data_1NSH
# 
_entry.id   1NSH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1NSH         pdb_00001nsh 10.2210/pdb1nsh/pdb 
RCSB  RCSB018162   ?            ?                   
WWPDB D_1000018162 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NSH 
_pdbx_database_status.recvd_initial_deposition_date   2003-01-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dempsey, A.C.' 1 
'Walsh, M.P.'   2 
'Shaw, G.S.'    3 
# 
_citation.id                        primary 
_citation.title                     'Unmasking the Annexin I Interaction from the structure of apo-S100A11' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                887 
_citation.page_last                 897 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12842051 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00126-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dempsey, A.C.' 1 ? 
primary 'Walsh, M.P.'   2 ? 
primary 'Shaw, G.S.'    3 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Calgizzarin 
_entity.formula_weight             11312.939 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100C protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLI
GGLAVACHESFVKAAPPQKRF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLI
GGLAVACHESFVKAAPPQKRF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ARG n 
1 3   PRO n 
1 4   THR n 
1 5   GLU n 
1 6   THR n 
1 7   GLU n 
1 8   ARG n 
1 9   CYS n 
1 10  ILE n 
1 11  GLU n 
1 12  SER n 
1 13  LEU n 
1 14  ILE n 
1 15  ALA n 
1 16  VAL n 
1 17  PHE n 
1 18  GLN n 
1 19  LYS n 
1 20  TYR n 
1 21  ALA n 
1 22  GLY n 
1 23  LYS n 
1 24  ASP n 
1 25  GLY n 
1 26  HIS n 
1 27  SER n 
1 28  VAL n 
1 29  THR n 
1 30  LEU n 
1 31  SER n 
1 32  LYS n 
1 33  THR n 
1 34  GLU n 
1 35  PHE n 
1 36  LEU n 
1 37  SER n 
1 38  PHE n 
1 39  MET n 
1 40  ASN n 
1 41  THR n 
1 42  GLU n 
1 43  LEU n 
1 44  ALA n 
1 45  ALA n 
1 46  PHE n 
1 47  THR n 
1 48  LYS n 
1 49  ASN n 
1 50  GLN n 
1 51  LYS n 
1 52  ASP n 
1 53  PRO n 
1 54  GLY n 
1 55  VAL n 
1 56  LEU n 
1 57  ASP n 
1 58  ARG n 
1 59  MET n 
1 60  MET n 
1 61  LYS n 
1 62  LYS n 
1 63  LEU n 
1 64  ASP n 
1 65  LEU n 
1 66  ASN n 
1 67  SER n 
1 68  ASP n 
1 69  GLY n 
1 70  GLN n 
1 71  LEU n 
1 72  ASP n 
1 73  PHE n 
1 74  GLN n 
1 75  GLU n 
1 76  PHE n 
1 77  LEU n 
1 78  ASN n 
1 79  LEU n 
1 80  ILE n 
1 81  GLY n 
1 82  GLY n 
1 83  LEU n 
1 84  ALA n 
1 85  VAL n 
1 86  ALA n 
1 87  CYS n 
1 88  HIS n 
1 89  GLU n 
1 90  SER n 
1 91  PHE n 
1 92  VAL n 
1 93  LYS n 
1 94  ALA n 
1 95  ALA n 
1 96  PRO n 
1 97  PRO n 
1 98  GLN n 
1 99  LYS n 
1 100 ARG n 
1 101 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               rabbit 
_entity_src_gen.gene_src_genus                     Oryctolagus 
_entity_src_gen.pdbx_gene_src_gene                 'S100A11 OR S100C OR PCALG' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Oryctolagus cuniculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9986 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10AB_RABIT 
_struct_ref.pdbx_db_accession          P24480 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLI
GGLAVACHESFVKAAPPQKRF
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NSH A 1 ? 101 ? P24480 2 ? 102 ? 1 101 
2 1 1NSH B 1 ? 101 ? P24480 2 ? 102 ? 1 101 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY        
2 1 1 3D_15N/13C-simultaneous_NOESY 
3 2 2 3D_13C-edited/filtered_NOESY  
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 308 ambient 7.25 '50 mM KCl' ? K 
2 308 ambient 7.25 '50 mM KCl' ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1 mM 13C,15N apo-S100A11, 50 mM KCl, 10 mM dithiothreitol, pH 7.25'                              '90% H2O, 10% D20' 
2 '3 mM 13C,15N apo-S100A11, 3 mM unlabelled apo-S100A11, 50 mM KCl, 10 mM dithiothreitol, pH 7.25' '100% D2O'         
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 600 
2 ? Varian INOVA 800 
# 
_pdbx_nmr_refine.entry_id           1NSH 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;Structures were calculated using 2964 NOE derived distance restraints:  1336 intraresidue, 658 sequential, 594 short range, 264 long range and 112 intermonomer.  There were 64 hydrogen bond distance restraints and 192 dihedral restraints included in calculations.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1NSH 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             19 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1NSH 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR       6.1C  collection           'Varian Inc.' 1 
NMRPipe    2.1   processing           'F. Delaglio, S. Grzesiek, G. W. Vuister, G. Zhu, J. Pfeifer, A. Bax' 2 
Pipp/Stapp 4.3.3 'data analysis'      'D. Garrett, G.M. Clore' 3 
CNS        1.1   'structure solution' 
;A.T.Brunger, P.D.Adams, G.M.Clore, W.L.Delano, P.Gros, R.W.Grosse-Kunstleve, J.-S.Jiang, J.Kuszewski, M.Nilges, N.S.Pannu, R.J.Read, L.M.Rice, T.Simonson, G.L.Warren
;
4 
CNS        1.1   refinement           
;A.T.Brunger, P.D.Adams, G.M.Clore, W.L.Delano, P.Gros, R.W.Grosse-Kunstleve, J.-S.Jiang, J.Kuszewski, M.Nilges, N.S.Pannu, R.J.Read, L.M.Rice, T.Simonson, G.L.Warren
;
5 
# 
_exptl.entry_id          1NSH 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1NSH 
_struct.title                     'Solution Structure of Rabbit apo-S100A11 (19 models)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NSH 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'calcium-binding protein, EF hand, helix-loop-helix, S100, Annexin, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 4  ? ALA A 21 ? THR A 4  ALA A 21 1 ? 18 
HELX_P HELX_P2  2  SER A 31 ? LEU A 43 ? SER A 31 LEU A 43 1 ? 13 
HELX_P HELX_P3  3  LEU A 43 ? LYS A 48 ? LEU A 43 LYS A 48 1 ? 6  
HELX_P HELX_P4  4  ASN A 49 ? LYS A 51 ? ASN A 49 LYS A 51 5 ? 3  
HELX_P HELX_P5  5  VAL A 55 ? LEU A 63 ? VAL A 55 LEU A 63 1 ? 9  
HELX_P HELX_P6  6  PHE A 73 ? ALA A 86 ? PHE A 73 ALA A 86 1 ? 14 
HELX_P HELX_P7  7  HIS A 88 ? VAL A 92 ? HIS A 88 VAL A 92 5 ? 5  
HELX_P HELX_P8  8  ALA A 95 ? LYS A 99 ? ALA A 95 LYS A 99 5 ? 5  
HELX_P HELX_P9  9  THR B 4  ? ALA B 21 ? THR B 4  ALA B 21 1 ? 18 
HELX_P HELX_P10 10 SER B 31 ? LEU B 43 ? SER B 31 LEU B 43 1 ? 13 
HELX_P HELX_P11 11 LEU B 43 ? LYS B 48 ? LEU B 43 LYS B 48 1 ? 6  
HELX_P HELX_P12 12 ASN B 49 ? LYS B 51 ? ASN B 49 LYS B 51 5 ? 3  
HELX_P HELX_P13 13 VAL B 55 ? LEU B 63 ? VAL B 55 LEU B 63 1 ? 9  
HELX_P HELX_P14 14 PHE B 73 ? ALA B 86 ? PHE B 73 ALA B 86 1 ? 14 
HELX_P HELX_P15 15 HIS B 88 ? VAL B 92 ? HIS B 88 VAL B 92 5 ? 5  
HELX_P HELX_P16 16 ALA B 95 ? LYS B 99 ? ALA B 95 LYS B 99 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1NSH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NSH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? 11.477  -9.106  13.686  1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? 10.627  -7.908  13.915  1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? 9.169   -8.300  14.132  1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 1   ? 8.697   -9.297  13.586  1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? 10.751  -6.984  12.702  1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? 11.689  -5.950  12.943  1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? 10.992  -9.712  12.994  1.00 0.00 ? 1   SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? 11.588  -9.593  14.599  1.00 0.00 ? 1   SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? 12.393  -8.780  13.320  1.00 0.00 ? 1   SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? 10.987  -7.394  14.794  1.00 0.00 ? 1   SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? 11.078  -7.557  11.848  1.00 0.00 ? 1   SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? 9.789   -6.539  12.491  1.00 0.00 ? 1   SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? 12.515  -6.332  13.250  1.00 0.00 ? 1   SER A HG   1  
ATOM 14    N N    . ARG A 1 2   ? 8.461   -7.507  14.930  1.00 0.00 ? 2   ARG A N    1  
ATOM 15    C CA   . ARG A 1 2   ? 7.055   -7.771  15.216  1.00 0.00 ? 2   ARG A CA   1  
ATOM 16    C C    . ARG A 1 2   ? 6.340   -6.500  15.680  1.00 0.00 ? 2   ARG A C    1  
ATOM 17    O O    . ARG A 1 2   ? 5.429   -6.013  15.011  1.00 0.00 ? 2   ARG A O    1  
ATOM 18    C CB   . ARG A 1 2   ? 6.923   -8.866  16.280  1.00 0.00 ? 2   ARG A CB   1  
ATOM 19    C CG   . ARG A 1 2   ? 6.653   -10.248 15.706  1.00 0.00 ? 2   ARG A CG   1  
ATOM 20    C CD   . ARG A 1 2   ? 6.800   -11.328 16.766  1.00 0.00 ? 2   ARG A CD   1  
ATOM 21    N NE   . ARG A 1 2   ? 8.031   -11.174 17.537  1.00 0.00 ? 2   ARG A NE   1  
ATOM 22    C CZ   . ARG A 1 2   ? 8.220   -11.694 18.749  1.00 0.00 ? 2   ARG A CZ   1  
ATOM 23    N NH1  . ARG A 1 2   ? 7.263   -12.409 19.330  1.00 0.00 ? 2   ARG A NH1  1  
ATOM 24    N NH2  . ARG A 1 2   ? 9.370   -11.502 19.381  1.00 0.00 ? 2   ARG A NH2  1  
ATOM 25    H H    . ARG A 1 2   ? 8.892   -6.726  15.332  1.00 0.00 ? 2   ARG A H    1  
ATOM 26    H HA   . ARG A 1 2   ? 6.592   -8.114  14.303  1.00 0.00 ? 2   ARG A HA   1  
ATOM 27    H HB2  . ARG A 1 2   ? 7.840   -8.909  16.848  1.00 0.00 ? 2   ARG A HB2  1  
ATOM 28    H HB3  . ARG A 1 2   ? 6.111   -8.612  16.944  1.00 0.00 ? 2   ARG A HB3  1  
ATOM 29    H HG2  . ARG A 1 2   ? 5.647   -10.275 15.316  1.00 0.00 ? 2   ARG A HG2  1  
ATOM 30    H HG3  . ARG A 1 2   ? 7.356   -10.441 14.909  1.00 0.00 ? 2   ARG A HG3  1  
ATOM 31    H HD2  . ARG A 1 2   ? 5.956   -11.271 17.438  1.00 0.00 ? 2   ARG A HD2  1  
ATOM 32    H HD3  . ARG A 1 2   ? 6.808   -12.293 16.280  1.00 0.00 ? 2   ARG A HD3  1  
ATOM 33    H HE   . ARG A 1 2   ? 8.757   -10.655 17.132  1.00 0.00 ? 2   ARG A HE   1  
ATOM 34    H HH11 . ARG A 1 2   ? 6.394   -12.561 18.860  1.00 0.00 ? 2   ARG A HH11 1  
ATOM 35    H HH12 . ARG A 1 2   ? 7.413   -12.795 20.240  1.00 0.00 ? 2   ARG A HH12 1  
ATOM 36    H HH22 . ARG A 1 2   ? 9.511   -11.891 20.291  1.00 0.00 ? 2   ARG A HH22 1  
ATOM 37    N N    . PRO A 1 3   ? 6.728   -5.955  16.847  1.00 0.00 ? 3   PRO A N    1  
ATOM 38    C CA   . PRO A 1 3   ? 6.109   -4.745  17.409  1.00 0.00 ? 3   PRO A CA   1  
ATOM 39    C C    . PRO A 1 3   ? 6.559   -3.451  16.736  1.00 0.00 ? 3   PRO A C    1  
ATOM 40    O O    . PRO A 1 3   ? 6.193   -2.359  17.172  1.00 0.00 ? 3   PRO A O    1  
ATOM 41    C CB   . PRO A 1 3   ? 6.611   -4.772  18.845  1.00 0.00 ? 3   PRO A CB   1  
ATOM 42    C CG   . PRO A 1 3   ? 7.959   -5.374  18.730  1.00 0.00 ? 3   PRO A CG   1  
ATOM 43    C CD   . PRO A 1 3   ? 7.786   -6.479  17.737  1.00 0.00 ? 3   PRO A CD   1  
ATOM 44    H HA   . PRO A 1 3   ? 5.034   -4.804  17.398  1.00 0.00 ? 3   PRO A HA   1  
ATOM 45    H HB2  . PRO A 1 3   ? 6.653   -3.768  19.233  1.00 0.00 ? 3   PRO A HB2  1  
ATOM 46    H HB3  . PRO A 1 3   ? 5.961   -5.384  19.444  1.00 0.00 ? 3   PRO A HB3  1  
ATOM 47    H HG2  . PRO A 1 3   ? 8.665   -4.641  18.367  1.00 0.00 ? 3   PRO A HG2  1  
ATOM 48    H HG3  . PRO A 1 3   ? 8.273   -5.770  19.684  1.00 0.00 ? 3   PRO A HG3  1  
ATOM 49    H HD2  . PRO A 1 3   ? 8.703   -6.656  17.199  1.00 0.00 ? 3   PRO A HD2  1  
ATOM 50    H HD3  . PRO A 1 3   ? 7.453   -7.374  18.236  1.00 0.00 ? 3   PRO A HD3  1  
ATOM 51    N N    . THR A 1 4   ? 7.361   -3.571  15.692  1.00 0.00 ? 4   THR A N    1  
ATOM 52    C CA   . THR A 1 4   ? 7.865   -2.396  14.986  1.00 0.00 ? 4   THR A CA   1  
ATOM 53    C C    . THR A 1 4   ? 6.753   -1.671  14.248  1.00 0.00 ? 4   THR A C    1  
ATOM 54    O O    . THR A 1 4   ? 5.887   -2.286  13.626  1.00 0.00 ? 4   THR A O    1  
ATOM 55    C CB   . THR A 1 4   ? 9.016   -2.750  14.031  1.00 0.00 ? 4   THR A CB   1  
ATOM 56    O OG1  . THR A 1 4   ? 9.201   -1.724  13.073  1.00 0.00 ? 4   THR A OG1  1  
ATOM 57    C CG2  . THR A 1 4   ? 8.830   -4.047  13.275  1.00 0.00 ? 4   THR A CG2  1  
ATOM 58    H H    . THR A 1 4   ? 7.623   -4.459  15.401  1.00 0.00 ? 4   THR A H    1  
ATOM 59    H HA   . THR A 1 4   ? 8.243   -1.723  15.732  1.00 0.00 ? 4   THR A HA   1  
ATOM 60    H HB   . THR A 1 4   ? 9.927   -2.836  14.608  1.00 0.00 ? 4   THR A HB   1  
ATOM 61    H HG1  . THR A 1 4   ? 9.271   -0.878  13.519  1.00 0.00 ? 4   THR A HG1  1  
ATOM 62    H HG21 . THR A 1 4   ? 8.287   -4.751  13.885  1.00 0.00 ? 4   THR A HG21 1  
ATOM 63    H HG22 . THR A 1 4   ? 9.797   -4.460  13.027  1.00 0.00 ? 4   THR A HG22 1  
ATOM 64    H HG23 . THR A 1 4   ? 8.278   -3.859  12.366  1.00 0.00 ? 4   THR A HG23 1  
ATOM 65    N N    . GLU A 1 5   ? 6.791   -0.345  14.335  1.00 0.00 ? 5   GLU A N    1  
ATOM 66    C CA   . GLU A 1 5   ? 5.800   0.510   13.696  1.00 0.00 ? 5   GLU A CA   1  
ATOM 67    C C    . GLU A 1 5   ? 5.518   0.056   12.270  1.00 0.00 ? 5   GLU A C    1  
ATOM 68    O O    . GLU A 1 5   ? 4.368   0.034   11.831  1.00 0.00 ? 5   GLU A O    1  
ATOM 69    C CB   . GLU A 1 5   ? 6.296   1.955   13.703  1.00 0.00 ? 5   GLU A CB   1  
ATOM 70    C CG   . GLU A 1 5   ? 5.248   2.958   14.155  1.00 0.00 ? 5   GLU A CG   1  
ATOM 71    C CD   . GLU A 1 5   ? 4.979   2.889   15.645  1.00 0.00 ? 5   GLU A CD   1  
ATOM 72    O OE1  . GLU A 1 5   ? 4.452   1.855   16.106  1.00 0.00 ? 5   GLU A OE1  1  
ATOM 73    O OE2  . GLU A 1 5   ? 5.296   3.869   16.351  1.00 0.00 ? 5   GLU A OE2  1  
ATOM 74    H H    . GLU A 1 5   ? 7.510   0.073   14.854  1.00 0.00 ? 5   GLU A H    1  
ATOM 75    H HA   . GLU A 1 5   ? 4.888   0.449   14.270  1.00 0.00 ? 5   GLU A HA   1  
ATOM 76    H HB2  . GLU A 1 5   ? 7.141   2.021   14.374  1.00 0.00 ? 5   GLU A HB2  1  
ATOM 77    H HB3  . GLU A 1 5   ? 6.616   2.220   12.707  1.00 0.00 ? 5   GLU A HB3  1  
ATOM 78    H HG2  . GLU A 1 5   ? 5.592   3.953   13.913  1.00 0.00 ? 5   GLU A HG2  1  
ATOM 79    H HG3  . GLU A 1 5   ? 4.326   2.760   13.627  1.00 0.00 ? 5   GLU A HG3  1  
ATOM 80    N N    . THR A 1 6   ? 6.570   -0.317  11.553  1.00 0.00 ? 6   THR A N    1  
ATOM 81    C CA   . THR A 1 6   ? 6.422   -0.782  10.185  1.00 0.00 ? 6   THR A CA   1  
ATOM 82    C C    . THR A 1 6   ? 5.765   -2.156  10.164  1.00 0.00 ? 6   THR A C    1  
ATOM 83    O O    . THR A 1 6   ? 4.921   -2.433  9.318   1.00 0.00 ? 6   THR A O    1  
ATOM 84    C CB   . THR A 1 6   ? 7.778   -0.838  9.481   1.00 0.00 ? 6   THR A CB   1  
ATOM 85    O OG1  . THR A 1 6   ? 8.615   0.218   9.918   1.00 0.00 ? 6   THR A OG1  1  
ATOM 86    C CG2  . THR A 1 6   ? 7.673   -0.746  7.973   1.00 0.00 ? 6   THR A CG2  1  
ATOM 87    H H    . THR A 1 6   ? 7.463   -0.287  11.955  1.00 0.00 ? 6   THR A H    1  
ATOM 88    H HA   . THR A 1 6   ? 5.783   -0.083  9.664   1.00 0.00 ? 6   THR A HA   1  
ATOM 89    H HB   . THR A 1 6   ? 8.260   -1.775  9.723   1.00 0.00 ? 6   THR A HB   1  
ATOM 90    H HG1  . THR A 1 6   ? 8.199   1.060   9.718   1.00 0.00 ? 6   THR A HG1  1  
ATOM 91    H HG21 . THR A 1 6   ? 6.820   -0.139  7.708   1.00 0.00 ? 6   THR A HG21 1  
ATOM 92    H HG22 . THR A 1 6   ? 7.550   -1.737  7.559   1.00 0.00 ? 6   THR A HG22 1  
ATOM 93    H HG23 . THR A 1 6   ? 8.571   -0.300  7.575   1.00 0.00 ? 6   THR A HG23 1  
ATOM 94    N N    . GLU A 1 7   ? 6.144   -3.009  11.112  1.00 0.00 ? 7   GLU A N    1  
ATOM 95    C CA   . GLU A 1 7   ? 5.578   -4.353  11.191  1.00 0.00 ? 7   GLU A CA   1  
ATOM 96    C C    . GLU A 1 7   ? 4.058   -4.290  11.186  1.00 0.00 ? 7   GLU A C    1  
ATOM 97    O O    . GLU A 1 7   ? 3.402   -4.927  10.362  1.00 0.00 ? 7   GLU A O    1  
ATOM 98    C CB   . GLU A 1 7   ? 6.064   -5.060  12.458  1.00 0.00 ? 7   GLU A CB   1  
ATOM 99    C CG   . GLU A 1 7   ? 7.094   -6.145  12.187  1.00 0.00 ? 7   GLU A CG   1  
ATOM 100   C CD   . GLU A 1 7   ? 6.508   -7.336  11.454  1.00 0.00 ? 7   GLU A CD   1  
ATOM 101   O OE1  . GLU A 1 7   ? 6.406   -7.276  10.211  1.00 0.00 ? 7   GLU A OE1  1  
ATOM 102   O OE2  . GLU A 1 7   ? 6.151   -8.327  12.123  1.00 0.00 ? 7   GLU A OE2  1  
ATOM 103   H H    . GLU A 1 7   ? 6.813   -2.731  11.771  1.00 0.00 ? 7   GLU A H    1  
ATOM 104   H HA   . GLU A 1 7   ? 5.910   -4.908  10.326  1.00 0.00 ? 7   GLU A HA   1  
ATOM 105   H HB2  . GLU A 1 7   ? 6.503   -4.326  13.125  1.00 0.00 ? 7   GLU A HB2  1  
ATOM 106   H HB3  . GLU A 1 7   ? 5.217   -5.514  12.948  1.00 0.00 ? 7   GLU A HB3  1  
ATOM 107   H HG2  . GLU A 1 7   ? 7.887   -5.727  11.585  1.00 0.00 ? 7   GLU A HG2  1  
ATOM 108   H HG3  . GLU A 1 7   ? 7.497   -6.483  13.129  1.00 0.00 ? 7   GLU A HG3  1  
ATOM 109   N N    . ARG A 1 8   ? 3.507   -3.501  12.095  1.00 0.00 ? 8   ARG A N    1  
ATOM 110   C CA   . ARG A 1 8   ? 2.063   -3.336  12.177  1.00 0.00 ? 8   ARG A CA   1  
ATOM 111   C C    . ARG A 1 8   ? 1.541   -2.637  10.925  1.00 0.00 ? 8   ARG A C    1  
ATOM 112   O O    . ARG A 1 8   ? 0.384   -2.810  10.541  1.00 0.00 ? 8   ARG A O    1  
ATOM 113   C CB   . ARG A 1 8   ? 1.689   -2.533  13.424  1.00 0.00 ? 8   ARG A CB   1  
ATOM 114   C CG   . ARG A 1 8   ? 1.805   -3.326  14.715  1.00 0.00 ? 8   ARG A CG   1  
ATOM 115   C CD   . ARG A 1 8   ? 1.213   -2.567  15.891  1.00 0.00 ? 8   ARG A CD   1  
ATOM 116   N NE   . ARG A 1 8   ? 2.058   -1.448  16.302  1.00 0.00 ? 8   ARG A NE   1  
ATOM 117   C CZ   . ARG A 1 8   ? 1.984   -0.862  17.495  1.00 0.00 ? 8   ARG A CZ   1  
ATOM 118   N NH1  . ARG A 1 8   ? 1.106   -1.284  18.396  1.00 0.00 ? 8   ARG A NH1  1  
ATOM 119   N NH2  . ARG A 1 8   ? 2.792   0.148   17.787  1.00 0.00 ? 8   ARG A NH2  1  
ATOM 120   H H    . ARG A 1 8   ? 4.085   -3.009  12.718  1.00 0.00 ? 8   ARG A H    1  
ATOM 121   H HA   . ARG A 1 8   ? 1.618   -4.319  12.241  1.00 0.00 ? 8   ARG A HA   1  
ATOM 122   H HB2  . ARG A 1 8   ? 2.341   -1.674  13.494  1.00 0.00 ? 8   ARG A HB2  1  
ATOM 123   H HB3  . ARG A 1 8   ? 0.668   -2.191  13.326  1.00 0.00 ? 8   ARG A HB3  1  
ATOM 124   H HG2  . ARG A 1 8   ? 1.276   -4.261  14.601  1.00 0.00 ? 8   ARG A HG2  1  
ATOM 125   H HG3  . ARG A 1 8   ? 2.848   -3.523  14.913  1.00 0.00 ? 8   ARG A HG3  1  
ATOM 126   H HD2  . ARG A 1 8   ? 0.243   -2.187  15.606  1.00 0.00 ? 8   ARG A HD2  1  
ATOM 127   H HD3  . ARG A 1 8   ? 1.102   -3.247  16.722  1.00 0.00 ? 8   ARG A HD3  1  
ATOM 128   H HE   . ARG A 1 8   ? 2.716   -1.116  15.655  1.00 0.00 ? 8   ARG A HE   1  
ATOM 129   H HH11 . ARG A 1 8   ? 0.494   -2.045  18.182  1.00 0.00 ? 8   ARG A HH11 1  
ATOM 130   H HH12 . ARG A 1 8   ? 1.056   -0.839  19.290  1.00 0.00 ? 8   ARG A HH12 1  
ATOM 131   H HH22 . ARG A 1 8   ? 2.737   0.590   18.683  1.00 0.00 ? 8   ARG A HH22 1  
ATOM 132   N N    . CYS A 1 9   ? 2.405   -1.841  10.295  1.00 0.00 ? 9   CYS A N    1  
ATOM 133   C CA   . CYS A 1 9   ? 2.039   -1.108  9.088   1.00 0.00 ? 9   CYS A CA   1  
ATOM 134   C C    . CYS A 1 9   ? 1.734   -2.059  7.930   1.00 0.00 ? 9   CYS A C    1  
ATOM 135   O O    . CYS A 1 9   ? 0.702   -1.932  7.273   1.00 0.00 ? 9   CYS A O    1  
ATOM 136   C CB   . CYS A 1 9   ? 3.153   -0.102  8.720   1.00 0.00 ? 9   CYS A CB   1  
ATOM 137   S SG   . CYS A 1 9   ? 4.213   -0.565  7.323   1.00 0.00 ? 9   CYS A SG   1  
ATOM 138   H H    . CYS A 1 9   ? 3.312   -1.743  10.653  1.00 0.00 ? 9   CYS A H    1  
ATOM 139   H HA   . CYS A 1 9   ? 1.140   -0.554  9.309   1.00 0.00 ? 9   CYS A HA   1  
ATOM 140   H HB2  . CYS A 1 9   ? 2.699   0.842   8.472   1.00 0.00 ? 9   CYS A HB2  1  
ATOM 141   H HB3  . CYS A 1 9   ? 3.790   0.036   9.581   1.00 0.00 ? 9   CYS A HB3  1  
ATOM 142   H HG   . CYS A 1 9   ? 5.000   -0.988  7.676   1.00 0.00 ? 9   CYS A HG   1  
ATOM 143   N N    . ILE A 1 10  ? 2.633   -3.006  7.680   1.00 0.00 ? 10  ILE A N    1  
ATOM 144   C CA   . ILE A 1 10  ? 2.444   -3.956  6.595   1.00 0.00 ? 10  ILE A CA   1  
ATOM 145   C C    . ILE A 1 10  ? 1.189   -4.795  6.798   1.00 0.00 ? 10  ILE A C    1  
ATOM 146   O O    . ILE A 1 10  ? 0.307   -4.822  5.944   1.00 0.00 ? 10  ILE A O    1  
ATOM 147   C CB   . ILE A 1 10  ? 3.654   -4.902  6.468   1.00 0.00 ? 10  ILE A CB   1  
ATOM 148   C CG1  . ILE A 1 10  ? 4.957   -4.107  6.397   1.00 0.00 ? 10  ILE A CG1  1  
ATOM 149   C CG2  . ILE A 1 10  ? 3.507   -5.790  5.244   1.00 0.00 ? 10  ILE A CG2  1  
ATOM 150   C CD1  . ILE A 1 10  ? 5.794   -4.199  7.648   1.00 0.00 ? 10  ILE A CD1  1  
ATOM 151   H H    . ILE A 1 10  ? 3.440   -3.064  8.229   1.00 0.00 ? 10  ILE A H    1  
ATOM 152   H HA   . ILE A 1 10  ? 2.352   -3.399  5.674   1.00 0.00 ? 10  ILE A HA   1  
ATOM 153   H HB   . ILE A 1 10  ? 3.676   -5.539  7.341   1.00 0.00 ? 10  ILE A HB   1  
ATOM 154   H HG12 . ILE A 1 10  ? 5.554   -4.481  5.583   1.00 0.00 ? 10  ILE A HG12 1  
ATOM 155   H HG13 . ILE A 1 10  ? 4.729   -3.066  6.227   1.00 0.00 ? 10  ILE A HG13 1  
ATOM 156   H HG21 . ILE A 1 10  ? 3.525   -6.825  5.548   1.00 0.00 ? 10  ILE A HG21 1  
ATOM 157   H HG22 . ILE A 1 10  ? 4.322   -5.599  4.562   1.00 0.00 ? 10  ILE A HG22 1  
ATOM 158   H HG23 . ILE A 1 10  ? 2.567   -5.574  4.755   1.00 0.00 ? 10  ILE A HG23 1  
ATOM 159   H HD11 . ILE A 1 10  ? 6.283   -3.251  7.817   1.00 0.00 ? 10  ILE A HD11 1  
ATOM 160   H HD12 . ILE A 1 10  ? 6.536   -4.974  7.528   1.00 0.00 ? 10  ILE A HD12 1  
ATOM 161   H HD13 . ILE A 1 10  ? 5.159   -4.433  8.487   1.00 0.00 ? 10  ILE A HD13 1  
ATOM 162   N N    . GLU A 1 11  ? 1.120   -5.485  7.929   1.00 0.00 ? 11  GLU A N    1  
ATOM 163   C CA   . GLU A 1 11  ? -0.022  -6.341  8.240   1.00 0.00 ? 11  GLU A CA   1  
ATOM 164   C C    . GLU A 1 11  ? -1.342  -5.589  8.116   1.00 0.00 ? 11  GLU A C    1  
ATOM 165   O O    . GLU A 1 11  ? -2.387  -6.188  7.865   1.00 0.00 ? 11  GLU A O    1  
ATOM 166   C CB   . GLU A 1 11  ? 0.120   -6.918  9.649   1.00 0.00 ? 11  GLU A CB   1  
ATOM 167   C CG   . GLU A 1 11  ? -0.103  -8.419  9.709   1.00 0.00 ? 11  GLU A CG   1  
ATOM 168   C CD   . GLU A 1 11  ? -1.389  -8.791  10.422  1.00 0.00 ? 11  GLU A CD   1  
ATOM 169   O OE1  . GLU A 1 11  ? -1.809  -8.035  11.323  1.00 0.00 ? 11  GLU A OE1  1  
ATOM 170   O OE2  . GLU A 1 11  ? -1.974  -9.840  10.080  1.00 0.00 ? 11  GLU A OE2  1  
ATOM 171   H H    . GLU A 1 11  ? 1.860   -5.427  8.569   1.00 0.00 ? 11  GLU A H    1  
ATOM 172   H HA   . GLU A 1 11  ? -0.022  -7.155  7.533   1.00 0.00 ? 11  GLU A HA   1  
ATOM 173   H HB2  . GLU A 1 11  ? 1.115   -6.707  10.014  1.00 0.00 ? 11  GLU A HB2  1  
ATOM 174   H HB3  . GLU A 1 11  ? -0.601  -6.441  10.297  1.00 0.00 ? 11  GLU A HB3  1  
ATOM 175   H HG2  . GLU A 1 11  ? -0.145  -8.803  8.700   1.00 0.00 ? 11  GLU A HG2  1  
ATOM 176   H HG3  . GLU A 1 11  ? 0.727   -8.870  10.232  1.00 0.00 ? 11  GLU A HG3  1  
ATOM 177   N N    . SER A 1 12  ? -1.289  -4.282  8.319   1.00 0.00 ? 12  SER A N    1  
ATOM 178   C CA   . SER A 1 12  ? -2.483  -3.451  8.258   1.00 0.00 ? 12  SER A CA   1  
ATOM 179   C C    . SER A 1 12  ? -3.119  -3.433  6.863   1.00 0.00 ? 12  SER A C    1  
ATOM 180   O O    . SER A 1 12  ? -4.307  -3.718  6.722   1.00 0.00 ? 12  SER A O    1  
ATOM 181   C CB   . SER A 1 12  ? -2.141  -2.025  8.694   1.00 0.00 ? 12  SER A CB   1  
ATOM 182   O OG   . SER A 1 12  ? -3.086  -1.541  9.632   1.00 0.00 ? 12  SER A OG   1  
ATOM 183   H H    . SER A 1 12  ? -0.429  -3.867  8.534   1.00 0.00 ? 12  SER A H    1  
ATOM 184   H HA   . SER A 1 12  ? -3.198  -3.859  8.954   1.00 0.00 ? 12  SER A HA   1  
ATOM 185   H HB2  . SER A 1 12  ? -1.163  -2.016  9.150   1.00 0.00 ? 12  SER A HB2  1  
ATOM 186   H HB3  . SER A 1 12  ? -2.142  -1.375  7.830   1.00 0.00 ? 12  SER A HB3  1  
ATOM 187   H HG   . SER A 1 12  ? -2.737  -1.644  10.520  1.00 0.00 ? 12  SER A HG   1  
ATOM 188   N N    . LEU A 1 13  ? -2.344  -3.068  5.843   1.00 0.00 ? 13  LEU A N    1  
ATOM 189   C CA   . LEU A 1 13  ? -2.863  -2.980  4.478   1.00 0.00 ? 13  LEU A CA   1  
ATOM 190   C C    . LEU A 1 13  ? -3.091  -4.345  3.823   1.00 0.00 ? 13  LEU A C    1  
ATOM 191   O O    . LEU A 1 13  ? -3.951  -4.488  2.955   1.00 0.00 ? 13  LEU A O    1  
ATOM 192   C CB   . LEU A 1 13  ? -1.915  -2.146  3.628   1.00 0.00 ? 13  LEU A CB   1  
ATOM 193   C CG   . LEU A 1 13  ? -2.225  -0.653  3.612   1.00 0.00 ? 13  LEU A CG   1  
ATOM 194   C CD1  . LEU A 1 13  ? -3.544  -0.391  2.912   1.00 0.00 ? 13  LEU A CD1  1  
ATOM 195   C CD2  . LEU A 1 13  ? -2.274  -0.092  5.018   1.00 0.00 ? 13  LEU A CD2  1  
ATOM 196   H H    . LEU A 1 13  ? -1.411  -2.822  6.012   1.00 0.00 ? 13  LEU A H    1  
ATOM 197   H HA   . LEU A 1 13  ? -3.812  -2.466  4.527   1.00 0.00 ? 13  LEU A HA   1  
ATOM 198   H HB2  . LEU A 1 13  ? -0.911  -2.285  4.003   1.00 0.00 ? 13  LEU A HB2  1  
ATOM 199   H HB3  . LEU A 1 13  ? -1.957  -2.511  2.612   1.00 0.00 ? 13  LEU A HB3  1  
ATOM 200   H HG   . LEU A 1 13  ? -1.446  -0.140  3.075   1.00 0.00 ? 13  LEU A HG   1  
ATOM 201   H HD11 . LEU A 1 13  ? -3.374  0.232   2.049   1.00 0.00 ? 13  LEU A HD11 1  
ATOM 202   H HD12 . LEU A 1 13  ? -4.222  0.110   3.593   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 203   H HD13 . LEU A 1 13  ? -3.977  -1.331  2.600   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 204   H HD21 . LEU A 1 13  ? -2.775  -0.793  5.668   1.00 0.00 ? 13  LEU A HD21 1  
ATOM 205   H HD22 . LEU A 1 13  ? -2.819  0.841   5.006   1.00 0.00 ? 13  LEU A HD22 1  
ATOM 206   H HD23 . LEU A 1 13  ? -1.270  0.080   5.375   1.00 0.00 ? 13  LEU A HD23 1  
ATOM 207   N N    . ILE A 1 14  ? -2.328  -5.345  4.217   1.00 0.00 ? 14  ILE A N    1  
ATOM 208   C CA   . ILE A 1 14  ? -2.481  -6.666  3.643   1.00 0.00 ? 14  ILE A CA   1  
ATOM 209   C C    . ILE A 1 14  ? -3.807  -7.278  4.017   1.00 0.00 ? 14  ILE A C    1  
ATOM 210   O O    . ILE A 1 14  ? -4.409  -8.016  3.245   1.00 0.00 ? 14  ILE A O    1  
ATOM 211   C CB   . ILE A 1 14  ? -1.426  -7.634  4.164   1.00 0.00 ? 14  ILE A CB   1  
ATOM 212   C CG1  . ILE A 1 14  ? -0.046  -7.017  4.165   1.00 0.00 ? 14  ILE A CG1  1  
ATOM 213   C CG2  . ILE A 1 14  ? -1.444  -8.898  3.347   1.00 0.00 ? 14  ILE A CG2  1  
ATOM 214   C CD1  . ILE A 1 14  ? 0.825   -7.619  5.232   1.00 0.00 ? 14  ILE A CD1  1  
ATOM 215   H H    . ILE A 1 14  ? -1.649  -5.200  4.898   1.00 0.00 ? 14  ILE A H    1  
ATOM 216   H HA   . ILE A 1 14  ? -2.392  -6.602  2.574   1.00 0.00 ? 14  ILE A HA   1  
ATOM 217   H HB   . ILE A 1 14  ? -1.691  -7.897  5.177   1.00 0.00 ? 14  ILE A HB   1  
ATOM 218   H HG12 . ILE A 1 14  ? 0.426   -7.181  3.208   1.00 0.00 ? 14  ILE A HG12 1  
ATOM 219   H HG13 . ILE A 1 14  ? -0.128  -5.963  4.355   1.00 0.00 ? 14  ILE A HG13 1  
ATOM 220   H HG21 . ILE A 1 14  ? -0.767  -8.794  2.516   1.00 0.00 ? 14  ILE A HG21 1  
ATOM 221   H HG22 . ILE A 1 14  ? -2.446  -9.065  2.982   1.00 0.00 ? 14  ILE A HG22 1  
ATOM 222   H HG23 . ILE A 1 14  ? -1.140  -9.725  3.966   1.00 0.00 ? 14  ILE A HG23 1  
ATOM 223   H HD11 . ILE A 1 14  ? 1.384   -6.845  5.723   1.00 0.00 ? 14  ILE A HD11 1  
ATOM 224   H HD12 . ILE A 1 14  ? 1.502   -8.329  4.783   1.00 0.00 ? 14  ILE A HD12 1  
ATOM 225   H HD13 . ILE A 1 14  ? 0.195   -8.124  5.953   1.00 0.00 ? 14  ILE A HD13 1  
ATOM 226   N N    . ALA A 1 15  ? -4.214  -7.011  5.237   1.00 0.00 ? 15  ALA A N    1  
ATOM 227   C CA   . ALA A 1 15  ? -5.419  -7.582  5.786   1.00 0.00 ? 15  ALA A CA   1  
ATOM 228   C C    . ALA A 1 15  ? -6.675  -6.885  5.293   1.00 0.00 ? 15  ALA A C    1  
ATOM 229   O O    . ALA A 1 15  ? -7.702  -7.533  5.089   1.00 0.00 ? 15  ALA A O    1  
ATOM 230   C CB   . ALA A 1 15  ? -5.295  -7.578  7.289   1.00 0.00 ? 15  ALA A CB   1  
ATOM 231   H H    . ALA A 1 15  ? -3.662  -6.435  5.803   1.00 0.00 ? 15  ALA A H    1  
ATOM 232   H HA   . ALA A 1 15  ? -5.460  -8.613  5.468   1.00 0.00 ? 15  ALA A HA   1  
ATOM 233   H HB1  . ALA A 1 15  ? -5.683  -8.505  7.680   1.00 0.00 ? 15  ALA A HB1  1  
ATOM 234   H HB2  . ALA A 1 15  ? -5.844  -6.745  7.699   1.00 0.00 ? 15  ALA A HB2  1  
ATOM 235   H HB3  . ALA A 1 15  ? -4.242  -7.491  7.545   1.00 0.00 ? 15  ALA A HB3  1  
ATOM 236   N N    . VAL A 1 16  ? -6.593  -5.582  5.046   1.00 0.00 ? 16  VAL A N    1  
ATOM 237   C CA   . VAL A 1 16  ? -7.730  -4.858  4.513   1.00 0.00 ? 16  VAL A CA   1  
ATOM 238   C C    . VAL A 1 16  ? -8.216  -5.596  3.276   1.00 0.00 ? 16  VAL A C    1  
ATOM 239   O O    . VAL A 1 16  ? -9.415  -5.715  3.021   1.00 0.00 ? 16  VAL A O    1  
ATOM 240   C CB   . VAL A 1 16  ? -7.331  -3.426  4.127   1.00 0.00 ? 16  VAL A CB   1  
ATOM 241   C CG1  . VAL A 1 16  ? -6.762  -2.693  5.322   1.00 0.00 ? 16  VAL A CG1  1  
ATOM 242   C CG2  . VAL A 1 16  ? -6.314  -3.451  3.008   1.00 0.00 ? 16  VAL A CG2  1  
ATOM 243   H H    . VAL A 1 16  ? -5.747  -5.112  5.182   1.00 0.00 ? 16  VAL A H    1  
ATOM 244   H HA   . VAL A 1 16  ? -8.513  -4.829  5.259   1.00 0.00 ? 16  VAL A HA   1  
ATOM 245   H HB   . VAL A 1 16  ? -8.204  -2.905  3.787   1.00 0.00 ? 16  VAL A HB   1  
ATOM 246   H HG11 . VAL A 1 16  ? -6.180  -3.384  5.911   1.00 0.00 ? 16  VAL A HG11 1  
ATOM 247   H HG12 . VAL A 1 16  ? -7.568  -2.293  5.918   1.00 0.00 ? 16  VAL A HG12 1  
ATOM 248   H HG13 . VAL A 1 16  ? -6.129  -1.887  4.976   1.00 0.00 ? 16  VAL A HG13 1  
ATOM 249   H HG21 . VAL A 1 16  ? -5.561  -4.191  3.243   1.00 0.00 ? 16  VAL A HG21 1  
ATOM 250   H HG22 . VAL A 1 16  ? -5.852  -2.478  2.916   1.00 0.00 ? 16  VAL A HG22 1  
ATOM 251   H HG23 . VAL A 1 16  ? -6.799  -3.713  2.082   1.00 0.00 ? 16  VAL A HG23 1  
ATOM 252   N N    . PHE A 1 17  ? -7.241  -6.112  2.531   1.00 0.00 ? 17  PHE A N    1  
ATOM 253   C CA   . PHE A 1 17  ? -7.509  -6.879  1.323   1.00 0.00 ? 17  PHE A CA   1  
ATOM 254   C C    . PHE A 1 17  ? -7.966  -8.295  1.684   1.00 0.00 ? 17  PHE A C    1  
ATOM 255   O O    . PHE A 1 17  ? -9.055  -8.717  1.299   1.00 0.00 ? 17  PHE A O    1  
ATOM 256   C CB   . PHE A 1 17  ? -6.246  -6.920  0.448   1.00 0.00 ? 17  PHE A CB   1  
ATOM 257   C CG   . PHE A 1 17  ? -6.126  -8.134  -0.434  1.00 0.00 ? 17  PHE A CG   1  
ATOM 258   C CD1  . PHE A 1 17  ? -6.997  -8.329  -1.495  1.00 0.00 ? 17  PHE A CD1  1  
ATOM 259   C CD2  . PHE A 1 17  ? -5.138  -9.076  -0.201  1.00 0.00 ? 17  PHE A CD2  1  
ATOM 260   C CE1  . PHE A 1 17  ? -6.881  -9.443  -2.307  1.00 0.00 ? 17  PHE A CE1  1  
ATOM 261   C CE2  . PHE A 1 17  ? -5.018  -10.191 -1.008  1.00 0.00 ? 17  PHE A CE2  1  
ATOM 262   C CZ   . PHE A 1 17  ? -5.891  -10.375 -2.063  1.00 0.00 ? 17  PHE A CZ   1  
ATOM 263   H H    . PHE A 1 17  ? -6.304  -5.979  2.819   1.00 0.00 ? 17  PHE A H    1  
ATOM 264   H HA   . PHE A 1 17  ? -8.300  -6.385  0.778   1.00 0.00 ? 17  PHE A HA   1  
ATOM 265   H HB2  . PHE A 1 17  ? -6.236  -6.051  -0.192  1.00 0.00 ? 17  PHE A HB2  1  
ATOM 266   H HB3  . PHE A 1 17  ? -5.376  -6.891  1.090   1.00 0.00 ? 17  PHE A HB3  1  
ATOM 267   H HD1  . PHE A 1 17  ? -7.771  -7.602  -1.687  1.00 0.00 ? 17  PHE A HD1  1  
ATOM 268   H HD2  . PHE A 1 17  ? -4.454  -8.934  0.623   1.00 0.00 ? 17  PHE A HD2  1  
ATOM 269   H HE1  . PHE A 1 17  ? -7.563  -9.585  -3.131  1.00 0.00 ? 17  PHE A HE1  1  
ATOM 270   H HE2  . PHE A 1 17  ? -4.244  -10.918 -0.815  1.00 0.00 ? 17  PHE A HE2  1  
ATOM 271   H HZ   . PHE A 1 17  ? -5.800  -11.246 -2.695  1.00 0.00 ? 17  PHE A HZ   1  
ATOM 272   N N    . GLN A 1 18  ? -7.126  -9.021  2.427   1.00 0.00 ? 18  GLN A N    1  
ATOM 273   C CA   . GLN A 1 18  ? -7.439  -10.394 2.837   1.00 0.00 ? 18  GLN A CA   1  
ATOM 274   C C    . GLN A 1 18  ? -8.834  -10.509 3.436   1.00 0.00 ? 18  GLN A C    1  
ATOM 275   O O    . GLN A 1 18  ? -9.589  -11.421 3.101   1.00 0.00 ? 18  GLN A O    1  
ATOM 276   C CB   . GLN A 1 18  ? -6.433  -10.893 3.880   1.00 0.00 ? 18  GLN A CB   1  
ATOM 277   C CG   . GLN A 1 18  ? -4.984  -10.636 3.522   1.00 0.00 ? 18  GLN A CG   1  
ATOM 278   C CD   . GLN A 1 18  ? -4.408  -11.719 2.640   1.00 0.00 ? 18  GLN A CD   1  
ATOM 279   O OE1  . GLN A 1 18  ? -3.527  -12.475 3.051   1.00 0.00 ? 18  GLN A OE1  1  
ATOM 280   N NE2  . GLN A 1 18  ? -4.910  -11.796 1.415   1.00 0.00 ? 18  GLN A NE2  1  
ATOM 281   H H    . GLN A 1 18  ? -6.269  -8.626  2.698   1.00 0.00 ? 18  GLN A H    1  
ATOM 282   H HA   . GLN A 1 18  ? -7.380  -11.026 1.964   1.00 0.00 ? 18  GLN A HA   1  
ATOM 283   H HB2  . GLN A 1 18  ? -6.638  -10.401 4.820   1.00 0.00 ? 18  GLN A HB2  1  
ATOM 284   H HB3  . GLN A 1 18  ? -6.566  -11.956 4.007   1.00 0.00 ? 18  GLN A HB3  1  
ATOM 285   H HG2  . GLN A 1 18  ? -4.921  -9.704  2.993   1.00 0.00 ? 18  GLN A HG2  1  
ATOM 286   H HG3  . GLN A 1 18  ? -4.404  -10.576 4.432   1.00 0.00 ? 18  GLN A HG3  1  
ATOM 287   H HE21 . GLN A 1 18  ? -5.613  -11.156 1.163   1.00 0.00 ? 18  GLN A HE21 1  
ATOM 288   H HE22 . GLN A 1 18  ? -4.560  -12.485 0.814   1.00 0.00 ? 18  GLN A HE22 1  
ATOM 289   N N    . LYS A 1 19  ? -9.160  -9.600  4.345   1.00 0.00 ? 19  LYS A N    1  
ATOM 290   C CA   . LYS A 1 19  ? -10.455 -9.626  5.014   1.00 0.00 ? 19  LYS A CA   1  
ATOM 291   C C    . LYS A 1 19  ? -11.599 -9.804  4.021   1.00 0.00 ? 19  LYS A C    1  
ATOM 292   O O    . LYS A 1 19  ? -12.428 -10.703 4.173   1.00 0.00 ? 19  LYS A O    1  
ATOM 293   C CB   . LYS A 1 19  ? -10.651 -8.330  5.801   1.00 0.00 ? 19  LYS A CB   1  
ATOM 294   C CG   . LYS A 1 19  ? -11.866 -8.342  6.711   1.00 0.00 ? 19  LYS A CG   1  
ATOM 295   C CD   . LYS A 1 19  ? -11.614 -9.160  7.967   1.00 0.00 ? 19  LYS A CD   1  
ATOM 296   C CE   . LYS A 1 19  ? -10.547 -8.521  8.842   1.00 0.00 ? 19  LYS A CE   1  
ATOM 297   N NZ   . LYS A 1 19  ? -10.876 -7.108  9.178   1.00 0.00 ? 19  LYS A NZ   1  
ATOM 298   H H    . LYS A 1 19  ? -8.509  -8.910  4.589   1.00 0.00 ? 19  LYS A H    1  
ATOM 299   H HA   . LYS A 1 19  ? -10.457 -10.457 5.703   1.00 0.00 ? 19  LYS A HA   1  
ATOM 300   H HB2  . LYS A 1 19  ? -9.776  -8.156  6.409   1.00 0.00 ? 19  LYS A HB2  1  
ATOM 301   H HB3  . LYS A 1 19  ? -10.759 -7.512  5.103   1.00 0.00 ? 19  LYS A HB3  1  
ATOM 302   H HG2  . LYS A 1 19  ? -12.098 -7.326  6.996   1.00 0.00 ? 19  LYS A HG2  1  
ATOM 303   H HG3  . LYS A 1 19  ? -12.702 -8.768  6.176   1.00 0.00 ? 19  LYS A HG3  1  
ATOM 304   H HD2  . LYS A 1 19  ? -12.532 -9.229  8.531   1.00 0.00 ? 19  LYS A HD2  1  
ATOM 305   H HD3  . LYS A 1 19  ? -11.288 -10.149 7.682   1.00 0.00 ? 19  LYS A HD3  1  
ATOM 306   H HE2  . LYS A 1 19  ? -10.461 -9.088  9.756   1.00 0.00 ? 19  LYS A HE2  1  
ATOM 307   H HE3  . LYS A 1 19  ? -9.605  -8.546  8.314   1.00 0.00 ? 19  LYS A HE3  1  
ATOM 308   H HZ1  . LYS A 1 19  ? -10.195 -6.738  9.872   1.00 0.00 ? 19  LYS A HZ1  1  
ATOM 309   H HZ2  . LYS A 1 19  ? -11.833 -7.049  9.582   1.00 0.00 ? 19  LYS A HZ2  1  
ATOM 310   H HZ3  . LYS A 1 19  ? -10.838 -6.519  8.322   1.00 0.00 ? 19  LYS A HZ3  1  
ATOM 311   N N    . TYR A 1 20  ? -11.627 -8.968  2.992   1.00 0.00 ? 20  TYR A N    1  
ATOM 312   C CA   . TYR A 1 20  ? -12.655 -9.063  1.966   1.00 0.00 ? 20  TYR A CA   1  
ATOM 313   C C    . TYR A 1 20  ? -12.301 -10.147 0.961   1.00 0.00 ? 20  TYR A C    1  
ATOM 314   O O    . TYR A 1 20  ? -13.170 -10.764 0.344   1.00 0.00 ? 20  TYR A O    1  
ATOM 315   C CB   . TYR A 1 20  ? -12.856 -7.716  1.274   1.00 0.00 ? 20  TYR A CB   1  
ATOM 316   C CG   . TYR A 1 20  ? -14.115 -7.009  1.722   1.00 0.00 ? 20  TYR A CG   1  
ATOM 317   C CD1  . TYR A 1 20  ? -14.122 -6.226  2.867   1.00 0.00 ? 20  TYR A CD1  1  
ATOM 318   C CD2  . TYR A 1 20  ? -15.298 -7.135  1.007   1.00 0.00 ? 20  TYR A CD2  1  
ATOM 319   C CE1  . TYR A 1 20  ? -15.272 -5.585  3.288   1.00 0.00 ? 20  TYR A CE1  1  
ATOM 320   C CE2  . TYR A 1 20  ? -16.454 -6.499  1.420   1.00 0.00 ? 20  TYR A CE2  1  
ATOM 321   C CZ   . TYR A 1 20  ? -16.435 -5.725  2.560   1.00 0.00 ? 20  TYR A CZ   1  
ATOM 322   O OH   . TYR A 1 20  ? -17.582 -5.091  2.977   1.00 0.00 ? 20  TYR A OH   1  
ATOM 323   H H    . TYR A 1 20  ? -10.919 -8.295  2.899   1.00 0.00 ? 20  TYR A H    1  
ATOM 324   H HA   . TYR A 1 20  ? -13.577 -9.342  2.455   1.00 0.00 ? 20  TYR A HA   1  
ATOM 325   H HB2  . TYR A 1 20  ? -12.015 -7.074  1.493   1.00 0.00 ? 20  TYR A HB2  1  
ATOM 326   H HB3  . TYR A 1 20  ? -12.920 -7.869  0.207   1.00 0.00 ? 20  TYR A HB3  1  
ATOM 327   H HD1  . TYR A 1 20  ? -13.208 -6.117  3.434   1.00 0.00 ? 20  TYR A HD1  1  
ATOM 328   H HD2  . TYR A 1 20  ? -15.310 -7.742  0.115   1.00 0.00 ? 20  TYR A HD2  1  
ATOM 329   H HE1  . TYR A 1 20  ? -15.256 -4.978  4.181   1.00 0.00 ? 20  TYR A HE1  1  
ATOM 330   H HE2  . TYR A 1 20  ? -17.364 -6.610  0.851   1.00 0.00 ? 20  TYR A HE2  1  
ATOM 331   H HH   . TYR A 1 20  ? -18.258 -5.744  3.169   1.00 0.00 ? 20  TYR A HH   1  
ATOM 332   N N    . ALA A 1 21  ? -11.001 -10.343 0.794   1.00 0.00 ? 21  ALA A N    1  
ATOM 333   C CA   . ALA A 1 21  ? -10.464 -11.313 -0.142  1.00 0.00 ? 21  ALA A CA   1  
ATOM 334   C C    . ALA A 1 21  ? -10.403 -12.721 0.453   1.00 0.00 ? 21  ALA A C    1  
ATOM 335   O O    . ALA A 1 21  ? -9.763  -13.608 -0.111  1.00 0.00 ? 21  ALA A O    1  
ATOM 336   C CB   . ALA A 1 21  ? -9.084  -10.850 -0.569  1.00 0.00 ? 21  ALA A CB   1  
ATOM 337   H H    . ALA A 1 21  ? -10.372 -9.796  1.309   1.00 0.00 ? 21  ALA A H    1  
ATOM 338   H HA   . ALA A 1 21  ? -11.098 -11.326 -1.015  1.00 0.00 ? 21  ALA A HA   1  
ATOM 339   H HB1  . ALA A 1 21  ? -9.175  -10.144 -1.384  1.00 0.00 ? 21  ALA A HB1  1  
ATOM 340   H HB2  . ALA A 1 21  ? -8.497  -11.697 -0.886  1.00 0.00 ? 21  ALA A HB2  1  
ATOM 341   H HB3  . ALA A 1 21  ? -8.603  -10.366 0.272   1.00 0.00 ? 21  ALA A HB3  1  
ATOM 342   N N    . GLY A 1 22  ? -11.068 -12.924 1.587   1.00 0.00 ? 22  GLY A N    1  
ATOM 343   C CA   . GLY A 1 22  ? -11.064 -14.231 2.217   1.00 0.00 ? 22  GLY A CA   1  
ATOM 344   C C    . GLY A 1 22  ? -10.943 -14.154 3.725   1.00 0.00 ? 22  GLY A C    1  
ATOM 345   O O    . GLY A 1 22  ? -9.982  -13.593 4.251   1.00 0.00 ? 22  GLY A O    1  
ATOM 346   H H    . GLY A 1 22  ? -11.564 -12.188 1.997   1.00 0.00 ? 22  GLY A H    1  
ATOM 347   H HA2  . GLY A 1 22  ? -11.984 -14.741 1.967   1.00 0.00 ? 22  GLY A HA2  1  
ATOM 348   H HA3  . GLY A 1 22  ? -10.234 -14.802 1.830   1.00 0.00 ? 22  GLY A HA3  1  
ATOM 349   N N    . LYS A 1 23  ? -11.921 -14.724 4.423   1.00 0.00 ? 23  LYS A N    1  
ATOM 350   C CA   . LYS A 1 23  ? -11.920 -14.724 5.881   1.00 0.00 ? 23  LYS A CA   1  
ATOM 351   C C    . LYS A 1 23  ? -11.350 -16.032 6.420   1.00 0.00 ? 23  LYS A C    1  
ATOM 352   O O    . LYS A 1 23  ? -10.774 -16.068 7.509   1.00 0.00 ? 23  LYS A O    1  
ATOM 353   C CB   . LYS A 1 23  ? -13.339 -14.512 6.413   1.00 0.00 ? 23  LYS A CB   1  
ATOM 354   C CG   . LYS A 1 23  ? -13.855 -13.094 6.217   1.00 0.00 ? 23  LYS A CG   1  
ATOM 355   C CD   . LYS A 1 23  ? -15.238 -13.082 5.585   1.00 0.00 ? 23  LYS A CD   1  
ATOM 356   C CE   . LYS A 1 23  ? -15.387 -11.943 4.590   1.00 0.00 ? 23  LYS A CE   1  
ATOM 357   N NZ   . LYS A 1 23  ? -16.448 -12.221 3.582   1.00 0.00 ? 23  LYS A NZ   1  
ATOM 358   H H    . LYS A 1 23  ? -12.658 -15.159 3.946   1.00 0.00 ? 23  LYS A H    1  
ATOM 359   H HA   . LYS A 1 23  ? -11.294 -13.908 6.212   1.00 0.00 ? 23  LYS A HA   1  
ATOM 360   H HB2  . LYS A 1 23  ? -14.007 -15.190 5.903   1.00 0.00 ? 23  LYS A HB2  1  
ATOM 361   H HB3  . LYS A 1 23  ? -13.352 -14.733 7.470   1.00 0.00 ? 23  LYS A HB3  1  
ATOM 362   H HG2  . LYS A 1 23  ? -13.907 -12.605 7.178   1.00 0.00 ? 23  LYS A HG2  1  
ATOM 363   H HG3  . LYS A 1 23  ? -13.171 -12.558 5.575   1.00 0.00 ? 23  LYS A HG3  1  
ATOM 364   H HD2  . LYS A 1 23  ? -15.397 -14.019 5.072   1.00 0.00 ? 23  LYS A HD2  1  
ATOM 365   H HD3  . LYS A 1 23  ? -15.978 -12.966 6.364   1.00 0.00 ? 23  LYS A HD3  1  
ATOM 366   H HE2  . LYS A 1 23  ? -15.640 -11.043 5.127   1.00 0.00 ? 23  LYS A HE2  1  
ATOM 367   H HE3  . LYS A 1 23  ? -14.444 -11.804 4.078   1.00 0.00 ? 23  LYS A HE3  1  
ATOM 368   H HZ1  . LYS A 1 23  ? -16.287 -11.650 2.727   1.00 0.00 ? 23  LYS A HZ1  1  
ATOM 369   H HZ2  . LYS A 1 23  ? -17.382 -11.984 3.973   1.00 0.00 ? 23  LYS A HZ2  1  
ATOM 370   H HZ3  . LYS A 1 23  ? -16.438 -13.227 3.321   1.00 0.00 ? 23  LYS A HZ3  1  
ATOM 371   N N    . ASP A 1 24  ? -11.511 -17.104 5.651   1.00 0.00 ? 24  ASP A N    1  
ATOM 372   C CA   . ASP A 1 24  ? -11.010 -18.415 6.047   1.00 0.00 ? 24  ASP A CA   1  
ATOM 373   C C    . ASP A 1 24  ? -10.061 -18.974 4.991   1.00 0.00 ? 24  ASP A C    1  
ATOM 374   O O    . ASP A 1 24  ? -9.944  -20.188 4.828   1.00 0.00 ? 24  ASP A O    1  
ATOM 375   C CB   . ASP A 1 24  ? -12.173 -19.385 6.266   1.00 0.00 ? 24  ASP A CB   1  
ATOM 376   C CG   . ASP A 1 24  ? -13.155 -18.887 7.308   1.00 0.00 ? 24  ASP A CG   1  
ATOM 377   O OD1  . ASP A 1 24  ? -13.311 -17.654 7.435   1.00 0.00 ? 24  ASP A OD1  1  
ATOM 378   O OD2  . ASP A 1 24  ? -13.768 -19.729 7.996   1.00 0.00 ? 24  ASP A OD2  1  
ATOM 379   H H    . ASP A 1 24  ? -11.977 -17.011 4.794   1.00 0.00 ? 24  ASP A H    1  
ATOM 380   H HA   . ASP A 1 24  ? -10.470 -18.298 6.974   1.00 0.00 ? 24  ASP A HA   1  
ATOM 381   H HB2  . ASP A 1 24  ? -12.702 -19.518 5.334   1.00 0.00 ? 24  ASP A HB2  1  
ATOM 382   H HB3  . ASP A 1 24  ? -11.782 -20.338 6.592   1.00 0.00 ? 24  ASP A HB3  1  
ATOM 383   N N    . GLY A 1 25  ? -9.385  -18.080 4.275   1.00 0.00 ? 25  GLY A N    1  
ATOM 384   C CA   . GLY A 1 25  ? -8.456  -18.503 3.244   1.00 0.00 ? 25  GLY A CA   1  
ATOM 385   C C    . GLY A 1 25  ? -9.154  -19.167 2.073   1.00 0.00 ? 25  GLY A C    1  
ATOM 386   O O    . GLY A 1 25  ? -9.626  -20.299 2.183   1.00 0.00 ? 25  GLY A O    1  
ATOM 387   H H    . GLY A 1 25  ? -9.519  -17.125 4.449   1.00 0.00 ? 25  GLY A H    1  
ATOM 388   H HA2  . GLY A 1 25  ? -7.916  -17.641 2.885   1.00 0.00 ? 25  GLY A HA2  1  
ATOM 389   H HA3  . GLY A 1 25  ? -7.753  -19.202 3.673   1.00 0.00 ? 25  GLY A HA3  1  
ATOM 390   N N    . HIS A 1 26  ? -9.219  -18.462 0.949   1.00 0.00 ? 26  HIS A N    1  
ATOM 391   C CA   . HIS A 1 26  ? -9.865  -18.989 -0.248  1.00 0.00 ? 26  HIS A CA   1  
ATOM 392   C C    . HIS A 1 26  ? -8.962  -18.835 -1.468  1.00 0.00 ? 26  HIS A C    1  
ATOM 393   O O    . HIS A 1 26  ? -8.693  -19.802 -2.180  1.00 0.00 ? 26  HIS A O    1  
ATOM 394   C CB   . HIS A 1 26  ? -11.196 -18.275 -0.493  1.00 0.00 ? 26  HIS A CB   1  
ATOM 395   C CG   . HIS A 1 26  ? -12.136 -19.045 -1.367  1.00 0.00 ? 26  HIS A CG   1  
ATOM 396   N ND1  . HIS A 1 26  ? -11.815 -20.264 -1.928  1.00 0.00 ? 26  HIS A ND1  1  
ATOM 397   C CD2  . HIS A 1 26  ? -13.396 -18.765 -1.777  1.00 0.00 ? 26  HIS A CD2  1  
ATOM 398   C CE1  . HIS A 1 26  ? -12.835 -20.699 -2.646  1.00 0.00 ? 26  HIS A CE1  1  
ATOM 399   N NE2  . HIS A 1 26  ? -13.807 -19.809 -2.570  1.00 0.00 ? 26  HIS A NE2  1  
ATOM 400   H H    . HIS A 1 26  ? -8.824  -17.565 0.922   1.00 0.00 ? 26  HIS A H    1  
ATOM 401   H HA   . HIS A 1 26  ? -10.055 -20.040 -0.087  1.00 0.00 ? 26  HIS A HA   1  
ATOM 402   H HB2  . HIS A 1 26  ? -11.686 -18.108 0.456   1.00 0.00 ? 26  HIS A HB2  1  
ATOM 403   H HB3  . HIS A 1 26  ? -11.005 -17.324 -0.965  1.00 0.00 ? 26  HIS A HB3  1  
ATOM 404   H HD1  . HIS A 1 26  ? -10.964 -20.738 -1.817  1.00 0.00 ? 26  HIS A HD1  1  
ATOM 405   H HD2  . HIS A 1 26  ? -13.970 -17.884 -1.528  1.00 0.00 ? 26  HIS A HD2  1  
ATOM 406   H HE1  . HIS A 1 26  ? -12.869 -21.625 -3.199  1.00 0.00 ? 26  HIS A HE1  1  
ATOM 407   H HE2  . HIS A 1 26  ? -14.708 -19.923 -2.937  1.00 0.00 ? 26  HIS A HE2  1  
ATOM 408   N N    . SER A 1 27  ? -8.496  -17.612 -1.702  1.00 0.00 ? 27  SER A N    1  
ATOM 409   C CA   . SER A 1 27  ? -7.623  -17.332 -2.836  1.00 0.00 ? 27  SER A CA   1  
ATOM 410   C C    . SER A 1 27  ? -6.750  -16.113 -2.559  1.00 0.00 ? 27  SER A C    1  
ATOM 411   O O    . SER A 1 27  ? -6.788  -15.544 -1.469  1.00 0.00 ? 27  SER A O    1  
ATOM 412   C CB   . SER A 1 27  ? -8.453  -17.104 -4.101  1.00 0.00 ? 27  SER A CB   1  
ATOM 413   O OG   . SER A 1 27  ? -9.319  -18.198 -4.347  1.00 0.00 ? 27  SER A OG   1  
ATOM 414   H H    . SER A 1 27  ? -8.746  -16.882 -1.099  1.00 0.00 ? 27  SER A H    1  
ATOM 415   H HA   . SER A 1 27  ? -6.986  -18.190 -2.984  1.00 0.00 ? 27  SER A HA   1  
ATOM 416   H HB2  . SER A 1 27  ? -9.047  -16.211 -3.983  1.00 0.00 ? 27  SER A HB2  1  
ATOM 417   H HB3  . SER A 1 27  ? -7.791  -16.986 -4.946  1.00 0.00 ? 27  SER A HB3  1  
ATOM 418   H HG   . SER A 1 27  ? -8.805  -19.008 -4.395  1.00 0.00 ? 27  SER A HG   1  
ATOM 419   N N    . VAL A 1 28  ? -5.962  -15.717 -3.555  1.00 0.00 ? 28  VAL A N    1  
ATOM 420   C CA   . VAL A 1 28  ? -5.080  -14.564 -3.417  1.00 0.00 ? 28  VAL A CA   1  
ATOM 421   C C    . VAL A 1 28  ? -5.654  -13.338 -4.119  1.00 0.00 ? 28  VAL A C    1  
ATOM 422   O O    . VAL A 1 28  ? -4.921  -12.415 -4.474  1.00 0.00 ? 28  VAL A O    1  
ATOM 423   C CB   . VAL A 1 28  ? -3.679  -14.859 -3.984  1.00 0.00 ? 28  VAL A CB   1  
ATOM 424   C CG1  . VAL A 1 28  ? -2.916  -15.798 -3.063  1.00 0.00 ? 28  VAL A CG1  1  
ATOM 425   C CG2  . VAL A 1 28  ? -3.782  -15.441 -5.386  1.00 0.00 ? 28  VAL A CG2  1  
ATOM 426   H H    . VAL A 1 28  ? -5.976  -16.210 -4.401  1.00 0.00 ? 28  VAL A H    1  
ATOM 427   H HA   . VAL A 1 28  ? -4.979  -14.347 -2.363  1.00 0.00 ? 28  VAL A HA   1  
ATOM 428   H HB   . VAL A 1 28  ? -3.134  -13.929 -4.043  1.00 0.00 ? 28  VAL A HB   1  
ATOM 429   H HG11 . VAL A 1 28  ? -1.880  -15.496 -3.018  1.00 0.00 ? 28  VAL A HG11 1  
ATOM 430   H HG12 . VAL A 1 28  ? -2.981  -16.807 -3.444  1.00 0.00 ? 28  VAL A HG12 1  
ATOM 431   H HG13 . VAL A 1 28  ? -3.346  -15.759 -2.073  1.00 0.00 ? 28  VAL A HG13 1  
ATOM 432   H HG21 . VAL A 1 28  ? -2.798  -15.487 -5.829  1.00 0.00 ? 28  VAL A HG21 1  
ATOM 433   H HG22 . VAL A 1 28  ? -4.419  -14.814 -5.990  1.00 0.00 ? 28  VAL A HG22 1  
ATOM 434   H HG23 . VAL A 1 28  ? -4.200  -16.435 -5.333  1.00 0.00 ? 28  VAL A HG23 1  
ATOM 435   N N    . THR A 1 29  ? -6.969  -13.333 -4.315  1.00 0.00 ? 29  THR A N    1  
ATOM 436   C CA   . THR A 1 29  ? -7.640  -12.218 -4.972  1.00 0.00 ? 29  THR A CA   1  
ATOM 437   C C    . THR A 1 29  ? -8.835  -11.745 -4.149  1.00 0.00 ? 29  THR A C    1  
ATOM 438   O O    . THR A 1 29  ? -9.034  -12.185 -3.016  1.00 0.00 ? 29  THR A O    1  
ATOM 439   C CB   . THR A 1 29  ? -8.087  -12.620 -6.377  1.00 0.00 ? 29  THR A CB   1  
ATOM 440   O OG1  . THR A 1 29  ? -8.489  -13.979 -6.407  1.00 0.00 ? 29  THR A OG1  1  
ATOM 441   C CG2  . THR A 1 29  ? -7.007  -12.435 -7.421  1.00 0.00 ? 29  THR A CG2  1  
ATOM 442   H H    . THR A 1 29  ? -7.503  -14.095 -4.009  1.00 0.00 ? 29  THR A H    1  
ATOM 443   H HA   . THR A 1 29  ? -6.934  -11.406 -5.052  1.00 0.00 ? 29  THR A HA   1  
ATOM 444   H HB   . THR A 1 29  ? -8.930  -12.011 -6.664  1.00 0.00 ? 29  THR A HB   1  
ATOM 445   H HG1  . THR A 1 29  ? -8.762  -14.212 -7.297  1.00 0.00 ? 29  THR A HG1  1  
ATOM 446   H HG21 . THR A 1 29  ? -7.427  -12.580 -8.405  1.00 0.00 ? 29  THR A HG21 1  
ATOM 447   H HG22 . THR A 1 29  ? -6.220  -13.156 -7.256  1.00 0.00 ? 29  THR A HG22 1  
ATOM 448   H HG23 . THR A 1 29  ? -6.600  -11.436 -7.347  1.00 0.00 ? 29  THR A HG23 1  
ATOM 449   N N    . LEU A 1 30  ? -9.622  -10.841 -4.720  1.00 0.00 ? 30  LEU A N    1  
ATOM 450   C CA   . LEU A 1 30  ? -10.792 -10.301 -4.034  1.00 0.00 ? 30  LEU A CA   1  
ATOM 451   C C    . LEU A 1 30  ? -11.953 -10.082 -5.020  1.00 0.00 ? 30  LEU A C    1  
ATOM 452   O O    . LEU A 1 30  ? -12.392 -11.024 -5.675  1.00 0.00 ? 30  LEU A O    1  
ATOM 453   C CB   . LEU A 1 30  ? -10.408 -8.997  -3.317  1.00 0.00 ? 30  LEU A CB   1  
ATOM 454   C CG   . LEU A 1 30  ? -11.239 -8.651  -2.077  1.00 0.00 ? 30  LEU A CG   1  
ATOM 455   C CD1  . LEU A 1 30  ? -11.060 -7.187  -1.717  1.00 0.00 ? 30  LEU A CD1  1  
ATOM 456   C CD2  . LEU A 1 30  ? -12.711 -8.975  -2.293  1.00 0.00 ? 30  LEU A CD2  1  
ATOM 457   H H    . LEU A 1 30  ? -9.409  -10.525 -5.621  1.00 0.00 ? 30  LEU A H    1  
ATOM 458   H HA   . LEU A 1 30  ? -11.102 -11.026 -3.296  1.00 0.00 ? 30  LEU A HA   1  
ATOM 459   H HB2  . LEU A 1 30  ? -9.376  -9.075  -3.015  1.00 0.00 ? 30  LEU A HB2  1  
ATOM 460   H HB3  . LEU A 1 30  ? -10.493 -8.184  -4.020  1.00 0.00 ? 30  LEU A HB3  1  
ATOM 461   H HG   . LEU A 1 30  ? -10.885 -9.236  -1.244  1.00 0.00 ? 30  LEU A HG   1  
ATOM 462   H HD11 . LEU A 1 30  ? -10.943 -6.605  -2.620  1.00 0.00 ? 30  LEU A HD11 1  
ATOM 463   H HD12 . LEU A 1 30  ? -10.180 -7.076  -1.100  1.00 0.00 ? 30  LEU A HD12 1  
ATOM 464   H HD13 . LEU A 1 30  ? -11.927 -6.841  -1.174  1.00 0.00 ? 30  LEU A HD13 1  
ATOM 465   H HD21 . LEU A 1 30  ? -12.805 -9.970  -2.700  1.00 0.00 ? 30  LEU A HD21 1  
ATOM 466   H HD22 . LEU A 1 30  ? -13.140 -8.262  -2.979  1.00 0.00 ? 30  LEU A HD22 1  
ATOM 467   H HD23 . LEU A 1 30  ? -13.232 -8.925  -1.349  1.00 0.00 ? 30  LEU A HD23 1  
ATOM 468   N N    . SER A 1 31  ? -12.447 -8.843  -5.127  1.00 0.00 ? 31  SER A N    1  
ATOM 469   C CA   . SER A 1 31  ? -13.542 -8.527  -6.033  1.00 0.00 ? 31  SER A CA   1  
ATOM 470   C C    . SER A 1 31  ? -13.764 -7.017  -6.083  1.00 0.00 ? 31  SER A C    1  
ATOM 471   O O    . SER A 1 31  ? -13.846 -6.359  -5.046  1.00 0.00 ? 31  SER A O    1  
ATOM 472   C CB   . SER A 1 31  ? -14.823 -9.247  -5.594  1.00 0.00 ? 31  SER A CB   1  
ATOM 473   O OG   . SER A 1 31  ? -15.959 -8.405  -5.710  1.00 0.00 ? 31  SER A OG   1  
ATOM 474   H H    . SER A 1 31  ? -12.068 -8.124  -4.587  1.00 0.00 ? 31  SER A H    1  
ATOM 475   H HA   . SER A 1 31  ? -13.264 -8.870  -7.019  1.00 0.00 ? 31  SER A HA   1  
ATOM 476   H HB2  . SER A 1 31  ? -14.974 -10.116 -6.214  1.00 0.00 ? 31  SER A HB2  1  
ATOM 477   H HB3  . SER A 1 31  ? -14.723 -9.555  -4.564  1.00 0.00 ? 31  SER A HB3  1  
ATOM 478   H HG   . SER A 1 31  ? -16.180 -8.292  -6.637  1.00 0.00 ? 31  SER A HG   1  
ATOM 479   N N    . LYS A 1 32  ? -13.851 -6.472  -7.292  1.00 0.00 ? 32  LYS A N    1  
ATOM 480   C CA   . LYS A 1 32  ? -14.051 -5.036  -7.475  1.00 0.00 ? 32  LYS A CA   1  
ATOM 481   C C    . LYS A 1 32  ? -15.216 -4.530  -6.624  1.00 0.00 ? 32  LYS A C    1  
ATOM 482   O O    . LYS A 1 32  ? -15.142 -3.457  -6.025  1.00 0.00 ? 32  LYS A O    1  
ATOM 483   C CB   . LYS A 1 32  ? -14.314 -4.722  -8.949  1.00 0.00 ? 32  LYS A CB   1  
ATOM 484   C CG   . LYS A 1 32  ? -13.205 -5.186  -9.878  1.00 0.00 ? 32  LYS A CG   1  
ATOM 485   C CD   . LYS A 1 32  ? -13.516 -4.851  -11.328 1.00 0.00 ? 32  LYS A CD   1  
ATOM 486   C CE   . LYS A 1 32  ? -14.800 -5.519  -11.792 1.00 0.00 ? 32  LYS A CE   1  
ATOM 487   N NZ   . LYS A 1 32  ? -14.691 -6.023  -13.188 1.00 0.00 ? 32  LYS A NZ   1  
ATOM 488   H H    . LYS A 1 32  ? -13.771 -7.046  -8.082  1.00 0.00 ? 32  LYS A H    1  
ATOM 489   H HA   . LYS A 1 32  ? -13.144 -4.533  -7.166  1.00 0.00 ? 32  LYS A HA   1  
ATOM 490   H HB2  . LYS A 1 32  ? -15.232 -5.204  -9.250  1.00 0.00 ? 32  LYS A HB2  1  
ATOM 491   H HB3  . LYS A 1 32  ? -14.425 -3.653  -9.063  1.00 0.00 ? 32  LYS A HB3  1  
ATOM 492   H HG2  . LYS A 1 32  ? -12.284 -4.700  -9.597  1.00 0.00 ? 32  LYS A HG2  1  
ATOM 493   H HG3  . LYS A 1 32  ? -13.093 -6.256  -9.783  1.00 0.00 ? 32  LYS A HG3  1  
ATOM 494   H HD2  . LYS A 1 32  ? -13.625 -3.781  -11.423 1.00 0.00 ? 32  LYS A HD2  1  
ATOM 495   H HD3  . LYS A 1 32  ? -12.699 -5.189  -11.949 1.00 0.00 ? 32  LYS A HD3  1  
ATOM 496   H HE2  . LYS A 1 32  ? -15.017 -6.349  -11.135 1.00 0.00 ? 32  LYS A HE2  1  
ATOM 497   H HE3  . LYS A 1 32  ? -15.605 -4.800  -11.739 1.00 0.00 ? 32  LYS A HE3  1  
ATOM 498   H HZ1  . LYS A 1 32  ? -14.330 -5.273  -13.812 1.00 0.00 ? 32  LYS A HZ1  1  
ATOM 499   H HZ2  . LYS A 1 32  ? -15.625 -6.325  -13.533 1.00 0.00 ? 32  LYS A HZ2  1  
ATOM 500   H HZ3  . LYS A 1 32  ? -14.041 -6.834  -13.226 1.00 0.00 ? 32  LYS A HZ3  1  
ATOM 501   N N    . THR A 1 33  ? -16.292 -5.311  -6.581  1.00 0.00 ? 33  THR A N    1  
ATOM 502   C CA   . THR A 1 33  ? -17.475 -4.953  -5.813  1.00 0.00 ? 33  THR A CA   1  
ATOM 503   C C    . THR A 1 33  ? -17.232 -5.137  -4.316  1.00 0.00 ? 33  THR A C    1  
ATOM 504   O O    . THR A 1 33  ? -17.627 -4.302  -3.509  1.00 0.00 ? 33  THR A O    1  
ATOM 505   C CB   . THR A 1 33  ? -18.672 -5.791  -6.280  1.00 0.00 ? 33  THR A CB   1  
ATOM 506   O OG1  . THR A 1 33  ? -19.383 -5.119  -7.303  1.00 0.00 ? 33  THR A OG1  1  
ATOM 507   C CG2  . THR A 1 33  ? -19.661 -6.119  -5.181  1.00 0.00 ? 33  THR A CG2  1  
ATOM 508   H H    . THR A 1 33  ? -16.290 -6.150  -7.078  1.00 0.00 ? 33  THR A H    1  
ATOM 509   H HA   . THR A 1 33  ? -17.685 -3.910  -6.002  1.00 0.00 ? 33  THR A HA   1  
ATOM 510   H HB   . THR A 1 33  ? -18.304 -6.723  -6.682  1.00 0.00 ? 33  THR A HB   1  
ATOM 511   H HG1  . THR A 1 33  ? -18.763 -4.780  -7.954  1.00 0.00 ? 33  THR A HG1  1  
ATOM 512   H HG21 . THR A 1 33  ? -19.170 -6.710  -4.422  1.00 0.00 ? 33  THR A HG21 1  
ATOM 513   H HG22 . THR A 1 33  ? -20.487 -6.679  -5.595  1.00 0.00 ? 33  THR A HG22 1  
ATOM 514   H HG23 . THR A 1 33  ? -20.030 -5.204  -4.742  1.00 0.00 ? 33  THR A HG23 1  
ATOM 515   N N    . GLU A 1 34  ? -16.574 -6.229  -3.945  1.00 0.00 ? 34  GLU A N    1  
ATOM 516   C CA   . GLU A 1 34  ? -16.289 -6.486  -2.538  1.00 0.00 ? 34  GLU A CA   1  
ATOM 517   C C    . GLU A 1 34  ? -15.527 -5.310  -1.933  1.00 0.00 ? 34  GLU A C    1  
ATOM 518   O O    . GLU A 1 34  ? -15.641 -5.024  -0.742  1.00 0.00 ? 34  GLU A O    1  
ATOM 519   C CB   . GLU A 1 34  ? -15.491 -7.779  -2.379  1.00 0.00 ? 34  GLU A CB   1  
ATOM 520   C CG   . GLU A 1 34  ? -16.315 -8.923  -1.813  1.00 0.00 ? 34  GLU A CG   1  
ATOM 521   C CD   . GLU A 1 34  ? -16.555 -10.026 -2.827  1.00 0.00 ? 34  GLU A CD   1  
ATOM 522   O OE1  . GLU A 1 34  ? -15.674 -10.899 -2.976  1.00 0.00 ? 34  GLU A OE1  1  
ATOM 523   O OE2  . GLU A 1 34  ? -17.627 -10.018 -3.469  1.00 0.00 ? 34  GLU A OE2  1  
ATOM 524   H H    . GLU A 1 34  ? -16.273 -6.868  -4.624  1.00 0.00 ? 34  GLU A H    1  
ATOM 525   H HA   . GLU A 1 34  ? -17.232 -6.589  -2.023  1.00 0.00 ? 34  GLU A HA   1  
ATOM 526   H HB2  . GLU A 1 34  ? -15.111 -8.076  -3.344  1.00 0.00 ? 34  GLU A HB2  1  
ATOM 527   H HB3  . GLU A 1 34  ? -14.660 -7.597  -1.714  1.00 0.00 ? 34  GLU A HB3  1  
ATOM 528   H HG2  . GLU A 1 34  ? -15.794 -9.342  -0.966  1.00 0.00 ? 34  GLU A HG2  1  
ATOM 529   H HG3  . GLU A 1 34  ? -17.270 -8.534  -1.492  1.00 0.00 ? 34  GLU A HG3  1  
ATOM 530   N N    . PHE A 1 35  ? -14.768 -4.624  -2.779  1.00 0.00 ? 35  PHE A N    1  
ATOM 531   C CA   . PHE A 1 35  ? -13.998 -3.462  -2.358  1.00 0.00 ? 35  PHE A CA   1  
ATOM 532   C C    . PHE A 1 35  ? -14.935 -2.302  -2.031  1.00 0.00 ? 35  PHE A C    1  
ATOM 533   O O    . PHE A 1 35  ? -14.651 -1.476  -1.165  1.00 0.00 ? 35  PHE A O    1  
ATOM 534   C CB   . PHE A 1 35  ? -13.038 -3.049  -3.475  1.00 0.00 ? 35  PHE A CB   1  
ATOM 535   C CG   . PHE A 1 35  ? -11.708 -2.546  -2.993  1.00 0.00 ? 35  PHE A CG   1  
ATOM 536   C CD1  . PHE A 1 35  ? -11.607 -1.778  -1.844  1.00 0.00 ? 35  PHE A CD1  1  
ATOM 537   C CD2  . PHE A 1 35  ? -10.558 -2.839  -3.703  1.00 0.00 ? 35  PHE A CD2  1  
ATOM 538   C CE1  . PHE A 1 35  ? -10.379 -1.312  -1.413  1.00 0.00 ? 35  PHE A CE1  1  
ATOM 539   C CE2  . PHE A 1 35  ? -9.331  -2.378  -3.277  1.00 0.00 ? 35  PHE A CE2  1  
ATOM 540   C CZ   . PHE A 1 35  ? -9.239  -1.613  -2.132  1.00 0.00 ? 35  PHE A CZ   1  
ATOM 541   H H    . PHE A 1 35  ? -14.736 -4.898  -3.719  1.00 0.00 ? 35  PHE A H    1  
ATOM 542   H HA   . PHE A 1 35  ? -13.434 -3.726  -1.477  1.00 0.00 ? 35  PHE A HA   1  
ATOM 543   H HB2  . PHE A 1 35  ? -12.854 -3.902  -4.112  1.00 0.00 ? 35  PHE A HB2  1  
ATOM 544   H HB3  . PHE A 1 35  ? -13.497 -2.266  -4.060  1.00 0.00 ? 35  PHE A HB3  1  
ATOM 545   H HD1  . PHE A 1 35  ? -12.497 -1.543  -1.283  1.00 0.00 ? 35  PHE A HD1  1  
ATOM 546   H HD2  . PHE A 1 35  ? -10.626 -3.437  -4.599  1.00 0.00 ? 35  PHE A HD2  1  
ATOM 547   H HE1  . PHE A 1 35  ? -10.312 -0.714  -0.516  1.00 0.00 ? 35  PHE A HE1  1  
ATOM 548   H HE2  . PHE A 1 35  ? -8.444  -2.613  -3.842  1.00 0.00 ? 35  PHE A HE2  1  
ATOM 549   H HZ   . PHE A 1 35  ? -8.278  -1.251  -1.798  1.00 0.00 ? 35  PHE A HZ   1  
ATOM 550   N N    . LEU A 1 36  ? -16.055 -2.253  -2.746  1.00 0.00 ? 36  LEU A N    1  
ATOM 551   C CA   . LEU A 1 36  ? -17.048 -1.201  -2.560  1.00 0.00 ? 36  LEU A CA   1  
ATOM 552   C C    . LEU A 1 36  ? -17.472 -1.080  -1.114  1.00 0.00 ? 36  LEU A C    1  
ATOM 553   O O    . LEU A 1 36  ? -17.359 -0.020  -0.497  1.00 0.00 ? 36  LEU A O    1  
ATOM 554   C CB   . LEU A 1 36  ? -18.294 -1.519  -3.384  1.00 0.00 ? 36  LEU A CB   1  
ATOM 555   C CG   . LEU A 1 36  ? -18.359 -0.841  -4.732  1.00 0.00 ? 36  LEU A CG   1  
ATOM 556   C CD1  . LEU A 1 36  ? -18.456 0.663   -4.541  1.00 0.00 ? 36  LEU A CD1  1  
ATOM 557   C CD2  . LEU A 1 36  ? -17.145 -1.217  -5.564  1.00 0.00 ? 36  LEU A CD2  1  
ATOM 558   H H    . LEU A 1 36  ? -16.215 -2.941  -3.424  1.00 0.00 ? 36  LEU A H    1  
ATOM 559   H HA   . LEU A 1 36  ? -16.630 -0.266  -2.895  1.00 0.00 ? 36  LEU A HA   1  
ATOM 560   H HB2  . LEU A 1 36  ? -18.338 -2.583  -3.538  1.00 0.00 ? 36  LEU A HB2  1  
ATOM 561   H HB3  . LEU A 1 36  ? -19.163 -1.221  -2.817  1.00 0.00 ? 36  LEU A HB3  1  
ATOM 562   H HG   . LEU A 1 36  ? -19.242 -1.178  -5.247  1.00 0.00 ? 36  LEU A HG   1  
ATOM 563   H HD11 . LEU A 1 36  ? -18.621 0.877   -3.492  1.00 0.00 ? 36  LEU A HD11 1  
ATOM 564   H HD12 . LEU A 1 36  ? -19.280 1.048   -5.121  1.00 0.00 ? 36  LEU A HD12 1  
ATOM 565   H HD13 . LEU A 1 36  ? -17.537 1.129   -4.863  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 566   H HD21 . LEU A 1 36  ? -16.745 -0.336  -6.042  1.00 0.00 ? 36  LEU A HD21 1  
ATOM 567   H HD22 . LEU A 1 36  ? -17.435 -1.938  -6.315  1.00 0.00 ? 36  LEU A HD22 1  
ATOM 568   H HD23 . LEU A 1 36  ? -16.394 -1.653  -4.922  1.00 0.00 ? 36  LEU A HD23 1  
ATOM 569   N N    . SER A 1 37  ? -17.995 -2.174  -0.602  1.00 0.00 ? 37  SER A N    1  
ATOM 570   C CA   . SER A 1 37  ? -18.489 -2.212  0.760   1.00 0.00 ? 37  SER A CA   1  
ATOM 571   C C    . SER A 1 37  ? -17.393 -1.884  1.772   1.00 0.00 ? 37  SER A C    1  
ATOM 572   O O    . SER A 1 37  ? -17.629 -1.161  2.740   1.00 0.00 ? 37  SER A O    1  
ATOM 573   C CB   . SER A 1 37  ? -19.096 -3.581  1.069   1.00 0.00 ? 37  SER A CB   1  
ATOM 574   O OG   . SER A 1 37  ? -18.325 -4.622  0.493   1.00 0.00 ? 37  SER A OG   1  
ATOM 575   H H    . SER A 1 37  ? -18.077 -2.969  -1.172  1.00 0.00 ? 37  SER A H    1  
ATOM 576   H HA   . SER A 1 37  ? -19.265 -1.464  0.828   1.00 0.00 ? 37  SER A HA   1  
ATOM 577   H HB2  . SER A 1 37  ? -19.130 -3.724  2.139   1.00 0.00 ? 37  SER A HB2  1  
ATOM 578   H HB3  . SER A 1 37  ? -20.098 -3.627  0.668   1.00 0.00 ? 37  SER A HB3  1  
ATOM 579   H HG   . SER A 1 37  ? -18.819 -5.026  -0.224  1.00 0.00 ? 37  SER A HG   1  
ATOM 580   N N    . PHE A 1 38  ? -16.198 -2.424  1.550   1.00 0.00 ? 38  PHE A N    1  
ATOM 581   C CA   . PHE A 1 38  ? -15.076 -2.189  2.455   1.00 0.00 ? 38  PHE A CA   1  
ATOM 582   C C    . PHE A 1 38  ? -14.774 -0.702  2.589   1.00 0.00 ? 38  PHE A C    1  
ATOM 583   O O    . PHE A 1 38  ? -14.590 -0.192  3.694   1.00 0.00 ? 38  PHE A O    1  
ATOM 584   C CB   . PHE A 1 38  ? -13.826 -2.921  1.967   1.00 0.00 ? 38  PHE A CB   1  
ATOM 585   C CG   . PHE A 1 38  ? -12.660 -2.796  2.907   1.00 0.00 ? 38  PHE A CG   1  
ATOM 586   C CD1  . PHE A 1 38  ? -12.573 -3.597  4.034   1.00 0.00 ? 38  PHE A CD1  1  
ATOM 587   C CD2  . PHE A 1 38  ? -11.653 -1.876  2.665   1.00 0.00 ? 38  PHE A CD2  1  
ATOM 588   C CE1  . PHE A 1 38  ? -11.504 -3.483  4.902   1.00 0.00 ? 38  PHE A CE1  1  
ATOM 589   C CE2  . PHE A 1 38  ? -10.580 -1.757  3.528   1.00 0.00 ? 38  PHE A CE2  1  
ATOM 590   C CZ   . PHE A 1 38  ? -10.506 -2.563  4.648   1.00 0.00 ? 38  PHE A CZ   1  
ATOM 591   H H    . PHE A 1 38  ? -16.069 -2.997  0.766   1.00 0.00 ? 38  PHE A H    1  
ATOM 592   H HA   . PHE A 1 38  ? -15.348 -2.577  3.424   1.00 0.00 ? 38  PHE A HA   1  
ATOM 593   H HB2  . PHE A 1 38  ? -14.052 -3.970  1.852   1.00 0.00 ? 38  PHE A HB2  1  
ATOM 594   H HB3  . PHE A 1 38  ? -13.529 -2.514  1.011   1.00 0.00 ? 38  PHE A HB3  1  
ATOM 595   H HD1  . PHE A 1 38  ? -13.354 -4.315  4.236   1.00 0.00 ? 38  PHE A HD1  1  
ATOM 596   H HD2  . PHE A 1 38  ? -11.710 -1.247  1.789   1.00 0.00 ? 38  PHE A HD2  1  
ATOM 597   H HE1  . PHE A 1 38  ? -11.448 -4.113  5.777   1.00 0.00 ? 38  PHE A HE1  1  
ATOM 598   H HE2  . PHE A 1 38  ? -9.802  -1.038  3.327   1.00 0.00 ? 38  PHE A HE2  1  
ATOM 599   H HZ   . PHE A 1 38  ? -9.669  -2.472  5.325   1.00 0.00 ? 38  PHE A HZ   1  
ATOM 600   N N    . MET A 1 39  ? -14.713 -0.012  1.458   1.00 0.00 ? 39  MET A N    1  
ATOM 601   C CA   . MET A 1 39  ? -14.422 1.416   1.451   1.00 0.00 ? 39  MET A CA   1  
ATOM 602   C C    . MET A 1 39  ? -15.467 2.196   2.245   1.00 0.00 ? 39  MET A C    1  
ATOM 603   O O    . MET A 1 39  ? -15.130 3.023   3.091   1.00 0.00 ? 39  MET A O    1  
ATOM 604   C CB   . MET A 1 39  ? -14.364 1.937   0.013   1.00 0.00 ? 39  MET A CB   1  
ATOM 605   C CG   . MET A 1 39  ? -14.062 3.425   -0.083  1.00 0.00 ? 39  MET A CG   1  
ATOM 606   S SD   . MET A 1 39  ? -12.488 3.767   -0.894  1.00 0.00 ? 39  MET A SD   1  
ATOM 607   C CE   . MET A 1 39  ? -11.349 2.962   0.230   1.00 0.00 ? 39  MET A CE   1  
ATOM 608   H H    . MET A 1 39  ? -14.861 -0.474  0.607   1.00 0.00 ? 39  MET A H    1  
ATOM 609   H HA   . MET A 1 39  ? -13.458 1.556   1.912   1.00 0.00 ? 39  MET A HA   1  
ATOM 610   H HB2  . MET A 1 39  ? -13.597 1.398   -0.522  1.00 0.00 ? 39  MET A HB2  1  
ATOM 611   H HB3  . MET A 1 39  ? -15.317 1.754   -0.462  1.00 0.00 ? 39  MET A HB3  1  
ATOM 612   H HG2  . MET A 1 39  ? -14.850 3.902   -0.646  1.00 0.00 ? 39  MET A HG2  1  
ATOM 613   H HG3  . MET A 1 39  ? -14.035 3.837   0.914   1.00 0.00 ? 39  MET A HG3  1  
