLY 77  ? B GLY 77  
57 1 Y 1 B LEU 78  ? B LEU 78  
58 1 Y 1 B GLU 79  ? B GLU 79  
59 1 Y 1 B ALA 80  ? B ALA 80  
60 1 Y 1 B LEU 81  ? B LEU 81  
61 1 Y 1 B LEU 250 ? B LEU 250 
62 1 Y 1 B GLN 251 ? B GLN 251 
63 1 Y 1 B ASN 252 ? B ASN 252 
64 1 Y 1 B MET 253 ? B MET 253 
65 1 Y 1 B TYR 254 ? B TYR 254 
66 1 Y 1 B GLY 255 ? B GLY 255 
67 1 Y 1 B LYS 371 ? B LYS 371 
68 1 Y 1 B GLY 372 ? B GLY 372 
69 1 Y 1 B GLU 373 ? B GLU 373 
70 1 Y 1 B HIS 374 ? B HIS 374 
71 1 Y 1 B LYS 375 ? B LYS 375 
72 1 Y 1 B VAL 376 ? B VAL 376 
73 1 Y 1 B ILE 377 ? B ILE 377 
74 1 Y 1 B PRO 378 ? B PRO 378 
75 1 Y 1 B GLN 379 ? B GLN 379 
76 1 Y 1 B GLN 380 ? B GLN 380 
77 1 Y 1 B GLY 381 ? B GLY 381 
78 1 Y 1 B SER 382 ? B SER 382 
79 1 Y 1 B HIS 383 ? B HIS 383 
80 1 Y 1 B VAL 384 ? B VAL 384 
81 1 Y 1 B LYS 385 ? B LYS 385 
82 1 Y 1 B GLN 386 ? B GLN 386 
83 1 Y 1 B SER 387 ? B SER 387 
84 1 Y 1 B PHE 388 ? B PHE 388 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  389 1  HOH HOH A . 
C 2 HOH 2  390 2  HOH HOH A . 
C 2 HOH 3  391 4  HOH HOH A . 
C 2 HOH 4  392 5  HOH HOH A . 
C 2 HOH 5  393 7  HOH HOH A . 
C 2 HOH 6  394 8  HOH HOH A . 
C 2 HOH 7  395 9  HOH HOH A . 
C 2 HOH 8  396 10 HOH HOH A . 
C 2 HOH 9  397 11 HOH HOH A . 
C 2 HOH 10 398 12 HOH HOH A . 
C 2 HOH 11 399 13 HOH HOH A . 
C 2 HOH 12 400 14 HOH HOH A . 
C 2 HOH 13 401 15 HOH HOH A . 
C 2 HOH 14 402 16 HOH HOH A . 
C 2 HOH 15 403 19 HOH HOH A . 
C 2 HOH 16 404 20 HOH HOH A . 
C 2 HOH 17 405 21 HOH HOH A . 
C 2 HOH 18 406 22 HOH HOH A . 
C 2 HOH 19 407 23 HOH HOH A . 
C 2 HOH 20 408 25 HOH HOH A . 
C 2 HOH 21 409 26 HOH HOH A . 
C 2 HOH 22 410 27 HOH HOH A . 
C 2 HOH 23 411 28 HOH HOH A . 
C 2 HOH 24 412 29 HOH HOH A . 
C 2 HOH 25 413 31 HOH HOH A . 
C 2 HOH 26 414 32 HOH HOH A . 
C 2 HOH 27 415 33 HOH HOH A . 
C 2 HOH 28 416 34 HOH HOH A . 
C 2 HOH 29 417 35 HOH HOH A . 
C 2 HOH 30 418 36 HOH HOH A . 
C 2 HOH 31 419 38 HOH HOH A . 
C 2 HOH 32 420 40 HOH HOH A . 
C 2 HOH 33 421 42 HOH HOH A . 
C 2 HOH 34 422 44 HOH HOH A . 
D 2 HOH 1  389 3  HOH HOH B . 
D 2 HOH 2  390 6  HOH HOH B . 
D 2 HOH 3  391 17 HOH HOH B . 
D 2 HOH 4  392 18 HOH HOH B . 
D 2 HOH 5  393 24 HOH HOH B . 
D 2 HOH 6  394 30 HOH HOH B . 
D 2 HOH 7  395 37 HOH HOH B . 
D 2 HOH 8  396 39 HOH HOH B . 
D 2 HOH 9  397 41 HOH HOH B . 
D 2 HOH 10 398 43 HOH HOH B . 
D 2 HOH 11 399 45 HOH HOH B . 
#