ATOM 614   H HE1  . MET A 1 39  ? -10.506 3.609   0.416   1.00 0.00 ? 39  MET A HE1  1  
ATOM 615   H HE2  . MET A 1 39  ? -11.004 2.038   -0.209  1.00 0.00 ? 39  MET A HE2  1  
ATOM 616   H HE3  . MET A 1 39  ? -11.853 2.751   1.161   1.00 0.00 ? 39  MET A HE3  1  
ATOM 617   N N    . ASN A 1 40  ? -16.734 1.937   1.950   1.00 0.00 ? 40  ASN A N    1  
ATOM 618   C CA   . ASN A 1 40  ? -17.838 2.621   2.616   1.00 0.00 ? 40  ASN A CA   1  
ATOM 619   C C    . ASN A 1 40  ? -18.039 2.143   4.056   1.00 0.00 ? 40  ASN A C    1  
ATOM 620   O O    . ASN A 1 40  ? -18.683 2.826   4.853   1.00 0.00 ? 40  ASN A O    1  
ATOM 621   C CB   . ASN A 1 40  ? -19.130 2.421   1.821   1.00 0.00 ? 40  ASN A CB   1  
ATOM 622   C CG   . ASN A 1 40  ? -19.045 3.003   0.424   1.00 0.00 ? 40  ASN A CG   1  
ATOM 623   O OD1  . ASN A 1 40  ? -18.947 4.217   0.249   1.00 0.00 ? 40  ASN A OD1  1  
ATOM 624   N ND2  . ASN A 1 40  ? -19.081 2.136   -0.584  1.00 0.00 ? 40  ASN A ND2  1  
ATOM 625   H H    . ASN A 1 40  ? -16.936 1.275   1.257   1.00 0.00 ? 40  ASN A H    1  
ATOM 626   H HA   . ASN A 1 40  ? -17.606 3.675   2.634   1.00 0.00 ? 40  ASN A HA   1  
ATOM 627   H HB2  . ASN A 1 40  ? -19.335 1.365   1.739   1.00 0.00 ? 40  ASN A HB2  1  
ATOM 628   H HB3  . ASN A 1 40  ? -19.945 2.902   2.343   1.00 0.00 ? 40  ASN A HB3  1  
ATOM 629   H HD21 . ASN A 1 40  ? -19.161 1.179   -0.369  1.00 0.00 ? 40  ASN A HD21 1  
ATOM 630   H HD22 . ASN A 1 40  ? -19.028 2.489   -1.501  1.00 0.00 ? 40  ASN A HD22 1  
ATOM 631   N N    . THR A 1 41  ? -17.519 0.963   4.384   1.00 0.00 ? 41  THR A N    1  
ATOM 632   C CA   . THR A 1 41  ? -17.689 0.411   5.730   1.00 0.00 ? 41  THR A CA   1  
ATOM 633   C C    . THR A 1 41  ? -16.473 0.638   6.622   1.00 0.00 ? 41  THR A C    1  
ATOM 634   O O    . THR A 1 41  ? -16.608 0.741   7.842   1.00 0.00 ? 41  THR A O    1  
ATOM 635   C CB   . THR A 1 41  ? -17.992 -1.088  5.656   1.00 0.00 ? 41  THR A CB   1  
ATOM 636   O OG1  . THR A 1 41  ? -18.478 -1.563  6.898   1.00 0.00 ? 41  THR A OG1  1  
ATOM 637   C CG2  . THR A 1 41  ? -16.797 -1.936  5.279   1.00 0.00 ? 41  THR A CG2  1  
ATOM 638   H H    . THR A 1 41  ? -17.033 0.445   3.710   1.00 0.00 ? 41  THR A H    1  
ATOM 639   H HA   . THR A 1 41  ? -18.537 0.908   6.176   1.00 0.00 ? 41  THR A HA   1  
ATOM 640   H HB   . THR A 1 41  ? -18.750 -1.252  4.914   1.00 0.00 ? 41  THR A HB   1  
ATOM 641   H HG1  . THR A 1 41  ? -17.774 -1.532  7.550   1.00 0.00 ? 41  THR A HG1  1  
ATOM 642   H HG21 . THR A 1 41  ? -15.967 -1.296  5.022   1.00 0.00 ? 41  THR A HG21 1  
ATOM 643   H HG22 . THR A 1 41  ? -17.049 -2.556  4.431   1.00 0.00 ? 41  THR A HG22 1  
ATOM 644   H HG23 . THR A 1 41  ? -16.522 -2.563  6.115   1.00 0.00 ? 41  THR A HG23 1  
ATOM 645   N N    . GLU A 1 42  ? -15.286 0.676   6.031   1.00 0.00 ? 42  GLU A N    1  
ATOM 646   C CA   . GLU A 1 42  ? -14.067 0.844   6.817   1.00 0.00 ? 42  GLU A CA   1  
ATOM 647   C C    . GLU A 1 42  ? -13.147 1.913   6.234   1.00 0.00 ? 42  GLU A C    1  
ATOM 648   O O    . GLU A 1 42  ? -11.941 1.906   6.482   1.00 0.00 ? 42  GLU A O    1  
ATOM 649   C CB   . GLU A 1 42  ? -13.326 -0.492  6.910   1.00 0.00 ? 42  GLU A CB   1  
ATOM 650   C CG   . GLU A 1 42  ? -14.240 -1.707  6.780   1.00 0.00 ? 42  GLU A CG   1  
ATOM 651   C CD   . GLU A 1 42  ? -13.779 -2.877  7.628   1.00 0.00 ? 42  GLU A CD   1  
ATOM 652   O OE1  . GLU A 1 42  ? -12.587 -3.241  7.539   1.00 0.00 ? 42  GLU A OE1  1  
ATOM 653   O OE2  . GLU A 1 42  ? -14.609 -3.429  8.380   1.00 0.00 ? 42  GLU A OE2  1  
ATOM 654   H H    . GLU A 1 42  ? -15.224 0.560   5.061   1.00 0.00 ? 42  GLU A H    1  
ATOM 655   H HA   . GLU A 1 42  ? -14.357 1.147   7.811   1.00 0.00 ? 42  GLU A HA   1  
ATOM 656   H HB2  . GLU A 1 42  ? -12.588 -0.538  6.123   1.00 0.00 ? 42  GLU A HB2  1  
ATOM 657   H HB3  . GLU A 1 42  ? -12.825 -0.547  7.866   1.00 0.00 ? 42  GLU A HB3  1  
ATOM 658   H HG2  . GLU A 1 42  ? -15.239 -1.428  7.089   1.00 0.00 ? 42  GLU A HG2  1  
ATOM 659   H HG3  . GLU A 1 42  ? -14.262 -2.016  5.745   1.00 0.00 ? 42  GLU A HG3  1  
ATOM 660   N N    . LEU A 1 43  ? -13.719 2.838   5.473   1.00 0.00 ? 43  LEU A N    1  
ATOM 661   C CA   . LEU A 1 43  ? -12.948 3.918   4.870   1.00 0.00 ? 43  LEU A CA   1  
ATOM 662   C C    . LEU A 1 43  ? -13.870 5.040   4.412   1.00 0.00 ? 43  LEU A C    1  
ATOM 663   O O    . LEU A 1 43  ? -13.823 5.471   3.259   1.00 0.00 ? 43  LEU A O    1  
ATOM 664   C CB   . LEU A 1 43  ? -12.118 3.397   3.692   1.00 0.00 ? 43  LEU A CB   1  
ATOM 665   C CG   . LEU A 1 43  ? -10.752 2.809   4.064   1.00 0.00 ? 43  LEU A CG   1  
ATOM 666   C CD1  . LEU A 1 43  ? -9.940  2.508   2.815   1.00 0.00 ? 43  LEU A CD1  1  
ATOM 667   C CD2  . LEU A 1 43  ? -9.990  3.757   4.979   1.00 0.00 ? 43  LEU A CD2  1  
ATOM 668   H H    . LEU A 1 43  ? -14.684 2.800   5.318   1.00 0.00 ? 43  LEU A H    1  
ATOM 669   H HA   . LEU A 1 43  ? -12.280 4.308   5.624   1.00 0.00 ? 43  LEU A HA   1  
ATOM 670   H HB2  . LEU A 1 43  ? -12.690 2.632   3.192   1.00 0.00 ? 43  LEU A HB2  1  
ATOM 671   H HB3  . LEU A 1 43  ? -11.958 4.212   3.003   1.00 0.00 ? 43  LEU A HB3  1  
ATOM 672   H HG   . LEU A 1 43  ? -10.899 1.879   4.593   1.00 0.00 ? 43  LEU A HG   1  
ATOM 673   H HD11 . LEU A 1 43  ? -9.809  3.415   2.244   1.00 0.00 ? 43  LEU A HD11 1  
ATOM 674   H HD12 . LEU A 1 43  ? -10.461 1.776   2.214   1.00 0.00 ? 43  LEU A HD12 1  
ATOM 675   H HD13 . LEU A 1 43  ? -8.974  2.119   3.098   1.00 0.00 ? 43  LEU A HD13 1  
ATOM 676   H HD21 . LEU A 1 43  ? -10.443 4.737   4.940   1.00 0.00 ? 43  LEU A HD21 1  
ATOM 677   H HD22 . LEU A 1 43  ? -8.961  3.824   4.655   1.00 0.00 ? 43  LEU A HD22 1  
ATOM 678   H HD23 . LEU A 1 43  ? -10.025 3.386   5.992   1.00 0.00 ? 43  LEU A HD23 1  
ATOM 679   N N    . ALA A 1 44  ? -14.707 5.512   5.330   1.00 0.00 ? 44  ALA A N    1  
ATOM 680   C CA   . ALA A 1 44  ? -15.641 6.588   5.032   1.00 0.00 ? 44  ALA A CA   1  
ATOM 681   C C    . ALA A 1 44  ? -14.913 7.922   4.968   1.00 0.00 ? 44  ALA A C    1  
ATOM 682   O O    . ALA A 1 44  ? -15.333 8.840   4.268   1.00 0.00 ? 44  ALA A O    1  
ATOM 683   C CB   . ALA A 1 44  ? -16.750 6.634   6.071   1.00 0.00 ? 44  ALA A CB   1  
ATOM 684   H H    . ALA A 1 44  ? -14.691 5.130   6.233   1.00 0.00 ? 44  ALA A H    1  
ATOM 685   H HA   . ALA A 1 44  ? -16.088 6.386   4.067   1.00 0.00 ? 44  ALA A HA   1  
ATOM 686   H HB1  . ALA A 1 44  ? -16.526 7.396   6.803   1.00 0.00 ? 44  ALA A HB1  1  
ATOM 687   H HB2  . ALA A 1 44  ? -16.824 5.675   6.561   1.00 0.00 ? 44  ALA A HB2  1  
ATOM 688   H HB3  . ALA A 1 44  ? -17.688 6.864   5.587   1.00 0.00 ? 44  ALA A HB3  1  
ATOM 689   N N    . ALA A 1 45  ? -13.806 8.016   5.694   1.00 0.00 ? 45  ALA A N    1  
ATOM 690   C CA   . ALA A 1 45  ? -13.006 9.231   5.708   1.00 0.00 ? 45  ALA A CA   1  
ATOM 691   C C    . ALA A 1 45  ? -12.493 9.552   4.305   1.00 0.00 ? 45  ALA A C    1  
ATOM 692   O O    . ALA A 1 45  ? -12.118 10.689  4.015   1.00 0.00 ? 45  ALA A O    1  
ATOM 693   C CB   . ALA A 1 45  ? -11.847 9.076   6.680   1.00 0.00 ? 45  ALA A CB   1  
ATOM 694   H H    . ALA A 1 45  ? -13.514 7.247   6.225   1.00 0.00 ? 45  ALA A H    1  
ATOM 695   H HA   . ALA A 1 45  ? -13.631 10.042  6.050   1.00 0.00 ? 45  ALA A HA   1  
ATOM 696   H HB1  . ALA A 1 45  ? -11.781 8.044   6.994   1.00 0.00 ? 45  ALA A HB1  1  
ATOM 697   H HB2  . ALA A 1 45  ? -12.015 9.704   7.542   1.00 0.00 ? 45  ALA A HB2  1  
ATOM 698   H HB3  . ALA A 1 45  ? -10.927 9.365   6.195   1.00 0.00 ? 45  ALA A HB3  1  
ATOM 699   N N    . PHE A 1 46  ? -12.479 8.539   3.443   1.00 0.00 ? 46  PHE A N    1  
ATOM 700   C CA   . PHE A 1 46  ? -12.015 8.698   2.071   1.00 0.00 ? 46  PHE A CA   1  
ATOM 701   C C    . PHE A 1 46  ? -13.189 8.903   1.115   1.00 0.00 ? 46  PHE A C    1  
ATOM 702   O O    . PHE A 1 46  ? -13.056 9.567   0.087   1.00 0.00 ? 46  PHE A O    1  
ATOM 703   C CB   . PHE A 1 46  ? -11.212 7.467   1.647   1.00 0.00 ? 46  PHE A CB   1  
ATOM 704   C CG   . PHE A 1 46  ? -9.838  7.407   2.249   1.00 0.00 ? 46  PHE A CG   1  
ATOM 705   C CD1  . PHE A 1 46  ? -9.667  7.094   3.588   1.00 0.00 ? 46  PHE A CD1  1  
ATOM 706   C CD2  . PHE A 1 46  ? -8.717  7.663   1.477   1.00 0.00 ? 46  PHE A CD2  1  
ATOM 707   C CE1  . PHE A 1 46  ? -8.403  7.036   4.145   1.00 0.00 ? 46  PHE A CE1  1  
ATOM 708   C CE2  . PHE A 1 46  ? -7.452  7.608   2.027   1.00 0.00 ? 46  PHE A CE2  1  
ATOM 709   C CZ   . PHE A 1 46  ? -7.294  7.293   3.362   1.00 0.00 ? 46  PHE A CZ   1  
ATOM 710   H H    . PHE A 1 46  ? -12.790 7.657   3.737   1.00 0.00 ? 46  PHE A H    1  
ATOM 711   H HA   . PHE A 1 46  ? -11.376 9.567   2.034   1.00 0.00 ? 46  PHE A HA   1  
ATOM 712   H HB2  . PHE A 1 46  ? -11.745 6.577   1.952   1.00 0.00 ? 46  PHE A HB2  1  
ATOM 713   H HB3  . PHE A 1 46  ? -11.106 7.467   0.572   1.00 0.00 ? 46  PHE A HB3  1  
ATOM 714   H HD1  . PHE A 1 46  ? -10.533 6.892   4.201   1.00 0.00 ? 46  PHE A HD1  1  
ATOM 715   H HD2  . PHE A 1 46  ? -8.840  7.909   0.431   1.00 0.00 ? 46  PHE A HD2  1  
ATOM 716   H HE1  . PHE A 1 46  ? -8.283  6.791   5.190   1.00 0.00 ? 46  PHE A HE1  1  
ATOM 717   H HE2  . PHE A 1 46  ? -6.587  7.808   1.412   1.00 0.00 ? 46  PHE A HE2  1  
ATOM 718   H HZ   . PHE A 1 46  ? -6.304  7.249   3.794   1.00 0.00 ? 46  PHE A HZ   1  
ATOM 719   N N    . THR A 1 47  ? -14.337 8.324   1.459   1.00 0.00 ? 47  THR A N    1  
ATOM 720   C CA   . THR A 1 47  ? -15.532 8.435   0.628   1.00 0.00 ? 47  THR A CA   1  
ATOM 721   C C    . THR A 1 47  ? -16.747 8.833   1.462   1.00 0.00 ? 47  THR A C    1  
ATOM 722   O O    . THR A 1 47  ? -17.831 8.270   1.308   1.00 0.00 ? 47  THR A O    1  
ATOM 723   C CB   . THR A 1 47  ? -15.799 7.108   -0.083  1.00 0.00 ? 47  THR A CB   1  
ATOM 724   O OG1  . THR A 1 47  ? -17.040 7.144   -0.765  1.00 0.00 ? 47  THR A OG1  1  
ATOM 725   C CG2  . THR A 1 47  ? -15.824 5.924   0.857   1.00 0.00 ? 47  THR A CG2  1  
ATOM 726   H H    . THR A 1 47  ? -14.379 7.803   2.288   1.00 0.00 ? 47  THR A H    1  
ATOM 727   H HA   . THR A 1 47  ? -15.355 9.201   -0.113  1.00 0.00 ? 47  THR A HA   1  
ATOM 728   H HB   . THR A 1 47  ? -15.018 6.938   -0.807  1.00 0.00 ? 47  THR A HB   1  
ATOM 729   H HG1  . THR A 1 47  ? -16.945 6.727   -1.625  1.00 0.00 ? 47  THR A HG1  1  
ATOM 730   H HG21 . THR A 1 47  ? -14.812 5.645   1.110   1.00 0.00 ? 47  THR A HG21 1  
ATOM 731   H HG22 . THR A 1 47  ? -16.318 5.093   0.376   1.00 0.00 ? 47  THR A HG22 1  
ATOM 732   H HG23 . THR A 1 47  ? -16.359 6.191   1.758   1.00 0.00 ? 47  THR A HG23 1  
ATOM 733   N N    . LYS A 1 48  ? -16.557 9.804   2.347   1.00 0.00 ? 48  LYS A N    1  
ATOM 734   C CA   . LYS A 1 48  ? -17.638 10.278  3.206   1.00 0.00 ? 48  LYS A CA   1  
ATOM 735   C C    . LYS A 1 48  ? -18.656 11.073  2.397   1.00 0.00 ? 48  LYS A C    1  
ATOM 736   O O    . LYS A 1 48  ? -18.378 12.188  1.956   1.00 0.00 ? 48  LYS A O    1  
ATOM 737   C CB   . LYS A 1 48  ? -17.078 11.137  4.341   1.00 0.00 ? 48  LYS A CB   1  
ATOM 738   C CG   . LYS A 1 48  ? -17.134 10.459  5.701   1.00 0.00 ? 48  LYS A CG   1  
ATOM 739   C CD   . LYS A 1 48  ? -15.935 10.829  6.561   1.00 0.00 ? 48  LYS A CD   1  
ATOM 740   C CE   . LYS A 1 48  ? -16.334 11.732  7.718   1.00 0.00 ? 48  LYS A CE   1  
ATOM 741   N NZ   . LYS A 1 48  ? -16.488 10.970  8.989   1.00 0.00 ? 48  LYS A NZ   1  
ATOM 742   H H    . LYS A 1 48  ? -15.671 10.213  2.425   1.00 0.00 ? 48  LYS A H    1  
ATOM 743   H HA   . LYS A 1 48  ? -18.128 9.413   3.629   1.00 0.00 ? 48  LYS A HA   1  
ATOM 744   H HB2  . LYS A 1 48  ? -16.046 11.373  4.124   1.00 0.00 ? 48  LYS A HB2  1  
ATOM 745   H HB3  . LYS A 1 48  ? -17.643 12.056  4.399   1.00 0.00 ? 48  LYS A HB3  1  
ATOM 746   H HG2  . LYS A 1 48  ? -18.036 10.765  6.208   1.00 0.00 ? 48  LYS A HG2  1  
ATOM 747   H HG3  . LYS A 1 48  ? -17.145 9.388   5.557   1.00 0.00 ? 48  LYS A HG3  1  
ATOM 748   H HD2  . LYS A 1 48  ? -15.497 9.926   6.958   1.00 0.00 ? 48  LYS A HD2  1  
ATOM 749   H HD3  . LYS A 1 48  ? -15.209 11.344  5.948   1.00 0.00 ? 48  LYS A HD3  1  
ATOM 750   H HE2  . LYS A 1 48  ? -15.571 12.484  7.851   1.00 0.00 ? 48  LYS A HE2  1  
ATOM 751   H HE3  . LYS A 1 48  ? -17.272 12.210  7.478   1.00 0.00 ? 48  LYS A HE3  1  
ATOM 752   H HZ1  . LYS A 1 48  ? -17.495 10.787  9.176   1.00 0.00 ? 48  LYS A HZ1  1  
ATOM 753   H HZ2  . LYS A 1 48  ? -16.095 11.516  9.783   1.00 0.00 ? 48  LYS A HZ2  1  
ATOM 754   H HZ3  . LYS A 1 48  ? -15.987 10.062  8.925   1.00 0.00 ? 48  LYS A HZ3  1  
ATOM 755   N N    . ASN A 1 49  ? -19.833 10.490  2.199   1.00 0.00 ? 49  ASN A N    1  
ATOM 756   C CA   . ASN A 1 49  ? -20.887 11.142  1.433   1.00 0.00 ? 49  ASN A CA   1  
ATOM 757   C C    . ASN A 1 49  ? -20.426 11.418  0.004   1.00 0.00 ? 49  ASN A C    1  
ATOM 758   O O    . ASN A 1 49  ? -20.993 12.263  -0.690  1.00 0.00 ? 49  ASN A O    1  
ATOM 759   C CB   . ASN A 1 49  ? -21.305 12.449  2.109   1.00 0.00 ? 49  ASN A CB   1  
ATOM 760   C CG   . ASN A 1 49  ? -22.802 12.682  2.043   1.00 0.00 ? 49  ASN A CG   1  
ATOM 761   O OD1  . ASN A 1 49  ? -23.593 11.827  2.441   1.00 0.00 ? 49  ASN A OD1  1  
ATOM 762   N ND2  . ASN A 1 49  ? -23.198 13.844  1.538   1.00 0.00 ? 49  ASN A ND2  1  
ATOM 763   H H    . ASN A 1 49  ? -19.993 9.596   2.570   1.00 0.00 ? 49  ASN A H    1  
ATOM 764   H HA   . ASN A 1 49  ? -21.737 10.475  1.402   1.00 0.00 ? 49  ASN A HA   1  
ATOM 765   H HB2  . ASN A 1 49  ? -21.010 12.421  3.148   1.00 0.00 ? 49  ASN A HB2  1  
ATOM 766   H HB3  . ASN A 1 49  ? -20.808 13.275  1.620   1.00 0.00 ? 49  ASN A HB3  1  
ATOM 767   H HD21 . ASN A 1 49  ? -22.508 14.479  1.239   1.00 0.00 ? 49  ASN A HD21 1  
ATOM 768   H HD22 . ASN A 1 49  ? -24.165 14.021  1.483   1.00 0.00 ? 49  ASN A HD22 1  
ATOM 769   N N    . GLN A 1 50  ? -19.393 10.698  -0.431  1.00 0.00 ? 50  GLN A N    1  
ATOM 770   C CA   . GLN A 1 50  ? -18.854 10.862  -1.776  1.00 0.00 ? 50  GLN A CA   1  
ATOM 771   C C    . GLN A 1 50  ? -18.498 12.321  -2.052  1.00 0.00 ? 50  GLN A C    1  
ATOM 772   O O    . GLN A 1 50  ? -18.656 12.809  -3.171  1.00 0.00 ? 50  GLN A O    1  
ATOM 773   C CB   . GLN A 1 50  ? -19.858 10.354  -2.812  1.00 0.00 ? 50  GLN A CB   1  
ATOM 774   C CG   . GLN A 1 50  ? -19.448 9.044   -3.462  1.00 0.00 ? 50  GLN A CG   1  
ATOM 775   C CD   . GLN A 1 50  ? -18.255 9.199   -4.385  1.00 0.00 ? 50  GLN A CD   1  
ATOM 776   O OE1  . GLN A 1 50  ? -18.409 9.458   -5.579  1.00 0.00 ? 50  GLN A OE1  1  
ATOM 777   N NE2  . GLN A 1 50  ? -17.056 9.041   -3.836  1.00 0.00 ? 50  GLN A NE2  1  
ATOM 778   H H    . GLN A 1 50  ? -18.984 10.039  0.167   1.00 0.00 ? 50  GLN A H    1  
ATOM 779   H HA   . GLN A 1 50  ? -17.954 10.269  -1.844  1.00 0.00 ? 50  GLN A HA   1  
ATOM 780   H HB2  . GLN A 1 50  ? -20.811 10.207  -2.328  1.00 0.00 ? 50  GLN A HB2  1  
ATOM 781   H HB3  . GLN A 1 50  ? -19.969 11.097  -3.588  1.00 0.00 ? 50  GLN A HB3  1  
ATOM 782   H HG2  . GLN A 1 50  ? -19.194 8.335   -2.687  1.00 0.00 ? 50  GLN A HG2  1  
ATOM 783   H HG3  . GLN A 1 50  ? -20.282 8.665   -4.036  1.00 0.00 ? 50  GLN A HG3  1  
ATOM 784   H HE21 . GLN A 1 50  ? -17.011 8.836   -2.874  1.00 0.00 ? 50  GLN A HE21 1  
ATOM 785   H HE22 . GLN A 1 50  ? -16.266 9.139   -4.414  1.00 0.00 ? 50  GLN A HE22 1  
ATOM 786   N N    . LYS A 1 51  ? -18.013 13.012  -1.025  1.00 0.00 ? 51  LYS A N    1  
ATOM 787   C CA   . LYS A 1 51  ? -17.631 14.415  -1.157  1.00 0.00 ? 51  LYS A CA   1  
ATOM 788   C C    . LYS A 1 51  ? -16.660 14.607  -2.319  1.00 0.00 ? 51  LYS A C    1  
ATOM 789   O O    . LYS A 1 51  ? -16.618 15.670  -2.937  1.00 0.00 ? 51  LYS A O    1  
ATOM 790   C CB   . LYS A 1 51  ? -16.994 14.915  0.142   1.00 0.00 ? 51  LYS A CB   1  
ATOM 791   C CG   . LYS A 1 51  ? -17.226 16.394  0.403   1.00 0.00 ? 51  LYS A CG   1  
ATOM 792   C CD   . LYS A 1 51  ? -16.019 17.228  0.004   1.00 0.00 ? 51  LYS A CD   1  
ATOM 793   C CE   . LYS A 1 51  ? -16.107 18.638  0.560   1.00 0.00 ? 51  LYS A CE   1  
ATOM 794   N NZ   . LYS A 1 51  ? -14.845 19.400  0.347   1.00 0.00 ? 51  LYS A NZ   1  
ATOM 795   H H    . LYS A 1 51  ? -17.906 12.568  -0.158  1.00 0.00 ? 51  LYS A H    1  
ATOM 796   H HA   . LYS A 1 51  ? -18.525 14.986  -1.352  1.00 0.00 ? 51  LYS A HA   1  
ATOM 797   H HB2  . LYS A 1 51  ? -17.406 14.357  0.969   1.00 0.00 ? 51  LYS A HB2  1  
ATOM 798   H HB3  . LYS A 1 51  ? -15.929 14.742  0.096   1.00 0.00 ? 51  LYS A HB3  1  
ATOM 799   H HG2  . LYS A 1 51  ? -18.081 16.721  -0.169  1.00 0.00 ? 51  LYS A HG2  1  
ATOM 800   H HG3  . LYS A 1 51  ? -17.419 16.537  1.456   1.00 0.00 ? 51  LYS A HG3  1  
ATOM 801   H HD2  . LYS A 1 51  ? -15.125 16.756  0.386   1.00 0.00 ? 51  LYS A HD2  1  
ATOM 802   H HD3  . LYS A 1 51  ? -15.969 17.278  -1.075  1.00 0.00 ? 51  LYS A HD3  1  
ATOM 803   H HE2  . LYS A 1 51  ? -16.917 19.156  0.069   1.00 0.00 ? 51  LYS A HE2  1  
ATOM 804   H HE3  . LYS A 1 51  ? -16.308 18.581  1.620   1.00 0.00 ? 51  LYS A HE3  1  
ATOM 805   H HZ1  . LYS A 1 51  ? -14.916 19.974  -0.517  1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 806   H HZ2  . LYS A 1 51  ? -14.044 18.746  0.251   1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 807   H HZ3  . LYS A 1 51  ? -14.668 20.031  1.156   1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 808   N N    . ASP A 1 52  ? -15.886 13.567  -2.610  1.00 0.00 ? 52  ASP A N    1  
ATOM 809   C CA   . ASP A 1 52  ? -14.918 13.613  -3.698  1.00 0.00 ? 52  ASP A CA   1  
ATOM 810   C C    . ASP A 1 52  ? -15.004 12.346  -4.549  1.00 0.00 ? 52  ASP A C    1  
ATOM 811   O O    . ASP A 1 52  ? -14.448 11.309  -4.187  1.00 0.00 ? 52  ASP A O    1  
ATOM 812   C CB   . ASP A 1 52  ? -13.502 13.771  -3.142  1.00 0.00 ? 52  ASP A CB   1  
ATOM 813   C CG   . ASP A 1 52  ? -13.118 15.225  -2.944  1.00 0.00 ? 52  ASP A CG   1  
ATOM 814   O OD1  . ASP A 1 52  ? -13.160 15.989  -3.932  1.00 0.00 ? 52  ASP A OD1  1  
ATOM 815   O OD2  . ASP A 1 52  ? -12.775 15.599  -1.803  1.00 0.00 ? 52  ASP A OD2  1  
ATOM 816   H H    . ASP A 1 52  ? -15.969 12.747  -2.081  1.00 0.00 ? 52  ASP A H    1  
ATOM 817   H HA   . ASP A 1 52  ? -15.151 14.467  -4.315  1.00 0.00 ? 52  ASP A HA   1  
ATOM 818   H HB2  . ASP A 1 52  ? -13.438 13.270  -2.188  1.00 0.00 ? 52  ASP A HB2  1  
ATOM 819   H HB3  . ASP A 1 52  ? -12.799 13.322  -3.828  1.00 0.00 ? 52  ASP A HB3  1  
ATOM 820   N N    . PRO A 1 53  ? -15.709 12.411  -5.694  1.00 0.00 ? 53  PRO A N    1  
ATOM 821   C CA   . PRO A 1 53  ? -15.869 11.264  -6.589  1.00 0.00 ? 53  PRO A CA   1  
ATOM 822   C C    . PRO A 1 53  ? -14.691 11.083  -7.544  1.00 0.00 ? 53  PRO A C    1  
ATOM 823   O O    . PRO A 1 53  ? -14.819 10.429  -8.579  1.00 0.00 ? 53  PRO A O    1  
ATOM 824   C CB   . PRO A 1 53  ? -17.132 11.623  -7.365  1.00 0.00 ? 53  PRO A CB   1  
ATOM 825   C CG   . PRO A 1 53  ? -17.103 13.112  -7.455  1.00 0.00 ? 53  PRO A CG   1  
ATOM 826   C CD   . PRO A 1 53  ? -16.414 13.604  -6.204  1.00 0.00 ? 53  PRO A CD   1  
ATOM 827   H HA   . PRO A 1 53  ? -16.031 10.349  -6.037  1.00 0.00 ? 53  PRO A HA   1  
ATOM 828   H HB2  . PRO A 1 53  ? -17.099 11.166  -8.344  1.00 0.00 ? 53  PRO A HB2  1  
ATOM 829   H HB3  . PRO A 1 53  ? -18.001 11.278  -6.827  1.00 0.00 ? 53  PRO A HB3  1  
ATOM 830   H HG2  . PRO A 1 53  ? -16.547 13.414  -8.330  1.00 0.00 ? 53  PRO A HG2  1  
ATOM 831   H HG3  . PRO A 1 53  ? -18.112 13.494  -7.501  1.00 0.00 ? 53  PRO A HG3  1  
ATOM 832   H HD2  . PRO A 1 53  ? -15.715 14.390  -6.444  1.00 0.00 ? 53  PRO A HD2  1  
ATOM 833   H HD3  . PRO A 1 53  ? -17.143 13.953  -5.488  1.00 0.00 ? 53  PRO A HD3  1  
ATOM 834   N N    . GLY A 1 54  ? -13.545 11.663  -7.196  1.00 0.00 ? 54  GLY A N    1  
ATOM 835   C CA   . GLY A 1 54  ? -12.372 11.547  -8.041  1.00 0.00 ? 54  GLY A CA   1  
ATOM 836   C C    . GLY A 1 54  ? -11.254 10.751  -7.392  1.00 0.00 ? 54  GLY A C    1  
ATOM 837   O O    . GLY A 1 54  ? -10.279 10.396  -8.051  1.00 0.00 ? 54  GLY A O    1  
ATOM 838   H H    . GLY A 1 54  ? -13.496 12.173  -6.363  1.00 0.00 ? 54  GLY A H    1  
ATOM 839   H HA2  . GLY A 1 54  ? -12.655 11.061  -8.962  1.00 0.00 ? 54  GLY A HA2  1  
ATOM 840   H HA3  . GLY A 1 54  ? -12.008 12.539  -8.268  1.00 0.00 ? 54  GLY A HA3  1  
ATOM 841   N N    . VAL A 1 55  ? -11.389 10.476  -6.098  1.00 0.00 ? 55  VAL A N    1  
ATOM 842   C CA   . VAL A 1 55  ? -10.377 9.719   -5.369  1.00 0.00 ? 55  VAL A CA   1  
ATOM 843   C C    . VAL A 1 55  ? -10.582 8.213   -5.528  1.00 0.00 ? 55  VAL A C    1  
ATOM 844   O O    . VAL A 1 55  ? -9.728  7.510   -6.069  1.00 0.00 ? 55  VAL A O    1  
ATOM 845   C CB   . VAL A 1 55  ? -10.392 10.068  -3.869  1.00 0.00 ? 55  VAL A CB   1  
ATOM 846   C CG1  . VAL A 1 55  ? -9.241  9.386   -3.145  1.00 0.00 ? 55  VAL A CG1  1  
ATOM 847   C CG2  . VAL A 1 55  ? -10.339 11.576  -3.672  1.00 0.00 ? 55  VAL A CG2  1  
ATOM 848   H H    . VAL A 1 55  ? -12.184 10.788  -5.621  1.00 0.00 ? 55  VAL A H    1  
ATOM 849   H HA   . VAL A 1 55  ? -9.408  9.985   -5.768  1.00 0.00 ? 55  VAL A HA   1  
ATOM 850   H HB   . VAL A 1 55  ? -11.318 9.705   -3.445  1.00 0.00 ? 55  VAL A HB   1  
ATOM 851   H HG11 . VAL A 1 55  ? -8.513  9.045   -3.866  1.00 0.00 ? 55  VAL A HG11 1  
ATOM 852   H HG12 . VAL A 1 55  ? -9.617  8.541   -2.586  1.00 0.00 ? 55  VAL A HG12 1  
ATOM 853   H HG13 . VAL A 1 55  ? -8.774  10.086  -2.467  1.00 0.00 ? 55  VAL A HG13 1  
ATOM 854   H HG21 . VAL A 1 55  ? -11.344 11.970  -3.633  1.00 0.00 ? 55  VAL A HG21 1  
ATOM 855   H HG22 . VAL A 1 55  ? -9.807  12.028  -4.498  1.00 0.00 ? 55  VAL A HG22 1  
ATOM 856   H HG23 . VAL A 1 55  ? -9.828  11.801  -2.749  1.00 0.00 ? 55  VAL A HG23 1  
ATOM 857   N N    . LEU A 1 56  ? -11.719 7.728   -5.037  1.00 0.00 ? 56  LEU A N    1  
ATOM 858   C CA   . LEU A 1 56  ? -12.053 6.315   -5.098  1.00 0.00 ? 56  LEU A CA   1  
ATOM 859   C C    . LEU A 1 56  ? -12.479 5.895   -6.503  1.00 0.00 ? 56  LEU A C    1  
ATOM 860   O O    . LEU A 1 56  ? -11.983 4.911   -7.051  1.00 0.00 ? 56  LEU A O    1  
ATOM 861   C CB   . LEU A 1 56  ? -13.186 6.038   -4.105  1.00 0.00 ? 56  LEU A CB   1  
ATOM 862   C CG   . LEU A 1 56  ? -14.129 4.899   -4.484  1.00 0.00 ? 56  LEU A CG   1  
ATOM 863   C CD1  . LEU A 1 56  ? -14.625 4.184   -3.242  1.00 0.00 ? 56  LEU A CD1  1  
ATOM 864   C CD2  . LEU A 1 56  ? -15.298 5.423   -5.306  1.00 0.00 ? 56  LEU A CD2  1  
ATOM 865   H H    . LEU A 1 56  ? -12.350 8.338   -4.611  1.00 0.00 ? 56  LEU A H    1  
ATOM 866   H HA   . LEU A 1 56  ? -11.183 5.749   -4.806  1.00 0.00 ? 56  LEU A HA   1  
ATOM 867   H HB2  . LEU A 1 56  ? -12.748 5.811   -3.144  1.00 0.00 ? 56  LEU A HB2  1  
ATOM 868   H HB3  . LEU A 1 56  ? -13.774 6.940   -4.010  1.00 0.00 ? 56  LEU A HB3  1  
ATOM 869   H HG   . LEU A 1 56  ? -13.586 4.191   -5.087  1.00 0.00 ? 56  LEU A HG   1  
ATOM 870   H HD11 . LEU A 1 56  ? -15.647 3.869   -3.394  1.00 0.00 ? 56  LEU A HD11 1  
ATOM 871   H HD12 . LEU A 1 56  ? -14.578 4.857   -2.400  1.00 0.00 ? 56  LEU A HD12 1  
ATOM 872   H HD13 . LEU A 1 56  ? -14.007 3.321   -3.051  1.00 0.00 ? 56  LEU A HD13 1  
ATOM 873   H HD21 . LEU A 1 56  ? -15.388 6.489   -5.166  1.00 0.00 ? 56  LEU A HD21 1  
ATOM 874   H HD22 . LEU A 1 56  ? -16.209 4.940   -4.985  1.00 0.00 ? 56  LEU A HD22 1  
ATOM 875   H HD23 . LEU A 1 56  ? -15.127 5.210   -6.351  1.00 0.00 ? 56  LEU A HD23 1  
ATOM 876   N N    . ASP A 1 57  ? -13.426 6.635   -7.058  1.00 0.00 ? 57  ASP A N    1  
ATOM 877   C CA   . ASP A 1 57  ? -13.964 6.344   -8.382  1.00 0.00 ? 57  ASP A CA   1  
ATOM 878   C C    . ASP A 1 57  ? -12.874 6.274   -9.451  1.00 0.00 ? 57  ASP A C    1  
ATOM 879   O O    . ASP A 1 57  ? -12.941 5.442   -10.355 1.00 0.00 ? 57  ASP A O    1  
ATOM 880   C CB   . ASP A 1 57  ? -14.996 7.405   -8.760  1.00 0.00 ? 57  ASP A CB   1  
ATOM 881   C CG   . ASP A 1 57  ? -16.029 6.887   -9.742  1.00 0.00 ? 57  ASP A CG   1  
ATOM 882   O OD1  . ASP A 1 57  ? -16.803 5.981   -9.366  1.00 0.00 ? 57  ASP A OD1  1  
ATOM 883   O OD2  . ASP A 1 57  ? -16.064 7.386   -10.886 1.00 0.00 ? 57  ASP A OD2  1  
ATOM 884   H H    . ASP A 1 57  ? -13.794 7.388   -6.550  1.00 0.00 ? 57  ASP A H    1  
ATOM 885   H HA   . ASP A 1 57  ? -14.458 5.385   -8.331  1.00 0.00 ? 57  ASP A HA   1  
ATOM 886   H HB2  . ASP A 1 57  ? -15.508 7.731   -7.867  1.00 0.00 ? 57  ASP A HB2  1  
ATOM 887   H HB3  . ASP A 1 57  ? -14.489 8.247   -9.208  1.00 0.00 ? 57  ASP A HB3  1  
ATOM 888   N N    . ARG A 1 58  ? -11.880 7.149   -9.355  1.00 0.00 ? 58  ARG A N    1  
ATOM 889   C CA   . ARG A 1 58  ? -10.794 7.173   -10.332 1.00 0.00 ? 58  ARG A CA   1  
ATOM 890   C C    . ARG A 1 58  ? -9.823  6.015   -10.124 1.00 0.00 ? 58  ARG A C    1  
ATOM 891   O O    . ARG A 1 58  ? -9.237  5.507   -11.080 1.00 0.00 ? 58  ARG A O    1  
ATOM 892   C CB   . ARG A 1 58  ? -10.032 8.496   -10.254 1.00 0.00 ? 58  ARG A CB   1  
ATOM 893   C CG   . ARG A 1 58  ? -10.790 9.673   -10.847 1.00 0.00 ? 58  ARG A CG   1  
ATOM 894   C CD   . ARG A 1 58  ? -9.862  10.613  -11.604 1.00 0.00 ? 58  ARG A CD   1  
ATOM 895   N NE   . ARG A 1 58  ? -9.701  11.894  -10.919 1.00 0.00 ? 58  ARG A NE   1  
ATOM 896   C CZ   . ARG A 1 58  ? -8.878  12.088  -9.890  1.00 0.00 ? 58  ARG A CZ   1  
ATOM 897   N NH1  . ARG A 1 58  ? -8.145  11.087  -9.419  1.00 0.00 ? 58  ARG A NH1  1  
ATOM 898   N NH2  . ARG A 1 58  ? -8.787  13.287  -9.332  1.00 0.00 ? 58  ARG A NH2  1  
ATOM 899   H H    . ARG A 1 58  ? -11.877 7.796   -8.618  1.00 0.00 ? 58  ARG A H    1  
ATOM 900   H HA   . ARG A 1 58  ? -11.233 7.084   -11.314 1.00 0.00 ? 58  ARG A HA   1  
ATOM 901   H HB2  . ARG A 1 58  ? -9.822  8.713   -9.219  1.00 0.00 ? 58  ARG A HB2  1  
ATOM 902   H HB3  . ARG A 1 58  ? -9.099  8.391   -10.786 1.00 0.00 ? 58  ARG A HB3  1  
ATOM 903   H HG2  . ARG A 1 58  ? -11.539 9.299   -11.529 1.00 0.00 ? 58  ARG A HG2  1  
ATOM 904   H HG3  . ARG A 1 58  ? -11.269 10.220  -10.049 1.00 0.00 ? 58  ARG A HG3  1  
ATOM 905   H HD2  . ARG A 1 58  ? -8.895  10.144  -11.700 1.00 0.00 ? 58  ARG A HD2  1  
ATOM 906   H HD3  . ARG A 1 58  ? -10.276 10.791  -12.586 1.00 0.00 ? 58  ARG A HD3  1  
ATOM 907   H HE   . ARG A 1 58  ? -10.233 12.650  -11.243 1.00 0.00 ? 58  ARG A HE   1  
ATOM 908   H HH11 . ARG A 1 58  ? -8.211  10.179  -9.833  1.00 0.00 ? 58  ARG A HH11 1  
ATOM 909   H HH12 . ARG A 1 58  ? -7.528  11.241  -8.646  1.00 0.00 ? 58  ARG A HH12 1  
ATOM 910   H HH22 . ARG A 1 58  ? -8.169  13.434  -8.561  1.00 0.00 ? 58  ARG A HH22 1  
ATOM 911   N N    . MET A 1 59  ? -9.642  5.614   -8.872  1.00 0.00 ? 59  MET A N    1  
ATOM 912   C CA   . MET A 1 59  ? -8.734  4.538   -8.536  1.00 0.00 ? 59  MET A CA   1  
ATOM 913   C C    . MET A 1 59  ? -9.297  3.174   -8.923  1.00 0.00 ? 59  MET A C    1  
ATOM 914   O O    . MET A 1 59  ? -8.632  2.389   -9.600  1.00 0.00 ? 59  MET A O    1  
ATOM 915   C CB   . MET A 1 59  ? -8.437  4.596   -7.040  1.00 0.00 ? 59  MET A CB   1  
ATOM 916   C CG   . MET A 1 59  ? -7.903  3.300   -6.486  1.00 0.00 ? 59  MET A CG   1  
ATOM 917   S SD   . MET A 1 59  ? -9.217  2.209   -5.922  1.00 0.00 ? 59  MET A SD   1  
ATOM 918   C CE   . MET A 1 59  ? -9.796  3.087   -4.484  1.00 0.00 ? 59  MET A CE   1  
ATOM 919   H H    . MET A 1 59  ? -10.123 6.060   -8.147  1.00 0.00 ? 59  MET A H    1  
ATOM 920   H HA   . MET A 1 59  ? -7.816  4.689   -9.075  1.00 0.00 ? 59  MET A HA   1  
ATOM 921   H HB2  . MET A 1 59  ? -7.705  5.368   -6.858  1.00 0.00 ? 59  MET A HB2  1  
ATOM 922   H HB3  . MET A 1 59  ? -9.347  4.840   -6.511  1.00 0.00 ? 59  MET A HB3  1  
ATOM 923   H HG2  . MET A 1 59  ? -7.349  2.803   -7.264  1.00 0.00 ? 59  MET A HG2  1  
ATOM 924   H HG3  . MET A 1 59  ? -7.251  3.522   -5.660  1.00 0.00 ? 59  MET A HG3  1  
ATOM 925   H HE1  . MET A 1 59  ? -8.994  3.165   -3.765  1.00 0.00 ? 59  MET A HE1  1  
ATOM 926   H HE2  . MET A 1 59  ? -10.624 2.553   -4.046  1.00 0.00 ? 59  MET A HE2  1  
ATOM 927   H HE3  . MET A 1 59  ? -10.115 4.076   -4.778  1.00 0.00 ? 59  MET A HE3  1  
ATOM 928   N N    . MET A 1 60  ? -10.507 2.885   -8.471  1.00 0.00 ? 60  MET A N    1  
ATOM 929   C CA   . MET A 1 60  ? -11.132 1.611   -8.748  1.00 0.00 ? 60  MET A CA   1  
ATOM 930   C C    . MET A 1 60  ? -11.315 1.386   -10.249 1.00 0.00 ? 60  MET A C    1  
ATOM 931   O O    . MET A 1 60  ? -11.286 0.250   -10.721 1.00 0.00 ? 60  MET A O    1  
ATOM 932   C CB   . MET A 1 60  ? -12.464 1.522   -8.004  1.00 0.00 ? 60  MET A CB   1  
ATOM 933   C CG   . MET A 1 60  ? -12.397 0.636   -6.765  1.00 0.00 ? 60  MET A CG   1  
ATOM 934   S SD   . MET A 1 60  ? -13.364 -0.872  -6.943  1.00 0.00 ? 60  MET A SD   1  
ATOM 935   C CE   . MET A 1 60  ? -12.929 -1.319  -8.618  1.00 0.00 ? 60  MET A CE   1  
ATOM 936   H H    . MET A 1 60  ? -10.985 3.533   -7.922  1.00 0.00 ? 60  MET A H    1  
ATOM 937   H HA   . MET A 1 60  ? -10.477 0.848   -8.367  1.00 0.00 ? 60  MET A HA   1  
ATOM 938   H HB2  . MET A 1 60  ? -12.759 2.515   -7.696  1.00 0.00 ? 60  MET A HB2  1  
ATOM 939   H HB3  . MET A 1 60  ? -13.214 1.122   -8.671  1.00 0.00 ? 60  MET A HB3  1  
ATOM 940   H HG2  . MET A 1 60  ? -11.363 0.361   -6.587  1.00 0.00 ? 60  MET A HG2  1  
ATOM 941   H HG3  . MET A 1 60  ? -12.771 1.191   -5.918  1.00 0.00 ? 60  MET A HG3  1  
ATOM 942   H HE1  . MET A 1 60  ? -13.804 -1.254  -9.248  1.00 0.00 ? 60  MET A HE1  1  
ATOM 943   H HE2  . MET A 1 60  ? -12.543 -2.328  -8.635  1.00 0.00 ? 60  MET A HE2  1  
ATOM 944   H HE3  . MET A 1 60  ? -12.172 -0.636  -8.982  1.00 0.00 ? 60  MET A HE3  1  
ATOM 945   N N    . LYS A 1 61  ? -11.500 2.467   -10.998 1.00 0.00 ? 61  LYS A N    1  
ATOM 946   C CA   . LYS A 1 61  ? -11.680 2.367   -12.443 1.00 0.00 ? 61  LYS A CA   1  
ATOM 947   C C    . LYS A 1 61  ? -10.350 2.166   -13.174 1.00 0.00 ? 61  LYS A C    1  
ATOM 948   O O    . LYS A 1 61  ? -10.250 1.341   -14.082 1.00 0.00 ? 61  LYS A O    1  
ATOM 949   C CB   . LYS A 1 61  ? -12.391 3.612   -12.980 1.00 0.00 ? 61  LYS A CB   1  
ATOM 950   C CG   . LYS A 1 61  ? -11.550 4.878   -12.926 1.00 0.00 ? 61  LYS A CG   1  
ATOM 951   C CD   . LYS A 1 61  ? -12.248 6.040   -13.615 1.00 0.00 ? 61  LYS A CD   1  
ATOM 952   C CE   . LYS A 1 61  ? -11.520 6.452   -14.884 1.00 0.00 ? 61  LYS A CE   1  
ATOM 953   N NZ   . LYS A 1 61  ? -10.435 7.436   -14.612 1.00 0.00 ? 61  LYS A NZ   1  
ATOM 954   H H    . LYS A 1 61  ? -11.511 3.350   -10.574 1.00 0.00 ? 61  LYS A H    1  
ATOM 955   H HA   . LYS A 1 61  ? -12.306 1.506   -12.632 1.00 0.00 ? 61  LYS A HA   1  
ATOM 956   H HB2  . LYS A 1 61  ? -12.669 3.436   -14.010 1.00 0.00 ? 61  LYS A HB2  1  
ATOM 957   H HB3  . LYS A 1 61  ? -13.287 3.777   -12.400 1.00 0.00 ? 61  LYS A HB3  1  
ATOM 958   H HG2  . LYS A 1 61  ? -11.372 5.137   -11.894 1.00 0.00 ? 61  LYS A HG2  1  
ATOM 959   H HG3  . LYS A 1 61  ? -10.608 4.693   -13.421 1.00 0.00 ? 61  LYS A HG3  1  
ATOM 960   H HD2  . LYS A 1 61  ? -13.255 5.745   -13.869 1.00 0.00 ? 61  LYS A HD2  1  
ATOM 961   H HD3  . LYS A 1 61  ? -12.278 6.881   -12.939 1.00 0.00 ? 61  LYS A HD3  1  
ATOM 962   H HE2  . LYS A 1 61  ? -11.090 5.571   -15.337 1.00 0.00 ? 61  LYS A HE2  1  
ATOM 963   H HE3  . LYS A 1 61  ? -12.233 6.893   -15.565 1.00 0.00 ? 61  LYS A HE3  1  
ATOM 964   H HZ1  . LYS A 1 61  ? -10.729 8.386   -14.920 1.00 0.00 ? 61  LYS A HZ1  1  
ATOM 965   H HZ2  . LYS A 1 61  ? -9.573  7.169   -15.128 1.00 0.00 ? 61  LYS A HZ2  1  
ATOM 966   H HZ3  . LYS A 1 61  ? -10.223 7.463   -13.595 1.00 0.00 ? 61  LYS A HZ3  1  
ATOM 967   N N    . LYS A 1 62  ? -9.339  2.944   -12.792 1.00 0.00 ? 62  LYS A N    1  
ATOM 968   C CA   . LYS A 1 62  ? -8.027  2.873   -13.434 1.00 0.00 ? 62  LYS A CA   1  
ATOM 969   C C    . LYS A 1 62  ? -7.178  1.710   -12.922 1.00 0.00 ? 62  LYS A C    1  
ATOM 970   O O    . LYS A 1 62  ? -6.099  1.447   -13.453 1.00 0.00 ? 62  LYS A O    1  
ATOM 971   C CB   . LYS A 1 62  ? -7.272  4.187   -13.228 1.00 0.00 ? 62  LYS A CB   1  
ATOM 972   C CG   . LYS A 1 62  ? -6.820  4.417   -11.794 1.00 0.00 ? 62  LYS A CG   1  
ATOM 973   C CD   . LYS A 1 62  ? -5.371  4.001   -11.594 1.00 0.00 ? 62  LYS A CD   1  
ATOM 974   C CE   . LYS A 1 62  ? -5.014  3.912   -10.119 1.00 0.00 ? 62  LYS A CE   1  
ATOM 975   N NZ   . LYS A 1 62  ? -3.647  4.434   -9.846  1.00 0.00 ? 62  LYS A NZ   1  
ATOM 976   H H    . LYS A 1 62  ? -9.486  3.598   -12.078 1.00 0.00 ? 62  LYS A H    1  
ATOM 977   H HA   . LYS A 1 62  ? -8.189  2.735   -14.492 1.00 0.00 ? 62  LYS A HA   1  
ATOM 978   H HB2  . LYS A 1 62  ? -6.398  4.187   -13.862 1.00 0.00 ? 62  LYS A HB2  1  
ATOM 979   H HB3  . LYS A 1 62  ? -7.915  5.004   -13.515 1.00 0.00 ? 62  LYS A HB3  1  
ATOM 980   H HG2  . LYS A 1 62  ? -6.917  5.466   -11.560 1.00 0.00 ? 62  LYS A HG2  1  
ATOM 981   H HG3  . LYS A 1 62  ? -7.446  3.838   -11.131 1.00 0.00 ? 62  LYS A HG3  1  
ATOM 982   H HD2  . LYS A 1 62  ? -5.218  3.034   -12.051 1.00 0.00 ? 62  LYS A HD2  1  
ATOM 983   H HD3  . LYS A 1 62  ? -4.729  4.730   -12.068 1.00 0.00 ? 62  LYS A HD3  1  
ATOM 984   H HE2  . LYS A 1 62  ? -5.729  4.488   -9.553  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 985   H HE3  . LYS A 1 62  ? -5.063  2.876   -9.813  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 986   H HZ1  . LYS A 1 62  ? -3.404  4.295   -8.844  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 987   H HZ2  . LYS A 1 62  ? -3.602  5.450   -10.063 1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 988   H HZ3  . LYS A 1 62  ? -2.949  3.935   -10.434 1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 989   N N    . LEU A 1 63  ? -7.648  1.022   -11.889 1.00 0.00 ? 63  LEU A N    1  
ATOM 990   C CA   . LEU A 1 63  ? -6.895  -0.098  -11.326 1.00 0.00 ? 63  LEU A CA   1  
ATOM 991   C C    . LEU A 1 63  ? -6.599  -1.164  -12.370 1.00 0.00 ? 63  LEU A C    1  
ATOM 992   O O    . LEU A 1 63  ? -5.710  -1.994  -12.184 1.00 0.00 ? 63  LEU A O    1  
ATOM 993   C CB   . LEU A 1 63  ? -7.632  -0.713  -10.133 1.00 0.00 ? 63  LEU A CB   1  
ATOM 994   C CG   . LEU A 1 63  ? -8.940  -1.432  -10.467 1.00 0.00 ? 63  LEU A CG   1  
ATOM 995   C CD1  . LEU A 1 63  ? -8.668  -2.816  -11.017 1.00 0.00 ? 63  LEU A CD1  1  
ATOM 996   C CD2  . LEU A 1 63  ? -9.823  -1.535  -9.238  1.00 0.00 ? 63  LEU A CD2  1  
ATOM 997   H H    . LEU A 1 63  ? -8.506  1.274   -11.492 1.00 0.00 ? 63  LEU A H    1  
ATOM 998   H HA   . LEU A 1 63  ? -5.956  0.291   -10.988 1.00 0.00 ? 63  LEU A HA   1  
ATOM 999   H HB2  . LEU A 1 63  ? -6.969  -1.421  -9.658  1.00 0.00 ? 63  LEU A HB2  1  
ATOM 1000  H HB3  . LEU A 1 63  ? -7.852  0.076   -9.429  1.00 0.00 ? 63  LEU A HB3  1  
ATOM 1001  H HG   . LEU A 1 63  ? -9.474  -0.871  -11.220 1.00 0.00 ? 63  LEU A HG   1  
ATOM 1002  H HD11 . LEU A 1 63  ? -7.784  -3.222  -10.547 1.00 0.00 ? 63  LEU A HD11 1  
ATOM 1003  H HD12 . LEU A 1 63  ? -8.518  -2.755  -12.082 1.00 0.00 ? 63  LEU A HD12 1  
ATOM 1004  H HD13 . LEU A 1 63  ? -9.513  -3.454  -10.805 1.00 0.00 ? 63  LEU A HD13 1  
ATOM 1005  H HD21 . LEU A 1 63  ? -9.976  -0.556  -8.826  1.00 0.00 ? 63  LEU A HD21 1  
ATOM 1006  H HD22 . LEU A 1 63  ? -9.343  -2.164  -8.505  1.00 0.00 ? 63  LEU A HD22 1  
ATOM 1007  H HD23 . LEU A 1 63  ? -10.773 -1.965  -9.515  1.00 0.00 ? 63  LEU A HD23 1  
ATOM 1008  N N    . ASP A 1 64  ? -7.336  -1.137  -13.468 1.00 0.00 ? 64  ASP A N    1  
ATOM 1009  C CA   . ASP A 1 64  ? -7.137  -2.102  -14.535 1.00 0.00 ? 64  ASP A CA   1  
ATOM 1010  C C    . ASP A 1 64  ? -7.242  -3.529  -14.007 1.00 0.00 ? 64  ASP A C    1  
ATOM 1011  O O    . ASP A 1 64  ? -6.238  -4.145  -13.648 1.00 0.00 ? 64  ASP A O    1  
ATOM 1012  C CB   . ASP A 1 64  ? -5.776  -1.888  -15.200 1.00 0.00 ? 64  ASP A CB   1  
ATOM 1013  C CG   . ASP A 1 64  ? -5.746  -2.393  -16.629 1.00 0.00 ? 64  ASP A CG   1  
ATOM 1014  O OD1  . ASP A 1 64  ? -6.547  -3.293  -16.958 1.00 0.00 ? 64  ASP A OD1  1  
ATOM 1015  O OD2  . ASP A 1 64  ? -4.921  -1.889  -17.420 1.00 0.00 ? 64  ASP A OD2  1  
ATOM 1016  H H    . ASP A 1 64  ? -8.029  -0.453  -13.567 1.00 0.00 ? 64  ASP A H    1  
ATOM 1017  H HA   . ASP A 1 64  ? -7.910  -1.938  -15.257 1.00 0.00 ? 64  ASP A HA   1  
ATOM 1018  H HB2  . ASP A 1 64  ? -5.548  -0.832  -15.207 1.00 0.00 ? 64  ASP A HB2  1  
ATOM 1019  H HB3  . ASP A 1 64  ? -5.020  -2.412  -14.636 1.00 0.00 ? 64  ASP A HB3  1  
ATOM 1020  N N    . LEU A 1 65  ? -8.466  -4.044  -13.949 1.00 0.00 ? 65  LEU A N    1  
ATOM 1021  C CA   . LEU A 1 65  ? -8.702  -5.393  -13.449 1.00 0.00 ? 65  LEU A CA   1  
ATOM 1022  C C    . LEU A 1 65  ? -8.605  -6.424  -14.568 1.00 0.00 ? 65  LEU A C    1  
ATOM 1023  O O    . LEU A 1 65  ? -9.375  -6.393  -15.528 1.00 0.00 ? 65  LEU A O    1  
ATOM 1024  C CB   . LEU A 1 65  ? -10.074 -5.472  -12.775 1.00 0.00 ? 65  LEU A CB   1  
ATOM 1025  C CG   . LEU A 1 65  ? -10.124 -6.312  -11.496 1.00 0.00 ? 65  LEU A CG   1  
ATOM 1026  C CD1  . LEU A 1 65  ? -9.873  -7.778  -11.810 1.00 0.00 ? 65  LEU A CD1  1  
ATOM 1027  C CD2  . LEU A 1 65  ? -9.115  -5.801  -10.475 1.00 0.00 ? 65  LEU A CD2  1  
ATOM 1028  H H    . LEU A 1 65  ? -9.228  -3.502  -14.240 1.00 0.00 ? 65  LEU A H    1  
ATOM 1029  H HA   . LEU A 1 65  ? -7.940  -5.610  -12.718 1.00 0.00 ? 65  LEU A HA   1  
ATOM 1030  H HB2  . LEU A 1 65  ? -10.391 -4.468  -12.535 1.00 0.00 ? 65  LEU A HB2  1  
ATOM 1031  H HB3  . LEU A 1 65  ? -10.774 -5.893  -13.481 1.00 0.00 ? 65  LEU A HB3  1  
ATOM 1032  H HG   . LEU A 1 65  ? -11.111 -6.229  -11.061 1.00 0.00 ? 65  LEU A HG   1  
ATOM 1033  H HD11 . LEU A 1 65  ? -10.253 -8.388  -11.004 1.00 0.00 ? 65  LEU A HD11 1  
ATOM 1034  H HD12 . LEU A 1 65  ? -8.812  -7.945  -11.921 1.00 0.00 ? 65  LEU A HD12 1  
ATOM 1035  H HD13 . LEU A 1 65  ? -10.378 -8.040  -12.730 1.00 0.00 ? 65  LEU A HD13 1  
ATOM 1036  H HD21 . LEU A 1 65  ? -8.675  -6.637  -9.955  1.00 0.00 ? 65  LEU A HD21 1  
ATOM 1037  H HD22 . LEU A 1 65  ? -9.614  -5.158  -9.763  1.00 0.00 ? 65  LEU A HD22 1  
ATOM 1038  H HD23 . LEU A 1 65  ? -8.340  -5.242  -10.976 1.00 0.00 ? 65  LEU A HD23 1  
ATOM 1039  N N    . ASN A 1 66  ? -7.652  -7.338  -14.429 1.00 0.00 ? 66  ASN A N    1  
ATOM 1040  C CA   . ASN A 1 66  ? -7.443  -8.390  -15.416 1.00 0.00 ? 66  ASN A CA   1  
ATOM 1041  C C    . ASN A 1 66  ? -6.389  -9.382  -14.930 1.00 0.00 ? 66  ASN A C    1  
ATOM 1042  O O    . ASN A 1 66  ? -5.630  -9.937  -15.724 1.00 0.00 ? 66  ASN A O    1  
ATOM 1043  C CB   . ASN A 1 66  ? -7.019  -7.785  -16.756 1.00 0.00 ? 66  ASN A CB   1  
ATOM 1044  C CG   . ASN A 1 66  ? -8.190  -7.601  -17.701 1.00 0.00 ? 66  ASN A CG   1  
ATOM 1045  O OD1  . ASN A 1 66  ? -9.159  -8.360  -17.661 1.00 0.00 ? 66  ASN A OD1  1  
ATOM 1046  N ND2  . ASN A 1 66  ? -8.107  -6.590  -18.558 1.00 0.00 ? 66  ASN A ND2  1  
ATOM 1047  H H    . ASN A 1 66  ? -7.075  -7.306  -13.638 1.00 0.00 ? 66  ASN A H    1  
ATOM 1048  H HA   . ASN A 1 66  ? -8.378  -8.912  -15.546 1.00 0.00 ? 66  ASN A HA   1  
ATOM 1049  H HB2  . ASN A 1 66  ? -6.567  -6.820  -16.582 1.00 0.00 ? 66  ASN A HB2  1  
ATOM 1050  H HB3  . ASN A 1 66  ? -6.298  -8.436  -17.228 1.00 0.00 ? 66  ASN A HB3  1  
ATOM 1051  H HD21 . ASN A 1 66  ? -7.302  -6.026  -18.533 1.00 0.00 ? 66  ASN A HD21 1  
ATOM 1052  H HD22 . ASN A 1 66  ? -8.855  -6.450  -19.183 1.00 0.00 ? 66  ASN A HD22 1  
ATOM 1053  N N    . SER A 1 67  ? -6.351  -9.599  -13.618 1.00 0.00 ? 67  SER A N    1  
ATOM 1054  C CA   . SER A 1 67  ? -5.394  -10.524 -13.021 1.00 0.00 ? 67  SER A CA   1  
ATOM 1055  C C    . SER A 1 67  ? -6.106  -11.753 -12.465 1.00 0.00 ? 67  SER A C    1  
ATOM 1056  O O    . SER A 1 67  ? -6.701  -11.703 -11.390 1.00 0.00 ? 67  SER A O    1  
ATOM 1057  C CB   . SER A 1 67  ? -4.607  -9.829  -11.908 1.00 0.00 ? 67  SER A CB   1  
ATOM 1058  O OG   . SER A 1 67  ? -3.439  -10.559 -11.578 1.00 0.00 ? 67  SER A OG   1  
ATOM 1059  H H    . SER A 1 67  ? -6.984  -9.128  -13.038 1.00 0.00 ? 67  SER A H    1  
ATOM 1060  H HA   . SER A 1 67  ? -4.709  -10.838 -13.794 1.00 0.00 ? 67  SER A HA   1  
ATOM 1061  H HB2  . SER A 1 67  ? -4.320  -8.842  -12.236 1.00 0.00 ? 67  SER A HB2  1  
ATOM 1062  H HB3  . SER A 1 67  ? -5.228  -9.749  -11.028 1.00 0.00 ? 67  SER A HB3  1  
ATOM 1063  H HG   . SER A 1 67  ? -2.869  -10.616 -12.347 1.00 0.00 ? 67  SER A HG   1  
ATOM 1064  N N    . ASP A 1 68  ? -6.043  -12.852 -13.211 1.00 0.00 ? 68  ASP A N    1  
ATOM 1065  C CA   . ASP A 1 68  ? -6.684  -14.099 -12.801 1.00 0.00 ? 68  ASP A CA   1  
ATOM 1066  C C    . ASP A 1 68  ? -8.207  -13.972 -12.812 1.00 0.00 ? 68  ASP A C    1  
ATOM 1067  O O    . ASP A 1 68  ? -8.912  -14.854 -12.323 1.00 0.00 ? 68  ASP A O    1  
ATOM 1068  C CB   . ASP A 1 68  ? -6.205  -14.515 -11.408 1.00 0.00 ? 68  ASP A CB   1  
ATOM 1069  C CG   . ASP A 1 68  ? -4.693  -14.582 -11.312 1.00 0.00 ? 68  ASP A CG   1  
ATOM 1070  O OD1  . ASP A 1 68  ? -4.087  -15.402 -12.034 1.00 0.00 ? 68  ASP A OD1  1  
ATOM 1071  O OD2  . ASP A 1 68  ? -4.113  -13.814 -10.515 1.00 0.00 ? 68  ASP A OD2  1  
ATOM 1072  H H    . ASP A 1 68  ? -5.555  -12.824 -14.060 1.00 0.00 ? 68  ASP A H    1  
ATOM 1073  H HA   . ASP A 1 68  ? -6.397  -14.861 -13.509 1.00 0.00 ? 68  ASP A HA   1  
ATOM 1074  H HB2  . ASP A 1 68  ? -6.561  -13.800 -10.682 1.00 0.00 ? 68  ASP A HB2  1  
ATOM 1075  H HB3  . ASP A 1 68  ? -6.605  -15.490 -11.173 1.00 0.00 ? 68  ASP A HB3  1  
ATOM 1076  N N    . GLY A 1 69  ? -8.713  -12.875 -13.376 1.00 0.00 ? 69  GLY A N    1  
ATOM 1077  C CA   . GLY A 1 69  ? -10.148 -12.669 -13.440 1.00 0.00 ? 69  GLY A CA   1  
ATOM 1078  C C    . GLY A 1 69  ? -10.702 -11.935 -12.232 1.00 0.00 ? 69  GLY A C    1  
ATOM 1079  O O    . GLY A 1 69  ? -11.744 -11.286 -12.322 1.00 0.00 ? 69  GLY A O    1  
ATOM 1080  H H    . GLY A 1 69  ? -8.109  -12.206 -13.756 1.00 0.00 ? 69  GLY A H    1  
ATOM 1081  H HA2  . GLY A 1 69  ? -10.376 -12.097 -14.327 1.00 0.00 ? 69  GLY A HA2  1  
ATOM 1082  H HA3  . GLY A 1 69  ? -10.632 -13.631 -13.514 1.00 0.00 ? 69  GLY A HA3  1  
ATOM 1083  N N    . GLN A 1 70  ? -10.017 -12.043 -11.096 1.00 0.00 ? 70  GLN A N    1  
ATOM 1084  C CA   . GLN A 1 70  ? -10.465 -11.389 -9.873  1.00 0.00 ? 70  GLN A CA   1  
ATOM 1085  C C    . GLN A 1 70  ? -9.542  -10.236 -9.485  1.00 0.00 ? 70  GLN A C    1  
ATOM 1086  O O    . GLN A 1 70  ? -8.692  -9.817  -10.271 1.00 0.00 ? 70  GLN A O    1  
ATOM 1087  C CB   . GLN A 1 70  ? -10.543 -12.409 -8.733  1.00 0.00 ? 70  GLN A CB   1  
ATOM 1088  C CG   . GLN A 1 70  ? -11.831 -13.214 -8.729  1.00 0.00 ? 70  GLN A CG   1  
ATOM 1089  C CD   . GLN A 1 70  ? -12.926 -12.556 -7.913  1.00 0.00 ? 70  GLN A CD   1  
ATOM 1090  O OE1  . GLN A 1 70  ? -13.609 -13.212 -7.127  1.00 0.00 ? 70  GLN A OE1  1  
ATOM 1091  N NE2  . GLN A 1 70  ? -13.101 -11.252 -8.097  1.00 0.00 ? 70  GLN A NE2  1  
ATOM 1092  H H    . GLN A 1 70  ? -9.201  -12.579 -11.078 1.00 0.00 ? 70  GLN A H    1  
ATOM 1093  H HA   . GLN A 1 70  ? -11.451 -10.995 -10.058 1.00 0.00 ? 70  GLN A HA   1  
ATOM 1094  H HB2  . GLN A 1 70  ? -9.714  -13.095 -8.823  1.00 0.00 ? 70  GLN A HB2  1  
ATOM 1095  H HB3  . GLN A 1 70  ? -10.465 -11.890 -7.791  1.00 0.00 ? 70  GLN A HB3  1  
ATOM 1096  H HG2  . GLN A 1 70  ? -12.177 -13.323 -9.746  1.00 0.00 ? 70  GLN A HG2  1  
ATOM 1097  H HG3  . GLN A 1 70  ? -11.628 -14.190 -8.312  1.00 0.00 ? 70  GLN A HG3  1  
ATOM 1098  H HE21 . GLN A 1 70  ? -12.521 -10.792 -8.741  1.00 0.00 ? 70  GLN A HE21 1  
ATOM 1099  H HE22 . GLN A 1 70  ? -13.800 -10.802 -7.579  1.00 0.00 ? 70  GLN A HE22 1  
ATOM 1100  N N    . LEU A 1 71  ? -9.720  -9.726  -8.266  1.00 0.00 ? 71  LEU A N    1  
ATOM 1101  C CA   . LEU A 1 71  ? -8.914  -8.626  -7.763  1.00 0.00 ? 71  LEU A CA   1  
ATOM 1102  C C    . LEU A 1 71  ? -7.437  -9.047  -7.687  1.00 0.00 ? 71  LEU A C    1  
ATOM 1103  O O    . LEU A 1 71  ? -6.926  -9.653  -8.629  1.00 0.00 ? 71  LEU A O    1  
ATOM 1104  C CB   . LEU A 1 71  ? -9.478  -8.171  -6.403  1.00 0.00 ? 71  LEU A CB   1  
ATOM 1105  C CG   . LEU A 1 71  ? -10.240 -6.841  -6.408  1.00 0.00 ? 71  LEU A CG   1  
ATOM 1106  C CD1  . LEU A 1 71  ? -9.280  -5.676  -6.244  1.00 0.00 ? 71  LEU A CD1  1  
ATOM 1107  C CD2  . LEU A 1 71  ? -11.062 -6.681  -7.679  1.00 0.00 ? 71  LEU A CD2  1  
ATOM 1108  H H    . LEU A 1 71  ? -10.412 -10.101 -7.689  1.00 0.00 ? 71  LEU A H    1  
ATOM 1109  H HA   . LEU A 1 71  ? -9.000  -7.815  -8.467  1.00 0.00 ? 71  LEU A HA   1  
ATOM 1110  H HB2  . LEU A 1 71  ? -10.154 -8.934  -6.056  1.00 0.00 ? 71  LEU A HB2  1  
ATOM 1111  H HB3  . LEU A 1 71  ? -8.674  -8.091  -5.698  1.00 0.00 ? 71  LEU A HB3  1  
ATOM 1112  H HG   . LEU A 1 71  ? -10.920 -6.826  -5.568  1.00 0.00 ? 71  LEU A HG   1  
ATOM 1113  H HD11 . LEU A 1 71  ? -8.415  -5.999  -5.681  1.00 0.00 ? 71  LEU A HD11 1  
ATOM 1114  H HD12 . LEU A 1 71  ? -9.779  -4.875  -5.714  1.00 0.00 ? 71  LEU A HD12 1  
ATOM 1115  H HD13 . LEU A 1 71  ? -8.969  -5.327  -7.216  1.00 0.00 ? 71  LEU A HD13 1  
ATOM 1116  H HD21 . LEU A 1 71  ? -10.403 -6.590  -8.528  1.00 0.00 ? 71  LEU A HD21 1  
ATOM 1117  H HD22 . LEU A 1 71  ? -11.673 -5.794  -7.603  1.00 0.00 ? 71  LEU A HD22 1  
ATOM 1118  H HD23 . LEU A 1 71  ? -11.697 -7.546  -7.808  1.00 0.00 ? 71  LEU A HD23 1  
ATOM 1119  N N    . ASP A 1 72  ? -6.742  -8.742  -6.589  1.00 0.00 ? 72  ASP A N    1  
ATOM 1120  C CA   . ASP A 1 72  ? -5.334  -9.116  -6.463  1.00 0.00 ? 72  ASP A CA   1  
ATOM 1121  C C    . ASP A 1 72  ? -4.740  -8.634  -5.142  1.00 0.00 ? 72  ASP A C    1  
ATOM 1122  O O    . ASP A 1 72  ? -5.458  -8.169  -4.258  1.00 0.00 ? 72  ASP A O    1  
ATOM 1123  C CB   . ASP A 1 72  ? -4.523  -8.555  -7.634  1.00 0.00 ? 72  ASP A CB   1  
ATOM 1124  C CG   . ASP A 1 72  ? -3.453  -9.517  -8.111  1.00 0.00 ? 72  ASP A CG   1  
ATOM 1125  O OD1  . ASP A 1 72  ? -3.609  -10.737 -7.892  1.00 0.00 ? 72  ASP A OD1  1  
ATOM 1126  O OD2  . ASP A 1 72  ? -2.457  -9.051  -8.704  1.00 0.00 ? 72  ASP A OD2  1  
ATOM 1127  H H    . ASP A 1 72  ? -7.177  -8.263  -5.857  1.00 0.00 ? 72  ASP A H    1  
ATOM 1128  H HA   . ASP A 1 72  ? -5.280  -10.195 -6.489  1.00 0.00 ? 72  ASP A HA   1  
ATOM 1129  H HB2  . ASP A 1 72  ? -5.187  -8.353  -8.458  1.00 0.00 ? 72  ASP A HB2  1  
ATOM 1130  H HB3  . ASP A 1 72  ? -4.046  -7.637  -7.326  1.00 0.00 ? 72  ASP A HB3  1  
ATOM 1131  N N    . PHE A 1 73  ? -3.422  -8.765  -5.014  1.00 0.00 ? 73  PHE A N    1  
ATOM 1132  C CA   . PHE A 1 73  ? -2.720  -8.363  -3.801  1.00 0.00 ? 73  PHE A CA   1  
ATOM 1133  C C    . PHE A 1 73  ? -2.404  -6.866  -3.783  1.00 0.00 ? 73  PHE A C    1  
ATOM 1134  O O    . PHE A 1 73  ? -2.810  -6.154  -2.862  1.00 0.00 ? 73  PHE A O    1  
ATOM 1135  C CB   . PHE A 1 73  ? -1.431  -9.175  -3.642  1.00 0.00 ? 73  PHE A CB   1  
ATOM 1136  C CG   . PHE A 1 73  ? -0.402  -8.888  -4.697  1.00 0.00 ? 73  PHE A CG   1  
ATOM 1137  C CD1  . PHE A 1 73  ? -0.473  -9.497  -5.940  1.00 0.00 ? 73  PHE A CD1  1  
ATOM 1138  C CD2  . PHE A 1 73  ? 0.634   -8.004  -4.445  1.00 0.00 ? 73  PHE A CD2  1  
ATOM 1139  C CE1  . PHE A 1 73  ? 0.472   -9.229  -6.913  1.00 0.00 ? 73  PHE A CE1  1  
ATOM 1140  C CE2  . PHE A 1 73  ? 1.581   -7.731  -5.415  1.00 0.00 ? 73  PHE A CE2  1  
ATOM 1141  C CZ   . PHE A 1 73  ? 1.500   -8.345  -6.650  1.00 0.00 ? 73  PHE A CZ   1  
ATOM 1142  H H    . PHE A 1 73  ? -2.910  -9.154  -5.752  1.00 0.00 ? 73  PHE A H    1  
ATOM 1143  H HA   . PHE A 1 73  ? -3.367  -8.583  -2.965  1.00 0.00 ? 73  PHE A HA   1  
ATOM 1144  H HB2  . PHE A 1 73  ? -0.992  -8.953  -2.683  1.00 0.00 ? 73  PHE A HB2  1  
ATOM 1145  H HB3  . PHE A 1 73  ? -1.671  -10.228 -3.688  1.00 0.00 ? 73  PHE A HB3  1  
ATOM 1146  H HD1  . PHE A 1 73  ? -1.275  -10.189 -6.147  1.00 0.00 ? 73  PHE A HD1  1  
ATOM 1147  H HD2  . PHE A 1 73  ? 0.700   -7.524  -3.476  1.00 0.00 ? 73  PHE A HD2  1  
ATOM 1148  H HE1  . PHE A 1 73  ? 0.407   -9.711  -7.877  1.00 0.00 ? 73  PHE A HE1  1  
ATOM 1149  H HE2  . PHE A 1 73  ? 2.383   -7.039  -5.207  1.00 0.00 ? 73  PHE A HE2  1  
ATOM 1150  H HZ   . PHE A 1 73  ? 2.238   -8.133  -7.409  1.00 0.00 ? 73  PHE A HZ   1  
ATOM 1151  N N    . GLN A 1 74  ? -1.675  -6.382  -4.790  1.00 0.00 ? 74  GLN A N    1  
ATOM 1152  C CA   . GLN A 1 74  ? -1.323  -4.969  -4.841  1.00 0.00 ? 74  GLN A CA   1  
ATOM 1153  C C    . GLN A 1 74  ? -2.510  -4.135  -5.275  1.00 0.00 ? 74  GLN A C    1  
ATOM 1154  O O    . GLN A 1 74  ? -2.640  -2.989  -4.862  1.00 0.00 ? 74  GLN A O    1  
ATOM 1155  C CB   . GLN A 1 74  ? -0.140  -4.712  -5.776  1.00 0.00 ? 74  GLN A CB   1  
ATOM 1156  C CG   . GLN A 1 74  ? 0.199   -3.229  -5.932  1.00 0.00 ? 74  GLN A CG   1  
ATOM 1157  C CD   . GLN A 1 74  ? 0.308   -2.499  -4.600  1.00 0.00 ? 74  GLN A CD   1  
ATOM 1158  O OE1  . GLN A 1 74  ? 0.954   -2.983  -3.669  1.00 0.00 ? 74  GLN A OE1  1  
ATOM 1159  N NE2  . GLN A 1 74  ? -0.325  -1.328  -4.500  1.00 0.00 ? 74  GLN A NE2  1  
ATOM 1160  H H    . GLN A 1 74  ? -1.371  -6.980  -5.501  1.00 0.00 ? 74  GLN A H    1  
ATOM 1161  H HA   . GLN A 1 74  ? -1.044  -4.669  -3.841  1.00 0.00 ? 74  GLN A HA   1  
ATOM 1162  H HB2  . GLN A 1 74  ? 0.730   -5.219  -5.386  1.00 0.00 ? 74  GLN A HB2  1  
ATOM 1163  H HB3  . GLN A 1 74  ? -0.372  -5.110  -6.752  1.00 0.00 ? 74  GLN A HB3  1  
ATOM 1164  H HG2  . GLN A 1 74  ? 1.144   -3.143  -6.448  1.00 0.00 ? 74  GLN A HG2  1  
ATOM 1165  H HG3  . GLN A 1 74  ? -0.575  -2.758  -6.521  1.00 0.00 ? 74  GLN A HG3  1  
ATOM 1166  H HE21 . GLN A 1 74  ? -0.824  -1.000  -5.278  1.00 0.00 ? 74  GLN A HE21 1  
ATOM 1167  H HE22 . GLN A 1 74  ? -0.264  -0.835  -3.649  1.00 0.00 ? 74  GLN A HE22 1  
ATOM 1168  N N    . GLU A 1 75  ? -3.385  -4.707  -6.100  1.00 0.00 ? 75  GLU A N    1  
ATOM 1169  C CA   . GLU A 1 75  ? -4.564  -3.984  -6.560  1.00 0.00 ? 75  GLU A CA   1  
ATOM 1170  C C    . GLU A 1 75  ? -5.211  -3.264  -5.391  1.00 0.00 ? 75  GLU A C    1  
ATOM 1171  O O    . GLU A 1 75  ? -5.597  -2.112  -5.503  1.00 0.00 ? 75  GLU A O    1  
ATOM 1172  C CB   . GLU A 1 75  ? -5.569  -4.936  -7.214  1.00 0.00 ? 75  GLU A CB   1  
ATOM 1173  C CG   . GLU A 1 75  ? -5.772  -4.675  -8.697  1.00 0.00 ? 75  GLU A CG   1  
ATOM 1174  C CD   . GLU A 1 75  ? -5.865  -5.953  -9.507  1.00 0.00 ? 75  GLU A CD   1  
ATOM 1175  O OE1  . GLU A 1 75  ? -6.651  -6.843  -9.121  1.00 0.00 ? 75  GLU A OE1  1  
ATOM 1176  O OE2  . GLU A 1 75  ? -5.150  -6.064  -10.526 1.00 0.00 ? 75  GLU A OE2  1  
ATOM 1177  H H    . GLU A 1 75  ? -3.238  -5.630  -6.395  1.00 0.00 ? 75  GLU A H    1  
ATOM 1178  H HA   . GLU A 1 75  ? -4.251  -3.246  -7.287  1.00 0.00 ? 75  GLU A HA   1  
ATOM 1179  H HB2  . GLU A 1 75  ? -5.220  -5.950  -7.092  1.00 0.00 ? 75  GLU A HB2  1  
ATOM 1180  H HB3  . GLU A 1 75  ? -6.524  -4.829  -6.720  1.00 0.00 ? 75  GLU A HB3  1  
ATOM 1181  H HG2  . GLU A 1 75  ? -6.686  -4.116  -8.830  1.00 0.00 ? 75  GLU A HG2  1  
ATOM 1182  H HG3  . GLU A 1 75  ? -4.938  -4.093  -9.064  1.00 0.00 ? 75  GLU A HG3  1  
ATOM 1183  N N    . PHE A 1 76  ? -5.295  -3.936  -4.256  1.00 0.00 ? 76  PHE A N    1  
ATOM 1184  C CA   . PHE A 1 76  ? -5.872  -3.318  -3.078  1.00 0.00 ? 76  PHE A CA   1  
ATOM 1185  C C    . PHE A 1 76  ? -4.943  -2.235  -2.553  1.00 0.00 ? 76  PHE A C    1  
ATOM 1186  O O    . PHE A 1 76  ? -5.344  -1.081  -2.404  1.00 0.00 ? 76  PHE A O    1  
ATOM 1187  C CB   . PHE A 1 76  ? -6.136  -4.364  -1.997  1.00 0.00 ? 76  PHE A CB   1  
ATOM 1188  C CG   . PHE A 1 76  ? -7.321  -4.047  -1.130  1.00 0.00 ? 76  PHE A CG   1  
ATOM 1189  C CD1  . PHE A 1 76  ? -7.299  -2.958  -0.274  1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1190  C CD2  . PHE A 1 76  ? -8.455  -4.840  -1.170  1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1191  C CE1  . PHE A 1 76  ? -8.387  -2.666  0.525   1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1192  C CE2  . PHE A 1 76  ? -9.547  -4.553  -0.374  1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1193  C CZ   . PHE A 1 76  ? -9.513  -3.466  0.476   1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1194  H H    . PHE A 1 76  ? -4.948  -4.851  -4.205  1.00 0.00 ? 76  PHE A H    1  
ATOM 1195  H HA   . PHE A 1 76  ? -6.802  -2.857  -3.379  1.00 0.00 ? 76  PHE A HA   1  
ATOM 1196  H HB2  . PHE A 1 76  ? -6.316  -5.319  -2.468  1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1197  H HB3  . PHE A 1 76  ? -5.264  -4.439  -1.359  1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1198  H HD1  . PHE A 1 76  ? -6.420  -2.332  -0.235  1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1199  H HD2  . PHE A 1 76  ? -8.483  -5.693  -1.834  1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1200  H HE1  . PHE A 1 76  ? -8.359  -1.814  1.189   1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1201  H HE2  . PHE A 1 76  ? -10.425 -5.180  -0.413  1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1202  H HZ   . PHE A 1 76  ? -10.364 -3.240  1.098   1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1203  N N    . LEU A 1 77  ? -3.689  -2.601  -2.301  1.00 0.00 ? 77  LEU A N    1  
ATOM 1204  C CA   . LEU A 1 77  ? -2.707  -1.637  -1.830  1.00 0.00 ? 77  LEU A CA   1  
ATOM 1205  C C    . LEU A 1 77  ? -2.671  -0.449  -2.786  1.00 0.00 ? 77  LEU A C    1  
ATOM 1206  O O    . LEU A 1 77  ? -2.481  0.694   -2.380  1.00 0.00 ? 77  LEU A O    1  
ATOM 1207  C CB   . LEU A 1 77  ? -1.328  -2.290  -1.721  1.00 0.00 ? 77  LEU A CB   1  
ATOM 1208  C CG   . LEU A 1 77  ? -1.003  -2.854  -0.342  1.00 0.00 ? 77  LEU A CG   1  
ATOM 1209  C CD1  . LEU A 1 77  ? 0.119   -3.878  -0.424  1.00 0.00 ? 77  LEU A CD1  1  
ATOM 1210  C CD2  . LEU A 1 77  ? -0.639  -1.726  0.603   1.00 0.00 ? 77  LEU A CD2  1  
ATOM 1211  H H    . LEU A 1 77  ? -3.414  -3.529  -2.458  1.00 0.00 ? 77  LEU A H    1  
ATOM 1212  H HA   . LEU A 1 77  ? -3.017  -1.292  -0.854  1.00 0.00 ? 77  LEU A HA   1  
ATOM 1213  H HB2  . LEU A 1 77  ? -1.272  -3.092  -2.443  1.00 0.00 ? 77  LEU A HB2  1  
ATOM 1214  H HB3  . LEU A 1 77  ? -0.581  -1.551  -1.967  1.00 0.00 ? 77  LEU A HB3  1  
ATOM 1215  H HG   . LEU A 1 77  ? -1.878  -3.350  0.053   1.00 0.00 ? 77  LEU A HG   1  
ATOM 1216  H HD11 . LEU A 1 77  ? -0.302  -4.872  -0.368  1.00 0.00 ? 77  LEU A HD11 1  
ATOM 1217  H HD12 . LEU A 1 77  ? 0.808   -3.730  0.398   1.00 0.00 ? 77  LEU A HD12 1  
ATOM 1218  H HD13 . LEU A 1 77  ? 0.644   -3.762  -1.360  1.00 0.00 ? 77  LEU A HD13 1  
ATOM 1219  H HD21 . LEU A 1 77  ? -0.364  -2.132  1.564   1.00 0.00 ? 77  LEU A HD21 1  
ATOM 1220  H HD22 . LEU A 1 77  ? -1.488  -1.068  0.716   1.00 0.00 ? 77  LEU A HD22 1  
ATOM 1221  H HD23 . LEU A 1 77  ? 0.192   -1.172  0.194   1.00 0.00 ? 77  LEU A HD23 1  
ATOM 1222  N N    . ASN A 1 78  ? -2.896  -0.747  -4.060  1.00 0.00 ? 78  ASN A N    1  
ATOM 1223  C CA   . ASN A 1 78  ? -2.939  0.262   -5.106  1.00 0.00 ? 78  ASN A CA   1  
ATOM 1224  C C    . ASN A 1 78  ? -4.243  1.033   -5.006  1.00 0.00 ? 78  ASN A C    1  
ATOM 1225  O O    . ASN A 1 78  ? -4.280  2.251   -5.178  1.00 0.00 ? 78  ASN A O    1  
ATOM 1226  C CB   . ASN A 1 78  ? -2.856  -0.399  -6.488  1.00 0.00 ? 78  ASN A CB   1  
ATOM 1227  C CG   . ASN A 1 78  ? -1.608  -0.021  -7.255  1.00 0.00 ? 78  ASN A CG   1  
ATOM 1228  O OD1  . ASN A 1 78  ? -1.096  1.092   -7.130  1.00 0.00 ? 78  ASN A OD1  1  
ATOM 1229  N ND2  . ASN A 1 78  ? -1.112  -0.956  -8.055  1.00 0.00 ? 78  ASN A ND2  1  
ATOM 1230  H H    . ASN A 1 78  ? -3.064  -1.680  -4.300  1.00 0.00 ? 78  ASN A H    1  
ATOM 1231  H HA   . ASN A 1 78  ? -2.108  0.936   -4.972  1.00 0.00 ? 78  ASN A HA   1  
ATOM 1232  H HB2  . ASN A 1 78  ? -2.866  -1.469  -6.367  1.00 0.00 ? 78  ASN A HB2  1  
ATOM 1233  H HB3  . ASN A 1 78  ? -3.716  -0.104  -7.073  1.00 0.00 ? 78  ASN A HB3  1  
ATOM 1234  H HD21 . ASN A 1 78  ? -1.578  -1.821  -8.101  1.00 0.00 ? 78  ASN A HD21 1  
ATOM 1235  H HD22 . ASN A 1 78  ? -0.303  -0.745  -8.568  1.00 0.00 ? 78  ASN A HD22 1  
ATOM 1236  N N    . LEU A 1 79  ? -5.320  0.298   -4.738  1.00 0.00 ? 79  LEU A N    1  
ATOM 1237  C CA   . LEU A 1 79  ? -6.633  0.900   -4.628  1.00 0.00 ? 79  LEU A CA   1  
ATOM 1238  C C    . LEU A 1 79  ? -6.687  1.843   -3.438  1.00 0.00 ? 79  LEU A C    1  
ATOM 1239  O O    . LEU A 1 79  ? -6.956  3.027   -3.593  1.00 0.00 ? 79  LEU A O    1  
ATOM 1240  C CB   . LEU A 1 79  ? -7.718  -0.178  -4.512  1.00 0.00 ? 79  LEU A CB   1  
ATOM 1241  C CG   . LEU A 1 79  ? -7.997  -0.972  -5.802  1.00 0.00 ? 79  LEU A CG   1  
ATOM 1242  C CD1  . LEU A 1 79  ? -9.422  -0.815  -6.269  1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1243  C CD2  . LEU A 1 79  ? -7.054  -0.571  -6.915  1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1244  H H    . LEU A 1 79  ? -5.224  -0.670  -4.622  1.00 0.00 ? 79  LEU A H    1  
ATOM 1245  H HA   . LEU A 1 79  ? -6.802  1.457   -5.529  1.00 0.00 ? 79  LEU A HA   1  
ATOM 1246  H HB2  . LEU A 1 79  ? -7.417  -0.876  -3.744  1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1247  H HB3  . LEU A 1 79  ? -8.637  0.296   -4.202  1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1248  H HG   . LEU A 1 79  ? -7.844  -2.007  -5.603  1.00 0.00 ? 79  LEU A HG   1  
ATOM 1249  H HD11 . LEU A 1 79  ? -9.458  -0.066  -7.048  1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1250  H HD12 . LEU A 1 79  ? -10.043 -0.510  -5.441  1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1251  H HD13 . LEU A 1 79  ? -9.773  -1.758  -6.662  1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1252  H HD21 . LEU A 1 79  ? -7.176  -1.249  -7.746  1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1253  H HD22 . LEU A 1 79  ? -6.041  -0.619  -6.556  1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1254  H HD23 . LEU A 1 79  ? -7.283  0.437   -7.229  1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1255  N N    . ILE A 1 80  ? -6.403  1.318   -2.253  1.00 0.00 ? 80  ILE A N    1  
ATOM 1256  C CA   . ILE A 1 80  ? -6.405  2.131   -1.046  1.00 0.00 ? 80  ILE A CA   1  
ATOM 1257  C C    . ILE A 1 80  ? -5.173  3.026   -0.987  1.00 0.00 ? 80  ILE A C    1  
ATOM 1258  O O    . ILE A 1 80  ? -5.270  4.201   -0.633  1.00 0.00 ? 80  ILE A O    1  
ATOM 1259  C CB   . ILE A 1 80  ? -6.485  1.278   0.232   1.00 0.00 ? 80  ILE A CB   1  
ATOM 1260  C CG1  . ILE A 1 80  ? -6.809  2.165   1.433   1.00 0.00 ? 80  ILE A CG1  1  
ATOM 1261  C CG2  . ILE A 1 80  ? -5.185  0.540   0.460   1.00 0.00 ? 80  ILE A CG2  1  
ATOM 1262  C CD1  . ILE A 1 80  ? -5.588  2.805   2.062   1.00 0.00 ? 80  ILE A CD1  1  
ATOM 1263  H H    . ILE A 1 80  ? -6.177  0.371   -2.192  1.00 0.00 ? 80  ILE A H    1  
ATOM 1264  H HA   . ILE A 1 80  ? -7.276  2.754   -1.077  1.00 0.00 ? 80  ILE A HA   1  
ATOM 1265  H HB   . ILE A 1 80  ? -7.270  0.548   0.108   1.00 0.00 ? 80  ILE A HB   1  
ATOM 1266  H HG12 . ILE A 1 80  ? -7.473  2.956   1.120   1.00 0.00 ? 80  ILE A HG12 1  
ATOM 1267  H HG13 . ILE A 1 80  ? -7.299  1.569   2.190   1.00 0.00 ? 80  ILE A HG13 1  
ATOM 1268  H HG21 . ILE A 1 80  ? -5.264  -0.056  1.360   1.00 0.00 ? 80  ILE A HG21 1  
ATOM 1269  H HG22 . ILE A 1 80  ? -4.388  1.265   0.572   1.00 0.00 ? 80  ILE A HG22 1  
ATOM 1270  H HG23 . ILE A 1 80  ? -4.981  -0.095  -0.384  1.00 0.00 ? 80  ILE A HG23 1  
ATOM 1271  H HD11 . ILE A 1 80  ? -5.368  2.310   2.996   1.00 0.00 ? 80  ILE A HD11 1  
ATOM 1272  H HD12 . ILE A 1 80  ? -5.782  3.849   2.240   1.00 0.00 ? 80  ILE A HD12 1  
ATOM 1273  H HD13 . ILE A 1 80  ? -4.741  2.707   1.396   1.00 0.00 ? 80  ILE A HD13 1  
ATOM 1274  N N    . GLY A 1 81  ? -4.013  2.472   -1.341  1.00 0.00 ? 81  GLY A N    1  
ATOM 1275  C CA   . GLY A 1 81  ? -2.793  3.258   -1.322  1.00 0.00 ? 81  GLY A CA   1  
ATOM 1276  C C    . GLY A 1 81  ? -2.957  4.535   -2.114  1.00 0.00 ? 81  GLY A C    1  
ATOM 1277  O O    . GLY A 1 81  ? -2.685  5.624   -1.611  1.00 0.00 ? 81  GLY A O    1  
ATOM 1278  H H    . GLY A 1 81  ? -3.989  1.533   -1.622  1.00 0.00 ? 81  GLY A H    1  
ATOM 1279  H HA2  . GLY A 1 81  ? -2.548  3.505   -0.299  1.00 0.00 ? 81  GLY A HA2  1  
ATOM 1280  H HA3  . GLY A 1 81  ? -1.988  2.681   -1.750  1.00 0.00 ? 81  GLY A HA3  1  
ATOM 1281  N N    . GLY A 1 82  ? -3.437  4.399   -3.347  1.00 0.00 ? 82  GLY A N    1  
ATOM 1282  C CA   . GLY A 1 82  ? -3.666  5.569   -4.180  1.00 0.00 ? 82  GLY A CA   1  
ATOM 1283  C C    . GLY A 1 82  ? -4.536  6.600   -3.480  1.00 0.00 ? 82  GLY A C    1  
ATOM 1284  O O    . GLY A 1 82  ? -4.262  7.798   -3.546  1.00 0.00 ? 82  GLY A O    1  
ATOM 1285  H H    . GLY A 1 82  ? -3.649  3.497   -3.687  1.00 0.00 ? 82  GLY A H    1  
ATOM 1286  H HA2  . GLY A 1 82  ? -2.713  6.026   -4.419  1.00 0.00 ? 82  GLY A HA2  1  
ATOM 1287  H HA3  . GLY A 1 82  ? -4.151  5.263   -5.095  1.00 0.00 ? 82  GLY A HA3  1  
ATOM 1288  N N    . LEU A 1 83  ? -5.583  6.138   -2.794  1.00 0.00 ? 83  LEU A N    1  
ATOM 1289  C CA   . LEU A 1 83  ? -6.469  7.046   -2.068  1.00 0.00 ? 83  LEU A CA   1  
ATOM 1290  C C    . LEU A 1 83  ? -5.690  7.789   -1.000  1.00 0.00 ? 83  LEU A C    1  
ATOM 1291  O O    . LEU A 1 83  ? -5.864  8.992   -0.819  1.00 0.00 ? 83  LEU A O    1  
ATOM 1292  C CB   . LEU A 1 83  ? -7.625  6.291   -1.425  1.00 0.00 ? 83  LEU A CB   1  
ATOM 1293  C CG   . LEU A 1 83  ? -8.141  5.103   -2.226  1.00 0.00 ? 83  LEU A CG   1  
ATOM 1294  C CD1  . LEU A 1 83  ? -9.406  4.556   -1.598  1.00 0.00 ? 83  LEU A CD1  1  
ATOM 1295  C CD2  . LEU A 1 83  ? -8.380  5.499   -3.677  1.00 0.00 ? 83  LEU A CD2  1  
ATOM 1296  H H    . LEU A 1 83  ? -5.756  5.170   -2.767  1.00 0.00 ? 83  LEU A H    1  
ATOM 1297  H HA   . LEU A 1 83  ? -6.863  7.761   -2.775  1.00 0.00 ? 83  LEU A HA   1  
ATOM 1298  H HB2  . LEU A 1 83  ? -7.300  5.933   -0.458  1.00 0.00 ? 83  LEU A HB2  1  
ATOM 1299  H HB3  . LEU A 1 83  ? -8.442  6.981   -1.280  1.00 0.00 ? 83  LEU A HB3  1  
ATOM 1300  H HG   . LEU A 1 83  ? -7.399  4.324   -2.207  1.00 0.00 ? 83  LEU A HG   1  
ATOM 1301  H HD11 . LEU A 1 83  ? -9.356  3.479   -1.573  1.00 0.00 ? 83  LEU A HD11 1  
ATOM 1302  H HD12 . LEU A 1 83  ? -10.260 4.864   -2.182  1.00 0.00 ? 83  LEU A HD12 1  
ATOM 1303  H HD13 . LEU A 1 83  ? -9.498  4.937   -0.592  1.00 0.00 ? 83  LEU A HD13 1  
ATOM 1304  H HD21 . LEU A 1 83  ? -7.971  4.740   -4.326  1.00 0.00 ? 83  LEU A HD21 1  
ATOM 1305  H HD22 . LEU A 1 83  ? -7.898  6.443   -3.881  1.00 0.00 ? 83  LEU A HD22 1  
ATOM 1306  H HD23 . LEU A 1 83  ? -9.440  5.592   -3.854  1.00 0.00 ? 83  LEU A HD23 1  
ATOM 1307  N N    . ALA A 1 84  ? -4.820  7.069   -0.300  1.00 0.00 ? 84  ALA A N    1  
ATOM 1308  C CA   . ALA A 1 84  ? -4.007  7.689   0.742   1.00 0.00 ? 84  ALA A CA   1  
ATOM 1309  C C    . ALA A 1 84  ? -3.247  8.878   0.181   1.00 0.00 ? 84  ALA A C    1  
ATOM 1310  O O    . ALA A 1 84  ? -3.004  9.868   0.871   1.00 0.00 ? 84  ALA A O    1  
ATOM 1311  C CB   . ALA A 1 84  ? -3.010  6.695   1.298   1.00 0.00 ? 84  ALA A CB   1  
ATOM 1312  H H    . ALA A 1 84  ? -4.722  6.101   -0.489  1.00 0.00 ? 84  ALA A H    1  
ATOM 1313  H HA   . ALA A 1 84  ? -4.656  8.015   1.539   1.00 0.00 ? 84  ALA A HA   1  
ATOM 1314  H HB1  . ALA A 1 84  ? -2.798  6.943   2.327   1.00 0.00 ? 84  ALA A HB1  1  
ATOM 1315  H HB2  . ALA A 1 84  ? -2.094  6.747   0.716   1.00 0.00 ? 84  ALA A HB2  1  
ATOM 1316  H HB3  . ALA A 1 84  ? -3.420  5.699   1.240   1.00 0.00 ? 84  ALA A HB3  1  
ATOM 1317  N N    . VAL A 1 85  ? -2.876  8.759   -1.082  1.00 0.00 ? 85  VAL A N    1  
ATOM 1318  C CA   . VAL A 1 85  ? -2.137  9.805   -1.772  1.00 0.00 ? 85  VAL A CA   1  
ATOM 1319  C C    . VAL A 1 85  ? -3.071  10.853  -2.357  1.00 0.00 ? 85  VAL A C    1  
ATOM 1320  O O    . VAL A 1 85  ? -2.653  11.961  -2.687  1.00 0.00 ? 85  VAL A O    1  
ATOM 1321  C CB   . VAL A 1 85  ? -1.220  9.244   -2.887  1.00 0.00 ? 85  VAL A CB   1  
ATOM 1322  C CG1  . VAL A 1 85  ? 0.209   9.673   -2.629  1.00 0.00 ? 85  VAL A CG1  1  
ATOM 1323  C CG2  . VAL A 1 85  ? -1.297  7.723   -2.985  1.00 0.00 ? 85  VAL A CG2  1  
ATOM 1324  H H    . VAL A 1 85  ? -3.110  7.943   -1.565  1.00 0.00 ? 85  VAL A H    1  
ATOM 1325  H HA   . VAL A 1 85  ? -1.515  10.290  -1.043  1.00 0.00 ? 85  VAL A HA   1  
ATOM 1326  H HB   . VAL A 1 85  ? -1.536  9.658   -3.834  1.00 0.00 ? 85  VAL A HB   1  
ATOM 1327  H HG11 . VAL A 1 85  ? 0.671   8.972   -1.945  1.00 0.00 ? 85  VAL A HG11 1  
ATOM 1328  H HG12 . VAL A 1 85  ? 0.215   10.659  -2.190  1.00 0.00 ? 85  VAL A HG12 1  
ATOM 1329  H HG13 . VAL A 1 85  ? 0.756   9.688   -3.556  1.00 0.00 ? 85  VAL A HG13 1  
ATOM 1330  H HG21 . VAL A 1 85  ? -0.650  7.280   -2.243  1.00 0.00 ? 85  VAL A HG21 1  
ATOM 1331  H HG22 . VAL A 1 85  ? -0.984  7.412   -3.967  1.00 0.00 ? 85  VAL A HG22 1  
ATOM 1332  H HG23 . VAL A 1 85  ? -2.308  7.399   -2.821  1.00 0.00 ? 85  VAL A HG23 1  
ATOM 1333  N N    . ALA A 1 86  ? -4.334  10.492  -2.481  1.00 0.00 ? 86  ALA A N    1  
ATOM 1334  C CA   . ALA A 1 86  ? -5.336  11.387  -3.022  1.00 0.00 ? 86  ALA A CA   1  
ATOM 1335  C C    . ALA A 1 86  ? -6.346  11.794  -1.954  1.00 0.00 ? 86  ALA A C    1  
ATOM 1336  O O    . ALA A 1 86  ? -7.407  12.337  -2.262  1.00 0.00 ? 86  ALA A O    1  
ATOM 1337  C CB   . ALA A 1 86  ? -6.029  10.703  -4.175  1.00 0.00 ? 86  ALA A CB   1  
ATOM 1338  H H    . ALA A 1 86  ? -4.604  9.595   -2.200  1.00 0.00 ? 86  ALA A H    1  
ATOM 1339  H HA   . ALA A 1 86  ? -4.838  12.269  -3.398  1.00 0.00 ? 86  ALA A HA   1  
ATOM 1340  H HB1  . ALA A 1 86  ? -6.233  11.421  -4.953  1.00 0.00 ? 86  ALA A HB1  1  
ATOM 1341  H HB2  . ALA A 1 86  ? -6.952  10.267  -3.828  1.00 0.00 ? 86  ALA A HB2  1  
ATOM 1342  H HB3  . ALA A 1 86  ? -5.383  9.926   -4.557  1.00 0.00 ? 86  ALA A HB3  1  
ATOM 1343  N N    . CYS A 1 87  ? -6.009  11.523  -0.698  1.00 0.00 ? 87  CYS A N    1  
ATOM 1344  C CA   . CYS A 1 87  ? -6.881  11.852  0.418   1.00 0.00 ? 87  CYS A CA   1  
ATOM 1345  C C    . CYS A 1 87  ? -6.075  12.033  1.699   1.00 0.00 ? 87  CYS A C    1  
ATOM 1346  O O    . CYS A 1 87  ? -6.314  12.967  2.464   1.00 0.00 ? 87  CYS A O    1  
ATOM 1347  C CB   . CYS A 1 87  ? -7.934  10.758  0.608   1.00 0.00 ? 87  CYS A CB   1  
ATOM 1348  S SG   . CYS A 1 87  ? -9.325  11.249  1.654   1.00 0.00 ? 87  CYS A SG   1  
ATOM 1349  H H    . CYS A 1 87  ? -5.152  11.086  -0.518  1.00 0.00 ? 87  CYS A H    1  
ATOM 1350  H HA   . CYS A 1 87  ? -7.379  12.782  0.185   1.00 0.00 ? 87  CYS A HA   1  
ATOM 1351  H HB2  . CYS A 1 87  ? -8.332  10.481  -0.357  1.00 0.00 ? 87  CYS A HB2  1  
ATOM 1352  H HB3  . CYS A 1 87  ? -7.469  9.897   1.062   1.00 0.00 ? 87  CYS A HB3  1  
ATOM 1353  H HG   . CYS A 1 87  ? -10.135 10.982  1.214   1.00 0.00 ? 87  CYS A HG   1  
ATOM 1354  N N    . HIS A 1 88  ? -5.115  11.137  1.933   1.00 0.00 ? 88  HIS A N    1  
ATOM 1355  C CA   . HIS A 1 88  ? -4.283  11.222  3.128   1.00 0.00 ? 88  HIS A CA   1  
ATOM 1356  C C    . HIS A 1 88  ? -2.993  11.988  2.841   1.00 0.00 ? 88  HIS A C    1  
ATOM 1357  O O    . HIS A 1 88  ? -2.883  12.675  1.827   1.00 0.00 ? 88  HIS A O    1  
ATOM 1358  C CB   . HIS A 1 88  ? -3.963  9.822   3.657   1.00 0.00 ? 88  HIS A CB   1  
ATOM 1359  C CG   . HIS A 1 88  ? -4.373  9.614   5.081   1.00 0.00 ? 88  HIS A CG   1  
ATOM 1360  N ND1  . HIS A 1 88  ? -3.537  9.858   6.150   1.00 0.00 ? 88  HIS A ND1  1  
ATOM 1361  C CD2  . HIS A 1 88  ? -5.543  9.185   5.613   1.00 0.00 ? 88  HIS A CD2  1  
ATOM 1362  C CE1  . HIS A 1 88  ? -4.173  9.587   7.276   1.00 0.00 ? 88  HIS A CE1  1  
ATOM 1363  N NE2  . HIS A 1 88  ? -5.391  9.178   6.977   1.00 0.00 ? 88  HIS A NE2  1  
ATOM 1364  H H    . HIS A 1 88  ? -4.962  10.407  1.288   1.00 0.00 ? 88  HIS A H    1  
ATOM 1365  H HA   . HIS A 1 88  ? -4.843  11.759  3.880   1.00 0.00 ? 88  HIS A HA   1  
ATOM 1366  H HB2  . HIS A 1 88  ? -4.480  9.092   3.054   1.00 0.00 ? 88  HIS A HB2  1  
ATOM 1367  H HB3  . HIS A 1 88  ? -2.899  9.652   3.587   1.00 0.00 ? 88  HIS A HB3  1  
ATOM 1368  H HD1  . HIS A 1 88  ? -2.613  10.180  6.093   1.00 0.00 ? 88  HIS A HD1  1  
ATOM 1369  H HD2  . HIS A 1 88  ? -6.430  8.901   5.063   1.00 0.00 ? 88  HIS A HD2  1  
ATOM 1370  H HE1  . HIS A 1 88  ? -3.767  9.686   8.271   1.00 0.00 ? 88  HIS A HE1  1  
ATOM 1371  H HE2  . HIS A 1 88  ? -6.045  8.831   7.620   1.00 0.00 ? 88  HIS A HE2  1  
ATOM 1372  N N    . GLU A 1 89  ? -2.023  11.866  3.742   1.00 0.00 ? 89  GLU A N    1  
ATOM 1373  C CA   . GLU A 1 89  ? -0.742  12.548  3.588   1.00 0.00 ? 89  GLU A CA   1  
ATOM 1374  C C    . GLU A 1 89  ? -0.060  12.140  2.281   1.00 0.00 ? 89  GLU A C    1  
ATOM 1375  O O    . GLU A 1 89  ? -0.701  11.591  1.384   1.00 0.00 ? 89  GLU A O    1  
ATOM 1376  C CB   . GLU A 1 89  ? 0.166   12.238  4.781   1.00 0.00 ? 89  GLU A CB   1  
ATOM 1377  C CG   . GLU A 1 89  ? -0.475  12.536  6.127   1.00 0.00 ? 89  GLU A CG   1  
ATOM 1378  C CD   . GLU A 1 89  ? 0.043   11.634  7.231   1.00 0.00 ? 89  GLU A CD   1  
ATOM 1379  O OE1  . GLU A 1 89  ? 1.214   11.801  7.634   1.00 0.00 ? 89  GLU A OE1  1  
ATOM 1380  O OE2  . GLU A 1 89  ? -0.722  10.761  7.693   1.00 0.00 ? 89  GLU A OE2  1  
ATOM 1381  H H    . GLU A 1 89  ? -2.172  11.305  4.531   1.00 0.00 ? 89  GLU A H    1  
ATOM 1382  H HA   . GLU A 1 89  ? -0.935  13.610  3.561   1.00 0.00 ? 89  GLU A HA   1  
ATOM 1383  H HB2  . GLU A 1 89  ? 0.430   11.191  4.756   1.00 0.00 ? 89  GLU A HB2  1  
ATOM 1384  H HB3  . GLU A 1 89  ? 1.066   12.828  4.698   1.00 0.00 ? 89  GLU A HB3  1  
ATOM 1385  H HG2  . GLU A 1 89  ? -0.263  13.561  6.393   1.00 0.00 ? 89  GLU A HG2  1  
ATOM 1386  H HG3  . GLU A 1 89  ? -1.542  12.401  6.042   1.00 0.00 ? 89  GLU A HG3  1  
ATOM 1387  N N    . SER A 1 90  ? 1.241   12.415  2.181   1.00 0.00 ? 90  SER A N    1  
ATOM 1388  C CA   . SER A 1 90  ? 2.020   12.084  0.987   1.00 0.00 ? 90  SER A CA   1  
ATOM 1389  C C    . SER A 1 90  ? 1.833   13.140  -0.099  1.00 0.00 ? 90  SER A C    1  
ATOM 1390  O O    . SER A 1 90  ? 2.800   13.744  -0.562  1.00 0.00 ? 90  SER A O    1  
ATOM 1391  C CB   . SER A 1 90  ? 1.638   10.701  0.446   1.00 0.00 ? 90  SER A CB   1  
ATOM 1392  O OG   . SER A 1 90  ? 2.762   10.043  -0.111  1.00 0.00 ? 90  SER A OG   1  
ATOM 1393  H H    . SER A 1 90  ? 1.692   12.857  2.928   1.00 0.00 ? 90  SER A H    1  
ATOM 1394  H HA   . SER A 1 90  ? 3.062   12.068  1.273   1.00 0.00 ? 90  SER A HA   1  
ATOM 1395  H HB2  . SER A 1 90  ? 1.247   10.099  1.251   1.00 0.00 ? 90  SER A HB2  1  
ATOM 1396  H HB3  . SER A 1 90  ? 0.884   10.813  -0.319  1.00 0.00 ? 90  SER A HB3  1  
ATOM 1397  H HG   . SER A 1 90  ? 3.258   9.609   0.587   1.00 0.00 ? 90  SER A HG   1  
ATOM 1398  N N    . PHE A 1 91  ? 0.586   13.359  -0.500  1.00 0.00 ? 91  PHE A N    1  
ATOM 1399  C CA   . PHE A 1 91  ? 0.277   14.345  -1.531  1.00 0.00 ? 91  PHE A CA   1  
ATOM 1400  C C    . PHE A 1 91  ? -0.640  15.433  -0.982  1.00 0.00 ? 91  PHE A C    1  
ATOM 1401  O O    . PHE A 1 91  ? -0.418  16.621  -1.215  1.00 0.00 ? 91  PHE A O    1  
ATOM 1402  C CB   . PHE A 1 91  ? -0.377  13.664  -2.735  1.00 0.00 ? 91  PHE A CB   1  
ATOM 1403  C CG   . PHE A 1 91  ? 0.450   13.739  -3.987  1.00 0.00 ? 91  PHE A CG   1  
ATOM 1404  C CD1  . PHE A 1 91  ? 0.657   14.952  -4.625  1.00 0.00 ? 91  PHE A CD1  1  
ATOM 1405  C CD2  . PHE A 1 91  ? 1.021   12.596  -4.525  1.00 0.00 ? 91  PHE A CD2  1  
ATOM 1406  C CE1  . PHE A 1 91  ? 1.419   15.023  -5.776  1.00 0.00 ? 91  PHE A CE1  1  
ATOM 1407  C CE2  . PHE A 1 91  ? 1.783   12.662  -5.676  1.00 0.00 ? 91  PHE A CE2  1  
ATOM 1408  C CZ   . PHE A 1 91  ? 1.982   13.877  -6.303  1.00 0.00 ? 91  PHE A CZ   1  
ATOM 1409  H H    . PHE A 1 91  ? -0.145  12.848  -0.095  1.00 0.00 ? 91  PHE A H    1  
ATOM 1410  H HA   . PHE A 1 91  ? 1.206   14.798  -1.844  1.00 0.00 ? 91  PHE A HA   1  
ATOM 1411  H HB2  . PHE A 1 91  ? -0.538  12.622  -2.507  1.00 0.00 ? 91  PHE A HB2  1  
ATOM 1412  H HB3  . PHE A 1 91  ? -1.329  14.136  -2.935  1.00 0.00 ? 91  PHE A HB3  1  
ATOM 1413  H HD1  . PHE A 1 91  ? 0.217   15.848  -4.215  1.00 0.00 ? 91  PHE A HD1  1  
ATOM 1414  H HD2  . PHE A 1 91  ? 0.866   11.646  -4.036  1.00 0.00 ? 91  PHE A HD2  1  
ATOM 1415  H HE1  . PHE A 1 91  ? 1.572   15.975  -6.264  1.00 0.00 ? 91  PHE A HE1  1  
ATOM 1416  H HE2  . PHE A 1 91  ? 2.223   11.764  -6.086  1.00 0.00 ? 91  PHE A HE2  1  
ATOM 1417  H HZ   . PHE A 1 91  ? 2.578   13.930  -7.202  1.00 0.00 ? 91  PHE A HZ   1  
ATOM 1418  N N    . VAL A 1 92  ? -1.669  15.018  -0.252  1.00 0.00 ? 92  VAL A N    1  
ATOM 1419  C CA   . VAL A 1 92  ? -2.619  15.957  0.332   1.00 0.00 ? 92  VAL A CA   1  
ATOM 1420  C C    . VAL A 1 92  ? -2.000  16.684  1.523   1.00 0.00 ? 92  VAL A C    1  
ATOM 1421  O O    . VAL A 1 92  ? -0.946  16.288  2.020   1.00 0.00 ? 92  VAL A O    1  
ATOM 1422  C CB   . VAL A 1 92  ? -3.910  15.243  0.790   1.00 0.00 ? 92  VAL A CB   1  
ATOM 1423  C CG1  . VAL A 1 92  ? -5.034  16.245  1.001   1.00 0.00 ? 92  VAL A CG1  1  
ATOM 1424  C CG2  . VAL A 1 92  ? -4.323  14.180  -0.220  1.00 0.00 ? 92  VAL A CG2  1  
ATOM 1425  H H    . VAL A 1 92  ? -1.791  14.058  -0.100  1.00 0.00 ? 92  VAL A H    1  
ATOM 1426  H HA   . VAL A 1 92  ? -2.880  16.682  -0.425  1.00 0.00 ? 92  VAL A HA   1  
ATOM 1427  H HB   . VAL A 1 92  ? -3.713  14.755  1.733   1.00 0.00 ? 92  VAL A HB   1  
ATOM 1428  H HG11 . VAL A 1 92  ? -4.915  17.071  0.314   1.00 0.00 ? 92  VAL A HG11 1  
ATOM 1429  H HG12 . VAL A 1 92  ? -5.002  16.614  2.015   1.00 0.00 ? 92  VAL A HG12 1  
ATOM 1430  H HG13 . VAL A 1 92  ? -5.984  15.764  0.823   1.00 0.00 ? 92  VAL A HG13 1  
ATOM 1431  H HG21 . VAL A 1 92  ? -3.641  13.345  -0.163  1.00 0.00 ? 92  VAL A HG21 1  
ATOM 1432  H HG22 . VAL A 1 92  ? -4.297  14.600  -1.215  1.00 0.00 ? 92  VAL A HG22 1  
ATOM 1433  H HG23 . VAL A 1 92  ? -5.325  13.843  0.003   1.00 0.00 ? 92  VAL A HG23 1  
ATOM 1434  N N    . LYS A 1 93  ? -2.655  17.755  1.969   1.00 0.00 ? 93  LYS A N    1  
ATOM 1435  C CA   . LYS A 1 93  ? -2.169  18.547  3.099   1.00 0.00 ? 93  LYS A CA   1  
ATOM 1436  C C    . LYS A 1 93  ? -0.688  18.890  2.940   1.00 0.00 ? 93  LYS A C    1  
ATOM 1437  O O    . LYS A 1 93  ? 0.025   19.075  3.926   1.00 0.00 ? 93  LYS A O    1  
ATOM 1438  C CB   . LYS A 1 93  ? -2.402  17.802  4.420   1.00 0.00 ? 93  LYS A CB   1  
ATOM 1439  C CG   . LYS A 1 93  ? -1.514  16.581  4.611   1.00 0.00 ? 93  LYS A CG   1  
ATOM 1440  C CD   . LYS A 1 93  ? -1.327  16.250  6.085   1.00 0.00 ? 93  LYS A CD   1  
ATOM 1441  C CE   . LYS A 1 93  ? 0.138   16.301  6.492   1.00 0.00 ? 93  LYS A CE   1  
ATOM 1442  N NZ   . LYS A 1 93  ? 0.422   17.446  7.401   1.00 0.00 ? 93  LYS A NZ   1  
ATOM 1443  H H    . LYS A 1 93  ? -3.485  18.024  1.525   1.00 0.00 ? 93  LYS A H    1  
ATOM 1444  H HA   . LYS A 1 93  ? -2.733  19.468  3.117   1.00 0.00 ? 93  LYS A HA   1  
ATOM 1445  H HB2  . LYS A 1 93  ? -2.220  18.483  5.238   1.00 0.00 ? 93  LYS A HB2  1  
ATOM 1446  H HB3  . LYS A 1 93  ? -3.433  17.479  4.457   1.00 0.00 ? 93  LYS A HB3  1  
ATOM 1447  H HG2  . LYS A 1 93  ? -1.972  15.736  4.119   1.00 0.00 ? 93  LYS A HG2  1  
ATOM 1448  H HG3  . LYS A 1 93  ? -0.548  16.777  4.169   1.00 0.00 ? 93  LYS A HG3  1  
ATOM 1449  H HD2  . LYS A 1 93  ? -1.879  16.965  6.679   1.00 0.00 ? 93  LYS A HD2  1  
ATOM 1450  H HD3  . LYS A 1 93  ? -1.709  15.257  6.271   1.00 0.00 ? 93  LYS A HD3  1  
ATOM 1451  H HE2  . LYS A 1 93  ? 0.390   15.381  6.998   1.00 0.00 ? 93  LYS A HE2  1  
ATOM 1452  H HE3  . LYS A 1 93  ? 0.743   16.399  5.603   1.00 0.00 ? 93  LYS A HE3  1  
ATOM 1453  H HZ1  . LYS A 1 93  ? -0.249  17.447  8.195   1.00 0.00 ? 93  LYS A HZ1  1  
ATOM 1454  H HZ2  . LYS A 1 93  ? 0.332   18.343  6.884   1.00 0.00 ? 93  LYS A HZ2  1  
ATOM 1455  H HZ3  . LYS A 1 93  ? 1.390   17.371  7.777   1.00 0.00 ? 93  LYS A HZ3  1  
ATOM 1456  N N    . ALA A 1 94  ? -0.239  18.972  1.693   1.00 0.00 ? 94  ALA A N    1  
ATOM 1457  C CA   . ALA A 1 94  ? 1.154   19.292  1.401   1.00 0.00 ? 94  ALA A CA   1  
ATOM 1458  C C    . ALA A 1 94  ? 1.257   20.403  0.361   1.00 0.00 ? 94  ALA A C    1  
ATOM 1459  O O    . ALA A 1 94  ? 2.131   21.266  0.443   1.00 0.00 ? 94  ALA A O    1  
ATOM 1460  C CB   . ALA A 1 94  ? 1.891   18.051  0.924   1.00 0.00 ? 94  ALA A CB   1  
ATOM 1461  H H    . ALA A 1 94  ? -0.857  18.815  0.951   1.00 0.00 ? 94  ALA A H    1  
ATOM 1462  H HA   . ALA A 1 94  ? 1.619   19.627  2.317   1.00 0.00 ? 94  ALA A HA   1  
ATOM 1463  H HB1  . ALA A 1 94  ? 2.652   18.336  0.212   1.00 0.00 ? 94  ALA A HB1  1  
ATOM 1464  H HB2  . ALA A 1 94  ? 1.191   17.376  0.452   1.00 0.00 ? 94  ALA A HB2  1  
ATOM 1465  H HB3  . ALA A 1 94  ? 2.353   17.560  1.767   1.00 0.00 ? 94  ALA A HB3  1  
ATOM 1466  N N    . ALA A 1 95  ? 0.357   20.376  -0.619  1.00 0.00 ? 95  ALA A N    1  
ATOM 1467  C CA   . ALA A 1 95  ? 0.346   21.380  -1.676  1.00 0.00 ? 95  ALA A CA   1  
ATOM 1468  C C    . ALA A 1 95  ? -1.060  21.938  -1.889  1.00 0.00 ? 95  ALA A C    1  
ATOM 1469  O O    . ALA A 1 95  ? -1.668  21.727  -2.939  1.00 0.00 ? 95  ALA A O    1  
ATOM 1470  C CB   . ALA A 1 95  ? 0.882   20.782  -2.969  1.00 0.00 ? 95  ALA A CB   1  
ATOM 1471  H H    . ALA A 1 95  ? -0.314  19.665  -0.632  1.00 0.00 ? 95  ALA A H    1  
ATOM 1472  H HA   . ALA A 1 95  ? 1.002   22.186  -1.381  1.00 0.00 ? 95  ALA A HA   1  
ATOM 1473  H HB1  . ALA A 1 95  ? 0.773   19.708  -2.940  1.00 0.00 ? 95  ALA A HB1  1  
ATOM 1474  H HB2  . ALA A 1 95  ? 1.926   21.036  -3.076  1.00 0.00 ? 95  ALA A HB2  1  
ATOM 1475  H HB3  . ALA A 1 95  ? 0.327   21.177  -3.807  1.00 0.00 ? 95  ALA A HB3  1  
ATOM 1476  N N    . PRO A 1 96  ? -1.600  22.662  -0.893  1.00 0.00 ? 96  PRO A N    1  
ATOM 1477  C CA   . PRO A 1 96  ? -2.941  23.251  -0.982  1.00 0.00 ? 96  PRO A CA   1  
ATOM 1478  C C    . PRO A 1 96  ? -3.087  24.183  -2.184  1.00 0.00 ? 96  PRO A C    1  
ATOM 1479  O O    . PRO A 1 96  ? -4.064  24.098  -2.926  1.00 0.00 ? 96  PRO A O    1  
ATOM 1480  C CB   . PRO A 1 96  ? -3.078  24.032  0.331   1.00 0.00 ? 96  PRO A CB   1  
ATOM 1481  C CG   . PRO A 1 96  ? -2.110  23.386  1.256   1.00 0.00 ? 96  PRO A CG   1  
ATOM 1482  C CD   . PRO A 1 96  ? -0.955  22.971  0.396   1.00 0.00 ? 96  PRO A CD   1  
ATOM 1483  H HA   . PRO A 1 96  ? -3.703  22.487  -1.030  1.00 0.00 ? 96  PRO A HA   1  
ATOM 1484  H HB2  . PRO A 1 96  ? -2.830  25.068  0.163   1.00 0.00 ? 96  PRO A HB2  1  
ATOM 1485  H HB3  . PRO A 1 96  ? -4.089  23.951  0.697   1.00 0.00 ? 96  PRO A HB3  1  
ATOM 1486  H HG2  . PRO A 1 96  ? -1.789  24.092  2.007   1.00 0.00 ? 96  PRO A HG2  1  
ATOM 1487  H HG3  . PRO A 1 96  ? -2.563  22.521  1.720   1.00 0.00 ? 96  PRO A HG3  1  
ATOM 1488  H HD2  . PRO A 1 96  ? -0.255  23.786  0.292   1.00 0.00 ? 96  PRO A HD2  1  
ATOM 1489  H HD3  . PRO A 1 96  ? -0.470  22.098  0.805   1.00 0.00 ? 96  PRO A HD3  1  
ATOM 1490  N N    . PRO A 1 97  ? -2.112  25.088  -2.400  1.00 0.00 ? 97  PRO A N    1  
ATOM 1491  C CA   . PRO A 1 97  ? -2.143  26.025  -3.518  1.00 0.00 ? 97  PRO A CA   1  
ATOM 1492  C C    . PRO A 1 97  ? -1.520  25.442  -4.785  1.00 0.00 ? 97  PRO A C    1  
ATOM 1493  O O    . PRO A 1 97  ? -1.329  26.149  -5.774  1.00 0.00 ? 97  PRO A O    1  
ATOM 1494  C CB   . PRO A 1 97  ? -1.301  27.182  -2.994  1.00 0.00 ? 97  PRO A CB   1  
ATOM 1495  C CG   . PRO A 1 97  ? -0.273  26.534  -2.127  1.00 0.00 ? 97  PRO A CG   1  
ATOM 1496  C CD   . PRO A 1 97  ? -0.901  25.272  -1.576  1.00 0.00 ? 97  PRO A CD   1  
ATOM 1497  H HA   . PRO A 1 97  ? -3.146  26.366  -3.727  1.00 0.00 ? 97  PRO A HA   1  
ATOM 1498  H HB2  . PRO A 1 97  ? -0.849  27.707  -3.823  1.00 0.00 ? 97  PRO A HB2  1  
ATOM 1499  H HB3  . PRO A 1 97  ? -1.924  27.859  -2.428  1.00 0.00 ? 97  PRO A HB3  1  
ATOM 1500  H HG2  . PRO A 1 97  ? 0.598   26.289  -2.715  1.00 0.00 ? 97  PRO A HG2  1  
ATOM 1501  H HG3  . PRO A 1 97  ? -0.005  27.199  -1.319  1.00 0.00 ? 97  PRO A HG3  1  
ATOM 1502  H HD2  . PRO A 1 97  ? -0.227  24.436  -1.694  1.00 0.00 ? 97  PRO A HD2  1  
ATOM 1503  H HD3  . PRO A 1 97  ? -1.157  25.405  -0.537  1.00 0.00 ? 97  PRO A HD3  1  
ATOM 1504  N N    . GLN A 1 98  ? -1.200  24.150  -4.748  1.00 0.00 ? 98  GLN A N    1  
ATOM 1505  C CA   . GLN A 1 98  ? -0.595  23.479  -5.892  1.00 0.00 ? 98  GLN A CA   1  
ATOM 1506  C C    . GLN A 1 98  ? -1.411  22.258  -6.306  1.00 0.00 ? 98  GLN A C    1  
ATOM 1507  O O    . GLN A 1 98  ? -0.858  21.251  -6.750  1.00 0.00 ? 98  GLN A O    1  
ATOM 1508  C CB   . GLN A 1 98  ? 0.840   23.063  -5.558  1.00 0.00 ? 98  GLN A CB   1  
ATOM 1509  C CG   . GLN A 1 98  ? 1.886   24.069  -6.013  1.00 0.00 ? 98  GLN A CG   1  
ATOM 1510  C CD   . GLN A 1 98  ? 2.621   23.621  -7.260  1.00 0.00 ? 98  GLN A CD   1  
ATOM 1511  O OE1  . GLN A 1 98  ? 2.211   22.674  -7.931  1.00 0.00 ? 98  GLN A OE1  1  
ATOM 1512  N NE2  . GLN A 1 98  ? 3.717   24.302  -7.578  1.00 0.00 ? 98  GLN A NE2  1  
ATOM 1513  H H    . GLN A 1 98  ? -1.373  23.637  -3.932  1.00 0.00 ? 98  GLN A H    1  
ATOM 1514  H HA   . GLN A 1 98  ? -0.575  24.179  -6.714  1.00 0.00 ? 98  GLN A HA   1  
ATOM 1515  H HB2  . GLN A 1 98  ? 0.929   22.943  -4.488  1.00 0.00 ? 98  GLN A HB2  1  
ATOM 1516  H HB3  . GLN A 1 98  ? 1.051   22.117  -6.036  1.00 0.00 ? 98  GLN A HB3  1  
ATOM 1517  H HG2  . GLN A 1 98  ? 1.397   25.008  -6.220  1.00 0.00 ? 98  GLN A HG2  1  
ATOM 1518  H HG3  . GLN A 1 98  ? 2.604   24.205  -5.218  1.00 0.00 ? 98  GLN A HG3  1  
ATOM 1519  H HE21 . GLN A 1 98  ? 3.986   25.047  -6.994  1.00 0.00 ? 98  GLN A HE21 1  
ATOM 1520  H HE22 . GLN A 1 98  ? 4.213   24.031  -8.384  1.00 0.00 ? 98  GLN A HE22 1  
ATOM 1521  N N    . LYS A 1 99  ? -2.728  22.353  -6.160  1.00 0.00 ? 99  LYS A N    1  
ATOM 1522  C CA   . LYS A 1 99  ? -3.618  21.254  -6.522  1.00 0.00 ? 99  LYS A CA   1  
ATOM 1523  C C    . LYS A 1 99  ? -4.522  21.647  -7.687  1.00 0.00 ? 99  LYS A C    1  
ATOM 1524  O O    . LYS A 1 99  ? -4.990  22.783  -7.767  1.00 0.00 ? 99  LYS A O    1  
ATOM 1525  C CB   . LYS A 1 99  ? -4.465  20.836  -5.318  1.00 0.00 ? 99  LYS A CB   1  
ATOM 1526  C CG   . LYS A 1 99  ? -5.481  21.883  -4.890  1.00 0.00 ? 99  LYS A CG   1  
ATOM 1527  C CD   . LYS A 1 99  ? -6.514  21.300  -3.940  1.00 0.00 ? 99  LYS A CD   1  
ATOM 1528  C CE   . LYS A 1 99  ? -7.786  20.904  -4.674  1.00 0.00 ? 99  LYS A CE   1  
ATOM 1529  N NZ   . LYS A 1 99  ? -8.734  20.172  -3.789  1.00 0.00 ? 99  LYS A NZ   1  
ATOM 1530  H H    . LYS A 1 99  ? -3.113  23.181  -5.803  1.00 0.00 ? 99  LYS A H    1  
ATOM 1531  H HA   . LYS A 1 99  ? -3.004  20.420  -6.826  1.00 0.00 ? 99  LYS A HA   1  
ATOM 1532  H HB2  . LYS A 1 99  ? -4.999  19.930  -5.566  1.00 0.00 ? 99  LYS A HB2  1  
ATOM 1533  H HB3  . LYS A 1 99  ? -3.810  20.639  -4.482  1.00 0.00 ? 99  LYS A HB3  1  
ATOM 1534  H HG2  . LYS A 1 99  ? -4.964  22.690  -4.393  1.00 0.00 ? 99  LYS A HG2  1  
ATOM 1535  H HG3  . LYS A 1 99  ? -5.985  22.262  -5.767  1.00 0.00 ? 99  LYS A HG3  1  
ATOM 1536  H HD2  . LYS A 1 99  ? -6.099  20.425  -3.463  1.00 0.00 ? 99  LYS A HD2  1  
ATOM 1537  H HD3  . LYS A 1 99  ? -6.757  22.039  -3.190  1.00 0.00 ? 99  LYS A HD3  1  
ATOM 1538  H HE2  . LYS A 1 99  ? -8.268  21.798  -5.040  1.00 0.00 ? 99  LYS A HE2  1  
ATOM 1539  H HE3  . LYS A 1 99  ? -7.522  20.271  -5.507  1.00 0.00 ? 99  LYS A HE3  1  
ATOM 1540  H HZ1  . LYS A 1 99  ? -8.548  20.408  -2.793  1.00 0.00 ? 99  LYS A HZ1  1  
ATOM 1541  H HZ2  . LYS A 1 99  ? -8.622  19.146  -3.916  1.00 0.00 ? 99  LYS A HZ2  1  
ATOM 1542  H HZ3  . LYS A 1 99  ? -9.714  20.435  -4.020  1.00 0.00 ? 99  LYS A HZ3  1  
ATOM 1543  N N    . ARG A 1 100 ? -4.764  20.700  -8.588  1.00 0.00 ? 100 ARG A N    1  
ATOM 1544  C CA   . ARG A 1 100 ? -5.612  20.948  -9.747  1.00 0.00 ? 100 ARG A CA   1  
ATOM 1545  C C    . ARG A 1 100 ? -6.082  19.637  -10.369 1.00 0.00 ? 100 ARG A C    1  
ATOM 1546  O O    . ARG A 1 100 ? -5.805  18.556  -9.846  1.00 0.00 ? 100 ARG A O    1  
ATOM 1547  C CB   . ARG A 1 100 ? -4.858  21.782  -10.787 1.00 0.00 ? 100 ARG A CB   1  
ATOM 1548  C CG   . ARG A 1 100 ? -5.645  22.981  -11.292 1.00 0.00 ? 100 ARG A CG   1  
ATOM 1549  C CD   . ARG A 1 100 ? -6.027  22.826  -12.756 1.00 0.00 ? 100 ARG A CD   1  
ATOM 1550  N NE   . ARG A 1 100 ? -5.219  23.678  -13.626 1.00 0.00 ? 100 ARG A NE   1  
ATOM 1551  C CZ   . ARG A 1 100 ? -5.564  24.008  -14.868 1.00 0.00 ? 100 ARG A CZ   1  
ATOM 1552  N NH1  . ARG A 1 100 ? -6.699  23.561  -15.391 1.00 0.00 ? 100 ARG A NH1  1  
ATOM 1553  N NH2  . ARG A 1 100 ? -4.771  24.788  -15.591 1.00 0.00 ? 100 ARG A NH2  1  
ATOM 1554  H H    . ARG A 1 100 ? -4.362  19.814  -8.469  1.00 0.00 ? 100 ARG A H    1  
ATOM 1555  H HA   . ARG A 1 100 ? -6.475  21.503  -9.413  1.00 0.00 ? 100 ARG A HA   1  
ATOM 1556  H HB2  . ARG A 1 100 ? -3.941  22.141  -10.345 1.00 0.00 ? 100 ARG A HB2  1  
ATOM 1557  H HB3  . ARG A 1 100 ? -4.617  21.153  -11.632 1.00 0.00 ? 100 ARG A HB3  1  
ATOM 1558  H HG2  . ARG A 1 100 ? -6.546  23.081  -10.705 1.00 0.00 ? 100 ARG A HG2  1  
ATOM 1559  H HG3  . ARG A 1 100 ? -5.040  23.868  -11.179 1.00 0.00 ? 100 ARG A HG3  1  
ATOM 1560  H HD2  . ARG A 1 100 ? -5.885  21.796  -13.046 1.00 0.00 ? 100 ARG A HD2  1  
ATOM 1561  H HD3  . ARG A 1 100 ? -7.067  23.092  -12.873 1.00 0.00 ? 100 ARG A HD3  1  
ATOM 1562  H HE   . ARG A 1 100 ? -4.375  24.023  -13.265 1.00 0.00 ? 100 ARG A HE   1  
ATOM 1563  H HH11 . ARG A 1 100 ? -7.300  22.972  -14.852 1.00 0.00 ? 100 ARG A HH11 1  
ATOM 1564  H HH12 . ARG A 1 100 ? -6.951  23.813  -16.325 1.00 0.00 ? 100 ARG A HH12 1  
ATOM 1565  H HH22 . ARG A 1 100 ? -5.029  25.036  -16.524 1.00 0.00 ? 100 ARG A HH22 1  
ATOM 1566  N N    . PHE A 1 101 ? -6.794  19.738  -11.486 1.00 0.00 ? 101 PHE A N    1  
ATOM 1567  C CA   . PHE A 1 101 ? -7.302  18.560  -12.178 1.00 0.00 ? 101 PHE A CA   1  
ATOM 1568  C C    . PHE A 1 101 ? -6.160  17.647  -12.609 1.00 0.00 ? 101 PHE A C    1  
ATOM 1569  O O    . PHE A 1 101 ? -4.990  17.999  -12.346 1.00 0.00 ? 101 PHE A O    1  
ATOM 1570  C CB   . PHE A 1 101 ? -8.125  18.976  -13.399 1.00 0.00 ? 101 PHE A CB   1  
ATOM 1571  C CG   . PHE A 1 101 ? -9.568  19.254  -13.086 1.00 0.00 ? 101 PHE A CG   1  
ATOM 1572  C CD1  . PHE A 1 101 ? -10.342 18.308  -12.433 1.00 0.00 ? 101 PHE A CD1  1  
ATOM 1573  C CD2  . PHE A 1 101 ? -10.149 20.459  -13.443 1.00 0.00 ? 101 PHE A CD2  1  
ATOM 1574  C CE1  . PHE A 1 101 ? -11.670 18.560  -12.143 1.00 0.00 ? 101 PHE A CE1  1  
ATOM 1575  C CE2  . PHE A 1 101 ? -11.476 20.717  -13.157 1.00 0.00 ? 101 PHE A CE2  1  
ATOM 1576  C CZ   . PHE A 1 101 ? -12.237 19.767  -12.505 1.00 0.00 ? 101 PHE A CZ   1  
ATOM 1577  O OXT  . PHE A 1 101 ? -6.443  16.585  -13.204 1.00 0.00 ? 101 PHE A OXT  1  
ATOM 1578  H H    . PHE A 1 101 ? -6.982  20.627  -11.854 1.00 0.00 ? 101 PHE A H    1  
ATOM 1579  H HA   . PHE A 1 101 ? -7.940  18.022  -11.492 1.00 0.00 ? 101 PHE A HA   1  
ATOM 1580  H HB2  . PHE A 1 101 ? -7.700  19.873  -13.823 1.00 0.00 ? 101 PHE A HB2  1  
ATOM 1581  H HB3  . PHE A 1 101 ? -8.090  18.185  -14.135 1.00 0.00 ? 101 PHE A HB3  1  
ATOM 1582  H HD1  . PHE A 1 101 ? -9.900  17.365  -12.149 1.00 0.00 ? 101 PHE A HD1  1  
ATOM 1583  H HD2  . PHE A 1 101 ? -9.554  21.203  -13.954 1.00 0.00 ? 101 PHE A HD2  1  
ATOM 1584  H HE1  . PHE A 1 101 ? -12.263 17.815  -11.633 1.00 0.00 ? 101 PHE A HE1  1  
ATOM 1585  H HE2  . PHE A 1 101 ? -11.917 21.661  -13.442 1.00 0.00 ? 101 PHE A HE2  1  
ATOM 1586  H HZ   . PHE A 1 101 ? -13.274 19.966  -12.280 1.00 0.00 ? 101 PHE A HZ   1  
ATOM 1587  N N    . SER B 1 1   ? -13.813 9.080   10.111  1.00 0.00 ? 1   SER B N    1  
ATOM 1588  C CA   . SER B 1 1   ? -13.055 7.895   10.587  1.00 0.00 ? 1   SER B CA   1  
ATOM 1589  C C    . SER B 1 1   ? -11.699 8.299   11.155  1.00 0.00 ? 1   SER B C    1  
ATOM 1590  O O    . SER B 1 1   ? -11.099 9.280   10.715  1.00 0.00 ? 1   SER B O    1  
ATOM 1591  C CB   . SER B 1 1   ? -12.870 6.931   9.413   1.00 0.00 ? 1   SER B CB   1  
ATOM 1592  O OG   . SER B 1 1   ? -13.843 5.902   9.439   1.00 0.00 ? 1   SER B OG   1  
ATOM 1593  H H1   . SER B 1 1   ? -13.166 9.665   9.545   1.00 0.00 ? 1   SER B H1   1  
ATOM 1594  H H2   . SER B 1 1   ? -14.153 9.597   10.948  1.00 0.00 ? 1   SER B H2   1  
ATOM 1595  H H3   . SER B 1 1   ? -14.607 8.738   9.533   1.00 0.00 ? 1   SER B H3   1  
ATOM 1596  H HA   . SER B 1 1   ? -13.629 7.406   11.360  1.00 0.00 ? 1   SER B HA   1  
ATOM 1597  H HB2  . SER B 1 1   ? -12.965 7.476   8.485   1.00 0.00 ? 1   SER B HB2  1  
ATOM 1598  H HB3  . SER B 1 1   ? -11.887 6.483   9.469   1.00 0.00 ? 1   SER B HB3  1  
ATOM 1599  H HG   . SER B 1 1   ? -14.718 6.290   9.514   1.00 0.00 ? 1   SER B HG   1  
ATOM 1600  N N    . ARG B 1 2   ? -11.221 7.536   12.132  1.00 0.00 ? 2   ARG B N    1  
ATOM 1601  C CA   . ARG B 1 2   ? -9.932  7.814   12.759  1.00 0.00 ? 2   ARG B CA   1  
ATOM 1602  C C    . ARG B 1 2   ? -9.365  6.562   13.431  1.00 0.00 ? 2   ARG B C    1  
ATOM 1603  O O    . ARG B 1 2   ? -8.317  6.058   13.032  1.00 0.00 ? 2   ARG B O    1  
ATOM 1604  C CB   . ARG B 1 2   ? -10.072 8.943   13.785  1.00 0.00 ? 2   ARG B CB   1  
ATOM 1605  C CG   . ARG B 1 2   ? -9.659  10.307  13.254  1.00 0.00 ? 2   ARG B CG   1  
ATOM 1606  C CD   . ARG B 1 2   ? -10.067 11.421  14.207  1.00 0.00 ? 2   ARG B CD   1  
ATOM 1607  N NE   . ARG B 1 2   ? -11.455 11.287  14.643  1.00 0.00 ? 2   ARG B NE   1  
ATOM 1608  C CZ   . ARG B 1 2   ? -11.944 11.845  15.749  1.00 0.00 ? 2   ARG B CZ   1  
ATOM 1609  N NH1  . ARG B 1 2   ? -11.165 12.581  16.532  1.00 0.00 ? 2   ARG B NH1  1  
ATOM 1610  N NH2  . ARG B 1 2   ? -13.218 11.667  16.072  1.00 0.00 ? 2   ARG B NH2  1  
ATOM 1611  H H    . ARG B 1 2   ? -11.744 6.766   12.436  1.00 0.00 ? 2   ARG B H    1  
ATOM 1612  H HA   . ARG B 1 2   ? -9.251  8.129   11.983  1.00 0.00 ? 2   ARG B HA   1  
ATOM 1613  H HB2  . ARG B 1 2   ? -11.103 9.002   14.099  1.00 0.00 ? 2   ARG B HB2  1  
ATOM 1614  H HB3  . ARG B 1 2   ? -9.456  8.714   14.642  1.00 0.00 ? 2   ARG B HB3  1  
ATOM 1615  H HG2  . ARG B 1 2   ? -8.586  10.327  13.134  1.00 0.00 ? 2   ARG B HG2  1  
ATOM 1616  H HG3  . ARG B 1 2   ? -10.134 10.471  12.299  1.00 0.00 ? 2   ARG B HG3  1  
ATOM 1617  H HD2  . ARG B 1 2   ? -9.422  11.389  15.073  1.00 0.00 ? 2   ARG B HD2  1  
ATOM 1618  H HD3  . ARG B 1 2   ? -9.947  12.370  13.704  1.00 0.00 ? 2   ARG B HD3  1  
ATOM 1619  H HE   . ARG B 1 2   ? -12.055 10.751  14.083  1.00 0.00 ? 2   ARG B HE   1  
ATOM 1620  H HH11 . ARG B 1 2   ? -10.204 12.721  16.294  1.00 0.00 ? 2   ARG B HH11 1  
ATOM 1621  H HH12 . ARG B 1 2   ? -11.539 12.998  17.360  1.00 0.00 ? 2   ARG B HH12 1  
ATOM 1622  H HH22 . ARG B 1 2   ? -13.585 12.086  16.902  1.00 0.00 ? 2   ARG B HH22 1  
ATOM 1623  N N    . PRO B 1 3   ? -10.041 6.053   14.476  1.00 0.00 ? 3   PRO B N    1  
ATOM 1624  C CA   . PRO B 1 3   ? -9.591  4.865   15.217  1.00 0.00 ? 3   PRO B CA   1  
ATOM 1625  C C    . PRO B 1 3   ? -9.860  3.547   14.494  1.00 0.00 ? 3   PRO B C    1  
ATOM 1626  O O    . PRO B 1 3   ? -9.621  2.472   15.043  1.00 0.00 ? 3   PRO B O    1  
ATOM 1627  C CB   . PRO B 1 3   ? -10.441 4.935   16.475  1.00 0.00 ? 3   PRO B CB   1  
ATOM 1628  C CG   . PRO B 1 3   ? -11.713 5.528   16.002  1.00 0.00 ? 3   PRO B CG   1  
ATOM 1629  C CD   . PRO B 1 3   ? -11.288 6.601   15.050  1.00 0.00 ? 3   PRO B CD   1  
ATOM 1630  H HA   . PRO B 1 3   ? -8.548  4.928   15.478  1.00 0.00 ? 3   PRO B HA   1  
ATOM 1631  H HB2  . PRO B 1 3   ? -10.585 3.945   16.873  1.00 0.00 ? 3   PRO B HB2  1  
ATOM 1632  H HB3  . PRO B 1 3   ? -9.963  5.570   17.201  1.00 0.00 ? 3   PRO B HB3  1  
ATOM 1633  H HG2  . PRO B 1 3   ? -12.306 4.781   15.494  1.00 0.00 ? 3   PRO B HG2  1  
ATOM 1634  H HG3  . PRO B 1 3   ? -12.259 5.953   16.831  1.00 0.00 ? 3   PRO B HG3  1  
ATOM 1635  H HD2  . PRO B 1 3   ? -12.036 6.756   14.290  1.00 0.00 ? 3   PRO B HD2  1  
ATOM 1636  H HD3  . PRO B 1 3   ? -11.090 7.514   15.590  1.00 0.00 ? 3   PRO B HD3  1  
ATOM 1637  N N    . THR B 1 4   ? -10.369 3.631   13.276  1.00 0.00 ? 4   THR B N    1  
ATOM 1638  C CA   . THR B 1 4   ? -10.681 2.432   12.504  1.00 0.00 ? 4   THR B CA   1  
ATOM 1639  C C    . THR B 1 4   ? -9.420  1.687   12.096  1.00 0.00 ? 4   THR B C    1  
ATOM 1640  O O    . THR B 1 4   ? -8.421  2.286   11.697  1.00 0.00 ? 4   THR B O    1  
ATOM 1641  C CB   . THR B 1 4   ? -11.548 2.751   11.276  1.00 0.00 ? 4   THR B CB   1  
ATOM 1642  O OG1  . THR B 1 4   ? -11.487 1.693   10.335  1.00 0.00 ? 4   THR B OG1  1  
ATOM 1643  C CG2  . THR B 1 4   ? -11.170 4.024   10.550  1.00 0.00 ? 4   THR B CG2  1  
ATOM 1644  H H    . THR B 1 4   ? -10.545 4.508   12.899  1.00 0.00 ? 4   THR B H    1  
ATOM 1645  H HA   . THR B 1 4   ? -11.239 1.781   13.150  1.00 0.00 ? 4   THR B HA   1  
ATOM 1646  H HB   . THR B 1 4   ? -12.575 2.850   11.598  1.00 0.00 ? 4   THR B HB   1  
ATOM 1647  H HG1  . THR B 1 4   ? -11.675 0.862   10.775  1.00 0.00 ? 4   THR B HG1  1  
ATOM 1648  H HG21 . THR B 1 4   ? -10.797 4.749   11.255  1.00 0.00 ? 4   THR B HG21 1  
ATOM 1649  H HG22 . THR B 1 4   ? -12.039 4.424   10.050  1.00 0.00 ? 4   THR B HG22 1  
ATOM 1650  H HG23 . THR B 1 4   ? -10.405 3.806   9.819   1.00 0.00 ? 4   THR B HG23 1  
ATOM 1651  N N    . GLU B 1 5   ? -9.484  0.365   12.214  1.00 0.00 ? 5   GLU B N    1  
ATOM 1652  C CA   . GLU B 1 5   ? -8.367  -0.506  11.876  1.00 0.00 ? 5   GLU B CA   1  
ATOM 1653  C C    . GLU B 1 5   ? -7.729  -0.097  10.555  1.00 0.00 ? 5   GLU B C    1  
ATOM 1654  O O    . GLU B 1 5   ? -6.505  -0.085  10.424  1.00 0.00 ? 5   GLU B O    1  
ATOM 1655  C CB   . GLU B 1 5   ? -8.855  -1.951  11.803  1.00 0.00 ? 5   GLU B CB   1  
ATOM 1656  C CG   . GLU B 1 5   ? -7.960  -2.936  12.538  1.00 0.00 ? 5   GLU B CG   1  
ATOM 1657  C CD   . GLU B 1 5   ? -8.078  -2.818  14.044  1.00 0.00 ? 5   GLU B CD   1  
ATOM 1658  O OE1  . GLU B 1 5   ? -7.680  -1.767  14.591  1.00 0.00 ? 5   GLU B OE1  1  
ATOM 1659  O OE2  . GLU B 1 5   ? -8.570  -3.775  14.678  1.00 0.00 ? 5   GLU B OE2  1  
ATOM 1660  H H    . GLU B 1 5   ? -10.314 -0.038  12.545  1.00 0.00 ? 5   GLU B H    1  
ATOM 1661  H HA   . GLU B 1 5   ? -7.631  -0.424  12.661  1.00 0.00 ? 5   GLU B HA   1  
ATOM 1662  H HB2  . GLU B 1 5   ? -9.843  -2.001  12.238  1.00 0.00 ? 5   GLU B HB2  1  
ATOM 1663  H HB3  . GLU B 1 5   ? -8.912  -2.249  10.767  1.00 0.00 ? 5   GLU B HB3  1  
ATOM 1664  H HG2  . GLU B 1 5   ? -8.237  -3.939  12.248  1.00 0.00 ? 5   GLU B HG2  1  
ATOM 1665  H HG3  . GLU B 1 5   ? -6.934  -2.751  12.255  1.00 0.00 ? 5   GLU B HG3  1  
ATOM 1666  N N    . THR B 1 6   ? -8.562  0.249   9.582   1.00 0.00 ? 6   THR B N    1  
ATOM 1667  C CA   . THR B 1 6   ? -8.067  0.670   8.283   1.00 0.00 ? 6   THR B CA   1  
ATOM 1668  C C    . THR B 1 6   ? -7.421  2.044   8.386   1.00 0.00 ? 6   THR B C    1  
ATOM 1669  O O    . THR B 1 6   ? -6.388  2.298   7.775   1.00 0.00 ? 6   THR B O    1  
ATOM 1670  C CB   . THR B 1 6   ? -9.200  0.697   7.255   1.00 0.00 ? 6   THR B CB   1  
ATOM 1671  O OG1  . THR B 1 6   ? -10.125 -0.346  7.498   1.00 0.00 ? 6   THR B OG1  1  
ATOM 1672  C CG2  . THR B 1 6   ? -8.714  0.559   5.828   1.00 0.00 ? 6   THR B CG2  1  
ATOM 1673  H H    . THR B 1 6   ? -9.528  0.228   9.745   1.00 0.00 ? 6   THR B H    1  
ATOM 1674  H HA   . THR B 1 6   ? -7.321  -0.043  7.964   1.00 0.00 ? 6   THR B HA   1  
ATOM 1675  H HB   . THR B 1 6   ? -9.723  1.640   7.335   1.00 0.00 ? 6   THR B HB   1  
ATOM 1676  H HG1  . THR B 1 6   ? -9.677  -1.194  7.435   1.00 0.00 ? 6   THR B HG1  1  
ATOM 1677  H HG21 . THR B 1 6   ? -7.826  -0.056  5.808   1.00 0.00 ? 6   THR B HG21 1  
ATOM 1678  H HG22 . THR B 1 6   ? -8.484  1.535   5.428   1.00 0.00 ? 6   THR B HG22 1  
ATOM 1679  H HG23 . THR B 1 6   ? -9.484  0.097   5.228   1.00 0.00 ? 6   THR B HG23 1  
ATOM 1680  N N    . GLU B 1 7   ? -8.025  2.928   9.178   1.00 0.00 ? 7   GLU B N    1  
ATOM 1681  C CA   . GLU B 1 7   ? -7.494  4.275   9.355   1.00 0.00 ? 7   GLU B CA   1  
ATOM 1682  C C    . GLU B 1 7   ? -6.022  4.218   9.741   1.00 0.00 ? 7   GLU B C    1  
ATOM 1683  O O    . GLU B 1 7   ? -5.175  4.831   9.091   1.00 0.00 ? 7   GLU B O    1  
ATOM 1684  C CB   . GLU B 1 7   ? -8.283  5.021   10.434  1.00 0.00 ? 7   GLU B CB   1  
ATOM 1685  C CG   . GLU B 1 7   ? -9.204  6.091   9.874   1.00 0.00 ? 7   GLU B CG   1  
ATOM 1686  C CD   . GLU B 1 7   ? -8.446  7.261   9.277   1.00 0.00 ? 7   GLU B CD   1  
ATOM 1687  O OE1  . GLU B 1 7   ? -8.031  7.163   8.103   1.00 0.00 ? 7   GLU B OE1  1  
ATOM 1688  O OE2  . GLU B 1 7   ? -8.267  8.275   9.984   1.00 0.00 ? 7   GLU B OE2  1  
ATOM 1689  H H    . GLU B 1 7   ? -8.842  2.668   9.653   1.00 0.00 ? 7   GLU B H    1  
ATOM 1690  H HA   . GLU B 1 7   ? -7.591  4.800   8.417   1.00 0.00 ? 7   GLU B HA   1  
ATOM 1691  H HB2  . GLU B 1 7   ? -8.880  4.307   10.990  1.00 0.00 ? 7   GLU B HB2  1  
ATOM 1692  H HB3  . GLU B 1 7   ? -7.586  5.494   11.108  1.00 0.00 ? 7   GLU B HB3  1  
ATOM 1693  H HG2  . GLU B 1 7   ? -9.820  5.651   9.104   1.00 0.00 ? 7   GLU B HG2  1  
ATOM 1694  H HG3  . GLU B 1 7   ? -9.833  6.457   10.670  1.00 0.00 ? 7   GLU B HG3  1  
ATOM 1695  N N    . ARG B 1 8   ? -5.725  3.462   10.785  1.00 0.00 ? 8   ARG B N    1  
ATOM 1696  C CA   . ARG B 1 8   ? -4.350  3.305   11.238  1.00 0.00 ? 8   ARG B CA   1  
ATOM 1697  C C    . ARG B 1 8   ? -3.529  2.568   10.183  1.00 0.00 ? 8   ARG B C    1  
ATOM 1698  O O    . ARG B 1 8   ? -2.312  2.734   10.100  1.00 0.00 ? 8   ARG B O    1  
ATOM 1699  C CB   . ARG B 1 8   ? -4.309  2.544   12.564  1.00 0.00 ? 8   ARG B CB   1  
ATOM 1700  C CG   . ARG B 1 8   ? -4.747  3.378   13.756  1.00 0.00 ? 8   ARG B CG   1  
ATOM 1701  C CD   . ARG B 1 8   ? -4.478  2.660   15.068  1.00 0.00 ? 8   ARG B CD   1  
ATOM 1702  N NE   . ARG B 1 8   ? -5.405  1.551   15.286  1.00 0.00 ? 8   ARG B NE   1  
ATOM 1703  C CZ   . ARG B 1 8   ? -5.640  1.004   16.475  1.00 0.00 ? 8   ARG B CZ   1  
ATOM 1704  N NH1  . ARG B 1 8   ? -5.019  1.458   17.558  1.00 0.00 ? 8   ARG B NH1  1  
ATOM 1705  N NH2  . ARG B 1 8   ? -6.500  0.000   16.585  1.00 0.00 ? 8   ARG B NH2  1  
ATOM 1706  H H    . ARG B 1 8   ? -6.444  2.987   11.255  1.00 0.00 ? 8   ARG B H    1  
ATOM 1707  H HA   . ARG B 1 8   ? -3.932  4.291   11.382  1.00 0.00 ? 8   ARG B HA   1  
ATOM 1708  H HB2  . ARG B 1 8   ? -4.961  1.686   12.492  1.00 0.00 ? 8   ARG B HB2  1  
ATOM 1709  H HB3  . ARG B 1 8   ? -3.300  2.204   12.739  1.00 0.00 ? 8   ARG B HB3  1  
ATOM 1710  H HG2  . ARG B 1 8   ? -4.203  4.311   13.750  1.00 0.00 ? 8   ARG B HG2  1  
ATOM 1711  H HG3  . ARG B 1 8   ? -5.806  3.576   13.674  1.00 0.00 ? 8   ARG B HG3  1  
ATOM 1712  H HD2  . ARG B 1 8   ? -3.469  2.275   15.053  1.00 0.00 ? 8   ARG B HD2  1  
ATOM 1713  H HD3  . ARG B 1 8   ? -4.580  3.366   15.878  1.00 0.00 ? 8   ARG B HD3  1  
ATOM 1714  H HE   . ARG B 1 8   ? -5.877  1.196   14.504  1.00 0.00 ? 8   ARG B HE   1  
ATOM 1715  H HH11 . ARG B 1 8   ? -4.370  2.214   17.483  1.00 0.00 ? 8   ARG B HH11 1  
ATOM 1716  H HH12 . ARG B 1 8   ? -5.201  1.043   18.449  1.00 0.00 ? 8   ARG B HH12 1  
ATOM 1717  H HH22 . ARG B 1 8   ? -6.677  -0.412  17.479  1.00 0.00 ? 8   ARG B HH22 1  
ATOM 1718  N N    . CYS B 1 9   ? -4.207  1.749   9.379   1.00 0.00 ? 9   CYS B N    1  
ATOM 1719  C CA   . CYS B 1 9   ? -3.549  0.978   8.330   1.00 0.00 ? 9   CYS B CA   1  
ATOM 1720  C C    . CYS B 1 9   ? -2.955  1.892   7.258   1.00 0.00 ? 9   CYS B C    1  
ATOM 1721  O O    . CYS B 1 9   ? -1.790  1.749   6.890   1.00 0.00 ? 9   CYS B O    1  
ATOM 1722  C CB   . CYS B 1 9   ? -4.535  -0.042  7.723   1.00 0.00 ? 9   CYS B CB   1  
ATOM 1723  S SG   . CYS B 1 9   ? -5.204  0.370   6.088   1.00 0.00 ? 9   CYS B SG   1  
ATOM 1724  H H    . CYS B 1 9   ? -5.175  1.657   9.498   1.00 0.00 ? 9   CYS B H    1  
ATOM 1725  H HA   . CYS B 1 9   ? -2.738  0.436   8.790   1.00 0.00 ? 9   CYS B HA   1  
ATOM 1726  H HB2  . CYS B 1 9   ? -4.038  -0.993  7.629   1.00 0.00 ? 9   CYS B HB2  1  
ATOM 1727  H HB3  . CYS B 1 9   ? -5.373  -0.155  8.396   1.00 0.00 ? 9   CYS B HB3  1  
ATOM 1728  H HG   . CYS B 1 9   ? -6.053  0.799   6.215   1.00 0.00 ? 9   CYS B HG   1  
ATOM 1729  N N    . ILE B 1 10  ? -3.756  2.828   6.756   1.00 0.00 ? 10  ILE B N    1  
ATOM 1730  C CA   . ILE B 1 10  ? -3.293  3.742   5.725   1.00 0.00 ? 10  ILE B CA   1  
ATOM 1731  C C    . ILE B 1 10  ? -2.128  4.594   6.214   1.00 0.00 ? 10  ILE B C    1  
ATOM 1732  O O    . ILE B 1 10  ? -1.057  4.596   5.613   1.00 0.00 ? 10  ILE B O    1  
ATOM 1733  C CB   . ILE B 1 10  ? -4.427  4.680   5.264   1.00 0.00 ? 10  ILE B CB   1  
ATOM 1734  C CG1  . ILE B 1 10  ? -5.672  3.877   4.889   1.00 0.00 ? 10  ILE B CG1  1  
ATOM 1735  C CG2  . ILE B 1 10  ? -3.968  5.528   4.089   1.00 0.00 ? 10  ILE B CG2  1  
ATOM 1736  C CD1  . ILE B 1 10  ? -6.799  4.006   5.881   1.00 0.00 ? 10  ILE B CD1  1  
ATOM 1737  H H    . ILE B 1 10  ? -4.676  2.900   7.079   1.00 0.00 ? 10  ILE B H    1  
ATOM 1738  H HA   . ILE B 1 10  ? -2.971  3.158   4.877   1.00 0.00 ? 10  ILE B HA   1  
ATOM 1739  H HB   . ILE B 1 10  ? -4.668  5.343   6.081   1.00 0.00 ? 10  ILE B HB   1  
ATOM 1740  H HG12 . ILE B 1 10  ? -6.039  4.222   3.938   1.00 0.00 ? 10  ILE B HG12 1  
ATOM 1741  H HG13 . ILE B 1 10  ? -5.412  2.832   4.815   1.00 0.00 ? 10  ILE B HG13 1  
ATOM 1742  H HG21 . ILE B 1 10  ? -4.059  6.572   4.345   1.00 0.00 ? 10  ILE B HG21 1  
ATOM 1743  H HG22 . ILE B 1 10  ? -4.583  5.312   3.228   1.00 0.00 ? 10  ILE B HG22 1  
ATOM 1744  H HG23 . ILE B 1 10  ? -2.936  5.300   3.862   1.00 0.00 ? 10  ILE B HG23 1  
ATOM 1745  H HD11 . ILE B 1 10  ? -7.319  3.062   5.951   1.00 0.00 ? 10  ILE B HD11 1  
ATOM 1746  H HD12 . ILE B 1 10  ? -7.484  4.773   5.552   1.00 0.00 ? 10  ILE B HD12 1  
ATOM 1747  H HD13 . ILE B 1 10  ? -6.398  4.270   6.847   1.00 0.00 ? 10  ILE B HD13 1  
ATOM 1748  N N    . GLU B 1 11  ? -2.346  5.320   7.302   1.00 0.00 ? 11  GLU B N    1  
ATOM 1749  C CA   . GLU B 1 11  ? -1.318  6.190   7.867   1.00 0.00 ? 11  GLU B CA   1  
ATOM 1750  C C    . GLU B 1 11  ? -0.014  5.440   8.107   1.00 0.00 ? 11  GLU B C    1  
ATOM 1751  O O    . GLU B 1 11  ? 1.064   6.034   8.112   1.00 0.00 ? 11  GLU B O    1  
ATOM 1752  C CB   . GLU B 1 11  ? -1.812  6.811   9.174   1.00 0.00 ? 11  GLU B CB   1  
ATOM 1753  C CG   . GLU B 1 11  ? -1.606  8.314   9.240   1.00 0.00 ? 11  GLU B CG   1  
ATOM 1754  C CD   . GLU B 1 11  ? -0.543  8.715   10.245  1.00 0.00 ? 11  GLU B CD   1  
ATOM 1755  O OE1  . GLU B 1 11  ? -0.368  7.989   11.246  1.00 0.00 ? 11  GLU B OE1  1  
ATOM 1756  O OE2  . GLU B 1 11  ? 0.114   9.756   10.031  1.00 0.00 ? 11  GLU B OE2  1  
ATOM 1757  H H    . GLU B 1 11  ? -3.225  5.279   7.735   1.00 0.00 ? 11  GLU B H    1  
ATOM 1758  H HA   . GLU B 1 11  ? -1.134  6.980   7.157   1.00 0.00 ? 11  GLU B HA   1  
ATOM 1759  H HB2  . GLU B 1 11  ? -2.868  6.609   9.279   1.00 0.00 ? 11  GLU B HB2  1  
ATOM 1760  H HB3  . GLU B 1 11  ? -1.283  6.359   10.000  1.00 0.00 ? 11  GLU B HB3  1  
ATOM 1761  H HG2  . GLU B 1 11  ? -1.306  8.666   8.263   1.00 0.00 ? 11  GLU B HG2  1  
ATOM 1762  H HG3  . GLU B 1 11  ? -2.539  8.779   9.519   1.00 0.00 ? 11  GLU B HG3  1  
ATOM 1763  N N    . SER B 1 12  ? -0.121  4.140   8.332   1.00 0.00 ? 12  SER B N    1  
ATOM 1764  C CA   . SER B 1 12  ? 1.045   3.313   8.604   1.00 0.00 ? 12  SER B CA   1  
ATOM 1765  C C    . SER B 1 12  ? 2.016   3.253   7.420   1.00 0.00 ? 12  SER B C    1  
ATOM 1766  O O    . SER B 1 12  ? 3.201   3.538   7.577   1.00 0.00 ? 12  SER B O    1  
ATOM 1767  C CB   . SER B 1 12  ? 0.599   1.900   8.984   1.00 0.00 ? 12  SER B CB   1  
ATOM 1768  O OG   . SER B 1 12  ? 1.271   1.450   10.148  1.00 0.00 ? 12  SER B OG   1  
ATOM 1769  H H    . SER B 1 12  ? -1.009  3.728   8.335   1.00 0.00 ? 12  SER B H    1  
ATOM 1770  H HA   . SER B 1 12  ? 1.561   3.746   9.447   1.00 0.00 ? 12  SER B HA   1  
ATOM 1771  H HB2  . SER B 1 12  ? -0.463  1.901   9.177   1.00 0.00 ? 12  SER B HB2  1  
ATOM 1772  H HB3  . SER B 1 12  ? 0.816   1.223   8.171   1.00 0.00 ? 12  SER B HB3  1  
ATOM 1773  H HG   . SER B 1 12  ? 0.707   1.580   10.914  1.00 0.00 ? 12  SER B HG   1  
ATOM 1774  N N    . LEU B 1 13  ? 1.526   2.851   6.248   1.00 0.00 ? 13  LEU B N    1  
ATOM 1775  C CA   . LEU B 1 13  ? 2.375   2.721   5.063   1.00 0.00 ? 13  LEU B CA   1  
ATOM 1776  C C    . LEU B 1 13  ? 2.768   4.065   4.444   1.00 0.00 ? 13  LEU B C    1  
ATOM 1777  O O    . LEU B 1 13  ? 3.820   4.185   3.820   1.00 0.00 ? 13  LEU B O    1  
ATOM 1778  C CB   . LEU B 1 13  ? 1.670   1.858   4.027   1.00 0.00 ? 13  LEU B CB   1  
ATOM 1779  C CG   . LEU B 1 13  ? 1.968   0.365   4.139   1.00 0.00 ? 13  LEU B CG   1  
ATOM 1780  C CD1  . LEU B 1 13  ? 3.421   0.087   3.806   1.00 0.00 ? 13  LEU B CD1  1  
ATOM 1781  C CD2  . LEU B 1 13  ? 1.655   -0.150  5.528   1.00 0.00 ? 13  LEU B CD2  1  
ATOM 1782  H H    . LEU B 1 13  ? 0.579   2.606   6.181   1.00 0.00 ? 13  LEU B H    1  
ATOM 1783  H HA   . LEU B 1 13  ? 3.277   2.213   5.370   1.00 0.00 ? 13  LEU B HA   1  
ATOM 1784  H HB2  . LEU B 1 13  ? 0.604   2.003   4.129   1.00 0.00 ? 13  LEU B HB2  1  
ATOM 1785  H HB3  . LEU B 1 13  ? 1.972   2.189   3.045   1.00 0.00 ? 13  LEU B HB3  1  
ATOM 1786  H HG   . LEU B 1 13  ? 1.350   -0.168  3.438   1.00 0.00 ? 13  LEU B HG   1  
ATOM 1787  H HD11 . LEU B 1 13  ? 3.474   -0.565  2.949   1.00 0.00 ? 13  LEU B HD11 1  
ATOM 1788  H HD12 . LEU B 1 13  ? 3.901   -0.390  4.655   1.00 0.00 ? 13  LEU B HD12 1  
ATOM 1789  H HD13 . LEU B 1 13  ? 3.923   1.017   3.585   1.00 0.00 ? 13  LEU B HD13 1  
ATOM 1790  H HD21 . LEU B 1 13  ? 1.977   0.574   6.261   1.00 0.00 ? 13  LEU B HD21 1  
ATOM 1791  H HD22 . LEU B 1 13  ? 2.182   -1.081  5.685   1.00 0.00 ? 13  LEU B HD22 1  
ATOM 1792  H HD23 . LEU B 1 13  ? 0.594   -0.315  5.623   1.00 0.00 ? 13  LEU B HD23 1  
ATOM 1793  N N    . ILE B 1 14  ? 1.934   5.075   4.598   1.00 0.00 ? 14  ILE B N    1  
ATOM 1794  C CA   . ILE B 1 14  ? 2.234   6.377   4.040   1.00 0.00 ? 14  ILE B CA   1  
ATOM 1795  C C    . ILE B 1 14  ? 3.423   7.007   4.720   1.00 0.00 ? 14  ILE B C    1  
ATOM 1796  O O    . ILE B 1 14  ? 4.203   7.722   4.103   1.00 0.00 ? 14  ILE B O    1  
ATOM 1797  C CB   . ILE B 1 14  ? 1.085   7.357   4.243   1.00 0.00 ? 14  ILE B CB   1  
ATOM 1798  C CG1  . ILE B 1 14  ? -0.254  6.735   3.913   1.00 0.00 ? 14  ILE B CG1  1  
ATOM 1799  C CG2  . ILE B 1 14  ? 1.316   8.594   3.418   1.00 0.00 ? 14  ILE B CG2  1  
ATOM 1800  C CD1  . ILE B 1 14  ? -1.364  7.367   4.703   1.00 0.00 ? 14  ILE B CD1  1  
ATOM 1801  H H    . ILE B 1 14  ? 1.102   4.949   5.089   1.00 0.00 ? 14  ILE B H    1  
ATOM 1802  H HA   . ILE B 1 14  ? 2.419   6.279   2.987   1.00 0.00 ? 14  ILE B HA   1  
ATOM 1803  H HB   . ILE B 1 14  ? 1.084   7.653   5.282   1.00 0.00 ? 14  ILE B HB   1  
ATOM 1804  H HG12 . ILE B 1 14  ? -0.465  6.865   2.862   1.00 0.00 ? 14  ILE B HG12 1  
ATOM 1805  H HG13 . ILE B 1 14  ? -0.227  5.687   4.151   1.00 0.00 ? 14  ILE B HG13 1  
ATOM 1806  H HG21 . ILE B 1 14  ? 0.871   8.461   2.446   1.00 0.00 ? 14  ILE B HG21 1  
ATOM 1807  H HG22 . ILE B 1 14  ? 2.378   8.753   3.315   1.00 0.00 ? 14  ILE B HG22 1  
ATOM 1808  H HG23 . ILE B 1 14  ? 0.867   9.440   3.912   1.00 0.00 ? 14  ILE B HG23 1  
ATOM 1809  H HD11 . ILE B 1 14  ? -2.033  6.607   5.059   1.00 0.00 ? 14  ILE B HD11 1  
ATOM 1810  H HD12 . ILE B 1 14  ? -1.902  8.059   4.074   1.00 0.00 ? 14  ILE B HD12 1  
ATOM 1811  H HD13 . ILE B 1 14  ? -0.937  7.897   5.543   1.00 0.00 ? 14  ILE B HD13 1  
ATOM 1812  N N    . ALA B 1 15  ? 3.504   6.780   6.012   1.00 0.00 ? 15  ALA B N    1  
ATOM 1813  C CA   . ALA B 1 15  ? 4.531   7.373   6.831   1.00 0.00 ? 15  ALA B CA   1  
ATOM 1814  C C    . ALA B 1 15  ? 5.869   6.667   6.697   1.00 0.00 ? 15  ALA B C    1  
ATOM 1815  O O    . ALA B 1 15  ? 6.916   7.313   6.740   1.00 0.00 ? 15  ALA B O    1  
ATOM 1816  C CB   . ALA B 1 15  ? 4.029   7.418   8.252   1.00 0.00 ? 15  ALA B CB   1  
ATOM 1817  H H    . ALA B 1 15  ? 2.823   6.221   6.436   1.00 0.00 ? 15  ALA B H    1  
ATOM 1818  H HA   . ALA B 1 15  ? 4.656   8.394   6.500   1.00 0.00 ? 15  ALA B HA   1  
ATOM 1819  H HB1  . ALA B 1 15  ? 4.309   8.358   8.699   1.00 0.00 ? 15  ALA B HB1  1  
ATOM 1820  H HB2  . ALA B 1 15  ? 4.450   6.601   8.815   1.00 0.00 ? 15  ALA B HB2  1  
ATOM 1821  H HB3  . ALA B 1 15  ? 2.945   7.336   8.235   1.00 0.00 ? 15  ALA B HB3  1  
ATOM 1822  N N    . VAL B 1 16  ? 5.846   5.357   6.480   1.00 0.00 ? 16  VAL B N    1  
ATOM 1823  C CA   . VAL B 1 16  ? 7.079   4.620   6.277   1.00 0.00 ? 16  VAL B CA   1  
ATOM 1824  C C    . VAL B 1 16  ? 7.868   5.320   5.183   1.00 0.00 ? 16  VAL B C    1  
ATOM 1825  O O    . VAL B 1 16  ? 9.092   5.436   5.238   1.00 0.00 ? 16  VAL B O    1  
ATOM 1826  C CB   . VAL B 1 16  ? 6.786   3.175   5.850   1.00 0.00 ? 16  VAL B CB   1  
ATOM 1827  C CG1  . VAL B 1 16  ? 5.929   2.478   6.882   1.00 0.00 ? 16  VAL B CG1  1  
ATOM 1828  C CG2  . VAL B 1 16  ? 6.088   3.159   4.507   1.00 0.00 ? 16  VAL B CG2  1  
ATOM 1829  H H    . VAL B 1 16  ? 4.992   4.887   6.411   1.00 0.00 ? 16  VAL B H    1  
ATOM 1830  H HA   . VAL B 1 16  ? 7.646   4.619   7.200   1.00 0.00 ? 16  VAL B HA   1  
ATOM 1831  H HB   . VAL B 1 16  ? 7.714   2.647   5.760   1.00 0.00 ? 16  VAL B HB   1  
ATOM 1832  H HG11 . VAL B 1 16  ? 5.219   3.184   7.281   1.00 0.00 ? 16  VAL B HG11 1  
ATOM 1833  H HG12 . VAL B 1 16  ? 6.554   2.100   7.677   1.00 0.00 ? 16  VAL B HG12 1  
ATOM 1834  H HG13 . VAL B 1 16  ? 5.401   1.659   6.413   1.00 0.00 ? 16  VAL B HG13 1  
ATOM 1835  H HG21 . VAL B 1 16  ? 5.303   3.904   4.519   1.00 0.00 ? 16  VAL B HG21 1  
ATOM 1836  H HG22 . VAL B 1 16  ? 5.661   2.182   4.332   1.00 0.00 ? 16  VAL B HG22 1  
ATOM 1837  H HG23 . VAL B 1 16  ? 6.795   3.393   3.728   1.00 0.00 ? 16  VAL B HG23 1  
ATOM 1838  N N    . PHE B 1 17  ? 7.117   5.808   4.197   1.00 0.00 ? 17  PHE B N    1  
ATOM 1839  C CA   . PHE B 1 17  ? 7.687   6.537   3.073   1.00 0.00 ? 17  PHE B CA   1  
ATOM 1840  C C    . PHE B 1 17  ? 8.044   7.966   3.494   1.00 0.00 ? 17  PHE B C    1  
ATOM 1841  O O    . PHE B 1 17  ? 9.196   8.379   3.385   1.00 0.00 ? 17  PHE B O    1  
ATOM 1842  C CB   . PHE B 1 17  ? 6.690   6.543   1.904   1.00 0.00 ? 17  PHE B CB   1  
ATOM 1843  C CG   . PHE B 1 17  ? 6.804   7.729   0.983   1.00 0.00 ? 17  PHE B CG   1  
ATOM 1844  C CD1  . PHE B 1 17  ? 7.916   7.894   0.172   1.00 0.00 ? 17  PHE B CD1  1  
ATOM 1845  C CD2  . PHE B 1 17  ? 5.792   8.674   0.925   1.00 0.00 ? 17  PHE B CD2  1  
ATOM 1846  C CE1  . PHE B 1 17  ? 8.016   8.979   -0.678  1.00 0.00 ? 17  PHE B CE1  1  
ATOM 1847  C CE2  . PHE B 1 17  ? 5.887   9.762   0.078   1.00 0.00 ? 17  PHE B CE2  1  
ATOM 1848  C CZ   . PHE B 1 17  ? 7.001   9.915   -0.724  1.00 0.00 ? 17  PHE B CZ   1  
ATOM 1849  H H    . PHE B 1 17  ? 6.137   5.680   4.241   1.00 0.00 ? 17  PHE B H    1  
ATOM 1850  H HA   . PHE B 1 17  ? 8.589   6.029   2.765   1.00 0.00 ? 17  PHE B HA   1  
ATOM 1851  H HB2  . PHE B 1 17  ? 6.839   5.656   1.312   1.00 0.00 ? 17  PHE B HB2  1  
ATOM 1852  H HB3  . PHE B 1 17  ? 5.685   6.533   2.304   1.00 0.00 ? 17  PHE B HB3  1  
ATOM 1853  H HD1  . PHE B 1 17  ? 8.711   7.163   0.208   1.00 0.00 ? 17  PHE B HD1  1  
ATOM 1854  H HD2  . PHE B 1 17  ? 4.921   8.555   1.553   1.00 0.00 ? 17  PHE B HD2  1  
ATOM 1855  H HE1  . PHE B 1 17  ? 8.886   9.098   -1.305  1.00 0.00 ? 17  PHE B HE1  1  
ATOM 1856  H HE2  . PHE B 1 17  ? 5.092   10.491  0.044   1.00 0.00 ? 17  PHE B HE2  1  
ATOM 1857  H HZ   . PHE B 1 17  ? 7.077   10.764  -1.386  1.00 0.00 ? 17  PHE B HZ   1  
ATOM 1858  N N    . GLN B 1 18  ? 7.045   8.711   3.974   1.00 0.00 ? 18  GLN B N    1  
ATOM 1859  C CA   . GLN B 1 18  ? 7.248   10.098  4.405   1.00 0.00 ? 18  GLN B CA   1  
ATOM 1860  C C    . GLN B 1 18  ? 8.445   10.238  5.337   1.00 0.00 ? 18  GLN B C    1  
ATOM 1861  O O    . GLN B 1 18  ? 9.265   11.142  5.175   1.00 0.00 ? 18  GLN B O    1  
ATOM 1862  C CB   . GLN B 1 18  ? 6.012   10.625  5.141   1.00 0.00 ? 18  GLN B CB   1  
ATOM 1863  C CG   . GLN B 1 18  ? 4.701   10.352  4.433   1.00 0.00 ? 18  GLN B CG   1  
ATOM 1864  C CD   . GLN B 1 18  ? 4.373   11.403  3.400   1.00 0.00 ? 18  GLN B CD   1  
ATOM 1865  O OE1  . GLN B 1 18  ? 3.420   12.168  3.549   1.00 0.00 ? 18  GLN B OE1  1  
ATOM 1866  N NE2  . GLN B 1 18  ? 5.171   11.443  2.342   1.00 0.00 ? 18  GLN B NE2  1  
ATOM 1867  H H    . GLN B 1 18  ? 6.146   8.322   4.030   1.00 0.00 ? 18  GLN B H    1  
ATOM 1868  H HA   . GLN B 1 18  ? 7.416   10.700  3.527   1.00 0.00 ? 18  GLN B HA   1  
ATOM 1869  H HB2  . GLN B 1 18  ? 5.968   10.165  6.117   1.00 0.00 ? 18  GLN B HB2  1  
ATOM 1870  H HB3  . GLN B 1 18  ? 6.112   11.694  5.263   1.00 0.00 ? 18  GLN B HB3  1  
ATOM 1871  H HG2  . GLN B 1 18  ? 4.772   9.402   3.937   1.00 0.00 ? 18  GLN B HG2  1  
ATOM 1872  H HG3  . GLN B 1 18  ? 3.908   10.318  5.168   1.00 0.00 ? 18  GLN B HG3  1  
ATOM 1873  H HE21 . GLN B 1 18  ? 5.913   10.799  2.298   1.00 0.00 ? 18  GLN B HE21 1  
ATOM 1874  H HE22 . GLN B 1 18  ? 4.988   12.111  1.649   1.00 0.00 ? 18  GLN B HE22 1  
ATOM 1875  N N    . LYS B 1 19  ? 8.525   9.361   6.328   1.00 0.00 ? 19  LYS B N    1  
ATOM 1876  C CA   . LYS B 1 19  ? 9.606   9.413   7.304   1.00 0.00 ? 19  LYS B CA   1  
ATOM 1877  C C    . LYS B 1 19  ? 10.967  9.565   6.630   1.00 0.00 ? 19  LYS B C    1  
ATOM 1878  O O    . LYS B 1 19  ? 11.733  10.470  6.959   1.00 0.00 ? 19  LYS B O    1  
ATOM 1879  C CB   . LYS B 1 19  ? 9.590   8.144   8.156   1.00 0.00 ? 19  LYS B CB   1  
ATOM 1880  C CG   . LYS B 1 19  ? 10.533  8.190   9.345   1.00 0.00 ? 19  LYS B CG   1  
ATOM 1881  C CD   . LYS B 1 19  ? 9.972   9.046   10.468  1.00 0.00 ? 19  LYS B CD   1  
ATOM 1882  C CE   . LYS B 1 19  ? 8.716   8.432   11.062  1.00 0.00 ? 19  LYS B CE   1  
ATOM 1883  N NZ   . LYS B 1 19  ? 8.942   7.032   11.516  1.00 0.00 ? 19  LYS B NZ   1  
ATOM 1884  H H    . LYS B 1 19  ? 7.830   8.676   6.419   1.00 0.00 ? 19  LYS B H    1  
ATOM 1885  H HA   . LYS B 1 19  ? 9.436   10.266  7.943   1.00 0.00 ? 19  LYS B HA   1  
ATOM 1886  H HB2  . LYS B 1 19  ? 8.588   7.986   8.526   1.00 0.00 ? 19  LYS B HB2  1  
ATOM 1887  H HB3  . LYS B 1 19  ? 9.869   7.306   7.536   1.00 0.00 ? 19  LYS B HB3  1  
ATOM 1888  H HG2  . LYS B 1 19  ? 10.681  7.185   9.711   1.00 0.00 ? 19  LYS B HG2  1  
ATOM 1889  H HG3  . LYS B 1 19  ? 11.479  8.603   9.026   1.00 0.00 ? 19  LYS B HG3  1  
ATOM 1890  H HD2  . LYS B 1 19  ? 10.717  9.139   11.245  1.00 0.00 ? 19  LYS B HD2  1  
ATOM 1891  H HD3  . LYS B 1 19  ? 9.734   10.025  10.077  1.00 0.00 ? 19  LYS B HD3  1  
ATOM 1892  H HE2  . LYS B 1 19  ? 8.401   9.028   11.905  1.00 0.00 ? 19  LYS B HE2  1  
ATOM 1893  H HE3  . LYS B 1 19  ? 7.939   8.436   10.310  1.00 0.00 ? 19  LYS B HE3  1  
ATOM 1894  H HZ1  . LYS B 1 19  ? 8.106   6.681   12.026  1.00 0.00 ? 19  LYS B HZ1  1  
ATOM 1895  H HZ2  . LYS B 1 19  ? 9.763   6.991   12.152  1.00 0.00 ? 19  LYS B HZ2  1  
ATOM 1896  H HZ3  . LYS B 1 19  ? 9.120   6.414   10.698  1.00 0.00 ? 19  LYS B HZ3  1  
ATOM 1897  N N    . TYR B 1 20  ? 11.252  8.695   5.670   1.00 0.00 ? 20  TYR B N    1  
ATOM 1898  C CA   . TYR B 1 20  ? 12.508  8.762   4.936   1.00 0.00 ? 20  TYR B CA   1  
ATOM 1899  C C    . TYR B 1 20  ? 12.427  9.811   3.840   1.00 0.00 ? 20  TYR B C    1  
ATOM 1900  O O    . TYR B 1 20  ? 13.427  10.411  3.447   1.00 0.00 ? 20  TYR B O    1  
ATOM 1901  C CB   . TYR B 1 20  ? 12.873  7.394   4.362   1.00 0.00 ? 20  TYR B CB   1  
ATOM 1902  C CG   . TYR B 1 20  ? 13.974  6.707   5.139   1.00 0.00 ? 20  TYR B CG   1  
ATOM 1903  C CD1  . TYR B 1 20  ? 13.684  5.960   6.272   1.00 0.00 ? 20  TYR B CD1  1  
ATOM 1904  C CD2  . TYR B 1 20  ? 15.301  6.815   4.745   1.00 0.00 ? 20  TYR B CD2  1  
ATOM 1905  C CE1  . TYR B 1 20  ? 14.687  5.338   6.992   1.00 0.00 ? 20  TYR B CE1  1  
ATOM 1906  C CE2  . TYR B 1 20  ? 16.309  6.197   5.459   1.00 0.00 ? 20  TYR B CE2  1  
ATOM 1907  C CZ   . TYR B 1 20  ? 15.998  5.459   6.582   1.00 0.00 ? 20  TYR B CZ   1  
ATOM 1908  O OH   . TYR B 1 20  ? 16.999  4.843   7.297   1.00 0.00 ? 20  TYR B OH   1  
ATOM 1909  H H    . TYR B 1 20  ? 10.588  8.016   5.420   1.00 0.00 ? 20  TYR B H    1  
ATOM 1910  H HA   . TYR B 1 20  ? 13.276  9.060   5.635   1.00 0.00 ? 20  TYR B HA   1  
ATOM 1911  H HB2  . TYR B 1 20  ? 12.001  6.756   4.381   1.00 0.00 ? 20  TYR B HB2  1  
ATOM 1912  H HB3  . TYR B 1 20  ? 13.208  7.512   3.343   1.00 0.00 ? 20  TYR B HB3  1  
ATOM 1913  H HD1  . TYR B 1 20  ? 12.657  5.866   6.592   1.00 0.00 ? 20  TYR B HD1  1  
ATOM 1914  H HD2  . TYR B 1 20  ? 15.542  7.393   3.867   1.00 0.00 ? 20  TYR B HD2  1  
ATOM 1915  H HE1  . TYR B 1 20  ? 14.443  4.760   7.871   1.00 0.00 ? 20  TYR B HE1  1  
ATOM 1916  H HE2  . TYR B 1 20  ? 17.336  6.294   5.137   1.00 0.00 ? 20  TYR B HE2  1  
ATOM 1917  H HH   . TYR B 1 20  ? 17.606  5.506   7.633   1.00 0.00 ? 20  TYR B HH   1  
ATOM 1918  N N    . ALA B 1 21  ? 11.213  9.995   3.340   1.00 0.00 ? 21  ALA B N    1  
ATOM 1919  C CA   . ALA B 1 21  ? 10.937  10.934  2.268   1.00 0.00 ? 21  ALA B CA   1  
ATOM 1920  C C    . ALA B 1 21  ? 10.732  12.359  2.782   1.00 0.00 ? 21  ALA B C    1  
ATOM 1921  O O    . ALA B 1 21  ? 10.262  13.226  2.045   1.00 0.00 ? 21  ALA B O    1  
ATOM 1922  C CB   . ALA B 1 21  ? 9.709   10.451  1.519   1.00 0.00 ? 21  ALA B CB   1  
ATOM 1923  H H    . ALA B 1 21  ? 10.472  9.462   3.696   1.00 0.00 ? 21  ALA B H    1  
ATOM 1924  H HA   . ALA B 1 21  ? 11.773  10.920  1.586   1.00 0.00 ? 21  ALA B HA   1  
ATOM 1925  H HB1  . ALA B 1 21  ? 10.002  9.720   0.778   1.00 0.00 ? 21  ALA B HB1  1  
ATOM 1926  H HB2  . ALA B 1 21  ? 9.226   11.286  1.036   1.00 0.00 ? 21  ALA B HB2  1  
ATOM 1927  H HB3  . ALA B 1 21  ? 9.028   9.992   2.224   1.00 0.00 ? 21  ALA B HB3  1  
ATOM 1928  N N    . GLY B 1 22  ? 11.086  12.601  4.041   1.00 0.00 ? 22  GLY B N    1  
ATOM 1929  C CA   . GLY B 1 22  ? 10.928  13.928  4.607   1.00 0.00 ? 22  GLY B CA   1  
ATOM 1930  C C    . GLY B 1 22  ? 10.425  13.899  6.036   1.00 0.00 ? 22  GLY B C    1  
ATOM 1931  O O    . GLY B 1 22  ? 9.359   13.353  6.317   1.00 0.00 ? 22  GLY B O    1  
ATOM 1932  H H    . GLY B 1 22  ? 11.457  11.881  4.589   1.00 0.00 ? 22  GLY B H    1  
ATOM 1933  H HA2  . GLY B 1 22  ? 11.883  14.433  4.583   1.00 0.00 ? 22  GLY B HA2  1  
ATOM 1934  H HA3  . GLY B 1 22  ? 10.225  14.483  4.003   1.00 0.00 ? 22  GLY B HA3  1  
ATOM 1935  N N    . LYS B 1 23  ? 11.195  14.495  6.941   1.00 0.00 ? 23  LYS B N    1  
ATOM 1936  C CA   . LYS B 1 23  ? 10.823  14.542  8.350   1.00 0.00 ? 23  LYS B CA   1  
ATOM 1937  C C    . LYS B 1 23  ? 10.139  15.864  8.684   1.00 0.00 ? 23  LYS B C    1  
ATOM 1938  O O    . LYS B 1 23  ? 9.305   15.932  9.588   1.00 0.00 ? 23  LYS B O    1  
ATOM 1939  C CB   . LYS B 1 23  ? 12.058  14.352  9.232   1.00 0.00 ? 23  LYS B CB   1  
ATOM 1940  C CG   . LYS B 1 23  ? 12.602  12.932  9.221   1.00 0.00 ? 23  LYS B CG   1  
ATOM 1941  C CD   . LYS B 1 23  ? 14.100  12.906  8.963   1.00 0.00 ? 23  LYS B CD   1  
ATOM 1942  C CE   . LYS B 1 23  ? 14.492  11.736  8.074   1.00 0.00 ? 23  LYS B CE   1  
ATOM 1943  N NZ   . LYS B 1 23  ? 15.776  11.985  7.362   1.00 0.00 ? 23  LYS B NZ   1  
ATOM 1944  H H    . LYS B 1 23  ? 12.032  14.916  6.654   1.00 0.00 ? 23  LYS B H    1  
ATOM 1945  H HA   . LYS B 1 23  ? 10.131  13.735  8.537   1.00 0.00 ? 23  LYS B HA   1  
ATOM 1946  H HB2  . LYS B 1 23  ? 12.837  15.018  8.889   1.00 0.00 ? 23  LYS B HB2  1  
ATOM 1947  H HB3  . LYS B 1 23  ? 11.802  14.608  10.251  1.00 0.00 ? 23  LYS B HB3  1  
ATOM 1948  H HG2  . LYS B 1 23  ? 12.405  12.474  10.178  1.00 0.00 ? 23  LYS B HG2  1  
ATOM 1949  H HG3  . LYS B 1 23  ? 12.102  12.372  8.443   1.00 0.00 ? 23  LYS B HG3  1  
ATOM 1950  H HD2  . LYS B 1 23  ? 14.388  13.825  8.477   1.00 0.00 ? 23  LYS B HD2  1  
ATOM 1951  H HD3  . LYS B 1 23  ? 14.617  12.819  9.908   1.00 0.00 ? 23  LYS B HD3  1  
ATOM 1952  H HE2  . LYS B 1 23  ? 14.597  10.854  8.688   1.00 0.00 ? 23  LYS B HE2  1  
ATOM 1953  H HE3  . LYS B 1 23  ? 13.711  11.577  7.346   1.00 0.00 ? 23  LYS B HE3  1  
ATOM 1954  H HZ1  . LYS B 1 23  ? 15.837  11.385  6.514   1.00 0.00 ? 23  LYS B HZ1  1  
ATOM 1955  H HZ2  . LYS B 1 23  ? 16.580  11.766  7.985   1.00 0.00 ? 23  LYS B HZ2  1  
ATOM 1956  H HZ3  . LYS B 1 23  ? 15.838  12.983  7.074   1.00 0.00 ? 23  LYS B HZ3  1  
ATOM 1957  N N    . ASP B 1 24  ? 10.496  16.911  7.947   1.00 0.00 ? 24  ASP B N    1  
ATOM 1958  C CA   . ASP B 1 24  ? 9.916   18.232  8.160   1.00 0.00 ? 24  ASP B CA   1  
ATOM 1959  C C    . ASP B 1 24  ? 9.269   18.753  6.880   1.00 0.00 ? 24  ASP B C    1  
ATOM 1960  O O    . ASP B 1 24  ? 9.203   19.962  6.654   1.00 0.00 ? 24  ASP B O    1  
ATOM 1961  C CB   . ASP B 1 24  ? 10.989  19.213  8.637   1.00 0.00 ? 24  ASP B CB   1  
ATOM 1962  C CG   . ASP B 1 24  ? 11.671  18.753  9.910   1.00 0.00 ? 24  ASP B CG   1  
ATOM 1963  O OD1  . ASP B 1 24  ? 11.785  17.525  10.113  1.00 0.00 ? 24  ASP B OD1  1  
ATOM 1964  O OD2  . ASP B 1 24  ? 12.094  19.620  10.704  1.00 0.00 ? 24  ASP B OD2  1  
ATOM 1965  H H    . ASP B 1 24  ? 11.165  16.793  7.241   1.00 0.00 ? 24  ASP B H    1  
ATOM 1966  H HA   . ASP B 1 24  ? 9.157   18.143  8.922   1.00 0.00 ? 24  ASP B HA   1  
ATOM 1967  H HB2  . ASP B 1 24  ? 11.739  19.319  7.868   1.00 0.00 ? 24  ASP B HB2  1  
ATOM 1968  H HB3  . ASP B 1 24  ? 10.531  20.174  8.822   1.00 0.00 ? 24  ASP B HB3  1  
ATOM 1969  N N    . GLY B 1 25  ? 8.797   17.833  6.045   1.00 0.00 ? 25  GLY B N    1  
ATOM 1970  C CA   . GLY B 1 25  ? 8.163   18.220  4.797   1.00 0.00 ? 25  GLY B CA   1  
ATOM 1971  C C    . GLY B 1 25  ? 9.139   18.848  3.821   1.00 0.00 ? 25  GLY B C    1  
ATOM 1972  O O    . GLY B 1 25  ? 9.573   19.984  4.012   1.00 0.00 ? 25  GLY B O    1  
ATOM 1973  H H    . GLY B 1 25  ? 8.878   16.884  6.276   1.00 0.00 ? 25  GLY B H    1  
ATOM 1974  H HA2  . GLY B 1 25  ? 7.729   17.343  4.340   1.00 0.00 ? 25  GLY B HA2  1  
ATOM 1975  H HA3  . GLY B 1 25  ? 7.377   18.929  5.010   1.00 0.00 ? 25  GLY B HA3  1  
ATOM 1976  N N    . HIS B 1 26  ? 9.486   18.107  2.774   1.00 0.00 ? 26  HIS B N    1  
ATOM 1977  C CA   . HIS B 1 26  ? 10.418  18.598  1.764   1.00 0.00 ? 26  HIS B CA   1  
ATOM 1978  C C    . HIS B 1 26  ? 9.854   18.402  0.361   1.00 0.00 ? 26  HIS B C    1  
ATOM 1979  O O    . HIS B 1 26  ? 9.781   19.344  -0.427  1.00 0.00 ? 26  HIS B O    1  
ATOM 1980  C CB   . HIS B 1 26  ? 11.764  17.883  1.891   1.00 0.00 ? 26  HIS B CB   1  
ATOM 1981  C CG   . HIS B 1 26  ? 12.898  18.629  1.261   1.00 0.00 ? 26  HIS B CG   1  
ATOM 1982  N ND1  . HIS B 1 26  ? 12.736  19.827  0.598   1.00 0.00 ? 26  HIS B ND1  1  
ATOM 1983  C CD2  . HIS B 1 26  ? 14.220  18.341  1.195   1.00 0.00 ? 26  HIS B CD2  1  
ATOM 1984  C CE1  . HIS B 1 26  ? 13.907  20.244  0.150   1.00 0.00 ? 26  HIS B CE1  1  
ATOM 1985  N NE2  . HIS B 1 26  ? 14.824  19.359  0.500   1.00 0.00 ? 26  HIS B NE2  1  
ATOM 1986  H H    . HIS B 1 26  ? 9.106   17.210  2.676   1.00 0.00 ? 26  HIS B H    1  
ATOM 1987  H HA   . HIS B 1 26  ? 10.564  19.655  1.935   1.00 0.00 ? 26  HIS B HA   1  
ATOM 1988  H HB2  . HIS B 1 26  ? 11.995  17.749  2.937   1.00 0.00 ? 26  HIS B HB2  1  
ATOM 1989  H HB3  . HIS B 1 26  ? 11.695  16.916  1.416   1.00 0.00 ? 26  HIS B HB3  1  
ATOM 1990  H HD1  . HIS B 1 26  ? 11.888  20.302  0.473   1.00 0.00 ? 26  HIS B HD1  1  
ATOM 1991  H HD2  . HIS B 1 26  ? 14.708  17.471  1.611   1.00 0.00 ? 26  HIS B HD2  1  
ATOM 1992  H HE1  . HIS B 1 26  ? 14.085  21.152  -0.405  1.00 0.00 ? 26  HIS B HE1  1  
ATOM 1993  H HE2  . HIS B 1 26  ? 15.790  19.466  0.372   1.00 0.00 ? 26  HIS B HE2  1  
ATOM 1994  N N    . SER B 1 27  ? 9.459   17.171  0.056   1.00 0.00 ? 27  SER B N    1  
ATOM 1995  C CA   . SER B 1 27  ? 8.901   16.850  -1.254  1.00 0.00 ? 27  SER B CA   1  
ATOM 1996  C C    . SER B 1 27  ? 7.982   15.637  -1.170  1.00 0.00 ? 27  SER B C    1  
ATOM 1997  O O    . SER B 1 27  ? 7.738   15.103  -0.087  1.00 0.00 ? 27  SER B O    1  
ATOM 1998  C CB   . SER B 1 27  ? 10.025  16.585  -2.257  1.00 0.00 ? 27  SER B CB   1  
ATOM 1999  O OG   . SER B 1 27  ? 10.930  17.674  -2.310  1.00 0.00 ? 27  SER B OG   1  
ATOM 2000  H H    . SER B 1 27  ? 9.542   16.461  0.726   1.00 0.00 ? 27  SER B H    1  
ATOM 2001  H HA   . SER B 1 27  ? 8.326   17.700  -1.586  1.00 0.00 ? 27  SER B HA   1  
ATOM 2002  H HB2  . SER B 1 27  ? 10.567  15.698  -1.962  1.00 0.00 ? 27  SER B HB2  1  
ATOM 2003  H HB3  . SER B 1 27  ? 9.601   16.437  -3.239  1.00 0.00 ? 27  SER B HB3  1  
ATOM 2004  H HG   . SER B 1 27  ? 10.449  18.480  -2.508  1.00 0.00 ? 27  SER B HG   1  
ATOM 2005  N N    . VAL B 1 28  ? 7.472   15.205  -2.319  1.00 0.00 ? 28  VAL B N    1  
ATOM 2006  C CA   . VAL B 1 28  ? 6.578   14.054  -2.373  1.00 0.00 ? 28  VAL B CA   1  
ATOM 2007  C C    . VAL B 1 28  ? 7.308   12.809  -2.867  1.00 0.00 ? 28  VAL B C    1  
ATOM 2008  O O    . VAL B 1 28  ? 6.686   11.871  -3.366  1.00 0.00 ? 28  VAL B O    1  
ATOM 2009  C CB   . VAL B 1 28  ? 5.370   14.325  -3.289  1.00 0.00 ? 28  VAL B CB   1  
ATOM 2010  C CG1  . VAL B 1 28  ? 4.400   15.289  -2.623  1.00 0.00 ? 28  VAL B CG1  1  
ATOM 2011  C CG2  . VAL B 1 28  ? 5.829   14.862  -4.635  1.00 0.00 ? 28  VAL B CG2  1  
ATOM 2012  H H    . VAL B 1 28  ? 7.703   15.671  -3.150  1.00 0.00 ? 28  VAL B H    1  
ATOM 2013  H HA   . VAL B 1 28  ? 6.212   13.871  -1.373  1.00 0.00 ? 28  VAL B HA   1  
ATOM 2014  H HB   . VAL B 1 28  ? 4.854   13.390  -3.456  1.00 0.00 ? 28  VAL B HB   1  
ATOM 2015  H HG11 . VAL B 1 28  ? 3.387   14.985  -2.835  1.00 0.00 ? 28  VAL B HG11 1  
ATOM 2016  H HG12 . VAL B 1 28  ? 4.565   16.286  -3.006  1.00 0.00 ? 28  VAL B HG12 1  
ATOM 2017  H HG13 . VAL B 1 28  ? 4.563   15.284  -1.555  1.00 0.00 ? 28  VAL B HG13 1  
ATOM 2018  H HG21 . VAL B 1 28  ? 4.991   14.890  -5.316  1.00 0.00 ? 28  VAL B HG21 1  
ATOM 2019  H HG22 . VAL B 1 28  ? 6.598   14.219  -5.036  1.00 0.00 ? 28  VAL B HG22 1  
ATOM 2020  H HG23 . VAL B 1 28  ? 6.223   15.860  -4.509  1.00 0.00 ? 28  VAL B HG23 1  
ATOM 2021  N N    . THR B 1 29  ? 8.630   12.803  -2.721  1.00 0.00 ? 29  THR B N    1  
ATOM 2022  C CA   . THR B 1 29  ? 9.441   11.670  -3.149  1.00 0.00 ? 29  THR B CA   1  
ATOM 2023  C C    . THR B 1 29  ? 10.385  11.228  -2.033  1.00 0.00 ? 29  THR B C    1  
ATOM 2024  O O    . THR B 1 29  ? 10.290  11.705  -0.902  1.00 0.00 ? 29  THR B O    1  
ATOM 2025  C CB   . THR B 1 29  ? 10.234  12.029  -4.406  1.00 0.00 ? 29  THR B CB   1  
ATOM 2026  O OG1  . THR B 1 29  ? 10.635  13.387  -4.376  1.00 0.00 ? 29  THR B OG1  1  
ATOM 2027  C CG2  . THR B 1 29  ? 9.454   11.805  -5.684  1.00 0.00 ? 29  THR B CG2  1  
ATOM 2028  H H    . THR B 1 29  ? 9.070   13.577  -2.314  1.00 0.00 ? 29  THR B H    1  
ATOM 2029  H HA   . THR B 1 29  ? 8.775   10.854  -3.380  1.00 0.00 ? 29  THR B HA   1  
ATOM 2030  H HB   . THR B 1 29  ? 11.119  11.414  -4.449  1.00 0.00 ? 29  THR B HB   1  
ATOM 2031  H HG1  . THR B 1 29  ? 11.127  13.593  -5.174  1.00 0.00 ? 29  THR B HG1  1  
ATOM 2032  H HG21 . THR B 1 29  ? 10.112  11.920  -6.532  1.00 0.00 ? 29  THR B HG21 1  
ATOM 2033  H HG22 . THR B 1 29  ? 8.654   12.529  -5.748  1.00 0.00 ? 29  THR B HG22 1  
ATOM 2034  H HG23 . THR B 1 29  ? 9.038   10.807  -5.683  1.00 0.00 ? 29  THR B HG23 1  
ATOM 2035  N N    . LEU B 1 30  ? 11.289  10.310  -2.356  1.00 0.00 ? 30  LEU B N    1  
ATOM 2036  C CA   . LEU B 1 30  ? 12.242  9.798   -1.377  1.00 0.00 ? 30  LEU B CA   1  
ATOM 2037  C C    . LEU B 1 30  ? 13.615  9.551   -2.026  1.00 0.00 ? 30  LEU B C    1  
ATOM 2038  O O    . LEU B 1 30  ? 14.211  10.474  -2.579  1.00 0.00 ? 30  LEU B O    1  
ATOM 2039  C CB   . LEU B 1 30  ? 11.683  8.517   -0.740  1.00 0.00 ? 30  LEU B CB   1  
ATOM 2040  C CG   . LEU B 1 30  ? 12.168  8.214   0.680   1.00 0.00 ? 30  LEU B CG   1  
ATOM 2041  C CD1  . LEU B 1 30  ? 11.897  6.762   1.030   1.00 0.00 ? 30  LEU B CD1  1  
ATOM 2042  C CD2  . LEU B 1 30  ? 13.647  8.537   0.838   1.00 0.00 ? 30  LEU B CD2  1  
ATOM 2043  H H    . LEU B 1 30  ? 11.310  9.964   -3.271  1.00 0.00 ? 30  LEU B H    1  
ATOM 2044  H HA   . LEU B 1 30  ? 12.356  10.548  -0.609  1.00 0.00 ? 30  LEU B HA   1  
ATOM 2045  H HB2  . LEU B 1 30  ? 10.608  8.601   -0.714  1.00 0.00 ? 30  LEU B HB2  1  
ATOM 2046  H HB3  . LEU B 1 30  ? 11.940  7.681   -1.371  1.00 0.00 ? 30  LEU B HB3  1  
ATOM 2047  H HG   . LEU B 1 30  ? 11.616  8.823   1.377   1.00 0.00 ? 30  LEU B HG   1  
ATOM 2048  H HD11 . LEU B 1 30  ? 12.012  6.150   0.148   1.00 0.00 ? 30  LEU B HD11 1  
ATOM 2049  H HD12 . LEU B 1 30  ? 10.889  6.666   1.406   1.00 0.00 ? 30  LEU B HD12 1  
ATOM 2050  H HD13 . LEU B 1 30  ? 12.595  6.436   1.788   1.00 0.00 ? 30  LEU B HD13 1  
ATOM 2051  H HD21 . LEU B 1 30  ? 13.846  9.519   0.436   1.00 0.00 ? 30  LEU B HD21 1  
ATOM 2052  H HD22 . LEU B 1 30  ? 14.234  7.805   0.305   1.00 0.00 ? 30  LEU B HD22 1  
ATOM 2053  H HD23 . LEU B 1 30  ? 13.911  8.518   1.884   1.00 0.00 ? 30  LEU B HD23 1  
ATOM 2054  N N    . SER B 1 31  ? 14.114  8.312   -1.964  1.00 0.00 ? 31  SER B N    1  
ATOM 2055  C CA   . SER B 1 31  ? 15.403  7.972   -2.551  1.00 0.00 ? 31  SER B CA   1  
ATOM 2056  C C    . SER B 1 31  ? 15.624  6.462   -2.493  1.00 0.00 ? 31  SER B C    1  
ATOM 2057  O O    . SER B 1 31  ? 15.436  5.838   -1.449  1.00 0.00 ? 31  SER B O    1  
ATOM 2058  C CB   . SER B 1 31  ? 16.533  8.710   -1.823  1.00 0.00 ? 31  SER B CB   1  
ATOM 2059  O OG   . SER B 1 31  ? 17.657  7.870   -1.618  1.00 0.00 ? 31  SER B OG   1  
ATOM 2060  H H    . SER B 1 31  ? 13.608  7.609   -1.517  1.00 0.00 ? 31  SER B H    1  
ATOM 2061  H HA   . SER B 1 31  ? 15.387  8.281   -3.586  1.00 0.00 ? 31  SER B HA   1  
ATOM 2062  H HB2  . SER B 1 31  ? 16.841  9.560   -2.413  1.00 0.00 ? 31  SER B HB2  1  
ATOM 2063  H HB3  . SER B 1 31  ? 16.175  9.053   -0.864  1.00 0.00 ? 31  SER B HB3  1  
ATOM 2064  H HG   . SER B 1 31  ? 18.106  7.725   -2.454  1.00 0.00 ? 31  SER B HG   1  
ATOM 2065  N N    . LYS B 1 32  ? 16.014  5.878   -3.623  1.00 0.00 ? 32  LYS B N    1  
ATOM 2066  C CA   . LYS B 1 32  ? 16.249  4.438   -3.702  1.00 0.00 ? 32  LYS B CA   1  
ATOM 2067  C C    . LYS B 1 32  ? 17.156  3.965   -2.567  1.00 0.00 ? 32  LYS B C    1  
ATOM 2068  O O    . LYS B 1 32  ? 16.926  2.911   -1.973  1.00 0.00 ? 32  LYS B O    1  
ATOM 2069  C CB   . LYS B 1 32  ? 16.877  4.078   -5.050  1.00 0.00 ? 32  LYS B CB   1  
ATOM 2070  C CG   . LYS B 1 32  ? 16.043  4.509   -6.245  1.00 0.00 ? 32  LYS B CG   1  
ATOM 2071  C CD   . LYS B 1 32  ? 16.713  4.126   -7.556  1.00 0.00 ? 32  LYS B CD   1  
ATOM 2072  C CE   . LYS B 1 32  ? 18.075  4.785   -7.698  1.00 0.00 ? 32  LYS B CE   1  
ATOM 2073  N NZ   . LYS B 1 32  ? 18.329  5.242   -9.092  1.00 0.00 ? 32  LYS B NZ   1  
ATOM 2074  H H    . LYS B 1 32  ? 16.140  6.427   -4.425  1.00 0.00 ? 32  LYS B H    1  
ATOM 2075  H HA   . LYS B 1 32  ? 15.290  3.941   -3.619  1.00 0.00 ? 32  LYS B HA   1  
ATOM 2076  H HB2  . LYS B 1 32  ? 17.844  4.553   -5.122  1.00 0.00 ? 32  LYS B HB2  1  
ATOM 2077  H HB3  . LYS B 1 32  ? 17.009  3.006   -5.097  1.00 0.00 ? 32  LYS B HB3  1  
ATOM 2078  H HG2  . LYS B 1 32  ? 15.079  4.026   -6.192  1.00 0.00 ? 32  LYS B HG2  1  
ATOM 2079  H HG3  . LYS B 1 32  ? 15.915  5.580   -6.216  1.00 0.00 ? 32  LYS B HG3  1  
ATOM 2080  H HD2  . LYS B 1 32  ? 16.837  3.054   -7.587  1.00 0.00 ? 32  LYS B HD2  1  
ATOM 2081  H HD3  . LYS B 1 32  ? 16.083  4.441   -8.376  1.00 0.00 ? 32  LYS B HD3  1  
ATOM 2082  H HE2  . LYS B 1 32  ? 18.122  5.636   -7.035  1.00 0.00 ? 32  LYS B HE2  1  
ATOM 2083  H HE3  . LYS B 1 32  ? 18.836  4.070   -7.418  1.00 0.00 ? 32  LYS B HE3  1  
ATOM 2084  H HZ1  . LYS B 1 32  ? 18.135  4.471   -9.762  1.00 0.00 ? 32  LYS B HZ1  1  
ATOM 2085  H HZ2  . LYS B 1 32  ? 19.321  5.535   -9.197  1.00 0.00 ? 32  LYS B HZ2  1  
ATOM 2086  H HZ3  . LYS B 1 32  ? 17.715  6.050   -9.320  1.00 0.00 ? 32  LYS B HZ3  1  
ATOM 2087  N N    . THR B 1 33  ? 18.189  4.751   -2.276  1.00 0.00 ? 33  THR B N    1  
ATOM 2088  C CA   . THR B 1 33  ? 19.135  4.423   -1.220  1.00 0.00 ? 33  THR B CA   1  
ATOM 2089  C C    . THR B 1 33  ? 18.519  4.655   0.157   1.00 0.00 ? 33  THR B C    1  
ATOM 2090  O O    . THR B 1 33  ? 18.692  3.848   1.065   1.00 0.00 ? 33  THR B O    1  
ATOM 2091  C CB   . THR B 1 33  ? 20.415  5.251   -1.394  1.00 0.00 ? 33  THR B CB   1  
ATOM 2092  O OG1  . THR B 1 33  ? 21.360  4.548   -2.181  1.00 0.00 ? 33  THR B OG1  1  
ATOM 2093  C CG2  . THR B 1 33  ? 21.094  5.618   -0.089  1.00 0.00 ? 33  THR B CG2  1  
ATOM 2094  H H    . THR B 1 33  ? 18.317  5.574   -2.784  1.00 0.00 ? 33  THR B H    1  
ATOM 2095  H HA   . THR B 1 33  ? 19.381  3.376   -1.315  1.00 0.00 ? 33  THR B HA   1  
ATOM 2096  H HB   . THR B 1 33  ? 20.166  6.168   -1.906  1.00 0.00 ? 33  THR B HB   1  
ATOM 2097  H HG1  . THR B 1 33  ? 20.926  4.186   -2.957  1.00 0.00 ? 33  THR B HG1  1  
ATOM 2098  H HG21 . THR B 1 33  ? 20.427  6.230   0.500   1.00 0.00 ? 33  THR B HG21 1  
ATOM 2099  H HG22 . THR B 1 33  ? 21.999  6.167   -0.297  1.00 0.00 ? 33  THR B HG22 1  
ATOM 2100  H HG23 . THR B 1 33  ? 21.334  4.719   0.458   1.00 0.00 ? 33  THR B HG23 1  
ATOM 2101  N N    . GLU B 1 34  ? 17.793  5.755   0.314   1.00 0.00 ? 34  GLU B N    1  
ATOM 2102  C CA   . GLU B 1 34  ? 17.160  6.056   1.593   1.00 0.00 ? 34  GLU B CA   1  
ATOM 2103  C C    . GLU B 1 34  ? 16.264  4.897   2.021   1.00 0.00 ? 34  GLU B C    1  
ATOM 2104  O O    . GLU B 1 34  ? 16.070  4.650   3.211   1.00 0.00 ? 34  GLU B O    1  
ATOM 2105  C CB   . GLU B 1 34  ? 16.353  7.349   1.502   1.00 0.00 ? 34  GLU B CB   1  
ATOM 2106  C CG   . GLU B 1 34  ? 17.010  8.516   2.221   1.00 0.00 ? 34  GLU B CG   1  
ATOM 2107  C CD   . GLU B 1 34  ? 17.505  9.586   1.268   1.00 0.00 ? 34  GLU B CD   1  
ATOM 2108  O OE1  . GLU B 1 34  ? 16.694  10.449  0.870   1.00 0.00 ? 34  GLU B OE1  1  
ATOM 2109  O OE2  . GLU B 1 34  ? 18.705  9.562   0.922   1.00 0.00 ? 34  GLU B OE2  1  
ATOM 2110  H H    . GLU B 1 34  ? 17.677  6.371   -0.440  1.00 0.00 ? 34  GLU B H    1  
ATOM 2111  H HA   . GLU B 1 34  ? 17.942  6.179   2.328   1.00 0.00 ? 34  GLU B HA   1  
ATOM 2112  H HB2  . GLU B 1 34  ? 16.233  7.614   0.463   1.00 0.00 ? 34  GLU B HB2  1  
ATOM 2113  H HB3  . GLU B 1 34  ? 15.380  7.187   1.939   1.00 0.00 ? 34  GLU B HB3  1  
ATOM 2114  H HG2  . GLU B 1 34  ? 16.291  8.959   2.894   1.00 0.00 ? 34  GLU B HG2  1  
ATOM 2115  H HG3  . GLU B 1 34  ? 17.849  8.141   2.789   1.00 0.00 ? 34  GLU B HG3  1  
ATOM 2116  N N    . PHE B 1 35  ? 15.743  4.180   1.033   1.00 0.00 ? 35  PHE B N    1  
ATOM 2117  C CA   . PHE B 1 35  ? 14.886  3.029   1.280   1.00 0.00 ? 35  PHE B CA   1  
ATOM 2118  C C    . PHE B 1 35  ? 15.704  1.885   1.872   1.00 0.00 ? 35  PHE B C    1  
ATOM 2119  O O    . PHE B 1 35  ? 15.204  1.086   2.662   1.00 0.00 ? 35  PHE B O    1  
ATOM 2120  C CB   . PHE B 1 35  ? 14.241  2.578   -0.031  1.00 0.00 ? 35  PHE B CB   1  
ATOM 2121  C CG   . PHE B 1 35  ? 12.830  2.085   0.111   1.00 0.00 ? 35  PHE B CG   1  
ATOM 2122  C CD1  . PHE B 1 35  ? 12.436  1.353   1.221   1.00 0.00 ? 35  PHE B CD1  1  
ATOM 2123  C CD2  . PHE B 1 35  ? 11.900  2.349   -0.877  1.00 0.00 ? 35  PHE B CD2  1  
ATOM 2124  C CE1  . PHE B 1 35  ? 11.137  0.896   1.339   1.00 0.00 ? 35  PHE B CE1  1  
ATOM 2125  C CE2  . PHE B 1 35  ? 10.602  1.897   -0.764  1.00 0.00 ? 35  PHE B CE2  1  
ATOM 2126  C CZ   . PHE B 1 35  ? 10.219  1.169   0.345   1.00 0.00 ? 35  PHE B CZ   1  
ATOM 2127  H H    . PHE B 1 35  ? 15.953  4.424   0.107   1.00 0.00 ? 35  PHE B H    1  
ATOM 2128  H HA   . PHE B 1 35  ? 14.117  3.319   1.979   1.00 0.00 ? 35  PHE B HA   1  
ATOM 2129  H HB2  . PHE B 1 35  ? 14.228  3.409   -0.722  1.00 0.00 ? 35  PHE B HB2  1  
ATOM 2130  H HB3  . PHE B 1 35  ? 14.831  1.778   -0.454  1.00 0.00 ? 35  PHE B HB3  1  
ATOM 2131  H HD1  . PHE B 1 35  ? 13.153  1.140   1.999   1.00 0.00 ? 35  PHE B HD1  1  
ATOM 2132  H HD2  . PHE B 1 35  ? 12.197  2.918   -1.745  1.00 0.00 ? 35  PHE B HD2  1  
ATOM 2133  H HE1  . PHE B 1 35  ? 10.841  0.327   2.208   1.00 0.00 ? 35  PHE B HE1  1  
ATOM 2134  H HE2  . PHE B 1 35  ? 9.890   2.111   -1.543  1.00 0.00 ? 35  PHE B HE2  1  
ATOM 2135  H HZ   . PHE B 1 35  ? 9.203   0.813   0.434   1.00 0.00 ? 35  PHE B HZ   1  
ATOM 2136  N N    . LEU B 1 36  ? 16.968  1.817   1.468   1.00 0.00 ? 36  LEU B N    1  
ATOM 2137  C CA   . LEU B 1 36  ? 17.877  0.776   1.935   1.00 0.00 ? 36  LEU B CA   1  
ATOM 2138  C C    . LEU B 1 36  ? 17.919  0.703   3.444   1.00 0.00 ? 36  LEU B C    1  
ATOM 2139  O O    . LEU B 1 36  ? 17.648  -0.336  4.047   1.00 0.00 ? 36  LEU B O    1  
ATOM 2140  C CB   . LEU B 1 36  ? 19.293  1.073   1.447   1.00 0.00 ? 36  LEU B CB   1  
ATOM 2141  C CG   . LEU B 1 36  ? 19.697  0.352   0.182   1.00 0.00 ? 36  LEU B CG   1  
ATOM 2142  C CD1  . LEU B 1 36  ? 19.736  -1.144  0.440   1.00 0.00 ? 36  LEU B CD1  1  
ATOM 2143  C CD2  . LEU B 1 36  ? 18.738  0.696   -0.943  1.00 0.00 ? 36  LEU B CD2  1  
ATOM 2144  H H    . LEU B 1 36  ? 17.299  2.484   0.833   1.00 0.00 ? 36  LEU B H    1  
ATOM 2145  H HA   . LEU B 1 36  ? 17.554  -0.171  1.534   1.00 0.00 ? 36  LEU B HA   1  
ATOM 2146  H HB2  . LEU B 1 36  ? 19.379  2.131   1.274   1.00 0.00 ? 36  LEU B HB2  1  
ATOM 2147  H HB3  . LEU B 1 36  ? 19.988  0.798   2.227   1.00 0.00 ? 36  LEU B HB3  1  
ATOM 2148  H HG   . LEU B 1 36  ? 20.684  0.676   -0.101  1.00 0.00 ? 36  LEU B HG   1  
ATOM 2149  H HD11 . LEU B 1 36  ? 19.628  -1.325  1.503   1.00 0.00 ? 36  LEU B HD11 1  
ATOM 2150  H HD12 . LEU B 1 36  ? 20.680  -1.545  0.100   1.00 0.00 ? 36  LEU B HD12 1  
ATOM 2151  H HD13 . LEU B 1 36  ? 18.928  -1.624  -0.090  1.00 0.00 ? 36  LEU B HD13 1  
ATOM 2152  H HD21 . LEU B 1 36  ? 18.468  -0.202  -1.478  1.00 0.00 ? 36  LEU B HD21 1  
ATOM 2153  H HD22 . LEU B 1 36  ? 19.213  1.392   -1.620  1.00 0.00 ? 36  LEU B HD22 1  
ATOM 2154  H HD23 . LEU B 1 36  ? 17.849  1.150   -0.529  1.00 0.00 ? 36  LEU B HD23 1  
ATOM 2155  N N    . SER B 1 37  ? 18.298  1.815   4.038   1.00 0.00 ? 37  SER B N    1  
ATOM 2156  C CA   . SER B 1 37  ? 18.428  1.899   5.478   1.00 0.00 ? 37  SER B CA   1  
ATOM 2157  C C    . SER B 1 37  ? 17.109  1.600   6.188   1.00 0.00 ? 37  SER B C    1  
ATOM 2158  O O    . SER B 1 37  ? 17.087  0.910   7.207   1.00 0.00 ? 37  SER B O    1  
ATOM 2159  C CB   . SER B 1 37  ? 18.942  3.280   5.888   1.00 0.00 ? 37  SER B CB   1  
ATOM 2160  O OG   . SER B 1 37  ? 18.348  4.298   5.102   1.00 0.00 ? 37  SER B OG   1  
ATOM 2161  H H    . SER B 1 37  ? 18.525  2.593   3.482   1.00 0.00 ? 37  SER B H    1  
ATOM 2162  H HA   . SER B 1 37  ? 19.157  1.157   5.766   1.00 0.00 ? 37  SER B HA   1  
ATOM 2163  H HB2  . SER B 1 37  ? 18.703  3.458   6.926   1.00 0.00 ? 37  SER B HB2  1  
ATOM 2164  H HB3  . SER B 1 37  ? 20.014  3.318   5.754   1.00 0.00 ? 37  SER B HB3  1  
ATOM 2165  H HG   . SER B 1 37  ? 19.009  4.682   4.521   1.00 0.00 ? 37  SER B HG   1  
ATOM 2166  N N    . PHE B 1 38  ? 16.012  2.127   5.651   1.00 0.00 ? 38  PHE B N    1  
ATOM 2167  C CA   . PHE B 1 38  ? 14.695  1.917   6.247   1.00 0.00 ? 38  PHE B CA   1  
ATOM 2168  C C    . PHE B 1 38  ? 14.363  0.433   6.348   1.00 0.00 ? 38  PHE B C    1  
ATOM 2169  O O    . PHE B 1 38  ? 13.901  -0.041  7.385   1.00 0.00 ? 38  PHE B O    1  
ATOM 2170  C CB   . PHE B 1 38  ? 13.615  2.627   5.433   1.00 0.00 ? 38  PHE B CB   1  
ATOM 2171  C CG   . PHE B 1 38  ? 12.247  2.528   6.049   1.00 0.00 ? 38  PHE B CG   1  
ATOM 2172  C CD1  . PHE B 1 38  ? 11.879  3.364   7.091   1.00 0.00 ? 38  PHE B CD1  1  
ATOM 2173  C CD2  . PHE B 1 38  ? 11.331  1.597   5.587   1.00 0.00 ? 38  PHE B CD2  1  
ATOM 2174  C CE1  . PHE B 1 38  ? 10.624  3.274   7.661   1.00 0.00 ? 38  PHE B CE1  1  
ATOM 2175  C CE2  . PHE B 1 38  ? 10.073  1.503   6.153   1.00 0.00 ? 38  PHE B CE2  1  
ATOM 2176  C CZ   . PHE B 1 38  ? 9.719   2.342   7.191   1.00 0.00 ? 38  PHE B CZ   1  
ATOM 2177  H H    . PHE B 1 38  ? 16.089  2.674   4.842   1.00 0.00 ? 38  PHE B H    1  
ATOM 2178  H HA   . PHE B 1 38  ? 14.714  2.336   7.241   1.00 0.00 ? 38  PHE B HA   1  
ATOM 2179  H HB2  . PHE B 1 38  ? 13.867  3.673   5.346   1.00 0.00 ? 38  PHE B HB2  1  
ATOM 2180  H HB3  . PHE B 1 38  ? 13.570  2.189   4.447   1.00 0.00 ? 38  PHE B HB3  1  
ATOM 2181  H HD1  . PHE B 1 38  ? 12.586  4.092   7.461   1.00 0.00 ? 38  PHE B HD1  1  
ATOM 2182  H HD2  . PHE B 1 38  ? 11.607  0.940   4.776   1.00 0.00 ? 38  PHE B HD2  1  
ATOM 2183  H HE1  . PHE B 1 38  ? 10.350  3.932   8.472   1.00 0.00 ? 38  PHE B HE1  1  
ATOM 2184  H HE2  . PHE B 1 38  ? 9.368   0.772   5.783   1.00 0.00 ? 38  PHE B HE2  1  
ATOM 2185  H HZ   . PHE B 1 38  ? 8.738   2.270   7.635   1.00 0.00 ? 38  PHE B HZ   1  
ATOM 2186  N N    . MET B 1 39  ? 14.590  -0.293  5.262   1.00 0.00 ? 39  MET B N    1  
ATOM 2187  C CA   . MET B 1 39  ? 14.305  -1.721  5.227   1.00 0.00 ? 39  MET B CA   1  
ATOM 2188  C C    . MET B 1 39  ? 15.109  -2.471  6.286   1.00 0.00 ? 39  MET B C    1  
ATOM 2189  O O    . MET B 1 39  ? 14.564  -3.271  7.044   1.00 0.00 ? 39  MET B O    1  
ATOM 2190  C CB   . MET B 1 39  ? 14.614  -2.288  3.839   1.00 0.00 ? 39  MET B CB   1  
ATOM 2191  C CG   . MET B 1 39  ? 14.338  -3.780  3.716   1.00 0.00 ? 39  MET B CG   1  
ATOM 2192  S SD   . MET B 1 39  ? 13.021  -4.155  2.542   1.00 0.00 ? 39  MET B SD   1  
ATOM 2193  C CE   . MET B 1 39  ? 11.638  -3.318  3.313   1.00 0.00 ? 39  MET B CE   1  
ATOM 2194  H H    . MET B 1 39  ? 14.952  0.143   4.462   1.00 0.00 ? 39  MET B H    1  
ATOM 2195  H HA   . MET B 1 39  ? 13.255  -1.851  5.431   1.00 0.00 ? 39  MET B HA   1  
ATOM 2196  H HB2  . MET B 1 39  ? 14.009  -1.770  3.109   1.00 0.00 ? 39  MET B HB2  1  
ATOM 2197  H HB3  . MET B 1 39  ? 15.657  -2.117  3.617   1.00 0.00 ? 39  MET B HB3  1  
ATOM 2198  H HG2  . MET B 1 39  ? 15.242  -4.273  3.389   1.00 0.00 ? 39  MET B HG2  1  
ATOM 2199  H HG3  . MET B 1 39  ? 14.055  -4.159  4.687   1.00 0.00 ? 39  MET B HG3  1  
ATOM 2200  H HE1  . MET B 1 39  ? 10.772  -3.962  3.298   1.00 0.00 ? 39  MET B HE1  1  
ATOM 2201  H HE2  . MET B 1 39  ? 11.419  -2.409  2.771   1.00 0.00 ? 39  MET B HE2  1  
ATOM 2202  H HE3  . MET B 1 39  ? 11.889  -3.075  4.335   1.00 0.00 ? 39  MET B HE3  1  
ATOM 2203  N N    . ASN B 1 40  ? 16.411  -2.216  6.316   1.00 0.00 ? 40  ASN B N    1  
ATOM 2204  C CA   . ASN B 1 40  ? 17.306  -2.874  7.263   1.00 0.00 ? 40  ASN B CA   1  
ATOM 2205  C C    . ASN B 1 40  ? 17.135  -2.349  8.690   1.00 0.00 ? 40  ASN B C    1  
ATOM 2206  O O    . ASN B 1 40  ? 17.551  -3.003  9.646   1.00 0.00 ? 40  ASN B O    1  
ATOM 2207  C CB   . ASN B 1 40  ? 18.759  -2.695  6.817   1.00 0.00 ? 40  ASN B CB   1  
ATOM 2208  C CG   . ASN B 1 40  ? 19.029  -3.321  5.462   1.00 0.00 ? 40  ASN B CG   1  
ATOM 2209  O OD1  . ASN B 1 40  ? 18.974  -4.541  5.308   1.00 0.00 ? 40  ASN B OD1  1  
ATOM 2210  N ND2  . ASN B 1 40  ? 19.326  -2.487  4.472   1.00 0.00 ? 40  ASN B ND2  1  
ATOM 2211  H H    . ASN B 1 40  ? 16.785  -1.577  5.675   1.00 0.00 ? 40  ASN B H    1  
ATOM 2212  H HA   . ASN B 1 40  ? 17.072  -3.928  7.255   1.00 0.00 ? 40  ASN B HA   1  
ATOM 2213  H HB2  . ASN B 1 40  ? 18.982  -1.640  6.756   1.00 0.00 ? 40  ASN B HB2  1  
ATOM 2214  H HB3  . ASN B 1 40  ? 19.411  -3.156  7.544   1.00 0.00 ? 40  ASN B HB3  1  
ATOM 2215  H HD21 . ASN B 1 40  ? 19.353  -1.523  4.668   1.00 0.00 ? 40  ASN B HD21 1  
ATOM 2216  H HD22 . ASN B 1 40  ? 19.506  -2.869  3.582   1.00 0.00 ? 40  ASN B HD22 1  
ATOM 2217  N N    . THR B 1 41  ? 16.554  -1.161  8.836   1.00 0.00 ? 41  THR B N    1  
ATOM 2218  C CA   . THR B 1 41  ? 16.378  -0.566  10.162  1.00 0.00 ? 41  THR B CA   1  
ATOM 2219  C C    . THR B 1 41  ? 14.972  -0.769  10.723  1.00 0.00 ? 41  THR B C    1  
ATOM 2220  O O    . THR B 1 41  ? 14.792  -0.832  11.938  1.00 0.00 ? 41  THR B O    1  
ATOM 2221  C CB   . THR B 1 41  ? 16.695  0.932   10.119  1.00 0.00 ? 41  THR B CB   1  
ATOM 2222  O OG1  . THR B 1 41  ? 16.849  1.449   11.428  1.00 0.00 ? 41  THR B OG1  1  
ATOM 2223  C CG2  . THR B 1 41  ? 15.639  1.761   9.423   1.00 0.00 ? 41  THR B CG2  1  
ATOM 2224  H H    . THR B 1 41  ? 16.257  -0.667  8.044   1.00 0.00 ? 41  THR B H    1  
ATOM 2225  H HA   . THR B 1 41  ? 17.080  -1.045  10.826  1.00 0.00 ? 41  THR B HA   1  
ATOM 2226  H HB   . THR B 1 41  ? 17.618  1.075   9.591   1.00 0.00 ? 41  THR B HB   1  
ATOM 2227  H HG1  . THR B 1 41  ? 16.003  1.435   11.882  1.00 0.00 ? 41  THR B HG1  1  
ATOM 2228  H HG21 . THR B 1 41  ? 14.900  1.111   8.984   1.00 0.00 ? 41  THR B HG21 1  
ATOM 2229  H HG22 . THR B 1 41  ? 16.102  2.356   8.649   1.00 0.00 ? 41  THR B HG22 1  
ATOM 2230  H HG23 . THR B 1 41  ? 15.163  2.415   10.141  1.00 0.00 ? 41  THR B HG23 1  
ATOM 2231  N N    . GLU B 1 42  ? 13.975  -0.830  9.850   1.00 0.00 ? 42  GLU B N    1  
ATOM 2232  C CA   . GLU B 1 42  ? 12.595  -0.979  10.303  1.00 0.00 ? 42  GLU B CA   1  
ATOM 2233  C C    . GLU B 1 42  ? 11.850  -2.070  9.539   1.00 0.00 ? 42  GLU B C    1  
ATOM 2234  O O    . GLU B 1 42  ? 10.622  -2.060  9.472   1.00 0.00 ? 42  GLU B O    1  
ATOM 2235  C CB   . GLU B 1 42  ? 11.862  0.356   10.163  1.00 0.00 ? 42  GLU B CB   1  
ATOM 2236  C CG   . GLU B 1 42  ? 12.783  1.570   10.231  1.00 0.00 ? 42  GLU B CG   1  
ATOM 2237  C CD   . GLU B 1 42  ? 12.126  2.765   10.894  1.00 0.00 ? 42  GLU B CD   1  
ATOM 2238  O OE1  . GLU B 1 42  ? 10.998  3.120   10.493  1.00 0.00 ? 42  GLU B OE1  1  
ATOM 2239  O OE2  . GLU B 1 42  ? 12.740  3.345   11.814  1.00 0.00 ? 42  GLU B OE2  1  
ATOM 2240  H H    . GLU B 1 42  ? 14.163  -0.747  8.892   1.00 0.00 ? 42  GLU B H    1  
ATOM 2241  H HA   . GLU B 1 42  ? 12.621  -1.249  11.348  1.00 0.00 ? 42  GLU B HA   1  
ATOM 2242  H HB2  . GLU B 1 42  ? 11.347  0.375   9.213   1.00 0.00 ? 42  GLU B HB2  1  
ATOM 2243  H HB3  . GLU B 1 42  ? 11.134  0.440   10.957  1.00 0.00 ? 42  GLU B HB3  1  
ATOM 2244  H HG2  . GLU B 1 42  ? 13.669  1.305   10.792  1.00 0.00 ? 42  GLU B HG2  1  
ATOM 2245  H HG3  . GLU B 1 42  ? 13.070  1.845   9.225   1.00 0.00 ? 42  GLU B HG3  1  
ATOM 2246  N N    . LEU B 1 43  ? 12.593  -3.016  8.980   1.00 0.00 ? 43  LEU B N    1  
ATOM 2247  C CA   . LEU B 1 43  ? 11.996  -4.118  8.235   1.00 0.00 ? 43  LEU B CA   1  
ATOM 2248  C C    . LEU B 1 43  ? 13.001  -5.250  8.065   1.00 0.00 ? 43  LEU B C    1  
ATOM 2249  O O    . LEU B 1 43  ? 13.247  -5.718  6.953   1.00 0.00 ? 43  LEU B O    1  
ATOM 2250  C CB   . LEU B 1 43  ? 11.497  -3.638  6.869   1.00 0.00 ? 43  LEU B CB   1  
ATOM 2251  C CG   . LEU B 1 43  ? 10.084  -3.044  6.861   1.00 0.00 ? 43  LEU B CG   1  
ATOM 2252  C CD1  . LEU B 1 43  ? 9.619   -2.787  5.437   1.00 0.00 ? 43  LEU B CD1  1  
ATOM 2253  C CD2  . LEU B 1 43  ? 9.109   -3.966  7.582   1.00 0.00 ? 43  LEU B CD2  1  
ATOM 2254  H H    . LEU B 1 43  ? 13.565  -2.979  9.076   1.00 0.00 ? 43  LEU B H    1  
ATOM 2255  H HA   . LEU B 1 43  ? 11.158  -4.486  8.806   1.00 0.00 ? 43  LEU B HA   1  
ATOM 2256  H HB2  . LEU B 1 43  ? 12.181  -2.887  6.506   1.00 0.00 ? 43  LEU B HB2  1  
ATOM 2257  H HB3  . LEU B 1 43  ? 11.513  -4.476  6.189   1.00 0.00 ? 43  LEU B HB3  1  
ATOM 2258  H HG   . LEU B 1 43  ? 10.096  -2.097  7.381   1.00 0.00 ? 43  LEU B HG   1  
ATOM 2259  H HD11 . LEU B 1 43  ? 9.634   -3.712  4.881   1.00 0.00 ? 43  LEU B HD11 1  
ATOM 2260  H HD12 . LEU B 1 43  ? 10.278  -2.073  4.966   1.00 0.00 ? 43  LEU B HD12 1  
ATOM 2261  H HD13 . LEU B 1 43  ? 8.614   -2.393  5.453   1.00 0.00 ? 43  LEU B HD13 1  
ATOM 2262  H HD21 . LEU B 1 43  ? 9.554   -4.944  7.693   1.00 0.00 ? 43  LEU B HD21 1  
ATOM 2263  H HD22 . LEU B 1 43  ? 8.198   -4.049  7.008   1.00 0.00 ? 43  LEU B HD22 1  
ATOM 2264  H HD23 . LEU B 1 43  ? 8.885   -3.560  8.557   1.00 0.00 ? 43  LEU B HD23 1  
ATOM 2265  N N    . ALA B 1 44  ? 13.575  -5.689  9.180   1.00 0.00 ? 44  ALA B N    1  
ATOM 2266  C CA   . ALA B 1 44  ? 14.549  -6.771  9.164   1.00 0.00 ? 44  ALA B CA   1  
ATOM 2267  C C    . ALA B 1 44  ? 13.855  -8.109  8.959   1.00 0.00 ? 44  ALA B C    1  
ATOM 2268  O O    . ALA B 1 44  ? 14.436  -9.046  8.419   1.00 0.00 ? 44  ALA B O    1  
ATOM 2269  C CB   . ALA B 1 44  ? 15.357  -6.778  10.452  1.00 0.00 ? 44  ALA B CB   1  
ATOM 2270  H H    . ALA B 1 44  ? 13.330  -5.279  10.035  1.00 0.00 ? 44  ALA B H    1  
ATOM 2271  H HA   . ALA B 1 44  ? 15.227  -6.597  8.338   1.00 0.00 ? 44  ALA B HA   1  
ATOM 2272  H HB1  . ALA B 1 44  ? 14.950  -7.517  11.127  1.00 0.00 ? 44  ALA B HB1  1  
ATOM 2273  H HB2  . ALA B 1 44  ? 15.307  -5.804  10.914  1.00 0.00 ? 44  ALA B HB2  1  
ATOM 2274  H HB3  . ALA B 1 44  ? 16.385  -7.021  10.231  1.00 0.00 ? 44  ALA B HB3  1  
ATOM 2275  N N    . ALA B 1 45  ? 12.599  -8.184  9.382   1.00 0.00 ? 45  ALA B N    1  
ATOM 2276  C CA   . ALA B 1 45  ? 11.817  -9.401  9.231   1.00 0.00 ? 45  ALA B CA   1  
ATOM 2277  C C    . ALA B 1 45  ? 11.677  -9.770  7.756   1.00 0.00 ? 45  ALA B C    1  
ATOM 2278  O O    . ALA B 1 45  ? 11.384  -10.916 7.416   1.00 0.00 ? 45  ALA B O    1  
ATOM 2279  C CB   . ALA B 1 45  ? 10.450  -9.220  9.870   1.00 0.00 ? 45  ALA B CB   1  
ATOM 2280  H H    . ALA B 1 45  ? 12.185  -7.399  9.796   1.00 0.00 ? 45  ALA B H    1  
ATOM 2281  H HA   . ALA B 1 45  ? 12.331  -10.198 9.748   1.00 0.00 ? 45  ALA B HA   1  
ATOM 2282  H HB1  . ALA B 1 45  ? 10.309  -8.179  10.124  1.00 0.00 ? 45  ALA B HB1  1  
ATOM 2283  H HB2  . ALA B 1 45  ? 10.390  -9.819  10.766  1.00 0.00 ? 45  ALA B HB2  1  
ATOM 2284  H HB3  . ALA B 1 45  ? 9.682   -9.529  9.176   1.00 0.00 ? 45  ALA B HB3  1  
ATOM 2285  N N    . PHE B 1 46  ? 11.890  -8.785  6.886   1.00 0.00 ? 46  PHE B N    1  
ATOM 2286  C CA   . PHE B 1 46  ? 11.790  -8.991  5.447   1.00 0.00 ? 46  PHE B CA   1  
ATOM 2287  C C    . PHE B 1 46  ? 13.167  -9.222  4.829   1.00 0.00 ? 46  PHE B C    1  
ATOM 2288  O O    . PHE B 1 46  ? 13.298  -9.919  3.823   1.00 0.00 ? 46  PHE B O    1  
ATOM 2289  C CB   . PHE B 1 46  ? 11.126  -7.777  4.792   1.00 0.00 ? 46  PHE B CB   1  
ATOM 2290  C CG   . PHE B 1 46  ? 9.644   -7.704  5.022   1.00 0.00 ? 46  PHE B CG   1  
ATOM 2291  C CD1  . PHE B 1 46  ? 9.138   -7.347  6.262   1.00 0.00 ? 46  PHE B CD1  1  
ATOM 2292  C CD2  . PHE B 1 46  ? 8.756   -7.989  3.998   1.00 0.00 ? 46  PHE B CD2  1  
ATOM 2293  C CE1  . PHE B 1 46  ? 7.775   -7.277  6.476   1.00 0.00 ? 46  PHE B CE1  1  
ATOM 2294  C CE2  . PHE B 1 46  ? 7.392   -7.920  4.205   1.00 0.00 ? 46  PHE B CE2  1  
ATOM 2295  C CZ   . PHE B 1 46  ? 6.900   -7.564  5.445   1.00 0.00 ? 46  PHE B CZ   1  
ATOM 2296  H H    . PHE B 1 46  ? 12.117  -7.893  7.220   1.00 0.00 ? 46  PHE B H    1  
ATOM 2297  H HA   . PHE B 1 46  ? 11.177  -9.862  5.276   1.00 0.00 ? 46  PHE B HA   1  
ATOM 2298  H HB2  . PHE B 1 46  ? 11.567  -6.876  5.194   1.00 0.00 ? 46  PHE B HB2  1  
ATOM 2299  H HB3  . PHE B 1 46  ? 11.298  -7.812  3.727   1.00 0.00 ? 46  PHE B HB3  1  
ATOM 2300  H HD1  . PHE B 1 46  ? 9.821   -7.123  7.069   1.00 0.00 ? 46  PHE B HD1  1  
ATOM 2301  H HD2  . PHE B 1 46  ? 9.140   -8.268  3.027   1.00 0.00 ? 46  PHE B HD2  1  
ATOM 2302  H HE1  . PHE B 1 46  ? 7.392   -6.999  7.447   1.00 0.00 ? 46  PHE B HE1  1  
ATOM 2303  H HE2  . PHE B 1 46  ? 6.712   -8.144  3.397   1.00 0.00 ? 46  PHE B HE2  1  
ATOM 2304  H HZ   . PHE B 1 46  ? 5.835   -7.510  5.609   1.00 0.00 ? 46  PHE B HZ   1  
ATOM 2305  N N    . THR B 1 47  ? 14.191  -8.625  5.435   1.00 0.00 ? 47  THR B N    1  
ATOM 2306  C CA   . THR B 1 47  ? 15.559  -8.759  4.940   1.00 0.00 ? 47  THR B CA   1  
ATOM 2307  C C    . THR B 1 47  ? 16.518  -9.123  6.069   1.00 0.00 ? 47  THR B C    1  
ATOM 2308  O O    . THR B 1 47  ? 17.610  -8.562  6.177   1.00 0.00 ? 47  THR B O    1  
ATOM 2309  C CB   . THR B 1 47  ? 16.004  -7.454  4.278   1.00 0.00 ? 47  THR B CB   1  
ATOM 2310  O OG1  . THR B 1 47  ? 17.378  -7.506  3.937   1.00 0.00 ? 47  THR B OG1  1  
ATOM 2311  C CG2  . THR B 1 47  ? 15.793  -6.240  5.155   1.00 0.00 ? 47  THR B CG2  1  
ATOM 2312  H H    . THR B 1 47  ? 14.023  -8.078  6.229   1.00 0.00 ? 47  THR B H    1  
ATOM 2313  H HA   . THR B 1 47  ? 15.573  -9.548  4.202   1.00 0.00 ? 47  THR B HA   1  
ATOM 2314  H HB   . THR B 1 47  ? 15.434  -7.310  3.373   1.00 0.00 ? 47  THR B HB   1  
ATOM 2315  H HG1  . THR B 1 47  ? 17.507  -7.117  3.069   1.00 0.00 ? 47  THR B HG1  1  
ATOM 2316  H HG21 . THR B 1 47  ? 14.751  -5.957  5.131   1.00 0.00 ? 47  THR B HG21 1  
ATOM 2317  H HG22 . THR B 1 47  ? 16.397  -5.422  4.790   1.00 0.00 ? 47  THR B HG22 1  
ATOM 2318  H HG23 . THR B 1 47  ? 16.079  -6.476  6.170   1.00 0.00 ? 47  THR B HG23 1  
ATOM 2319  N N    . LYS B 1 48  ? 16.106  -10.068 6.907   1.00 0.00 ? 48  LYS B N    1  
ATOM 2320  C CA   . LYS B 1 48  ? 16.929  -10.508 8.027   1.00 0.00 ? 48  LYS B CA   1  
ATOM 2321  C C    . LYS B 1 48  ? 18.117  -11.325 7.530   1.00 0.00 ? 48  LYS B C    1  
ATOM 2322  O O    . LYS B 1 48  ? 17.956  -12.455 7.069   1.00 0.00 ? 48  LYS B O    1  
ATOM 2323  C CB   . LYS B 1 48  ? 16.094  -11.333 9.009   1.00 0.00 ? 48  LYS B CB   1  
ATOM 2324  C CG   . LYS B 1 48  ? 15.806  -10.612 10.316  1.00 0.00 ? 48  LYS B CG   1  
ATOM 2325  C CD   . LYS B 1 48  ? 14.425  -10.959 10.854  1.00 0.00 ? 48  LYS B CD   1  
ATOM 2326  C CE   . LYS B 1 48  ? 14.512  -11.821 12.103  1.00 0.00 ? 48  LYS B CE   1  
ATOM 2327  N NZ   . LYS B 1 48  ? 14.342  -11.019 13.346  1.00 0.00 ? 48  LYS B NZ   1  
ATOM 2328  H H    . LYS B 1 48  ? 15.227  -10.477 6.769   1.00 0.00 ? 48  LYS B H    1  
ATOM 2329  H HA   . LYS B 1 48  ? 17.299  -9.628  8.533   1.00 0.00 ? 48  LYS B HA   1  
ATOM 2330  H HB2  . LYS B 1 48  ? 15.151  -11.580 8.544   1.00 0.00 ? 48  LYS B HB2  1  
ATOM 2331  H HB3  . LYS B 1 48  ? 16.622  -12.248 9.237   1.00 0.00 ? 48  LYS B HB3  1  
ATOM 2332  H HG2  . LYS B 1 48  ? 16.548  -10.899 11.046  1.00 0.00 ? 48  LYS B HG2  1  
ATOM 2333  H HG3  . LYS B 1 48  ? 15.858  -9.547  10.146  1.00 0.00 ? 48  LYS B HG3  1  
ATOM 2334  H HD2  . LYS B 1 48  ? 13.905  -10.045 11.097  1.00 0.00 ? 48  LYS B HD2  1  
ATOM 2335  H HD3  . LYS B 1 48  ? 13.877  -11.496 10.093  1.00 0.00 ? 48  LYS B HD3  1  
ATOM 2336  H HE2  . LYS B 1 48  ? 13.738  -12.572 12.061  1.00 0.00 ? 48  LYS B HE2  1  
ATOM 2337  H HE3  . LYS B 1 48  ? 15.479  -12.304 12.126  1.00 0.00 ? 48  LYS B HE3  1  
ATOM 2338  H HZ1  . LYS B 1 48  ? 15.268  -10.825 13.776  1.00 0.00 ? 48  LYS B HZ1  1  
ATOM 2339  H HZ2  . LYS B 1 48  ? 13.757  -11.540 14.030  1.00 0.00 ? 48  LYS B HZ2  1  
ATOM 2340  H HZ3  . LYS B 1 48  ? 13.876  -10.116 13.127  1.00 0.00 ? 48  LYS B HZ3  1  
ATOM 2341  N N    . ASN B 1 49  ? 19.308  -10.743 7.620   1.00 0.00 ? 49  ASN B N    1  
ATOM 2342  C CA   . ASN B 1 49  ? 20.520  -11.416 7.170   1.00 0.00 ? 49  ASN B CA   1  
ATOM 2343  C C    . ASN B 1 49  ? 20.438  -11.739 5.680   1.00 0.00 ? 49  ASN B C    1  
ATOM 2344  O O    . ASN B 1 49  ? 21.159  -12.603 5.181   1.00 0.00 ? 49  ASN B O    1  
ATOM 2345  C CB   . ASN B 1 49  ? 20.747  -12.699 7.972   1.00 0.00 ? 49  ASN B CB   1  
ATOM 2346  C CG   . ASN B 1 49  ? 22.209  -12.928 8.297   1.00 0.00 ? 49  ASN B CG   1  
ATOM 2347  O OD1  . ASN B 1 49  ? 22.876  -12.057 8.856   1.00 0.00 ? 49  ASN B OD1  1  
ATOM 2348  N ND2  . ASN B 1 49  ? 22.716  -14.104 7.949   1.00 0.00 ? 49  ASN B ND2  1  
ATOM 2349  H H    . ASN B 1 49  ? 19.372  -9.838  7.991   1.00 0.00 ? 49  ASN B H    1  
ATOM 2350  H HA   . ASN B 1 49  ? 21.351  -10.747 7.335   1.00 0.00 ? 49  ASN B HA   1  
ATOM 2351  H HB2  . ASN B 1 49  ? 20.196  -12.638 8.899   1.00 0.00 ? 49  ASN B HB2  1  
ATOM 2352  H HB3  . ASN B 1 49  ? 20.387  -13.542 7.400   1.00 0.00 ? 49  ASN B HB3  1  
ATOM 2353  H HD21 . ASN B 1 49  ? 22.122  -14.752 7.505   1.00 0.00 ? 49  ASN B HD21 1  
ATOM 2354  H HD22 . ASN B 1 49  ? 23.665  -14.278 8.148   1.00 0.00 ? 49  ASN B HD22 1  
ATOM 2355  N N    . GLN B 1 50  ? 19.552  -11.039 4.973   1.00 0.00 ? 50  GLN B N    1  
ATOM 2356  C CA   . GLN B 1 50  ? 19.373  -11.247 3.541   1.00 0.00 ? 50  GLN B CA   1  
ATOM 2357  C C    . GLN B 1 50  ? 19.094  -12.717 3.231   1.00 0.00 ? 50  GLN B C    1  
ATOM 2358  O O    . GLN B 1 50  ? 19.530  -13.239 2.205   1.00 0.00 ? 50  GLN B O    1  
ATOM 2359  C CB   . GLN B 1 50  ? 20.611  -10.769 2.779   1.00 0.00 ? 50  GLN B CB   1  
ATOM 2360  C CG   . GLN B 1 50  ? 20.385  -9.483  2.003   1.00 0.00 ? 50  GLN B CG   1  
ATOM 2361  C CD   . GLN B 1 50  ? 19.466  -9.673  0.813   1.00 0.00 ? 50  GLN B CD   1  
ATOM 2362  O OE1  . GLN B 1 50  ? 19.917  -9.970  -0.293  1.00 0.00 ? 50  GLN B OE1  1  
ATOM 2363  N NE2  . GLN B 1 50  ? 18.169  -9.503  1.036   1.00 0.00 ? 50  GLN B NE2  1  
ATOM 2364  H H    . GLN B 1 50  ? 19.007  -10.362 5.426   1.00 0.00 ? 50  GLN B H    1  
ATOM 2365  H HA   . GLN B 1 50  ? 18.522  -10.661 3.228   1.00 0.00 ? 50  GLN B HA   1  
ATOM 2366  H HB2  . GLN B 1 50  ? 21.409  -10.602 3.487   1.00 0.00 ? 50  GLN B HB2  1  
ATOM 2367  H HB3  . GLN B 1 50  ? 20.912  -11.536 2.083   1.00 0.00 ? 50  GLN B HB3  1  
ATOM 2368  H HG2  . GLN B 1 50  ? 19.946  -8.751  2.664   1.00 0.00 ? 50  GLN B HG2  1  
ATOM 2369  H HG3  . GLN B 1 50  ? 21.340  -9.119  1.649   1.00 0.00 ? 50  GLN B HG3  1  
ATOM 2370  H HE21 . GLN B 1 50  ? 17.882  -9.265  1.947   1.00 0.00 ? 50  GLN B HE21 1  
ATOM 2371  H HE22 . GLN B 1 50  ? 17.549  -9.620  0.279   1.00 0.00 ? 50  GLN B HE22 1  
ATOM 2372  N N    . LYS B 1 51  ? 18.359  -13.376 4.122   1.00 0.00 ? 51  LYS B N    1  
ATOM 2373  C CA   . LYS B 1 51  ? 18.018  -14.784 3.942   1.00 0.00 ? 51  LYS B CA   1  
ATOM 2374  C C    . LYS B 1 51  ? 17.375  -15.018 2.578   1.00 0.00 ? 51  LYS B C    1  
ATOM 2375  O O    . LYS B 1 51  ? 17.488  -16.100 2.003   1.00 0.00 ? 51  LYS B O    1  
ATOM 2376  C CB   . LYS B 1 51  ? 17.068  -15.245 5.050   1.00 0.00 ? 51  LYS B CB   1  
ATOM 2377  C CG   . LYS B 1 51  ? 17.220  -16.714 5.411   1.00 0.00 ? 51  LYS B CG   1  
ATOM 2378  C CD   . LYS B 1 51  ? 16.151  -17.565 4.744   1.00 0.00 ? 51  LYS B CD   1  
ATOM 2379  C CE   . LYS B 1 51  ? 16.089  -18.957 5.350   1.00 0.00 ? 51  LYS B CE   1  
ATOM 2380  N NZ   . LYS B 1 51  ? 14.921  -19.731 4.848   1.00 0.00 ? 51  LYS B NZ   1  
ATOM 2381  H H    . LYS B 1 51  ? 18.038  -12.905 4.919   1.00 0.00 ? 51  LYS B H    1  
ATOM 2382  H HA   . LYS B 1 51  ? 18.930  -15.357 4.000   1.00 0.00 ? 51  LYS B HA   1  
ATOM 2383  H HB2  . LYS B 1 51  ? 17.258  -14.658 5.937   1.00 0.00 ? 51  LYS B HB2  1  
ATOM 2384  H HB3  . LYS B 1 51  ? 16.050  -15.078 4.730   1.00 0.00 ? 51  LYS B HB3  1  
ATOM 2385  H HG2  . LYS B 1 51  ? 18.191  -17.055 5.087   1.00 0.00 ? 51  LYS B HG2  1  
ATOM 2386  H HG3  . LYS B 1 51  ? 17.136  -16.821 6.482   1.00 0.00 ? 51  LYS B HG3  1  
ATOM 2387  H HD2  . LYS B 1 51  ? 15.192  -17.085 4.869   1.00 0.00 ? 51  LYS B HD2  1  
ATOM 2388  H HD3  . LYS B 1 51  ? 16.378  -17.650 3.690   1.00 0.00 ? 51  LYS B HD3  1  
ATOM 2389  H HE2  . LYS B 1 51  ? 16.996  -19.487 5.098   1.00 0.00 ? 51  LYS B HE2  1  
ATOM 2390  H HE3  . LYS B 1 51  ? 16.015  -18.864 6.424   1.00 0.00 ? 51  LYS B HE3  1  
ATOM 2391  H HZ1  . LYS B 1 51  ? 15.208  -20.330 4.046   1.00 0.00 ? 51  LYS B HZ1  1  
ATOM 2392  H HZ2  . LYS B 1 51  ? 14.172  -19.082 4.530   1.00 0.00 ? 51  LYS B HZ2  1  
ATOM 2393  H HZ3  . LYS B 1 51  ? 14.542  -20.338 5.603   1.00 0.00 ? 51  LYS B HZ3  1  
ATOM 2394  N N    . ASP B 1 52  ? 16.704  -13.991 2.065   1.00 0.00 ? 52  ASP B N    1  
ATOM 2395  C CA   . ASP B 1 52  ? 16.046  -14.076 0.768   1.00 0.00 ? 52  ASP B CA   1  
ATOM 2396  C C    . ASP B 1 52  ? 16.351  -12.838 -0.073  1.00 0.00 ? 52  ASP B C    1  
ATOM 2397  O O    . ASP B 1 52  ? 15.727  -11.792 0.102   1.00 0.00 ? 52  ASP B O    1  
ATOM 2398  C CB   . ASP B 1 52  ? 14.534  -14.223 0.951   1.00 0.00 ? 52  ASP B CB   1  
ATOM 2399  C CG   . ASP B 1 52  ? 14.107  -15.671 1.089   1.00 0.00 ? 52  ASP B CG   1  
ATOM 2400  O OD1  . ASP B 1 52  ? 14.397  -16.466 0.171   1.00 0.00 ? 52  ASP B OD1  1  
ATOM 2401  O OD2  . ASP B 1 52  ? 13.482  -16.010 2.117   1.00 0.00 ? 52  ASP B OD2  1  
ATOM 2402  H H    . ASP B 1 52  ? 16.653  -13.153 2.572   1.00 0.00 ? 52  ASP B H    1  
ATOM 2403  H HA   . ASP B 1 52  ? 16.425  -14.948 0.259   1.00 0.00 ? 52  ASP B HA   1  
ATOM 2404  H HB2  . ASP B 1 52  ? 14.232  -13.691 1.840   1.00 0.00 ? 52  ASP B HB2  1  
ATOM 2405  H HB3  . ASP B 1 52  ? 14.032  -13.798 0.094   1.00 0.00 ? 52  ASP B HB3  1  
ATOM 2406  N N    . PRO B 1 53  ? 17.325  -12.936 -0.998  1.00 0.00 ? 53  PRO B N    1  
ATOM 2407  C CA   . PRO B 1 53  ? 17.713  -11.818 -1.858  1.00 0.00 ? 53  PRO B CA   1  
ATOM 2408  C C    . PRO B 1 53  ? 16.817  -11.672 -3.087  1.00 0.00 ? 53  PRO B C    1  
ATOM 2409  O O    . PRO B 1 53  ? 17.208  -11.052 -4.076  1.00 0.00 ? 53  PRO B O    1  
ATOM 2410  C CB   . PRO B 1 53  ? 19.130  -12.197 -2.275  1.00 0.00 ? 53  PRO B CB   1  
ATOM 2411  C CG   . PRO B 1 53  ? 19.118  -13.687 -2.321  1.00 0.00 ? 53  PRO B CG   1  
ATOM 2412  C CD   . PRO B 1 53  ? 18.132  -14.141 -1.271  1.00 0.00 ? 53  PRO B CD   1  
ATOM 2413  H HA   . PRO B 1 53  ? 17.732  -10.885 -1.313  1.00 0.00 ? 53  PRO B HA   1  
ATOM 2414  H HB2  . PRO B 1 53  ? 19.350  -11.771 -3.244  1.00 0.00 ? 53  PRO B HB2  1  
ATOM 2415  H HB3  . PRO B 1 53  ? 19.836  -11.830 -1.544  1.00 0.00 ? 53  PRO B HB3  1  
ATOM 2416  H HG2  . PRO B 1 53  ? 18.803  -14.021 -3.299  1.00 0.00 ? 53  PRO B HG2  1  
ATOM 2417  H HG3  . PRO B 1 53  ? 20.104  -14.067 -2.096  1.00 0.00 ? 53  PRO B HG3  1  
ATOM 2418  H HD2  . PRO B 1 53  ? 17.513  -14.937 -1.657  1.00 0.00 ? 53  PRO B HD2  1  
ATOM 2419  H HD3  . PRO B 1 53  ? 18.653  -14.466 -0.383  1.00 0.00 ? 53  PRO B HD3  1  
ATOM 2420  N N    . GLY B 1 54  ? 15.619  -12.245 -3.024  1.00 0.00 ? 54  GLY B N    1  
ATOM 2421  C CA   . GLY B 1 54  ? 14.700  -12.161 -4.143  1.00 0.00 ? 54  GLY B CA   1  
ATOM 2422  C C    . GLY B 1 54  ? 13.456  -11.350 -3.826  1.00 0.00 ? 54  GLY B C    1  
ATOM 2423  O O    . GLY B 1 54  ? 12.683  -11.020 -4.723  1.00 0.00 ? 54  GLY B O    1  
ATOM 2424  H H    . GLY B 1 54  ? 15.356  -12.728 -2.215  1.00 0.00 ? 54  GLY B H    1  
ATOM 2425  H HA2  . GLY B 1 54  ? 15.211  -11.704 -4.977  1.00 0.00 ? 54  GLY B HA2  1  
ATOM 2426  H HA3  . GLY B 1 54  ? 14.401  -13.161 -4.424  1.00 0.00 ? 54  GLY B HA3  1  
ATOM 2427  N N    . VAL B 1 55  ? 13.258  -11.032 -2.551  1.00 0.00 ? 55  VAL B N    1  
ATOM 2428  C CA   . VAL B 1 55  ? 12.097  -10.256 -2.128  1.00 0.00 ? 55  VAL B CA   1  
ATOM 2429  C C    . VAL B 1 55  ? 12.342  -8.756  -2.279  1.00 0.00 ? 55  VAL B C    1  
ATOM 2430  O O    . VAL B 1 55  ? 11.657  -8.075  -3.041  1.00 0.00 ? 55  VAL B O    1  
ATOM 2431  C CB   . VAL B 1 55  ? 11.728  -10.558 -0.663  1.00 0.00 ? 55  VAL B CB   1  
ATOM 2432  C CG1  . VAL B 1 55  ? 10.433  -9.857  -0.279  1.00 0.00 ? 55  VAL B CG1  1  
ATOM 2433  C CG2  . VAL B 1 55  ? 11.621  -12.058 -0.439  1.00 0.00 ? 55  VAL B CG2  1  
ATOM 2434  H H    . VAL B 1 55  ? 13.905  -11.325 -1.877  1.00 0.00 ? 55  VAL B H    1  
ATOM 2435  H HA   . VAL B 1 55  ? 11.261  -10.539 -2.752  1.00 0.00 ? 55  VAL B HA   1  
ATOM 2436  H HB   . VAL B 1 55  ? 12.517  -10.177 -0.030  1.00 0.00 ? 55  VAL B HB   1  
ATOM 2437  H HG11 . VAL B 1 55  ? 9.914   -9.542  -1.173  1.00 0.00 ? 55  VAL B HG11 1  
ATOM 2438  H HG12 . VAL B 1 55  ? 10.658  -8.993  0.328   1.00 0.00 ? 55  VAL B HG12 1  
ATOM 2439  H HG13 . VAL B 1 55  ? 9.807   -10.537 0.279   1.00 0.00 ? 55  VAL B HG13 1  
ATOM 2440  H HG21 . VAL B 1 55  ? 12.581  -12.446 -0.133  1.00 0.00 ? 55  VAL B HG21 1  
ATOM 2441  H HG22 . VAL B 1 55  ? 11.314  -12.539 -1.356  1.00 0.00 ? 55  VAL B HG22 1  
ATOM 2442  H HG23 . VAL B 1 55  ? 10.891  -12.255 0.332   1.00 0.00 ? 55  VAL B HG23 1  
ATOM 2443  N N    . LEU B 1 56  ? 13.318  -8.250  -1.531  1.00 0.00 ? 56  LEU B N    1  
ATOM 2444  C CA   . LEU B 1 56  ? 13.663  -6.839  -1.549  1.00 0.00 ? 56  LEU B CA   1  
ATOM 2445  C C    . LEU B 1 56  ? 14.435  -6.462  -2.811  1.00 0.00 ? 56  LEU B C    1  
ATOM 2446  O O    . LEU B 1 56  ? 14.098  -5.498  -3.500  1.00 0.00 ? 56  LEU B O    1  
ATOM 2447  C CB   . LEU B 1 56  ? 14.507  -6.525  -0.309  1.00 0.00 ? 56  LEU B CB   1  
ATOM 2448  C CG   . LEU B 1 56  ? 15.519  -5.395  -0.473  1.00 0.00 ? 56  LEU B CG   1  
ATOM 2449  C CD1  . LEU B 1 56  ? 15.686  -4.637  0.831   1.00 0.00 ? 56  LEU B CD1  1  
ATOM 2450  C CD2  . LEU B 1 56  ? 16.857  -5.940  -0.951  1.00 0.00 ? 56  LEU B CD2  1  
ATOM 2451  H H    . LEU B 1 56  ? 13.818  -8.844  -0.937  1.00 0.00 ? 56  LEU B H    1  
ATOM 2452  H HA   . LEU B 1 56  ? 12.749  -6.267  -1.507  1.00 0.00 ? 56  LEU B HA   1  
ATOM 2453  H HB2  . LEU B 1 56  ? 13.839  -6.269  0.499   1.00 0.00 ? 56  LEU B HB2  1  
ATOM 2454  H HB3  . LEU B 1 56  ? 15.047  -7.421  -0.038  1.00 0.00 ? 56  LEU B HB3  1  
ATOM 2455  H HG   . LEU B 1 56  ? 15.152  -4.709  -1.217  1.00 0.00 ? 56  LEU B HG   1  
ATOM 2456  H HD11 . LEU B 1 56  ? 16.714  -4.323  0.935   1.00 0.00 ? 56  LEU B HD11 1  
ATOM 2457  H HD12 . LEU B 1 56  ? 15.422  -5.283  1.656   1.00 0.00 ? 56  LEU B HD12 1  
ATOM 2458  H HD13 . LEU B 1 56  ? 15.042  -3.771  0.829   1.00 0.00 ? 56  LEU B HD13 1  
ATOM 2459  H HD21 . LEU B 1 56  ? 16.904  -7.002  -0.759  1.00 0.00 ? 56  LEU B HD21 1  
ATOM 2460  H HD22 . LEU B 1 56  ? 17.658  -5.442  -0.425  1.00 0.00 ? 56  LEU B HD22 1  
ATOM 2461  H HD23 . LEU B 1 56  ? 16.960  -5.762  -2.012  1.00 0.00 ? 56  LEU B HD23 1  
ATOM 2462  N N    . ASP B 1 57  ? 15.488  -7.216  -3.083  1.00 0.00 ? 57  ASP B N    1  
ATOM 2463  C CA   . ASP B 1 57  ? 16.348  -6.965  -4.235  1.00 0.00 ? 57  ASP B CA   1  
ATOM 2464  C C    . ASP B 1 57  ? 15.566  -6.934  -5.547  1.00 0.00 ? 57  ASP B C    1  
ATOM 2465  O O    . ASP B 1 57  ? 15.865  -6.132  -6.431  1.00 0.00 ? 57  ASP B O    1  
ATOM 2466  C CB   . ASP B 1 57  ? 17.438  -8.034  -4.303  1.00 0.00 ? 57  ASP B CB   1  
ATOM 2467  C CG   . ASP B 1 57  ? 18.689  -7.542  -5.005  1.00 0.00 ? 57  ASP B CG   1  
ATOM 2468  O OD1  . ASP B 1 57  ? 19.345  -6.621  -4.474  1.00 0.00 ? 57  ASP B OD1  1  
ATOM 2469  O OD2  . ASP B 1 57  ? 19.013  -8.079  -6.086  1.00 0.00 ? 57  ASP B OD2  1  
ATOM 2470  H H    . ASP B 1 57  ? 15.711  -7.951  -2.474  1.00 0.00 ? 57  ASP B H    1  
ATOM 2471  H HA   . ASP B 1 57  ? 16.816  -6.004  -4.090  1.00 0.00 ? 57  ASP B HA   1  
ATOM 2472  H HB2  . ASP B 1 57  ? 17.702  -8.330  -3.298  1.00 0.00 ? 57  ASP B HB2  1  
ATOM 2473  H HB3  . ASP B 1 57  ? 17.059  -8.892  -4.838  1.00 0.00 ? 57  ASP B HB3  1  
ATOM 2474  N N    . ARG B 1 58  ? 14.577  -7.811  -5.680  1.00 0.00 ? 58  ARG B N    1  
ATOM 2475  C CA   . ARG B 1 58  ? 13.776  -7.871  -6.901  1.00 0.00 ? 58  ARG B CA   1  
ATOM 2476  C C    . ARG B 1 58  ? 12.789  -6.710  -6.985  1.00 0.00 ? 58  ARG B C    1  
ATOM 2477  O O    . ARG B 1 58  ? 12.468  -6.235  -8.074  1.00 0.00 ? 58  ARG B O    1  
ATOM 2478  C CB   . ARG B 1 58  ? 13.014  -9.193  -6.977  1.00 0.00 ? 58  ARG B CB   1  
ATOM 2479  C CG   . ARG B 1 58  ? 13.893  -10.386 -7.319  1.00 0.00 ? 58  ARG B CG   1  
ATOM 2480  C CD   . ARG B 1 58  ? 13.185  -11.353 -8.256  1.00 0.00 ? 58  ARG B CD   1  
ATOM 2481  N NE   . ARG B 1 58  ? 12.850  -12.612 -7.593  1.00 0.00 ? 58  ARG B NE   1  
ATOM 2482  C CZ   . ARG B 1 58  ? 11.791  -12.776 -6.803  1.00 0.00 ? 58  ARG B CZ   1  
ATOM 2483  N NH1  . ARG B 1 58  ? 10.966  -11.763 -6.566  1.00 0.00 ? 58  ARG B NH1  1  
ATOM 2484  N NH2  . ARG B 1 58  ? 11.555  -13.957 -6.248  1.00 0.00 ? 58  ARG B NH2  1  
ATOM 2485  H H    . ARG B 1 58  ? 14.385  -8.434  -4.948  1.00 0.00 ? 58  ARG B H    1  
ATOM 2486  H HA   . ARG B 1 58  ? 14.451  -7.811  -7.740  1.00 0.00 ? 58  ARG B HA   1  
ATOM 2487  H HB2  . ARG B 1 58  ? 12.546  -9.377  -6.023  1.00 0.00 ? 58  ARG B HB2  1  
ATOM 2488  H HB3  . ARG B 1 58  ? 12.248  -9.109  -7.732  1.00 0.00 ? 58  ARG B HB3  1  
ATOM 2489  H HG2  . ARG B 1 58  ? 14.792  -10.031 -7.798  1.00 0.00 ? 58  ARG B HG2  1  
ATOM 2490  H HG3  . ARG B 1 58  ? 14.149  -10.904 -6.407  1.00 0.00 ? 58  ARG B HG3  1  
ATOM 2491  H HD2  . ARG B 1 58  ? 12.276  -10.892 -8.612  1.00 0.00 ? 58  ARG B HD2  1  
ATOM 2492  H HD3  . ARG B 1 58  ? 13.833  -11.561 -9.094  1.00 0.00 ? 58  ARG B HD3  1  
ATOM 2493  H HE   . ARG B 1 58  ? 13.443  -13.376 -7.746  1.00 0.00 ? 58  ARG B HE   1  
ATOM 2494  H HH11 . ARG B 1 58  ? 11.138  -10.869 -6.980  1.00 0.00 ? 58  ARG B HH11 1  
ATOM 2495  H HH12 . ARG B 1 58  ? 10.172  -11.894 -5.972  1.00 0.00 ? 58  ARG B HH12 1  
ATOM 2496  H HH22 . ARG B 1 58  ? 10.760  -14.081 -5.655  1.00 0.00 ? 58  ARG B HH22 1  
ATOM 2497  N N    . MET B 1 59  ? 12.296  -6.269  -5.833  1.00 0.00 ? 59  MET B N    1  
ATOM 2498  C CA   . MET B 1 59  ? 11.337  -5.187  -5.776  1.00 0.00 ? 59  MET B CA   1  
ATOM 2499  C C    . MET B 1 59  ? 11.986  -3.834  -6.049  1.00 0.00 ? 59  MET B C    1  
ATOM 2500  O O    . MET B 1 59  ? 11.519  -3.074  -6.898  1.00 0.00 ? 59  MET B O    1  
ATOM 2501  C CB   . MET B 1 59  ? 10.668  -5.197  -4.403  1.00 0.00 ? 59  MET B CB   1  
ATOM 2502  C CG   . MET B 1 59  ? 10.017  -3.888  -4.045  1.00 0.00 ? 59  MET B CG   1  
ATOM 2503  S SD   . MET B 1 59  ? 11.147  -2.772  -3.200  1.00 0.00 ? 59  MET B SD   1  
ATOM 2504  C CE   . MET B 1 59  ? 11.338  -3.603  -1.635  1.00 0.00 ? 59  MET B CE   1  
ATOM 2505  H H    . MET B 1 59  ? 12.574  -6.689  -4.995  1.00 0.00 ? 59  MET B H    1  
ATOM 2506  H HA   . MET B 1 59  ? 10.587  -5.359  -6.525  1.00 0.00 ? 59  MET B HA   1  
ATOM 2507  H HB2  . MET B 1 59  ? 9.912   -5.967  -4.388  1.00 0.00 ? 59  MET B HB2  1  
ATOM 2508  H HB3  . MET B 1 59  ? 11.413  -5.422  -3.652  1.00 0.00 ? 59  MET B HB3  1  
ATOM 2509  H HG2  . MET B 1 59  ? 9.681   -3.418  -4.955  1.00 0.00 ? 59  MET B HG2  1  
ATOM 2510  H HG3  . MET B 1 59  ? 9.174   -4.085  -3.406  1.00 0.00 ? 59  MET B HG3  1  
ATOM 2511  H HE1  . MET B 1 59  ? 10.379  -3.661  -1.142  1.00 0.00 ? 59  MET B HE1  1  
ATOM 2512  H HE2  . MET B 1 59  ? 12.029  -3.051  -1.018  1.00 0.00 ? 59  MET B HE2  1  
ATOM 2513  H HE3  . MET B 1 59  ? 11.718  -4.598  -1.806  1.00 0.00 ? 59  MET B HE3  1  
ATOM 2514  N N    . MET B 1 60  ? 13.042  -3.526  -5.313  1.00 0.00 ? 60  MET B N    1  
ATOM 2515  C CA   . MET B 1 60  ? 13.722  -2.259  -5.463  1.00 0.00 ? 60  MET B CA   1  
ATOM 2516  C C    . MET B 1 60  ? 14.283  -2.081  -6.874  1.00 0.00 ? 60  MET B C    1  
ATOM 2517  O O    . MET B 1 60  ? 14.381  -0.961  -7.374  1.00 0.00 ? 60  MET B O    1  
ATOM 2518  C CB   . MET B 1 60  ? 14.821  -2.140  -4.407  1.00 0.00 ? 60  MET B CB   1  
ATOM 2519  C CG   . MET B 1 60  ? 14.443  -1.215  -3.256  1.00 0.00 ? 60  MET B CG   1  
ATOM 2520  S SD   . MET B 1 60  ? 15.432  0.291   -3.229  1.00 0.00 ? 60  MET B SD   1  
ATOM 2521  C CE   . MET B 1 60  ? 15.440  0.682   -4.974  1.00 0.00 ? 60  MET B CE   1  
ATOM 2522  H H    . MET B 1 60  ? 13.362  -4.153  -4.640  1.00 0.00 ? 60  MET B H    1  
ATOM 2523  H HA   . MET B 1 60  ? 12.996  -1.487  -5.286  1.00 0.00 ? 60  MET B HA   1  
ATOM 2524  H HB2  . MET B 1 60  ? 15.024  -3.122  -4.002  1.00 0.00 ? 60  MET B HB2  1  
ATOM 2525  H HB3  . MET B 1 60  ? 15.717  -1.759  -4.873  1.00 0.00 ? 60  MET B HB3  1  
ATOM 2526  H HG2  . MET B 1 60  ? 13.400  -0.939  -3.356  1.00 0.00 ? 60  MET B HG2  1  
ATOM 2527  H HG3  . MET B 1 60  ? 14.587  -1.741  -2.324  1.00 0.00 ? 60  MET B HG3  1  
ATOM 2528  H HE1  . MET B 1 60  ? 16.445  0.601   -5.357  1.00 0.00 ? 60  MET B HE1  1  
ATOM 2529  H HE2  . MET B 1 60  ? 15.075  1.687   -5.121  1.00 0.00 ? 60  MET B HE2  1  
ATOM 2530  H HE3  . MET B 1 60  ? 14.797  -0.016  -5.496  1.00 0.00 ? 60  MET B HE3  1  
ATOM 2531  N N    . LYS B 1 61  ? 14.648  -3.185  -7.516  1.00 0.00 ? 61  LYS B N    1  
ATOM 2532  C CA   . LYS B 1 61  ? 15.192  -3.130  -8.870  1.00 0.00 ? 61  LYS B CA   1  
ATOM 2533  C C    . LYS B 1 61  ? 14.092  -2.958  -9.922  1.00 0.00 ? 61  LYS B C    1  
ATOM 2534  O O    . LYS B 1 61  ? 14.231  -2.164  -10.852 1.00 0.00 ? 61  LYS B O    1  
ATOM 2535  C CB   . LYS B 1 61  ? 16.011  -4.389  -9.167  1.00 0.00 ? 61  LYS B CB   1  
ATOM 2536  C CG   . LYS B 1 61  ? 15.178  -5.656  -9.289  1.00 0.00 ? 61  LYS B CG   1  
ATOM 2537  C CD   . LYS B 1 61  ? 16.024  -6.837  -9.739  1.00 0.00 ? 61  LYS B CD   1  
ATOM 2538  C CE   . LYS B 1 61  ? 15.642  -7.293  -11.137 1.00 0.00 ? 61  LYS B CE   1  
ATOM 2539  N NZ   . LYS B 1 61  ? 14.520  -8.272  -11.120 1.00 0.00 ? 61  LYS B NZ   1  
ATOM 2540  H H    . LYS B 1 61  ? 14.547  -4.054  -7.075  1.00 0.00 ? 61  LYS B H    1  
ATOM 2541  H HA   . LYS B 1 61  ? 15.847  -2.273  -8.920  1.00 0.00 ? 61  LYS B HA   1  
ATOM 2542  H HB2  . LYS B 1 61  ? 16.542  -4.245  -10.097 1.00 0.00 ? 61  LYS B HB2  1  
ATOM 2543  H HB3  . LYS B 1 61  ? 16.729  -4.532  -8.373  1.00 0.00 ? 61  LYS B HB3  1  
ATOM 2544  H HG2  . LYS B 1 61  ? 14.741  -5.883  -8.329  1.00 0.00 ? 61  LYS B HG2  1  
ATOM 2545  H HG3  . LYS B 1 61  ? 14.394  -5.491  -10.013 1.00 0.00 ? 61  LYS B HG3  1  
ATOM 2546  H HD2  . LYS B 1 61  ? 17.064  -6.546  -9.737  1.00 0.00 ? 61  LYS B HD2  1  
ATOM 2547  H HD3  . LYS B 1 61  ? 15.877  -7.656  -9.050  1.00 0.00 ? 61  LYS B HD3  1  
ATOM 2548  H HE2  . LYS B 1 61  ? 15.345  -6.429  -11.714 1.00 0.00 ? 61  LYS B HE2  1  
ATOM 2549  H HE3  . LYS B 1 61  ? 16.504  -7.754  -11.599 1.00 0.00 ? 61  LYS B HE3  1  
ATOM 2550  H HZ1  . LYS B 1 61  ? 14.878  -9.230  -11.313 1.00 0.00 ? 61  LYS B HZ1  1  
ATOM 2551  H HZ2  . LYS B 1 61  ? 13.818  -8.024  -11.846 1.00 0.00 ? 61  LYS B HZ2  1  
ATOM 2552  H HZ3  . LYS B 1 61  ? 14.055  -8.267  -10.189 1.00 0.00 ? 61  LYS B HZ3  1  
ATOM 2553  N N    . LYS B 1 62  ? 13.015  -3.728  -9.786  1.00 0.00 ? 62  LYS B N    1  
ATOM 2554  C CA   . LYS B 1 62  ? 11.909  -3.683  -10.742 1.00 0.00 ? 62  LYS B CA   1  
ATOM 2555  C C    . LYS B 1 62  ? 10.963  -2.508  -10.501 1.00 0.00 ? 62  LYS B C    1  
ATOM 2556  O O    . LYS B 1 62  ? 10.056  -2.266  -11.299 1.00 0.00 ? 62  LYS B O    1  
ATOM 2557  C CB   . LYS B 1 62  ? 11.121  -4.993  -10.693 1.00 0.00 ? 62  LYS B CB   1  
ATOM 2558  C CG   . LYS B 1 62  ? 10.318  -5.179  -9.415  1.00 0.00 ? 62  LYS B CG   1  
ATOM 2559  C CD   . LYS B 1 62  ? 8.867   -4.762  -9.605  1.00 0.00 ? 62  LYS B CD   1  
ATOM 2560  C CE   . LYS B 1 62  ? 8.147   -4.628  -8.273  1.00 0.00 ? 62  LYS B CE   1  
ATOM 2561  N NZ   . LYS B 1 62  ? 6.753   -5.147  -8.341  1.00 0.00 ? 62  LYS B NZ   1  
ATOM 2562  H H    . LYS B 1 62  ? 12.971  -4.358  -9.036  1.00 0.00 ? 62  LYS B H    1  
ATOM 2563  H HA   . LYS B 1 62  ? 12.337  -3.580  -11.728 1.00 0.00 ? 62  LYS B HA   1  
ATOM 2564  H HB2  . LYS B 1 62  ? 10.437  -5.018  -11.527 1.00 0.00 ? 62  LYS B HB2  1  
ATOM 2565  H HB3  . LYS B 1 62  ? 11.813  -5.817  -10.780 1.00 0.00 ? 62  LYS B HB3  1  
ATOM 2566  H HG2  . LYS B 1 62  ? 10.348  -6.220  -9.131  1.00 0.00 ? 62  LYS B HG2  1  
ATOM 2567  H HG3  . LYS B 1 62  ? 10.758  -4.576  -8.634  1.00 0.00 ? 62  LYS B HG3  1  
ATOM 2568  H HD2  . LYS B 1 62  ? 8.840   -3.811  -10.115 1.00 0.00 ? 62  LYS B HD2  1  
ATOM 2569  H HD3  . LYS B 1 62  ? 8.364   -5.509  -10.202 1.00 0.00 ? 62  LYS B HD3  1  
ATOM 2570  H HE2  . LYS B 1 62  ? 8.692   -5.183  -7.524  1.00 0.00 ? 62  LYS B HE2  1  
ATOM 2571  H HE3  . LYS B 1 62  ? 8.121   -3.583  -7.996  1.00 0.00 ? 62  LYS B HE3  1  
ATOM 2572  H HZ1  . LYS B 1 62  ? 6.264   -4.975  -7.438  1.00 0.00 ? 62  LYS B HZ1  1  
ATOM 2573  H HZ2  . LYS B 1 62  ? 6.761   -6.170  -8.528  1.00 0.00 ? 62  LYS B HZ2  1  
ATOM 2574  H HZ3  . LYS B 1 62  ? 6.231   -4.670  -9.103  1.00 0.00 ? 62  LYS B HZ3  1  
ATOM 2575  N N    . LEU B 1 63  ? 11.156  -1.785  -9.405  1.00 0.00 ? 63  LEU B N    1  
ATOM 2576  C CA   . LEU B 1 63  ? 10.290  -0.652  -9.089  1.00 0.00 ? 63  LEU B CA   1  
ATOM 2577  C C    . LEU B 1 63  ? 10.275  0.379   -10.209 1.00 0.00 ? 63  LEU B C    1  
ATOM 2578  O O    . LEU B 1 63  ? 9.370   1.212   -10.282 1.00 0.00 ? 63  LEU B O    1  
ATOM 2579  C CB   . LEU B 1 63  ? 10.701  0.005   -7.768  1.00 0.00 ? 63  LEU B CB   1  
ATOM 2580  C CG   . LEU B 1 63  ? 12.055  0.718   -7.781  1.00 0.00 ? 63  LEU B CG   1  
ATOM 2581  C CD1  . LEU B 1 63  ? 11.937  2.082   -8.426  1.00 0.00 ? 63  LEU B CD1  1  
ATOM 2582  C CD2  . LEU B 1 63  ? 12.594  0.864   -6.372  1.00 0.00 ? 63  LEU B CD2  1  
ATOM 2583  H H    . LEU B 1 63  ? 11.884  -2.022  -8.794  1.00 0.00 ? 63  LEU B H    1  
ATOM 2584  H HA   . LEU B 1 63  ? 9.294   -1.033  -8.989  1.00 0.00 ? 63  LEU B HA   1  
ATOM 2585  H HB2  . LEU B 1 63  ? 9.942   0.725   -7.501  1.00 0.00 ? 63  LEU B HB2  1  
ATOM 2586  H HB3  . LEU B 1 63  ? 10.731  -0.760  -7.007  1.00 0.00 ? 63  LEU B HB3  1  
ATOM 2587  H HG   . LEU B 1 63  ? 12.759  0.136   -8.355  1.00 0.00 ? 63  LEU B HG   1  
ATOM 2588  H HD11 . LEU B 1 63  ? 10.964  2.499   -8.212  1.00 0.00 ? 63  LEU B HD11 1  
ATOM 2589  H HD12 . LEU B 1 63  ? 12.064  1.987   -9.491  1.00 0.00 ? 63  LEU B HD12 1  
ATOM 2590  H HD13 . LEU B 1 63  ? 12.702  2.731   -8.026  1.00 0.00 ? 63  LEU B HD13 1  
ATOM 2591  H HD21 . LEU B 1 63  ? 12.634  -0.099  -5.902  1.00 0.00 ? 63  LEU B HD21 1  
ATOM 2592  H HD22 . LEU B 1 63  ? 11.945  1.515   -5.806  1.00 0.00 ? 63  LEU B HD22 1  
ATOM 2593  H HD23 . LEU B 1 63  ? 13.585  1.289   -6.411  1.00 0.00 ? 63  LEU B HD23 1  
ATOM 2594  N N    . ASP B 1 64  ? 11.267  0.321   -11.080 1.00 0.00 ? 64  ASP B N    1  
ATOM 2595  C CA   . ASP B 1 64  ? 11.350  1.250   -12.193 1.00 0.00 ? 64  ASP B CA   1  
ATOM 2596  C C    . ASP B 1 64  ? 11.323  2.694   -11.702 1.00 0.00 ? 64  ASP B C    1  
ATOM 2597  O O    . ASP B 1 64  ? 10.264  3.316   -11.631 1.00 0.00 ? 64  ASP B O    1  
ATOM 2598  C CB   . ASP B 1 64  ? 10.204  1.009   -13.175 1.00 0.00 ? 64  ASP B CB   1  
ATOM 2599  C CG   . ASP B 1 64  ? 10.541  1.467   -14.581 1.00 0.00 ? 64  ASP B CG   1  
ATOM 2600  O OD1  . ASP B 1 64  ? 11.403  2.360   -14.723 1.00 0.00 ? 64  ASP B OD1  1  
ATOM 2601  O OD2  . ASP B 1 64  ? 9.943   0.934   -15.539 1.00 0.00 ? 64  ASP B OD2  1  
ATOM 2602  H H    . ASP B 1 64  ? 11.960  -0.363  -10.977 1.00 0.00 ? 64  ASP B H    1  
ATOM 2603  H HA   . ASP B 1 64  ? 12.281  1.066   -12.688 1.00 0.00 ? 64  ASP B HA   1  
ATOM 2604  H HB2  . ASP B 1 64  ? 9.980   -0.048  -13.206 1.00 0.00 ? 64  ASP B HB2  1  
ATOM 2605  H HB3  . ASP B 1 64  ? 9.331   1.547   -12.840 1.00 0.00 ? 64  ASP B HB3  1  
ATOM 2606  N N    . LEU B 1 65  ? 12.494  3.216   -11.350 1.00 0.00 ? 65  LEU B N    1  
ATOM 2607  C CA   . LEU B 1 65  ? 12.600  4.581   -10.851 1.00 0.00 ? 65  LEU B CA   1  
ATOM 2608  C C    . LEU B 1 65  ? 12.797  5.575   -11.989 1.00 0.00 ? 65  LEU B C    1  
ATOM 2609  O O    . LEU B 1 65  ? 13.786  5.517   -12.719 1.00 0.00 ? 65  LEU B O    1  
ATOM 2610  C CB   . LEU B 1 65  ? 13.756  4.688   -9.852  1.00 0.00 ? 65  LEU B CB   1  
ATOM 2611  C CG   . LEU B 1 65  ? 13.482  5.567   -8.629  1.00 0.00 ? 65  LEU B CG   1  
ATOM 2612  C CD1  . LEU B 1 65  ? 13.326  7.022   -9.044  1.00 0.00 ? 65  LEU B CD1  1  
ATOM 2613  C CD2  . LEU B 1 65  ? 12.243  5.085   -7.883  1.00 0.00 ? 65  LEU B CD2  1  
ATOM 2614  H H    . LEU B 1 65  ? 13.302  2.666   -11.419 1.00 0.00 ? 65  LEU B H    1  
ATOM 2615  H HA   . LEU B 1 65  ? 11.678  4.818   -10.345 1.00 0.00 ? 65  LEU B HA   1  
ATOM 2616  H HB2  . LEU B 1 65  ? 13.996  3.693   -9.506  1.00 0.00 ? 65  LEU B HB2  1  
ATOM 2617  H HB3  . LEU B 1 65  ? 14.615  5.087   -10.369 1.00 0.00 ? 65  LEU B HB3  1  
ATOM 2618  H HG   . LEU B 1 65  ? 14.323  5.504   -7.955  1.00 0.00 ? 65  LEU B HG   1  
ATOM 2619  H HD11 . LEU B 1 65  ? 13.490  7.659   -8.189  1.00 0.00 ? 65  LEU B HD11 1  
ATOM 2620  H HD12 . LEU B 1 65  ? 12.328  7.181   -9.428  1.00 0.00 ? 65  LEU B HD12 1  
ATOM 2621  H HD13 . LEU B 1 65  ? 14.049  7.256   -9.812  1.00 0.00 ? 65  LEU B HD13 1  
ATOM 2622  H HD21 . LEU B 1 65  ? 11.688  5.937   -7.521  1.00 0.00 ? 65  LEU B HD21 1  
ATOM 2623  H HD22 . LEU B 1 65  ? 12.540  4.469   -7.048  1.00 0.00 ? 65  LEU B HD22 1  
ATOM 2624  H HD23 . LEU B 1 65  ? 11.620  4.509   -8.548  1.00 0.00 ? 65  LEU B HD23 1  
ATOM 2625  N N    . ASN B 1 66  ? 11.842  6.489   -12.128 1.00 0.00 ? 66  ASN B N    1  
ATOM 2626  C CA   . ASN B 1 66  ? 11.896  7.507   -13.169 1.00 0.00 ? 66  ASN B CA   1  
ATOM 2627  C C    . ASN B 1 66  ? 10.758  8.510   -13.000 1.00 0.00 ? 66  ASN B C    1  
ATOM 2628  O O    . ASN B 1 66  ? 10.230  9.035   -13.980 1.00 0.00 ? 66  ASN B O    1  
ATOM 2629  C CB   . ASN B 1 66  ? 11.826  6.857   -14.553 1.00 0.00 ? 66  ASN B CB   1  
ATOM 2630  C CG   . ASN B 1 66  ? 13.200  6.648   -15.162 1.00 0.00 ? 66  ASN B CG   1  
ATOM 2631  O OD1  . ASN B 1 66  ? 14.130  7.411   -14.901 1.00 0.00 ? 66  ASN B OD1  1  
ATOM 2632  N ND2  . ASN B 1 66  ? 13.333  5.610   -15.979 1.00 0.00 ? 66  ASN B ND2  1  
ATOM 2633  H H    . ASN B 1 66  ? 11.082  6.479   -11.509 1.00 0.00 ? 66  ASN B H    1  
ATOM 2634  H HA   . ASN B 1 66  ? 12.837  8.029   -13.073 1.00 0.00 ? 66  ASN B HA   1  
ATOM 2635  H HB2  . ASN B 1 66  ? 11.340  5.897   -14.469 1.00 0.00 ? 66  ASN B HB2  1  
ATOM 2636  H HB3  . ASN B 1 66  ? 11.252  7.490   -15.213 1.00 0.00 ? 66  ASN B HB3  1  
ATOM 2637  H HD21 . ASN B 1 66  ? 12.545  5.043   -16.141 1.00 0.00 ? 66  ASN B HD21 1  
ATOM 2638  H HD22 . ASN B 1 66  ? 14.215  5.452   -16.387 1.00 0.00 ? 66  ASN B HD22 1  
ATOM 2639  N N    . SER B 1 67  ? 10.388  8.769   -11.749 1.00 0.00 ? 67  SER B N    1  
ATOM 2640  C CA   . SER B 1 67  ? 9.314   9.708   -11.446 1.00 0.00 ? 67  SER B CA   1  
ATOM 2641  C C    . SER B 1 67  ? 9.866   10.957  -10.767 1.00 0.00 ? 67  SER B C    1  
ATOM 2642  O O    . SER B 1 67  ? 10.168  10.946  -9.574  1.00 0.00 ? 67  SER B O    1  
ATOM 2643  C CB   . SER B 1 67  ? 8.268   9.047   -10.548 1.00 0.00 ? 67  SER B CB   1  
ATOM 2644  O OG   . SER B 1 67  ? 7.056   9.782   -10.551 1.00 0.00 ? 67  SER B OG   1  
ATOM 2645  H H    . SER B 1 67  ? 10.850  8.320   -11.011 1.00 0.00 ? 67  SER B H    1  
ATOM 2646  H HA   . SER B 1 67  ? 8.850   9.994   -12.377 1.00 0.00 ? 67  SER B HA   1  
ATOM 2647  H HB2  . SER B 1 67  ? 8.068   8.048   -10.907 1.00 0.00 ? 67  SER B HB2  1  
ATOM 2648  H HB3  . SER B 1 67  ? 8.643   8.998   -9.537  1.00 0.00 ? 67  SER B HB3  1  
ATOM 2649  H HG   . SER B 1 67  ? 6.699   9.808   -11.441 1.00 0.00 ? 67  SER B HG   1  
ATOM 2650  N N    . ASP B 1 68  ? 9.999   12.032  -11.539 1.00 0.00 ? 68  ASP B N    1  
ATOM 2651  C CA   . ASP B 1 68  ? 10.520  13.294  -11.019 1.00 0.00 ? 68  ASP B CA   1  
ATOM 2652  C C    . ASP B 1 68  ? 11.996  13.173  -10.637 1.00 0.00 ? 68  ASP B C    1  
ATOM 2653  O O    . ASP B 1 68  ? 12.557  14.074  -10.014 1.00 0.00 ? 68  ASP B O    1  
ATOM 2654  C CB   . ASP B 1 68  ? 9.704   13.753  -9.809  1.00 0.00 ? 68  ASP B CB   1  
ATOM 2655  C CG   . ASP B 1 68  ? 8.217   13.816  -10.104 1.00 0.00 ? 68  ASP B CG   1  
ATOM 2656  O OD1  . ASP B 1 68  ? 7.821   14.612  -10.981 1.00 0.00 ? 68  ASP B OD1  1  
ATOM 2657  O OD2  . ASP B 1 68  ? 7.451   13.072  -9.457  1.00 0.00 ? 68  ASP B OD2  1  
ATOM 2658  H H    . ASP B 1 68  ? 9.744   11.975  -12.484 1.00 0.00 ? 68  ASP B H    1  
ATOM 2659  H HA   . ASP B 1 68  ? 10.427  14.033  -11.801 1.00 0.00 ? 68  ASP B HA   1  
ATOM 2660  H HB2  . ASP B 1 68  ? 9.859   13.064  -8.993  1.00 0.00 ? 68  ASP B HB2  1  
ATOM 2661  H HB3  . ASP B 1 68  ? 10.035  14.737  -9.512  1.00 0.00 ? 68  ASP B HB3  1  
ATOM 2662  N N    . GLY B 1 69  ? 12.624  12.061  -11.017 1.00 0.00 ? 69  GLY B N    1  
ATOM 2663  C CA   . GLY B 1 69  ? 14.027  11.859  -10.707 1.00 0.00 ? 69  GLY B CA   1  
ATOM 2664  C C    . GLY B 1 69  ? 14.251  11.167  -9.375  1.00 0.00 ? 69  GLY B C    1  
ATOM 2665  O O    . GLY B 1 69  ? 15.280  10.520  -9.175  1.00 0.00 ? 69  GLY B O    1  
ATOM 2666  H H    . GLY B 1 69  ? 12.135  11.376  -11.518 1.00 0.00 ? 69  GLY B H    1  
ATOM 2667  H HA2  . GLY B 1 69  ? 14.471  11.260  -11.489 1.00 0.00 ? 69  GLY B HA2  1  
ATOM 2668  H HA3  . GLY B 1 69  ? 14.518  12.821  -10.687 1.00 0.00 ? 69  GLY B HA3  1  
ATOM 2669  N N    . GLN B 1 70  ? 13.300  11.308  -8.456  1.00 0.00 ? 70  GLN B N    1  
ATOM 2670  C CA   . GLN B 1 70  ? 13.419  10.696  -7.139  1.00 0.00 ? 70  GLN B CA   1  
ATOM 2671  C C    . GLN B 1 70  ? 12.422  9.552   -6.962  1.00 0.00 ? 70  GLN B C    1  
ATOM 2672  O O    . GLN B 1 70  ? 11.800  9.104   -7.924  1.00 0.00 ? 70  GLN B O    1  
ATOM 2673  C CB   . GLN B 1 70  ? 13.207  11.752  -6.050  1.00 0.00 ? 70  GLN B CB   1  
ATOM 2674  C CG   . GLN B 1 70  ? 14.455  12.563  -5.744  1.00 0.00 ? 70  GLN B CG   1  
ATOM 2675  C CD   . GLN B 1 70  ? 15.304  11.936  -4.655  1.00 0.00 ? 70  GLN B CD   1  
ATOM 2676  O OE1  . GLN B 1 70  ? 15.766  12.620  -3.742  1.00 0.00 ? 70  GLN B OE1  1  
ATOM 2677  N NE2  . GLN B 1 70  ? 15.513  10.627  -4.746  1.00 0.00 ? 70  GLN B NE2  1  
ATOM 2678  H H    . GLN B 1 70  ? 12.508  11.841  -8.663  1.00 0.00 ? 70  GLN B H    1  
ATOM 2679  H HA   . GLN B 1 70  ? 14.417  10.301  -7.054  1.00 0.00 ? 70  GLN B HA   1  
ATOM 2680  H HB2  . GLN B 1 70  ? 12.432  12.432  -6.370  1.00 0.00 ? 70  GLN B HB2  1  
ATOM 2681  H HB3  . GLN B 1 70  ? 12.891  11.263  -5.142  1.00 0.00 ? 70  GLN B HB3  1  
ATOM 2682  H HG2  . GLN B 1 70  ? 15.049  12.640  -6.642  1.00 0.00 ? 70  GLN B HG2  1  
ATOM 2683  H HG3  . GLN B 1 70  ? 14.157  13.551  -5.424  1.00 0.00 ? 70  GLN B HG3  1  
ATOM 2684  H HE21 . GLN B 1 70  ? 15.115  10.145  -5.500  1.00 0.00 ? 70  GLN B HE21 1  
ATOM 2685  H HE22 . GLN B 1 70  ? 16.055  10.198  -4.052  1.00 0.00 ? 70  GLN B HE22 1  
ATOM 2686  N N    . LEU B 1 71  ? 12.281  9.083   -5.722  1.00 0.00 ? 71  LEU B N    1  
ATOM 2687  C CA   . LEU B 1 71  ? 11.369  7.995   -5.406  1.00 0.00 ? 71  LEU B CA   1  
ATOM 2688  C C    . LEU B 1 71  ? 9.924   8.413   -5.723  1.00 0.00 ? 71  LEU B C    1  
ATOM 2689  O O    . LEU B 1 71  ? 9.673   8.985   -6.782  1.00 0.00 ? 71  LEU B O    1  
ATOM 2690  C CB   . LEU B 1 71  ? 11.566  7.588   -3.932  1.00 0.00 ? 71  LEU B CB   1  
ATOM 2691  C CG   . LEU B 1 71  ? 12.299  6.261   -3.700  1.00 0.00 ? 71  LEU B CG   1  
ATOM 2692  C CD1  . LEU B 1 71  ? 11.324  5.098   -3.748  1.00 0.00 ? 71  LEU B CD1  1  
ATOM 2693  C CD2  . LEU B 1 71  ? 13.418  6.064   -4.715  1.00 0.00 ? 71  LEU B CD2  1  
ATOM 2694  H H    . LEU B 1 71  ? 12.805  9.479   -4.999  1.00 0.00 ? 71  LEU B H    1  
ATOM 2695  H HA   . LEU B 1 71  ? 11.629  7.162   -6.037  1.00 0.00 ? 71  LEU B HA   1  
ATOM 2696  H HB2  . LEU B 1 71  ? 12.134  8.364   -3.449  1.00 0.00 ? 71  LEU B HB2  1  
ATOM 2697  H HB3  . LEU B 1 71  ? 10.608  7.526   -3.454  1.00 0.00 ? 71  LEU B HB3  1  
ATOM 2698  H HG   . LEU B 1 71  ? 12.743  6.276   -2.715  1.00 0.00 ? 71  LEU B HG   1  
ATOM 2699  H HD11 . LEU B 1 71  ? 10.345  5.436   -3.436  1.00 0.00 ? 71  LEU B HD11 1  
ATOM 2700  H HD12 . LEU B 1 71  ? 11.667  4.317   -3.086  1.00 0.00 ? 71  LEU B HD12 1  
ATOM 2701  H HD13 . LEU B 1 71  ? 11.269  4.716   -4.756  1.00 0.00 ? 71  LEU B HD13 1  
ATOM 2702  H HD21 . LEU B 1 71  ? 12.995  5.943   -5.700  1.00 0.00 ? 71  LEU B HD21 1  
ATOM 2703  H HD22 . LEU B 1 71  ? 13.984  5.183   -4.457  1.00 0.00 ? 71  LEU B HD22 1  
ATOM 2704  H HD23 . LEU B 1 71  ? 14.068  6.927   -4.705  1.00 0.00 ? 71  LEU B HD23 1  
ATOM 2705  N N    . ASP B 1 72  ? 8.971   8.139   -4.829  1.00 0.00 ? 72  ASP B N    1  
ATOM 2706  C CA   . ASP B 1 72  ? 7.578   8.513   -5.078  1.00 0.00 ? 72  ASP B CA   1  
ATOM 2707  C C    . ASP B 1 72  ? 6.666   8.070   -3.936  1.00 0.00 ? 72  ASP B C    1  
ATOM 2708  O O    . ASP B 1 72  ? 7.132   7.637   -2.884  1.00 0.00 ? 72  ASP B O    1  
ATOM 2709  C CB   . ASP B 1 72  ? 7.090   7.911   -6.398  1.00 0.00 ? 72  ASP B CB   1  
ATOM 2710  C CG   . ASP B 1 72  ? 6.180   8.852   -7.163  1.00 0.00 ? 72  ASP B CG   1  
ATOM 2711  O OD1  . ASP B 1 72  ? 6.283   10.080  -6.952  1.00 0.00 ? 72  ASP B OD1  1  
ATOM 2712  O OD2  . ASP B 1 72  ? 5.366   8.362   -7.973  1.00 0.00 ? 72  ASP B OD2  1  
ATOM 2713  H H    . ASP B 1 72  ? 9.202   7.687   -3.995  1.00 0.00 ? 72  ASP B H    1  
ATOM 2714  H HA   . ASP B 1 72  ? 7.538   9.590   -5.152  1.00 0.00 ? 72  ASP B HA   1  
ATOM 2715  H HB2  . ASP B 1 72  ? 7.942   7.684   -7.019  1.00 0.00 ? 72  ASP B HB2  1  
ATOM 2716  H HB3  . ASP B 1 72  ? 6.547   7.000   -6.193  1.00 0.00 ? 72  ASP B HB3  1  
ATOM 2717  N N    . PHE B 1 73  ? 5.359   8.201   -4.154  1.00 0.00 ? 73  PHE B N    1  
ATOM 2718  C CA   . PHE B 1 73  ? 4.368   7.834   -3.147  1.00 0.00 ? 73  PHE B CA   1  
ATOM 2719  C C    . PHE B 1 73  ? 4.053   6.337   -3.162  1.00 0.00 ? 73  PHE B C    1  
ATOM 2720  O O    . PHE B 1 73  ? 4.208   5.658   -2.145  1.00 0.00 ? 73  PHE B O    1  
ATOM 2721  C CB   . PHE B 1 73  ? 3.086   8.646   -3.349  1.00 0.00 ? 73  PHE B CB   1  
ATOM 2722  C CG   . PHE B 1 73  ? 2.359   8.321   -4.621  1.00 0.00 ? 73  PHE B CG   1  
ATOM 2723  C CD1  . PHE B 1 73  ? 2.746   8.890   -5.825  1.00 0.00 ? 73  PHE B CD1  1  
ATOM 2724  C CD2  . PHE B 1 73  ? 1.289   7.440   -4.613  1.00 0.00 ? 73  PHE B CD2  1  
ATOM 2725  C CE1  . PHE B 1 73  ? 2.080   8.587   -6.996  1.00 0.00 ? 73  PHE B CE1  1  
ATOM 2726  C CE2  . PHE B 1 73  ? 0.619   7.133   -5.783  1.00 0.00 ? 73  PHE B CE2  1  
ATOM 2727  C CZ   . PHE B 1 73  ? 1.015   7.707   -6.975  1.00 0.00 ? 73  PHE B CZ   1  
ATOM 2728  H H    . PHE B 1 73  ? 5.053   8.564   -5.010  1.00 0.00 ? 73  PHE B H    1  
ATOM 2729  H HA   . PHE B 1 73  ? 4.782   8.084   -2.182  1.00 0.00 ? 73  PHE B HA   1  
ATOM 2730  H HB2  . PHE B 1 73  ? 2.416   8.452   -2.526  1.00 0.00 ? 73  PHE B HB2  1  
ATOM 2731  H HB3  . PHE B 1 73  ? 3.333   9.697   -3.365  1.00 0.00 ? 73  PHE B HB3  1  
ATOM 2732  H HD1  . PHE B 1 73  ? 3.578   9.578   -5.841  1.00 0.00 ? 73  PHE B HD1  1  
ATOM 2733  H HD2  . PHE B 1 73  ? 0.975   6.993   -3.677  1.00 0.00 ? 73  PHE B HD2  1  
ATOM 2734  H HE1  . PHE B 1 73  ? 2.391   9.037   -7.927  1.00 0.00 ? 73  PHE B HE1  1  
ATOM 2735  H HE2  . PHE B 1 73  ? -0.212  6.444   -5.766  1.00 0.00 ? 73  PHE B HE2  1  
ATOM 2736  H HZ   . PHE B 1 73  ? 0.493   7.468   -7.891  1.00 0.00 ? 73  PHE B HZ   1  
ATOM 2737  N N    . GLN B 1 74  ? 3.603   5.818   -4.305  1.00 0.00 ? 74  GLN B N    1  
ATOM 2738  C CA   . GLN B 1 74  ? 3.269   4.403   -4.399  1.00 0.00 ? 74  GLN B CA   1  
ATOM 2739  C C    . GLN B 1 74  ? 4.524   3.560   -4.489  1.00 0.00 ? 74  GLN B C    1  
ATOM 2740  O O    . GLN B 1 74  ? 4.539   2.430   -4.020  1.00 0.00 ? 74  GLN B O    1  
ATOM 2741  C CB   . GLN B 1 74  ? 2.362   4.110   -5.597  1.00 0.00 ? 74  GLN B CB   1  
ATOM 2742  C CG   . GLN B 1 74  ? 2.068   2.622   -5.785  1.00 0.00 ? 74  GLN B CG   1  
ATOM 2743  C CD   . GLN B 1 74  ? 1.620   1.936   -4.502  1.00 0.00 ? 74  GLN B CD   1  
ATOM 2744  O OE1  . GLN B 1 74  ? 0.761   2.445   -3.784  1.00 0.00 ? 74  GLN B OE1  1  
ATOM 2745  N NE2  . GLN B 1 74  ? 2.203   0.771   -4.206  1.00 0.00 ? 74  GLN B NE2  1  
ATOM 2746  H H    . GLN B 1 74  ? 3.492   6.392   -5.089  1.00 0.00 ? 74  GLN B H    1  
ATOM 2747  H HA   . GLN B 1 74  ? 2.744   4.134   -3.494  1.00 0.00 ? 74  GLN B HA   1  
ATOM 2748  H HB2  . GLN B 1 74  ? 1.423   4.627   -5.458  1.00 0.00 ? 74  GLN B HB2  1  
ATOM 2749  H HB3  . GLN B 1 74  ? 2.837   4.479   -6.493  1.00 0.00 ? 74  GLN B HB3  1  
ATOM 2750  H HG2  . GLN B 1 74  ? 1.287   2.516   -6.522  1.00 0.00 ? 74  GLN B HG2  1  
ATOM 2751  H HG3  . GLN B 1 74  ? 2.964   2.137   -6.143  1.00 0.00 ? 74  GLN B HG3  1  
ATOM 2752  H HE21 . GLN B 1 74  ? 2.882   0.420   -4.821  1.00 0.00 ? 74  GLN B HE21 1  
ATOM 2753  H HE22 . GLN B 1 74  ? 1.924   0.305   -3.384  1.00 0.00 ? 74  GLN B HE22 1  
ATOM 2754  N N    . GLU B 1 75  ? 5.583   4.110   -5.081  1.00 0.00 ? 75  GLU B N    1  
ATOM 2755  C CA   . GLU B 1 75  ? 6.838   3.376   -5.202  1.00 0.00 ? 75  GLU B CA   1  
ATOM 2756  C C    . GLU B 1 75  ? 7.161   2.697   -3.885  1.00 0.00 ? 75  GLU B C    1  
ATOM 2757  O O    . GLU B 1 75  ? 7.558   1.544   -3.857  1.00 0.00 ? 75  GLU B O    1  
ATOM 2758  C CB   . GLU B 1 75  ? 7.979   4.311   -5.609  1.00 0.00 ? 75  GLU B CB   1  
ATOM 2759  C CG   . GLU B 1 75  ? 8.552   4.004   -6.983  1.00 0.00 ? 75  GLU B CG   1  
ATOM 2760  C CD   . GLU B 1 75  ? 8.853   5.256   -7.782  1.00 0.00 ? 75  GLU B CD   1  
ATOM 2761  O OE1  . GLU B 1 75  ? 9.520   6.161   -7.238  1.00 0.00 ? 75  GLU B OE1  1  
ATOM 2762  O OE2  . GLU B 1 75  ? 8.422   5.332   -8.951  1.00 0.00 ? 75  GLU B OE2  1  
ATOM 2763  H H    . GLU B 1 75  ? 5.520   5.022   -5.434  1.00 0.00 ? 75  GLU B H    1  
ATOM 2764  H HA   . GLU B 1 75  ? 6.716   2.615   -5.961  1.00 0.00 ? 75  GLU B HA   1  
ATOM 2765  H HB2  . GLU B 1 75  ? 7.615   5.327   -5.612  1.00 0.00 ? 75  GLU B HB2  1  
ATOM 2766  H HB3  . GLU B 1 75  ? 8.776   4.223   -4.884  1.00 0.00 ? 75  GLU B HB3  1  
ATOM 2767  H HG2  . GLU B 1 75  ? 9.468   3.444   -6.859  1.00 0.00 ? 75  GLU B HG2  1  
ATOM 2768  H HG3  . GLU B 1 75  ? 7.838   3.407   -7.531  1.00 0.00 ? 75  GLU B HG3  1  
ATOM 2769  N N    . PHE B 1 76  ? 6.956   3.406   -2.788  1.00 0.00 ? 76  PHE B N    1  
ATOM 2770  C CA   . PHE B 1 76  ? 7.211   2.828   -1.483  1.00 0.00 ? 76  PHE B CA   1  
ATOM 2771  C C    . PHE B 1 76  ? 6.175   1.759   -1.177  1.00 0.00 ? 76  PHE B C    1  
ATOM 2772  O O    . PHE B 1 76  ? 6.520   0.612   -0.894  1.00 0.00 ? 76  PHE B O    1  
ATOM 2773  C CB   . PHE B 1 76  ? 7.196   3.909   -0.404  1.00 0.00 ? 76  PHE B CB   1  
ATOM 2774  C CG   . PHE B 1 76  ? 8.119   3.626   0.746   1.00 0.00 ? 76  PHE B CG   1  
ATOM 2775  C CD1  . PHE B 1 76  ? 7.875   2.565   1.603   1.00 0.00 ? 76  PHE B CD1  1  
ATOM 2776  C CD2  . PHE B 1 76  ? 9.229   4.422   0.970   1.00 0.00 ? 76  PHE B CD2  1  
ATOM 2777  C CE1  . PHE B 1 76  ? 8.723   2.303   2.662   1.00 0.00 ? 76  PHE B CE1  1  
ATOM 2778  C CE2  . PHE B 1 76  ? 10.081  4.166   2.028   1.00 0.00 ? 76  PHE B CE2  1  
ATOM 2779  C CZ   . PHE B 1 76  ? 9.827   3.106   2.874   1.00 0.00 ? 76  PHE B CZ   1  
ATOM 2780  H H    . PHE B 1 76  ? 6.613   4.320   -2.857  1.00 0.00 ? 76  PHE B H    1  
ATOM 2781  H HA   . PHE B 1 76  ? 8.185   2.362   -1.521  1.00 0.00 ? 76  PHE B HA   1  
ATOM 2782  H HB2  . PHE B 1 76  ? 7.493   4.850   -0.844  1.00 0.00 ? 76  PHE B HB2  1  
ATOM 2783  H HB3  . PHE B 1 76  ? 6.190   4.001   -0.013  1.00 0.00 ? 76  PHE B HB3  1  
ATOM 2784  H HD1  . PHE B 1 76  ? 7.012   1.936   1.437   1.00 0.00 ? 76  PHE B HD1  1  
ATOM 2785  H HD2  . PHE B 1 76  ? 9.429   5.252   0.309   1.00 0.00 ? 76  PHE B HD2  1  
ATOM 2786  H HE1  . PHE B 1 76  ? 8.522   1.473   3.324   1.00 0.00 ? 76  PHE B HE1  1  
ATOM 2787  H HE2  . PHE B 1 76  ? 10.942  4.795   2.192   1.00 0.00 ? 76  PHE B HE2  1  
ATOM 2788  H HZ   . PHE B 1 76  ? 10.490  2.904   3.702   1.00 0.00 ? 76  PHE B HZ   1  
ATOM 2789  N N    . LEU B 1 77  ? 4.899   2.128   -1.266  1.00 0.00 ? 77  LEU B N    1  
ATOM 2790  C CA   . LEU B 1 77  ? 3.825   1.175   -1.030  1.00 0.00 ? 77  LEU B CA   1  
ATOM 2791  C C    . LEU B 1 77  ? 4.030   -0.042  -1.923  1.00 0.00 ? 77  LEU B C    1  
ATOM 2792  O O    . LEU B 1 77  ? 3.737   -1.173  -1.542  1.00 0.00 ? 77  LEU B O    1  
ATOM 2793  C CB   . LEU B 1 77  ? 2.468   1.826   -1.297  1.00 0.00 ? 77  LEU B CB   1  
ATOM 2794  C CG   . LEU B 1 77  ? 1.803   2.433   -0.064  1.00 0.00 ? 77  LEU B CG   1  
ATOM 2795  C CD1  . LEU B 1 77  ? 0.744   3.449   -0.463  1.00 0.00 ? 77  LEU B CD1  1  
ATOM 2796  C CD2  . LEU B 1 77  ? 1.205   1.333   0.792   1.00 0.00 ? 77  LEU B CD2  1  
ATOM 2797  H H    . LEU B 1 77  ? 4.677   3.050   -1.516  1.00 0.00 ? 77  LEU B H    1  
ATOM 2798  H HA   . LEU B 1 77  ? 3.875   0.865   0.005   1.00 0.00 ? 77  LEU B HA   1  
ATOM 2799  H HB2  . LEU B 1 77  ? 2.600   2.604   -2.034  1.00 0.00 ? 77  LEU B HB2  1  
ATOM 2800  H HB3  . LEU B 1 77  ? 1.805   1.077   -1.700  1.00 0.00 ? 77  LEU B HB3  1  
ATOM 2801  H HG   . LEU B 1 77  ? 2.552   2.945   0.524   1.00 0.00 ? 77  LEU B HG   1  
ATOM 2802  H HD11 . LEU B 1 77  ? 1.141   4.446   -0.333  1.00 0.00 ? 77  LEU B HD11 1  
ATOM 2803  H HD12 . LEU B 1 77  ? -0.132  3.324   0.160   1.00 0.00 ? 77  LEU B HD12 1  
ATOM 2804  H HD13 . LEU B 1 77  ? 0.474   3.301   -1.497  1.00 0.00 ? 77  LEU B HD13 1  
ATOM 2805  H HD21 . LEU B 1 77  ? 0.697   1.770   1.637   1.00 0.00 ? 77  LEU B HD21 1  
ATOM 2806  H HD22 . LEU B 1 77  ? 1.995   0.684   1.139   1.00 0.00 ? 77  LEU B HD22 1  
ATOM 2807  H HD23 . LEU B 1 77  ? 0.504   0.764   0.202   1.00 0.00 ? 77  LEU B HD23 1  
ATOM 2808  N N    . ASN B 1 78  ? 4.574   0.216   -3.107  1.00 0.00 ? 78  ASN B N    1  
ATOM 2809  C CA   . ASN B 1 78  ? 4.878   -0.828  -4.074  1.00 0.00 ? 78  ASN B CA   1  
ATOM 2810  C C    . ASN B 1 78  ? 6.110   -1.588  -3.621  1.00 0.00 ? 78  ASN B C    1  
ATOM 2811  O O    . ASN B 1 78  ? 6.183   -2.811  -3.738  1.00 0.00 ? 78  ASN B O    1  
ATOM 2812  C CB   . ASN B 1 78  ? 5.152   -0.212  -5.452  1.00 0.00 ? 78  ASN B CB   1  
ATOM 2813  C CG   . ASN B 1 78  ? 4.138   -0.619  -6.499  1.00 0.00 ? 78  ASN B CG   1  
ATOM 2814  O OD1  . ASN B 1 78  ? 3.606   -1.729  -6.473  1.00 0.00 ? 78  ASN B OD1  1  
ATOM 2815  N ND2  . ASN B 1 78  ? 3.867   0.287   -7.431  1.00 0.00 ? 78  ASN B ND2  1  
ATOM 2816  H H    . ASN B 1 78  ? 4.800   1.140   -3.326  1.00 0.00 ? 78  ASN B H    1  
ATOM 2817  H HA   . ASN B 1 78  ? 4.036   -1.501  -4.137  1.00 0.00 ? 78  ASN B HA   1  
ATOM 2818  H HB2  . ASN B 1 78  ? 5.135   0.863   -5.368  1.00 0.00 ? 78  ASN B HB2  1  
ATOM 2819  H HB3  . ASN B 1 78  ? 6.131   -0.522  -5.789  1.00 0.00 ? 78  ASN B HB3  1  
ATOM 2820  H HD21 . ASN B 1 78  ? 4.334   1.153   -7.384  1.00 0.00 ? 78  ASN B HD21 1  
ATOM 2821  H HD22 . ASN B 1 78  ? 3.215   0.057   -8.126  1.00 0.00 ? 78  ASN B HD22 1  
ATOM 2822  N N    . LEU B 1 79  ? 7.085   -0.842  -3.111  1.00 0.00 ? 79  LEU B N    1  
ATOM 2823  C CA   . LEU B 1 79  ? 8.325   -1.433  -2.650  1.00 0.00 ? 79  LEU B CA   1  
ATOM 2824  C C    . LEU B 1 79  ? 8.070   -2.337  -1.456  1.00 0.00 ? 79  LEU B C    1  
ATOM 2825  O O    . LEU B 1 79  ? 8.365   -3.525  -1.500  1.00 0.00 ? 79  LEU B O    1  
ATOM 2826  C CB   . LEU B 1 79  ? 9.349   -0.348  -2.297  1.00 0.00 ? 79  LEU B CB   1  
ATOM 2827  C CG   . LEU B 1 79  ? 9.951   0.405   -3.497  1.00 0.00 ? 79  LEU B CG   1  
ATOM 2828  C CD1  . LEU B 1 79  ? 11.448  0.238   -3.580  1.00 0.00 ? 79  LEU B CD1  1  
ATOM 2829  C CD2  . LEU B 1 79  ? 9.322   -0.036  -4.801  1.00 0.00 ? 79  LEU B CD2  1  
ATOM 2830  H H    . LEU B 1 79  ? 6.967   0.129   -3.054  1.00 0.00 ? 79  LEU B H    1  
ATOM 2831  H HA   . LEU B 1 79  ? 8.716   -2.019  -3.459  1.00 0.00 ? 79  LEU B HA   1  
ATOM 2832  H HB2  . LEU B 1 79  ? 8.865   0.372   -1.654  1.00 0.00 ? 79  LEU B HB2  1  
ATOM 2833  H HB3  . LEU B 1 79  ? 10.157  -0.807  -1.748  1.00 0.00 ? 79  LEU B HB3  1  
ATOM 2834  H HG   . LEU B 1 79  ? 9.757   1.446   -3.378  1.00 0.00 ? 79  LEU B HG   1  
ATOM 2835  H HD11 . LEU B 1 79  ? 11.677  -0.535  -4.300  1.00 0.00 ? 79  LEU B HD11 1  
ATOM 2836  H HD12 . LEU B 1 79  ? 11.835  -0.037  -2.613  1.00 0.00 ? 79  LEU B HD12 1  
ATOM 2837  H HD13 . LEU B 1 79  ? 11.890  1.170   -3.901  1.00 0.00 ? 79  LEU B HD13 1  
ATOM 2838  H HD21 . LEU B 1 79  ? 9.654   0.617   -5.595  1.00 0.00 ? 79  LEU B HD21 1  
ATOM 2839  H HD22 . LEU B 1 79  ? 8.251   0.020   -4.715  1.00 0.00 ? 79  LEU B HD22 1  
ATOM 2840  H HD23 . LEU B 1 79  ? 9.618   -1.053  -5.014  1.00 0.00 ? 79  LEU B HD23 1  
ATOM 2841  N N    . ILE B 1 80  ? 7.495   -1.776  -0.401  1.00 0.00 ? 80  ILE B N    1  
ATOM 2842  C CA   . ILE B 1 80  ? 7.186   -2.550  0.792   1.00 0.00 ? 80  ILE B CA   1  
ATOM 2843  C C    . ILE B 1 80  ? 5.976   -3.447  0.565   1.00 0.00 ? 80  ILE B C    1  
ATOM 2844  O O    . ILE B 1 80  ? 5.974   -4.610  0.969   1.00 0.00 ? 80  ILE B O    1  
ATOM 2845  C CB   . ILE B 1 80  ? 6.941   -1.656  2.021   1.00 0.00 ? 80  ILE B CB   1  
ATOM 2846  C CG1  . ILE B 1 80  ? 6.945   -2.502  3.293   1.00 0.00 ? 80  ILE B CG1  1  
ATOM 2847  C CG2  . ILE B 1 80  ? 5.629   -0.916  1.886   1.00 0.00 ? 80  ILE B CG2  1  
ATOM 2848  C CD1  . ILE B 1 80  ? 5.600   -3.126  3.610   1.00 0.00 ? 80  ILE B CD1  1  
ATOM 2849  H H    . ILE B 1 80  ? 7.265   -0.829  -0.431  1.00 0.00 ? 80  ILE B H    1  
ATOM 2850  H HA   . ILE B 1 80  ? 8.034   -3.170  1.005   1.00 0.00 ? 80  ILE B HA   1  
ATOM 2851  H HB   . ILE B 1 80  ? 7.736   -0.928  2.078   1.00 0.00 ? 80  ILE B HB   1  
ATOM 2852  H HG12 . ILE B 1 80  ? 7.663   -3.301  3.184   1.00 0.00 ? 80  ILE B HG12 1  
ATOM 2853  H HG13 . ILE B 1 80  ? 7.228   -1.880  4.130   1.00 0.00 ? 80  ILE B HG13 1  
ATOM 2854  H HG21 . ILE B 1 80  ? 5.478   -0.291  2.757   1.00 0.00 ? 80  ILE B HG21 1  
ATOM 2855  H HG22 . ILE B 1 80  ? 4.827   -1.640  1.814   1.00 0.00 ? 80  ILE B HG22 1  
ATOM 2856  H HG23 . ILE B 1 80  ? 5.650   -0.309  0.997   1.00 0.00 ? 80  ILE B HG23 1  
ATOM 2857  H HD11 . ILE B 1 80  ? 5.152   -2.602  4.441   1.00 0.00 ? 80  ILE B HD11 1  
ATOM 2858  H HD12 . ILE B 1 80  ? 5.739   -4.164  3.864   1.00 0.00 ? 80  ILE B HD12 1  
ATOM 2859  H HD13 . ILE B 1 80  ? 4.952   -3.053  2.747   1.00 0.00 ? 80  ILE B HD13 1  
ATOM 2860  N N    . GLY B 1 81  ? 4.947   -2.910  -0.092  1.00 0.00 ? 81  GLY B N    1  
ATOM 2861  C CA   . GLY B 1 81  ? 3.759   -3.701  -0.358  1.00 0.00 ? 81  GLY B CA   1  
ATOM 2862  C C    . GLY B 1 81  ? 4.114   -5.001  -1.040  1.00 0.00 ? 81  GLY B C    1  
ATOM 2863  O O    . GLY B 1 81  ? 3.719   -6.075  -0.589  1.00 0.00 ? 81  GLY B O    1  
ATOM 2864  H H    . GLY B 1 81  ? 4.999   -1.981  -0.399  1.00 0.00 ? 81  GLY B H    1  
ATOM 2865  H HA2  . GLY B 1 81  ? 3.260   -3.915  0.576   1.00 0.00 ? 81  GLY B HA2  1  
ATOM 2866  H HA3  . GLY B 1 81  ? 3.092   -3.141  -0.994  1.00 0.00 ? 81  GLY B HA3  1  
ATOM 2867  N N    . GLY B 1 82  ? 4.893   -4.903  -2.114  1.00 0.00 ? 82  GLY B N    1  
ATOM 2868  C CA   . GLY B 1 82  ? 5.323   -6.099  -2.824  1.00 0.00 ? 82  GLY B CA   1  
ATOM 2869  C C    . GLY B 1 82  ? 5.981   -7.102  -1.892  1.00 0.00 ? 82  GLY B C    1  
ATOM 2870  O O    . GLY B 1 82  ? 5.728   -8.303  -1.987  1.00 0.00 ? 82  GLY B O    1  
ATOM 2871  H H    . GLY B 1 82  ? 5.189   -4.011  -2.418  1.00 0.00 ? 82  GLY B H    1  
ATOM 2872  H HA2  . GLY B 1 82  ? 4.460   -6.566  -3.283  1.00 0.00 ? 82  GLY B HA2  1  
ATOM 2873  H HA3  . GLY B 1 82  ? 6.025   -5.820  -3.593  1.00 0.00 ? 82  GLY B HA3  1  
ATOM 2874  N N    . LEU B 1 83  ? 6.820   -6.614  -0.977  1.00 0.00 ? 83  LEU B N    1  
ATOM 2875  C CA   . LEU B 1 83  ? 7.487   -7.494  -0.021  1.00 0.00 ? 83  LEU B CA   1  
ATOM 2876  C C    . LEU B 1 83  ? 6.461   -8.206  0.836   1.00 0.00 ? 83  LEU B C    1  
ATOM 2877  O O    . LEU B 1 83  ? 6.575   -9.402  1.095   1.00 0.00 ? 83  LEU B O    1  
ATOM 2878  C CB   . LEU B 1 83  ? 8.445   -6.714  0.871   1.00 0.00 ? 83  LEU B CB   1  
ATOM 2879  C CG   . LEU B 1 83  ? 9.153   -5.551  0.190   1.00 0.00 ? 83  LEU B CG   1  
ATOM 2880  C CD1  . LEU B 1 83  ? 10.219  -4.978  1.102   1.00 0.00 ? 83  LEU B CD1  1  
ATOM 2881  C CD2  . LEU B 1 83  ? 9.753   -5.993  -1.138  1.00 0.00 ? 83  LEU B CD2  1  
ATOM 2882  H H    . LEU B 1 83  ? 6.985   -5.646  -0.939  1.00 0.00 ? 83  LEU B H    1  
ATOM 2883  H HA   . LEU B 1 83  ? 8.046   -8.231  -0.581  1.00 0.00 ? 83  LEU B HA   1  
ATOM 2884  H HB2  . LEU B 1 83  ? 7.886   -6.327  1.711   1.00 0.00 ? 83  LEU B HB2  1  
ATOM 2885  H HB3  . LEU B 1 83  ? 9.195   -7.396  1.242   1.00 0.00 ? 83  LEU B HB3  1  
ATOM 2886  H HG   . LEU B 1 83  ? 8.434   -4.775  -0.005  1.00 0.00 ? 83  LEU B HG   1  
ATOM 2887  H HD11 . LEU B 1 83  ? 10.167  -3.901  1.079   1.00 0.00 ? 83  LEU B HD11 1  
ATOM 2888  H HD12 . LEU B 1 83  ? 11.193  -5.303  0.765   1.00 0.00 ? 83  LEU B HD12 1  
ATOM 2889  H HD13 . LEU B 1 83  ? 10.049  -5.326  2.110   1.00 0.00 ? 83  LEU B HD13 1  
ATOM 2890  H HD21 . LEU B 1 83  ? 9.526   -5.256  -1.894  1.00 0.00 ? 83  LEU B HD21 1  
ATOM 2891  H HD22 . LEU B 1 83  ? 9.334   -6.944  -1.429  1.00 0.00 ? 83  LEU B HD22 1  
ATOM 2892  H HD23 . LEU B 1 83  ? 10.822  -6.087  -1.036  1.00 0.00 ? 83  LEU B HD23 1  
ATOM 2893  N N    . ALA B 1 84  ? 5.442   -7.468  1.268   1.00 0.00 ? 84  ALA B N    1  
ATOM 2894  C CA   . ALA B 1 84  ? 4.389   -8.057  2.088   1.00 0.00 ? 84  ALA B CA   1  
ATOM 2895  C C    . ALA B 1 84  ? 3.791   -9.267  1.390   1.00 0.00 ? 84  ALA B C    1  
ATOM 2896  O O    . ALA B 1 84  ? 3.376   -10.235 2.027   1.00 0.00 ? 84  ALA B O    1  
ATOM 2897  C CB   . ALA B 1 84  ? 3.286   -7.051  2.340   1.00 0.00 ? 84  ALA B CB   1  
ATOM 2898  H H    . ALA B 1 84  ? 5.400   -6.507  1.030   1.00 0.00 ? 84  ALA B H    1  
ATOM 2899  H HA   . ALA B 1 84  ? 4.812   -8.354  3.035   1.00 0.00 ? 84  ALA B HA   1  
ATOM 2900  H HB1  . ALA B 1 84  ? 2.818   -7.266  3.287   1.00 0.00 ? 84  ALA B HB1  1  
ATOM 2901  H HB2  . ALA B 1 84  ? 2.550   -7.125  1.545   1.00 0.00 ? 84  ALA B HB2  1  
ATOM 2902  H HB3  . ALA B 1 84  ? 3.703   -6.055  2.356   1.00 0.00 ? 84  ALA B HB3  1  
ATOM 2903  N N    . VAL B 1 85  ? 3.755   -9.190  0.071   1.00 0.00 ? 85  VAL B N    1  
ATOM 2904  C CA   . VAL B 1 85  ? 3.211   -10.260 -0.750  1.00 0.00 ? 85  VAL B CA   1  
ATOM 2905  C C    . VAL B 1 85  ? 4.260   -11.322 -1.043  1.00 0.00 ? 85  VAL B C    1  
ATOM 2906  O O    . VAL B 1 85  ? 3.934   -12.443 -1.434  1.00 0.00 ? 85  VAL B O    1  
ATOM 2907  C CB   . VAL B 1 85  ? 2.612   -9.740  -2.079  1.00 0.00 ? 85  VAL B CB   1  
ATOM 2908  C CG1  . VAL B 1 85  ? 1.162   -10.166 -2.180  1.00 0.00 ? 85  VAL B CG1  1  
ATOM 2909  C CG2  . VAL B 1 85  ? 2.718   -8.223  -2.203  1.00 0.00 ? 85  VAL B CG2  1  
ATOM 2910  H H    . VAL B 1 85  ? 4.108   -8.389  -0.361  1.00 0.00 ? 85  VAL B H    1  
ATOM 2911  H HA   . VAL B 1 85  ? 2.423   -10.724 -0.188  1.00 0.00 ? 85  VAL B HA   1  
ATOM 2912  H HB   . VAL B 1 85  ? 3.158   -10.183 -2.901  1.00 0.00 ? 85  VAL B HB   1  
ATOM 2913  H HG11 . VAL B 1 85  ? 0.545   -9.447  -1.659  1.00 0.00 ? 85  VAL B HG11 1  
ATOM 2914  H HG12 . VAL B 1 85  ? 1.042   -11.138 -1.726  1.00 0.00 ? 85  VAL B HG12 1  
ATOM 2915  H HG13 . VAL B 1 85  ? 0.870   -10.214 -3.216  1.00 0.00 ? 85  VAL B HG13 1  
ATOM 2916  H HG21 . VAL B 1 85  ? 1.905   -7.759  -1.665  1.00 0.00 ? 85  VAL B HG21 1  
ATOM 2917  H HG22 . VAL B 1 85  ? 2.667   -7.945  -3.242  1.00 0.00 ? 85  VAL B HG22 1  
ATOM 2918  H HG23 . VAL B 1 85  ? 3.654   -7.890  -1.797  1.00 0.00 ? 85  VAL B HG23 1  
ATOM 2919  N N    . ALA B 1 86  ? 5.515   -10.961 -0.852  1.00 0.00 ? 86  ALA B N    1  
ATOM 2920  C CA   . ALA B 1 86  ? 6.618   -11.870 -1.092  1.00 0.00 ? 86  ALA B CA   1  
ATOM 2921  C C    . ALA B 1 86  ? 7.321   -12.237 0.211   1.00 0.00 ? 86  ALA B C    1  
ATOM 2922  O O    . ALA B 1 86  ? 8.423   -12.786 0.201   1.00 0.00 ? 86  ALA B O    1  
ATOM 2923  C CB   . ALA B 1 86  ? 7.584   -11.219 -2.052  1.00 0.00 ? 86  ALA B CB   1  
ATOM 2924  H H    . ALA B 1 86  ? 5.709   -10.054 -0.542  1.00 0.00 ? 86  ALA B H    1  
ATOM 2925  H HA   . ALA B 1 86  ? 6.229   -12.765 -1.553  1.00 0.00 ? 86  ALA B HA   1  
ATOM 2926  H HB1  . ALA B 1 86  ? 7.976   -11.961 -2.729  1.00 0.00 ? 86  ALA B HB1  1  
ATOM 2927  H HB2  . ALA B 1 86  ? 8.391   -10.769 -1.494  1.00 0.00 ? 86  ALA B HB2  1  
ATOM 2928  H HB3  . ALA B 1 86  ? 7.060   -10.458 -2.611  1.00 0.00 ? 86  ALA B HB3  1  
ATOM 2929  N N    . CYS B 1 87  ? 6.675   -11.927 1.330   1.00 0.00 ? 87  CYS B N    1  
ATOM 2930  C CA   . CYS B 1 87  ? 7.232   -12.217 2.641   1.00 0.00 ? 87  CYS B CA   1  
ATOM 2931  C C    . CYS B 1 87  ? 6.126   -12.359 3.681   1.00 0.00 ? 87  CYS B C    1  
ATOM 2932  O O    . CYS B 1 87  ? 6.158   -13.268 4.510   1.00 0.00 ? 87  CYS B O    1  
ATOM 2933  C CB   . CYS B 1 87  ? 8.207   -11.114 3.059   1.00 0.00 ? 87  CYS B CB   1  
ATOM 2934  S SG   . CYS B 1 87  ? 9.284   -11.565 4.439   1.00 0.00 ? 87  CYS B SG   1  
ATOM 2935  H H    . CYS B 1 87  ? 5.802   -11.488 1.271   1.00 0.00 ? 87  CYS B H    1  
ATOM 2936  H HA   . CYS B 1 87  ? 7.769   -13.151 2.574   1.00 0.00 ? 87  CYS B HA   1  
ATOM 2937  H HB2  . CYS B 1 87  ? 8.838   -10.864 2.218   1.00 0.00 ? 87  CYS B HB2  1  
ATOM 2938  H HB3  . CYS B 1 87  ? 7.645   -10.240 3.352   1.00 0.00 ? 87  CYS B HB3  1  
ATOM 2939  H HG   . CYS B 1 87  ? 10.181  -11.306 4.212   1.00 0.00 ? 87  CYS B HG   1  
ATOM 2940  N N    . HIS B 1 88  ? 5.142   -11.462 3.632   1.00 0.00 ? 88  HIS B N    1  
ATOM 2941  C CA   . HIS B 1 88  ? 4.033   -11.511 4.579   1.00 0.00 ? 88  HIS B CA   1  
ATOM 2942  C C    . HIS B 1 88  ? 2.855   -12.290 3.996   1.00 0.00 ? 88  HIS B C    1  
ATOM 2943  O O    . HIS B 1 88  ? 3.003   -13.011 3.010   1.00 0.00 ? 88  HIS B O    1  
ATOM 2944  C CB   . HIS B 1 88  ? 3.593   -10.095 4.962   1.00 0.00 ? 88  HIS B CB   1  
ATOM 2945  C CG   . HIS B 1 88  ? 3.628   -9.840  6.437   1.00 0.00 ? 88  HIS B CG   1  
ATOM 2946  N ND1  . HIS B 1 88  ? 2.545   -10.054 7.264   1.00 0.00 ? 88  HIS B ND1  1  
ATOM 2947  C CD2  . HIS B 1 88  ? 4.625   -9.389  7.235   1.00 0.00 ? 88  HIS B CD2  1  
ATOM 2948  C CE1  . HIS B 1 88  ? 2.875   -9.743  8.505   1.00 0.00 ? 88  HIS B CE1  1  
ATOM 2949  N NE2  . HIS B 1 88  ? 4.131   -9.339  8.514   1.00 0.00 ? 88  HIS B NE2  1  
ATOM 2950  H H    . HIS B 1 88  ? 5.162   -10.753 2.947   1.00 0.00 ? 88  HIS B H    1  
ATOM 2951  H HA   . HIS B 1 88  ? 4.379   -12.021 5.464   1.00 0.00 ? 88  HIS B HA   1  
ATOM 2952  H HB2  . HIS B 1 88  ? 4.250   -9.383  4.489   1.00 0.00 ? 88  HIS B HB2  1  
ATOM 2953  H HB3  . HIS B 1 88  ? 2.583   -9.932  4.619   1.00 0.00 ? 88  HIS B HB3  1  
ATOM 2954  H HD1  . HIS B 1 88  ? 1.665   -10.381 6.984   1.00 0.00 ? 88  HIS B HD1  1  
ATOM 2955  H HD2  . HIS B 1 88  ? 5.624   -9.119  6.922   1.00 0.00 ? 88  HIS B HD2  1  
ATOM 2956  H HE1  . HIS B 1 88  ? 2.227   -9.813  9.367   1.00 0.00 ? 88  HIS B HE1  1  
ATOM 2957  H HE2  . HIS B 1 88  ? 4.600   -8.970  9.292   1.00 0.00 ? 88  HIS B HE2  1  
ATOM 2958  N N    . GLU B 1 89  ? 1.687   -12.144 4.616   1.00 0.00 ? 89  GLU B N    1  
ATOM 2959  C CA   . GLU B 1 89  ? 0.485   -12.836 4.162   1.00 0.00 ? 89  GLU B CA   1  
ATOM 2960  C C    . GLU B 1 89  ? 0.161   -12.472 2.713   1.00 0.00 ? 89  GLU B C    1  
ATOM 2961  O O    . GLU B 1 89  ? 1.011   -11.950 1.991   1.00 0.00 ? 89  GLU B O    1  
ATOM 2962  C CB   . GLU B 1 89  ? -0.695  -12.490 5.074   1.00 0.00 ? 89  GLU B CB   1  
ATOM 2963  C CG   . GLU B 1 89  ? -0.421  -12.743 6.547   1.00 0.00 ? 89  GLU B CG   1  
ATOM 2964  C CD   . GLU B 1 89  ? -1.199  -11.809 7.453   1.00 0.00 ? 89  GLU B CD   1  
ATOM 2965  O OE1  . GLU B 1 89  ? -2.435  -11.964 7.546   1.00 0.00 ? 89  GLU B OE1  1  
ATOM 2966  O OE2  . GLU B 1 89  ? -0.573  -10.921 8.070   1.00 0.00 ? 89  GLU B OE2  1  
ATOM 2967  H H    . GLU B 1 89  ? 1.633   -11.557 5.398   1.00 0.00 ? 89  GLU B H    1  
ATOM 2968  H HA   . GLU B 1 89  ? 0.674   -13.897 4.220   1.00 0.00 ? 89  GLU B HA   1  
ATOM 2969  H HB2  . GLU B 1 89  ? -0.939  -11.446 4.950   1.00 0.00 ? 89  GLU B HB2  1  
ATOM 2970  H HB3  . GLU B 1 89  ? -1.548  -13.087 4.784   1.00 0.00 ? 89  GLU B HB3  1  
ATOM 2971  H HG2  . GLU B 1 89  ? -0.697  -13.760 6.783   1.00 0.00 ? 89  GLU B HG2  1  
ATOM 2972  H HG3  . GLU B 1 89  ? 0.634   -12.605 6.733   1.00 0.00 ? 89  GLU B HG3  1  
ATOM 2973  N N    . SER B 1 90  ? -1.074  -12.756 2.292   1.00 0.00 ? 90  SER B N    1  
ATOM 2974  C CA   . SER B 1 90  ? -1.521  -12.467 0.929   1.00 0.00 ? 90  SER B CA   1  
ATOM 2975  C C    . SER B 1 90  ? -1.067  -13.556 -0.038  1.00 0.00 ? 90  SER B C    1  
ATOM 2976  O O    . SER B 1 90  ? -1.888  -14.179 -0.713  1.00 0.00 ? 90  SER B O    1  
ATOM 2977  C CB   . SER B 1 90  ? -1.007  -11.102 0.460   1.00 0.00 ? 90  SER B CB   1  
ATOM 2978  O OG   . SER B 1 90  ? -1.949  -10.465 -0.386  1.00 0.00 ? 90  SER B OG   1  
ATOM 2979  H H    . SER B 1 90  ? -1.701  -13.175 2.915   1.00 0.00 ? 90  SER B H    1  
ATOM 2980  H HA   . SER B 1 90  ? -2.600  -12.446 0.939   1.00 0.00 ? 90  SER B HA   1  
ATOM 2981  H HB2  . SER B 1 90  ? -0.831  -10.471 1.319   1.00 0.00 ? 90  SER B HB2  1  
ATOM 2982  H HB3  . SER B 1 90  ? -0.084  -11.234 -0.084  1.00 0.00 ? 90  SER B HB3  1  
ATOM 2983  H HG   . SER B 1 90  ? -2.605  -10.012 0.148   1.00 0.00 ? 90  SER B HG   1  
ATOM 2984  N N    . PHE B 1 91  ? 0.240   -13.784 -0.101  1.00 0.00 ? 91  PHE B N    1  
ATOM 2985  C CA   . PHE B 1 91  ? 0.797   -14.800 -0.986  1.00 0.00 ? 91  PHE B CA   1  
ATOM 2986  C C    . PHE B 1 91  ? 1.539   -15.868 -0.187  1.00 0.00 ? 91  PHE B C    1  
ATOM 2987  O O    . PHE B 1 91  ? 1.379   -17.064 -0.430  1.00 0.00 ? 91  PHE B O    1  
ATOM 2988  C CB   . PHE B 1 91  ? 1.740   -14.158 -2.006  1.00 0.00 ? 91  PHE B CB   1  
ATOM 2989  C CG   . PHE B 1 91  ? 1.258   -14.275 -3.424  1.00 0.00 ? 91  PHE B CG   1  
ATOM 2990  C CD1  . PHE B 1 91  ? 1.216   -15.509 -4.054  1.00 0.00 ? 91  PHE B CD1  1  
ATOM 2991  C CD2  . PHE B 1 91  ? 0.849   -13.153 -4.126  1.00 0.00 ? 91  PHE B CD2  1  
ATOM 2992  C CE1  . PHE B 1 91  ? 0.772   -15.621 -5.358  1.00 0.00 ? 91  PHE B CE1  1  
ATOM 2993  C CE2  . PHE B 1 91  ? 0.405   -13.259 -5.431  1.00 0.00 ? 91  PHE B CE2  1  
ATOM 2994  C CZ   . PHE B 1 91  ? 0.366   -14.495 -6.048  1.00 0.00 ? 91  PHE B CZ   1  
ATOM 2995  H H    . PHE B 1 91  ? 0.846   -13.256 0.462   1.00 0.00 ? 91  PHE B H    1  
ATOM 2996  H HA   . PHE B 1 91  ? -0.022  -15.268 -1.511  1.00 0.00 ? 91  PHE B HA   1  
ATOM 2997  H HB2  . PHE B 1 91  ? 1.841   -13.107 -1.778  1.00 0.00 ? 91  PHE B HB2  1  
ATOM 2998  H HB3  . PHE B 1 91  ? 2.709   -14.630 -1.941  1.00 0.00 ? 91  PHE B HB3  1  
ATOM 2999  H HD1  . PHE B 1 91  ? 1.532   -16.390 -3.515  1.00 0.00 ? 91  PHE B HD1  1  
ATOM 3000  H HD2  . PHE B 1 91  ? 0.878   -12.187 -3.645  1.00 0.00 ? 91  PHE B HD2  1  
ATOM 3001  H HE1  . PHE B 1 91  ? 0.744   -16.588 -5.838  1.00 0.00 ? 91  PHE B HE1  1  
ATOM 3002  H HE2  . PHE B 1 91  ? 0.088   -12.378 -5.968  1.00 0.00 ? 91  PHE B HE2  1  
ATOM 3003  H HZ   . PHE B 1 91  ? 0.020   -14.580 -7.066  1.00 0.00 ? 91  PHE B HZ   1  
ATOM 3004  N N    . VAL B 1 92  ? 2.350   -15.425 0.768   1.00 0.00 ? 92  VAL B N    1  
ATOM 3005  C CA   . VAL B 1 92  ? 3.116   -16.340 1.605   1.00 0.00 ? 92  VAL B CA   1  
ATOM 3006  C C    . VAL B 1 92  ? 2.211   -17.032 2.620   1.00 0.00 ? 92  VAL B C    1  
ATOM 3007  O O    . VAL B 1 92  ? 1.067   -16.623 2.819   1.00 0.00 ? 92  VAL B O    1  
ATOM 3008  C CB   . VAL B 1 92  ? 4.251   -15.606 2.352   1.00 0.00 ? 92  VAL B CB   1  
ATOM 3009  C CG1  . VAL B 1 92  ? 5.280   -16.597 2.875   1.00 0.00 ? 92  VAL B CG1  1  
ATOM 3010  C CG2  . VAL B 1 92  ? 4.912   -14.575 1.448   1.00 0.00 ? 92  VAL B CG2  1  
ATOM 3011  H H    . VAL B 1 92  ? 2.435   -14.460 0.914   1.00 0.00 ? 92  VAL B H    1  
ATOM 3012  H HA   . VAL B 1 92  ? 3.559   -17.088 0.962   1.00 0.00 ? 92  VAL B HA   1  
ATOM 3013  H HB   . VAL B 1 92  ? 3.821   -15.088 3.197   1.00 0.00 ? 92  VAL B HB   1  
ATOM 3014  H HG11 . VAL B 1 92  ? 5.336   -17.444 2.208   1.00 0.00 ? 92  VAL B HG11 1  
ATOM 3015  H HG12 . VAL B 1 92  ? 4.987   -16.933 3.860   1.00 0.00 ? 92  VAL B HG12 1  
ATOM 3016  H HG13 . VAL B 1 92  ? 6.246   -16.117 2.931   1.00 0.00 ? 92  VAL B HG13 1  
ATOM 3017  H HG21 . VAL B 1 92  ? 4.243   -13.740 1.303   1.00 0.00 ? 92  VAL B HG21 1  
ATOM 3018  H HG22 . VAL B 1 92  ? 5.138   -15.025 0.493   1.00 0.00 ? 92  VAL B HG22 1  
ATOM 3019  H HG23 . VAL B 1 92  ? 5.826   -14.227 1.908   1.00 0.00 ? 92  VAL B HG23 1  
ATOM 3020  N N    . LYS B 1 93  ? 2.726   -18.085 3.253   1.00 0.00 ? 93  LYS B N    1  
ATOM 3021  C CA   . LYS B 1 93  ? 1.964   -18.841 4.247   1.00 0.00 ? 93  LYS B CA   1  
ATOM 3022  C C    . LYS B 1 93  ? 0.572   -19.195 3.727   1.00 0.00 ? 93  LYS B C    1  
ATOM 3023  O O    . LYS B 1 93  ? -0.370  -19.350 4.503   1.00 0.00 ? 93  LYS B O    1  
ATOM 3024  C CB   . LYS B 1 93  ? 1.857   -18.053 5.558   1.00 0.00 ? 93  LYS B CB   1  
ATOM 3025  C CG   . LYS B 1 93  ? 0.954   -16.830 5.478   1.00 0.00 ? 93  LYS B CG   1  
ATOM 3026  C CD   . LYS B 1 93  ? 0.400   -16.453 6.844   1.00 0.00 ? 93  LYS B CD   1  
ATOM 3027  C CE   . LYS B 1 93  ? -1.122  -16.497 6.865   1.00 0.00 ? 93  LYS B CE   1  
ATOM 3028  N NZ   . LYS B 1 93  ? -1.633  -17.612 7.710   1.00 0.00 ? 93  LYS B NZ   1  
ATOM 3029  H H    . LYS B 1 93  ? 3.641   -18.364 3.044   1.00 0.00 ? 93  LYS B H    1  
ATOM 3030  H HA   . LYS B 1 93  ? 2.501   -19.759 4.438   1.00 0.00 ? 93  LYS B HA   1  
ATOM 3031  H HB2  . LYS B 1 93  ? 1.468   -18.708 6.325   1.00 0.00 ? 93  LYS B HB2  1  
ATOM 3032  H HB3  . LYS B 1 93  ? 2.845   -17.725 5.848   1.00 0.00 ? 93  LYS B HB3  1  
ATOM 3033  H HG2  . LYS B 1 93  ? 1.525   -16.000 5.091   1.00 0.00 ? 93  LYS B HG2  1  
ATOM 3034  H HG3  . LYS B 1 93  ? 0.132   -17.045 4.811   1.00 0.00 ? 93  LYS B HG3  1  
ATOM 3035  H HD2  . LYS B 1 93  ? 0.779   -17.145 7.581   1.00 0.00 ? 93  LYS B HD2  1  
ATOM 3036  H HD3  . LYS B 1 93  ? 0.724   -15.452 7.088   1.00 0.00 ? 93  LYS B HD3  1  
ATOM 3037  H HE2  . LYS B 1 93  ? -1.490  -15.562 7.261   1.00 0.00 ? 93  LYS B HE2  1  
ATOM 3038  H HE3  . LYS B 1 93  ? -1.481  -16.626 5.856   1.00 0.00 ? 93  LYS B HE3  1  
ATOM 3039  H HZ1  . LYS B 1 93  ? -1.185  -17.584 8.648   1.00 0.00 ? 93  LYS B HZ1  1  
ATOM 3040  H HZ2  . LYS B 1 93  ? -1.419  -18.526 7.262   1.00 0.00 ? 93  LYS B HZ2  1  
ATOM 3041  H HZ3  . LYS B 1 93  ? -2.663  -17.530 7.826   1.00 0.00 ? 93  LYS B HZ3  1  
ATOM 3042  N N    . ALA B 1 94  ? 0.454   -19.319 2.410   1.00 0.00 ? 94  ALA B N    1  
ATOM 3043  C CA   . ALA B 1 94  ? -0.818  -19.655 1.783   1.00 0.00 ? 94  ALA B CA   1  
ATOM 3044  C C    . ALA B 1 94  ? -0.657  -20.799 0.787   1.00 0.00 ? 94  ALA B C    1  
ATOM 3045  O O    . ALA B 1 94  ? -1.528  -21.662 0.671   1.00 0.00 ? 94  ALA B O    1  
ATOM 3046  C CB   . ALA B 1 94  ? -1.404  -18.433 1.093   1.00 0.00 ? 94  ALA B CB   1  
ATOM 3047  H H    . ALA B 1 94  ? 1.243   -19.183 1.845   1.00 0.00 ? 94  ALA B H    1  
ATOM 3048  H HA   . ALA B 1 94  ? -1.503  -19.962 2.561   1.00 0.00 ? 94  ALA B HA   1  
ATOM 3049  H HB1  . ALA B 1 94  ? -1.958  -18.743 0.219   1.00 0.00 ? 94  ALA B HB1  1  
ATOM 3050  H HB2  . ALA B 1 94  ? -0.605  -17.770 0.795   1.00 0.00 ? 94  ALA B HB2  1  
ATOM 3051  H HB3  . ALA B 1 94  ? -2.065  -17.916 1.775   1.00 0.00 ? 94  ALA B HB3  1  
ATOM 3052  N N    . ALA B 1 95  ? 0.463   -20.800 0.069   1.00 0.00 ? 95  ALA B N    1  
ATOM 3053  C CA   . ALA B 1 95  ? 0.739   -21.837 -0.918  1.00 0.00 ? 95  ALA B CA   1  
ATOM 3054  C C    . ALA B 1 95  ? 2.150   -22.396 -0.747  1.00 0.00 ? 95  ALA B C    1  
ATOM 3055  O O    . ALA B 1 95  ? 3.006   -22.218 -1.615  1.00 0.00 ? 95  ALA B O    1  
ATOM 3056  C CB   . ALA B 1 95  ? 0.553   -21.283 -2.323  1.00 0.00 ? 95  ALA B CB   1  
ATOM 3057  H H    . ALA B 1 95  ? 1.118   -20.086 0.204   1.00 0.00 ? 95  ALA B H    1  
ATOM 3058  H HA   . ALA B 1 95  ? 0.026   -22.635 -0.773  1.00 0.00 ? 95  ALA B HA   1  
ATOM 3059  H HB1  . ALA B 1 95  ? 0.655   -20.208 -2.302  1.00 0.00 ? 95  ALA B HB1  1  
ATOM 3060  H HB2  . ALA B 1 95  ? -0.431  -21.545 -2.685  1.00 0.00 ? 95  ALA B HB2  1  
ATOM 3061  H HB3  . ALA B 1 95  ? 1.301   -21.704 -2.979  1.00 0.00 ? 95  ALA B HB3  1  
ATOM 3062  N N    . PRO B 1 96  ? 2.416   -23.086 0.377   1.00 0.00 ? 96  PRO B N    1  
ATOM 3063  C CA   . PRO B 1 96  ? 3.732   -23.672 0.651   1.00 0.00 ? 96  PRO B CA   1  
ATOM 3064  C C    . PRO B 1 96  ? 4.176   -24.641 -0.443  1.00 0.00 ? 96  PRO B C    1  
ATOM 3065  O O    . PRO B 1 96  ? 5.311   -24.575 -0.913  1.00 0.00 ? 96  PRO B O    1  
ATOM 3066  C CB   . PRO B 1 96  ? 3.528   -24.409 1.980   1.00 0.00 ? 96  PRO B CB   1  
ATOM 3067  C CG   . PRO B 1 96  ? 2.360   -23.737 2.607   1.00 0.00 ? 96  PRO B CG   1  
ATOM 3068  C CD   . PRO B 1 96  ? 1.463   -23.355 1.468   1.00 0.00 ? 96  PRO B CD   1  
ATOM 3069  H HA   . PRO B 1 96  ? 4.484   -22.906 0.775   1.00 0.00 ? 96  PRO B HA   1  
ATOM 3070  H HB2  . PRO B 1 96  ? 3.325   -25.451 1.789   1.00 0.00 ? 96  PRO B HB2  1  
ATOM 3071  H HB3  . PRO B 1 96  ? 4.412   -24.312 2.590   1.00 0.00 ? 96  PRO B HB3  1  
ATOM 3072  H HG2  . PRO B 1 96  ? 1.854   -24.420 3.273   1.00 0.00 ? 96  PRO B HG2  1  
ATOM 3073  H HG3  . PRO B 1 96  ? 2.682   -22.856 3.142   1.00 0.00 ? 96  PRO B HG3  1  
ATOM 3074  H HD2  . PRO B 1 96  ? 0.808   -24.175 1.216   1.00 0.00 ? 96  PRO B HD2  1  
ATOM 3075  H HD3  . PRO B 1 96  ? 0.894   -22.472 1.712   1.00 0.00 ? 96  PRO B HD3  1  
ATOM 3076  N N    . PRO B 1 97  ? 3.285   -25.557 -0.870  1.00 0.00 ? 97  PRO B N    1  
ATOM 3077  C CA   . PRO B 1 97  ? 3.594   -26.528 -1.913  1.00 0.00 ? 97  PRO B CA   1  
ATOM 3078  C C    . PRO B 1 97  ? 3.317   -25.990 -3.315  1.00 0.00 ? 97  PRO B C    1  
ATOM 3079  O O    . PRO B 1 97  ? 3.381   -26.730 -4.297  1.00 0.00 ? 97  PRO B O    1  
ATOM 3080  C CB   . PRO B 1 97  ? 2.642   -27.672 -1.584  1.00 0.00 ? 97  PRO B CB   1  
ATOM 3081  C CG   . PRO B 1 97  ? 1.430   -26.999 -1.029  1.00 0.00 ? 97  PRO B CG   1  
ATOM 3082  C CD   . PRO B 1 97  ? 1.902   -25.719 -0.378  1.00 0.00 ? 97  PRO B CD   1  
ATOM 3083  H HA   . PRO B 1 97  ? 4.617   -26.873 -1.851  1.00 0.00 ? 97  PRO B HA   1  
ATOM 3084  H HB2  . PRO B 1 97  ? 2.413   -28.225 -2.484  1.00 0.00 ? 97  PRO B HB2  1  
ATOM 3085  H HB3  . PRO B 1 97  ? 3.097   -28.327 -0.857  1.00 0.00 ? 97  PRO B HB3  1  
ATOM 3086  H HG2  . PRO B 1 97  ? 0.739   -26.778 -1.827  1.00 0.00 ? 97  PRO B HG2  1  
ATOM 3087  H HG3  . PRO B 1 97  ? 0.963   -27.639 -0.296  1.00 0.00 ? 97  PRO B HG3  1  
ATOM 3088  H HD2  . PRO B 1 97  ? 1.284   -24.889 -0.691  1.00 0.00 ? 97  PRO B HD2  1  
ATOM 3089  H HD3  . PRO B 1 97  ? 1.885   -25.816 0.696   1.00 0.00 ? 97  PRO B HD3  1  
ATOM 3090  N N    . GLN B 1 98  ? 3.005   -24.698 -3.403  1.00 0.00 ? 98  GLN B N    1  
ATOM 3091  C CA   . GLN B 1 98  ? 2.714   -24.067 -4.684  1.00 0.00 ? 98  GLN B CA   1  
ATOM 3092  C C    . GLN B 1 98  ? 3.614   -22.857 -4.917  1.00 0.00 ? 98  GLN B C    1  
ATOM 3093  O O    . GLN B 1 98  ? 3.197   -21.868 -5.520  1.00 0.00 ? 98  GLN B O    1  
ATOM 3094  C CB   . GLN B 1 98  ? 1.242   -23.646 -4.742  1.00 0.00 ? 98  GLN B CB   1  
ATOM 3095  C CG   . GLN B 1 98  ? 0.343   -24.670 -5.415  1.00 0.00 ? 98  GLN B CG   1  
ATOM 3096  C CD   . GLN B 1 98  ? -0.049  -24.265 -6.823  1.00 0.00 ? 98  GLN B CD   1  
ATOM 3097  O OE1  . GLN B 1 98  ? 0.523   -23.339 -7.397  1.00 0.00 ? 98  GLN B OE1  1  
ATOM 3098  N NE2  . GLN B 1 98  ? -1.030  -24.961 -7.387  1.00 0.00 ? 98  GLN B NE2  1  
ATOM 3099  H H    . GLN B 1 98  ? 2.967   -24.158 -2.587  1.00 0.00 ? 98  GLN B H    1  
ATOM 3100  H HA   . GLN B 1 98  ? 2.901   -24.793 -5.462  1.00 0.00 ? 98  GLN B HA   1  
ATOM 3101  H HB2  . GLN B 1 98  ? 0.884   -23.492 -3.734  1.00 0.00 ? 98  GLN B HB2  1  
ATOM 3102  H HB3  . GLN B 1 98  ? 1.165   -22.717 -5.286  1.00 0.00 ? 98  GLN B HB3  1  
ATOM 3103  H HG2  . GLN B 1 98  ? 0.865   -25.614 -5.461  1.00 0.00 ? 98  GLN B HG2  1  
ATOM 3104  H HG3  . GLN B 1 98  ? -0.555  -24.785 -4.825  1.00 0.00 ? 98  GLN B HG3  1  
ATOM 3105  H HE21 . GLN B 1 98  ? -1.441  -25.688 -6.867  1.00 0.00 ? 98  GLN B HE21 1  
ATOM 3106  H HE22 . GLN B 1 98  ? -1.304  -24.718 -8.300  1.00 0.00 ? 98  GLN B HE22 1  
ATOM 3107  N N    . LYS B 1 99  ? 4.850   -22.941 -4.435  1.00 0.00 ? 99  LYS B N    1  
ATOM 3108  C CA   . LYS B 1 99  ? 5.807   -21.851 -4.594  1.00 0.00 ? 99  LYS B CA   1  
ATOM 3109  C C    . LYS B 1 99  ? 6.976   -22.278 -5.477  1.00 0.00 ? 99  LYS B C    1  
ATOM 3110  O O    . LYS B 1 99  ? 7.443   -23.414 -5.400  1.00 0.00 ? 99  LYS B O    1  
ATOM 3111  C CB   . LYS B 1 99  ? 6.321   -21.390 -3.228  1.00 0.00 ? 99  LYS B CB   1  
ATOM 3112  C CG   . LYS B 1 99  ? 7.190   -22.419 -2.522  1.00 0.00 ? 99  LYS B CG   1  
ATOM 3113  C CD   . LYS B 1 99  ? 7.950   -21.802 -1.359  1.00 0.00 ? 99  LYS B CD   1  
ATOM 3114  C CE   . LYS B 1 99  ? 9.368   -21.424 -1.757  1.00 0.00 ? 99  LYS B CE   1  
ATOM 3115  N NZ   . LYS B 1 99  ? 10.062  -20.660 -0.684  1.00 0.00 ? 99  LYS B NZ   1  
ATOM 3116  H H    . LYS B 1 99  ? 5.125   -23.755 -3.965  1.00 0.00 ? 99  LYS B H    1  
ATOM 3117  H HA   . LYS B 1 99  ? 5.295   -21.028 -5.071  1.00 0.00 ? 99  LYS B HA   1  
ATOM 3118  H HB2  . LYS B 1 99  ? 6.904   -20.491 -3.361  1.00 0.00 ? 99  LYS B HB2  1  
ATOM 3119  H HB3  . LYS B 1 99  ? 5.475   -21.170 -2.594  1.00 0.00 ? 99  LYS B HB3  1  
ATOM 3120  H HG2  . LYS B 1 99  ? 6.561   -23.212 -2.147  1.00 0.00 ? 99  LYS B HG2  1  
ATOM 3121  H HG3  . LYS B 1 99  ? 7.900   -22.824 -3.229  1.00 0.00 ? 99  LYS B HG3  1  
ATOM 3122  H HD2  . LYS B 1 99  ? 7.430   -20.914 -1.033  1.00 0.00 ? 99  LYS B HD2  1  
ATOM 3123  H HD3  . LYS B 1 99  ? 7.991   -22.516 -0.549  1.00 0.00 ? 99  LYS B HD3  1  
ATOM 3124  H HE2  . LYS B 1 99  ? 9.924   -22.328 -1.960  1.00 0.00 ? 99  LYS B HE2  1  
ATOM 3125  H HE3  . LYS B 1 99  ? 9.327   -20.820 -2.651  1.00 0.00 ? 99  LYS B HE3  1  
ATOM 3126  H HZ1  . LYS B 1 99  ? 9.629   -20.867 0.239   1.00 0.00 ? 99  LYS B HZ1  1  
ATOM 3127  H HZ2  . LYS B 1 99  ? 9.988   -19.639 -0.868  1.00 0.00 ? 99  LYS B HZ2  1  
ATOM 3128  H HZ3  . LYS B 1 99  ? 11.067  -20.923 -0.651  1.00 0.00 ? 99  LYS B HZ3  1  
ATOM 3129  N N    . ARG B 1 100 ? 7.445   -21.359 -6.316  1.00 0.00 ? 100 ARG B N    1  
ATOM 3130  C CA   . ARG B 1 100 ? 8.559   -21.641 -7.213  1.00 0.00 ? 100 ARG B CA   1  
ATOM 3131  C C    . ARG B 1 100 ? 9.178   -20.347 -7.736  1.00 0.00 ? 100 ARG B C    1  
ATOM 3132  O O    . ARG B 1 100 ? 8.782   -19.253 -7.336  1.00 0.00 ? 100 ARG B O    1  
ATOM 3133  C CB   . ARG B 1 100 ? 8.092   -22.511 -8.382  1.00 0.00 ? 100 ARG B CB   1  
ATOM 3134  C CG   . ARG B 1 100 ? 8.977   -23.722 -8.632  1.00 0.00 ? 100 ARG B CG   1  
ATOM 3135  C CD   . ARG B 1 100 ? 9.719   -23.612 -9.955  1.00 0.00 ? 100 ARG B CD   1  
ATOM 3136  N NE   . ARG B 1 100 ? 9.156   -24.495 -10.973 1.00 0.00 ? 100 ARG B NE   1  
ATOM 3137  C CZ   . ARG B 1 100 ? 9.805   -24.864 -12.076 1.00 0.00 ? 100 ARG B CZ   1  
ATOM 3138  N NH1  . ARG B 1 100 ? 11.038  -24.428 -12.306 1.00 0.00 ? 100 ARG B NH1  1  
ATOM 3139  N NH2  . ARG B 1 100 ? 9.220   -25.671 -12.950 1.00 0.00 ? 100 ARG B NH2  1  
ATOM 3140  H H    . ARG B 1 100 ? 7.031   -20.470 -6.331  1.00 0.00 ? 100 ARG B H    1  
ATOM 3141  H HA   . ARG B 1 100 ? 9.307   -22.181 -6.651  1.00 0.00 ? 100 ARG B HA   1  
ATOM 3142  H HB2  . ARG B 1 100 ? 7.090   -22.860 -8.177  1.00 0.00 ? 100 ARG B HB2  1  
ATOM 3143  H HB3  . ARG B 1 100 ? 8.076   -21.910 -9.280  1.00 0.00 ? 100 ARG B HB3  1  
ATOM 3144  H HG2  . ARG B 1 100 ? 9.698   -23.798 -7.832  1.00 0.00 ? 100 ARG B HG2  1  
ATOM 3145  H HG3  . ARG B 1 100 ? 8.359   -24.609 -8.648  1.00 0.00 ? 100 ARG B HG3  1  
ATOM 3146  H HD2  . ARG B 1 100 ? 9.660   -22.592 -10.304 1.00 0.00 ? 100 ARG B HD2  1  
ATOM 3147  H HD3  . ARG B 1 100 ? 10.754  -23.876 -9.794  1.00 0.00 ? 100 ARG B HD3  1  
ATOM 3148  H HE   . ARG B 1 100 ? 8.247   -24.832 -10.828 1.00 0.00 ? 100 ARG B HE   1  
ATOM 3149  H HH11 . ARG B 1 100 ? 11.484  -23.820 -11.650 1.00 0.00 ? 100 ARG B HH11 1  
ATOM 3150  H HH12 . ARG B 1 100 ? 11.519  -24.709 -13.136 1.00 0.00 ? 100 ARG B HH12 1  
ATOM 3151  H HH22 . ARG B 1 100 ? 9.707   -25.948 -13.778 1.00 0.00 ? 100 ARG B HH22 1  
ATOM 3152  N N    . PHE B 1 101 ? 10.150  -20.483 -8.631  1.00 0.00 ? 101 PHE B N    1  
ATOM 3153  C CA   . PHE B 1 101 ? 10.823  -19.325 -9.209  1.00 0.00 ? 101 PHE B CA   1  
ATOM 3154  C C    . PHE B 1 101 ? 9.832   -18.431 -9.946  1.00 0.00 ? 101 PHE B C    1  
ATOM 3155  O O    . PHE B 1 101 ? 8.632   -18.778 -9.975  1.00 0.00 ? 101 PHE B O    1  
ATOM 3156  C CB   . PHE B 1 101 ? 11.928  -19.777 -10.166 1.00 0.00 ? 101 PHE B CB   1  
ATOM 3157  C CG   . PHE B 1 101 ? 13.242  -20.038 -9.486  1.00 0.00 ? 101 PHE B CG   1  
ATOM 3158  C CD1  . PHE B 1 101 ? 13.828  -19.069 -8.688  1.00 0.00 ? 101 PHE B CD1  1  
ATOM 3159  C CD2  . PHE B 1 101 ? 13.890  -21.253 -9.645  1.00 0.00 ? 101 PHE B CD2  1  
ATOM 3160  C CE1  . PHE B 1 101 ? 15.037  -19.306 -8.061  1.00 0.00 ? 101 PHE B CE1  1  
ATOM 3161  C CE2  . PHE B 1 101 ? 15.099  -21.495 -9.021  1.00 0.00 ? 101 PHE B CE2  1  
ATOM 3162  C CZ   . PHE B 1 101 ? 15.673  -20.520 -8.228  1.00 0.00 ? 101 PHE B CZ   1  
ATOM 3163  O OXT  . PHE B 1 101 ? 10.263  -17.390 -10.484 1.00 0.00 ? 101 PHE B OXT  1  
ATOM 3164  H H    . PHE B 1 101 ? 10.422  -21.382 -8.909  1.00 0.00 ? 101 PHE B H    1  
ATOM 3165  H HA   . PHE B 1 101 ? 11.267  -18.762 -8.401  1.00 0.00 ? 101 PHE B HA   1  
ATOM 3166  H HB2  . PHE B 1 101 ? 11.621  -20.690 -10.654 1.00 0.00 ? 101 PHE B HB2  1  
ATOM 3167  H HB3  . PHE B 1 101 ? 12.085  -19.011 -10.911 1.00 0.00 ? 101 PHE B HB3  1  
ATOM 3168  H HD1  . PHE B 1 101 ? 13.332  -18.118 -8.556  1.00 0.00 ? 101 PHE B HD1  1  
ATOM 3169  H HD2  . PHE B 1 101 ? 13.442  -22.014 -10.266 1.00 0.00 ? 101 PHE B HD2  1  
ATOM 3170  H HE1  . PHE B 1 101 ? 15.484  -18.542 -7.441  1.00 0.00 ? 101 PHE B HE1  1  
ATOM 3171  H HE2  . PHE B 1 101 ? 15.594  -22.446 -9.153  1.00 0.00 ? 101 PHE B HE2  1  
ATOM 3172  H HZ   . PHE B 1 101 ? 16.618  -20.708 -7.739  1.00 0.00 ? 101 PHE B HZ   1  
ATOM 3173  N N    . SER A 1 1   ? 3.990   -1.559  20.051  1.00 0.00 ? 1   SER A N    2  
ATOM 3174  C CA   . SER A 1 1   ? 4.336   -1.976  21.434  1.00 0.00 ? 1   SER A CA   2  
ATOM 3175  C C    . SER A 1 1   ? 5.659   -2.737  21.466  1.00 0.00 ? 1   SER A C    2  
ATOM 3176  O O    . SER A 1 1   ? 6.696   -2.183  21.827  1.00 0.00 ? 1   SER A O    2  
ATOM 3177  C CB   . SER A 1 1   ? 3.205   -2.853  21.977  1.00 0.00 ? 1   SER A CB   2  
ATOM 3178  O OG   . SER A 1 1   ? 2.286   -2.090  22.738  1.00 0.00 ? 1   SER A OG   2  
ATOM 3179  H H1   . SER A 1 1   ? 4.165   -2.368  19.422  1.00 0.00 ? 1   SER A H1   2  
ATOM 3180  H H2   . SER A 1 1   ? 4.596   -0.750  19.803  1.00 0.00 ? 1   SER A H2   2  
ATOM 3181  H H3   . SER A 1 1   ? 2.985   -1.292  20.042  1.00 0.00 ? 1   SER A H3   2  
ATOM 3182  H HA   . SER A 1 1   ? 4.424   -1.092  22.047  1.00 0.00 ? 1   SER A HA   2  
ATOM 3183  H HB2  . SER A 1 1   ? 2.678   -3.308  21.150  1.00 0.00 ? 1   SER A HB2  2  
ATOM 3184  H HB3  . SER A 1 1   ? 3.622   -3.626  22.606  1.00 0.00 ? 1   SER A HB3  2  
ATOM 3185  H HG   . SER A 1 1   ? 1.967   -1.353  22.211  1.00 0.00 ? 1   SER A HG   2  
ATOM 3186  N N    . ARG A 1 2   ? 5.616   -4.011  21.085  1.00 0.00 ? 2   ARG A N    2  
ATOM 3187  C CA   . ARG A 1 2   ? 6.813   -4.845  21.071  1.00 0.00 ? 2   ARG A CA   2  
ATOM 3188  C C    . ARG A 1 2   ? 7.445   -4.878  19.680  1.00 0.00 ? 2   ARG A C    2  
ATOM 3189  O O    . ARG A 1 2   ? 8.634   -4.603  19.526  1.00 0.00 ? 2   ARG A O    2  
ATOM 3190  C CB   . ARG A 1 2   ? 6.480   -6.266  21.536  1.00 0.00 ? 2   ARG A CB   2  
ATOM 3191  C CG   . ARG A 1 2   ? 7.187   -6.666  22.822  1.00 0.00 ? 2   ARG A CG   2  
ATOM 3192  C CD   . ARG A 1 2   ? 6.347   -6.334  24.045  1.00 0.00 ? 2   ARG A CD   2  
ATOM 3193  N NE   . ARG A 1 2   ? 7.114   -6.449  25.283  1.00 0.00 ? 2   ARG A NE   2  
ATOM 3194  C CZ   . ARG A 1 2   ? 7.965   -5.521  25.715  1.00 0.00 ? 2   ARG A CZ   2  
ATOM 3195  N NH1  . ARG A 1 2   ? 8.162   -4.411  25.014  1.00 0.00 ? 2   ARG A NH1  2  
ATOM 3196  N NH2  . ARG A 1 2   ? 8.624   -5.705  26.853  1.00 0.00 ? 2   ARG A NH2  2  
ATOM 3197  H H    . ARG A 1 2   ? 4.759   -4.400  20.809  1.00 0.00 ? 2   ARG A H    2  
ATOM 3198  H HA   . ARG A 1 2   ? 7.522   -4.410  21.761  1.00 0.00 ? 2   ARG A HA   2  
ATOM 3199  H HB2  . ARG A 1 2   ? 5.415   -6.339  21.698  1.00 0.00 ? 2   ARG A HB2  2  
ATOM 3200  H HB3  . ARG A 1 2   ? 6.766   -6.964  20.762  1.00 0.00 ? 2   ARG A HB3  2  
ATOM 3201  H HG2  . ARG A 1 2   ? 7.373   -7.729  22.804  1.00 0.00 ? 2   ARG A HG2  2  
ATOM 3202  H HG3  . ARG A 1 2   ? 8.125   -6.135  22.886  1.00 0.00 ? 2   ARG A HG3  2  
ATOM 3203  H HD2  . ARG A 1 2   ? 5.981   -5.322  23.951  1.00 0.00 ? 2   ARG A HD2  2  
ATOM 3204  H HD3  . ARG A 1 2   ? 5.510   -7.016  24.086  1.00 0.00 ? 2   ARG A HD3  2  
ATOM 3205  H HE   . ARG A 1 2   ? 6.987   -7.258  25.820  1.00 0.00 ? 2   ARG A HE   2  
ATOM 3206  H HH11 . ARG A 1 2   ? 7.669   -4.266  24.157  1.00 0.00 ? 2   ARG A HH11 2  
ATOM 3207  H HH12 . ARG A 1 2   ? 8.803   -3.719  25.345  1.00 0.00 ? 2   ARG A HH12 2  
ATOM 3208  H HH22 . ARG A 1 2   ? 9.264   -5.009  27.177  1.00 0.00 ? 2   ARG A HH22 2  
ATOM 3209  N N    . PRO A 1 3   ? 6.657   -5.217  18.642  1.00 0.00 ? 3   PRO A N    2  
ATOM 3210  C CA   . PRO A 1 3   ? 7.145   -5.285  17.260  1.00 0.00 ? 3   PRO A CA   2  
ATOM 3211  C C    . PRO A 1 3   ? 7.608   -3.914  16.750  1.00 0.00 ? 3   PRO A C    2  
ATOM 3212  O O    . PRO A 1 3   ? 8.424   -3.256  17.395  1.00 0.00 ? 3   PRO A O    2  
ATOM 3213  C CB   . PRO A 1 3   ? 5.916   -5.804  16.486  1.00 0.00 ? 3   PRO A CB   2  
ATOM 3214  C CG   . PRO A 1 3   ? 5.072   -6.446  17.523  1.00 0.00 ? 3   PRO A CG   2  
ATOM 3215  C CD   . PRO A 1 3   ? 5.230   -5.562  18.714  1.00 0.00 ? 3   PRO A CD   2  
ATOM 3216  H HA   . PRO A 1 3   ? 7.958   -5.991  17.165  1.00 0.00 ? 3   PRO A HA   2  
ATOM 3217  H HB2  . PRO A 1 3   ? 5.398   -4.977  16.028  1.00 0.00 ? 3   PRO A HB2  2  
ATOM 3218  H HB3  . PRO A 1 3   ? 6.226   -6.510  15.733  1.00 0.00 ? 3   PRO A HB3  2  
ATOM 3219  H HG2  . PRO A 1 3   ? 4.041   -6.473  17.200  1.00 0.00 ? 3   PRO A HG2  2  
ATOM 3220  H HG3  . PRO A 1 3   ? 5.434   -7.440  17.738  1.00 0.00 ? 3   PRO A HG3  2  
ATOM 3221  H HD2  . PRO A 1 3   ? 4.614   -4.681  18.607  1.00 0.00 ? 3   PRO A HD2  2  
ATOM 3222  H HD3  . PRO A 1 3   ? 4.998   -6.091  19.622  1.00 0.00 ? 3   PRO A HD3  2  
ATOM 3223  N N    . THR A 1 4   ? 7.094   -3.484  15.600  1.00 0.00 ? 4   THR A N    2  
ATOM 3224  C CA   . THR A 1 4   ? 7.467   -2.195  15.030  1.00 0.00 ? 4   THR A CA   2  
ATOM 3225  C C    . THR A 1 4   ? 6.285   -1.543  14.334  1.00 0.00 ? 4   THR A C    2  
ATOM 3226  O O    . THR A 1 4   ? 5.442   -2.215  13.741  1.00 0.00 ? 4   THR A O    2  
ATOM 3227  C CB   . THR A 1 4   ? 8.644   -2.350  14.056  1.00 0.00 ? 4   THR A CB   2  
ATOM 3228  O OG1  . THR A 1 4   ? 8.682   -1.272  13.136  1.00 0.00 ? 4   THR A OG1  2  
ATOM 3229  C CG2  . THR A 1 4   ? 8.611   -3.633  13.251  1.00 0.00 ? 4   THR A CG2  2  
ATOM 3230  H H    . THR A 1 4   ? 6.449   -4.043  15.123  1.00 0.00 ? 4   THR A H    2  
ATOM 3231  H HA   . THR A 1 4   ? 7.770   -1.550  15.838  1.00 0.00 ? 4   THR A HA   2  
ATOM 3232  H HB   . THR A 1 4   ? 9.565   -2.341  14.622  1.00 0.00 ? 4   THR A HB   2  
ATOM 3233  H HG1  . THR A 1 4   ? 9.023   -0.490  13.575  1.00 0.00 ? 4   THR A HG1  2  
ATOM 3234  H HG21 . THR A 1 4   ? 9.603   -3.854  12.888  1.00 0.00 ? 4   THR A HG21 2  
ATOM 3235  H HG22 . THR A 1 4   ? 7.939   -3.515  12.414  1.00 0.00 ? 4   THR A HG22 2  
ATOM 3236  H HG23 . THR A 1 4   ? 8.268   -4.444  13.876  1.00 0.00 ? 4   THR A HG23 2  
ATOM 3237  N N    . GLU A 1 5   ? 6.235   -0.220  14.420  1.00 0.00 ? 5   GLU A N    2  
ATOM 3238  C CA   . GLU A 1 5   ? 5.167   0.558   13.811  1.00 0.00 ? 5   GLU A CA   2  
ATOM 3239  C C    . GLU A 1 5   ? 4.879   0.077   12.392  1.00 0.00 ? 5   GLU A C    2  
ATOM 3240  O O    . GLU A 1 5   ? 3.723   -0.099  12.008  1.00 0.00 ? 5   GLU A O    2  
ATOM 3241  C CB   . GLU A 1 5   ? 5.565   2.029   13.807  1.00 0.00 ? 5   GLU A CB   2  
ATOM 3242  C CG   . GLU A 1 5   ? 4.444   2.965   14.229  1.00 0.00 ? 5   GLU A CG   2  
ATOM 3243  C CD   . GLU A 1 5   ? 4.807   4.426   14.050  1.00 0.00 ? 5   GLU A CD   2  
ATOM 3244  O OE1  . GLU A 1 5   ? 6.014   4.745   14.064  1.00 0.00 ? 5   GLU A OE1  2  
ATOM 3245  O OE2  . GLU A 1 5   ? 3.882   5.252   13.896  1.00 0.00 ? 5   GLU A OE2  2  
ATOM 3246  H H    . GLU A 1 5   ? 6.941   0.248   14.912  1.00 0.00 ? 5   GLU A H    2  
ATOM 3247  H HA   . GLU A 1 5   ? 4.278   0.436   14.411  1.00 0.00 ? 5   GLU A HA   2  
ATOM 3248  H HB2  . GLU A 1 5   ? 6.393   2.157   14.492  1.00 0.00 ? 5   GLU A HB2  2  
ATOM 3249  H HB3  . GLU A 1 5   ? 5.884   2.304   12.813  1.00 0.00 ? 5   GLU A HB3  2  
ATOM 3250  H HG2  . GLU A 1 5   ? 3.570   2.752   13.632  1.00 0.00 ? 5   GLU A HG2  2  
ATOM 3251  H HG3  . GLU A 1 5   ? 4.219   2.791   15.271  1.00 0.00 ? 5   GLU A HG3  2  
ATOM 3252  N N    . THR A 1 6   ? 5.940   -0.155  11.629  1.00 0.00 ? 6   THR A N    2  
ATOM 3253  C CA   . THR A 1 6   ? 5.804   -0.640  10.264  1.00 0.00 ? 6   THR A CA   2  
ATOM 3254  C C    . THR A 1 6   ? 5.200   -2.038  10.268  1.00 0.00 ? 6   THR A C    2  
ATOM 3255  O O    . THR A 1 6   ? 4.349   -2.364  9.448   1.00 0.00 ? 6   THR A O    2  
ATOM 3256  C CB   . THR A 1 6   ? 7.169   -0.666  9.575   1.00 0.00 ? 6   THR A CB   2  
ATOM 3257  O OG1  . THR A 1 6   ? 8.028   0.317   10.125  1.00 0.00 ? 6   THR A OG1  2  
ATOM 3258  C CG2  . THR A 1 6   ? 7.091   -0.423  8.084   1.00 0.00 ? 6   THR A CG2  2  
ATOM 3259  H H    . THR A 1 6   ? 6.836   -0.010  11.998  1.00 0.00 ? 6   THR A H    2  
ATOM 3260  H HA   . THR A 1 6   ? 5.146   0.029   9.724   1.00 0.00 ? 6   THR A HA   2  
ATOM 3261  H HB   . THR A 1 6   ? 7.621   -1.635  9.729   1.00 0.00 ? 6   THR A HB   2  
ATOM 3262  H HG1  . THR A 1 6   ? 8.570   -0.079  10.811  1.00 0.00 ? 6   THR A HG1  2  
ATOM 3263  H HG21 . THR A 1 6   ? 8.039   -0.047  7.731   1.00 0.00 ? 6   THR A HG21 2  
ATOM 3264  H HG22 . THR A 1 6   ? 6.316   0.299   7.877   1.00 0.00 ? 6   THR A HG22 2  
ATOM 3265  H HG23 . THR A 1 6   ? 6.863   -1.351  7.581   1.00 0.00 ? 6   THR A HG23 2  
ATOM 3266  N N    . GLU A 1 7   ? 5.636   -2.860  11.212  1.00 0.00 ? 7   GLU A N    2  
ATOM 3267  C CA   . GLU A 1 7   ? 5.134   -4.227  11.318  1.00 0.00 ? 7   GLU A CA   2  
ATOM 3268  C C    . GLU A 1 7   ? 3.607   -4.239  11.324  1.00 0.00 ? 7   GLU A C    2  
ATOM 3269  O O    . GLU A 1 7   ? 2.982   -5.132  10.753  1.00 0.00 ? 7   GLU A O    2  
ATOM 3270  C CB   . GLU A 1 7   ? 5.669   -4.889  12.592  1.00 0.00 ? 7   GLU A CB   2  
ATOM 3271  C CG   . GLU A 1 7   ? 6.590   -6.067  12.323  1.00 0.00 ? 7   GLU A CG   2  
ATOM 3272  C CD   . GLU A 1 7   ? 5.883   -7.402  12.449  1.00 0.00 ? 7   GLU A CD   2  
ATOM 3273  O OE1  . GLU A 1 7   ? 4.635   -7.421  12.379  1.00 0.00 ? 7   GLU A OE1  2  
ATOM 3274  O OE2  . GLU A 1 7   ? 6.575   -8.427  12.617  1.00 0.00 ? 7   GLU A OE2  2  
ATOM 3275  H H    . GLU A 1 7   ? 6.310   -2.544  11.846  1.00 0.00 ? 7   GLU A H    2  
ATOM 3276  H HA   . GLU A 1 7   ? 5.485   -4.778  10.459  1.00 0.00 ? 7   GLU A HA   2  
ATOM 3277  H HB2  . GLU A 1 7   ? 6.216   -4.154  13.166  1.00 0.00 ? 7   GLU A HB2  2  
ATOM 3278  H HB3  . GLU A 1 7   ? 4.835   -5.241  13.181  1.00 0.00 ? 7   GLU A HB3  2  
ATOM 3279  H HG2  . GLU A 1 7   ? 6.984   -5.978  11.321  1.00 0.00 ? 7   GLU A HG2  2  
ATOM 3280  H HG3  . GLU A 1 7   ? 7.405   -6.040  13.032  1.00 0.00 ? 7   GLU A HG3  2  
ATOM 3281  N N    . ARG A 1 8   ? 3.016   -3.230  11.952  1.00 0.00 ? 8   ARG A N    2  
ATOM 3282  C CA   . ARG A 1 8   ? 1.568   -3.110  12.009  1.00 0.00 ? 8   ARG A CA   2  
ATOM 3283  C C    . ARG A 1 8   ? 1.025   -2.530  10.703  1.00 0.00 ? 8   ARG A C    2  
ATOM 3284  O O    . ARG A 1 8   ? -0.124  -2.775  10.335  1.00 0.00 ? 8   ARG A O    2  
ATOM 3285  C CB   . ARG A 1 8   ? 1.158   -2.228  13.190  1.00 0.00 ? 8   ARG A CB   2  
ATOM 3286  C CG   . ARG A 1 8   ? -0.336  -1.957  13.258  1.00 0.00 ? 8   ARG A CG   2  
ATOM 3287  C CD   . ARG A 1 8   ? -0.863  -2.075  14.679  1.00 0.00 ? 8   ARG A CD   2  
ATOM 3288  N NE   . ARG A 1 8   ? -1.210  -3.452  15.023  1.00 0.00 ? 8   ARG A NE   2  
ATOM 3289  C CZ   . ARG A 1 8   ? -2.226  -4.119  14.480  1.00 0.00 ? 8   ARG A CZ   2  
ATOM 3290  N NH1  . ARG A 1 8   ? -2.997  -3.539  13.569  1.00 0.00 ? 8   ARG A NH1  2  
ATOM 3291  N NH2  . ARG A 1 8   ? -2.472  -5.368  14.849  1.00 0.00 ? 8   ARG A NH2  2  
ATOM 3292  H H    . ARG A 1 8   ? 3.568   -2.539  12.373  1.00 0.00 ? 8   ARG A H    2  
ATOM 3293  H HA   . ARG A 1 8   ? 1.158   -4.100  12.148  1.00 0.00 ? 8   ARG A HA   2  
ATOM 3294  H HB2  . ARG A 1 8   ? 1.457   -2.714  14.108  1.00 0.00 ? 8   ARG A HB2  2  
ATOM 3295  H HB3  . ARG A 1 8   ? 1.671   -1.281  13.112  1.00 0.00 ? 8   ARG A HB3  2  
ATOM 3296  H HG2  . ARG A 1 8   ? -0.526  -0.958  12.896  1.00 0.00 ? 8   ARG A HG2  2  
ATOM 3297  H HG3  . ARG A 1 8   ? -0.848  -2.673  12.632  1.00 0.00 ? 8   ARG A HG3  2  
ATOM 3298  H HD2  . ARG A 1 8   ? -0.105  -1.723  15.362  1.00 0.00 ? 8   ARG A HD2  2  
ATOM 3299  H HD3  . ARG A 1 8   ? -1.746  -1.458  14.774  1.00 0.00 ? 8   ARG A HD3  2  
ATOM 3300  H HE   . ARG A 1 8   ? -0.656  -3.904  15.693  1.00 0.00 ? 8   ARG A HE   2  
ATOM 3301  H HH11 . ARG A 1 8   ? -2.817  -2.597  13.287  1.00 0.00 ? 8   ARG A HH11 2  
ATOM 3302  H HH12 . ARG A 1 8   ? -3.758  -4.045  13.164  1.00 0.00 ? 8   ARG A HH12 2  
ATOM 3303  H HH22 . ARG A 1 8   ? -3.235  -5.868  14.442  1.00 0.00 ? 8   ARG A HH22 2  
ATOM 3304  N N    . CYS A 1 9   ? 1.857   -1.749  10.014  1.00 0.00 ? 9   CYS A N    2  
ATOM 3305  C CA   . CYS A 1 9   ? 1.459   -1.120  8.757   1.00 0.00 ? 9   CYS A CA   2  
ATOM 3306  C C    . CYS A 1 9   ? 1.263   -2.152  7.648   1.00 0.00 ? 9   CYS A C    2  
ATOM 3307  O O    . CYS A 1 9   ? 0.314   -2.061  6.869   1.00 0.00 ? 9   CYS A O    2  
ATOM 3308  C CB   . CYS A 1 9   ? 2.495   -0.062  8.337   1.00 0.00 ? 9   CYS A CB   2  
ATOM 3309  S SG   . CYS A 1 9   ? 3.905   -0.687  7.384   1.00 0.00 ? 9   CYS A SG   2  
ATOM 3310  H H    . CYS A 1 9   ? 2.757   -1.584  10.365  1.00 0.00 ? 9   CYS A H    2  
ATOM 3311  H HA   . CYS A 1 9   ? 0.516   -0.626  8.930   1.00 0.00 ? 9   CYS A HA   2  
ATOM 3312  H HB2  . CYS A 1 9   ? 2.005   0.682   7.731   1.00 0.00 ? 9   CYS A HB2  2  
ATOM 3313  H HB3  . CYS A 1 9   ? 2.886   0.410   9.226   1.00 0.00 ? 9   CYS A HB3  2  
ATOM 3314  H HG   . CYS A 1 9   ? 4.420   0.069   7.089   1.00 0.00 ? 9   CYS A HG   2  
ATOM 3315  N N    . ILE A 1 10  ? 2.163   -3.124  7.575   1.00 0.00 ? 10  ILE A N    2  
ATOM 3316  C CA   . ILE A 1 10  ? 2.084   -4.154  6.554   1.00 0.00 ? 10  ILE A CA   2  
ATOM 3317  C C    . ILE A 1 10  ? 0.941   -5.123  6.825   1.00 0.00 ? 10  ILE A C    2  
ATOM 3318  O O    . ILE A 1 10  ? 0.098   -5.355  5.963   1.00 0.00 ? 10  ILE A O    2  
ATOM 3319  C CB   . ILE A 1 10  ? 3.395   -4.958  6.461   1.00 0.00 ? 10  ILE A CB   2  
ATOM 3320  C CG1  . ILE A 1 10  ? 4.589   -4.021  6.302   1.00 0.00 ? 10  ILE A CG1  2  
ATOM 3321  C CG2  . ILE A 1 10  ? 3.336   -5.932  5.297   1.00 0.00 ? 10  ILE A CG2  2  
ATOM 3322  C CD1  . ILE A 1 10  ? 5.384   -3.821  7.566   1.00 0.00 ? 10  ILE A CD1  2  
ATOM 3323  H H    . ILE A 1 10  ? 2.902   -3.146  8.214   1.00 0.00 ? 10  ILE A H    2  
ATOM 3324  H HA   . ILE A 1 10  ? 1.916   -3.671  5.603   1.00 0.00 ? 10  ILE A HA   2  
ATOM 3325  H HB   . ILE A 1 10  ? 3.510   -5.527  7.372   1.00 0.00 ? 10  ILE A HB   2  
ATOM 3326  H HG12 . ILE A 1 10  ? 5.256   -4.429  5.561   1.00 0.00 ? 10  ILE A HG12 2  
ATOM 3327  H HG13 . ILE A 1 10  ? 4.237   -3.055  5.974   1.00 0.00 ? 10  ILE A HG13 2  
ATOM 3328  H HG21 . ILE A 1 10  ? 3.669   -6.905  5.626   1.00 0.00 ? 10  ILE A HG21 2  
ATOM 3329  H HG22 . ILE A 1 10  ? 3.978   -5.579  4.503   1.00 0.00 ? 10  ILE A HG22 2  
ATOM 3330  H HG23 . ILE A 1 10  ? 2.321   -6.000  4.936   1.00 0.00 ? 10  ILE A HG23 2  
ATOM 3331  H HD11 . ILE A 1 10  ? 4.837   -4.229  8.402   1.00 0.00 ? 10  ILE A HD11 2  
ATOM 3332  H HD12 . ILE A 1 10  ? 5.547   -2.766  7.719   1.00 0.00 ? 10  ILE A HD12 2  
ATOM 3333  H HD13 . ILE A 1 10  ? 6.335   -4.325  7.478   1.00 0.00 ? 10  ILE A HD13 2  
ATOM 3334  N N    . GLU A 1 11  ? 0.930   -5.705  8.017   1.00 0.00 ? 11  GLU A N    2  
ATOM 3335  C CA   . GLU A 1 11  ? -0.093  -6.677  8.386   1.00 0.00 ? 11  GLU A CA   2  
ATOM 3336  C C    . GLU A 1 11  ? -1.500  -6.150  8.136   1.00 0.00 ? 11  GLU A C    2  
ATOM 3337  O O    . GLU A 1 11  ? -2.427  -6.927  7.911   1.00 0.00 ? 11  GLU A O    2  
ATOM 3338  C CB   . GLU A 1 11  ? 0.062   -7.085  9.851   1.00 0.00 ? 11  GLU A CB   2  
ATOM 3339  C CG   . GLU A 1 11  ? 0.182   -8.588  10.042  1.00 0.00 ? 11  GLU A CG   2  
ATOM 3340  C CD   . GLU A 1 11  ? -0.749  -9.117  11.115  1.00 0.00 ? 11  GLU A CD   2  
ATOM 3341  O OE1  . GLU A 1 11  ? -1.183  -8.318  11.971  1.00 0.00 ? 11  GLU A OE1  2  
ATOM 3342  O OE2  . GLU A 1 11  ? -1.045  -10.330 11.098  1.00 0.00 ? 11  GLU A OE2  2  
ATOM 3343  H H    . GLU A 1 11  ? 1.640   -5.492  8.659   1.00 0.00 ? 11  GLU A H    2  
ATOM 3344  H HA   . GLU A 1 11  ? 0.057   -7.551  7.773   1.00 0.00 ? 11  GLU A HA   2  
ATOM 3345  H HB2  . GLU A 1 11  ? 0.949   -6.618  10.252  1.00 0.00 ? 11  GLU A HB2  2  
ATOM 3346  H HB3  . GLU A 1 11  ? -0.799  -6.740  10.405  1.00 0.00 ? 11  GLU A HB3  2  
ATOM 3347  H HG2  . GLU A 1 11  ? -0.056  -9.076  9.106   1.00 0.00 ? 11  GLU A HG2  2  
ATOM 3348  H HG3  . GLU A 1 11  ? 1.199   -8.822  10.319  1.00 0.00 ? 11  GLU A HG3  2  
ATOM 3349  N N    . SER A 1 12  ? -1.665  -4.836  8.184   1.00 0.00 ? 12  SER A N    2  
ATOM 3350  C CA   . SER A 1 12  ? -2.975  -4.240  7.968   1.00 0.00 ? 12  SER A CA   2  
ATOM 3351  C C    . SER A 1 12  ? -3.344  -4.203  6.483   1.00 0.00 ? 12  SER A C    2  
ATOM 3352  O O    . SER A 1 12  ? -4.384  -4.725  6.089   1.00 0.00 ? 12  SER A O    2  
ATOM 3353  C CB   . SER A 1 12  ? -3.015  -2.831  8.554   1.00 0.00 ? 12  SER A CB   2  
ATOM 3354  O OG   . SER A 1 12  ? -2.758  -2.851  9.947   1.00 0.00 ? 12  SER A OG   2  
ATOM 3355  H H    . SER A 1 12  ? -0.896  -4.259  8.373   1.00 0.00 ? 12  SER A H    2  
ATOM 3356  H HA   . SER A 1 12  ? -3.700  -4.850  8.486   1.00 0.00 ? 12  SER A HA   2  
ATOM 3357  H HB2  . SER A 1 12  ? -2.265  -2.221  8.073   1.00 0.00 ? 12  SER A HB2  2  
ATOM 3358  H HB3  . SER A 1 12  ? -3.990  -2.403  8.387   1.00 0.00 ? 12  SER A HB3  2  
ATOM 3359  H HG   . SER A 1 12  ? -2.085  -2.200  10.159  1.00 0.00 ? 12  SER A HG   2  
ATOM 3360  N N    . LEU A 1 13  ? -2.495  -3.587  5.660   1.00 0.00 ? 13  LEU A N    2  
ATOM 3361  C CA   . LEU A 1 13  ? -2.761  -3.487  4.228   1.00 0.00 ? 13  LEU A CA   2  
ATOM 3362  C C    . LEU A 1 13  ? -2.931  -4.864  3.585   1.00 0.00 ? 13  LEU A C    2  
ATOM 3363  O O    . LEU A 1 13  ? -3.643  -5.016  2.590   1.00 0.00 ? 13  LEU A O    2  
ATOM 3364  C CB   . LEU A 1 13  ? -1.646  -2.704  3.547   1.00 0.00 ? 13  LEU A CB   2  
ATOM 3365  C CG   . LEU A 1 13  ? -1.869  -1.192  3.507   1.00 0.00 ? 13  LEU A CG   2  
ATOM 3366  C CD1  . LEU A 1 13  ? -3.209  -0.864  2.872   1.00 0.00 ? 13  LEU A CD1  2  
ATOM 3367  C CD2  . LEU A 1 13  ? -1.800  -0.589  4.898   1.00 0.00 ? 13  LEU A CD2  2  
ATOM 3368  H H    . LEU A 1 13  ? -1.679  -3.180  6.019   1.00 0.00 ? 13  LEU A H    2  
ATOM 3369  H HA   . LEU A 1 13  ? -3.685  -2.942  4.111   1.00 0.00 ? 13  LEU A HA   2  
ATOM 3370  H HB2  . LEU A 1 13  ? -0.722  -2.901  4.071   1.00 0.00 ? 13  LEU A HB2  2  
ATOM 3371  H HB3  . LEU A 1 13  ? -1.551  -3.058  2.532   1.00 0.00 ? 13  LEU A HB3  2  
ATOM 3372  H HG   . LEU A 1 13  ? -1.094  -0.742  2.912   1.00 0.00 ? 13  LEU A HG   2  
ATOM 3373  H HD11 . LEU A 1 13  ? -3.103  -0.001  2.232   1.00 0.00 ? 13  LEU A HD11 2  
ATOM 3374  H HD12 . LEU A 1 13  ? -3.933  -0.648  3.650   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 3375  H HD13 . LEU A 1 13  ? -3.549  -1.708  2.290   1.00 0.00 ? 13  LEU A HD13 2  
ATOM 3376  H HD21 . LEU A 1 13  ? -1.368  -1.303  5.582   1.00 0.00 ? 13  LEU A HD21 2  
ATOM 3377  H HD22 . LEU A 1 13  ? -2.795  -0.334  5.222   1.00 0.00 ? 13  LEU A HD22 2  
ATOM 3378  H HD23 . LEU A 1 13  ? -1.193  0.302   4.873   1.00 0.00 ? 13  LEU A HD23 2  
ATOM 3379  N N    . ILE A 1 14  ? -2.297  -5.869  4.161   1.00 0.00 ? 14  ILE A N    2  
ATOM 3380  C CA   . ILE A 1 14  ? -2.409  -7.218  3.657   1.00 0.00 ? 14  ILE A CA   2  
ATOM 3381  C C    . ILE A 1 14  ? -3.772  -7.778  3.950   1.00 0.00 ? 14  ILE A C    2  
ATOM 3382  O O    . ILE A 1 14  ? -4.347  -8.517  3.157   1.00 0.00 ? 14  ILE A O    2  
ATOM 3383  C CB   . ILE A 1 14  ? -1.431  -8.147  4.362   1.00 0.00 ? 14  ILE A CB   2  
ATOM 3384  C CG1  . ILE A 1 14  ? -0.032  -7.579  4.354   1.00 0.00 ? 14  ILE A CG1  2  
ATOM 3385  C CG2  . ILE A 1 14  ? -1.471  -9.516  3.738   1.00 0.00 ? 14  ILE A CG2  2  
ATOM 3386  C CD1  . ILE A 1 14  ? 0.784   -8.087  5.509   1.00 0.00 ? 14  ILE A CD1  2  
ATOM 3387  H H    . ILE A 1 14  ? -1.757  -5.711  4.956   1.00 0.00 ? 14  ILE A H    2  
ATOM 3388  H HA   . ILE A 1 14  ? -2.212  -7.234  2.601   1.00 0.00 ? 14  ILE A HA   2  
ATOM 3389  H HB   . ILE A 1 14  ? -1.757  -8.248  5.387   1.00 0.00 ? 14  ILE A HB   2  
ATOM 3390  H HG12 . ILE A 1 14  ? 0.466   -7.853  3.437   1.00 0.00 ? 14  ILE A HG12 2  
ATOM 3391  H HG13 . ILE A 1 14  ? -0.091  -6.508  4.429   1.00 0.00 ? 14  ILE A HG13 2  
ATOM 3392  H HG21 . ILE A 1 14  ? -0.870  -10.193 4.323   1.00 0.00 ? 14  ILE A HG21 2  
ATOM 3393  H HG22 . ILE A 1 14  ? -1.084  -9.459  2.735   1.00 0.00 ? 14  ILE A HG22 2  
ATOM 3394  H HG23 . ILE A 1 14  ? -2.494  -9.865  3.716   1.00 0.00 ? 14  ILE A HG23 2  
ATOM 3395  H HD11 . ILE A 1 14  ? 1.519   -8.785  5.148   1.00 0.00 ? 14  ILE A HD11 2  
ATOM 3396  H HD12 . ILE A 1 14  ? 0.124   -8.582  6.211   1.00 0.00 ? 14  ILE A HD12 2  
ATOM 3397  H HD13 . ILE A 1 14  ? 1.273   -7.263  5.995   1.00 0.00 ? 14  ILE A HD13 2  
ATOM 3398  N N    . ALA A 1 15  ? -4.239  -7.453  5.137   1.00 0.00 ? 15  ALA A N    2  
ATOM 3399  C CA   . ALA A 1 15  ? -5.492  -7.951  5.631   1.00 0.00 ? 15  ALA A CA   2  
ATOM 3400  C C    . ALA A 1 15  ? -6.673  -7.227  5.020   1.00 0.00 ? 15  ALA A C    2  
ATOM 3401  O O    . ALA A 1 15  ? -7.680  -7.849  4.684   1.00 0.00 ? 15  ALA A O    2  
ATOM 3402  C CB   . ALA A 1 15  ? -5.471  -7.866  7.135   1.00 0.00 ? 15  ALA A CB   2  
ATOM 3403  H H    . ALA A 1 15  ? -3.698  -6.879  5.719   1.00 0.00 ? 15  ALA A H    2  
ATOM 3404  H HA   . ALA A 1 15  ? -5.552  -8.989  5.363   1.00 0.00 ? 15  ALA A HA   2  
ATOM 3405  H HB1  . ALA A 1 15  ? -6.005  -6.988  7.458   1.00 0.00 ? 15  ALA A HB1  2  
ATOM 3406  H HB2  . ALA A 1 15  ? -4.434  -7.808  7.461   1.00 0.00 ? 15  ALA A HB2  2  
ATOM 3407  H HB3  . ALA A 1 15  ? -5.930  -8.751  7.546   1.00 0.00 ? 15  ALA A HB3  2  
ATOM 3408  N N    . VAL A 1 16  ? -6.538  -5.923  4.826   1.00 0.00 ? 16  VAL A N    2  
ATOM 3409  C CA   . VAL A 1 16  ? -7.592  -5.158  4.197   1.00 0.00 ? 16  VAL A CA   2  
ATOM 3410  C C    . VAL A 1 16  ? -7.959  -5.829  2.886   1.00 0.00 ? 16  VAL A C    2  
ATOM 3411  O O    . VAL A 1 16  ? -9.110  -5.809  2.449   1.00 0.00 ? 16  VAL A O    2  
ATOM 3412  C CB   . VAL A 1 16  ? -7.128  -3.719  3.914   1.00 0.00 ? 16  VAL A CB   2  
ATOM 3413  C CG1  . VAL A 1 16  ? -6.696  -3.042  5.190   1.00 0.00 ? 16  VAL A CG1  2  
ATOM 3414  C CG2  . VAL A 1 16  ? -5.977  -3.704  2.928   1.00 0.00 ? 16  VAL A CG2  2  
ATOM 3415  H H    . VAL A 1 16  ? -5.706  -5.476  5.073   1.00 0.00 ? 16  VAL A H    2  
ATOM 3416  H HA   . VAL A 1 16  ? -8.450  -5.135  4.853   1.00 0.00 ? 16  VAL A HA   2  
ATOM 3417  H HB   . VAL A 1 16  ? -7.947  -3.169  3.494   1.00 0.00 ? 16  VAL A HB   2  
ATOM 3418  H HG11 . VAL A 1 16  ? -6.083  -2.183  4.944   1.00 0.00 ? 16  VAL A HG11 2  
ATOM 3419  H HG12 . VAL A 1 16  ? -6.121  -3.742  5.777   1.00 0.00 ? 16  VAL A HG12 2  
ATOM 3420  H HG13 . VAL A 1 16  ? -7.563  -2.724  5.745   1.00 0.00 ? 16  VAL A HG13 2  
ATOM 3421  H HG21 . VAL A 1 16  ? -5.799  -2.692  2.594   1.00 0.00 ? 16  VAL A HG21 2  
ATOM 3422  H HG22 . VAL A 1 16  ? -6.210  -4.329  2.083   1.00 0.00 ? 16  VAL A HG22 2  
ATOM 3423  H HG23 . VAL A 1 16  ? -5.097  -4.079  3.422   1.00 0.00 ? 16  VAL A HG23 2  
ATOM 3424  N N    . PHE A 1 17  ? -6.940  -6.414  2.264   1.00 0.00 ? 17  PHE A N    2  
ATOM 3425  C CA   . PHE A 1 17  ? -7.102  -7.094  0.987   1.00 0.00 ? 17  PHE A CA   2  
ATOM 3426  C C    . PHE A 1 17  ? -7.670  -8.510  1.132   1.00 0.00 ? 17  PHE A C    2  
ATOM 3427  O O    . PHE A 1 17  ? -8.704  -8.818  0.542   1.00 0.00 ? 17  PHE A O    2  
ATOM 3428  C CB   . PHE A 1 17  ? -5.756  -7.144  0.248   1.00 0.00 ? 17  PHE A CB   2  
ATOM 3429  C CG   . PHE A 1 17  ? -5.664  -8.234  -0.787  1.00 0.00 ? 17  PHE A CG   2  
ATOM 3430  C CD1  . PHE A 1 17  ? -6.703  -8.455  -1.676  1.00 0.00 ? 17  PHE A CD1  2  
ATOM 3431  C CD2  . PHE A 1 17  ? -4.539  -9.041  -0.863  1.00 0.00 ? 17  PHE A CD2  2  
ATOM 3432  C CE1  . PHE A 1 17  ? -6.622  -9.459  -2.623  1.00 0.00 ? 17  PHE A CE1  2  
ATOM 3433  C CE2  . PHE A 1 17  ? -4.453  -10.047 -1.806  1.00 0.00 ? 17  PHE A CE2  2  
ATOM 3434  C CZ   . PHE A 1 17  ? -5.497  -10.256 -2.688  1.00 0.00 ? 17  PHE A CZ   2  
ATOM 3435  H H    . PHE A 1 17  ? -6.041  -6.372  2.679   1.00 0.00 ? 17  PHE A H    2  
ATOM 3436  H HA   . PHE A 1 17  ? -7.791  -6.512  0.398   1.00 0.00 ? 17  PHE A HA   2  
ATOM 3437  H HB2  . PHE A 1 17  ? -5.595  -6.201  -0.252  1.00 0.00 ? 17  PHE A HB2  2  
ATOM 3438  H HB3  . PHE A 1 17  ? -4.967  -7.301  0.968   1.00 0.00 ? 17  PHE A HB3  2  
ATOM 3439  H HD1  . PHE A 1 17  ? -7.584  -7.833  -1.627  1.00 0.00 ? 17  PHE A HD1  2  
ATOM 3440  H HD2  . PHE A 1 17  ? -3.723  -8.878  -0.174  1.00 0.00 ? 17  PHE A HD2  2  
ATOM 3441  H HE1  . PHE A 1 17  ? -7.440  -9.621  -3.310  1.00 0.00 ? 17  PHE A HE1  2  
ATOM 3442  H HE2  . PHE A 1 17  ? -3.571  -10.668 -1.855  1.00 0.00 ? 17  PHE A HE2  2  
ATOM 3443  H HZ   . PHE A 1 17  ? -5.432  -11.042 -3.426  1.00 0.00 ? 17  PHE A HZ   2  
ATOM 3444  N N    . GLN A 1 18  ? -6.982  -9.375  1.883   1.00 0.00 ? 18  GLN A N    2  
ATOM 3445  C CA   . GLN A 1 18  ? -7.420  -10.765 2.045   1.00 0.00 ? 18  GLN A CA   2  
ATOM 3446  C C    . GLN A 1 18  ? -8.679  -10.885 2.889   1.00 0.00 ? 18  GLN A C    2  
ATOM 3447  O O    . GLN A 1 18  ? -9.454  -11.827 2.720   1.00 0.00 ? 18  GLN A O    2  
ATOM 3448  C CB   . GLN A 1 18  ? -6.302  -11.629 2.633   1.00 0.00 ? 18  GLN A CB   2  
ATOM 3449  C CG   . GLN A 1 18  ? -5.450  -10.912 3.658   1.00 0.00 ? 18  GLN A CG   2  
ATOM 3450  C CD   . GLN A 1 18  ? -5.705  -11.398 5.055   1.00 0.00 ? 18  GLN A CD   2  
ATOM 3451  O OE1  . GLN A 1 18  ? -5.048  -12.316 5.548   1.00 0.00 ? 18  GLN A OE1  2  
ATOM 3452  N NE2  . GLN A 1 18  ? -6.673  -10.775 5.699   1.00 0.00 ? 18  GLN A NE2  2  
ATOM 3453  H H    . GLN A 1 18  ? -6.154  -9.082  2.323   1.00 0.00 ? 18  GLN A H    2  
ATOM 3454  H HA   . GLN A 1 18  ? -7.644  -11.140 1.062   1.00 0.00 ? 18  GLN A HA   2  
ATOM 3455  H HB2  . GLN A 1 18  ? -6.743  -12.494 3.106   1.00 0.00 ? 18  GLN A HB2  2  
ATOM 3456  H HB3  . GLN A 1 18  ? -5.658  -11.959 1.831   1.00 0.00 ? 18  GLN A HB3  2  
ATOM 3457  H HG2  . GLN A 1 18  ? -4.411  -11.058 3.420   1.00 0.00 ? 18  GLN A HG2  2  
ATOM 3458  H HG3  . GLN A 1 18  ? -5.685  -9.861  3.624   1.00 0.00 ? 18  GLN A HG3  2  
ATOM 3459  H HE21 . GLN A 1 18  ? -7.153  -10.054 5.232   1.00 0.00 ? 18  GLN A HE21 2  
ATOM 3460  H HE22 . GLN A 1 18  ? -6.859  -11.044 6.608   1.00 0.00 ? 18  GLN A HE22 2  
ATOM 3461  N N    . LYS A 1 19  ? -8.898  -9.937  3.792   1.00 0.00 ? 19  LYS A N    2  
ATOM 3462  C CA   . LYS A 1 19  ? -10.087 -9.972  4.634   1.00 0.00 ? 19  LYS A CA   2  
ATOM 3463  C C    . LYS A 1 19  ? -11.332 -10.016 3.761   1.00 0.00 ? 19  LYS A C    2  
ATOM 3464  O O    . LYS A 1 19  ? -12.196 -10.876 3.926   1.00 0.00 ? 19  LYS A O    2  
ATOM 3465  C CB   . LYS A 1 19  ? -10.133 -8.753  5.556   1.00 0.00 ? 19  LYS A CB   2  
ATOM 3466  C CG   . LYS A 1 19  ? -11.265 -8.802  6.569   1.00 0.00 ? 19  LYS A CG   2  
ATOM 3467  C CD   . LYS A 1 19  ? -11.076 -9.938  7.563   1.00 0.00 ? 19  LYS A CD   2  
ATOM 3468  C CE   . LYS A 1 19  ? -12.362 -10.724 7.771   1.00 0.00 ? 19  LYS A CE   2  
ATOM 3469  N NZ   . LYS A 1 19  ? -12.972 -10.448 9.101   1.00 0.00 ? 19  LYS A NZ   2  
ATOM 3470  H H    . LYS A 1 19  ? -8.258  -9.201  3.887   1.00 0.00 ? 19  LYS A H    2  
ATOM 3471  H HA   . LYS A 1 19  ? -10.045 -10.870 5.232   1.00 0.00 ? 19  LYS A HA   2  
ATOM 3472  H HB2  . LYS A 1 19  ? -9.200  -8.686  6.096   1.00 0.00 ? 19  LYS A HB2  2  
ATOM 3473  H HB3  . LYS A 1 19  ? -10.255 -7.864  4.955   1.00 0.00 ? 19  LYS A HB3  2  
ATOM 3474  H HG2  . LYS A 1 19  ? -11.295 -7.866  7.109   1.00 0.00 ? 19  LYS A HG2  2  
ATOM 3475  H HG3  . LYS A 1 19  ? -12.199 -8.945  6.044   1.00 0.00 ? 19  LYS A HG3  2  
ATOM 3476  H HD2  . LYS A 1 19  ? -10.316 -10.607 7.190   1.00 0.00 ? 19  LYS A HD2  2  
ATOM 3477  H HD3  . LYS A 1 19  ? -10.760 -9.525  8.510   1.00 0.00 ? 19  LYS A HD3  2  
ATOM 3478  H HE2  . LYS A 1 19  ? -13.066 -10.452 6.999   1.00 0.00 ? 19  LYS A HE2  2  
ATOM 3479  H HE3  . LYS A 1 19  ? -12.139 -11.779 7.699   1.00 0.00 ? 19  LYS A HE3  2  
ATOM 3480  H HZ1  . LYS A 1 19  ? -12.247 -10.111 9.765   1.00 0.00 ? 19  LYS A HZ1  2  
ATOM 3481  H HZ2  . LYS A 1 19  ? -13.401 -11.314 9.485   1.00 0.00 ? 19  LYS A HZ2  2  
ATOM 3482  H HZ3  . LYS A 1 19  ? -13.710 -9.720  9.011   1.00 0.00 ? 19  LYS A HZ3  2  
ATOM 3483  N N    . TYR A 1 20  ? -11.388 -9.099  2.803   1.00 0.00 ? 20  TYR A N    2  
ATOM 3484  C CA   . TYR A 1 20  ? -12.493 -9.036  1.861   1.00 0.00 ? 20  TYR A CA   2  
ATOM 3485  C C    . TYR A 1 20  ? -12.298 -10.088 0.779   1.00 0.00 ? 20  TYR A C    2  
ATOM 3486  O O    . TYR A 1 20  ? -13.255 -10.590 0.188   1.00 0.00 ? 20  TYR A O    2  
ATOM 3487  C CB   . TYR A 1 20  ? -12.580 -7.636  1.249   1.00 0.00 ? 20  TYR A CB   2  
ATOM 3488  C CG   . TYR A 1 20  ? -12.417 -6.524  2.268   1.00 0.00 ? 20  TYR A CG   2  
ATOM 3489  C CD1  . TYR A 1 20  ? -12.823 -6.699  3.587   1.00 0.00 ? 20  TYR A CD1  2  
ATOM 3490  C CD2  . TYR A 1 20  ? -11.858 -5.303  1.913   1.00 0.00 ? 20  TYR A CD2  2  
ATOM 3491  C CE1  . TYR A 1 20  ? -12.676 -5.691  4.520   1.00 0.00 ? 20  TYR A CE1  2  
ATOM 3492  C CE2  . TYR A 1 20  ? -11.707 -4.289  2.843   1.00 0.00 ? 20  TYR A CE2  2  
ATOM 3493  C CZ   . TYR A 1 20  ? -12.119 -4.489  4.144   1.00 0.00 ? 20  TYR A CZ   2  
ATOM 3494  O OH   . TYR A 1 20  ? -11.972 -3.483  5.071   1.00 0.00 ? 20  TYR A OH   2  
ATOM 3495  H H    . TYR A 1 20  ? -10.641 -8.470  2.701   1.00 0.00 ? 20  TYR A H    2  
ATOM 3496  H HA   . TYR A 1 20  ? -13.405 -9.248  2.399   1.00 0.00 ? 20  TYR A HA   2  
ATOM 3497  H HB2  . TYR A 1 20  ? -11.803 -7.524  0.508   1.00 0.00 ? 20  TYR A HB2  2  
ATOM 3498  H HB3  . TYR A 1 20  ? -13.543 -7.517  0.776   1.00 0.00 ? 20  TYR A HB3  2  
ATOM 3499  H HD1  . TYR A 1 20  ? -13.258 -7.644  3.880   1.00 0.00 ? 20  TYR A HD1  2  
ATOM 3500  H HD2  . TYR A 1 20  ? -11.537 -5.148  0.894   1.00 0.00 ? 20  TYR A HD2  2  
ATOM 3501  H HE1  . TYR A 1 20  ? -12.999 -5.848  5.540   1.00 0.00 ? 20  TYR A HE1  2  
ATOM 3502  H HE2  . TYR A 1 20  ? -11.271 -3.346  2.549   1.00 0.00 ? 20  TYR A HE2  2  
ATOM 3503  H HH   . TYR A 1 20  ? -11.039 -3.296  5.198   1.00 0.00 ? 20  TYR A HH   2  
ATOM 3504  N N    . ALA A 1 21  ? -11.031 -10.399 0.530   1.00 0.00 ? 21  ALA A N    2  
ATOM 3505  C CA   . ALA A 1 21  ? -10.639 -11.372 -0.474  1.00 0.00 ? 21  ALA A CA   2  
ATOM 3506  C C    . ALA A 1 21  ? -10.773 -12.808 0.036   1.00 0.00 ? 21  ALA A C    2  
ATOM 3507  O O    . ALA A 1 21  ? -10.447 -13.757 -0.677  1.00 0.00 ? 21  ALA A O    2  
ATOM 3508  C CB   . ALA A 1 21  ? -9.210  -11.082 -0.897  1.00 0.00 ? 21  ALA A CB   2  
ATOM 3509  H H    . ALA A 1 21  ? -10.327 -9.947  1.039   1.00 0.00 ? 21  ALA A H    2  
ATOM 3510  H HA   . ALA A 1 21  ? -11.274 -11.246 -1.334  1.00 0.00 ? 21  ALA A HA   2  
ATOM 3511  H HB1  . ALA A 1 21  ? -8.700  -10.573 -0.088  1.00 0.00 ? 21  ALA A HB1  2  
ATOM 3512  H HB2  . ALA A 1 21  ? -9.215  -10.448 -1.775  1.00 0.00 ? 21  ALA A HB2  2  
ATOM 3513  H HB3  . ALA A 1 21  ? -8.700  -12.006 -1.120  1.00 0.00 ? 21  ALA A HB3  2  
ATOM 3514  N N    . GLY A 1 22  ? -11.256 -12.965 1.266   1.00 0.00 ? 22  GLY A N    2  
ATOM 3515  C CA   . GLY A 1 22  ? -11.423 -14.292 1.830   1.00 0.00 ? 22  GLY A CA   2  
ATOM 3516  C C    . GLY A 1 22  ? -10.219 -14.739 2.637   1.00 0.00 ? 22  GLY A C    2  
ATOM 3517  O O    . GLY A 1 22  ? -9.078  -14.464 2.267   1.00 0.00 ? 22  GLY A O    2  
ATOM 3518  H H    . GLY A 1 22  ? -11.505 -12.179 1.793   1.00 0.00 ? 22  GLY A H    2  
ATOM 3519  H HA2  . GLY A 1 22  ? -12.291 -14.292 2.472   1.00 0.00 ? 22  GLY A HA2  2  
ATOM 3520  H HA3  . GLY A 1 22  ? -11.584 -14.995 1.026   1.00 0.00 ? 22  GLY A HA3  2  
ATOM 3521  N N    . LYS A 1 23  ? -10.477 -15.431 3.743   1.00 0.00 ? 23  LYS A N    2  
ATOM 3522  C CA   . LYS A 1 23  ? -9.408  -15.919 4.606   1.00 0.00 ? 23  LYS A CA   2  
ATOM 3523  C C    . LYS A 1 23  ? -9.320  -17.442 4.553   1.00 0.00 ? 23  LYS A C    2  
ATOM 3524  O O    . LYS A 1 23  ? -8.239  -18.016 4.681   1.00 0.00 ? 23  LYS A O    2  
ATOM 3525  C CB   . LYS A 1 23  ? -9.639  -15.461 6.048   1.00 0.00 ? 23  LYS A CB   2  
ATOM 3526  C CG   . LYS A 1 23  ? -8.360  -15.345 6.861   1.00 0.00 ? 23  LYS A CG   2  
ATOM 3527  C CD   . LYS A 1 23  ? -8.534  -15.916 8.261   1.00 0.00 ? 23  LYS A CD   2  
ATOM 3528  C CE   . LYS A 1 23  ? -8.002  -14.964 9.321   1.00 0.00 ? 23  LYS A CE   2  
ATOM 3529  N NZ   . LYS A 1 23  ? -6.544  -14.711 9.161   1.00 0.00 ? 23  LYS A NZ   2  
ATOM 3530  H H    . LYS A 1 23  ? -11.408 -15.617 3.983   1.00 0.00 ? 23  LYS A H    2  
ATOM 3531  H HA   . LYS A 1 23  ? -8.478  -15.505 4.251   1.00 0.00 ? 23  LYS A HA   2  
ATOM 3532  H HB2  . LYS A 1 23  ? -10.121 -14.495 6.033   1.00 0.00 ? 23  LYS A HB2  2  
ATOM 3533  H HB3  . LYS A 1 23  ? -10.291 -16.170 6.537   1.00 0.00 ? 23  LYS A HB3  2  
ATOM 3534  H HG2  . LYS A 1 23  ? -7.575  -15.889 6.358   1.00 0.00 ? 23  LYS A HG2  2  
ATOM 3535  H HG3  . LYS A 1 23  ? -8.087  -14.303 6.937   1.00 0.00 ? 23  LYS A HG3  2  
ATOM 3536  H HD2  . LYS A 1 23  ? -9.584  -16.089 8.442   1.00 0.00 ? 23  LYS A HD2  2  
ATOM 3537  H HD3  . LYS A 1 23  ? -7.996  -16.850 8.327   1.00 0.00 ? 23  LYS A HD3  2  
ATOM 3538  H HE2  . LYS A 1 23  ? -8.531  -14.026 9.243   1.00 0.00 ? 23  LYS A HE2  2  
ATOM 3539  H HE3  . LYS A 1 23  ? -8.180  -15.396 10.296  1.00 0.00 ? 23  LYS A HE3  2  
ATOM 3540  H HZ1  . LYS A 1 23  ? -6.387  -13.949 8.471   1.00 0.00 ? 23  LYS A HZ1  2  
ATOM 3541  H HZ2  . LYS A 1 23  ? -6.067  -15.572 8.824   1.00 0.00 ? 23  LYS A HZ2  2  
ATOM 3542  H HZ3  . LYS A 1 23  ? -6.127  -14.432 10.072  1.00 0.00 ? 23  LYS A HZ3  2  
ATOM 3543  N N    . ASP A 1 24  ? -10.465 -18.089 4.363   1.00 0.00 ? 24  ASP A N    2  
ATOM 3544  C CA   . ASP A 1 24  ? -10.518 -19.545 4.293   1.00 0.00 ? 24  ASP A CA   2  
ATOM 3545  C C    . ASP A 1 24  ? -10.582 -20.019 2.845   1.00 0.00 ? 24  ASP A C    2  
ATOM 3546  O O    . ASP A 1 24  ? -11.461 -19.610 2.086   1.00 0.00 ? 24  ASP A O    2  
ATOM 3547  C CB   . ASP A 1 24  ? -11.728 -20.070 5.067   1.00 0.00 ? 24  ASP A CB   2  
ATOM 3548  C CG   . ASP A 1 24  ? -11.450 -20.209 6.551   1.00 0.00 ? 24  ASP A CG   2  
ATOM 3549  O OD1  . ASP A 1 24  ? -11.502 -19.183 7.262   1.00 0.00 ? 24  ASP A OD1  2  
ATOM 3550  O OD2  . ASP A 1 24  ? -11.181 -21.341 7.002   1.00 0.00 ? 24  ASP A OD2  2  
ATOM 3551  H H    . ASP A 1 24  ? -11.295 -17.577 4.268   1.00 0.00 ? 24  ASP A H    2  
ATOM 3552  H HA   . ASP A 1 24  ? -9.617  -19.932 4.746   1.00 0.00 ? 24  ASP A HA   2  
ATOM 3553  H HB2  . ASP A 1 24  ? -12.554 -19.389 4.937   1.00 0.00 ? 24  ASP A HB2  2  
ATOM 3554  H HB3  . ASP A 1 24  ? -12.002 -21.040 4.678   1.00 0.00 ? 24  ASP A HB3  2  
ATOM 3555  N N    . GLY A 1 25  ? -9.646  -20.883 2.468   1.00 0.00 ? 25  GLY A N    2  
ATOM 3556  C CA   . GLY A 1 25  ? -9.614  -21.399 1.112   1.00 0.00 ? 25  GLY A CA   2  
ATOM 3557  C C    . GLY A 1 25  ? -8.540  -20.743 0.266   1.00 0.00 ? 25  GLY A C    2  
ATOM 3558  O O    . GLY A 1 25  ? -7.996  -21.364 -0.647  1.00 0.00 ? 25  GLY A O    2  
ATOM 3559  H H    . GLY A 1 25  ? -8.971  -21.175 3.116   1.00 0.00 ? 25  GLY A H    2  
ATOM 3560  H HA2  . GLY A 1 25  ? -9.431  -22.463 1.147   1.00 0.00 ? 25  GLY A HA2  2  
ATOM 3561  H HA3  . GLY A 1 25  ? -10.575 -21.225 0.650   1.00 0.00 ? 25  GLY A HA3  2  
ATOM 3562  N N    . HIS A 1 26  ? -8.234  -19.486 0.570   1.00 0.00 ? 26  HIS A N    2  
ATOM 3563  C CA   . HIS A 1 26  ? -7.217  -18.746 -0.169  1.00 0.00 ? 26  HIS A CA   2  
ATOM 3564  C C    . HIS A 1 26  ? -7.604  -18.610 -1.639  1.00 0.00 ? 26  HIS A C    2  
ATOM 3565  O O    . HIS A 1 26  ? -7.644  -19.597 -2.374  1.00 0.00 ? 26  HIS A O    2  
ATOM 3566  C CB   . HIS A 1 26  ? -5.860  -19.443 -0.049  1.00 0.00 ? 26  HIS A CB   2  
ATOM 3567  C CG   . HIS A 1 26  ? -5.325  -19.475 1.350   1.00 0.00 ? 26  HIS A CG   2  
ATOM 3568  N ND1  . HIS A 1 26  ? -6.057  -19.932 2.425   1.00 0.00 ? 26  HIS A ND1  2  
ATOM 3569  C CD2  . HIS A 1 26  ? -4.121  -19.104 1.846   1.00 0.00 ? 26  HIS A CD2  2  
ATOM 3570  C CE1  . HIS A 1 26  ? -5.328  -19.840 3.523   1.00 0.00 ? 26  HIS A CE1  2  
ATOM 3571  N NE2  . HIS A 1 26  ? -4.149  -19.341 3.199   1.00 0.00 ? 26  HIS A NE2  2  
ATOM 3572  H H    . HIS A 1 26  ? -8.702  -19.045 1.310   1.00 0.00 ? 26  HIS A H    2  
ATOM 3573  H HA   . HIS A 1 26  ? -7.144  -17.760 0.264   1.00 0.00 ? 26  HIS A HA   2  
ATOM 3574  H HB2  . HIS A 1 26  ? -5.955  -20.463 -0.391  1.00 0.00 ? 26  HIS A HB2  2  
ATOM 3575  H HB3  . HIS A 1 26  ? -5.141  -18.928 -0.669  1.00 0.00 ? 26  HIS A HB3  2  
ATOM 3576  H HD1  . HIS A 1 26  ? -6.975  -20.272 2.390   1.00 0.00 ? 26  HIS A HD1  2  
ATOM 3577  H HD2  . HIS A 1 26  ? -3.294  -18.697 1.283   1.00 0.00 ? 26  HIS A HD2  2  
ATOM 3578  H HE1  . HIS A 1 26  ? -5.642  -20.124 4.517   1.00 0.00 ? 26  HIS A HE1  2  
ATOM 3579  H HE2  . HIS A 1 26  ? -3.449  -19.085 3.836   1.00 0.00 ? 26  HIS A HE2  2  
ATOM 3580  N N    . SER A 1 27  ? -7.890  -17.382 -2.059  1.00 0.00 ? 27  SER A N    2  
ATOM 3581  C CA   . SER A 1 27  ? -8.275  -17.116 -3.440  1.00 0.00 ? 27  SER A CA   2  
ATOM 3582  C C    . SER A 1 27  ? -7.176  -16.359 -4.180  1.00 0.00 ? 27  SER A C    2  
ATOM 3583  O O    . SER A 1 27  ? -7.040  -16.481 -5.398  1.00 0.00 ? 27  SER A O    2  
ATOM 3584  C CB   . SER A 1 27  ? -9.578  -16.314 -3.483  1.00 0.00 ? 27  SER A CB   2  
ATOM 3585  O OG   . SER A 1 27  ? -10.700 -17.152 -3.265  1.00 0.00 ? 27  SER A OG   2  
ATOM 3586  H H    . SER A 1 27  ? -7.841  -16.637 -1.425  1.00 0.00 ? 27  SER A H    2  
ATOM 3587  H HA   . SER A 1 27  ? -8.434  -18.066 -3.929  1.00 0.00 ? 27  SER A HA   2  
ATOM 3588  H HB2  . SER A 1 27  ? -9.556  -15.557 -2.714  1.00 0.00 ? 27  SER A HB2  2  
ATOM 3589  H HB3  . SER A 1 27  ? -9.677  -15.844 -4.450  1.00 0.00 ? 27  SER A HB3  2  
ATOM 3590  H HG   . SER A 1 27  ? -11.336 -16.696 -2.709  1.00 0.00 ? 27  SER A HG   2  
ATOM 3591  N N    . VAL A 1 28  ? -6.396  -15.577 -3.434  1.00 0.00 ? 28  VAL A N    2  
ATOM 3592  C CA   . VAL A 1 28  ? -5.301  -14.790 -4.007  1.00 0.00 ? 28  VAL A CA   2  
ATOM 3593  C C    . VAL A 1 28  ? -5.802  -13.483 -4.623  1.00 0.00 ? 28  VAL A C    2  
ATOM 3594  O O    . VAL A 1 28  ? -5.006  -12.639 -5.033  1.00 0.00 ? 28  VAL A O    2  
ATOM 3595  C CB   . VAL A 1 28  ? -4.518  -15.579 -5.077  1.00 0.00 ? 28  VAL A CB   2  
ATOM 3596  C CG1  . VAL A 1 28  ? -3.196  -14.896 -5.381  1.00 0.00 ? 28  VAL A CG1  2  
ATOM 3597  C CG2  . VAL A 1 28  ? -4.294  -17.016 -4.628  1.00 0.00 ? 28  VAL A CG2  2  
ATOM 3598  H H    . VAL A 1 28  ? -6.561  -15.524 -2.470  1.00 0.00 ? 28  VAL A H    2  
ATOM 3599  H HA   . VAL A 1 28  ? -4.618  -14.550 -3.205  1.00 0.00 ? 28  VAL A HA   2  
ATOM 3600  H HB   . VAL A 1 28  ? -5.105  -15.596 -5.985  1.00 0.00 ? 28  VAL A HB   2  
ATOM 3601  H HG11 . VAL A 1 28  ? -3.382  -13.950 -5.867  1.00 0.00 ? 28  VAL A HG11 2  
ATOM 3602  H HG12 . VAL A 1 28  ? -2.607  -15.526 -6.033  1.00 0.00 ? 28  VAL A HG12 2  
ATOM 3603  H HG13 . VAL A 1 28  ? -2.657  -14.727 -4.461  1.00 0.00 ? 28  VAL A HG13 2  
ATOM 3604  H HG21 . VAL A 1 28  ? -4.330  -17.065 -3.550  1.00 0.00 ? 28  VAL A HG21 2  
ATOM 3605  H HG22 . VAL A 1 28  ? -3.328  -17.355 -4.971  1.00 0.00 ? 28  VAL A HG22 2  
ATOM 3606  H HG23 . VAL A 1 28  ? -5.066  -17.647 -5.043  1.00 0.00 ? 28  VAL A HG23 2  
ATOM 3607  N N    . THR A 1 29  ? -7.121  -13.317 -4.684  1.00 0.00 ? 29  THR A N    2  
ATOM 3608  C CA   . THR A 1 29  ? -7.713  -12.110 -5.244  1.00 0.00 ? 29  THR A CA   2  
ATOM 3609  C C    . THR A 1 29  ? -8.909  -11.658 -4.414  1.00 0.00 ? 29  THR A C    2  
ATOM 3610  O O    . THR A 1 29  ? -9.254  -12.282 -3.412  1.00 0.00 ? 29  THR A O    2  
ATOM 3611  C CB   . THR A 1 29  ? -8.136  -12.343 -6.694  1.00 0.00 ? 29  THR A CB   2  
ATOM 3612  O OG1  . THR A 1 29  ? -8.705  -13.630 -6.852  1.00 0.00 ? 29  THR A OG1  2  
ATOM 3613  C CG2  . THR A 1 29  ? -6.990  -12.220 -7.676  1.00 0.00 ? 29  THR A CG2  2  
ATOM 3614  H H    . THR A 1 29  ? -7.710  -14.017 -4.340  1.00 0.00 ? 29  THR A H    2  
ATOM 3615  H HA   . THR A 1 29  ? -6.966  -11.333 -5.223  1.00 0.00 ? 29  THR A HA   2  
ATOM 3616  H HB   . THR A 1 29  ? -8.879  -11.607 -6.962  1.00 0.00 ? 29  THR A HB   2  
ATOM 3617  H HG1  . THR A 1 29  ? -9.326  -13.796 -6.139  1.00 0.00 ? 29  THR A HG1  2  
ATOM 3618  H HG21 . THR A 1 29  ? -6.706  -11.181 -7.771  1.00 0.00 ? 29  THR A HG21 2  
ATOM 3619  H HG22 . THR A 1 29  ? -7.298  -12.598 -8.638  1.00 0.00 ? 29  THR A HG22 2  
ATOM 3620  H HG23 . THR A 1 29  ? -6.146  -12.791 -7.317  1.00 0.00 ? 29  THR A HG23 2  
ATOM 3621  N N    . LEU A 1 30  ? -9.530  -10.566 -4.837  1.00 0.00 ? 30  LEU A N    2  
ATOM 3622  C CA   . LEU A 1 30  ? -10.684 -10.019 -4.135  1.00 0.00 ? 30  LEU A CA   2  
ATOM 3623  C C    . LEU A 1 30  ? -11.817 -9.710  -5.125  1.00 0.00 ? 30  LEU A C    2  
ATOM 3624  O O    . LEU A 1 30  ? -12.245 -10.589 -5.870  1.00 0.00 ? 30  LEU A O    2  
ATOM 3625  C CB   . LEU A 1 30  ? -10.264 -8.763  -3.353  1.00 0.00 ? 30  LEU A CB   2  
ATOM 3626  C CG   . LEU A 1 30  ? -11.179 -8.346  -2.186  1.00 0.00 ? 30  LEU A CG   2  
ATOM 3627  C CD1  . LEU A 1 30  ? -11.468 -6.854  -2.242  1.00 0.00 ? 30  LEU A CD1  2  
ATOM 3628  C CD2  . LEU A 1 30  ? -12.484 -9.132  -2.182  1.00 0.00 ? 30  LEU A CD2  2  
ATOM 3629  H H    . LEU A 1 30  ? -9.200  -10.115 -5.641  1.00 0.00 ? 30  LEU A H    2  
ATOM 3630  H HA   . LEU A 1 30  ? -11.028 -10.769 -3.441  1.00 0.00 ? 30  LEU A HA   2  
ATOM 3631  H HB2  . LEU A 1 30  ? -9.276  -8.935  -2.954  1.00 0.00 ? 30  LEU A HB2  2  
ATOM 3632  H HB3  . LEU A 1 30  ? -10.206 -7.938  -4.046  1.00 0.00 ? 30  LEU A HB3  2  
ATOM 3633  H HG   . LEU A 1 30  ? -10.668 -8.546  -1.254  1.00 0.00 ? 30  LEU A HG   2  
ATOM 3634  H HD11 . LEU A 1 30  ? -11.754 -6.505  -1.259  1.00 0.00 ? 30  LEU A HD11 2  
ATOM 3635  H HD12 . LEU A 1 30  ? -12.273 -6.670  -2.937  1.00 0.00 ? 30  LEU A HD12 2  
ATOM 3636  H HD13 . LEU A 1 30  ? -10.582 -6.328  -2.567  1.00 0.00 ? 30  LEU A HD13 2  
ATOM 3637  H HD21 . LEU A 1 30  ? -13.076 -8.852  -3.039  1.00 0.00 ? 30  LEU A HD21 2  
ATOM 3638  H HD22 . LEU A 1 30  ? -13.033 -8.912  -1.279  1.00 0.00 ? 30  LEU A HD22 2  
ATOM 3639  H HD23 . LEU A 1 30  ? -12.268 -10.186 -2.222  1.00 0.00 ? 30  LEU A HD23 2  
ATOM 3640  N N    . SER A 1 31  ? -12.295 -8.464  -5.138  1.00 0.00 ? 31  SER A N    2  
ATOM 3641  C CA   . SER A 1 31  ? -13.361 -8.058  -6.044  1.00 0.00 ? 31  SER A CA   2  
ATOM 3642  C C    . SER A 1 31  ? -13.589 -6.553  -5.945  1.00 0.00 ? 31  SER A C    2  
ATOM 3643  O O    . SER A 1 31  ? -13.781 -6.015  -4.855  1.00 0.00 ? 31  SER A O    2  
ATOM 3644  C CB   . SER A 1 31  ? -14.651 -8.816  -5.727  1.00 0.00 ? 31  SER A CB   2  
ATOM 3645  O OG   . SER A 1 31  ? -15.730 -8.343  -6.516  1.00 0.00 ? 31  SER A OG   2  
ATOM 3646  H H    . SER A 1 31  ? -11.922 -7.798  -4.529  1.00 0.00 ? 31  SER A H    2  
ATOM 3647  H HA   . SER A 1 31  ? -13.050 -8.297  -7.050  1.00 0.00 ? 31  SER A HA   2  
ATOM 3648  H HB2  . SER A 1 31  ? -14.508 -9.866  -5.932  1.00 0.00 ? 31  SER A HB2  2  
ATOM 3649  H HB3  . SER A 1 31  ? -14.898 -8.686  -4.686  1.00 0.00 ? 31  SER A HB3  2  
ATOM 3650  H HG   . SER A 1 31  ? -16.003 -7.480  -6.200  1.00 0.00 ? 31  SER A HG   2  
ATOM 3651  N N    . LYS A 1 32  ? -13.550 -5.877  -7.089  1.00 0.00 ? 32  LYS A N    2  
ATOM 3652  C CA   . LYS A 1 32  ? -13.734 -4.428  -7.130  1.00 0.00 ? 32  LYS A CA   2  
ATOM 3653  C C    . LYS A 1 32  ? -14.976 -4.002  -6.354  1.00 0.00 ? 32  LYS A C    2  
ATOM 3654  O O    . LYS A 1 32  ? -14.986 -2.952  -5.709  1.00 0.00 ? 32  LYS A O    2  
ATOM 3655  C CB   . LYS A 1 32  ? -13.836 -3.950  -8.580  1.00 0.00 ? 32  LYS A CB   2  
ATOM 3656  C CG   . LYS A 1 32  ? -14.961 -4.610  -9.361  1.00 0.00 ? 32  LYS A CG   2  
ATOM 3657  C CD   . LYS A 1 32  ? -15.051 -4.066  -10.778 1.00 0.00 ? 32  LYS A CD   2  
ATOM 3658  C CE   . LYS A 1 32  ? -15.520 -2.619  -10.793 1.00 0.00 ? 32  LYS A CE   2  
ATOM 3659  N NZ   . LYS A 1 32  ? -14.680 -1.772  -11.684 1.00 0.00 ? 32  LYS A NZ   2  
ATOM 3660  H H    . LYS A 1 32  ? -13.381 -6.360  -7.923  1.00 0.00 ? 32  LYS A H    2  
ATOM 3661  H HA   . LYS A 1 32  ? -12.866 -3.974  -6.674  1.00 0.00 ? 32  LYS A HA   2  
ATOM 3662  H HB2  . LYS A 1 32  ? -14.001 -2.883  -8.584  1.00 0.00 ? 32  LYS A HB2  2  
ATOM 3663  H HB3  . LYS A 1 32  ? -12.905 -4.164  -9.083  1.00 0.00 ? 32  LYS A HB3  2  
ATOM 3664  H HG2  . LYS A 1 32  ? -14.780 -5.673  -9.406  1.00 0.00 ? 32  LYS A HG2  2  
ATOM 3665  H HG3  . LYS A 1 32  ? -15.896 -4.425  -8.853  1.00 0.00 ? 32  LYS A HG3  2  
ATOM 3666  H HD2  . LYS A 1 32  ? -14.075 -4.121  -11.238 1.00 0.00 ? 32  LYS A HD2  2  
ATOM 3667  H HD3  . LYS A 1 32  ? -15.750 -4.667  -11.340 1.00 0.00 ? 32  LYS A HD3  2  
ATOM 3668  H HE2  . LYS A 1 32  ? -16.542 -2.589  -11.142 1.00 0.00 ? 32  LYS A HE2  2  
ATOM 3669  H HE3  . LYS A 1 32  ? -15.472 -2.226  -9.788  1.00 0.00 ? 32  LYS A HE3  2  
ATOM 3670  H HZ1  . LYS A 1 32  ? -15.085 -1.749  -12.642 1.00 0.00 ? 32  LYS A HZ1  2  
ATOM 3671  H HZ2  . LYS A 1 32  ? -13.716 -2.157  -11.737 1.00 0.00 ? 32  LYS A HZ2  2  
ATOM 3672  H HZ3  . LYS A 1 32  ? -14.634 -0.801  -11.315 1.00 0.00 ? 32  LYS A HZ3  2  
ATOM 3673  N N    . THR A 1 33  ? -16.020 -4.819  -6.419  1.00 0.00 ? 33  THR A N    2  
ATOM 3674  C CA   . THR A 1 33  ? -17.261 -4.527  -5.726  1.00 0.00 ? 33  THR A CA   2  
ATOM 3675  C C    . THR A 1 33  ? -17.118 -4.758  -4.222  1.00 0.00 ? 33  THR A C    2  
ATOM 3676  O O    . THR A 1 33  ? -17.585 -3.955  -3.418  1.00 0.00 ? 33  THR A O    2  
ATOM 3677  C CB   . THR A 1 33  ? -18.391 -5.384  -6.300  1.00 0.00 ? 33  THR A CB   2  
ATOM 3678  O OG1  . THR A 1 33  ? -18.993 -4.741  -7.409  1.00 0.00 ? 33  THR A OG1  2  
ATOM 3679  C CG2  . THR A 1 33  ? -19.480 -5.689  -5.301  1.00 0.00 ? 33  THR A CG2  2  
ATOM 3680  H H    . THR A 1 33  ? -15.956 -5.638  -6.946  1.00 0.00 ? 33  THR A H    2  
ATOM 3681  H HA   . THR A 1 33  ? -17.493 -3.486  -5.894  1.00 0.00 ? 33  THR A HA   2  
ATOM 3682  H HB   . THR A 1 33  ? -17.978 -6.323  -6.638  1.00 0.00 ? 33  THR A HB   2  
ATOM 3683  H HG1  . THR A 1 33  ? -18.312 -4.450  -8.020  1.00 0.00 ? 33  THR A HG1  2  
ATOM 3684  H HG21 . THR A 1 33  ? -20.276 -6.231  -5.787  1.00 0.00 ? 33  THR A HG21 2  
ATOM 3685  H HG22 . THR A 1 33  ? -19.862 -4.763  -4.898  1.00 0.00 ? 33  THR A HG22 2  
ATOM 3686  H HG23 . THR A 1 33  ? -19.069 -6.287  -4.501  1.00 0.00 ? 33  THR A HG23 2  
ATOM 3687  N N    . GLU A 1 34  ? -16.472 -5.854  -3.835  1.00 0.00 ? 34  GLU A N    2  
ATOM 3688  C CA   . GLU A 1 34  ? -16.288 -6.148  -2.418  1.00 0.00 ? 34  GLU A CA   2  
ATOM 3689  C C    . GLU A 1 34  ? -15.593 -4.984  -1.727  1.00 0.00 ? 34  GLU A C    2  
ATOM 3690  O O    . GLU A 1 34  ? -15.805 -4.731  -0.542  1.00 0.00 ? 34  GLU A O    2  
ATOM 3691  C CB   . GLU A 1 34  ? -15.481 -7.432  -2.229  1.00 0.00 ? 34  GLU A CB   2  
ATOM 3692  C CG   . GLU A 1 34  ? -16.322 -8.601  -1.747  1.00 0.00 ? 34  GLU A CG   2  
ATOM 3693  C CD   . GLU A 1 34  ? -16.186 -9.825  -2.631  1.00 0.00 ? 34  GLU A CD   2  
ATOM 3694  O OE1  . GLU A 1 34  ? -15.231 -10.604 -2.423  1.00 0.00 ? 34  GLU A OE1  2  
ATOM 3695  O OE2  . GLU A 1 34  ? -17.034 -10.006 -3.531  1.00 0.00 ? 34  GLU A OE2  2  
ATOM 3696  H H    . GLU A 1 34  ? -16.112 -6.469  -4.508  1.00 0.00 ? 34  GLU A H    2  
ATOM 3697  H HA   . GLU A 1 34  ? -17.266 -6.279  -1.978  1.00 0.00 ? 34  GLU A HA   2  
ATOM 3698  H HB2  . GLU A 1 34  ? -15.029 -7.701  -3.170  1.00 0.00 ? 34  GLU A HB2  2  
ATOM 3699  H HB3  . GLU A 1 34  ? -14.701 -7.254  -1.503  1.00 0.00 ? 34  GLU A HB3  2  
ATOM 3700  H HG2  . GLU A 1 34  ? -16.013 -8.861  -0.746  1.00 0.00 ? 34  GLU A HG2  2  
ATOM 3701  H HG3  . GLU A 1 34  ? -17.359 -8.296  -1.734  1.00 0.00 ? 34  GLU A HG3  2  
ATOM 3702  N N    . PHE A 1 35  ? -14.776 -4.267  -2.489  1.00 0.00 ? 35  PHE A N    2  
ATOM 3703  C CA   . PHE A 1 35  ? -14.059 -3.113  -1.966  1.00 0.00 ? 35  PHE A CA   2  
ATOM 3704  C C    . PHE A 1 35  ? -15.027 -1.949  -1.759  1.00 0.00 ? 35  PHE A C    2  
ATOM 3705  O O    . PHE A 1 35  ? -14.832 -1.110  -0.881  1.00 0.00 ? 35  PHE A O    2  
ATOM 3706  C CB   . PHE A 1 35  ? -12.935 -2.708  -2.927  1.00 0.00 ? 35  PHE A CB   2  
ATOM 3707  C CG   . PHE A 1 35  ? -11.684 -2.238  -2.239  1.00 0.00 ? 35  PHE A CG   2  
ATOM 3708  C CD1  . PHE A 1 35  ? -11.750 -1.425  -1.118  1.00 0.00 ? 35  PHE A CD1  2  
ATOM 3709  C CD2  . PHE A 1 35  ? -10.439 -2.604  -2.721  1.00 0.00 ? 35  PHE A CD2  2  
ATOM 3710  C CE1  . PHE A 1 35  ? -10.597 -0.989  -0.492  1.00 0.00 ? 35  PHE A CE1  2  
ATOM 3711  C CE2  . PHE A 1 35  ? -9.284  -2.170  -2.101  1.00 0.00 ? 35  PHE A CE2  2  
ATOM 3712  C CZ   . PHE A 1 35  ? -9.363  -1.361  -0.985  1.00 0.00 ? 35  PHE A CZ   2  
ATOM 3713  H H    . PHE A 1 35  ? -14.664 -4.512  -3.430  1.00 0.00 ? 35  PHE A H    2  
ATOM 3714  H HA   . PHE A 1 35  ? -13.632 -3.388  -1.014  1.00 0.00 ? 35  PHE A HA   2  
ATOM 3715  H HB2  . PHE A 1 35  ? -12.670 -3.559  -3.540  1.00 0.00 ? 35  PHE A HB2  2  
ATOM 3716  H HB3  . PHE A 1 35  ? -13.286 -1.910  -3.563  1.00 0.00 ? 35  PHE A HB3  2  
ATOM 3717  H HD1  . PHE A 1 35  ? -12.713 -1.132  -0.731  1.00 0.00 ? 35  PHE A HD1  2  
ATOM 3718  H HD2  . PHE A 1 35  ? -10.376 -3.239  -3.593  1.00 0.00 ? 35  PHE A HD2  2  
ATOM 3719  H HE1  . PHE A 1 35  ? -10.662 -0.358  0.381   1.00 0.00 ? 35  PHE A HE1  2  
ATOM 3720  H HE2  . PHE A 1 35  ? -8.320  -2.464  -2.488  1.00 0.00 ? 35  PHE A HE2  2  
ATOM 3721  H HZ   . PHE A 1 35  ? -8.462  -1.020  -0.499  1.00 0.00 ? 35  PHE A HZ   2  
ATOM 3722  N N    . LEU A 1 36  ? -16.078 -1.911  -2.576  1.00 0.00 ? 36  LEU A N    2  
ATOM 3723  C CA   . LEU A 1 36  ? -17.082 -0.859  -2.488  1.00 0.00 ? 36  LEU A CA   2  
ATOM 3724  C C    . LEU A 1 36  ? -17.733 -0.828  -1.127  1.00 0.00 ? 36  LEU A C    2  
ATOM 3725  O O    . LEU A 1 36  ? -17.717 0.186   -0.428  1.00 0.00 ? 36  LEU A O    2  
ATOM 3726  C CB   . LEU A 1 36  ? -18.178 -1.107  -3.517  1.00 0.00 ? 36  LEU A CB   2  
ATOM 3727  C CG   . LEU A 1 36  ? -18.012 -0.349  -4.807  1.00 0.00 ? 36  LEU A CG   2  
ATOM 3728  C CD1  . LEU A 1 36  ? -17.978 1.141   -4.524  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 3729  C CD2  . LEU A 1 36  ? -16.752 -0.814  -5.514  1.00 0.00 ? 36  LEU A CD2  2  
ATOM 3730  H H    . LEU A 1 36  ? -16.183 -2.609  -3.256  1.00 0.00 ? 36  LEU A H    2  
ATOM 3731  H HA   . LEU A 1 36  ? -16.610 0.088   -2.688  1.00 0.00 ? 36  LEU A HA   2  
ATOM 3732  H HB2  . LEU A 1 36  ? -18.204 -2.159  -3.742  1.00 0.00 ? 36  LEU A HB2  2  
ATOM 3733  H HB3  . LEU A 1 36  ? -19.125 -0.826  -3.082  1.00 0.00 ? 36  LEU A HB3  2  
ATOM 3734  H HG   . LEU A 1 36  ? -18.853 -0.559  -5.440  1.00 0.00 ? 36  LEU A HG   2  
ATOM 3735  H HD11 . LEU A 1 36  ? -16.979 1.517   -4.686  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 3736  H HD12 . LEU A 1 36  ? -18.265 1.312   -3.492  1.00 0.00 ? 36  LEU A HD12 2  
ATOM 3737  H HD13 . LEU A 1 36  ? -18.669 1.648   -5.180  1.00 0.00 ? 36  LEU A HD13 2  
ATOM 3738  H HD21 . LEU A 1 36  ? -17.001 -1.606  -6.204  1.00 0.00 ? 36  LEU A HD21 2  
ATOM 3739  H HD22 . LEU A 1 36  ? -16.050 -1.186  -4.780  1.00 0.00 ? 36  LEU A HD22 2  
ATOM 3740  H HD23 . LEU A 1 36  ? -16.312 0.013   -6.051  1.00 0.00 ? 36  LEU A HD23 2  
ATOM 3741  N N    . SER A 1 37  ? -18.340 -1.944  -0.780  1.00 0.00 ? 37  SER A N    2  
ATOM 3742  C CA   . SER A 1 37  ? -19.046 -2.058  0.478   1.00 0.00 ? 37  SER A CA   2  
ATOM 3743  C C    . SER A 1 37  ? -18.086 -2.020  1.662   1.00 0.00 ? 37  SER A C    2  
ATOM 3744  O O    . SER A 1 37  ? -18.285 -1.259  2.610   1.00 0.00 ? 37  SER A O    2  
ATOM 3745  C CB   . SER A 1 37  ? -19.872 -3.346  0.514   1.00 0.00 ? 37  SER A CB   2  
ATOM 3746  O OG   . SER A 1 37  ? -20.630 -3.432  1.708   1.00 0.00 ? 37  SER A OG   2  
ATOM 3747  H H    . SER A 1 37  ? -18.334 -2.701  -1.406  1.00 0.00 ? 37  SER A H    2  
ATOM 3748  H HA   . SER A 1 37  ? -19.714 -1.213  0.537   1.00 0.00 ? 37  SER A HA   2  
ATOM 3749  H HB2  . SER A 1 37  ? -20.547 -3.361  -0.328  1.00 0.00 ? 37  SER A HB2  2  
ATOM 3750  H HB3  . SER A 1 37  ? -19.209 -4.197  0.460   1.00 0.00 ? 37  SER A HB3  2  
ATOM 3751  H HG   . SER A 1 37  ? -20.974 -4.324  1.805   1.00 0.00 ? 37  SER A HG   2  
ATOM 3752  N N    . PHE A 1 38  ? -17.047 -2.847  1.606   1.00 0.00 ? 38  PHE A N    2  
ATOM 3753  C CA   . PHE A 1 38  ? -16.063 -2.908  2.680   1.00 0.00 ? 38  PHE A CA   2  
ATOM 3754  C C    . PHE A 1 38  ? -15.419 -1.544  2.918   1.00 0.00 ? 38  PHE A C    2  
ATOM 3755  O O    . PHE A 1 38  ? -14.957 -1.252  4.020   1.00 0.00 ? 38  PHE A O    2  
ATOM 3756  C CB   . PHE A 1 38  ? -14.993 -3.953  2.363   1.00 0.00 ? 38  PHE A CB   2  
ATOM 3757  C CG   . PHE A 1 38  ? -15.347 -5.328  2.852   1.00 0.00 ? 38  PHE A CG   2  
ATOM 3758  C CD1  . PHE A 1 38  ? -15.638 -5.548  4.188   1.00 0.00 ? 38  PHE A CD1  2  
ATOM 3759  C CD2  . PHE A 1 38  ? -15.393 -6.401  1.975   1.00 0.00 ? 38  PHE A CD2  2  
ATOM 3760  C CE1  . PHE A 1 38  ? -15.965 -6.811  4.643   1.00 0.00 ? 38  PHE A CE1  2  
ATOM 3761  C CE2  . PHE A 1 38  ? -15.719 -7.667  2.424   1.00 0.00 ? 38  PHE A CE2  2  
ATOM 3762  C CZ   . PHE A 1 38  ? -16.006 -7.872  3.759   1.00 0.00 ? 38  PHE A CZ   2  
ATOM 3763  H H    . PHE A 1 38  ? -16.944 -3.433  0.827   1.00 0.00 ? 38  PHE A H    2  
ATOM 3764  H HA   . PHE A 1 38  ? -16.580 -3.206  3.579   1.00 0.00 ? 38  PHE A HA   2  
ATOM 3765  H HB2  . PHE A 1 38  ? -14.851 -4.004  1.294   1.00 0.00 ? 38  PHE A HB2  2  
ATOM 3766  H HB3  . PHE A 1 38  ? -14.067 -3.660  2.831   1.00 0.00 ? 38  PHE A HB3  2  
ATOM 3767  H HD1  . PHE A 1 38  ? -15.607 -4.719  4.881   1.00 0.00 ? 38  PHE A HD1  2  
ATOM 3768  H HD2  . PHE A 1 38  ? -15.168 -6.242  0.932   1.00 0.00 ? 38  PHE A HD2  2  
ATOM 3769  H HE1  . PHE A 1 38  ? -16.189 -6.970  5.687   1.00 0.00 ? 38  PHE A HE1  2  
ATOM 3770  H HE2  . PHE A 1 38  ? -15.751 -8.494  1.730   1.00 0.00 ? 38  PHE A HE2  2  
ATOM 3771  H HZ   . PHE A 1 38  ? -16.262 -8.860  4.111   1.00 0.00 ? 38  PHE A HZ   2  
ATOM 3772  N N    . MET A 1 39  ? -15.398 -0.710  1.885   1.00 0.00 ? 39  MET A N    2  
ATOM 3773  C CA   . MET A 1 39  ? -14.822 0.623   1.994   1.00 0.00 ? 39  MET A CA   2  
ATOM 3774  C C    . MET A 1 39  ? -15.792 1.570   2.700   1.00 0.00 ? 39  MET A C    2  
ATOM 3775  O O    . MET A 1 39  ? -15.440 2.224   3.677   1.00 0.00 ? 39  MET A O    2  
ATOM 3776  C CB   . MET A 1 39  ? -14.476 1.167   0.605   1.00 0.00 ? 39  MET A CB   2  
ATOM 3777  C CG   . MET A 1 39  ? -14.101 2.643   0.597   1.00 0.00 ? 39  MET A CG   2  
ATOM 3778  S SD   . MET A 1 39  ? -12.659 2.996   -0.427  1.00 0.00 ? 39  MET A SD   2  
ATOM 3779  C CE   . MET A 1 39  ? -11.431 1.955   0.356   1.00 0.00 ? 39  MET A CE   2  
ATOM 3780  H H    . MET A 1 39  ? -15.784 -0.993  1.031   1.00 0.00 ? 39  MET A H    2  
ATOM 3781  H HA   . MET A 1 39  ? -13.919 0.548   2.579   1.00 0.00 ? 39  MET A HA   2  
ATOM 3782  H HB2  . MET A 1 39  ? -13.644 0.604   0.208   1.00 0.00 ? 39  MET A HB2  2  
ATOM 3783  H HB3  . MET A 1 39  ? -15.330 1.033   -0.044  1.00 0.00 ? 39  MET A HB3  2  
ATOM 3784  H HG2  . MET A 1 39  ? -14.939 3.211   0.219   1.00 0.00 ? 39  MET A HG2  2  
ATOM 3785  H HG3  . MET A 1 39  ? -13.890 2.951   1.610   1.00 0.00 ? 39  MET A HG3  2  
ATOM 3786  H HE1  . MET A 1 39  ? -10.835 1.473   -0.403  1.00 0.00 ? 39  MET A HE1  2  
ATOM 3787  H HE2  . MET A 1 39  ? -11.926 1.205   0.958   1.00 0.00 ? 39  MET A HE2  2  
ATOM 3788  H HE3  . MET A 1 39  ? -10.794 2.559   0.985   1.00 0.00 ? 39  MET A HE3  2  
ATOM 3789  N N    . ASN A 1 40  ? -17.011 1.637   2.185   1.00 0.00 ? 40  ASN A N    2  
ATOM 3790  C CA   . ASN A 1 40  ? -18.042 2.506   2.743   1.00 0.00 ? 40  ASN A CA   2  
ATOM 3791  C C    . ASN A 1 40  ? -18.319 2.198   4.217   1.00 0.00 ? 40  ASN A C    2  
ATOM 3792  O O    . ASN A 1 40  ? -18.888 3.025   4.929   1.00 0.00 ? 40  ASN A O    2  
ATOM 3793  C CB   . ASN A 1 40  ? -19.333 2.370   1.932   1.00 0.00 ? 40  ASN A CB   2  
ATOM 3794  C CG   . ASN A 1 40  ? -19.256 3.086   0.598   1.00 0.00 ? 40  ASN A CG   2  
ATOM 3795  O OD1  . ASN A 1 40  ? -19.256 4.315   0.539   1.00 0.00 ? 40  ASN A OD1  2  
ATOM 3796  N ND2  . ASN A 1 40  ? -19.190 2.318   -0.487  1.00 0.00 ? 40  ASN A ND2  2  
ATOM 3797  H H    . ASN A 1 40  ? -17.226 1.091   1.399   1.00 0.00 ? 40  ASN A H    2  
ATOM 3798  H HA   . ASN A 1 40  ? -17.689 3.523   2.664   1.00 0.00 ? 40  ASN A HA   2  
ATOM 3799  H HB2  . ASN A 1 40  ? -19.526 1.323   1.748   1.00 0.00 ? 40  ASN A HB2  2  
ATOM 3800  H HB3  . ASN A 1 40  ? -20.151 2.788   2.499   1.00 0.00 ? 40  ASN A HB3  2  
ATOM 3801  H HD21 . ASN A 1 40  ? -19.195 1.341   -0.366  1.00 0.00 ? 40  ASN A HD21 2  
ATOM 3802  H HD22 . ASN A 1 40  ? -19.140 2.761   -1.364  1.00 0.00 ? 40  ASN A HD22 2  
ATOM 3803  N N    . THR A 1 41  ? -17.940 1.005   4.668   1.00 0.00 ? 41  THR A N    2  
ATOM 3804  C CA   . THR A 1 41  ? -18.181 0.605   6.053   1.00 0.00 ? 41  THR A CA   2  
ATOM 3805  C C    . THR A 1 41  ? -16.969 0.828   6.948   1.00 0.00 ? 41  THR A C    2  
ATOM 3806  O O    . THR A 1 41  ? -17.111 1.043   8.151   1.00 0.00 ? 41  THR A O    2  
ATOM 3807  C CB   . THR A 1 41  ? -18.570 -0.872  6.119   1.00 0.00 ? 41  THR A CB   2  
ATOM 3808  O OG1  . THR A 1 41  ? -18.810 -1.271  7.456   1.00 0.00 ? 41  THR A OG1  2  
ATOM 3809  C CG2  . THR A 1 41  ? -17.518 -1.795  5.549   1.00 0.00 ? 41  THR A CG2  2  
ATOM 3810  H H    . THR A 1 41  ? -17.506 0.375   4.056   1.00 0.00 ? 41  THR A H    2  
ATOM 3811  H HA   . THR A 1 41  ? -19.002 1.195   6.430   1.00 0.00 ? 41  THR A HA   2  
ATOM 3812  H HB   . THR A 1 41  ? -19.470 -1.020  5.557   1.00 0.00 ? 41  THR A HB   2  
ATOM 3813  H HG1  . THR A 1 41  ? -19.750 -1.427  7.579   1.00 0.00 ? 41  THR A HG1  2  
ATOM 3814  H HG21 . THR A 1 41  ? -17.347 -2.613  6.233   1.00 0.00 ? 41  THR A HG21 2  
ATOM 3815  H HG22 . THR A 1 41  ? -16.600 -1.248  5.405   1.00 0.00 ? 41  THR A HG22 2  
ATOM 3816  H HG23 . THR A 1 41  ? -17.858 -2.184  4.600   1.00 0.00 ? 41  THR A HG23 2  
ATOM 3817  N N    . GLU A 1 42  ? -15.776 0.731   6.376   1.00 0.00 ? 42  GLU A N    2  
ATOM 3818  C CA   . GLU A 1 42  ? -14.557 0.876   7.163   1.00 0.00 ? 42  GLU A CA   2  
ATOM 3819  C C    . GLU A 1 42  ? -13.624 1.941   6.590   1.00 0.00 ? 42  GLU A C    2  
ATOM 3820  O O    . GLU A 1 42  ? -13.051 2.737   7.335   1.00 0.00 ? 42  GLU A O    2  
ATOM 3821  C CB   . GLU A 1 42  ? -13.840 -0.474  7.244   1.00 0.00 ? 42  GLU A CB   2  
ATOM 3822  C CG   . GLU A 1 42  ? -14.783 -1.676  7.187   1.00 0.00 ? 42  GLU A CG   2  
ATOM 3823  C CD   . GLU A 1 42  ? -14.575 -2.635  8.344   1.00 0.00 ? 42  GLU A CD   2  
ATOM 3824  O OE1  . GLU A 1 42  ? -14.738 -2.207  9.506   1.00 0.00 ? 42  GLU A OE1  2  
ATOM 3825  O OE2  . GLU A 1 42  ? -14.250 -3.813  8.087   1.00 0.00 ? 42  GLU A OE2  2  
ATOM 3826  H H    . GLU A 1 42  ? -15.713 0.523   5.421   1.00 0.00 ? 42  GLU A H    2  
ATOM 3827  H HA   . GLU A 1 42  ? -14.846 1.174   8.160   1.00 0.00 ? 42  GLU A HA   2  
ATOM 3828  H HB2  . GLU A 1 42  ? -13.147 -0.550  6.419   1.00 0.00 ? 42  GLU A HB2  2  
ATOM 3829  H HB3  . GLU A 1 42  ? -13.289 -0.520  8.171   1.00 0.00 ? 42  GLU A HB3  2  
ATOM 3830  H HG2  . GLU A 1 42  ? -15.810 -1.326  7.211   1.00 0.00 ? 42  GLU A HG2  2  
ATOM 3831  H HG3  . GLU A 1 42  ? -14.611 -2.209  6.263   1.00 0.00 ? 42  GLU A HG3  2  
ATOM 3832  N N    . LEU A 1 43  ? -13.478 1.960   5.272   1.00 0.00 ? 43  LEU A N    2  
ATOM 3833  C CA   . LEU A 1 43  ? -12.619 2.936   4.614   1.00 0.00 ? 43  LEU A CA   2  
ATOM 3834  C C    . LEU A 1 43  ? -13.459 4.050   4.009   1.00 0.00 ? 43  LEU A C    2  
ATOM 3835  O O    . LEU A 1 43  ? -13.141 4.587   2.947   1.00 0.00 ? 43  LEU A O    2  
ATOM 3836  C CB   . LEU A 1 43  ? -11.772 2.260   3.534   1.00 0.00 ? 43  LEU A CB   2  
ATOM 3837  C CG   . LEU A 1 43  ? -10.355 1.887   3.968   1.00 0.00 ? 43  LEU A CG   2  
ATOM 3838  C CD1  . LEU A 1 43  ? -9.611  1.206   2.832   1.00 0.00 ? 43  LEU A CD1  2  
ATOM 3839  C CD2  . LEU A 1 43  ? -9.604  3.124   4.441   1.00 0.00 ? 43  LEU A CD2  2  
ATOM 3840  H H    . LEU A 1 43  ? -13.963 1.310   4.727   1.00 0.00 ? 43  LEU A H    2  
ATOM 3841  H HA   . LEU A 1 43  ? -11.966 3.360   5.361   1.00 0.00 ? 43  LEU A HA   2  
ATOM 3842  H HB2  . LEU A 1 43  ? -12.278 1.359   3.219   1.00 0.00 ? 43  LEU A HB2  2  
ATOM 3843  H HB3  . LEU A 1 43  ? -11.700 2.927   2.689   1.00 0.00 ? 43  LEU A HB3  2  
ATOM 3844  H HG   . LEU A 1 43  ? -10.410 1.192   4.795   1.00 0.00 ? 43  LEU A HG   2  
ATOM 3845  H HD11 . LEU A 1 43  ? -9.190  1.955   2.178   1.00 0.00 ? 43  LEU A HD11 2  
ATOM 3846  H HD12 . LEU A 1 43  ? -10.298 0.586   2.273   1.00 0.00 ? 43  LEU A HD12 2  
ATOM 3847  H HD13 . LEU A 1 43  ? -8.820  0.592   3.235   1.00 0.00 ? 43  LEU A HD13 2  
ATOM 3848  H HD21 . LEU A 1 43  ? -10.297 3.946   4.551   1.00 0.00 ? 43  LEU A HD21 2  
ATOM 3849  H HD22 . LEU A 1 43  ? -8.845  3.387   3.718   1.00 0.00 ? 43  LEU A HD22 2  
ATOM 3850  H HD23 . LEU A 1 43  ? -9.138  2.919   5.393   1.00 0.00 ? 43  LEU A HD23 2  
ATOM 3851  N N    . ALA A 1 44  ? -14.541 4.382   4.699   1.00 0.00 ? 44  ALA A N    2  
ATOM 3852  C CA   . ALA A 1 44  ? -15.451 5.422   4.250   1.00 0.00 ? 44  ALA A CA   2  
ATOM 3853  C C    . ALA A 1 44  ? -14.921 6.803   4.614   1.00 0.00 ? 44  ALA A C    2  
ATOM 3854  O O    . ALA A 1 44  ? -15.192 7.784   3.924   1.00 0.00 ? 44  ALA A O    2  
ATOM 3855  C CB   . ALA A 1 44  ? -16.826 5.193   4.852   1.00 0.00 ? 44  ALA A CB   2  
ATOM 3856  H H    . ALA A 1 44  ? -14.734 3.910   5.535   1.00 0.00 ? 44  ALA A H    2  
ATOM 3857  H HA   . ALA A 1 44  ? -15.537 5.351   3.175   1.00 0.00 ? 44  ALA A HA   2  
ATOM 3858  H HB1  . ALA A 1 44  ? -16.953 5.831   5.714   1.00 0.00 ? 44  ALA A HB1  2  
ATOM 3859  H HB2  . ALA A 1 44  ? -16.915 4.158   5.153   1.00 0.00 ? 44  ALA A HB2  2  
ATOM 3860  H HB3  . ALA A 1 44  ? -17.584 5.422   4.118   1.00 0.00 ? 44  ALA A HB3  2  
ATOM 3861  N N    . ALA A 1 45  ? -14.155 6.869   5.699   1.00 0.00 ? 45  ALA A N    2  
ATOM 3862  C CA   . ALA A 1 45  ? -13.576 8.128   6.150   1.00 0.00 ? 45  ALA A CA   2  
ATOM 3863  C C    . ALA A 1 45  ? -12.797 8.802   5.023   1.00 0.00 ? 45  ALA A C    2  
ATOM 3864  O O    . ALA A 1 45  ? -12.636 10.022  5.009   1.00 0.00 ? 45  ALA A O    2  
ATOM 3865  C CB   . ALA A 1 45  ? -12.676 7.891   7.353   1.00 0.00 ? 45  ALA A CB   2  
ATOM 3866  H H    . ALA A 1 45  ? -13.968 6.050   6.204   1.00 0.00 ? 45  ALA A H    2  
ATOM 3867  H HA   . ALA A 1 45  ? -14.383 8.777   6.455   1.00 0.00 ? 45  ALA A HA   2  
ATOM 3868  H HB1  . ALA A 1 45  ? -11.774 8.475   7.250   1.00 0.00 ? 45  ALA A HB1  2  
ATOM 3869  H HB2  . ALA A 1 45  ? -12.421 6.843   7.411   1.00 0.00 ? 45  ALA A HB2  2  
ATOM 3870  H HB3  . ALA A 1 45  ? -13.194 8.185   8.254   1.00 0.00 ? 45  ALA A HB3  2  
ATOM 3871  N N    . PHE A 1 46  ? -12.321 7.995   4.078   1.00 0.00 ? 46  PHE A N    2  
ATOM 3872  C CA   . PHE A 1 46  ? -11.563 8.506   2.944   1.00 0.00 ? 46  PHE A CA   2  
ATOM 3873  C C    . PHE A 1 46  ? -12.429 8.565   1.685   1.00 0.00 ? 46  PHE A C    2  
ATOM 3874  O O    . PHE A 1 46  ? -11.912 8.666   0.573   1.00 0.00 ? 46  PHE A O    2  
ATOM 3875  C CB   . PHE A 1 46  ? -10.339 7.624   2.688   1.00 0.00 ? 46  PHE A CB   2  
ATOM 3876  C CG   . PHE A 1 46  ? -9.198  7.886   3.630   1.00 0.00 ? 46  PHE A CG   2  
ATOM 3877  C CD1  . PHE A 1 46  ? -9.406  7.916   5.000   1.00 0.00 ? 46  PHE A CD1  2  
ATOM 3878  C CD2  . PHE A 1 46  ? -7.918  8.099   3.144   1.00 0.00 ? 46  PHE A CD2  2  
ATOM 3879  C CE1  . PHE A 1 46  ? -8.357  8.155   5.868   1.00 0.00 ? 46  PHE A CE1  2  
ATOM 3880  C CE2  . PHE A 1 46  ? -6.865  8.337   4.008   1.00 0.00 ? 46  PHE A CE2  2  
ATOM 3881  C CZ   . PHE A 1 46  ? -7.085  8.365   5.371   1.00 0.00 ? 46  PHE A CZ   2  
ATOM 3882  H H    . PHE A 1 46  ? -12.485 7.032   4.146   1.00 0.00 ? 46  PHE A H    2  
ATOM 3883  H HA   . PHE A 1 46  ? -11.231 9.504   3.187   1.00 0.00 ? 46  PHE A HA   2  
ATOM 3884  H HB2  . PHE A 1 46  ? -10.625 6.587   2.794   1.00 0.00 ? 46  PHE A HB2  2  
ATOM 3885  H HB3  . PHE A 1 46  ? -9.986  7.793   1.681   1.00 0.00 ? 46  PHE A HB3  2  
ATOM 3886  H HD1  . PHE A 1 46  ? -10.399 7.750   5.389   1.00 0.00 ? 46  PHE A HD1  2  
ATOM 3887  H HD2  . PHE A 1 46  ? -7.745  8.078   2.079   1.00 0.00 ? 46  PHE A HD2  2  
ATOM 3888  H HE1  . PHE A 1 46  ? -8.531  8.176   6.933   1.00 0.00 ? 46  PHE A HE1  2  
ATOM 3889  H HE2  . PHE A 1 46  ? -5.873  8.502   3.617   1.00 0.00 ? 46  PHE A HE2  2  
ATOM 3890  H HZ   . PHE A 1 46  ? -6.265  8.551   6.048   1.00 0.00 ? 46  PHE A HZ   2  
ATOM 3891  N N    . THR A 1 47  ? -13.748 8.502   1.866   1.00 0.00 ? 47  THR A N    2  
ATOM 3892  C CA   . THR A 1 47  ? -14.677 8.548   0.742   1.00 0.00 ? 47  THR A CA   2  
ATOM 3893  C C    . THR A 1 47  ? -16.124 8.497   1.226   1.00 0.00 ? 47  THR A C    2  
ATOM 3894  O O    . THR A 1 47  ? -16.946 7.757   0.685   1.00 0.00 ? 47  THR A O    2  
ATOM 3895  C CB   . THR A 1 47  ? -14.406 7.386   -0.219  1.00 0.00 ? 47  THR A CB   2  
ATOM 3896  O OG1  . THR A 1 47  ? -15.315 7.413   -1.304  1.00 0.00 ? 47  THR A OG1  2  
ATOM 3897  C CG2  . THR A 1 47  ? -14.517 6.028   0.439   1.00 0.00 ? 47  THR A CG2  2  
ATOM 3898  H H    . THR A 1 47  ? -14.103 8.422   2.775   1.00 0.00 ? 47  THR A H    2  
ATOM 3899  H HA   . THR A 1 47  ? -14.518 9.478   0.218   1.00 0.00 ? 47  THR A HA   2  
ATOM 3900  H HB   . THR A 1 47  ? -13.405 7.483   -0.612  1.00 0.00 ? 47  THR A HB   2  
ATOM 3901  H HG1  . THR A 1 47  ? -16.210 7.302   -0.976  1.00 0.00 ? 47  THR A HG1  2  
ATOM 3902  H HG21 . THR A 1 47  ? -15.394 5.519   0.067   1.00 0.00 ? 47  THR A HG21 2  
ATOM 3903  H HG22 . THR A 1 47  ? -14.600 6.151   1.508   1.00 0.00 ? 47  THR A HG22 2  
ATOM 3904  H HG23 . THR A 1 47  ? -13.637 5.444   0.210   1.00 0.00 ? 47  THR A HG23 2  
ATOM 3905  N N    . LYS A 1 48  ? -16.430 9.291   2.249   1.00 0.00 ? 48  LYS A N    2  
ATOM 3906  C CA   . LYS A 1 48  ? -17.779 9.337   2.804   1.00 0.00 ? 48  LYS A CA   2  
ATOM 3907  C C    . LYS A 1 48  ? -18.366 10.743  2.701   1.00 0.00 ? 48  LYS A C    2  
ATOM 3908  O O    . LYS A 1 48  ? -19.557 10.910  2.441   1.00 0.00 ? 48  LYS A O    2  
ATOM 3909  C CB   . LYS A 1 48  ? -17.773 8.879   4.265   1.00 0.00 ? 48  LYS A CB   2  
ATOM 3910  C CG   . LYS A 1 48  ? -16.791 9.639   5.144   1.00 0.00 ? 48  LYS A CG   2  
ATOM 3911  C CD   . LYS A 1 48  ? -17.507 10.557  6.124   1.00 0.00 ? 48  LYS A CD   2  
ATOM 3912  C CE   . LYS A 1 48  ? -16.903 10.467  7.517   1.00 0.00 ? 48  LYS A CE   2  
ATOM 3913  N NZ   . LYS A 1 48  ? -16.675 11.812  8.113   1.00 0.00 ? 48  LYS A NZ   2  
ATOM 3914  H H    . LYS A 1 48  ? -15.731 9.858   2.637   1.00 0.00 ? 48  LYS A H    2  
ATOM 3915  H HA   . LYS A 1 48  ? -18.396 8.662   2.229   1.00 0.00 ? 48  LYS A HA   2  
ATOM 3916  H HB2  . LYS A 1 48  ? -18.765 9.008   4.673   1.00 0.00 ? 48  LYS A HB2  2  
ATOM 3917  H HB3  . LYS A 1 48  ? -17.515 7.830   4.299   1.00 0.00 ? 48  LYS A HB3  2  
ATOM 3918  H HG2  . LYS A 1 48  ? -16.199 8.928   5.700   1.00 0.00 ? 48  LYS A HG2  2  
ATOM 3919  H HG3  . LYS A 1 48  ? -16.145 10.234  4.514   1.00 0.00 ? 48  LYS A HG3  2  
ATOM 3920  H HD2  . LYS A 1 48  ? -17.426 11.575  5.774   1.00 0.00 ? 48  LYS A HD2  2  
ATOM 3921  H HD3  . LYS A 1 48  ? -18.548 10.273  6.174   1.00 0.00 ? 48  LYS A HD3  2  
ATOM 3922  H HE2  . LYS A 1 48  ? -17.577 9.911   8.152   1.00 0.00 ? 48  LYS A HE2  2  
ATOM 3923  H HE3  . LYS A 1 48  ? -15.958 9.945   7.454   1.00 0.00 ? 48  LYS A HE3  2  
ATOM 3924  H HZ1  . LYS A 1 48  ? -15.798 11.812  8.672   1.00 0.00 ? 48  LYS A HZ1  2  
ATOM 3925  H HZ2  . LYS A 1 48  ? -17.469 12.066  8.736   1.00 0.00 ? 48  LYS A HZ2  2  
ATOM 3926  H HZ3  . LYS A 1 48  ? -16.596 12.527  7.362   1.00 0.00 ? 48  LYS A HZ3  2  
ATOM 3927  N N    . ASN A 1 49  ? -17.522 11.748  2.904   1.00 0.00 ? 49  ASN A N    2  
ATOM 3928  C CA   . ASN A 1 49  ? -17.958 13.139  2.831   1.00 0.00 ? 49  ASN A CA   2  
ATOM 3929  C C    . ASN A 1 49  ? -16.795 14.053  2.458   1.00 0.00 ? 49  ASN A C    2  
ATOM 3930  O O    . ASN A 1 49  ? -16.768 15.224  2.832   1.00 0.00 ? 49  ASN A O    2  
ATOM 3931  C CB   . ASN A 1 49  ? -18.561 13.577  4.168   1.00 0.00 ? 49  ASN A CB   2  
ATOM 3932  C CG   . ASN A 1 49  ? -19.883 14.300  3.995   1.00 0.00 ? 49  ASN A CG   2  
ATOM 3933  O OD1  . ASN A 1 49  ? -19.950 15.351  3.358   1.00 0.00 ? 49  ASN A OD1  2  
ATOM 3934  N ND2  . ASN A 1 49  ? -20.943 13.738  4.566   1.00 0.00 ? 49  ASN A ND2  2  
ATOM 3935  H H    . ASN A 1 49  ? -16.583 11.553  3.106   1.00 0.00 ? 49  ASN A H    2  
ATOM 3936  H HA   . ASN A 1 49  ? -18.715 13.208  2.064   1.00 0.00 ? 49  ASN A HA   2  
ATOM 3937  H HB2  . ASN A 1 49  ? -18.728 12.706  4.783   1.00 0.00 ? 49  ASN A HB2  2  
ATOM 3938  H HB3  . ASN A 1 49  ? -17.871 14.240  4.669   1.00 0.00 ? 49  ASN A HB3  2  
ATOM 3939  H HD21 . ASN A 1 49  ? -20.812 12.898  5.060   1.00 0.00 ? 49  ASN A HD21 2  
ATOM 3940  H HD22 . ASN A 1 49  ? -21.814 14.187  4.469   1.00 0.00 ? 49  ASN A HD22 2  
ATOM 3941  N N    . GLN A 1 50  ? -15.835 13.508  1.716   1.00 0.00 ? 50  GLN A N    2  
ATOM 3942  C CA   . GLN A 1 50  ? -14.669 14.273  1.290   1.00 0.00 ? 50  GLN A CA   2  
ATOM 3943  C C    . GLN A 1 50  ? -15.006 15.167  0.100   1.00 0.00 ? 50  GLN A C    2  
ATOM 3944  O O    . GLN A 1 50  ? -14.324 16.160  -0.155  1.00 0.00 ? 50  GLN A O    2  
ATOM 3945  C CB   . GLN A 1 50  ? -13.520 13.331  0.922   1.00 0.00 ? 50  GLN A CB   2  
ATOM 3946  C CG   . GLN A 1 50  ? -13.334 12.183  1.899   1.00 0.00 ? 50  GLN A CG   2  
ATOM 3947  C CD   . GLN A 1 50  ? -13.022 12.658  3.304   1.00 0.00 ? 50  GLN A CD   2  
ATOM 3948  O OE1  . GLN A 1 50  ? -11.898 13.067  3.600   1.00 0.00 ? 50  GLN A OE1  2  
ATOM 3949  N NE2  . GLN A 1 50  ? -14.018 12.606  4.180   1.00 0.00 ? 50  GLN A NE2  2  
ATOM 3950  H H    . GLN A 1 50  ? -15.913 12.568  1.449   1.00 0.00 ? 50  GLN A H    2  
ATOM 3951  H HA   . GLN A 1 50  ? -14.361 14.895  2.116   1.00 0.00 ? 50  GLN A HA   2  
ATOM 3952  H HB2  . GLN A 1 50  ? -13.711 12.916  -0.057  1.00 0.00 ? 50  GLN A HB2  2  
ATOM 3953  H HB3  . GLN A 1 50  ? -12.602 13.899  0.888   1.00 0.00 ? 50  GLN A HB3  2  
ATOM 3954  H HG2  . GLN A 1 50  ? -14.241 11.599  1.927   1.00 0.00 ? 50  GLN A HG2  2  
ATOM 3955  H HG3  . GLN A 1 50  ? -12.517 11.564  1.555   1.00 0.00 ? 50  GLN A HG3  2  
ATOM 3956  H HE21 . GLN A 1 50  ? -14.889 12.266  3.871   1.00 0.00 ? 50  GLN A HE21 2  
ATOM 3957  H HE22 . GLN A 1 50  ? -13.843 12.906  5.101   1.00 0.00 ? 50  GLN A HE22 2  
ATOM 3958  N N    . LYS A 1 51  ? -16.058 14.809  -0.630  1.00 0.00 ? 51  LYS A N    2  
ATOM 3959  C CA   . LYS A 1 51  ? -16.479 15.578  -1.796  1.00 0.00 ? 51  LYS A CA   2  
ATOM 3960  C C    . LYS A 1 51  ? -15.417 15.523  -2.891  1.00 0.00 ? 51  LYS A C    2  
ATOM 3961  O O    . LYS A 1 51  ? -15.260 16.467  -3.664  1.00 0.00 ? 51  LYS A O    2  
ATOM 3962  C CB   . LYS A 1 51  ? -16.755 17.032  -1.407  1.00 0.00 ? 51  LYS A CB   2  
ATOM 3963  C CG   . LYS A 1 51  ? -17.954 17.634  -2.122  1.00 0.00 ? 51  LYS A CG   2  
ATOM 3964  C CD   . LYS A 1 51  ? -18.532 18.808  -1.348  1.00 0.00 ? 51  LYS A CD   2  
ATOM 3965  C CE   . LYS A 1 51  ? -19.281 19.763  -2.264  1.00 0.00 ? 51  LYS A CE   2  
ATOM 3966  N NZ   . LYS A 1 51  ? -18.445 20.934  -2.647  1.00 0.00 ? 51  LYS A NZ   2  
ATOM 3967  H H    . LYS A 1 51  ? -16.562 14.005  -0.383  1.00 0.00 ? 51  LYS A H    2  
ATOM 3968  H HA   . LYS A 1 51  ? -17.390 15.136  -2.173  1.00 0.00 ? 51  LYS A HA   2  
ATOM 3969  H HB2  . LYS A 1 51  ? -16.936 17.081  -0.344  1.00 0.00 ? 51  LYS A HB2  2  
ATOM 3970  H HB3  . LYS A 1 51  ? -15.886 17.628  -1.643  1.00 0.00 ? 51  LYS A HB3  2  
ATOM 3971  H HG2  . LYS A 1 51  ? -17.644 17.978  -3.098  1.00 0.00 ? 51  LYS A HG2  2  
ATOM 3972  H HG3  . LYS A 1 51  ? -18.715 16.876  -2.230  1.00 0.00 ? 51  LYS A HG3  2  
ATOM 3973  H HD2  . LYS A 1 51  ? -19.215 18.433  -0.600  1.00 0.00 ? 51  LYS A HD2  2  
ATOM 3974  H HD3  . LYS A 1 51  ? -17.726 19.342  -0.868  1.00 0.00 ? 51  LYS A HD3  2  
ATOM 3975  H HE2  . LYS A 1 51  ? -19.571 19.232  -3.158  1.00 0.00 ? 51  LYS A HE2  2  
ATOM 3976  H HE3  . LYS A 1 51  ? -20.165 20.114  -1.752  1.00 0.00 ? 51  LYS A HE3  2  
ATOM 3977  H HZ1  . LYS A 1 51  ? -18.644 21.209  -3.629  1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 3978  H HZ2  . LYS A 1 51  ? -17.436 20.697  -2.562  1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 3979  H HZ3  . LYS A 1 51  ? -18.653 21.740  -2.023  1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 3980  N N    . ASP A 1 52  ? -14.692 14.411  -2.948  1.00 0.00 ? 52  ASP A N    2  
ATOM 3981  C CA   . ASP A 1 52  ? -13.645 14.231  -3.946  1.00 0.00 ? 52  ASP A CA   2  
ATOM 3982  C C    . ASP A 1 52  ? -13.773 12.873  -4.632  1.00 0.00 ? 52  ASP A C    2  
ATOM 3983  O O    . ASP A 1 52  ? -13.100 11.913  -4.257  1.00 0.00 ? 52  ASP A O    2  
ATOM 3984  C CB   . ASP A 1 52  ? -12.265 14.361  -3.299  1.00 0.00 ? 52  ASP A CB   2  
ATOM 3985  C CG   . ASP A 1 52  ? -11.277 15.095  -4.185  1.00 0.00 ? 52  ASP A CG   2  
ATOM 3986  O OD1  . ASP A 1 52  ? -11.365 14.946  -5.422  1.00 0.00 ? 52  ASP A OD1  2  
ATOM 3987  O OD2  . ASP A 1 52  ? -10.416 15.818  -3.643  1.00 0.00 ? 52  ASP A OD2  2  
ATOM 3988  H H    . ASP A 1 52  ? -14.865 13.693  -2.303  1.00 0.00 ? 52  ASP A H    2  
ATOM 3989  H HA   . ASP A 1 52  ? -13.759 15.008  -4.688  1.00 0.00 ? 52  ASP A HA   2  
ATOM 3990  H HB2  . ASP A 1 52  ? -12.359 14.906  -2.370  1.00 0.00 ? 52  ASP A HB2  2  
ATOM 3991  H HB3  . ASP A 1 52  ? -11.876 13.376  -3.094  1.00 0.00 ? 52  ASP A HB3  2  
ATOM 3992  N N    . PRO A 1 53  ? -14.641 12.777  -5.654  1.00 0.00 ? 53  PRO A N    2  
ATOM 3993  C CA   . PRO A 1 53  ? -14.855 11.529  -6.396  1.00 0.00 ? 53  PRO A CA   2  
ATOM 3994  C C    . PRO A 1 53  ? -13.587 11.044  -7.094  1.00 0.00 ? 53  PRO A C    2  
ATOM 3995  O O    . PRO A 1 53  ? -13.498 9.886   -7.504  1.00 0.00 ? 53  PRO A O    2  
ATOM 3996  C CB   . PRO A 1 53  ? -15.923 11.900  -7.435  1.00 0.00 ? 53  PRO A CB   2  
ATOM 3997  C CG   . PRO A 1 53  ? -16.557 13.145  -6.915  1.00 0.00 ? 53  PRO A CG   2  
ATOM 3998  C CD   . PRO A 1 53  ? -15.481 13.872  -6.166  1.00 0.00 ? 53  PRO A CD   2  
ATOM 3999  H HA   . PRO A 1 53  ? -15.231 10.747  -5.754  1.00 0.00 ? 53  PRO A HA   2  
ATOM 4000  H HB2  . PRO A 1 53  ? -15.453 12.067  -8.393  1.00 0.00 ? 53  PRO A HB2  2  
ATOM 4001  H HB3  . PRO A 1 53  ? -16.641 11.098  -7.517  1.00 0.00 ? 53  PRO A HB3  2  
ATOM 4002  H HG2  . PRO A 1 53  ? -16.914 13.747  -7.739  1.00 0.00 ? 53  PRO A HG2  2  
ATOM 4003  H HG3  . PRO A 1 53  ? -17.371 12.893  -6.252  1.00 0.00 ? 53  PRO A HG3  2  
ATOM 4004  H HD2  . PRO A 1 53  ? -14.920 14.511  -6.833  1.00 0.00 ? 53  PRO A HD2  2  
ATOM 4005  H HD3  . PRO A 1 53  ? -15.904 14.446  -5.355  1.00 0.00 ? 53  PRO A HD3  2  
ATOM 4006  N N    . GLY A 1 54  ? -12.609 11.934  -7.226  1.00 0.00 ? 54  GLY A N    2  
ATOM 4007  C CA   . GLY A 1 54  ? -11.361 11.579  -7.876  1.00 0.00 ? 54  GLY A CA   2  
ATOM 4008  C C    . GLY A 1 54  ? -10.501 10.654  -7.033  1.00 0.00 ? 54  GLY A C    2  
ATOM 4009  O O    . GLY A 1 54  ? -9.549  10.062  -7.536  1.00 0.00 ? 54  GLY A O    2  
ATOM 4010  H H    . GLY A 1 54  ? -12.734 12.841  -6.881  1.00 0.00 ? 54  GLY A H    2  
ATOM 4011  H HA2  . GLY A 1 54  ? -11.583 11.089  -8.812  1.00 0.00 ? 54  GLY A HA2  2  
ATOM 4012  H HA3  . GLY A 1 54  ? -10.804 12.481  -8.079  1.00 0.00 ? 54  GLY A HA3  2  
ATOM 4013  N N    . VAL A 1 55  ? -10.834 10.534  -5.751  1.00 0.00 ? 55  VAL A N    2  
ATOM 4014  C CA   . VAL A 1 55  ? -10.081 9.675   -4.843  1.00 0.00 ? 55  VAL A CA   2  
ATOM 4015  C C    . VAL A 1 55  ? -10.557 8.229   -4.929  1.00 0.00 ? 55  VAL A C    2  
ATOM 4016  O O    . VAL A 1 55  ? -9.782  7.328   -5.250  1.00 0.00 ? 55  VAL A O    2  
ATOM 4017  C CB   . VAL A 1 55  ? -10.200 10.163  -3.384  1.00 0.00 ? 55  VAL A CB   2  
ATOM 4018  C CG1  . VAL A 1 55  ? -9.381  9.283   -2.451  1.00 0.00 ? 55  VAL A CG1  2  
ATOM 4019  C CG2  . VAL A 1 55  ? -9.769  11.618  -3.273  1.00 0.00 ? 55  VAL A CG2  2  
ATOM 4020  H H    . VAL A 1 55  ? -11.603 11.034  -5.406  1.00 0.00 ? 55  VAL A H    2  
ATOM 4021  H HA   . VAL A 1 55  ? -9.041  9.716   -5.131  1.00 0.00 ? 55  VAL A HA   2  
ATOM 4022  H HB   . VAL A 1 55  ? -11.236 10.093  -3.087  1.00 0.00 ? 55  VAL A HB   2  
ATOM 4023  H HG11 . VAL A 1 55  ? -10.031 8.563   -1.974  1.00 0.00 ? 55  VAL A HG11 2  
ATOM 4024  H HG12 . VAL A 1 55  ? -8.908  9.896   -1.699  1.00 0.00 ? 55  VAL A HG12 2  
ATOM 4025  H HG13 . VAL A 1 55  ? -8.625  8.762   -3.020  1.00 0.00 ? 55  VAL A HG13 2  
ATOM 4026  H HG21 . VAL A 1 55  ? -9.795  11.923  -2.236  1.00 0.00 ? 55  VAL A HG21 2  
ATOM 4027  H HG22 . VAL A 1 55  ? -10.443 12.237  -3.847  1.00 0.00 ? 55  VAL A HG22 2  
ATOM 4028  H HG23 . VAL A 1 55  ? -8.766  11.726  -3.656  1.00 0.00 ? 55  VAL A HG23 2  
ATOM 4029  N N    . LEU A 1 56  ? -11.834 8.015   -4.638  1.00 0.00 ? 56  LEU A N    2  
ATOM 4030  C CA   . LEU A 1 56  ? -12.414 6.681   -4.679  1.00 0.00 ? 56  LEU A CA   2  
ATOM 4031  C C    . LEU A 1 56  ? -12.420 6.140   -6.106  1.00 0.00 ? 56  LEU A C    2  
ATOM 4032  O O    . LEU A 1 56  ? -11.959 5.028   -6.364  1.00 0.00 ? 56  LEU A O    2  
ATOM 4033  C CB   . LEU A 1 56  ? -13.833 6.737   -4.107  1.00 0.00 ? 56  LEU A CB   2  
ATOM 4034  C CG   . LEU A 1 56  ? -14.776 5.610   -4.525  1.00 0.00 ? 56  LEU A CG   2  
ATOM 4035  C CD1  . LEU A 1 56  ? -14.441 4.328   -3.780  1.00 0.00 ? 56  LEU A CD1  2  
ATOM 4036  C CD2  . LEU A 1 56  ? -16.213 6.025   -4.269  1.00 0.00 ? 56  LEU A CD2  2  
ATOM 4037  H H    . LEU A 1 56  ? -12.405 8.773   -4.389  1.00 0.00 ? 56  LEU A H    2  
ATOM 4038  H HA   . LEU A 1 56  ? -11.810 6.034   -4.061  1.00 0.00 ? 56  LEU A HA   2  
ATOM 4039  H HB2  . LEU A 1 56  ? -13.760 6.731   -3.030  1.00 0.00 ? 56  LEU A HB2  2  
ATOM 4040  H HB3  . LEU A 1 56  ? -14.277 7.674   -4.412  1.00 0.00 ? 56  LEU A HB3  2  
ATOM 4041  H HG   . LEU A 1 56  ? -14.665 5.422   -5.583  1.00 0.00 ? 56  LEU A HG   2  
ATOM 4042  H HD11 . LEU A 1 56  ? -14.405 4.528   -2.718  1.00 0.00 ? 56  LEU A HD11 2  
ATOM 4043  H HD12 . LEU A 1 56  ? -13.481 3.961   -4.110  1.00 0.00 ? 56  LEU A HD12 2  
ATOM 4044  H HD13 . LEU A 1 56  ? -15.200 3.586   -3.980  1.00 0.00 ? 56  LEU A HD13 2  
ATOM 4045  H HD21 . LEU A 1 56  ? -16.833 5.708   -5.093  1.00 0.00 ? 56  LEU A HD21 2  
ATOM 4046  H HD22 . LEU A 1 56  ? -16.261 7.102   -4.173  1.00 0.00 ? 56  LEU A HD22 2  
ATOM 4047  H HD23 . LEU A 1 56  ? -16.563 5.567   -3.356  1.00 0.00 ? 56  LEU A HD23 2  
ATOM 4048  N N    . ASP A 1 57  ? -12.942 6.940   -7.026  1.00 0.00 ? 57  ASP A N    2  
ATOM 4049  C CA   . ASP A 1 57  ? -13.012 6.559   -8.431  1.00 0.00 ? 57  ASP A CA   2  
ATOM 4050  C C    . ASP A 1 57  ? -11.628 6.225   -8.978  1.00 0.00 ? 57  ASP A C    2  
ATOM 4051  O O    . ASP A 1 57  ? -11.495 5.449   -9.924  1.00 0.00 ? 57  ASP A O    2  
ATOM 4052  C CB   . ASP A 1 57  ? -13.640 7.685   -9.252  1.00 0.00 ? 57  ASP A CB   2  
ATOM 4053  C CG   . ASP A 1 57  ? -14.275 7.181   -10.533 1.00 0.00 ? 57  ASP A CG   2  
ATOM 4054  O OD1  . ASP A 1 57  ? -13.538 6.986   -11.524 1.00 0.00 ? 57  ASP A OD1  2  
ATOM 4055  O OD2  . ASP A 1 57  ? -15.508 6.981   -10.547 1.00 0.00 ? 57  ASP A OD2  2  
ATOM 4056  H H    . ASP A 1 57  ? -13.290 7.813   -6.753  1.00 0.00 ? 57  ASP A H    2  
ATOM 4057  H HA   . ASP A 1 57  ? -13.636 5.681   -8.505  1.00 0.00 ? 57  ASP A HA   2  
ATOM 4058  H HB2  . ASP A 1 57  ? -14.404 8.170   -8.661  1.00 0.00 ? 57  ASP A HB2  2  
ATOM 4059  H HB3  . ASP A 1 57  ? -12.877 8.405   -9.508  1.00 0.00 ? 57  ASP A HB3  2  
ATOM 4060  N N    . ARG A 1 58  ? -10.597 6.816   -8.379  1.00 0.00 ? 58  ARG A N    2  
ATOM 4061  C CA   . ARG A 1 58  ? -9.224  6.578   -8.813  1.00 0.00 ? 58  ARG A CA   2  
ATOM 4062  C C    . ARG A 1 58  ? -8.878  5.098   -8.727  1.00 0.00 ? 58  ARG A C    2  
ATOM 4063  O O    . ARG A 1 58  ? -8.364  4.513   -9.681  1.00 0.00 ? 58  ARG A O    2  
ATOM 4064  C CB   . ARG A 1 58  ? -8.247  7.385   -7.954  1.00 0.00 ? 58  ARG A CB   2  
ATOM 4065  C CG   . ARG A 1 58  ? -7.230  8.173   -8.766  1.00 0.00 ? 58  ARG A CG   2  
ATOM 4066  C CD   . ARG A 1 58  ? -5.817  7.991   -8.228  1.00 0.00 ? 58  ARG A CD   2  
ATOM 4067  N NE   . ARG A 1 58  ? -4.909  7.466   -9.247  1.00 0.00 ? 58  ARG A NE   2  
ATOM 4068  C CZ   . ARG A 1 58  ? -3.763  6.847   -8.970  1.00 0.00 ? 58  ARG A CZ   2  
ATOM 4069  N NH1  . ARG A 1 58  ? -3.379  6.673   -7.712  1.00 0.00 ? 58  ARG A NH1  2  
ATOM 4070  N NH2  . ARG A 1 58  ? -2.996  6.400   -9.956  1.00 0.00 ? 58  ARG A NH2  2  
ATOM 4071  H H    . ARG A 1 58  ? -10.762 7.426   -7.631  1.00 0.00 ? 58  ARG A H    2  
ATOM 4072  H HA   . ARG A 1 58  ? -9.139  6.900   -9.840  1.00 0.00 ? 58  ARG A HA   2  
ATOM 4073  H HB2  . ARG A 1 58  ? -8.807  8.079   -7.347  1.00 0.00 ? 58  ARG A HB2  2  
ATOM 4074  H HB3  . ARG A 1 58  ? -7.712  6.708   -7.305  1.00 0.00 ? 58  ARG A HB3  2  
ATOM 4075  H HG2  . ARG A 1 58  ? -7.259  7.834   -9.789  1.00 0.00 ? 58  ARG A HG2  2  
ATOM 4076  H HG3  . ARG A 1 58  ? -7.487  9.223   -8.726  1.00 0.00 ? 58  ARG A HG3  2  
ATOM 4077  H HD2  . ARG A 1 58  ? -5.448  8.947   -7.890  1.00 0.00 ? 58  ARG A HD2  2  
ATOM 4078  H HD3  . ARG A 1 58  ? -5.846  7.303   -7.397  1.00 0.00 ? 58  ARG A HD3  2  
ATOM 4079  H HE   . ARG A 1 58  ? -5.166  7.581   -10.185 1.00 0.00 ? 58  ARG A HE   2  
ATOM 4080  H HH11 . ARG A 1 58  ? -3.950  7.007   -6.962  1.00 0.00 ? 58  ARG A HH11 2  
ATOM 4081  H HH12 . ARG A 1 58  ? -2.517  6.207   -7.513  1.00 0.00 ? 58  ARG A HH12 2  
ATOM 4082  H HH22 . ARG A 1 58  ? -2.136  5.935   -9.750  1.00 0.00 ? 58  ARG A HH22 2  
ATOM 4083  N N    . MET A 1 59  ? -9.158  4.499   -7.576  1.00 0.00 ? 59  MET A N    2  
ATOM 4084  C CA   . MET A 1 59  ? -8.870  3.085   -7.365  1.00 0.00 ? 59  MET A CA   2  
ATOM 4085  C C    . MET A 1 59  ? -9.548  2.224   -8.424  1.00 0.00 ? 59  MET A C    2  
ATOM 4086  O O    . MET A 1 59  ? -8.905  1.411   -9.083  1.00 0.00 ? 59  MET A O    2  
ATOM 4087  C CB   . MET A 1 59  ? -9.319  2.657   -5.957  1.00 0.00 ? 59  MET A CB   2  
ATOM 4088  C CG   . MET A 1 59  ? -10.722 2.054   -5.877  1.00 0.00 ? 59  MET A CG   2  
ATOM 4089  S SD   . MET A 1 59  ? -11.100 1.380   -4.249  1.00 0.00 ? 59  MET A SD   2  
ATOM 4090  C CE   . MET A 1 59  ? -10.196 2.522   -3.218  1.00 0.00 ? 59  MET A CE   2  
ATOM 4091  H H    . MET A 1 59  ? -9.564  5.020   -6.850  1.00 0.00 ? 59  MET A H    2  
ATOM 4092  H HA   . MET A 1 59  ? -7.802  2.952   -7.446  1.00 0.00 ? 59  MET A HA   2  
ATOM 4093  H HB2  . MET A 1 59  ? -8.623  1.926   -5.583  1.00 0.00 ? 59  MET A HB2  2  
ATOM 4094  H HB3  . MET A 1 59  ? -9.290  3.523   -5.314  1.00 0.00 ? 59  MET A HB3  2  
ATOM 4095  H HG2  . MET A 1 59  ? -11.444 2.823   -6.104  1.00 0.00 ? 59  MET A HG2  2  
ATOM 4096  H HG3  . MET A 1 59  ? -10.802 1.260   -6.603  1.00 0.00 ? 59  MET A HG3  2  
ATOM 4097  H HE1  . MET A 1 59  ? -10.283 2.225   -2.185  1.00 0.00 ? 59  MET A HE1  2  
ATOM 4098  H HE2  . MET A 1 59  ? -10.603 3.511   -3.350  1.00 0.00 ? 59  MET A HE2  2  
ATOM 4099  H HE3  . MET A 1 59  ? -9.154  2.521   -3.509  1.00 0.00 ? 59  MET A HE3  2  
ATOM 4100  N N    . MET A 1 60  ? -10.853 2.406   -8.567  1.00 0.00 ? 60  MET A N    2  
ATOM 4101  C CA   . MET A 1 60  ? -11.635 1.637   -9.529  1.00 0.00 ? 60  MET A CA   2  
ATOM 4102  C C    . MET A 1 60  ? -11.213 1.925   -10.963 1.00 0.00 ? 60  MET A C    2  
ATOM 4103  O O    . MET A 1 60  ? -11.435 1.110   -11.856 1.00 0.00 ? 60  MET A O    2  
ATOM 4104  C CB   . MET A 1 60  ? -13.121 1.925   -9.338  1.00 0.00 ? 60  MET A CB   2  
ATOM 4105  C CG   . MET A 1 60  ? -13.598 1.642   -7.925  1.00 0.00 ? 60  MET A CG   2  
ATOM 4106  S SD   . MET A 1 60  ? -14.143 -0.061  -7.707  1.00 0.00 ? 60  MET A SD   2  
ATOM 4107  C CE   . MET A 1 60  ? -12.569 -0.914  -7.739  1.00 0.00 ? 60  MET A CE   2  
ATOM 4108  H H    . MET A 1 60  ? -11.307 3.067   -7.995  1.00 0.00 ? 60  MET A H    2  
ATOM 4109  H HA   . MET A 1 60  ? -11.460 0.592   -9.327  1.00 0.00 ? 60  MET A HA   2  
ATOM 4110  H HB2  . MET A 1 60  ? -13.309 2.966   -9.561  1.00 0.00 ? 60  MET A HB2  2  
ATOM 4111  H HB3  . MET A 1 60  ? -13.690 1.310   -10.019 1.00 0.00 ? 60  MET A HB3  2  
ATOM 4112  H HG2  . MET A 1 60  ? -12.779 1.828   -7.244  1.00 0.00 ? 60  MET A HG2  2  
ATOM 4113  H HG3  . MET A 1 60  ? -14.419 2.304   -7.693  1.00 0.00 ? 60  MET A HG3  2  
ATOM 4114  H HE1  . MET A 1 60  ? -11.774 -0.206  -7.552  1.00 0.00 ? 60  MET A HE1  2  
ATOM 4115  H HE2  . MET A 1 60  ? -12.425 -1.368  -8.709  1.00 0.00 ? 60  MET A HE2  2  
ATOM 4116  H HE3  . MET A 1 60  ? -12.558 -1.679  -6.977  1.00 0.00 ? 60  MET A HE3  2  
ATOM 4117  N N    . LYS A 1 61  ? -10.602 3.081   -11.182 1.00 0.00 ? 61  LYS A N    2  
ATOM 4118  C CA   . LYS A 1 61  ? -10.149 3.451   -12.518 1.00 0.00 ? 61  LYS A CA   2  
ATOM 4119  C C    . LYS A 1 61  ? -8.846  2.735   -12.863 1.00 0.00 ? 61  LYS A C    2  
ATOM 4120  O O    . LYS A 1 61  ? -8.786  1.953   -13.812 1.00 0.00 ? 61  LYS A O    2  
ATOM 4121  C CB   . LYS A 1 61  ? -9.953  4.966   -12.613 1.00 0.00 ? 61  LYS A CB   2  
ATOM 4122  C CG   . LYS A 1 61  ? -11.242 5.733   -12.862 1.00 0.00 ? 61  LYS A CG   2  
ATOM 4123  C CD   . LYS A 1 61  ? -11.841 5.401   -14.219 1.00 0.00 ? 61  LYS A CD   2  
ATOM 4124  C CE   . LYS A 1 61  ? -10.874 5.716   -15.349 1.00 0.00 ? 61  LYS A CE   2  
ATOM 4125  N NZ   . LYS A 1 61  ? -11.568 6.307   -16.527 1.00 0.00 ? 61  LYS A NZ   2  
ATOM 4126  H H    . LYS A 1 61  ? -10.449 3.692   -10.433 1.00 0.00 ? 61  LYS A H    2  
ATOM 4127  H HA   . LYS A 1 61  ? -10.910 3.149   -13.221 1.00 0.00 ? 61  LYS A HA   2  
ATOM 4128  H HB2  . LYS A 1 61  ? -9.521  5.319   -11.689 1.00 0.00 ? 61  LYS A HB2  2  
ATOM 4129  H HB3  . LYS A 1 61  ? -9.272  5.178   -13.423 1.00 0.00 ? 61  LYS A HB3  2  
ATOM 4130  H HG2  . LYS A 1 61  ? -11.956 5.477   -12.094 1.00 0.00 ? 61  LYS A HG2  2  
ATOM 4131  H HG3  . LYS A 1 61  ? -11.031 6.792   -12.821 1.00 0.00 ? 61  LYS A HG3  2  
ATOM 4132  H HD2  . LYS A 1 61  ? -12.082 4.349   -14.248 1.00 0.00 ? 61  LYS A HD2  2  
ATOM 4133  H HD3  . LYS A 1 61  ? -12.741 5.982   -14.356 1.00 0.00 ? 61  LYS A HD3  2  
ATOM 4134  H HE2  . LYS A 1 61  ? -10.135 6.417   -14.990 1.00 0.00 ? 61  LYS A HE2  2  
ATOM 4135  H HE3  . LYS A 1 61  ? -10.384 4.801   -15.652 1.00 0.00 ? 61  LYS A HE3  2  
ATOM 4136  H HZ1  . LYS A 1 61  ? -12.575 6.045   -16.517 1.00 0.00 ? 61  LYS A HZ1  2  
ATOM 4137  H HZ2  . LYS A 1 61  ? -11.140 5.957   -17.407 1.00 0.00 ? 61  LYS A HZ2  2  
ATOM 4138  H HZ3  . LYS A 1 61  ? -11.489 7.344   -16.505 1.00 0.00 ? 61  LYS A HZ3  2  
ATOM 4139  N N    . LYS A 1 62  ? -7.806  3.007   -12.081 1.00 0.00 ? 62  LYS A N    2  
ATOM 4140  C CA   . LYS A 1 62  ? -6.498  2.392   -12.292 1.00 0.00 ? 62  LYS A CA   2  
ATOM 4141  C C    . LYS A 1 62  ? -6.422  0.983   -11.697 1.00 0.00 ? 62  LYS A C    2  
ATOM 4142  O O    . LYS A 1 62  ? -5.354  0.371   -11.677 1.00 0.00 ? 62  LYS A O    2  
ATOM 4143  C CB   . LYS A 1 62  ? -5.399  3.270   -11.688 1.00 0.00 ? 62  LYS A CB   2  
ATOM 4144  C CG   . LYS A 1 62  ? -4.247  3.547   -12.640 1.00 0.00 ? 62  LYS A CG   2  
ATOM 4145  C CD   . LYS A 1 62  ? -3.665  2.260   -13.206 1.00 0.00 ? 62  LYS A CD   2  
ATOM 4146  C CE   . LYS A 1 62  ? -2.616  1.668   -12.280 1.00 0.00 ? 62  LYS A CE   2  
ATOM 4147  N NZ   . LYS A 1 62  ? -2.521  0.189   -12.421 1.00 0.00 ? 62  LYS A NZ   2  
ATOM 4148  H H    . LYS A 1 62  ? -7.920  3.637   -11.338 1.00 0.00 ? 62  LYS A H    2  
ATOM 4149  H HA   . LYS A 1 62  ? -6.338  2.324   -13.357 1.00 0.00 ? 62  LYS A HA   2  
ATOM 4150  H HB2  . LYS A 1 62  ? -5.831  4.215   -11.396 1.00 0.00 ? 62  LYS A HB2  2  
ATOM 4151  H HB3  . LYS A 1 62  ? -5.003  2.781   -10.810 1.00 0.00 ? 62  LYS A HB3  2  
ATOM 4152  H HG2  . LYS A 1 62  ? -4.605  4.156   -13.456 1.00 0.00 ? 62  LYS A HG2  2  
ATOM 4153  H HG3  . LYS A 1 62  ? -3.472  4.078   -12.106 1.00 0.00 ? 62  LYS A HG3  2  
ATOM 4154  H HD2  . LYS A 1 62  ? -4.461  1.542   -13.336 1.00 0.00 ? 62  LYS A HD2  2  
ATOM 4155  H HD3  . LYS A 1 62  ? -3.210  2.472   -14.162 1.00 0.00 ? 62  LYS A HD3  2  
ATOM 4156  H HE2  . LYS A 1 62  ? -1.656  2.105   -12.517 1.00 0.00 ? 62  LYS A HE2  2  
ATOM 4157  H HE3  . LYS A 1 62  ? -2.877  1.909   -11.260 1.00 0.00 ? 62  LYS A HE3  2  
ATOM 4158  H HZ1  . LYS A 1 62  ? -3.423  -0.196  -12.768 1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 4159  H HZ2  . LYS A 1 62  ? -2.304  -0.246  -11.501 1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 4160  H HZ3  . LYS A 1 62  ? -1.768  -0.059  -13.094 1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 4161  N N    . LEU A 1 63  ? -7.548  0.473   -11.201 1.00 0.00 ? 63  LEU A N    2  
ATOM 4162  C CA   . LEU A 1 63  ? -7.583  -0.859  -10.596 1.00 0.00 ? 63  LEU A CA   2  
ATOM 4163  C C    . LEU A 1 63  ? -6.949  -1.908  -11.495 1.00 0.00 ? 63  LEU A C    2  
ATOM 4164  O O    . LEU A 1 63  ? -6.482  -2.944  -11.022 1.00 0.00 ? 63  LEU A O    2  
ATOM 4165  C CB   . LEU A 1 63  ? -9.023  -1.257  -10.248 1.00 0.00 ? 63  LEU A CB   2  
ATOM 4166  C CG   . LEU A 1 63  ? -9.801  -1.959  -11.364 1.00 0.00 ? 63  LEU A CG   2  
ATOM 4167  C CD1  . LEU A 1 63  ? -11.167 -2.402  -10.860 1.00 0.00 ? 63  LEU A CD1  2  
ATOM 4168  C CD2  . LEU A 1 63  ? -9.941  -1.045  -12.573 1.00 0.00 ? 63  LEU A CD2  2  
ATOM 4169  H H    . LEU A 1 63  ? -8.368  1.004   -11.230 1.00 0.00 ? 63  LEU A H    2  
ATOM 4170  H HA   . LEU A 1 63  ? -7.008  -0.814  -9.694  1.00 0.00 ? 63  LEU A HA   2  
ATOM 4171  H HB2  . LEU A 1 63  ? -8.992  -1.915  -9.391  1.00 0.00 ? 63  LEU A HB2  2  
ATOM 4172  H HB3  . LEU A 1 63  ? -9.564  -0.365  -9.973  1.00 0.00 ? 63  LEU A HB3  2  
ATOM 4173  H HG   . LEU A 1 63  ? -9.258  -2.841  -11.671 1.00 0.00 ? 63  LEU A HG   2  
ATOM 4174  H HD11 . LEU A 1 63  ? -11.073 -2.786  -9.855  1.00 0.00 ? 63  LEU A HD11 2  
ATOM 4175  H HD12 . LEU A 1 63  ? -11.556 -3.175  -11.507 1.00 0.00 ? 63  LEU A HD12 2  
ATOM 4176  H HD13 . LEU A 1 63  ? -11.842 -1.558  -10.862 1.00 0.00 ? 63  LEU A HD13 2  
ATOM 4177  H HD21 . LEU A 1 63  ? -9.627  -0.046  -12.309 1.00 0.00 ? 63  LEU A HD21 2  
ATOM 4178  H HD22 . LEU A 1 63  ? -10.972 -1.024  -12.893 1.00 0.00 ? 63  LEU A HD22 2  
ATOM 4179  H HD23 . LEU A 1 63  ? -9.324  -1.415  -13.376 1.00 0.00 ? 63  LEU A HD23 2  
ATOM 4180  N N    . ASP A 1 64  ? -6.937  -1.640  -12.788 1.00 0.00 ? 64  ASP A N    2  
ATOM 4181  C CA   . ASP A 1 64  ? -6.361  -2.564  -13.746 1.00 0.00 ? 64  ASP A CA   2  
ATOM 4182  C C    . ASP A 1 64  ? -7.213  -3.825  -13.860 1.00 0.00 ? 64  ASP A C    2  
ATOM 4183  O O    . ASP A 1 64  ? -6.770  -4.922  -13.519 1.00 0.00 ? 64  ASP A O    2  
ATOM 4184  C CB   . ASP A 1 64  ? -4.928  -2.929  -13.351 1.00 0.00 ? 64  ASP A CB   2  
ATOM 4185  C CG   . ASP A 1 64  ? -4.028  -3.125  -14.555 1.00 0.00 ? 64  ASP A CG   2  
ATOM 4186  O OD1  . ASP A 1 64  ? -3.958  -4.263  -15.066 1.00 0.00 ? 64  ASP A OD1  2  
ATOM 4187  O OD2  . ASP A 1 64  ? -3.390  -2.142  -14.987 1.00 0.00 ? 64  ASP A OD2  2  
ATOM 4188  H H    . ASP A 1 64  ? -7.327  -0.800  -13.109 1.00 0.00 ? 64  ASP A H    2  
ATOM 4189  H HA   . ASP A 1 64  ? -6.346  -2.064  -14.695 1.00 0.00 ? 64  ASP A HA   2  
ATOM 4190  H HB2  . ASP A 1 64  ? -4.516  -2.138  -12.743 1.00 0.00 ? 64  ASP A HB2  2  
ATOM 4191  H HB3  . ASP A 1 64  ? -4.941  -3.847  -12.781 1.00 0.00 ? 64  ASP A HB3  2  
ATOM 4192  N N    . LEU A 1 65  ? -8.442  -3.657  -14.337 1.00 0.00 ? 65  LEU A N    2  
ATOM 4193  C CA   . LEU A 1 65  ? -9.364  -4.776  -14.494 1.00 0.00 ? 65  LEU A CA   2  
ATOM 4194  C C    . LEU A 1 65  ? -9.818  -4.902  -15.947 1.00 0.00 ? 65  LEU A C    2  
ATOM 4195  O O    . LEU A 1 65  ? -9.781  -3.933  -16.704 1.00 0.00 ? 65  LEU A O    2  
ATOM 4196  C CB   . LEU A 1 65  ? -10.578 -4.594  -13.576 1.00 0.00 ? 65  LEU A CB   2  
ATOM 4197  C CG   . LEU A 1 65  ? -10.660 -5.574  -12.402 1.00 0.00 ? 65  LEU A CG   2  
ATOM 4198  C CD1  . LEU A 1 65  ? -10.516 -7.007  -12.891 1.00 0.00 ? 65  LEU A CD1  2  
ATOM 4199  C CD2  . LEU A 1 65  ? -9.596  -5.255  -11.361 1.00 0.00 ? 65  LEU A CD2  2  
ATOM 4200  H H    . LEU A 1 65  ? -8.736  -2.758  -14.590 1.00 0.00 ? 65  LEU A H    2  
ATOM 4201  H HA   . LEU A 1 65  ? -8.843  -5.678  -14.213 1.00 0.00 ? 65  LEU A HA   2  
ATOM 4202  H HB2  . LEU A 1 65  ? -10.551 -3.589  -13.177 1.00 0.00 ? 65  LEU A HB2  2  
ATOM 4203  H HB3  . LEU A 1 65  ? -11.473 -4.703  -14.169 1.00 0.00 ? 65  LEU A HB3  2  
ATOM 4204  H HG   . LEU A 1 65  ? -11.628 -5.479  -11.931 1.00 0.00 ? 65  LEU A HG   2  
ATOM 4205  H HD11 . LEU A 1 65  ? -11.001 -7.110  -13.851 1.00 0.00 ? 65  LEU A HD11 2  
ATOM 4206  H HD12 . LEU A 1 65  ? -10.977 -7.678  -12.181 1.00 0.00 ? 65  LEU A HD12 2  
ATOM 4207  H HD13 . LEU A 1 65  ? -9.468  -7.251  -12.989 1.00 0.00 ? 65  LEU A HD13 2  
ATOM 4208  H HD21 . LEU A 1 65  ? -8.758  -4.768  -11.839 1.00 0.00 ? 65  LEU A HD21 2  
ATOM 4209  H HD22 . LEU A 1 65  ? -9.262  -6.170  -10.895 1.00 0.00 ? 65  LEU A HD22 2  
ATOM 4210  H HD23 . LEU A 1 65  ? -10.011 -4.599  -10.609 1.00 0.00 ? 65  LEU A HD23 2  
ATOM 4211  N N    . ASN A 1 66  ? -10.243 -6.102  -16.328 1.00 0.00 ? 66  ASN A N    2  
ATOM 4212  C CA   . ASN A 1 66  ? -10.701 -6.351  -17.690 1.00 0.00 ? 66  ASN A CA   2  
ATOM 4213  C C    . ASN A 1 66  ? -11.645 -7.548  -17.736 1.00 0.00 ? 66  ASN A C    2  
ATOM 4214  O O    . ASN A 1 66  ? -12.858 -7.390  -17.887 1.00 0.00 ? 66  ASN A O    2  
ATOM 4215  C CB   . ASN A 1 66  ? -9.507  -6.593  -18.614 1.00 0.00 ? 66  ASN A CB   2  
ATOM 4216  C CG   . ASN A 1 66  ? -8.756  -5.316  -18.936 1.00 0.00 ? 66  ASN A CG   2  
ATOM 4217  O OD1  . ASN A 1 66  ? -9.064  -4.630  -19.911 1.00 0.00 ? 66  ASN A OD1  2  
ATOM 4218  N ND2  . ASN A 1 66  ? -7.762  -4.992  -18.117 1.00 0.00 ? 66  ASN A ND2  2  
ATOM 4219  H H    . ASN A 1 66  ? -10.249 -6.836  -15.679 1.00 0.00 ? 66  ASN A H    2  
ATOM 4220  H HA   . ASN A 1 66  ? -11.234 -5.474  -18.026 1.00 0.00 ? 66  ASN A HA   2  
ATOM 4221  H HB2  . ASN A 1 66  ? -8.824  -7.280  -18.137 1.00 0.00 ? 66  ASN A HB2  2  
ATOM 4222  H HB3  . ASN A 1 66  ? -9.858  -7.026  -19.539 1.00 0.00 ? 66  ASN A HB3  2  
ATOM 4223  H HD21 . ASN A 1 66  ? -7.573  -5.589  -17.359 1.00 0.00 ? 66  ASN A HD21 2  
ATOM 4224  H HD22 . ASN A 1 66  ? -7.258  -4.167  -18.305 1.00 0.00 ? 66  ASN A HD22 2  
ATOM 4225  N N    . SER A 1 67  ? -11.081 -8.744  -17.607 1.00 0.00 ? 67  SER A N    2  
ATOM 4226  C CA   . SER A 1 67  ? -11.870 -9.969  -17.634 1.00 0.00 ? 67  SER A CA   2  
ATOM 4227  C C    . SER A 1 67  ? -11.045 -11.157 -17.153 1.00 0.00 ? 67  SER A C    2  
ATOM 4228  O O    . SER A 1 67  ? -9.921  -11.370 -17.608 1.00 0.00 ? 67  SER A O    2  
ATOM 4229  C CB   . SER A 1 67  ? -12.389 -10.234 -19.049 1.00 0.00 ? 67  SER A CB   2  
ATOM 4230  O OG   . SER A 1 67  ? -11.368 -10.039 -20.011 1.00 0.00 ? 67  SER A OG   2  
ATOM 4231  H H    . SER A 1 67  ? -10.110 -8.803  -17.491 1.00 0.00 ? 67  SER A H    2  
ATOM 4232  H HA   . SER A 1 67  ? -12.711 -9.837  -16.971 1.00 0.00 ? 67  SER A HA   2  
ATOM 4233  H HB2  . SER A 1 67  ? -12.740 -11.253 -19.116 1.00 0.00 ? 67  SER A HB2  2  
ATOM 4234  H HB3  . SER A 1 67  ? -13.204 -9.558  -19.264 1.00 0.00 ? 67  SER A HB3  2  
ATOM 4235  H HG   . SER A 1 67  ? -11.002 -9.156  -19.918 1.00 0.00 ? 67  SER A HG   2  
ATOM 4236  N N    . ASP A 1 68  ? -11.609 -11.928 -16.229 1.00 0.00 ? 68  ASP A N    2  
ATOM 4237  C CA   . ASP A 1 68  ? -10.924 -13.095 -15.686 1.00 0.00 ? 68  ASP A CA   2  
ATOM 4238  C C    . ASP A 1 68  ? -9.623  -12.689 -14.999 1.00 0.00 ? 68  ASP A C    2  
ATOM 4239  O O    . ASP A 1 68  ? -8.607  -12.463 -15.655 1.00 0.00 ? 68  ASP A O    2  
ATOM 4240  C CB   . ASP A 1 68  ? -10.635 -14.106 -16.798 1.00 0.00 ? 68  ASP A CB   2  
ATOM 4241  C CG   . ASP A 1 68  ? -11.054 -15.514 -16.421 1.00 0.00 ? 68  ASP A CG   2  
ATOM 4242  O OD1  . ASP A 1 68  ? -12.272 -15.785 -16.400 1.00 0.00 ? 68  ASP A OD1  2  
ATOM 4243  O OD2  . ASP A 1 68  ? -10.162 -16.344 -16.148 1.00 0.00 ? 68  ASP A OD2  2  
ATOM 4244  H H    . ASP A 1 68  ? -12.508 -11.707 -15.905 1.00 0.00 ? 68  ASP A H    2  
ATOM 4245  H HA   . ASP A 1 68  ? -11.575 -13.551 -14.956 1.00 0.00 ? 68  ASP A HA   2  
ATOM 4246  H HB2  . ASP A 1 68  ? -11.176 -13.817 -17.687 1.00 0.00 ? 68  ASP A HB2  2  
ATOM 4247  H HB3  . ASP A 1 68  ? -9.576  -14.108 -17.010 1.00 0.00 ? 68  ASP A HB3  2  
ATOM 4248  N N    . GLY A 1 69  ? -9.664  -12.597 -13.673 1.00 0.00 ? 69  GLY A N    2  
ATOM 4249  C CA   . GLY A 1 69  ? -8.483  -12.218 -12.920 1.00 0.00 ? 69  GLY A CA   2  
ATOM 4250  C C    . GLY A 1 69  ? -8.820  -11.702 -11.534 1.00 0.00 ? 69  GLY A C    2  
ATOM 4251  O O    . GLY A 1 69  ? -8.029  -11.842 -10.602 1.00 0.00 ? 69  GLY A O    2  
ATOM 4252  H H    . GLY A 1 69  ? -10.502 -12.788 -13.203 1.00 0.00 ? 69  GLY A H    2  
ATOM 4253  H HA2  . GLY A 1 69  ? -7.839  -13.079 -12.824 1.00 0.00 ? 69  GLY A HA2  2  
ATOM 4254  H HA3  . GLY A 1 69  ? -7.956  -11.446 -13.461 1.00 0.00 ? 69  GLY A HA3  2  
ATOM 4255  N N    . GLN A 1 70  ? -10.001 -11.104 -11.400 1.00 0.00 ? 70  GLN A N    2  
ATOM 4256  C CA   . GLN A 1 70  ? -10.445 -10.566 -10.119 1.00 0.00 ? 70  GLN A CA   2  
ATOM 4257  C C    . GLN A 1 70  ? -9.484  -9.491  -9.619  1.00 0.00 ? 70  GLN A C    2  
ATOM 4258  O O    . GLN A 1 70  ? -8.622  -9.026  -10.363 1.00 0.00 ? 70  GLN A O    2  
ATOM 4259  C CB   . GLN A 1 70  ? -10.563 -11.692 -9.084  1.00 0.00 ? 70  GLN A CB   2  
ATOM 4260  C CG   . GLN A 1 70  ? -11.898 -12.417 -9.130  1.00 0.00 ? 70  GLN A CG   2  
ATOM 4261  C CD   . GLN A 1 70  ? -12.934 -11.802 -8.207  1.00 0.00 ? 70  GLN A CD   2  
ATOM 4262  O OE1  . GLN A 1 70  ? -13.601 -12.506 -7.449  1.00 0.00 ? 70  GLN A OE1  2  
ATOM 4263  N NE2  . GLN A 1 70  ? -13.075 -10.482 -8.265  1.00 0.00 ? 70  GLN A NE2  2  
ATOM 4264  H H    . GLN A 1 70  ? -10.587 -11.025 -12.180 1.00 0.00 ? 70  GLN A H    2  
ATOM 4265  H HA   . GLN A 1 70  ? -11.415 -10.122 -10.269 1.00 0.00 ? 70  GLN A HA   2  
ATOM 4266  H HB2  . GLN A 1 70  ? -9.779  -12.412 -9.266  1.00 0.00 ? 70  GLN A HB2  2  
ATOM 4267  H HB3  . GLN A 1 70  ? -10.433 -11.279 -8.095  1.00 0.00 ? 70  GLN A HB3  2  
ATOM 4268  H HG2  . GLN A 1 70  ? -12.277 -12.385 -10.141 1.00 0.00 ? 70  GLN A HG2  2  
ATOM 4269  H HG3  . GLN A 1 70  ? -11.743 -13.446 -8.838  1.00 0.00 ? 70  GLN A HG3  2  
ATOM 4270  H HE21 . GLN A 1 70  ? -12.512 -9.983  -8.894  1.00 0.00 ? 70  GLN A HE21 2  
ATOM 4271  H HE22 . GLN A 1 70  ? -13.737 -10.060 -7.675  1.00 0.00 ? 70  GLN A HE22 2  
ATOM 4272  N N    . LEU A 1 71  ? -9.634  -9.101  -8.354  1.00 0.00 ? 71  LEU A N    2  
ATOM 4273  C CA   . LEU A 1 71  ? -8.774  -8.092  -7.761  1.00 0.00 ? 71  LEU A CA   2  
ATOM 4274  C C    . LEU A 1 71  ? -7.327  -8.611  -7.735  1.00 0.00 ? 71  LEU A C    2  
ATOM 4275  O O    . LEU A 1 71  ? -6.868  -9.176  -8.727  1.00 0.00 ? 71  LEU A O    2  
ATOM 4276  C CB   . LEU A 1 71  ? -9.306  -7.725  -6.363  1.00 0.00 ? 71  LEU A CB   2  
ATOM 4277  C CG   . LEU A 1 71  ? -10.051 -6.384  -6.252  1.00 0.00 ? 71  LEU A CG   2  
ATOM 4278  C CD1  . LEU A 1 71  ? -9.101  -5.279  -5.818  1.00 0.00 ? 71  LEU A CD1  2  
ATOM 4279  C CD2  . LEU A 1 71  ? -10.738 -6.017  -7.563  1.00 0.00 ? 71  LEU A CD2  2  
ATOM 4280  H H    . LEU A 1 71  ? -10.333 -9.506  -7.804  1.00 0.00 ? 71  LEU A H    2  
ATOM 4281  H HA   . LEU A 1 71  ? -8.813  -7.222  -8.395  1.00 0.00 ? 71  LEU A HA   2  
ATOM 4282  H HB2  . LEU A 1 71  ? -9.985  -8.502  -6.053  1.00 0.00 ? 71  LEU A HB2  2  
ATOM 4283  H HB3  . LEU A 1 71  ? -8.484  -7.703  -5.671  1.00 0.00 ? 71  LEU A HB3  2  
ATOM 4284  H HG   . LEU A 1 71  ? -10.815 -6.474  -5.493  1.00 0.00 ? 71  LEU A HG   2  
ATOM 4285  H HD11 . LEU A 1 71  ? -8.898  -4.626  -6.655  1.00 0.00 ? 71  LEU A HD11 2  
ATOM 4286  H HD12 . LEU A 1 71  ? -8.176  -5.719  -5.469  1.00 0.00 ? 71  LEU A HD12 2  
ATOM 4287  H HD13 . LEU A 1 71  ? -9.557  -4.709  -5.018  1.00 0.00 ? 71  LEU A HD13 2  
ATOM 4288  H HD21 . LEU A 1 71  ? -11.331 -6.853  -7.905  1.00 0.00 ? 71  LEU A HD21 2  
ATOM 4289  H HD22 . LEU A 1 71  ? -9.993  -5.775  -8.306  1.00 0.00 ? 71  LEU A HD22 2  
ATOM 4290  H HD23 . LEU A 1 71  ? -11.378 -5.163  -7.406  1.00 0.00 ? 71  LEU A HD23 2  
ATOM 4291  N N    . ASP A 1 72  ? -6.604  -8.442  -6.626  1.00 0.00 ? 72  ASP A N    2  
ATOM 4292  C CA   . ASP A 1 72  ? -5.220  -8.926  -6.553  1.00 0.00 ? 72  ASP A CA   2  
ATOM 4293  C C    . ASP A 1 72  ? -4.530  -8.474  -5.270  1.00 0.00 ? 72  ASP A C    2  
ATOM 4294  O O    . ASP A 1 72  ? -5.172  -7.972  -4.349  1.00 0.00 ? 72  ASP A O    2  
ATOM 4295  C CB   . ASP A 1 72  ? -4.408  -8.445  -7.762  1.00 0.00 ? 72  ASP A CB   2  
ATOM 4296  C CG   . ASP A 1 72  ? -3.514  -9.531  -8.327  1.00 0.00 ? 72  ASP A CG   2  
ATOM 4297  O OD1  . ASP A 1 72  ? -4.029  -10.628 -8.628  1.00 0.00 ? 72  ASP A OD1  2  
ATOM 4298  O OD2  . ASP A 1 72  ? -2.298  -9.284  -8.469  1.00 0.00 ? 72  ASP A OD2  2  
ATOM 4299  H H    . ASP A 1 72  ? -7.000  -7.998  -5.848  1.00 0.00 ? 72  ASP A H    2  
ATOM 4300  H HA   . ASP A 1 72  ? -5.251  -10.005 -6.564  1.00 0.00 ? 72  ASP A HA   2  
ATOM 4301  H HB2  . ASP A 1 72  ? -5.081  -8.123  -8.538  1.00 0.00 ? 72  ASP A HB2  2  
ATOM 4302  H HB3  . ASP A 1 72  ? -3.787  -7.613  -7.463  1.00 0.00 ? 72  ASP A HB3  2  
ATOM 4303  N N    . PHE A 1 73  ? -3.213  -8.663  -5.221  1.00 0.00 ? 73  PHE A N    2  
ATOM 4304  C CA   . PHE A 1 73  ? -2.427  -8.286  -4.055  1.00 0.00 ? 73  PHE A CA   2  
ATOM 4305  C C    . PHE A 1 73  ? -2.204  -6.776  -3.991  1.00 0.00 ? 73  PHE A C    2  
ATOM 4306  O O    . PHE A 1 73  ? -2.630  -6.128  -3.034  1.00 0.00 ? 73  PHE A O    2  
ATOM 4307  C CB   . PHE A 1 73  ? -1.091  -9.036  -4.038  1.00 0.00 ? 73  PHE A CB   2  
ATOM 4308  C CG   . PHE A 1 73  ? -0.124  -8.603  -5.102  1.00 0.00 ? 73  PHE A CG   2  
ATOM 4309  C CD1  . PHE A 1 73  ? -0.249  -9.064  -6.403  1.00 0.00 ? 73  PHE A CD1  2  
ATOM 4310  C CD2  . PHE A 1 73  ? 0.911   -7.733  -4.799  1.00 0.00 ? 73  PHE A CD2  2  
ATOM 4311  C CE1  . PHE A 1 73  ? 0.642   -8.665  -7.382  1.00 0.00 ? 73  PHE A CE1  2  
ATOM 4312  C CE2  . PHE A 1 73  ? 1.805   -7.332  -5.774  1.00 0.00 ? 73  PHE A CE2  2  
ATOM 4313  C CZ   . PHE A 1 73  ? 1.669   -7.797  -7.067  1.00 0.00 ? 73  PHE A CZ   2  
ATOM 4314  H H    . PHE A 1 73  ? -2.761  -9.072  -5.989  1.00 0.00 ? 73  PHE A H    2  
ATOM 4315  H HA   . PHE A 1 73  ? -2.990  -8.579  -3.181  1.00 0.00 ? 73  PHE A HA   2  
ATOM 4316  H HB2  . PHE A 1 73  ? -0.619  -8.879  -3.083  1.00 0.00 ? 73  PHE A HB2  2  
ATOM 4317  H HB3  . PHE A 1 73  ? -1.279  -10.092 -4.169  1.00 0.00 ? 73  PHE A HB3  2  
ATOM 4318  H HD1  . PHE A 1 73  ? -1.051  -9.741  -6.652  1.00 0.00 ? 73  PHE A HD1  2  
ATOM 4319  H HD2  . PHE A 1 73  ? 1.019   -7.368  -3.785  1.00 0.00 ? 73  PHE A HD2  2  
ATOM 4320  H HE1  . PHE A 1 73  ? 0.534   -9.030  -8.393  1.00 0.00 ? 73  PHE A HE1  2  
ATOM 4321  H HE2  . PHE A 1 73  ? 2.607   -6.653  -5.524  1.00 0.00 ? 73  PHE A HE2  2  
ATOM 4322  H HZ   . PHE A 1 73  ? 2.367   -7.485  -7.830  1.00 0.00 ? 73  PHE A HZ   2  
ATOM 4323  N N    . GLN A 1 74  ? -1.550  -6.204  -5.004  1.00 0.00 ? 74  GLN A N    2  
ATOM 4324  C CA   . GLN A 1 74  ? -1.318  -4.768  -5.007  1.00 0.00 ? 74  GLN A CA   2  
ATOM 4325  C C    . GLN A 1 74  ? -2.558  -4.033  -5.471  1.00 0.00 ? 74  GLN A C    2  
ATOM 4326  O O    . GLN A 1 74  ? -2.768  -2.884  -5.103  1.00 0.00 ? 74  GLN A O    2  
ATOM 4327  C CB   . GLN A 1 74  ? -0.122  -4.368  -5.870  1.00 0.00 ? 74  GLN A CB   2  
ATOM 4328  C CG   . GLN A 1 74  ? 0.630   -3.165  -5.309  1.00 0.00 ? 74  GLN A CG   2  
ATOM 4329  C CD   . GLN A 1 74  ? 0.421   -1.894  -6.119  1.00 0.00 ? 74  GLN A CD   2  
ATOM 4330  O OE1  . GLN A 1 74  ? 0.827   -1.817  -7.278  1.00 0.00 ? 74  GLN A OE1  2  
ATOM 4331  N NE2  . GLN A 1 74  ? -0.215  -0.885  -5.515  1.00 0.00 ? 74  GLN A NE2  2  
ATOM 4332  H H    . GLN A 1 74  ? -1.238  -6.747  -5.754  1.00 0.00 ? 74  GLN A H    2  
ATOM 4333  H HA   . GLN A 1 74  ? -1.117  -4.478  -3.986  1.00 0.00 ? 74  GLN A HA   2  
ATOM 4334  H HB2  . GLN A 1 74  ? 0.562   -5.202  -5.932  1.00 0.00 ? 74  GLN A HB2  2  
ATOM 4335  H HB3  . GLN A 1 74  ? -0.470  -4.120  -6.861  1.00 0.00 ? 74  GLN A HB3  2  
ATOM 4336  H HG2  . GLN A 1 74  ? 0.291   -2.986  -4.300  1.00 0.00 ? 74  GLN A HG2  2  
ATOM 4337  H HG3  . GLN A 1 74  ? 1.686   -3.395  -5.295  1.00 0.00 ? 74  GLN A HG3  2  
ATOM 4338  H HE21 . GLN A 1 74  ? -0.524  -1.006  -4.586  1.00 0.00 ? 74  GLN A HE21 2  
ATOM 4339  H HE22 . GLN A 1 74  ? -0.338  -0.051  -6.022  1.00 0.00 ? 74  GLN A HE22 2  
ATOM 4340  N N    . GLU A 1 75  ? -3.400  -4.701  -6.263  1.00 0.00 ? 75  GLU A N    2  
ATOM 4341  C CA   . GLU A 1 75  ? -4.633  -4.079  -6.733  1.00 0.00 ? 75  GLU A CA   2  
ATOM 4342  C C    . GLU A 1 75  ? -5.325  -3.400  -5.560  1.00 0.00 ? 75  GLU A C    2  
ATOM 4343  O O    . GLU A 1 75  ? -5.969  -2.363  -5.713  1.00 0.00 ? 75  GLU A O    2  
ATOM 4344  C CB   . GLU A 1 75  ? -5.562  -5.113  -7.374  1.00 0.00 ? 75  GLU A CB   2  
ATOM 4345  C CG   . GLU A 1 75  ? -5.815  -4.862  -8.851  1.00 0.00 ? 75  GLU A CG   2  
ATOM 4346  C CD   . GLU A 1 75  ? -5.948  -6.143  -9.650  1.00 0.00 ? 75  GLU A CD   2  
ATOM 4347  O OE1  . GLU A 1 75  ? -7.069  -6.688  -9.717  1.00 0.00 ? 75  GLU A OE1  2  
ATOM 4348  O OE2  . GLU A 1 75  ? -4.928  -6.602  -10.209 1.00 0.00 ? 75  GLU A OE2  2  
ATOM 4349  H H    . GLU A 1 75  ? -3.198  -5.625  -6.518  1.00 0.00 ? 75  GLU A H    2  
ATOM 4350  H HA   . GLU A 1 75  ? -4.371  -3.330  -7.467  1.00 0.00 ? 75  GLU A HA   2  
ATOM 4351  H HB2  . GLU A 1 75  ? -5.123  -6.093  -7.266  1.00 0.00 ? 75  GLU A HB2  2  
ATOM 4352  H HB3  . GLU A 1 75  ? -6.514  -5.095  -6.860  1.00 0.00 ? 75  GLU A HB3  2  
ATOM 4353  H HG2  . GLU A 1 75  ? -6.728  -4.296  -8.957  1.00 0.00 ? 75  GLU A HG2  2  
ATOM 4354  H HG3  . GLU A 1 75  ? -4.990  -4.290  -9.250  1.00 0.00 ? 75  GLU A HG3  2  
ATOM 4355  N N    . PHE A 1 76  ? -5.145  -3.987  -4.376  1.00 0.00 ? 76  PHE A N    2  
ATOM 4356  C CA   . PHE A 1 76  ? -5.705  -3.442  -3.155  1.00 0.00 ? 76  PHE A CA   2  
ATOM 4357  C C    . PHE A 1 76  ? -4.830  -2.308  -2.647  1.00 0.00 ? 76  PHE A C    2  
ATOM 4358  O O    . PHE A 1 76  ? -5.301  -1.192  -2.437  1.00 0.00 ? 76  PHE A O    2  
ATOM 4359  C CB   . PHE A 1 76  ? -5.815  -4.523  -2.084  1.00 0.00 ? 76  PHE A CB   2  
ATOM 4360  C CG   . PHE A 1 76  ? -6.996  -4.328  -1.183  1.00 0.00 ? 76  PHE A CG   2  
ATOM 4361  C CD1  . PHE A 1 76  ? -6.908  -3.497  -0.081  1.00 0.00 ? 76  PHE A CD1  2  
ATOM 4362  C CD2  . PHE A 1 76  ? -8.197  -4.966  -1.446  1.00 0.00 ? 76  PHE A CD2  2  
ATOM 4363  C CE1  . PHE A 1 76  ? -7.996  -3.305  0.747   1.00 0.00 ? 76  PHE A CE1  2  
ATOM 4364  C CE2  . PHE A 1 76  ? -9.289  -4.779  -0.621  1.00 0.00 ? 76  PHE A CE2  2  
ATOM 4365  C CZ   . PHE A 1 76  ? -9.188  -3.948  0.477   1.00 0.00 ? 76  PHE A CZ   2  
ATOM 4366  H H    . PHE A 1 76  ? -4.597  -4.798  -4.325  1.00 0.00 ? 76  PHE A H    2  
ATOM 4367  H HA   . PHE A 1 76  ? -6.689  -3.058  -3.377  1.00 0.00 ? 76  PHE A HA   2  
ATOM 4368  H HB2  . PHE A 1 76  ? -5.910  -5.487  -2.560  1.00 0.00 ? 76  PHE A HB2  2  
ATOM 4369  H HB3  . PHE A 1 76  ? -4.919  -4.511  -1.474  1.00 0.00 ? 76  PHE A HB3  2  
ATOM 4370  H HD1  . PHE A 1 76  ? -5.976  -2.994  0.132   1.00 0.00 ? 76  PHE A HD1  2  
ATOM 4371  H HD2  . PHE A 1 76  ? -8.275  -5.616  -2.304  1.00 0.00 ? 76  PHE A HD2  2  
ATOM 4372  H HE1  . PHE A 1 76  ? -7.915  -2.655  1.604   1.00 0.00 ? 76  PHE A HE1  2  
ATOM 4373  H HE2  . PHE A 1 76  ? -10.220 -5.281  -0.833  1.00 0.00 ? 76  PHE A HE2  2  
ATOM 4374  H HZ   . PHE A 1 76  ? -10.039 -3.799  1.121   1.00 0.00 ? 76  PHE A HZ   2  
ATOM 4375  N N    . LEU A 1 77  ? -3.542  -2.597  -2.470  1.00 0.00 ? 77  LEU A N    2  
ATOM 4376  C CA   . LEU A 1 77  ? -2.595  -1.592  -2.007  1.00 0.00 ? 77  LEU A CA   2  
ATOM 4377  C C    . LEU A 1 77  ? -2.628  -0.387  -2.938  1.00 0.00 ? 77  LEU A C    2  
ATOM 4378  O O    . LEU A 1 77  ? -2.481  0.751   -2.506  1.00 0.00 ? 77  LEU A O    2  
ATOM 4379  C CB   . LEU A 1 77  ? -1.187  -2.180  -1.922  1.00 0.00 ? 77  LEU A CB   2  
ATOM 4380  C CG   . LEU A 1 77  ? -0.812  -2.718  -0.540  1.00 0.00 ? 77  LEU A CG   2  
ATOM 4381  C CD1  . LEU A 1 77  ? 0.421   -3.604  -0.617  1.00 0.00 ? 77  LEU A CD1  2  
ATOM 4382  C CD2  . LEU A 1 77  ? -0.594  -1.567  0.429   1.00 0.00 ? 77  LEU A CD2  2  
ATOM 4383  H H    . LEU A 1 77  ? -3.220  -3.501  -2.667  1.00 0.00 ? 77  LEU A H    2  
ATOM 4384  H HA   . LEU A 1 77  ? -2.906  -1.276  -1.022  1.00 0.00 ? 77  LEU A HA   2  
ATOM 4385  H HB2  . LEU A 1 77  ? -1.109  -2.987  -2.637  1.00 0.00 ? 77  LEU A HB2  2  
ATOM 4386  H HB3  . LEU A 1 77  ? -0.478  -1.411  -2.190  1.00 0.00 ? 77  LEU A HB3  2  
ATOM 4387  H HG   . LEU A 1 77  ? -1.627  -3.319  -0.165  1.00 0.00 ? 77  LEU A HG   2  
ATOM 4388  H HD11 . LEU A 1 77  ? 0.114   -4.640  -0.627  1.00 0.00 ? 77  LEU A HD11 2  
ATOM 4389  H HD12 . LEU A 1 77  ? 1.055   -3.423  0.243   1.00 0.00 ? 77  LEU A HD12 2  
ATOM 4390  H HD13 . LEU A 1 77  ? 0.969   -3.382  -1.521  1.00 0.00 ? 77  LEU A HD13 2  
ATOM 4391  H HD21 . LEU A 1 77  ? -1.442  -1.495  1.093   1.00 0.00 ? 77  LEU A HD21 2  
ATOM 4392  H HD22 . LEU A 1 77  ? -0.492  -0.646  -0.125  1.00 0.00 ? 77  LEU A HD22 2  
ATOM 4393  H HD23 . LEU A 1 77  ? 0.302   -1.744  1.005   1.00 0.00 ? 77  LEU A HD23 2  
ATOM 4394  N N    . ASN A 1 78  ? -2.865  -0.655  -4.218  1.00 0.00 ? 78  ASN A N    2  
ATOM 4395  C CA   . ASN A 1 78  ? -2.970  0.396   -5.216  1.00 0.00 ? 78  ASN A CA   2  
ATOM 4396  C C    . ASN A 1 78  ? -4.324  1.074   -5.060  1.00 0.00 ? 78  ASN A C    2  
ATOM 4397  O O    . ASN A 1 78  ? -4.451  2.290   -5.207  1.00 0.00 ? 78  ASN A O    2  
ATOM 4398  C CB   . ASN A 1 78  ? -2.812  -0.186  -6.632  1.00 0.00 ? 78  ASN A CB   2  
ATOM 4399  C CG   . ASN A 1 78  ? -3.769  0.421   -7.645  1.00 0.00 ? 78  ASN A CG   2  
ATOM 4400  O OD1  . ASN A 1 78  ? -3.720  1.620   -7.921  1.00 0.00 ? 78  ASN A OD1  2  
ATOM 4401  N ND2  . ASN A 1 78  ? -4.647  -0.406  -8.200  1.00 0.00 ? 78  ASN A ND2  2  
ATOM 4402  H H    . ASN A 1 78  ? -3.002  -1.584  -4.490  1.00 0.00 ? 78  ASN A H    2  
ATOM 4403  H HA   . ASN A 1 78  ? -2.187  1.118   -5.032  1.00 0.00 ? 78  ASN A HA   2  
ATOM 4404  H HB2  . ASN A 1 78  ? -1.807  -0.008  -6.978  1.00 0.00 ? 78  ASN A HB2  2  
ATOM 4405  H HB3  . ASN A 1 78  ? -2.989  -1.251  -6.596  1.00 0.00 ? 78  ASN A HB3  2  
ATOM 4406  H HD21 . ASN A 1 78  ? -4.628  -1.352  -7.928  1.00 0.00 ? 78  ASN A HD21 2  
ATOM 4407  H HD22 . ASN A 1 78  ? -5.278  -0.039  -8.858  1.00 0.00 ? 78  ASN A HD22 2  
ATOM 4408  N N    . LEU A 1 79  ? -5.335  0.265   -4.749  1.00 0.00 ? 79  LEU A N    2  
ATOM 4409  C CA   . LEU A 1 79  ? -6.681  0.767   -4.558  1.00 0.00 ? 79  LEU A CA   2  
ATOM 4410  C C    . LEU A 1 79  ? -6.733  1.666   -3.329  1.00 0.00 ? 79  LEU A C    2  
ATOM 4411  O O    . LEU A 1 79  ? -7.082  2.840   -3.428  1.00 0.00 ? 79  LEU A O    2  
ATOM 4412  C CB   . LEU A 1 79  ? -7.656  -0.404  -4.396  1.00 0.00 ? 79  LEU A CB   2  
ATOM 4413  C CG   . LEU A 1 79  ? -8.580  -0.673  -5.589  1.00 0.00 ? 79  LEU A CG   2  
ATOM 4414  C CD1  . LEU A 1 79  ? -7.818  -0.652  -6.904  1.00 0.00 ? 79  LEU A CD1  2  
ATOM 4415  C CD2  . LEU A 1 79  ? -9.299  -2.001  -5.416  1.00 0.00 ? 79  LEU A CD2  2  
ATOM 4416  H H    . LEU A 1 79  ? -5.166  -0.693  -4.642  1.00 0.00 ? 79  LEU A H    2  
ATOM 4417  H HA   . LEU A 1 79  ? -6.951  1.340   -5.429  1.00 0.00 ? 79  LEU A HA   2  
ATOM 4418  H HB2  . LEU A 1 79  ? -7.080  -1.297  -4.206  1.00 0.00 ? 79  LEU A HB2  2  
ATOM 4419  H HB3  . LEU A 1 79  ? -8.274  -0.211  -3.531  1.00 0.00 ? 79  LEU A HB3  2  
ATOM 4420  H HG   . LEU A 1 79  ? -9.323  0.100   -5.631  1.00 0.00 ? 79  LEU A HG   2  
ATOM 4421  H HD11 . LEU A 1 79  ? -7.612  -1.665  -7.217  1.00 0.00 ? 79  LEU A HD11 2  
ATOM 4422  H HD12 . LEU A 1 79  ? -6.892  -0.114  -6.779  1.00 0.00 ? 79  LEU A HD12 2  
ATOM 4423  H HD13 . LEU A 1 79  ? -8.422  -0.160  -7.654  1.00 0.00 ? 79  LEU A HD13 2  
ATOM 4424  H HD21 . LEU A 1 79  ? -8.777  -2.602  -4.686  1.00 0.00 ? 79  LEU A HD21 2  
ATOM 4425  H HD22 . LEU A 1 79  ? -9.325  -2.524  -6.362  1.00 0.00 ? 79  LEU A HD22 2  
ATOM 4426  H HD23 . LEU A 1 79  ? -10.308 -1.819  -5.077  1.00 0.00 ? 79  LEU A HD23 2  
ATOM 4427  N N    . ILE A 1 80  ? -6.357  1.115   -2.177  1.00 0.00 ? 80  ILE A N    2  
ATOM 4428  C CA   . ILE A 1 80  ? -6.344  1.878   -0.936  1.00 0.00 ? 80  ILE A CA   2  
ATOM 4429  C C    . ILE A 1 80  ? -5.172  2.847   -0.917  1.00 0.00 ? 80  ILE A C    2  
ATOM 4430  O O    . ILE A 1 80  ? -5.329  4.018   -0.570  1.00 0.00 ? 80  ILE A O    2  
ATOM 4431  C CB   . ILE A 1 80  ? -6.309  0.974   0.313   1.00 0.00 ? 80  ILE A CB   2  
ATOM 4432  C CG1  . ILE A 1 80  ? -6.790  1.756   1.531   1.00 0.00 ? 80  ILE A CG1  2  
ATOM 4433  C CG2  . ILE A 1 80  ? -4.917  0.432   0.560   1.00 0.00 ? 80  ILE A CG2  2  
ATOM 4434  C CD1  . ILE A 1 80  ? -5.697  2.565   2.196   1.00 0.00 ? 80  ILE A CD1  2  
ATOM 4435  H H    . ILE A 1 80  ? -6.072  0.182   -2.165  1.00 0.00 ? 80  ILE A H    2  
ATOM 4436  H HA   . ILE A 1 80  ? -7.251  2.447   -0.900  1.00 0.00 ? 80  ILE A HA   2  
ATOM 4437  H HB   . ILE A 1 80  ? -6.971  0.138   0.147   1.00 0.00 ? 80  ILE A HB   2  
ATOM 4438  H HG12 . ILE A 1 80  ? -7.569  2.439   1.228   1.00 0.00 ? 80  ILE A HG12 2  
ATOM 4439  H HG13 . ILE A 1 80  ? -7.184  1.066   2.262   1.00 0.00 ? 80  ILE A HG13 2  
ATOM 4440  H HG21 . ILE A 1 80  ? -4.241  1.264   0.708   1.00 0.00 ? 80  ILE A HG21 2  
ATOM 4441  H HG22 . ILE A 1 80  ? -4.601  -0.148  -0.290  1.00 0.00 ? 80  ILE A HG22 2  
ATOM 4442  H HG23 . ILE A 1 80  ? -4.931  -0.188  1.450   1.00 0.00 ? 80  ILE A HG23 2  
ATOM 4443  H HD11 . ILE A 1 80  ? -5.379  2.062   3.097   1.00 0.00 ? 80  ILE A HD11 2  
ATOM 4444  H HD12 . ILE A 1 80  ? -6.075  3.544   2.438   1.00 0.00 ? 80  ILE A HD12 2  
ATOM 4445  H HD13 . ILE A 1 80  ? -4.854  2.662   1.523   1.00 0.00 ? 80  ILE A HD13 2  
ATOM 4446  N N    . GLY A 1 81  ? -3.996  2.366   -1.319  1.00 0.00 ? 81  GLY A N    2  
ATOM 4447  C CA   . GLY A 1 81  ? -2.829  3.228   -1.363  1.00 0.00 ? 81  GLY A CA   2  
ATOM 4448  C C    . GLY A 1 81  ? -3.131  4.474   -2.159  1.00 0.00 ? 81  GLY A C    2  
ATOM 4449  O O    . GLY A 1 81  ? -2.893  5.591   -1.701  1.00 0.00 ? 81  GLY A O    2  
ATOM 4450  H H    . GLY A 1 81  ? -3.927  1.431   -1.606  1.00 0.00 ? 81  GLY A H    2  
ATOM 4451  H HA2  . GLY A 1 81  ? -2.555  3.506   -0.355  1.00 0.00 ? 81  GLY A HA2  2  
ATOM 4452  H HA3  . GLY A 1 81  ? -2.009  2.703   -1.825  1.00 0.00 ? 81  GLY A HA3  2  
ATOM 4453  N N    . GLY A 1 82  ? -3.695  4.276   -3.349  1.00 0.00 ? 82  GLY A N    2  
ATOM 4454  C CA   . GLY A 1 82  ? -4.065  5.407   -4.183  1.00 0.00 ? 82  GLY A CA   2  
ATOM 4455  C C    . GLY A 1 82  ? -4.908  6.409   -3.414  1.00 0.00 ? 82  GLY A C    2  
ATOM 4456  O O    . GLY A 1 82  ? -4.677  7.615   -3.500  1.00 0.00 ? 82  GLY A O    2  
ATOM 4457  H H    . GLY A 1 82  ? -3.875  3.354   -3.653  1.00 0.00 ? 82  GLY A H    2  
ATOM 4458  H HA2  . GLY A 1 82  ? -3.166  5.899   -4.534  1.00 0.00 ? 82  GLY A HA2  2  
ATOM 4459  H HA3  . GLY A 1 82  ? -4.629  5.051   -5.033  1.00 0.00 ? 82  GLY A HA3  2  
ATOM 4460  N N    . LEU A 1 83  ? -5.878  5.915   -2.637  1.00 0.00 ? 83  LEU A N    2  
ATOM 4461  C CA   . LEU A 1 83  ? -6.722  6.799   -1.836  1.00 0.00 ? 83  LEU A CA   2  
ATOM 4462  C C    . LEU A 1 83  ? -5.860  7.647   -0.914  1.00 0.00 ? 83  LEU A C    2  
ATOM 4463  O O    . LEU A 1 83  ? -6.063  8.855   -0.793  1.00 0.00 ? 83  LEU A O    2  
ATOM 4464  C CB   . LEU A 1 83  ? -7.723  5.999   -1.002  1.00 0.00 ? 83  LEU A CB   2  
ATOM 4465  C CG   . LEU A 1 83  ? -8.308  4.773   -1.693  1.00 0.00 ? 83  LEU A CG   2  
ATOM 4466  C CD1  . LEU A 1 83  ? -9.391  4.140   -0.834  1.00 0.00 ? 83  LEU A CD1  2  
ATOM 4467  C CD2  . LEU A 1 83  ? -8.852  5.144   -3.065  1.00 0.00 ? 83  LEU A CD2  2  
ATOM 4468  H H    . LEU A 1 83  ? -6.017  4.941   -2.594  1.00 0.00 ? 83  LEU A H    2  
ATOM 4469  H HA   . LEU A 1 83  ? -7.259  7.449   -2.509  1.00 0.00 ? 83  LEU A HA   2  
ATOM 4470  H HB2  . LEU A 1 83  ? -7.230  5.675   -0.098  1.00 0.00 ? 83  LEU A HB2  2  
ATOM 4471  H HB3  . LEU A 1 83  ? -8.539  6.654   -0.731  1.00 0.00 ? 83  LEU A HB3  2  
ATOM 4472  H HG   . LEU A 1 83  ? -7.527  4.045   -1.829  1.00 0.00 ? 83  LEU A HG   2  
ATOM 4473  H HD11 . LEU A 1 83  ? -10.356 4.298   -1.292  1.00 0.00 ? 83  LEU A HD11 2  
ATOM 4474  H HD12 . LEU A 1 83  ? -9.380  4.591   0.148   1.00 0.00 ? 83  LEU A HD12 2  
ATOM 4475  H HD13 . LEU A 1 83  ? -9.203  3.079   -0.744  1.00 0.00 ? 83  LEU A HD13 2  
ATOM 4476  H HD21 . LEU A 1 83  ? -9.924  5.258   -3.008  1.00 0.00 ? 83  LEU A HD21 2  
ATOM 4477  H HD22 . LEU A 1 83  ? -8.608  4.364   -3.768  1.00 0.00 ? 83  LEU A HD22 2  
ATOM 4478  H HD23 . LEU A 1 83  ? -8.410  6.072   -3.392  1.00 0.00 ? 83  LEU A HD23 2  
ATOM 4479  N N    . ALA A 1 84  ? -4.885  7.008   -0.268  1.00 0.00 ? 84  ALA A N    2  
ATOM 4480  C CA   . ALA A 1 84  ? -3.988  7.717   0.636   1.00 0.00 ? 84  ALA A CA   2  
ATOM 4481  C C    . ALA A 1 84  ? -3.315  8.879   -0.070  1.00 0.00 ? 84  ALA A C    2  
ATOM 4482  O O    . ALA A 1 84  ? -3.167  9.962   0.488   1.00 0.00 ? 84  ALA A O    2  
ATOM 4483  C CB   . ALA A 1 84  ? -2.914  6.787   1.163   1.00 0.00 ? 84  ALA A CB   2  
ATOM 4484  H H    . ALA A 1 84  ? -4.767  6.036   -0.405  1.00 0.00 ? 84  ALA A H    2  
ATOM 4485  H HA   . ALA A 1 84  ? -4.562  8.086   1.472   1.00 0.00 ? 84  ALA A HA   2  
ATOM 4486  H HB1  . ALA A 1 84  ? -3.302  5.781   1.221   1.00 0.00 ? 84  ALA A HB1  2  
ATOM 4487  H HB2  . ALA A 1 84  ? -2.608  7.116   2.143   1.00 0.00 ? 84  ALA A HB2  2  
ATOM 4488  H HB3  . ALA A 1 84  ? -2.062  6.811   0.490   1.00 0.00 ? 84  ALA A HB3  2  
ATOM 4489  N N    . VAL A 1 85  ? -2.904  8.638   -1.300  1.00 0.00 ? 85  VAL A N    2  
ATOM 4490  C CA   . VAL A 1 85  ? -2.233  9.661   -2.088  1.00 0.00 ? 85  VAL A CA   2  
ATOM 4491  C C    . VAL A 1 85  ? -3.208  10.714  -2.565  1.00 0.00 ? 85  VAL A C    2  
ATOM 4492  O O    . VAL A 1 85  ? -2.817  11.804  -2.980  1.00 0.00 ? 85  VAL A O    2  
ATOM 4493  C CB   . VAL A 1 85  ? -1.468  9.084   -3.303  1.00 0.00 ? 85  VAL A CB   2  
ATOM 4494  C CG1  . VAL A 1 85  ? -0.013  9.491   -3.216  1.00 0.00 ? 85  VAL A CG1  2  
ATOM 4495  C CG2  . VAL A 1 85  ? -1.575  7.567   -3.390  1.00 0.00 ? 85  VAL A CG2  2  
ATOM 4496  H H    . VAL A 1 85  ? -3.055  7.754   -1.684  1.00 0.00 ? 85  VAL A H    2  
ATOM 4497  H HA   . VAL A 1 85  ? -1.521  10.140  -1.444  1.00 0.00 ? 85  VAL A HA   2  
ATOM 4498  H HB   . VAL A 1 85  ? -1.891  9.506   -4.205  1.00 0.00 ? 85  VAL A HB   2  
ATOM 4499  H HG11 . VAL A 1 85  ? 0.056   10.514  -2.883  1.00 0.00 ? 85  VAL A HG11 2  
ATOM 4500  H HG12 . VAL A 1 85  ? 0.448   9.393   -4.185  1.00 0.00 ? 85  VAL A HG12 2  
ATOM 4501  H HG13 . VAL A 1 85  ? 0.489   8.848   -2.506  1.00 0.00 ? 85  VAL A HG13 2  
ATOM 4502  H HG21 . VAL A 1 85  ? -2.600  7.267   -3.261  1.00 0.00 ? 85  VAL A HG21 2  
ATOM 4503  H HG22 . VAL A 1 85  ? -0.968  7.118   -2.616  1.00 0.00 ? 85  VAL A HG22 2  
ATOM 4504  H HG23 . VAL A 1 85  ? -1.223  7.237   -4.355  1.00 0.00 ? 85  VAL A HG23 2  
ATOM 4505  N N    . ALA A 1 86  ? -4.477  10.375  -2.514  1.00 0.00 ? 86  ALA A N    2  
ATOM 4506  C CA   . ALA A 1 86  ? -5.520  11.269  -2.948  1.00 0.00 ? 86  ALA A CA   2  
ATOM 4507  C C    . ALA A 1 86  ? -6.329  11.800  -1.770  1.00 0.00 ? 86  ALA A C    2  
ATOM 4508  O O    . ALA A 1 86  ? -7.430  12.319  -1.947  1.00 0.00 ? 86  ALA A O    2  
ATOM 4509  C CB   . ALA A 1 86  ? -6.403  10.519  -3.907  1.00 0.00 ? 86  ALA A CB   2  
ATOM 4510  H H    . ALA A 1 86  ? -4.723  9.486   -2.183  1.00 0.00 ? 86  ALA A H    2  
ATOM 4511  H HA   . ALA A 1 86  ? -5.069  12.095  -3.476  1.00 0.00 ? 86  ALA A HA   2  
ATOM 4512  H HB1  . ALA A 1 86  ? -6.659  11.153  -4.740  1.00 0.00 ? 86  ALA A HB1  2  
ATOM 4513  H HB2  . ALA A 1 86  ? -7.297  10.205  -3.395  1.00 0.00 ? 86  ALA A HB2  2  
ATOM 4514  H HB3  . ALA A 1 86  ? -5.863  9.650   -4.261  1.00 0.00 ? 86  ALA A HB3  2  
ATOM 4515  N N    . CYS A 1 87  ? -5.781  11.660  -0.566  1.00 0.00 ? 87  CYS A N    2  
ATOM 4516  C CA   . CYS A 1 87  ? -6.470  12.125  0.629   1.00 0.00 ? 87  CYS A CA   2  
ATOM 4517  C C    . CYS A 1 87  ? -5.510  12.363  1.797   1.00 0.00 ? 87  CYS A C    2  
ATOM 4518  O O    . CYS A 1 87  ? -5.719  13.278  2.592   1.00 0.00 ? 87  CYS A O    2  
ATOM 4519  C CB   . CYS A 1 87  ? -7.545  11.118  1.041   1.00 0.00 ? 87  CYS A CB   2  
ATOM 4520  S SG   . CYS A 1 87  ? -8.531  11.630  2.468   1.00 0.00 ? 87  CYS A SG   2  
ATOM 4521  H H    . CYS A 1 87  ? -4.906  11.235  -0.485  1.00 0.00 ? 87  CYS A H    2  
ATOM 4522  H HA   . CYS A 1 87  ? -6.951  13.061  0.386   1.00 0.00 ? 87  CYS A HA   2  
ATOM 4523  H HB2  . CYS A 1 87  ? -8.222  10.967  0.212   1.00 0.00 ? 87  CYS A HB2  2  
ATOM 4524  H HB3  . CYS A 1 87  ? -7.072  10.178  1.287   1.00 0.00 ? 87  CYS A HB3  2  
ATOM 4525  H HG   . CYS A 1 87  ? -9.441  11.730  2.179   1.00 0.00 ? 87  CYS A HG   2  
ATOM 4526  N N    . HIS A 1 88  ? -4.473  11.532  1.922   1.00 0.00 ? 88  HIS A N    2  
ATOM 4527  C CA   . HIS A 1 88  ? -3.530  11.683  3.033   1.00 0.00 ? 88  HIS A CA   2  
ATOM 4528  C C    . HIS A 1 88  ? -2.100  11.982  2.575   1.00 0.00 ? 88  HIS A C    2  
ATOM 4529  O O    . HIS A 1 88  ? -1.580  13.069  2.833   1.00 0.00 ? 88  HIS A O    2  
ATOM 4530  C CB   . HIS A 1 88  ? -3.537  10.431  3.908   1.00 0.00 ? 88  HIS A CB   2  
ATOM 4531  C CG   . HIS A 1 88  ? -4.430  10.544  5.104   1.00 0.00 ? 88  HIS A CG   2  
ATOM 4532  N ND1  . HIS A 1 88  ? -5.630  11.223  5.086   1.00 0.00 ? 88  HIS A ND1  2  
ATOM 4533  C CD2  . HIS A 1 88  ? -4.292  10.062  6.363   1.00 0.00 ? 88  HIS A CD2  2  
ATOM 4534  C CE1  . HIS A 1 88  ? -6.190  11.155  6.281   1.00 0.00 ? 88  HIS A CE1  2  
ATOM 4535  N NE2  . HIS A 1 88  ? -5.399  10.456  7.073   1.00 0.00 ? 88  HIS A NE2  2  
ATOM 4536  H H    . HIS A 1 88  ? -4.353  10.797  1.275   1.00 0.00 ? 88  HIS A H    2  
ATOM 4537  H HA   . HIS A 1 88  ? -3.870  12.515  3.631   1.00 0.00 ? 88  HIS A HA   2  
ATOM 4538  H HB2  . HIS A 1 88  ? -3.871  9.589   3.321   1.00 0.00 ? 88  HIS A HB2  2  
ATOM 4539  H HB3  . HIS A 1 88  ? -2.534  10.244  4.260   1.00 0.00 ? 88  HIS A HB3  2  
ATOM 4540  H HD1  . HIS A 1 88  ? -6.014  11.686  4.313   1.00 0.00 ? 88  HIS A HD1  2  
ATOM 4541  H HD2  . HIS A 1 88  ? -3.463  9.477   6.737   1.00 0.00 ? 88  HIS A HD2  2  
ATOM 4542  H HE1  . HIS A 1 88  ? -7.135  11.597  6.562   1.00 0.00 ? 88  HIS A HE1  2  
ATOM 4543  H HE2  . HIS A 1 88  ? -5.525  10.340  8.038   1.00 0.00 ? 88  HIS A HE2  2  
ATOM 4544  N N    . GLU A 1 89  ? -1.456  11.005  1.931   1.00 0.00 ? 89  GLU A N    2  
ATOM 4545  C CA   . GLU A 1 89  ? -0.067  11.154  1.471   1.00 0.00 ? 89  GLU A CA   2  
ATOM 4546  C C    . GLU A 1 89  ? 0.229   12.564  0.980   1.00 0.00 ? 89  GLU A C    2  
ATOM 4547  O O    . GLU A 1 89  ? -0.674  13.305  0.590   1.00 0.00 ? 89  GLU A O    2  
ATOM 4548  C CB   . GLU A 1 89  ? 0.266   10.151  0.363   1.00 0.00 ? 89  GLU A CB   2  
ATOM 4549  C CG   . GLU A 1 89  ? -0.226  8.737   0.634   1.00 0.00 ? 89  GLU A CG   2  
ATOM 4550  C CD   . GLU A 1 89  ? 0.901   7.724   0.699   1.00 0.00 ? 89  GLU A CD   2  
ATOM 4551  O OE1  . GLU A 1 89  ? 2.056   8.136   0.941   1.00 0.00 ? 89  GLU A OE1  2  
ATOM 4552  O OE2  . GLU A 1 89  ? 0.630   6.521   0.506   1.00 0.00 ? 89  GLU A OE2  2  
ATOM 4553  H H    . GLU A 1 89  ? -1.917  10.155  1.781   1.00 0.00 ? 89  GLU A H    2  
ATOM 4554  H HA   . GLU A 1 89  ? 0.572   10.956  2.315   1.00 0.00 ? 89  GLU A HA   2  
ATOM 4555  H HB2  . GLU A 1 89  ? -0.175  10.494  -0.557  1.00 0.00 ? 89  GLU A HB2  2  
ATOM 4556  H HB3  . GLU A 1 89  ? 1.338   10.116  0.241   1.00 0.00 ? 89  GLU A HB3  2  
ATOM 4557  H HG2  . GLU A 1 89  ? -0.752  8.725   1.575   1.00 0.00 ? 89  GLU A HG2  2  
ATOM 4558  H HG3  . GLU A 1 89  ? -0.901  8.448   -0.157  1.00 0.00 ? 89  GLU A HG3  2  
ATOM 4559  N N    . SER A 1 90  ? 1.507   12.925  1.010   1.00 0.00 ? 90  SER A N    2  
ATOM 4560  C CA   . SER A 1 90  ? 1.940   14.244  0.579   1.00 0.00 ? 90  SER A CA   2  
ATOM 4561  C C    . SER A 1 90  ? 1.760   14.418  -0.928  1.00 0.00 ? 90  SER A C    2  
ATOM 4562  O O    . SER A 1 90  ? 2.734   14.548  -1.670  1.00 0.00 ? 90  SER A O    2  
ATOM 4563  C CB   . SER A 1 90  ? 3.404   14.475  0.962   1.00 0.00 ? 90  SER A CB   2  
ATOM 4564  O OG   . SER A 1 90  ? 3.639   15.836  1.284   1.00 0.00 ? 90  SER A OG   2  
ATOM 4565  H H    . SER A 1 90  ? 2.175   12.288  1.337   1.00 0.00 ? 90  SER A H    2  
ATOM 4566  H HA   . SER A 1 90  ? 1.327   14.968  1.091   1.00 0.00 ? 90  SER A HA   2  
ATOM 4567  H HB2  . SER A 1 90  ? 3.649   13.868  1.821   1.00 0.00 ? 90  SER A HB2  2  
ATOM 4568  H HB3  . SER A 1 90  ? 4.038   14.199  0.133   1.00 0.00 ? 90  SER A HB3  2  
ATOM 4569  H HG   . SER A 1 90  ? 3.336   16.010  2.177   1.00 0.00 ? 90  SER A HG   2  
ATOM 4570  N N    . PHE A 1 91  ? 0.507   14.422  -1.373  1.00 0.00 ? 91  PHE A N    2  
ATOM 4571  C CA   . PHE A 1 91  ? 0.197   14.582  -2.788  1.00 0.00 ? 91  PHE A CA   2  
ATOM 4572  C C    . PHE A 1 91  ? -1.055  15.431  -2.973  1.00 0.00 ? 91  PHE A C    2  
ATOM 4573  O O    . PHE A 1 91  ? -1.068  16.376  -3.762  1.00 0.00 ? 91  PHE A O    2  
ATOM 4574  C CB   . PHE A 1 91  ? 0.003   13.217  -3.451  1.00 0.00 ? 91  PHE A CB   2  
ATOM 4575  C CG   . PHE A 1 91  ? 0.609   13.125  -4.822  1.00 0.00 ? 91  PHE A CG   2  
ATOM 4576  C CD1  . PHE A 1 91  ? 0.250   14.023  -5.813  1.00 0.00 ? 91  PHE A CD1  2  
ATOM 4577  C CD2  . PHE A 1 91  ? 1.538   12.140  -5.119  1.00 0.00 ? 91  PHE A CD2  2  
ATOM 4578  C CE1  . PHE A 1 91  ? 0.806   13.941  -7.076  1.00 0.00 ? 91  PHE A CE1  2  
ATOM 4579  C CE2  . PHE A 1 91  ? 2.097   12.053  -6.379  1.00 0.00 ? 91  PHE A CE2  2  
ATOM 4580  C CZ   . PHE A 1 91  ? 1.731   12.955  -7.359  1.00 0.00 ? 91  PHE A CZ   2  
ATOM 4581  H H    . PHE A 1 91  ? -0.227  14.317  -0.732  1.00 0.00 ? 91  PHE A H    2  
ATOM 4582  H HA   . PHE A 1 91  ? 1.030   15.085  -3.256  1.00 0.00 ? 91  PHE A HA   2  
ATOM 4583  H HB2  . PHE A 1 91  ? 0.461   12.457  -2.834  1.00 0.00 ? 91  PHE A HB2  2  
ATOM 4584  H HB3  . PHE A 1 91  ? -1.054  13.014  -3.539  1.00 0.00 ? 91  PHE A HB3  2  
ATOM 4585  H HD1  . PHE A 1 91  ? -0.473  14.794  -5.593  1.00 0.00 ? 91  PHE A HD1  2  
ATOM 4586  H HD2  . PHE A 1 91  ? 1.825   11.434  -4.353  1.00 0.00 ? 91  PHE A HD2  2  
ATOM 4587  H HE1  . PHE A 1 91  ? 0.518   14.647  -7.841  1.00 0.00 ? 91  PHE A HE1  2  
ATOM 4588  H HE2  . PHE A 1 91  ? 2.821   11.281  -6.598  1.00 0.00 ? 91  PHE A HE2  2  
ATOM 4589  H HZ   . PHE A 1 91  ? 2.166   12.889  -8.345  1.00 0.00 ? 91  PHE A HZ   2  
ATOM 4590  N N    . VAL A 1 92  ? -2.107  15.085  -2.238  1.00 0.00 ? 92  VAL A N    2  
ATOM 4591  C CA   . VAL A 1 92  ? -3.366  15.813  -2.318  1.00 0.00 ? 92  VAL A CA   2  
ATOM 4592  C C    . VAL A 1 92  ? -3.229  17.216  -1.731  1.00 0.00 ? 92  VAL A C    2  
ATOM 4593  O O    . VAL A 1 92  ? -3.978  18.125  -2.090  1.00 0.00 ? 92  VAL A O    2  
ATOM 4594  C CB   . VAL A 1 92  ? -4.496  15.062  -1.583  1.00 0.00 ? 92  VAL A CB   2  
ATOM 4595  C CG1  . VAL A 1 92  ? -4.159  14.890  -0.110  1.00 0.00 ? 92  VAL A CG1  2  
ATOM 4596  C CG2  . VAL A 1 92  ? -5.823  15.789  -1.753  1.00 0.00 ? 92  VAL A CG2  2  
ATOM 4597  H H    . VAL A 1 92  ? -2.034  14.322  -1.628  1.00 0.00 ? 92  VAL A H    2  
ATOM 4598  H HA   . VAL A 1 92  ? -3.636  15.895  -3.360  1.00 0.00 ? 92  VAL A HA   2  
ATOM 4599  H HB   . VAL A 1 92  ? -4.591  14.080  -2.023  1.00 0.00 ? 92  VAL A HB   2  
ATOM 4600  H HG11 . VAL A 1 92  ? -5.060  14.973  0.479   1.00 0.00 ? 92  VAL A HG11 2  
ATOM 4601  H HG12 . VAL A 1 92  ? -3.459  15.655  0.193   1.00 0.00 ? 92  VAL A HG12 2  
ATOM 4602  H HG13 . VAL A 1 92  ? -3.716  13.916  0.046   1.00 0.00 ? 92  VAL A HG13 2  
ATOM 4603  H HG21 . VAL A 1 92  ? -5.769  16.442  -2.612  1.00 0.00 ? 92  VAL A HG21 2  
ATOM 4604  H HG22 . VAL A 1 92  ? -6.031  16.373  -0.869  1.00 0.00 ? 92  VAL A HG22 2  
ATOM 4605  H HG23 . VAL A 1 92  ? -6.613  15.066  -1.900  1.00 0.00 ? 92  VAL A HG23 2  
ATOM 4606  N N    . LYS A 1 93  ? -2.269  17.385  -0.828  1.00 0.00 ? 93  LYS A N    2  
ATOM 4607  C CA   . LYS A 1 93  ? -2.034  18.676  -0.191  1.00 0.00 ? 93  LYS A CA   2  
ATOM 4608  C C    . LYS A 1 93  ? -1.259  19.613  -1.116  1.00 0.00 ? 93  LYS A C    2  
ATOM 4609  O O    . LYS A 1 93  ? -1.288  20.832  -0.941  1.00 0.00 ? 93  LYS A O    2  
ATOM 4610  C CB   . LYS A 1 93  ? -1.271  18.488  1.122   1.00 0.00 ? 93  LYS A CB   2  
ATOM 4611  C CG   . LYS A 1 93  ? -1.849  19.286  2.280   1.00 0.00 ? 93  LYS A CG   2  
ATOM 4612  C CD   . LYS A 1 93  ? -0.805  19.535  3.358   1.00 0.00 ? 93  LYS A CD   2  
ATOM 4613  C CE   . LYS A 1 93  ? -1.171  20.733  4.219   1.00 0.00 ? 93  LYS A CE   2  
ATOM 4614  N NZ   . LYS A 1 93  ? -0.579  20.640  5.582   1.00 0.00 ? 93  LYS A NZ   2  
ATOM 4615  H H    . LYS A 1 93  ? -1.705  16.622  -0.582  1.00 0.00 ? 93  LYS A H    2  
ATOM 4616  H HA   . LYS A 1 93  ? -2.995  19.118  0.023   1.00 0.00 ? 93  LYS A HA   2  
ATOM 4617  H HB2  . LYS A 1 93  ? -1.292  17.442  1.389   1.00 0.00 ? 93  LYS A HB2  2  
ATOM 4618  H HB3  . LYS A 1 93  ? -0.245  18.793  0.978   1.00 0.00 ? 93  LYS A HB3  2  
ATOM 4619  H HG2  . LYS A 1 93  ? -2.203  20.236  1.910   1.00 0.00 ? 93  LYS A HG2  2  
ATOM 4620  H HG3  . LYS A 1 93  ? -2.672  18.734  2.709   1.00 0.00 ? 93  LYS A HG3  2  
ATOM 4621  H HD2  . LYS A 1 93  ? -0.736  18.661  3.987   1.00 0.00 ? 93  LYS A HD2  2  
ATOM 4622  H HD3  . LYS A 1 93  ? 0.149   19.719  2.886   1.00 0.00 ? 93  LYS A HD3  2  
ATOM 4623  H HE2  . LYS A 1 93  ? -0.807  21.631  3.739   1.00 0.00 ? 93  LYS A HE2  2  
ATOM 4624  H HE3  . LYS A 1 93  ? -2.247  20.784  4.305   1.00 0.00 ? 93  LYS A HE3  2  
ATOM 4625  H HZ1  . LYS A 1 93  ? -1.277  20.254  6.249   1.00 0.00 ? 93  LYS A HZ1  2  
ATOM 4626  H HZ2  . LYS A 1 93  ? -0.287  21.582  5.911   1.00 0.00 ? 93  LYS A HZ2  2  
ATOM 4627  H HZ3  . LYS A 1 93  ? 0.254   20.017  5.568   1.00 0.00 ? 93  LYS A HZ3  2  
ATOM 4628  N N    . ALA A 1 94  ? -0.566  19.041  -2.097  1.00 0.00 ? 94  ALA A N    2  
ATOM 4629  C CA   . ALA A 1 94  ? 0.213   19.830  -3.042  1.00 0.00 ? 94  ALA A CA   2  
ATOM 4630  C C    . ALA A 1 94  ? -0.578  20.109  -4.317  1.00 0.00 ? 94  ALA A C    2  
ATOM 4631  O O    . ALA A 1 94  ? -0.002  20.285  -5.391  1.00 0.00 ? 94  ALA A O    2  
ATOM 4632  C CB   . ALA A 1 94  ? 1.515   19.116  -3.375  1.00 0.00 ? 94  ALA A CB   2  
ATOM 4633  H H    . ALA A 1 94  ? -0.579  18.065  -2.186  1.00 0.00 ? 94  ALA A H    2  
ATOM 4634  H HA   . ALA A 1 94  ? 0.457   20.770  -2.569  1.00 0.00 ? 94  ALA A HA   2  
ATOM 4635  H HB1  . ALA A 1 94  ? 2.313   19.840  -3.453  1.00 0.00 ? 94  ALA A HB1  2  
ATOM 4636  H HB2  . ALA A 1 94  ? 1.411   18.593  -4.313  1.00 0.00 ? 94  ALA A HB2  2  
ATOM 4637  H HB3  . ALA A 1 94  ? 1.747   18.408  -2.593  1.00 0.00 ? 94  ALA A HB3  2  
ATOM 4638  N N    . ALA A 1 95  ? -1.902  20.150  -4.193  1.00 0.00 ? 95  ALA A N    2  
ATOM 4639  C CA   . ALA A 1 95  ? -2.769  20.408  -5.336  1.00 0.00 ? 95  ALA A CA   2  
ATOM 4640  C C    . ALA A 1 95  ? -2.989  21.907  -5.533  1.00 0.00 ? 95  ALA A C    2  
ATOM 4641  O O    . ALA A 1 95  ? -2.801  22.430  -6.631  1.00 0.00 ? 95  ALA A O    2  
ATOM 4642  C CB   . ALA A 1 95  ? -4.101  19.692  -5.159  1.00 0.00 ? 95  ALA A CB   2  
ATOM 4643  H H    . ALA A 1 95  ? -2.304  20.002  -3.312  1.00 0.00 ? 95  ALA A H    2  
ATOM 4644  H HA   . ALA A 1 95  ? -2.287  20.008  -6.216  1.00 0.00 ? 95  ALA A HA   2  
ATOM 4645  H HB1  . ALA A 1 95  ? -4.109  18.794  -5.759  1.00 0.00 ? 95  ALA A HB1  2  
ATOM 4646  H HB2  . ALA A 1 95  ? -4.905  20.343  -5.473  1.00 0.00 ? 95  ALA A HB2  2  
ATOM 4647  H HB3  . ALA A 1 95  ? -4.234  19.432  -4.120  1.00 0.00 ? 95  ALA A HB3  2  
ATOM 4648  N N    . PRO A 1 96  ? -3.393  22.621  -4.467  1.00 0.00 ? 96  PRO A N    2  
ATOM 4649  C CA   . PRO A 1 96  ? -3.637  24.067  -4.527  1.00 0.00 ? 96  PRO A CA   2  
ATOM 4650  C C    . PRO A 1 96  ? -2.439  24.849  -5.069  1.00 0.00 ? 96  PRO A C    2  
ATOM 4651  O O    . PRO A 1 96  ? -2.599  25.714  -5.929  1.00 0.00 ? 96  PRO A O    2  
ATOM 4652  C CB   . PRO A 1 96  ? -3.910  24.441  -3.067  1.00 0.00 ? 96  PRO A CB   2  
ATOM 4653  C CG   . PRO A 1 96  ? -4.413  23.184  -2.452  1.00 0.00 ? 96  PRO A CG   2  
ATOM 4654  C CD   . PRO A 1 96  ? -3.641  22.084  -3.116  1.00 0.00 ? 96  PRO A CD   2  
ATOM 4655  H HA   . PRO A 1 96  ? -4.508  24.292  -5.124  1.00 0.00 ? 96  PRO A HA   2  
ATOM 4656  H HB2  . PRO A 1 96  ? -2.994  24.767  -2.600  1.00 0.00 ? 96  PRO A HB2  2  
ATOM 4657  H HB3  . PRO A 1 96  ? -4.648  25.226  -3.023  1.00 0.00 ? 96  PRO A HB3  2  
ATOM 4658  H HG2  . PRO A 1 96  ? -4.222  23.192  -1.388  1.00 0.00 ? 96  PRO A HG2  2  
ATOM 4659  H HG3  . PRO A 1 96  ? -5.469  23.074  -2.646  1.00 0.00 ? 96  PRO A HG3  2  
ATOM 4660  H HD2  . PRO A 1 96  ? -2.713  21.911  -2.594  1.00 0.00 ? 96  PRO A HD2  2  
ATOM 4661  H HD3  . PRO A 1 96  ? -4.229  21.180  -3.160  1.00 0.00 ? 96  PRO A HD3  2  
ATOM 4662  N N    . PRO A 1 97  ? -1.217  24.565  -4.574  1.00 0.00 ? 97  PRO A N    2  
ATOM 4663  C CA   . PRO A 1 97  ? -0.011  25.263  -5.029  1.00 0.00 ? 97  PRO A CA   2  
ATOM 4664  C C    . PRO A 1 97  ? 0.421   24.826  -6.425  1.00 0.00 ? 97  PRO A C    2  
ATOM 4665  O O    . PRO A 1 97  ? 0.941   25.627  -7.202  1.00 0.00 ? 97  PRO A O    2  
ATOM 4666  C CB   . PRO A 1 97  ? 1.039   24.866  -3.992  1.00 0.00 ? 97  PRO A CB   2  
ATOM 4667  C CG   . PRO A 1 97  ? 0.593   23.536  -3.494  1.00 0.00 ? 97  PRO A CG   2  
ATOM 4668  C CD   . PRO A 1 97  ? -0.912  23.553  -3.542  1.00 0.00 ? 97  PRO A CD   2  
ATOM 4669  H HA   . PRO A 1 97  ? -0.147  26.335  -5.015  1.00 0.00 ? 97  PRO A HA   2  
ATOM 4670  H HB2  . PRO A 1 97  ? 2.009   24.807  -4.464  1.00 0.00 ? 97  PRO A HB2  2  
ATOM 4671  H HB3  . PRO A 1 97  ? 1.061   25.597  -3.199  1.00 0.00 ? 97  PRO A HB3  2  
ATOM 4672  H HG2  . PRO A 1 97  ? 0.979   22.757  -4.134  1.00 0.00 ? 97  PRO A HG2  2  
ATOM 4673  H HG3  . PRO A 1 97  ? 0.933   23.391  -2.480  1.00 0.00 ? 97  PRO A HG3  2  
ATOM 4674  H HD2  . PRO A 1 97  ? -1.286  22.582  -3.829  1.00 0.00 ? 97  PRO A HD2  2  
ATOM 4675  H HD3  . PRO A 1 97  ? -1.315  23.844  -2.584  1.00 0.00 ? 97  PRO A HD3  2  
ATOM 4676  N N    . GLN A 1 98  ? 0.201   23.553  -6.736  1.00 0.00 ? 98  GLN A N    2  
ATOM 4677  C CA   . GLN A 1 98  ? 0.568   23.013  -8.039  1.00 0.00 ? 98  GLN A CA   2  
ATOM 4678  C C    . GLN A 1 98  ? -0.440  23.434  -9.104  1.00 0.00 ? 98  GLN A C    2  
ATOM 4679  O O    . GLN A 1 98  ? -1.650  23.385  -8.880  1.00 0.00 ? 98  GLN A O    2  
ATOM 4680  C CB   . GLN A 1 98  ? 0.656   21.487  -7.977  1.00 0.00 ? 98  GLN A CB   2  
ATOM 4681  C CG   . GLN A 1 98  ? 1.105   20.850  -9.283  1.00 0.00 ? 98  GLN A CG   2  
ATOM 4682  C CD   . GLN A 1 98  ? 2.296   19.929  -9.106  1.00 0.00 ? 98  GLN A CD   2  
ATOM 4683  O OE1  . GLN A 1 98  ? 3.089   20.091  -8.177  1.00 0.00 ? 98  GLN A OE1  2  
ATOM 4684  N NE2  . GLN A 1 98  ? 2.430   18.956  -9.999  1.00 0.00 ? 98  GLN A NE2  2  
ATOM 4685  H H    . GLN A 1 98  ? -0.217  22.964  -6.074  1.00 0.00 ? 98  GLN A H    2  
ATOM 4686  H HA   . GLN A 1 98  ? 1.537   23.410  -8.302  1.00 0.00 ? 98  GLN A HA   2  
ATOM 4687  H HB2  . GLN A 1 98  ? 1.359   21.210  -7.205  1.00 0.00 ? 98  GLN A HB2  2  
ATOM 4688  H HB3  . GLN A 1 98  ? -0.317  21.093  -7.725  1.00 0.00 ? 98  GLN A HB3  2  
ATOM 4689  H HG2  . GLN A 1 98  ? 0.285   20.277  -9.689  1.00 0.00 ? 98  GLN A HG2  2  
ATOM 4690  H HG3  . GLN A 1 98  ? 1.373   21.633  -9.977  1.00 0.00 ? 98  GLN A HG3  2  
ATOM 4691  H HE21 . GLN A 1 98  ? 1.759   18.887  -10.715 1.00 0.00 ? 98  GLN A HE21 2  
ATOM 4692  H HE22 . GLN A 1 98  ? 3.195   18.344  -9.907  1.00 0.00 ? 98  GLN A HE22 2  
ATOM 4693  N N    . LYS A 1 99  ? 0.065   23.847  -10.261 1.00 0.00 ? 99  LYS A N    2  
ATOM 4694  C CA   . LYS A 1 99  ? -0.793  24.278  -11.359 1.00 0.00 ? 99  LYS A CA   2  
ATOM 4695  C C    . LYS A 1 99  ? -0.692  23.317  -12.540 1.00 0.00 ? 99  LYS A C    2  
ATOM 4696  O O    . LYS A 1 99  ? 0.401   23.041  -13.037 1.00 0.00 ? 99  LYS A O    2  
ATOM 4697  C CB   . LYS A 1 99  ? -0.415  25.692  -11.804 1.00 0.00 ? 99  LYS A CB   2  
ATOM 4698  C CG   . LYS A 1 99  ? -0.479  26.718  -10.683 1.00 0.00 ? 99  LYS A CG   2  
ATOM 4699  C CD   . LYS A 1 99  ? 0.305   27.973  -11.032 1.00 0.00 ? 99  LYS A CD   2  
ATOM 4700  C CE   . LYS A 1 99  ? 0.694   28.751  -9.786  1.00 0.00 ? 99  LYS A CE   2  
ATOM 4701  N NZ   . LYS A 1 99  ? 1.857   29.649  -10.032 1.00 0.00 ? 99  LYS A NZ   2  
ATOM 4702  H H    . LYS A 1 99  ? 1.038   23.865  -10.379 1.00 0.00 ? 99  LYS A H    2  
ATOM 4703  H HA   . LYS A 1 99  ? -1.811  24.283  -11.001 1.00 0.00 ? 99  LYS A HA   2  
ATOM 4704  H HB2  . LYS A 1 99  ? 0.591   25.678  -12.193 1.00 0.00 ? 99  LYS A HB2  2  
ATOM 4705  H HB3  . LYS A 1 99  ? -1.091  26.003  -12.586 1.00 0.00 ? 99  LYS A HB3  2  
ATOM 4706  H HG2  . LYS A 1 99  ? -1.510  26.987  -10.511 1.00 0.00 ? 99  LYS A HG2  2  
ATOM 4707  H HG3  . LYS A 1 99  ? -0.063  26.283  -9.786  1.00 0.00 ? 99  LYS A HG3  2  
ATOM 4708  H HD2  . LYS A 1 99  ? 1.202   27.690  -11.563 1.00 0.00 ? 99  LYS A HD2  2  
ATOM 4709  H HD3  . LYS A 1 99  ? -0.305  28.603  -11.664 1.00 0.00 ? 99  LYS A HD3  2  
ATOM 4710  H HE2  . LYS A 1 99  ? -0.149  29.348  -9.472  1.00 0.00 ? 99  LYS A HE2  2  
ATOM 4711  H HE3  . LYS A 1 99  ? 0.950   28.051  -9.005  1.00 0.00 ? 99  LYS A HE3  2  
ATOM 4712  H HZ1  . LYS A 1 99  ? 1.576   30.435  -10.652 1.00 0.00 ? 99  LYS A HZ1  2  
ATOM 4713  H HZ2  . LYS A 1 99  ? 2.627   29.120  -10.488 1.00 0.00 ? 99  LYS A HZ2  2  
ATOM 4714  H HZ3  . LYS A 1 99  ? 2.204   30.038  -9.132  1.00 0.00 ? 99  LYS A HZ3  2  
ATOM 4715  N N    . ARG A 1 100 ? -1.837  22.810  -12.982 1.00 0.00 ? 100 ARG A N    2  
ATOM 4716  C CA   . ARG A 1 100 ? -1.879  21.880  -14.105 1.00 0.00 ? 100 ARG A CA   2  
ATOM 4717  C C    . ARG A 1 100 ? -2.868  22.352  -15.166 1.00 0.00 ? 100 ARG A C    2  
ATOM 4718  O O    . ARG A 1 100 ? -2.568  22.333  -16.360 1.00 0.00 ? 100 ARG A O    2  
ATOM 4719  C CB   . ARG A 1 100 ? -2.264  20.481  -13.620 1.00 0.00 ? 100 ARG A CB   2  
ATOM 4720  C CG   . ARG A 1 100 ? -3.605  20.432  -12.906 1.00 0.00 ? 100 ARG A CG   2  
ATOM 4721  C CD   . ARG A 1 100 ? -3.654  19.305  -11.887 1.00 0.00 ? 100 ARG A CD   2  
ATOM 4722  N NE   . ARG A 1 100 ? -4.982  18.706  -11.796 1.00 0.00 ? 100 ARG A NE   2  
ATOM 4723  C CZ   . ARG A 1 100 ? -5.265  17.636  -11.055 1.00 0.00 ? 100 ARG A CZ   2  
ATOM 4724  N NH1  . ARG A 1 100 ? -4.315  17.045  -10.341 1.00 0.00 ? 100 ARG A NH1  2  
ATOM 4725  N NH2  . ARG A 1 100 ? -6.500  17.155  -11.029 1.00 0.00 ? 100 ARG A NH2  2  
ATOM 4726  H H    . ARG A 1 100 ? -2.675  23.068  -12.544 1.00 0.00 ? 100 ARG A H    2  
ATOM 4727  H HA   . ARG A 1 100 ? -0.893  21.841  -14.540 1.00 0.00 ? 100 ARG A HA   2  
ATOM 4728  H HB2  . ARG A 1 100 ? -2.310  19.818  -14.471 1.00 0.00 ? 100 ARG A HB2  2  
ATOM 4729  H HB3  . ARG A 1 100 ? -1.505  20.127  -12.939 1.00 0.00 ? 100 ARG A HB3  2  
ATOM 4730  H HG2  . ARG A 1 100 ? -3.765  21.370  -12.397 1.00 0.00 ? 100 ARG A HG2  2  
ATOM 4731  H HG3  . ARG A 1 100 ? -4.386  20.278  -13.636 1.00 0.00 ? 100 ARG A HG3  2  
ATOM 4732  H HD2  . ARG A 1 100 ? -2.945  18.543  -12.178 1.00 0.00 ? 100 ARG A HD2  2  
ATOM 4733  H HD3  . ARG A 1 100 ? -3.379  19.700  -10.920 1.00 0.00 ? 100 ARG A HD3  2  
ATOM 4734  H HE   . ARG A 1 100 ? -5.703  19.121  -12.314 1.00 0.00 ? 100 ARG A HE   2  
ATOM 4735  H HH11 . ARG A 1 100 ? -3.381  17.403  -10.356 1.00 0.00 ? 100 ARG A HH11 2  
ATOM 4736  H HH12 . ARG A 1 100 ? -4.533  16.242  -9.786  1.00 0.00 ? 100 ARG A HH12 2  
ATOM 4737  H HH22 . ARG A 1 100 ? -6.712  16.352  -10.472 1.00 0.00 ? 100 ARG A HH22 2  
ATOM 4738  N N    . PHE A 1 101 ? -4.047  22.776  -14.722 1.00 0.00 ? 101 PHE A N    2  
ATOM 4739  C CA   . PHE A 1 101 ? -5.080  23.254  -15.634 1.00 0.00 ? 101 PHE A CA   2  
ATOM 4740  C C    . PHE A 1 101 ? -5.388  24.727  -15.384 1.00 0.00 ? 101 PHE A C    2  
ATOM 4741  O O    . PHE A 1 101 ? -5.461  25.123  -14.201 1.00 0.00 ? 101 PHE A O    2  
ATOM 4742  C CB   . PHE A 1 101 ? -6.354  22.422  -15.475 1.00 0.00 ? 101 PHE A CB   2  
ATOM 4743  C CG   . PHE A 1 101 ? -7.199  22.374  -16.716 1.00 0.00 ? 101 PHE A CG   2  
ATOM 4744  C CD1  . PHE A 1 101 ? -8.026  23.436  -17.048 1.00 0.00 ? 101 PHE A CD1  2  
ATOM 4745  C CD2  . PHE A 1 101 ? -7.167  21.268  -17.550 1.00 0.00 ? 101 PHE A CD2  2  
ATOM 4746  C CE1  . PHE A 1 101 ? -8.803  23.396  -18.190 1.00 0.00 ? 101 PHE A CE1  2  
ATOM 4747  C CE2  . PHE A 1 101 ? -7.943  21.222  -18.692 1.00 0.00 ? 101 PHE A CE2  2  
ATOM 4748  C CZ   . PHE A 1 101 ? -8.763  22.286  -19.012 1.00 0.00 ? 101 PHE A CZ   2  
ATOM 4749  O OXT  . PHE A 1 101 ? -5.552  25.472  -16.372 1.00 0.00 ? 101 PHE A OXT  2  
ATOM 4750  H H    . PHE A 1 101 ? -4.227  22.767  -13.759 1.00 0.00 ? 101 PHE A H    2  
ATOM 4751  H HA   . PHE A 1 101 ? -4.711  23.141  -16.642 1.00 0.00 ? 101 PHE A HA   2  
ATOM 4752  H HB2  . PHE A 1 101 ? -6.084  21.409  -15.219 1.00 0.00 ? 101 PHE A HB2  2  
ATOM 4753  H HB3  . PHE A 1 101 ? -6.953  22.842  -14.680 1.00 0.00 ? 101 PHE A HB3  2  
ATOM 4754  H HD1  . PHE A 1 101 ? -8.058  24.304  -16.406 1.00 0.00 ? 101 PHE A HD1  2  
ATOM 4755  H HD2  . PHE A 1 101 ? -6.526  20.435  -17.301 1.00 0.00 ? 101 PHE A HD2  2  
ATOM 4756  H HE1  . PHE A 1 101 ? -9.444  24.229  -18.437 1.00 0.00 ? 101 PHE A HE1  2  
ATOM 4757  H HE2  . PHE A 1 101 ? -7.910  20.354  -19.334 1.00 0.00 ? 101 PHE A HE2  2  
ATOM 4758  H HZ   . PHE A 1 101 ? -9.370  22.252  -19.905 1.00 0.00 ? 101 PHE A HZ   2  
ATOM 4759  N N    . SER B 1 1   ? -8.228  1.774   18.412  1.00 0.00 ? 1   SER B N    2  
ATOM 4760  C CA   . SER B 1 1   ? -8.914  2.235   19.648  1.00 0.00 ? 1   SER B CA   2  
ATOM 4761  C C    . SER B 1 1   ? -10.197 2.991   19.316  1.00 0.00 ? 1   SER B C    2  
ATOM 4762  O O    . SER B 1 1   ? -11.295 2.443   19.419  1.00 0.00 ? 1   SER B O    2  
ATOM 4763  C CB   . SER B 1 1   ? -7.955  3.133   20.432  1.00 0.00 ? 1   SER B CB   2  
ATOM 4764  O OG   . SER B 1 1   ? -7.263  2.398   21.426  1.00 0.00 ? 1   SER B OG   2  
ATOM 4765  H H1   . SER B 1 1   ? -8.234  2.562   17.734  1.00 0.00 ? 1   SER B H1   2  
ATOM 4766  H H2   . SER B 1 1   ? -8.754  0.956   18.044  1.00 0.00 ? 1   SER B H2   2  
ATOM 4767  H H3   . SER B 1 1   ? -7.255  1.510   18.669  1.00 0.00 ? 1   SER B H3   2  
ATOM 4768  H HA   . SER B 1 1   ? -9.159  1.370   20.246  1.00 0.00 ? 1   SER B HA   2  
ATOM 4769  H HB2  . SER B 1 1   ? -7.233  3.563   19.754  1.00 0.00 ? 1   SER B HB2  2  
ATOM 4770  H HB3  . SER B 1 1   ? -8.515  3.923   20.910  1.00 0.00 ? 1   SER B HB3  2  
ATOM 4771  H HG   . SER B 1 1   ? -6.823  1.646   21.022  1.00 0.00 ? 1   SER B HG   2  
ATOM 4772  N N    . ARG B 1 2   ? -10.053 4.251   18.918  1.00 0.00 ? 2   ARG B N    2  
ATOM 4773  C CA   . ARG B 1 2   ? -11.204 5.079   18.573  1.00 0.00 ? 2   ARG B CA   2  
ATOM 4774  C C    . ARG B 1 2   ? -11.460 5.065   17.066  1.00 0.00 ? 2   ARG B C    2  
ATOM 4775  O O    . ARG B 1 2   ? -12.573 4.781   16.623  1.00 0.00 ? 2   ARG B O    2  
ATOM 4776  C CB   . ARG B 1 2   ? -10.995 6.517   19.061  1.00 0.00 ? 2   ARG B CB   2  
ATOM 4777  C CG   . ARG B 1 2   ? -12.004 6.954   20.110  1.00 0.00 ? 2   ARG B CG   2  
ATOM 4778  C CD   . ARG B 1 2   ? -11.505 6.665   21.518  1.00 0.00 ? 2   ARG B CD   2  
ATOM 4779  N NE   . ARG B 1 2   ? -12.562 6.816   22.515  1.00 0.00 ? 2   ARG B NE   2  
ATOM 4780  C CZ   . ARG B 1 2   ? -13.500 5.900   22.746  1.00 0.00 ? 2   ARG B CZ   2  
ATOM 4781  N NH1  . ARG B 1 2   ? -13.516 4.767   22.054  1.00 0.00 ? 2   ARG B NH1  2  
ATOM 4782  N NH2  . ARG B 1 2   ? -14.425 6.118   23.671  1.00 0.00 ? 2   ARG B NH2  2  
ATOM 4783  H H    . ARG B 1 2   ? -9.154  4.634   18.857  1.00 0.00 ? 2   ARG B H    2  
ATOM 4784  H HA   . ARG B 1 2   ? -12.067 4.664   19.072  1.00 0.00 ? 2   ARG B HA   2  
ATOM 4785  H HB2  . ARG B 1 2   ? -10.007 6.599   19.487  1.00 0.00 ? 2   ARG B HB2  2  
ATOM 4786  H HB3  . ARG B 1 2   ? -11.072 7.187   18.218  1.00 0.00 ? 2   ARG B HB3  2  
ATOM 4787  H HG2  . ARG B 1 2   ? -12.175 8.016   20.011  1.00 0.00 ? 2   ARG B HG2  2  
ATOM 4788  H HG3  . ARG B 1 2   ? -12.930 6.422   19.950  1.00 0.00 ? 2   ARG B HG3  2  
ATOM 4789  H HD2  . ARG B 1 2   ? -11.133 5.652   21.552  1.00 0.00 ? 2   ARG B HD2  2  
ATOM 4790  H HD3  . ARG B 1 2   ? -10.703 7.350   21.749  1.00 0.00 ? 2   ARG B HD3  2  
ATOM 4791  H HE   . ARG B 1 2   ? -12.574 7.643   23.040  1.00 0.00 ? 2   ARG B HE   2  
ATOM 4792  H HH11 . ARG B 1 2   ? -12.822 4.597   21.355  1.00 0.00 ? 2   ARG B HH11 2  
ATOM 4793  H HH12 . ARG B 1 2   ? -14.223 4.083   22.233  1.00 0.00 ? 2   ARG B HH12 2  
ATOM 4794  H HH22 . ARG B 1 2   ? -15.130 5.430   23.844  1.00 0.00 ? 2   ARG B HH22 2  
ATOM 4795  N N    . PRO B 1 3   ? -10.433 5.373   16.253  1.00 0.00 ? 3   PRO B N    2  
ATOM 4796  C CA   . PRO B 1 3   ? -10.552 5.394   14.790  1.00 0.00 ? 3   PRO B CA   2  
ATOM 4797  C C    . PRO B 1 3   ? -10.876 4.006   14.223  1.00 0.00 ? 3   PRO B C    2  
ATOM 4798  O O    . PRO B 1 3   ? -11.832 3.366   14.661  1.00 0.00 ? 3   PRO B O    2  
ATOM 4799  C CB   . PRO B 1 3   ? -9.163  5.893   14.339  1.00 0.00 ? 3   PRO B CB   2  
ATOM 4800  C CG   . PRO B 1 3   ? -8.609  6.573   15.536  1.00 0.00 ? 3   PRO B CG   2  
ATOM 4801  C CD   . PRO B 1 3   ? -9.070  5.726   16.675  1.00 0.00 ? 3   PRO B CD   2  
ATOM 4802  H HA   . PRO B 1 3   ? -11.310 6.094   14.470  1.00 0.00 ? 3   PRO B HA   2  
ATOM 4803  H HB2  . PRO B 1 3   ? -8.549  5.054   14.056  1.00 0.00 ? 3   PRO B HB2  2  
ATOM 4804  H HB3  . PRO B 1 3   ? -9.269  6.575   13.510  1.00 0.00 ? 3   PRO B HB3  2  
ATOM 4805  H HG2  . PRO B 1 3   ? -7.529  6.594   15.487  1.00 0.00 ? 3   PRO B HG2  2  
ATOM 4806  H HG3  . PRO B 1 3   ? -9.009  7.571   15.620  1.00 0.00 ? 3   PRO B HG3  2  
ATOM 4807  H HD2  . PRO B 1 3   ? -8.451  4.844   16.756  1.00 0.00 ? 3   PRO B HD2  2  
ATOM 4808  H HD3  . PRO B 1 3   ? -9.075  6.286   17.596  1.00 0.00 ? 3   PRO B HD3  2  
ATOM 4809  N N    . THR B 1 4   ? -10.086 3.542   13.257  1.00 0.00 ? 4   THR B N    2  
ATOM 4810  C CA   . THR B 1 4   ? -10.308 2.233   12.653  1.00 0.00 ? 4   THR B CA   2  
ATOM 4811  C C    . THR B 1 4   ? -8.989  1.565   12.303  1.00 0.00 ? 4   THR B C    2  
ATOM 4812  O O    . THR B 1 4   ? -8.020  2.221   11.923  1.00 0.00 ? 4   THR B O    2  
ATOM 4813  C CB   . THR B 1 4   ? -11.197 2.351   11.406  1.00 0.00 ? 4   THR B CB   2  
ATOM 4814  O OG1  . THR B 1 4   ? -11.003 1.244   10.544  1.00 0.00 ? 4   THR B OG1  2  
ATOM 4815  C CG2  . THR B 1 4   ? -10.954 3.608   10.596  1.00 0.00 ? 4   THR B CG2  2  
ATOM 4816  H H    . THR B 1 4   ? -9.339  4.088   12.944  1.00 0.00 ? 4   THR B H    2  
ATOM 4817  H HA   . THR B 1 4   ? -10.810 1.614   13.378  1.00 0.00 ? 4   THR B HA   2  
ATOM 4818  H HB   . THR B 1 4   ? -12.232 2.356   11.718  1.00 0.00 ? 4   THR B HB   2  
ATOM 4819  H HG1  . THR B 1 4   ? -11.447 0.474   10.906  1.00 0.00 ? 4   THR B HG1  2  
ATOM 4820  H HG21 . THR B 1 4   ? -11.821 3.814   9.985   1.00 0.00 ? 4   THR B HG21 2  
ATOM 4821  H HG22 . THR B 1 4   ? -10.093 3.467   9.961   1.00 0.00 ? 4   THR B HG22 2  
ATOM 4822  H HG23 . THR B 1 4   ? -10.779 4.440   11.261  1.00 0.00 ? 4   THR B HG23 2  
ATOM 4823  N N    . GLU B 1 5   ? -8.968  0.246   12.441  1.00 0.00 ? 5   GLU B N    2  
ATOM 4824  C CA   . GLU B 1 5   ? -7.785  -0.548  12.150  1.00 0.00 ? 5   GLU B CA   2  
ATOM 4825  C C    . GLU B 1 5   ? -7.143  -0.112  10.838  1.00 0.00 ? 5   GLU B C    2  
ATOM 4826  O O    . GLU B 1 5   ? -5.926  0.057   10.754  1.00 0.00 ? 5   GLU B O    2  
ATOM 4827  C CB   . GLU B 1 5   ? -8.175  -2.021  12.093  1.00 0.00 ? 5   GLU B CB   2  
ATOM 4828  C CG   . GLU B 1 5   ? -7.202  -2.938  12.816  1.00 0.00 ? 5   GLU B CG   2  
ATOM 4829  C CD   . GLU B 1 5   ? -7.512  -4.406  12.598  1.00 0.00 ? 5   GLU B CD   2  
ATOM 4830  O OE1  . GLU B 1 5   ? -8.686  -4.728  12.315  1.00 0.00 ? 5   GLU B OE1  2  
ATOM 4831  O OE2  . GLU B 1 5   ? -6.584  -5.232  12.710  1.00 0.00 ? 5   GLU B OE2  2  
ATOM 4832  H H    . GLU B 1 5   ? -9.779  -0.210  12.751  1.00 0.00 ? 5   GLU B H    2  
ATOM 4833  H HA   . GLU B 1 5   ? -7.078  -0.401  12.953  1.00 0.00 ? 5   GLU B HA   2  
ATOM 4834  H HB2  . GLU B 1 5   ? -9.150  -2.129  12.547  1.00 0.00 ? 5   GLU B HB2  2  
ATOM 4835  H HB3  . GLU B 1 5   ? -8.230  -2.327  11.059  1.00 0.00 ? 5   GLU B HB3  2  
ATOM 4836  H HG2  . GLU B 1 5   ? -6.204  -2.740  12.455  1.00 0.00 ? 5   GLU B HG2  2  
ATOM 4837  H HG3  . GLU B 1 5   ? -7.249  -2.728  13.875  1.00 0.00 ? 5   GLU B HG3  2  
ATOM 4838  N N    . THR B 1 6   ? -7.973  0.091   9.822   1.00 0.00 ? 6   THR B N    2  
ATOM 4839  C CA   . THR B 1 6   ? -7.492  0.532   8.520   1.00 0.00 ? 6   THR B CA   2  
ATOM 4840  C C    . THR B 1 6   ? -6.903  1.933   8.634   1.00 0.00 ? 6   THR B C    2  
ATOM 4841  O O    . THR B 1 6   ? -5.870  2.236   8.047   1.00 0.00 ? 6   THR B O    2  
ATOM 4842  C CB   . THR B 1 6   ? -8.635  0.529   7.505   1.00 0.00 ? 6   THR B CB   2  
ATOM 4843  O OG1  . THR B 1 6   ? -9.610  -0.438  7.850   1.00 0.00 ? 6   THR B OG1  2  
ATOM 4844  C CG2  . THR B 1 6   ? -8.180  0.241   6.093   1.00 0.00 ? 6   THR B CG2  2  
ATOM 4845  H H    . THR B 1 6   ? -8.934  -0.045  9.955   1.00 0.00 ? 6   THR B H    2  
ATOM 4846  H HA   . THR B 1 6   ? -6.720  -0.151  8.190   1.00 0.00 ? 6   THR B HA   2  
ATOM 4847  H HB   . THR B 1 6   ? -9.107  1.502   7.509   1.00 0.00 ? 6   THR B HB   2  
ATOM 4848  H HG1  . THR B 1 6   ? -10.308 -0.023  8.363   1.00 0.00 ? 6   THR B HG1  2  
ATOM 4849  H HG21 . THR B 1 6   ? -9.008  -0.151  5.522   1.00 0.00 ? 6   THR B HG21 2  
ATOM 4850  H HG22 . THR B 1 6   ? -7.382  -0.484  6.114   1.00 0.00 ? 6   THR B HG22 2  
ATOM 4851  H HG23 . THR B 1 6   ? -7.828  1.152   5.636   1.00 0.00 ? 6   THR B HG23 2  
ATOM 4852  N N    . GLU B 1 7   ? -7.560  2.783   9.409   1.00 0.00 ? 7   GLU B N    2  
ATOM 4853  C CA   . GLU B 1 7   ? -7.097  4.155   9.595   1.00 0.00 ? 7   GLU B CA   2  
ATOM 4854  C C    . GLU B 1 7   ? -5.622  4.172   9.989   1.00 0.00 ? 7   GLU B C    2  
ATOM 4855  O O    . GLU B 1 7   ? -4.867  5.050   9.569   1.00 0.00 ? 7   GLU B O    2  
ATOM 4856  C CB   . GLU B 1 7   ? -7.935  4.856   10.669  1.00 0.00 ? 7   GLU B CB   2  
ATOM 4857  C CG   . GLU B 1 7   ? -8.754  6.020   10.136  1.00 0.00 ? 7   GLU B CG   2  
ATOM 4858  C CD   . GLU B 1 7   ? -8.095  7.361   10.395  1.00 0.00 ? 7   GLU B CD   2  
ATOM 4859  O OE1  . GLU B 1 7   ? -6.872  7.383   10.645  1.00 0.00 ? 7   GLU B OE1  2  
ATOM 4860  O OE2  . GLU B 1 7   ? -8.803  8.389   10.349  1.00 0.00 ? 7   GLU B OE2  2  
ATOM 4861  H H    . GLU B 1 7   ? -8.375  2.484   9.861   1.00 0.00 ? 7   GLU B H    2  
ATOM 4862  H HA   . GLU B 1 7   ? -7.214  4.676   8.658   1.00 0.00 ? 7   GLU B HA   2  
ATOM 4863  H HB2  . GLU B 1 7   ? -8.615  4.136   11.107  1.00 0.00 ? 7   GLU B HB2  2  
ATOM 4864  H HB3  . GLU B 1 7   ? -7.277  5.230   11.440  1.00 0.00 ? 7   GLU B HB3  2  
ATOM 4865  H HG2  . GLU B 1 7   ? -8.879  5.898   9.071   1.00 0.00 ? 7   GLU B HG2  2  
ATOM 4866  H HG3  . GLU B 1 7   ? -9.722  6.012   10.616  1.00 0.00 ? 7   GLU B HG3  2  
ATOM 4867  N N    . ARG B 1 8   ? -5.215  3.187   10.780  1.00 0.00 ? 8   ARG B N    2  
ATOM 4868  C CA   . ARG B 1 8   ? -3.830  3.076   11.207  1.00 0.00 ? 8   ARG B CA   2  
ATOM 4869  C C    . ARG B 1 8   ? -2.974  2.456   10.103  1.00 0.00 ? 8   ARG B C    2  
ATOM 4870  O O    . ARG B 1 8   ? -1.768  2.694   10.031  1.00 0.00 ? 8   ARG B O    2  
ATOM 4871  C CB   . ARG B 1 8   ? -3.738  2.234   12.482  1.00 0.00 ? 8   ARG B CB   2  
ATOM 4872  C CG   . ARG B 1 8   ? -2.311  1.972   12.937  1.00 0.00 ? 8   ARG B CG   2  
ATOM 4873  C CD   . ARG B 1 8   ? -2.162  2.137   14.442  1.00 0.00 ? 8   ARG B CD   2  
ATOM 4874  N NE   . ARG B 1 8   ? -1.910  3.526   14.818  1.00 0.00 ? 8   ARG B NE   2  
ATOM 4875  C CZ   . ARG B 1 8   ? -0.787  4.179   14.531  1.00 0.00 ? 8   ARG B CZ   2  
ATOM 4876  N NH1  . ARG B 1 8   ? 0.188   3.574   13.865  1.00 0.00 ? 8   ARG B NH1  2  
ATOM 4877  N NH2  . ARG B 1 8   ? -0.638  5.441   14.910  1.00 0.00 ? 8   ARG B NH2  2  
ATOM 4878  H H    . ARG B 1 8   ? -5.859  2.508   11.070  1.00 0.00 ? 8   ARG B H    2  
ATOM 4879  H HA   . ARG B 1 8   ? -3.465  4.071   11.415  1.00 0.00 ? 8   ARG B HA   2  
ATOM 4880  H HB2  . ARG B 1 8   ? -4.258  2.747   13.277  1.00 0.00 ? 8   ARG B HB2  2  
ATOM 4881  H HB3  . ARG B 1 8   ? -4.217  1.282   12.307  1.00 0.00 ? 8   ARG B HB3  2  
ATOM 4882  H HG2  . ARG B 1 8   ? -2.040  0.962   12.668  1.00 0.00 ? 8   ARG B HG2  2  
ATOM 4883  H HG3  . ARG B 1 8   ? -1.654  2.668   12.440  1.00 0.00 ? 8   ARG B HG3  2  
ATOM 4884  H HD2  . ARG B 1 8   ? -3.073  1.804   14.919  1.00 0.00 ? 8   ARG B HD2  2  
ATOM 4885  H HD3  . ARG B 1 8   ? -1.337  1.527   14.777  1.00 0.00 ? 8   ARG B HD3  2  
ATOM 4886  H HE   . ARG B 1 8   ? -2.615  3.996   15.310  1.00 0.00 ? 8   ARG B HE   2  
ATOM 4887  H HH11 . ARG B 1 8   ? 0.083   2.622   13.576  1.00 0.00 ? 8   ARG B HH11 2  
ATOM 4888  H HH12 . ARG B 1 8   ? 1.030   4.071   13.651  1.00 0.00 ? 8   ARG B HH12 2  
ATOM 4889  H HH22 . ARG B 1 8   ? 0.205   5.932   14.695  1.00 0.00 ? 8   ARG B HH22 2  
ATOM 4890  N N    . CYS B 1 9   ? -3.606  1.650   9.251   1.00 0.00 ? 9   CYS B N    2  
ATOM 4891  C CA   . CYS B 1 9   ? -2.904  0.982   8.157   1.00 0.00 ? 9   CYS B CA   2  
ATOM 4892  C C    . CYS B 1 9   ? -2.425  1.978   7.103   1.00 0.00 ? 9   CYS B C    2  
ATOM 4893  O O    . CYS B 1 9   ? -1.310  1.867   6.594   1.00 0.00 ? 9   CYS B O    2  
ATOM 4894  C CB   . CYS B 1 9   ? -3.802  -0.093  7.522   1.00 0.00 ? 9   CYS B CB   2  
ATOM 4895  S SG   . CYS B 1 9   ? -4.920  0.494   6.220   1.00 0.00 ? 9   CYS B SG   2  
ATOM 4896  H H    . CYS B 1 9   ? -4.566  1.492   9.365   1.00 0.00 ? 9   CYS B H    2  
ATOM 4897  H HA   . CYS B 1 9   ? -2.037  0.497   8.580   1.00 0.00 ? 9   CYS B HA   2  
ATOM 4898  H HB2  . CYS B 1 9   ? -3.177  -0.855  7.086   1.00 0.00 ? 9   CYS B HB2  2  
ATOM 4899  H HB3  . CYS B 1 9   ? -4.410  -0.538  8.296   1.00 0.00 ? 9   CYS B HB3  2  
ATOM 4900  H HG   . CYS B 1 9   ? -5.347  -0.272  5.829   1.00 0.00 ? 9   CYS B HG   2  
ATOM 4901  N N    . ILE B 1 10  ? -3.275  2.944   6.770   1.00 0.00 ? 10  ILE B N    2  
ATOM 4902  C CA   . ILE B 1 10  ? -2.934  3.942   5.772   1.00 0.00 ? 10  ILE B CA   2  
ATOM 4903  C C    . ILE B 1 10  ? -1.894  4.924   6.293   1.00 0.00 ? 10  ILE B C    2  
ATOM 4904  O O    . ILE B 1 10  ? -0.858  5.130   5.668   1.00 0.00 ? 10  ILE B O    2  
ATOM 4905  C CB   . ILE B 1 10  ? -4.175  4.736   5.322   1.00 0.00 ? 10  ILE B CB   2  
ATOM 4906  C CG1  . ILE B 1 10  ? -5.292  3.790   4.892   1.00 0.00 ? 10  ILE B CG1  2  
ATOM 4907  C CG2  . ILE B 1 10  ? -3.816  5.672   4.180   1.00 0.00 ? 10  ILE B CG2  2  
ATOM 4908  C CD1  . ILE B 1 10  ? -6.384  3.627   5.918   1.00 0.00 ? 10  ILE B CD1  2  
ATOM 4909  H H    . ILE B 1 10  ? -4.152  2.983   7.199   1.00 0.00 ? 10  ILE B H    2  
ATOM 4910  H HA   . ILE B 1 10  ? -2.530  3.429   4.911   1.00 0.00 ? 10  ILE B HA   2  
ATOM 4911  H HB   . ILE B 1 10  ? -4.516  5.333   6.153   1.00 0.00 ? 10  ILE B HB   2  
ATOM 4912  H HG12 . ILE B 1 10  ? -5.746  4.171   3.994   1.00 0.00 ? 10  ILE B HG12 2  
ATOM 4913  H HG13 . ILE B 1 10  ? -4.873  2.815   4.697   1.00 0.00 ? 10  ILE B HG13 2  
ATOM 4914  H HG21 . ILE B 1 10  ? -4.218  6.654   4.381   1.00 0.00 ? 10  ILE B HG21 2  
ATOM 4915  H HG22 . ILE B 1 10  ? -4.236  5.292   3.260   1.00 0.00 ? 10  ILE B HG22 2  
ATOM 4916  H HG23 . ILE B 1 10  ? -2.742  5.734   4.088   1.00 0.00 ? 10  ILE B HG23 2  
ATOM 4917  H HD11 . ILE B 1 10  ? -6.066  4.063   6.854   1.00 0.00 ? 10  ILE B HD11 2  
ATOM 4918  H HD12 . ILE B 1 10  ? -6.585  2.577   6.059   1.00 0.00 ? 10  ILE B HD12 2  
ATOM 4919  H HD13 . ILE B 1 10  ? -7.279  4.124   5.575   1.00 0.00 ? 10  ILE B HD13 2  
ATOM 4920  N N    . GLU B 1 11  ? -2.185  5.543   7.429   1.00 0.00 ? 11  GLU B N    2  
ATOM 4921  C CA   . GLU B 1 11  ? -1.286  6.531   8.014   1.00 0.00 ? 11  GLU B CA   2  
ATOM 4922  C C    . GLU B 1 11  ? 0.137   6.002   8.149   1.00 0.00 ? 11  GLU B C    2  
ATOM 4923  O O    . GLU B 1 11  ? 1.094   6.776   8.143   1.00 0.00 ? 11  GLU B O    2  
ATOM 4924  C CB   . GLU B 1 11  ? -1.806  6.985   9.378   1.00 0.00 ? 11  GLU B CB   2  
ATOM 4925  C CG   . GLU B 1 11  ? -1.965  8.493   9.483   1.00 0.00 ? 11  GLU B CG   2  
ATOM 4926  C CD   . GLU B 1 11  ? -1.335  9.060   10.741  1.00 0.00 ? 11  GLU B CD   2  
ATOM 4927  O OE1  . GLU B 1 11  ? -1.138  8.291   11.705  1.00 0.00 ? 11  GLU B OE1  2  
ATOM 4928  O OE2  . GLU B 1 11  ? -1.039  10.274  10.761  1.00 0.00 ? 11  GLU B OE2  2  
ATOM 4929  H H    . GLU B 1 11  ? -3.036  5.348   7.875   1.00 0.00 ? 11  GLU B H    2  
ATOM 4930  H HA   . GLU B 1 11  ? -1.269  7.384   7.357   1.00 0.00 ? 11  GLU B HA   2  
ATOM 4931  H HB2  . GLU B 1 11  ? -2.769  6.528   9.554   1.00 0.00 ? 11  GLU B HB2  2  
ATOM 4932  H HB3  . GLU B 1 11  ? -1.117  6.661   10.144  1.00 0.00 ? 11  GLU B HB3  2  
ATOM 4933  H HG2  . GLU B 1 11  ? -1.494  8.952   8.624   1.00 0.00 ? 11  GLU B HG2  2  
ATOM 4934  H HG3  . GLU B 1 11  ? -3.018  8.731   9.485   1.00 0.00 ? 11  GLU B HG3  2  
ATOM 4935  N N    . SER B 1 12  ? 0.279   4.691   8.279   1.00 0.00 ? 12  SER B N    2  
ATOM 4936  C CA   . SER B 1 12  ? 1.598   4.095   8.424   1.00 0.00 ? 12  SER B CA   2  
ATOM 4937  C C    . SER B 1 12  ? 2.333   4.011   7.084   1.00 0.00 ? 12  SER B C    2  
ATOM 4938  O O    . SER B 1 12  ? 3.441   4.523   6.953   1.00 0.00 ? 12  SER B O    2  
ATOM 4939  C CB   . SER B 1 12  ? 1.481   2.705   9.047   1.00 0.00 ? 12  SER B CB   2  
ATOM 4940  O OG   . SER B 1 12  ? 0.877   2.767   10.327  1.00 0.00 ? 12  SER B OG   2  
ATOM 4941  H H    . SER B 1 12  ? -0.516  4.117   8.285   1.00 0.00 ? 12  SER B H    2  
ATOM 4942  H HA   . SER B 1 12  ? 2.169   4.723   9.090   1.00 0.00 ? 12  SER B HA   2  
ATOM 4943  H HB2  . SER B 1 12  ? 0.876   2.077   8.409   1.00 0.00 ? 12  SER B HB2  2  
ATOM 4944  H HB3  . SER B 1 12  ? 2.466   2.276   9.147   1.00 0.00 ? 12  SER B HB3  2  
ATOM 4945  H HG   . SER B 1 12  ? 0.171   2.120   10.380  1.00 0.00 ? 12  SER B HG   2  
ATOM 4946  N N    . LEU B 1 13  ? 1.720   3.365   6.093   1.00 0.00 ? 13  LEU B N    2  
ATOM 4947  C CA   . LEU B 1 13  ? 2.341   3.220   4.780   1.00 0.00 ? 13  LEU B CA   2  
ATOM 4948  C C    . LEU B 1 13  ? 2.675   4.576   4.157   1.00 0.00 ? 13  LEU B C    2  
ATOM 4949  O O    . LEU B 1 13  ? 3.617   4.699   3.373   1.00 0.00 ? 13  LEU B O    2  
ATOM 4950  C CB   . LEU B 1 13  ? 1.433   2.410   3.863   1.00 0.00 ? 13  LEU B CB   2  
ATOM 4951  C CG   . LEU B 1 13  ? 1.653   0.899   3.930   1.00 0.00 ? 13  LEU B CG   2  
ATOM 4952  C CD1  . LEU B 1 13  ? 3.109   0.556   3.669   1.00 0.00 ? 13  LEU B CD1  2  
ATOM 4953  C CD2  . LEU B 1 13  ? 1.229   0.342   5.276   1.00 0.00 ? 13  LEU B CD2  2  
ATOM 4954  H H    . LEU B 1 13  ? 0.837   2.966   6.245   1.00 0.00 ? 13  LEU B H    2  
ATOM 4955  H HA   . LEU B 1 13  ? 3.263   2.675   4.919   1.00 0.00 ? 13  LEU B HA   2  
ATOM 4956  H HB2  . LEU B 1 13  ? 0.407   2.620   4.126   1.00 0.00 ? 13  LEU B HB2  2  
ATOM 4957  H HB3  . LEU B 1 13  ? 1.602   2.732   2.846   1.00 0.00 ? 13  LEU B HB3  2  
ATOM 4958  H HG   . LEU B 1 13  ? 1.053   0.427   3.171   1.00 0.00 ? 13  LEU B HG   2  
ATOM 4959  H HD11 . LEU B 1 13  ? 3.168   -0.326  3.050   1.00 0.00 ? 13  LEU B HD11 2  
ATOM 4960  H HD12 . LEU B 1 13  ? 3.610   0.368   4.612   1.00 0.00 ? 13  LEU B HD12 2  
ATOM 4961  H HD13 . LEU B 1 13  ? 3.590   1.382   3.166   1.00 0.00 ? 13  LEU B HD13 2  
ATOM 4962  H HD21 . LEU B 1 13  ? 0.640   1.074   5.804   1.00 0.00 ? 13  LEU B HD21 2  
ATOM 4963  H HD22 . LEU B 1 13  ? 2.108   0.101   5.850   1.00 0.00 ? 13  LEU B HD22 2  
ATOM 4964  H HD23 . LEU B 1 13  ? 0.645   -0.553  5.126   1.00 0.00 ? 13  LEU B HD23 2  
ATOM 4965  N N    . ILE B 1 14  ? 1.921   5.597   4.520   1.00 0.00 ? 14  ILE B N    2  
ATOM 4966  C CA   . ILE B 1 14  ? 2.162   6.929   4.017   1.00 0.00 ? 14  ILE B CA   2  
ATOM 4967  C C    . ILE B 1 14  ? 3.408   7.504   4.631   1.00 0.00 ? 14  ILE B C    2  
ATOM 4968  O O    . ILE B 1 14  ? 4.168   8.219   3.987   1.00 0.00 ? 14  ILE B O    2  
ATOM 4969  C CB   . ILE B 1 14  ? 1.041   7.875   4.421   1.00 0.00 ? 14  ILE B CB   2  
ATOM 4970  C CG1  . ILE B 1 14  ? -0.312  7.301   4.074   1.00 0.00 ? 14  ILE B CG1  2  
ATOM 4971  C CG2  . ILE B 1 14  ? 1.243   9.225   3.783   1.00 0.00 ? 14  ILE B CG2  2  
ATOM 4972  C CD1  . ILE B 1 14  ? -1.393  7.843   4.966   1.00 0.00 ? 14  ILE B CD1  2  
ATOM 4973  H H    . ILE B 1 14  ? 1.195   5.462   5.156   1.00 0.00 ? 14  ILE B H    2  
ATOM 4974  H HA   . ILE B 1 14  ? 2.241   6.910   2.946   1.00 0.00 ? 14  ILE B HA   2  
ATOM 4975  H HB   . ILE B 1 14  ? 1.095   8.012   5.491   1.00 0.00 ? 14  ILE B HB   2  
ATOM 4976  H HG12 . ILE B 1 14  ? -0.559  7.544   3.051   1.00 0.00 ? 14  ILE B HG12 2  
ATOM 4977  H HG13 . ILE B 1 14  ? -0.279  6.234   4.196   1.00 0.00 ? 14  ILE B HG13 2  
ATOM 4978  H HG21 . ILE B 1 14  ? 0.516   9.918   4.174   1.00 0.00 ? 14  ILE B HG21 2  
ATOM 4979  H HG22 . ILE B 1 14  ? 1.126   9.134   2.716   1.00 0.00 ? 14  ILE B HG22 2  
ATOM 4980  H HG23 . ILE B 1 14  ? 2.240   9.576   4.011   1.00 0.00 ? 14  ILE B HG23 2  
ATOM 4981  H HD11 . ILE B 1 14  ? -2.009  8.526   4.407   1.00 0.00 ? 14  ILE B HD11 2  
ATOM 4982  H HD12 . ILE B 1 14  ? -0.933  8.364   5.797   1.00 0.00 ? 14  ILE B HD12 2  
ATOM 4983  H HD13 . ILE B 1 14  ? -1.995  7.034   5.338   1.00 0.00 ? 14  ILE B HD13 2  
ATOM 4984  N N    . ALA B 1 15  ? 3.555   7.220   5.907   1.00 0.00 ? 15  ALA B N    2  
ATOM 4985  C CA   . ALA B 1 15  ? 4.643   7.738   6.688   1.00 0.00 ? 15  ALA B CA   2  
ATOM 4986  C C    . ALA B 1 15  ? 5.938   6.999   6.422   1.00 0.00 ? 15  ALA B C    2  
ATOM 4987  O O    . ALA B 1 15  ? 7.000   7.615   6.335   1.00 0.00 ? 15  ALA B O    2  
ATOM 4988  C CB   . ALA B 1 15  ? 4.240   7.702   8.139   1.00 0.00 ? 15  ALA B CB   2  
ATOM 4989  H H    . ALA B 1 15  ? 2.881   6.663   6.350   1.00 0.00 ? 15  ALA B H    2  
ATOM 4990  H HA   . ALA B 1 15  ? 4.774   8.767   6.410   1.00 0.00 ? 15  ALA B HA   2  
ATOM 4991  H HB1  . ALA B 1 15  ? 4.670   6.836   8.615   1.00 0.00 ? 15  ALA B HB1  2  
ATOM 4992  H HB2  . ALA B 1 15  ? 3.154   7.649   8.192   1.00 0.00 ? 15  ALA B HB2  2  
ATOM 4993  H HB3  . ALA B 1 15  ? 4.582   8.600   8.625   1.00 0.00 ? 15  ALA B HB3  2  
ATOM 4994  N N    . VAL B 1 16  ? 5.852   5.690   6.243   1.00 0.00 ? 16  VAL B N    2  
ATOM 4995  C CA   . VAL B 1 16  ? 7.028   4.909   5.928   1.00 0.00 ? 16  VAL B CA   2  
ATOM 4996  C C    . VAL B 1 16  ? 7.720   5.539   4.732   1.00 0.00 ? 16  VAL B C    2  
ATOM 4997  O O    . VAL B 1 16  ? 8.944   5.510   4.604   1.00 0.00 ? 16  VAL B O    2  
ATOM 4998  C CB   . VAL B 1 16  ? 6.645   3.459   5.583   1.00 0.00 ? 16  VAL B CB   2  
ATOM 4999  C CG1  . VAL B 1 16  ? 5.899   2.822   6.726   1.00 0.00 ? 16  VAL B CG1  2  
ATOM 5000  C CG2  . VAL B 1 16  ? 5.784   3.408   4.337   1.00 0.00 ? 16  VAL B CG2  2  
ATOM 5001  H H    . VAL B 1 16  ? 4.983   5.247   6.283   1.00 0.00 ? 16  VAL B H    2  
ATOM 5002  H HA   . VAL B 1 16  ? 7.690   4.911   6.782   1.00 0.00 ? 16  VAL B HA   2  
ATOM 5003  H HB   . VAL B 1 16  ? 7.542   2.901   5.403   1.00 0.00 ? 16  VAL B HB   2  
ATOM 5004  H HG11 . VAL B 1 16  ? 5.365   1.954   6.359   1.00 0.00 ? 16  VAL B HG11 2  
ATOM 5005  H HG12 . VAL B 1 16  ? 5.197   3.538   7.124   1.00 0.00 ? 16  VAL B HG12 2  
ATOM 5006  H HG13 . VAL B 1 16  ? 6.595   2.526   7.494   1.00 0.00 ? 16  VAL B HG13 2  
ATOM 5007  H HG21 . VAL B 1 16  ? 5.692   2.384   4.002   1.00 0.00 ? 16  VAL B HG21 2  
ATOM 5008  H HG22 . VAL B 1 16  ? 6.227   4.006   3.559   1.00 0.00 ? 16  VAL B HG22 2  
ATOM 5009  H HG23 . VAL B 1 16  ? 4.809   3.795   4.578   1.00 0.00 ? 16  VAL B HG23 2  
ATOM 5010  N N    . PHE B 1 17  ? 6.896   6.099   3.852   1.00 0.00 ? 17  PHE B N    2  
ATOM 5011  C CA   . PHE B 1 17  ? 7.380   6.739   2.637   1.00 0.00 ? 17  PHE B CA   2  
ATOM 5012  C C    . PHE B 1 17  ? 7.899   8.160   2.878   1.00 0.00 ? 17  PHE B C    2  
ATOM 5013  O O    . PHE B 1 17  ? 9.049   8.455   2.561   1.00 0.00 ? 17  PHE B O    2  
ATOM 5014  C CB   . PHE B 1 17  ? 6.268   6.759   1.579   1.00 0.00 ? 17  PHE B CB   2  
ATOM 5015  C CG   . PHE B 1 17  ? 6.445   7.815   0.520   1.00 0.00 ? 17  PHE B CG   2  
ATOM 5016  C CD1  . PHE B 1 17  ? 7.679   8.011   -0.081  1.00 0.00 ? 17  PHE B CD1  2  
ATOM 5017  C CD2  . PHE B 1 17  ? 5.381   8.614   0.135   1.00 0.00 ? 17  PHE B CD2  2  
ATOM 5018  C CE1  . PHE B 1 17  ? 7.847   8.985   -1.049  1.00 0.00 ? 17  PHE B CE1  2  
ATOM 5019  C CE2  . PHE B 1 17  ? 5.543   9.589   -0.832  1.00 0.00 ? 17  PHE B CE2  2  
ATOM 5020  C CZ   . PHE B 1 17  ? 6.777   9.774   -1.424  1.00 0.00 ? 17  PHE B CZ   2  
ATOM 5021  H H    . PHE B 1 17  ? 5.921   6.067   4.026   1.00 0.00 ? 17  PHE B H    2  
ATOM 5022  H HA   . PHE B 1 17  ? 8.195   6.140   2.263   1.00 0.00 ? 17  PHE B HA   2  
ATOM 5023  H HB2  . PHE B 1 17  ? 6.235   5.800   1.085   1.00 0.00 ? 17  PHE B HB2  2  
ATOM 5024  H HB3  . PHE B 1 17  ? 5.321   6.935   2.069   1.00 0.00 ? 17  PHE B HB3  2  
ATOM 5025  H HD1  . PHE B 1 17  ? 8.516   7.394   0.211   1.00 0.00 ? 17  PHE B HD1  2  
ATOM 5026  H HD2  . PHE B 1 17  ? 4.416   8.470   0.596   1.00 0.00 ? 17  PHE B HD2  2  
ATOM 5027  H HE1  . PHE B 1 17  ? 8.812   9.127   -1.510  1.00 0.00 ? 17  PHE B HE1  2  
ATOM 5028  H HE2  . PHE B 1 17  ? 4.705   10.205  -1.125  1.00 0.00 ? 17  PHE B HE2  2  
ATOM 5029  H HZ   . PHE B 1 17  ? 6.906   10.535  -2.180  1.00 0.00 ? 17  PHE B HZ   2  
ATOM 5030  N N    . GLN B 1 18  ? 7.044   9.047   3.400   1.00 0.00 ? 18  GLN B N    2  
ATOM 5031  C CA   . GLN B 1 18  ? 7.432   10.443  3.623   1.00 0.00 ? 18  GLN B CA   2  
ATOM 5032  C C    . GLN B 1 18  ? 8.436   10.595  4.756   1.00 0.00 ? 18  GLN B C    2  
ATOM 5033  O O    . GLN B 1 18  ? 9.233   11.534  4.760   1.00 0.00 ? 18  GLN B O    2  
ATOM 5034  C CB   . GLN B 1 18  ? 6.205   11.321  3.880   1.00 0.00 ? 18  GLN B CB   2  
ATOM 5035  C CG   . GLN B 1 18  ? 5.119   10.634  4.675   1.00 0.00 ? 18  GLN B CG   2  
ATOM 5036  C CD   . GLN B 1 18  ? 5.011   11.166  6.075   1.00 0.00 ? 18  GLN B CD   2  
ATOM 5037  O OE1  . GLN B 1 18  ? 4.253   12.096  6.354   1.00 0.00 ? 18  GLN B OE1  2  
ATOM 5038  N NE2  . GLN B 1 18  ? 5.779   10.568  6.965   1.00 0.00 ? 18  GLN B NE2  2  
ATOM 5039  H H    . GLN B 1 18  ? 6.131   8.765   3.623   1.00 0.00 ? 18  GLN B H    2  
ATOM 5040  H HA   . GLN B 1 18  ? 7.902   10.787  2.719   1.00 0.00 ? 18  GLN B HA   2  
ATOM 5041  H HB2  . GLN B 1 18  ? 6.516   12.202  4.420   1.00 0.00 ? 18  GLN B HB2  2  
ATOM 5042  H HB3  . GLN B 1 18  ? 5.790   11.621  2.929   1.00 0.00 ? 18  GLN B HB3  2  
ATOM 5043  H HG2  . GLN B 1 18  ? 4.175   10.767  4.176   1.00 0.00 ? 18  GLN B HG2  2  
ATOM 5044  H HG3  . GLN B 1 18  ? 5.349   9.584   4.737   1.00 0.00 ? 18  GLN B HG3  2  
ATOM 5045  H HE21 . GLN B 1 18  ? 6.360   9.834   6.659   1.00 0.00 ? 18  GLN B HE21 2  
ATOM 5046  H HE22 . GLN B 1 18  ? 5.729   10.867  7.881   1.00 0.00 ? 18  GLN B HE22 2  
ATOM 5047  N N    . LYS B 1 19  ? 8.414   9.678   5.715   1.00 0.00 ? 19  LYS B N    2  
ATOM 5048  C CA   . LYS B 1 19  ? 9.348   9.745   6.831   1.00 0.00 ? 19  LYS B CA   2  
ATOM 5049  C C    . LYS B 1 19  ? 10.775  9.765   6.302   1.00 0.00 ? 19  LYS B C    2  
ATOM 5050  O O    . LYS B 1 19  ? 11.573  10.634  6.655   1.00 0.00 ? 19  LYS B O    2  
ATOM 5051  C CB   . LYS B 1 19  ? 9.153   8.556   7.774   1.00 0.00 ? 19  LYS B CB   2  
ATOM 5052  C CG   . LYS B 1 19  ? 9.990   8.643   9.040   1.00 0.00 ? 19  LYS B CG   2  
ATOM 5053  C CD   . LYS B 1 19  ? 9.558   9.810   9.915   1.00 0.00 ? 19  LYS B CD   2  
ATOM 5054  C CE   . LYS B 1 19  ? 10.751  10.607  10.419  1.00 0.00 ? 19  LYS B CE   2  
ATOM 5055  N NZ   . LYS B 1 19  ? 11.002  10.377  11.868  1.00 0.00 ? 19  LYS B NZ   2  
ATOM 5056  H H    . LYS B 1 19  ? 7.768   8.943   5.667   1.00 0.00 ? 19  LYS B H    2  
ATOM 5057  H HA   . LYS B 1 19  ? 9.160   10.663  7.369   1.00 0.00 ? 19  LYS B HA   2  
ATOM 5058  H HB2  . LYS B 1 19  ? 8.112   8.503   8.058   1.00 0.00 ? 19  LYS B HB2  2  
ATOM 5059  H HB3  . LYS B 1 19  ? 9.422   7.649   7.252   1.00 0.00 ? 19  LYS B HB3  2  
ATOM 5060  H HG2  . LYS B 1 19  ? 9.877   7.726   9.598   1.00 0.00 ? 19  LYS B HG2  2  
ATOM 5061  H HG3  . LYS B 1 19  ? 11.027  8.774   8.765   1.00 0.00 ? 19  LYS B HG3  2  
ATOM 5062  H HD2  . LYS B 1 19  ? 8.920   10.463  9.339   1.00 0.00 ? 19  LYS B HD2  2  
ATOM 5063  H HD3  . LYS B 1 19  ? 9.010   9.426   10.764  1.00 0.00 ? 19  LYS B HD3  2  
ATOM 5064  H HE2  . LYS B 1 19  ? 11.628  10.314  9.860   1.00 0.00 ? 19  LYS B HE2  2  
ATOM 5065  H HE3  . LYS B 1 19  ? 10.559  11.658  10.258  1.00 0.00 ? 19  LYS B HE3  2  
ATOM 5066  H HZ1  . LYS B 1 19  ? 10.128  10.059  12.335  1.00 0.00 ? 19  LYS B HZ1  2  
ATOM 5067  H HZ2  . LYS B 1 19  ? 11.322  11.257  12.320  1.00 0.00 ? 19  LYS B HZ2  2  
ATOM 5068  H HZ3  . LYS B 1 19  ? 11.734  9.649   11.993  1.00 0.00 ? 19  LYS B HZ3  2  
ATOM 5069  N N    . TYR B 1 20  ? 11.069  8.819   5.422   1.00 0.00 ? 20  TYR B N    2  
ATOM 5070  C CA   . TYR B 1 20  ? 12.377  8.730   4.794   1.00 0.00 ? 20  TYR B CA   2  
ATOM 5071  C C    . TYR B 1 20  ? 12.469  9.746   3.665   1.00 0.00 ? 20  TYR B C    2  
ATOM 5072  O O    . TYR B 1 20  ? 13.546  10.234  3.322   1.00 0.00 ? 20  TYR B O    2  
ATOM 5073  C CB   . TYR B 1 20  ? 12.612  7.311   4.271   1.00 0.00 ? 20  TYR B CB   2  
ATOM 5074  C CG   . TYR B 1 20  ? 12.191  6.233   5.250   1.00 0.00 ? 20  TYR B CG   2  
ATOM 5075  C CD1  . TYR B 1 20  ? 12.247  6.453   6.621   1.00 0.00 ? 20  TYR B CD1  2  
ATOM 5076  C CD2  . TYR B 1 20  ? 11.735  4.998   4.804   1.00 0.00 ? 20  TYR B CD2  2  
ATOM 5077  C CE1  . TYR B 1 20  ? 11.863  5.474   7.519   1.00 0.00 ? 20  TYR B CE1  2  
ATOM 5078  C CE2  . TYR B 1 20  ? 11.349  4.015   5.697   1.00 0.00 ? 20  TYR B CE2  2  
ATOM 5079  C CZ   . TYR B 1 20  ? 11.415  4.259   7.052   1.00 0.00 ? 20  TYR B CZ   2  
ATOM 5080  O OH   . TYR B 1 20  ? 11.034  3.282   7.943   1.00 0.00 ? 20  TYR B OH   2  
ATOM 5081  H H    . TYR B 1 20  ? 10.372  8.185   5.153   1.00 0.00 ? 20  TYR B H    2  
ATOM 5082  H HA   . TYR B 1 20  ? 13.124  8.964   5.539   1.00 0.00 ? 20  TYR B HA   2  
ATOM 5083  H HB2  . TYR B 1 20  ? 12.050  7.172   3.359   1.00 0.00 ? 20  TYR B HB2  2  
ATOM 5084  H HB3  . TYR B 1 20  ? 13.665  7.180   4.062   1.00 0.00 ? 20  TYR B HB3  2  
ATOM 5085  H HD1  . TYR B 1 20  ? 12.598  7.407   6.985   1.00 0.00 ? 20  TYR B HD1  2  
ATOM 5086  H HD2  . TYR B 1 20  ? 11.685  4.809   3.741   1.00 0.00 ? 20  TYR B HD2  2  
ATOM 5087  H HE1  . TYR B 1 20  ? 11.917  5.664   8.580   1.00 0.00 ? 20  TYR B HE1  2  
ATOM 5088  H HE2  . TYR B 1 20  ? 10.998  3.061   5.331   1.00 0.00 ? 20  TYR B HE2  2  
ATOM 5089  H HH   . TYR B 1 20  ? 10.098  3.096   7.832   1.00 0.00 ? 20  TYR B HH   2  
ATOM 5090  N N    . ALA B 1 21  ? 11.308  10.044  3.090   1.00 0.00 ? 21  ALA B N    2  
ATOM 5091  C CA   . ALA B 1 21  ? 11.191  10.983  1.990   1.00 0.00 ? 21  ALA B CA   2  
ATOM 5092  C C    . ALA B 1 21  ? 11.195  12.435  2.470   1.00 0.00 ? 21  ALA B C    2  
ATOM 5093  O O    . ALA B 1 21  ? 11.064  13.360  1.668   1.00 0.00 ? 21  ALA B O    2  
ATOM 5094  C CB   . ALA B 1 21  ? 9.916   10.673  1.226   1.00 0.00 ? 21  ALA B CB   2  
ATOM 5095  H H    . ALA B 1 21  ? 10.497  9.605   3.417   1.00 0.00 ? 21  ALA B H    2  
ATOM 5096  H HA   . ALA B 1 21  ? 12.023  10.832  1.325   1.00 0.00 ? 21  ALA B HA   2  
ATOM 5097  H HB1  . ALA B 1 21  ? 9.215   10.189  1.895   1.00 0.00 ? 21  ALA B HB1  2  
ATOM 5098  H HB2  . ALA B 1 21  ? 10.143  10.011  0.400   1.00 0.00 ? 21  ALA B HB2  2  
ATOM 5099  H HB3  . ALA B 1 21  ? 9.484   11.587  0.852   1.00 0.00 ? 21  ALA B HB3  2  
ATOM 5100  N N    . GLY B 1 22  ? 11.351  12.634  3.777   1.00 0.00 ? 22  GLY B N    2  
ATOM 5101  C CA   . GLY B 1 22  ? 11.373  13.978  4.323   1.00 0.00 ? 22  GLY B CA   2  
ATOM 5102  C C    . GLY B 1 22  ? 10.006  14.446  4.781   1.00 0.00 ? 22  GLY B C    2  
ATOM 5103  O O    . GLY B 1 22  ? 8.995   14.155  4.141   1.00 0.00 ? 22  GLY B O    2  
ATOM 5104  H H    . GLY B 1 22  ? 11.454  11.866  4.375   1.00 0.00 ? 22  GLY B H    2  
ATOM 5105  H HA2  . GLY B 1 22  ? 12.050  14.002  5.164   1.00 0.00 ? 22  GLY B HA2  2  
ATOM 5106  H HA3  . GLY B 1 22  ? 11.736  14.656  3.564   1.00 0.00 ? 22  GLY B HA3  2  
ATOM 5107  N N    . LYS B 1 23  ? 9.976   15.174  5.893   1.00 0.00 ? 23  LYS B N    2  
ATOM 5108  C CA   . LYS B 1 23  ? 8.725   15.686  6.439   1.00 0.00 ? 23  LYS B CA   2  
ATOM 5109  C C    . LYS B 1 23  ? 8.659   17.205  6.316   1.00 0.00 ? 23  LYS B C    2  
ATOM 5110  O O    . LYS B 1 23  ? 7.582   17.778  6.147   1.00 0.00 ? 23  LYS B O    2  
ATOM 5111  C CB   . LYS B 1 23  ? 8.578   15.275  7.906   1.00 0.00 ? 23  LYS B CB   2  
ATOM 5112  C CG   . LYS B 1 23  ? 7.134   15.180  8.370   1.00 0.00 ? 23  LYS B CG   2  
ATOM 5113  C CD   . LYS B 1 23  ? 6.947   15.795  9.749   1.00 0.00 ? 23  LYS B CD   2  
ATOM 5114  C CE   . LYS B 1 23  ? 6.160   14.876  10.669  1.00 0.00 ? 23  LYS B CE   2  
ATOM 5115  N NZ   . LYS B 1 23  ? 4.789   14.612  10.149  1.00 0.00 ? 23  LYS B NZ   2  
ATOM 5116  H H    . LYS B 1 23  ? 10.816  15.372  6.356   1.00 0.00 ? 23  LYS B H    2  
ATOM 5117  H HA   . LYS B 1 23  ? 7.913   15.255  5.872   1.00 0.00 ? 23  LYS B HA   2  
ATOM 5118  H HB2  . LYS B 1 23  ? 9.044   14.310  8.045   1.00 0.00 ? 23  LYS B HB2  2  
ATOM 5119  H HB3  . LYS B 1 23  ? 9.086   16.002  8.523   1.00 0.00 ? 23  LYS B HB3  2  
ATOM 5120  H HG2  . LYS B 1 23  ? 6.505   15.703  7.666   1.00 0.00 ? 23  LYS B HG2  2  
ATOM 5121  H HG3  . LYS B 1 23  ? 6.847   14.139  8.407   1.00 0.00 ? 23  LYS B HG3  2  
ATOM 5122  H HD2  . LYS B 1 23  ? 7.917   15.979  10.186  1.00 0.00 ? 23  LYS B HD2  2  
ATOM 5123  H HD3  . LYS B 1 23  ? 6.414   16.729  9.645   1.00 0.00 ? 23  LYS B HD3  2  
ATOM 5124  H HE2  . LYS B 1 23  ? 6.687   13.938  10.757  1.00 0.00 ? 23  LYS B HE2  2  
ATOM 5125  H HE3  . LYS B 1 23  ? 6.084   15.339  11.642  1.00 0.00 ? 23  LYS B HE3  2  
ATOM 5126  H HZ1  . LYS B 1 23  ? 4.810   13.826  9.469   1.00 0.00 ? 23  LYS B HZ1  2  
ATOM 5127  H HZ2  . LYS B 1 23  ? 4.417   15.458  9.674   1.00 0.00 ? 23  LYS B HZ2  2  
ATOM 5128  H HZ3  . LYS B 1 23  ? 4.153   14.361  10.933  1.00 0.00 ? 23  LYS B HZ3  2  
ATOM 5129  N N    . ASP B 1 24  ? 9.818   17.851  6.404   1.00 0.00 ? 24  ASP B N    2  
ATOM 5130  C CA   . ASP B 1 24  ? 9.892   19.304  6.303   1.00 0.00 ? 24  ASP B CA   2  
ATOM 5131  C C    . ASP B 1 24  ? 10.325  19.730  4.903   1.00 0.00 ? 24  ASP B C    2  
ATOM 5132  O O    . ASP B 1 24  ? 11.367  19.301  4.408   1.00 0.00 ? 24  ASP B O    2  
ATOM 5133  C CB   . ASP B 1 24  ? 10.867  19.860  7.342   1.00 0.00 ? 24  ASP B CB   2  
ATOM 5134  C CG   . ASP B 1 24  ? 10.220  20.044  8.702   1.00 0.00 ? 24  ASP B CG   2  
ATOM 5135  O OD1  . ASP B 1 24  ? 10.086  19.043  9.435   1.00 0.00 ? 24  ASP B OD1  2  
ATOM 5136  O OD2  . ASP B 1 24  ? 9.849   21.189  9.031   1.00 0.00 ? 24  ASP B OD2  2  
ATOM 5137  H H    . ASP B 1 24  ? 10.641  17.339  6.539   1.00 0.00 ? 24  ASP B H    2  
ATOM 5138  H HA   . ASP B 1 24  ? 8.906   19.701  6.498   1.00 0.00 ? 24  ASP B HA   2  
ATOM 5139  H HB2  . ASP B 1 24  ? 11.697  19.177  7.450   1.00 0.00 ? 24  ASP B HB2  2  
ATOM 5140  H HB3  . ASP B 1 24  ? 11.235  20.817  7.005   1.00 0.00 ? 24  ASP B HB3  2  
ATOM 5141  N N    . GLY B 1 25  ? 9.519   20.579  4.273   1.00 0.00 ? 25  GLY B N    2  
ATOM 5142  C CA   . GLY B 1 25  ? 9.837   21.050  2.938   1.00 0.00 ? 25  GLY B CA   2  
ATOM 5143  C C    . GLY B 1 25  ? 9.011   20.363  1.868   1.00 0.00 ? 25  GLY B C    2  
ATOM 5144  O O    . GLY B 1 25  ? 8.720   20.952  0.827   1.00 0.00 ? 25  GLY B O    2  
ATOM 5145  H H    . GLY B 1 25  ? 8.703   20.888  4.719   1.00 0.00 ? 25  GLY B H    2  
ATOM 5146  H HA2  . GLY B 1 25  ? 9.655   22.113  2.891   1.00 0.00 ? 25  GLY B HA2  2  
ATOM 5147  H HA3  . GLY B 1 25  ? 10.883  20.866  2.743   1.00 0.00 ? 25  GLY B HA3  2  
ATOM 5148  N N    . HIS B 1 26  ? 8.632   19.116  2.125   1.00 0.00 ? 26  HIS B N    2  
ATOM 5149  C CA   . HIS B 1 26  ? 7.835   18.349  1.174   1.00 0.00 ? 26  HIS B CA   2  
ATOM 5150  C C    . HIS B 1 26  ? 8.583   18.168  -0.143  1.00 0.00 ? 26  HIS B C    2  
ATOM 5151  O O    . HIS B 1 26  ? 8.813   19.129  -0.875  1.00 0.00 ? 26  HIS B O    2  
ATOM 5152  C CB   . HIS B 1 26  ? 6.495   19.044  0.922   1.00 0.00 ? 26  HIS B CB   2  
ATOM 5153  C CG   . HIS B 1 26  ? 5.621   19.118  2.137   1.00 0.00 ? 26  HIS B CG   2  
ATOM 5154  N ND1  . HIS B 1 26  ? 6.057   19.612  3.349   1.00 0.00 ? 26  HIS B ND1  2  
ATOM 5155  C CD2  . HIS B 1 26  ? 4.330   18.757  2.323   1.00 0.00 ? 26  HIS B CD2  2  
ATOM 5156  C CE1  . HIS B 1 26  ? 5.072   19.552  4.226   1.00 0.00 ? 26  HIS B CE1  2  
ATOM 5157  N NE2  . HIS B 1 26  ? 4.013   19.037  3.629   1.00 0.00 ? 26  HIS B NE2  2  
ATOM 5158  H H    . HIS B 1 26  ? 8.895   18.701  2.972   1.00 0.00 ? 26  HIS B H    2  
ATOM 5159  H HA   . HIS B 1 26  ? 7.650   17.376  1.606   1.00 0.00 ? 26  HIS B HA   2  
ATOM 5160  H HB2  . HIS B 1 26  ? 6.678   20.052  0.584   1.00 0.00 ? 26  HIS B HB2  2  
ATOM 5161  H HB3  . HIS B 1 26  ? 5.957   18.504  0.157   1.00 0.00 ? 26  HIS B HB3  2  
ATOM 5162  H HD1  . HIS B 1 26  ? 6.955   19.955  3.537   1.00 0.00 ? 26  HIS B HD1  2  
ATOM 5163  H HD2  . HIS B 1 26  ? 3.670   18.329  1.580   1.00 0.00 ? 26  HIS B HD2  2  
ATOM 5164  H HE1  . HIS B 1 26  ? 5.123   19.870  5.257   1.00 0.00 ? 26  HIS B HE1  2  
ATOM 5165  H HE2  . HIS B 1 26  ? 3.172   18.800  4.074   1.00 0.00 ? 26  HIS B HE2  2  
ATOM 5166  N N    . SER B 1 27  ? 8.962   16.927  -0.436  1.00 0.00 ? 27  SER B N    2  
ATOM 5167  C CA   . SER B 1 27  ? 9.686   16.618  -1.665  1.00 0.00 ? 27  SER B CA   2  
ATOM 5168  C C    . SER B 1 27  ? 8.808   15.834  -2.636  1.00 0.00 ? 27  SER B C    2  
ATOM 5169  O O    . SER B 1 27  ? 8.986   15.916  -3.851  1.00 0.00 ? 27  SER B O    2  
ATOM 5170  C CB   . SER B 1 27  ? 10.952  15.821  -1.348  1.00 0.00 ? 27  SER B CB   2  
ATOM 5171  O OG   . SER B 1 27  ? 11.986  16.670  -0.879  1.00 0.00 ? 27  SER B OG   2  
ATOM 5172  H H    . SER B 1 27  ? 8.750   16.202  0.188   1.00 0.00 ? 27  SER B H    2  
ATOM 5173  H HA   . SER B 1 27  ? 9.967   17.552  -2.127  1.00 0.00 ? 27  SER B HA   2  
ATOM 5174  H HB2  . SER B 1 27  ? 10.732  15.088  -0.586  1.00 0.00 ? 27  SER B HB2  2  
ATOM 5175  H HB3  . SER B 1 27  ? 11.292  15.320  -2.242  1.00 0.00 ? 27  SER B HB3  2  
ATOM 5176  H HG   . SER B 1 27  ? 12.457  16.236  -0.164  1.00 0.00 ? 27  SER B HG   2  
ATOM 5177  N N    . VAL B 1 28  ? 7.859   15.072  -2.088  1.00 0.00 ? 28  VAL B N    2  
ATOM 5178  C CA   . VAL B 1 28  ? 6.943   14.262  -2.895  1.00 0.00 ? 28  VAL B CA   2  
ATOM 5179  C C    . VAL B 1 28  ? 7.580   12.939  -3.321  1.00 0.00 ? 28  VAL B C    2  
ATOM 5180  O O    . VAL B 1 28  ? 6.910   12.078  -3.893  1.00 0.00 ? 28  VAL B O    2  
ATOM 5181  C CB   . VAL B 1 28  ? 6.464   15.014  -4.155  1.00 0.00 ? 28  VAL B CB   2  
ATOM 5182  C CG1  . VAL B 1 28  ? 5.259   14.315  -4.764  1.00 0.00 ? 28  VAL B CG1  2  
ATOM 5183  C CG2  . VAL B 1 28  ? 6.137   16.463  -3.823  1.00 0.00 ? 28  VAL B CG2  2  
ATOM 5184  H H    . VAL B 1 28  ? 7.774   15.052  -1.113  1.00 0.00 ? 28  VAL B H    2  
ATOM 5185  H HA   . VAL B 1 28  ? 6.077   14.046  -2.286  1.00 0.00 ? 28  VAL B HA   2  
ATOM 5186  H HB   . VAL B 1 28  ? 7.261   15.003  -4.882  1.00 0.00 ? 28  VAL B HB   2  
ATOM 5187  H HG11 . VAL B 1 28  ? 5.559   13.354  -5.156  1.00 0.00 ? 28  VAL B HG11 2  
ATOM 5188  H HG12 . VAL B 1 28  ? 4.858   14.920  -5.563  1.00 0.00 ? 28  VAL B HG12 2  
ATOM 5189  H HG13 . VAL B 1 28  ? 4.502   14.174  -4.006  1.00 0.00 ? 28  VAL B HG13 2  
ATOM 5190  H HG21 . VAL B 1 28  ? 5.898   16.547  -2.774  1.00 0.00 ? 28  VAL B HG21 2  
ATOM 5191  H HG22 . VAL B 1 28  ? 5.292   16.786  -4.413  1.00 0.00 ? 28  VAL B HG22 2  
ATOM 5192  H HG23 . VAL B 1 28  ? 6.992   17.084  -4.049  1.00 0.00 ? 28  VAL B HG23 2  
ATOM 5193  N N    . THR B 1 29  ? 8.869   12.775  -3.038  1.00 0.00 ? 29  THR B N    2  
ATOM 5194  C CA   . THR B 1 29  ? 9.581   11.554  -3.391  1.00 0.00 ? 29  THR B CA   2  
ATOM 5195  C C    . THR B 1 29  ? 10.523  11.134  -2.269  1.00 0.00 ? 29  THR B C    2  
ATOM 5196  O O    . THR B 1 29  ? 10.605  11.791  -1.232  1.00 0.00 ? 29  THR B O    2  
ATOM 5197  C CB   . THR B 1 29  ? 10.360  11.742  -4.691  1.00 0.00 ? 29  THR B CB   2  
ATOM 5198  O OG1  . THR B 1 29  ? 10.956  13.027  -4.740  1.00 0.00 ? 29  THR B OG1  2  
ATOM 5199  C CG2  . THR B 1 29  ? 9.501   11.582  -5.928  1.00 0.00 ? 29  THR B CG2  2  
ATOM 5200  H H    . THR B 1 29  ? 9.355   13.490  -2.579  1.00 0.00 ? 29  THR B H    2  
ATOM 5201  H HA   . THR B 1 29  ? 8.850   10.775  -3.536  1.00 0.00 ? 29  THR B HA   2  
ATOM 5202  H HB   . THR B 1 29  ? 11.144  11.000  -4.736  1.00 0.00 ? 29  THR B HB   2  
ATOM 5203  H HG1  . THR B 1 29  ? 11.376  13.218  -3.898  1.00 0.00 ? 29  THR B HG1  2  
ATOM 5204  H HG21 . THR B 1 29  ? 9.248   10.540  -6.059  1.00 0.00 ? 29  THR B HG21 2  
ATOM 5205  H HG22 . THR B 1 29  ? 10.046  11.932  -6.793  1.00 0.00 ? 29  THR B HG22 2  
ATOM 5206  H HG23 . THR B 1 29  ? 8.597   12.161  -5.815  1.00 0.00 ? 29  THR B HG23 2  
ATOM 5207  N N    . LEU B 1 30  ? 11.227  10.031  -2.484  1.00 0.00 ? 30  LEU B N    2  
ATOM 5208  C CA   . LEU B 1 30  ? 12.162  9.512   -1.494  1.00 0.00 ? 30  LEU B CA   2  
ATOM 5209  C C    . LEU B 1 30  ? 13.509  9.175   -2.151  1.00 0.00 ? 30  LEU B C    2  
ATOM 5210  O O    . LEU B 1 30  ? 14.115  10.033  -2.790  1.00 0.00 ? 30  LEU B O    2  
ATOM 5211  C CB   . LEU B 1 30  ? 11.552  8.280   -0.803  1.00 0.00 ? 30  LEU B CB   2  
ATOM 5212  C CG   . LEU B 1 30  ? 12.136  7.905   0.571   1.00 0.00 ? 30  LEU B CG   2  
ATOM 5213  C CD1  . LEU B 1 30  ? 12.424  6.414   0.638   1.00 0.00 ? 30  LEU B CD1  2  
ATOM 5214  C CD2  . LEU B 1 30  ? 13.401  8.696   0.882   1.00 0.00 ? 30  LEU B CD2  2  
ATOM 5215  H H    . LEU B 1 30  ? 11.111  9.553   -3.331  1.00 0.00 ? 30  LEU B H    2  
ATOM 5216  H HA   . LEU B 1 30  ? 12.321  10.286  -0.759  1.00 0.00 ? 30  LEU B HA   2  
ATOM 5217  H HB2  . LEU B 1 30  ? 10.495  8.461   -0.677  1.00 0.00 ? 30  LEU B HB2  2  
ATOM 5218  H HB3  . LEU B 1 30  ? 11.669  7.434   -1.462  1.00 0.00 ? 30  LEU B HB3  2  
ATOM 5219  H HG   . LEU B 1 30  ? 11.405  8.133   1.335   1.00 0.00 ? 30  LEU B HG   2  
ATOM 5220  H HD11 . LEU B 1 30  ? 12.448  6.098   1.671   1.00 0.00 ? 30  LEU B HD11 2  
ATOM 5221  H HD12 . LEU B 1 30  ? 13.379  6.210   0.177   1.00 0.00 ? 30  LEU B HD12 2  
ATOM 5222  H HD13 . LEU B 1 30  ? 11.649  5.874   0.115   1.00 0.00 ? 30  LEU B HD13 2  
ATOM 5223  H HD21 . LEU B 1 30  ? 14.191  8.392   0.214   1.00 0.00 ? 30  LEU B HD21 2  
ATOM 5224  H HD22 . LEU B 1 30  ? 13.700  8.507   1.902   1.00 0.00 ? 30  LEU B HD22 2  
ATOM 5225  H HD23 . LEU B 1 30  ? 13.206  9.749   0.754   1.00 0.00 ? 30  LEU B HD23 2  
ATOM 5226  N N    . SER B 1 31  ? 13.969  7.932   -2.003  1.00 0.00 ? 31  SER B N    2  
ATOM 5227  C CA   . SER B 1 31  ? 15.229  7.503   -2.592  1.00 0.00 ? 31  SER B CA   2  
ATOM 5228  C C    . SER B 1 31  ? 15.418  6.003   -2.390  1.00 0.00 ? 31  SER B C    2  
ATOM 5229  O O    . SER B 1 31  ? 15.323  5.501   -1.271  1.00 0.00 ? 31  SER B O    2  
ATOM 5230  C CB   . SER B 1 31  ? 16.399  8.276   -1.982  1.00 0.00 ? 31  SER B CB   2  
ATOM 5231  O OG   . SER B 1 31  ? 17.641  7.782   -2.454  1.00 0.00 ? 31  SER B OG   2  
ATOM 5232  H H    . SER B 1 31  ? 13.449  7.286   -1.487  1.00 0.00 ? 31  SER B H    2  
ATOM 5233  H HA   . SER B 1 31  ? 15.185  7.708   -3.652  1.00 0.00 ? 31  SER B HA   2  
ATOM 5234  H HB2  . SER B 1 31  ? 16.317  9.318   -2.250  1.00 0.00 ? 31  SER B HB2  2  
ATOM 5235  H HB3  . SER B 1 31  ? 16.372  8.180   -0.909  1.00 0.00 ? 31  SER B HB3  2  
ATOM 5236  H HG   . SER B 1 31  ? 17.821  6.930   -2.051  1.00 0.00 ? 31  SER B HG   2  
ATOM 5237  N N    . LYS B 1 32  ? 15.668  5.288   -3.484  1.00 0.00 ? 32  LYS B N    2  
ATOM 5238  C CA   . LYS B 1 32  ? 15.851  3.841   -3.430  1.00 0.00 ? 32  LYS B CA   2  
ATOM 5239  C C    . LYS B 1 32  ? 16.852  3.445   -2.349  1.00 0.00 ? 32  LYS B C    2  
ATOM 5240  O O    . LYS B 1 32  ? 16.694  2.417   -1.690  1.00 0.00 ? 32  LYS B O    2  
ATOM 5241  C CB   . LYS B 1 32  ? 16.318  3.317   -4.790  1.00 0.00 ? 32  LYS B CB   2  
ATOM 5242  C CG   . LYS B 1 32  ? 17.608  3.956   -5.279  1.00 0.00 ? 32  LYS B CG   2  
ATOM 5243  C CD   . LYS B 1 32  ? 18.053  3.366   -6.608  1.00 0.00 ? 32  LYS B CD   2  
ATOM 5244  C CE   . LYS B 1 32  ? 18.504  1.922   -6.456  1.00 0.00 ? 32  LYS B CE   2  
ATOM 5245  N NZ   . LYS B 1 32  ? 17.916  1.044   -7.505  1.00 0.00 ? 32  LYS B NZ   2  
ATOM 5246  H H    . LYS B 1 32  ? 15.720  5.744   -4.350  1.00 0.00 ? 32  LYS B H    2  
ATOM 5247  H HA   . LYS B 1 32  ? 14.894  3.398   -3.195  1.00 0.00 ? 32  LYS B HA   2  
ATOM 5248  H HB2  . LYS B 1 32  ? 16.474  2.251   -4.717  1.00 0.00 ? 32  LYS B HB2  2  
ATOM 5249  H HB3  . LYS B 1 32  ? 15.547  3.510   -5.521  1.00 0.00 ? 32  LYS B HB3  2  
ATOM 5250  H HG2  . LYS B 1 32  ? 17.448  5.017   -5.403  1.00 0.00 ? 32  LYS B HG2  2  
ATOM 5251  H HG3  . LYS B 1 32  ? 18.382  3.790   -4.543  1.00 0.00 ? 32  LYS B HG3  2  
ATOM 5252  H HD2  . LYS B 1 32  ? 17.227  3.404   -7.302  1.00 0.00 ? 32  LYS B HD2  2  
ATOM 5253  H HD3  . LYS B 1 32  ? 18.876  3.953   -6.993  1.00 0.00 ? 32  LYS B HD3  2  
ATOM 5254  H HE2  . LYS B 1 32  ? 19.581  1.885   -6.531  1.00 0.00 ? 32  LYS B HE2  2  
ATOM 5255  H HE3  . LYS B 1 32  ? 18.199  1.562   -5.484  1.00 0.00 ? 32  LYS B HE3  2  
ATOM 5256  H HZ1  . LYS B 1 32  ? 18.552  0.992   -8.326  1.00 0.00 ? 32  LYS B HZ1  2  
ATOM 5257  H HZ2  . LYS B 1 32  ? 16.998  1.422   -7.816  1.00 0.00 ? 32  LYS B HZ2  2  
ATOM 5258  H HZ3  . LYS B 1 32  ? 17.773  0.084   -7.129  1.00 0.00 ? 32  LYS B HZ3  2  
ATOM 5259  N N    . THR B 1 33  ? 17.882  4.264   -2.173  1.00 0.00 ? 33  THR B N    2  
ATOM 5260  C CA   . THR B 1 33  ? 18.904  3.999   -1.178  1.00 0.00 ? 33  THR B CA   2  
ATOM 5261  C C    . THR B 1 33  ? 18.383  4.278   0.233   1.00 0.00 ? 33  THR B C    2  
ATOM 5262  O O    . THR B 1 33  ? 18.627  3.504   1.154   1.00 0.00 ? 33  THR B O    2  
ATOM 5263  C CB   . THR B 1 33  ? 20.146  4.842   -1.472  1.00 0.00 ? 33  THR B CB   2  
ATOM 5264  O OG1  . THR B 1 33  ? 21.009  4.166   -2.369  1.00 0.00 ? 33  THR B OG1  2  
ATOM 5265  C CG2  . THR B 1 33  ? 20.946  5.183   -0.238  1.00 0.00 ? 33  THR B CG2  2  
ATOM 5266  H H    . THR B 1 33  ? 17.958  5.065   -2.725  1.00 0.00 ? 33  THR B H    2  
ATOM 5267  H HA   . THR B 1 33  ? 19.168  2.955   -1.248  1.00 0.00 ? 33  THR B HA   2  
ATOM 5268  H HB   . THR B 1 33  ? 19.837  5.768   -1.933  1.00 0.00 ? 33  THR B HB   2  
ATOM 5269  H HG1  . THR B 1 33  ? 20.505  3.853   -3.124  1.00 0.00 ? 33  THR B HG1  2  
ATOM 5270  H HG21 . THR B 1 33  ? 21.842  5.712   -0.523  1.00 0.00 ? 33  THR B HG21 2  
ATOM 5271  H HG22 . THR B 1 33  ? 21.209  4.272   0.277   1.00 0.00 ? 33  THR B HG22 2  
ATOM 5272  H HG23 . THR B 1 33  ? 20.348  5.805   0.411   1.00 0.00 ? 33  THR B HG23 2  
ATOM 5273  N N    . GLU B 1 34  ? 17.665  5.383   0.406   1.00 0.00 ? 34  GLU B N    2  
ATOM 5274  C CA   . GLU B 1 34  ? 17.127  5.723   1.719   1.00 0.00 ? 34  GLU B CA   2  
ATOM 5275  C C    . GLU B 1 34  ? 16.273  4.578   2.247   1.00 0.00 ? 34  GLU B C    2  
ATOM 5276  O O    . GLU B 1 34  ? 16.176  4.365   3.455   1.00 0.00 ? 34  GLU B O    2  
ATOM 5277  C CB   . GLU B 1 34  ? 16.303  7.008   1.655   1.00 0.00 ? 34  GLU B CB   2  
ATOM 5278  C CG   . GLU B 1 34  ? 16.999  8.196   2.298   1.00 0.00 ? 34  GLU B CG   2  
ATOM 5279  C CD   . GLU B 1 34  ? 17.097  9.391   1.369   1.00 0.00 ? 34  GLU B CD   2  
ATOM 5280  O OE1  . GLU B 1 34  ? 16.124  10.171  1.301   1.00 0.00 ? 34  GLU B OE1  2  
ATOM 5281  O OE2  . GLU B 1 34  ? 18.146  9.545   0.710   1.00 0.00 ? 34  GLU B OE2  2  
ATOM 5282  H H    . GLU B 1 34  ? 17.491  5.974   -0.357  1.00 0.00 ? 34  GLU B H    2  
ATOM 5283  H HA   . GLU B 1 34  ? 17.961  5.871   2.389   1.00 0.00 ? 34  GLU B HA   2  
ATOM 5284  H HB2  . GLU B 1 34  ? 16.107  7.245   0.621   1.00 0.00 ? 34  GLU B HB2  2  
ATOM 5285  H HB3  . GLU B 1 34  ? 15.364  6.850   2.163   1.00 0.00 ? 34  GLU B HB3  2  
ATOM 5286  H HG2  . GLU B 1 34  ? 16.445  8.487   3.177   1.00 0.00 ? 34  GLU B HG2  2  
ATOM 5287  H HG3  . GLU B 1 34  ? 17.997  7.896   2.585   1.00 0.00 ? 34  GLU B HG3  2  
ATOM 5288  N N    . PHE B 1 35  ? 15.674  3.833   1.326   1.00 0.00 ? 35  PHE B N    2  
ATOM 5289  C CA   . PHE B 1 35  ? 14.844  2.694   1.686   1.00 0.00 ? 35  PHE B CA   2  
ATOM 5290  C C    . PHE B 1 35  ? 15.722  1.542   2.170   1.00 0.00 ? 35  PHE B C    2  
ATOM 5291  O O    . PHE B 1 35  ? 15.306  0.730   2.995   1.00 0.00 ? 35  PHE B O    2  
ATOM 5292  C CB   . PHE B 1 35  ? 14.000  2.254   0.484   1.00 0.00 ? 35  PHE B CB   2  
ATOM 5293  C CG   . PHE B 1 35  ? 12.613  1.800   0.845   1.00 0.00 ? 35  PHE B CG   2  
ATOM 5294  C CD1  . PHE B 1 35  ? 12.387  1.023   1.971   1.00 0.00 ? 35  PHE B CD1  2  
ATOM 5295  C CD2  . PHE B 1 35  ? 11.534  2.146   0.050   1.00 0.00 ? 35  PHE B CD2  2  
ATOM 5296  C CE1  . PHE B 1 35  ? 11.112  0.604   2.295   1.00 0.00 ? 35  PHE B CE1  2  
ATOM 5297  C CE2  . PHE B 1 35  ? 10.256  1.727   0.368   1.00 0.00 ? 35  PHE B CE2  2  
ATOM 5298  C CZ   . PHE B 1 35  ? 10.046  0.955   1.493   1.00 0.00 ? 35  PHE B CZ   2  
ATOM 5299  H H    . PHE B 1 35  ? 15.807  4.047   0.379   1.00 0.00 ? 35  PHE B H    2  
ATOM 5300  H HA   . PHE B 1 35  ? 14.189  2.997   2.489   1.00 0.00 ? 35  PHE B HA   2  
ATOM 5301  H HB2  . PHE B 1 35  ? 13.904  3.084   -0.204  1.00 0.00 ? 35  PHE B HB2  2  
ATOM 5302  H HB3  . PHE B 1 35  ? 14.499  1.437   -0.015  1.00 0.00 ? 35  PHE B HB3  2  
ATOM 5303  H HD1  . PHE B 1 35  ? 13.219  0.748   2.600   1.00 0.00 ? 35  PHE B HD1  2  
ATOM 5304  H HD2  . PHE B 1 35  ? 11.697  2.752   -0.829  1.00 0.00 ? 35  PHE B HD2  2  
ATOM 5305  H HE1  . PHE B 1 35  ? 10.949  0.002   3.176   1.00 0.00 ? 35  PHE B HE1  2  
ATOM 5306  H HE2  . PHE B 1 35  ? 9.424   2.004   -0.260  1.00 0.00 ? 35  PHE B HE2  2  
ATOM 5307  H HZ   . PHE B 1 35  ? 9.049   0.625   1.744   1.00 0.00 ? 35  PHE B HZ   2  
ATOM 5308  N N    . LEU B 1 36  ? 16.946  1.482   1.650   1.00 0.00 ? 36  LEU B N    2  
ATOM 5309  C CA   . LEU B 1 36  ? 17.890  0.437   2.025   1.00 0.00 ? 36  LEU B CA   2  
ATOM 5310  C C    . LEU B 1 36  ? 18.174  0.452   3.506   1.00 0.00 ? 36  LEU B C    2  
ATOM 5311  O O    . LEU B 1 36  ? 17.976  -0.538  4.210   1.00 0.00 ? 36  LEU B O    2  
ATOM 5312  C CB   . LEU B 1 36  ? 19.213  0.656   1.302   1.00 0.00 ? 36  LEU B CB   2  
ATOM 5313  C CG   . LEU B 1 36  ? 19.378  -0.142  0.036   1.00 0.00 ? 36  LEU B CG   2  
ATOM 5314  C CD1  . LEU B 1 36  ? 19.268  -1.624  0.350   1.00 0.00 ? 36  LEU B CD1  2  
ATOM 5315  C CD2  . LEU B 1 36  ? 18.343  0.293   -0.982  1.00 0.00 ? 36  LEU B CD2  2  
ATOM 5316  H H    . LEU B 1 36  ? 17.224  2.158   0.997   1.00 0.00 ? 36  LEU B H    2  
ATOM 5317  H HA   . LEU B 1 36  ? 17.481  -0.519  1.741   1.00 0.00 ? 36  LEU B HA   2  
ATOM 5318  H HB2  . LEU B 1 36  ? 19.300  1.701   1.056   1.00 0.00 ? 36  LEU B HB2  2  
ATOM 5319  H HB3  . LEU B 1 36  ? 20.017  0.393   1.973   1.00 0.00 ? 36  LEU B HB3  2  
ATOM 5320  H HG   . LEU B 1 36  ? 20.354  0.050   -0.368  1.00 0.00 ? 36  LEU B HG   2  
ATOM 5321  H HD11 . LEU B 1 36  ? 18.342  -2.010  -0.050  1.00 0.00 ? 36  LEU B HD11 2  
ATOM 5322  H HD12 . LEU B 1 36  ? 19.282  -1.761  1.425   1.00 0.00 ? 36  LEU B HD12 2  
ATOM 5323  H HD13 . LEU B 1 36  ? 20.100  -2.149  -0.092  1.00 0.00 ? 36  LEU B HD13 2  
ATOM 5324  H HD21 . LEU B 1 36  ? 18.762  1.063   -1.613  1.00 0.00 ? 36  LEU B HD21 2  
ATOM 5325  H HD22 . LEU B 1 36  ? 17.478  0.685   -0.464  1.00 0.00 ? 36  LEU B HD22 2  
ATOM 5326  H HD23 . LEU B 1 36  ? 18.050  -0.552  -1.586  1.00 0.00 ? 36  LEU B HD23 2  
ATOM 5327  N N    . SER B 1 37  ? 18.677  1.582   3.960   1.00 0.00 ? 37  SER B N    2  
ATOM 5328  C CA   . SER B 1 37  ? 19.038  1.740   5.353   1.00 0.00 ? 37  SER B CA   2  
ATOM 5329  C C    . SER B 1 37  ? 17.809  1.735   6.253   1.00 0.00 ? 37  SER B C    2  
ATOM 5330  O O    . SER B 1 37  ? 17.757  1.007   7.245   1.00 0.00 ? 37  SER B O    2  
ATOM 5331  C CB   . SER B 1 37  ? 19.833  3.031   5.556   1.00 0.00 ? 37  SER B CB   2  
ATOM 5332  O OG   . SER B 1 37  ? 20.261  3.160   6.900   1.00 0.00 ? 37  SER B OG   2  
ATOM 5333  H H    . SER B 1 37  ? 18.833  2.319   3.329   1.00 0.00 ? 37  SER B H    2  
ATOM 5334  H HA   . SER B 1 37  ? 19.666  0.898   5.607   1.00 0.00 ? 37  SER B HA   2  
ATOM 5335  H HB2  . SER B 1 37  ? 20.702  3.022   4.914   1.00 0.00 ? 37  SER B HB2  2  
ATOM 5336  H HB3  . SER B 1 37  ? 19.210  3.877   5.306   1.00 0.00 ? 37  SER B HB3  2  
ATOM 5337  H HG   . SER B 1 37  ? 20.574  4.054   7.053   1.00 0.00 ? 37  SER B HG   2  
ATOM 5338  N N    . PHE B 1 38  ? 16.821  2.555   5.907   1.00 0.00 ? 38  PHE B N    2  
ATOM 5339  C CA   . PHE B 1 38  ? 15.596  2.648   6.693   1.00 0.00 ? 38  PHE B CA   2  
ATOM 5340  C C    . PHE B 1 38  ? 14.908  1.289   6.803   1.00 0.00 ? 38  PHE B C    2  
ATOM 5341  O O    . PHE B 1 38  ? 14.179  1.030   7.760   1.00 0.00 ? 38  PHE B O    2  
ATOM 5342  C CB   . PHE B 1 38  ? 14.647  3.676   6.081   1.00 0.00 ? 38  PHE B CB   2  
ATOM 5343  C CG   . PHE B 1 38  ? 14.871  5.068   6.598   1.00 0.00 ? 38  PHE B CG   2  
ATOM 5344  C CD1  . PHE B 1 38  ? 14.812  5.333   7.957   1.00 0.00 ? 38  PHE B CD1  2  
ATOM 5345  C CD2  . PHE B 1 38  ? 15.142  6.113   5.729   1.00 0.00 ? 38  PHE B CD2  2  
ATOM 5346  C CE1  . PHE B 1 38  ? 15.018  6.611   8.439   1.00 0.00 ? 38  PHE B CE1  2  
ATOM 5347  C CE2  . PHE B 1 38  ? 15.349  7.394   6.204   1.00 0.00 ? 38  PHE B CE2  2  
ATOM 5348  C CZ   . PHE B 1 38  ? 15.286  7.644   7.562   1.00 0.00 ? 38  PHE B CZ   2  
ATOM 5349  H H    . PHE B 1 38  ? 16.921  3.116   5.109   1.00 0.00 ? 38  PHE B H    2  
ATOM 5350  H HA   . PHE B 1 38  ? 15.868  2.976   7.685   1.00 0.00 ? 38  PHE B HA   2  
ATOM 5351  H HB2  . PHE B 1 38  ? 14.782  3.693   5.009   1.00 0.00 ? 38  PHE B HB2  2  
ATOM 5352  H HB3  . PHE B 1 38  ? 13.630  3.396   6.306   1.00 0.00 ? 38  PHE B HB3  2  
ATOM 5353  H HD1  . PHE B 1 38  ? 14.601  4.526   8.645   1.00 0.00 ? 38  PHE B HD1  2  
ATOM 5354  H HD2  . PHE B 1 38  ? 15.190  5.919   4.668   1.00 0.00 ? 38  PHE B HD2  2  
ATOM 5355  H HE1  . PHE B 1 38  ? 14.968  6.804   9.500   1.00 0.00 ? 38  PHE B HE1  2  
ATOM 5356  H HE2  . PHE B 1 38  ? 15.559  8.199   5.516   1.00 0.00 ? 38  PHE B HE2  2  
ATOM 5357  H HZ   . PHE B 1 38  ? 15.448  8.643   7.936   1.00 0.00 ? 38  PHE B HZ   2  
ATOM 5358  N N    . MET B 1 39  ? 15.147  0.422   5.825   1.00 0.00 ? 39  MET B N    2  
ATOM 5359  C CA   . MET B 1 39  ? 14.556  -0.909  5.828   1.00 0.00 ? 39  MET B CA   2  
ATOM 5360  C C    . MET B 1 39  ? 15.310  -1.828  6.787   1.00 0.00 ? 39  MET B C    2  
ATOM 5361  O O    . MET B 1 39  ? 14.717  -2.454  7.663   1.00 0.00 ? 39  MET B O    2  
ATOM 5362  C CB   . MET B 1 39  ? 14.573  -1.500  4.414   1.00 0.00 ? 39  MET B CB   2  
ATOM 5363  C CG   . MET B 1 39  ? 14.208  -2.977  4.360   1.00 0.00 ? 39  MET B CG   2  
ATOM 5364  S SD   . MET B 1 39  ? 13.074  -3.368  3.014   1.00 0.00 ? 39  MET B SD   2  
ATOM 5365  C CE   . MET B 1 39  ? 11.690  -2.309  3.423   1.00 0.00 ? 39  MET B CE   2  
ATOM 5366  H H    . MET B 1 39  ? 15.738  0.680   5.089   1.00 0.00 ? 39  MET B H    2  
ATOM 5367  H HA   . MET B 1 39  ? 13.534  -0.818  6.160   1.00 0.00 ? 39  MET B HA   2  
ATOM 5368  H HB2  . MET B 1 39  ? 13.873  -0.954  3.801   1.00 0.00 ? 39  MET B HB2  2  
ATOM 5369  H HB3  . MET B 1 39  ? 15.565  -1.382  4.000   1.00 0.00 ? 39  MET B HB3  2  
ATOM 5370  H HG2  . MET B 1 39  ? 15.112  -3.552  4.226   1.00 0.00 ? 39  MET B HG2  2  
ATOM 5371  H HG3  . MET B 1 39  ? 13.743  -3.252  5.294   1.00 0.00 ? 39  MET B HG3  2  
ATOM 5372  H HE1  . MET B 1 39  ? 11.308  -1.852  2.522   1.00 0.00 ? 39  MET B HE1  2  
ATOM 5373  H HE2  . MET B 1 39  ? 12.017  -1.537  4.107   1.00 0.00 ? 39  MET B HE2  2  
ATOM 5374  H HE3  . MET B 1 39  ? 10.911  -2.895  3.888   1.00 0.00 ? 39  MET B HE3  2  
ATOM 5375  N N    . ASN B 1 40  ? 16.621  -1.908  6.603   1.00 0.00 ? 40  ASN B N    2  
ATOM 5376  C CA   . ASN B 1 40  ? 17.470  -2.754  7.433   1.00 0.00 ? 40  ASN B CA   2  
ATOM 5377  C C    . ASN B 1 40  ? 17.364  -2.398  8.918   1.00 0.00 ? 40  ASN B C    2  
ATOM 5378  O O    . ASN B 1 40  ? 17.729  -3.199  9.778   1.00 0.00 ? 40  ASN B O    2  
ATOM 5379  C CB   . ASN B 1 40  ? 18.926  -2.638  6.974   1.00 0.00 ? 40  ASN B CB   2  
ATOM 5380  C CG   . ASN B 1 40  ? 19.189  -3.397  5.687   1.00 0.00 ? 40  ASN B CG   2  
ATOM 5381  O OD1  . ASN B 1 40  ? 19.199  -4.628  5.672   1.00 0.00 ? 40  ASN B OD1  2  
ATOM 5382  N ND2  . ASN B 1 40  ? 19.406  -2.665  4.599   1.00 0.00 ? 40  ASN B ND2  2  
ATOM 5383  H H    . ASN B 1 40  ? 17.030  -1.387  5.880   1.00 0.00 ? 40  ASN B H    2  
ATOM 5384  H HA   . ASN B 1 40  ? 17.146  -3.774  7.299   1.00 0.00 ? 40  ASN B HA   2  
ATOM 5385  H HB2  . ASN B 1 40  ? 19.164  -1.597  6.812   1.00 0.00 ? 40  ASN B HB2  2  
ATOM 5386  H HB3  . ASN B 1 40  ? 19.571  -3.035  7.745   1.00 0.00 ? 40  ASN B HB3  2  
ATOM 5387  H HD21 . ASN B 1 40  ? 19.384  -1.685  4.685   1.00 0.00 ? 40  ASN B HD21 2  
ATOM 5388  H HD22 . ASN B 1 40  ? 19.579  -3.136  3.751   1.00 0.00 ? 40  ASN B HD22 2  
ATOM 5389  N N    . THR B 1 41  ? 16.888  -1.192  9.218   1.00 0.00 ? 41  THR B N    2  
ATOM 5390  C CA   . THR B 1 41  ? 16.770  -0.746  10.607  1.00 0.00 ? 41  THR B CA   2  
ATOM 5391  C C    . THR B 1 41  ? 15.369  -0.946  11.169  1.00 0.00 ? 41  THR B C    2  
ATOM 5392  O O    . THR B 1 41  ? 15.199  -1.121  12.375  1.00 0.00 ? 41  THR B O    2  
ATOM 5393  C CB   . THR B 1 41  ? 17.135  0.733   10.721  1.00 0.00 ? 41  THR B CB   2  
ATOM 5394  O OG1  . THR B 1 41  ? 17.029  1.176   12.062  1.00 0.00 ? 41  THR B OG1  2  
ATOM 5395  C CG2  . THR B 1 41  ? 16.267  1.634   9.872   1.00 0.00 ? 41  THR B CG2  2  
ATOM 5396  H H    . THR B 1 41  ? 16.626  -0.584  8.496   1.00 0.00 ? 41  THR B H    2  
ATOM 5397  H HA   . THR B 1 41  ? 17.466  -1.320  11.197  1.00 0.00 ? 41  THR B HA   2  
ATOM 5398  H HB   . THR B 1 41  ? 18.149  0.867   10.402  1.00 0.00 ? 41  THR B HB   2  
ATOM 5399  H HG1  . THR B 1 41  ? 17.905  1.341   12.415  1.00 0.00 ? 41  THR B HG1  2  
ATOM 5400  H HG21 . THR B 1 41  ? 15.930  2.472   10.463  1.00 0.00 ? 41  THR B HG21 2  
ATOM 5401  H HG22 . THR B 1 41  ? 15.414  1.077   9.517   1.00 0.00 ? 41  THR B HG22 2  
ATOM 5402  H HG23 . THR B 1 41  ? 16.839  1.993   9.030   1.00 0.00 ? 41  THR B HG23 2  
ATOM 5403  N N    . GLU B 1 42  ? 14.362  -0.872  10.309  1.00 0.00 ? 42  GLU B N    2  
ATOM 5404  C CA   . GLU B 1 42  ? 12.982  -0.998  10.764  1.00 0.00 ? 42  GLU B CA   2  
ATOM 5405  C C    . GLU B 1 42  ? 12.221  -2.085  10.007  1.00 0.00 ? 42  GLU B C    2  
ATOM 5406  O O    . GLU B 1 42  ? 11.475  -2.860  10.606  1.00 0.00 ? 42  GLU B O    2  
ATOM 5407  C CB   . GLU B 1 42  ? 12.274  0.352   10.616  1.00 0.00 ? 42  GLU B CB   2  
ATOM 5408  C CG   . GLU B 1 42  ? 13.204  1.556   10.763  1.00 0.00 ? 42  GLU B CG   2  
ATOM 5409  C CD   . GLU B 1 42  ? 12.713  2.550   11.797  1.00 0.00 ? 42  GLU B CD   2  
ATOM 5410  O OE1  . GLU B 1 42  ? 12.572  2.161   12.975  1.00 0.00 ? 42  GLU B OE1  2  
ATOM 5411  O OE2  . GLU B 1 42  ? 12.468  3.717   11.428  1.00 0.00 ? 42  GLU B OE2  2  
ATOM 5412  H H    . GLU B 1 42  ? 14.545  -0.696  9.363   1.00 0.00 ? 42  GLU B H    2  
ATOM 5413  H HA   . GLU B 1 42  ? 13.005  -1.261  11.810  1.00 0.00 ? 42  GLU B HA   2  
ATOM 5414  H HB2  . GLU B 1 42  ? 11.814  0.398   9.640   1.00 0.00 ? 42  GLU B HB2  2  
ATOM 5415  H HB3  . GLU B 1 42  ? 11.504  0.426   11.369  1.00 0.00 ? 42  GLU B HB3  2  
ATOM 5416  H HG2  . GLU B 1 42  ? 14.190  1.210   11.059  1.00 0.00 ? 42  GLU B HG2  2  
ATOM 5417  H HG3  . GLU B 1 42  ? 13.276  2.058   9.809   1.00 0.00 ? 42  GLU B HG3  2  
ATOM 5418  N N    . LEU B 1 43  ? 12.416  -2.146  8.696   1.00 0.00 ? 43  LEU B N    2  
ATOM 5419  C CA   . LEU B 1 43  ? 11.748  -3.146  7.872   1.00 0.00 ? 43  LEU B CA   2  
ATOM 5420  C C    . LEU B 1 43  ? 12.711  -4.274  7.538   1.00 0.00 ? 43  LEU B C    2  
ATOM 5421  O O    . LEU B 1 43  ? 12.672  -4.847  6.448   1.00 0.00 ? 43  LEU B O    2  
ATOM 5422  C CB   . LEU B 1 43  ? 11.208  -2.509  6.591   1.00 0.00 ? 43  LEU B CB   2  
ATOM 5423  C CG   . LEU B 1 43  ? 9.728   -2.128  6.638   1.00 0.00 ? 43  LEU B CG   2  
ATOM 5424  C CD1  . LEU B 1 43  ? 9.302   -1.487  5.328   1.00 0.00 ? 43  LEU B CD1  2  
ATOM 5425  C CD2  . LEU B 1 43  ? 8.876   -3.352  6.944   1.00 0.00 ? 43  LEU B CD2  2  
ATOM 5426  H H    . LEU B 1 43  ? 13.027  -1.511  8.273   1.00 0.00 ? 43  LEU B H    2  
ATOM 5427  H HA   . LEU B 1 43  ? 10.925  -3.549  8.442   1.00 0.00 ? 43  LEU B HA   2  
ATOM 5428  H HB2  . LEU B 1 43  ? 11.781  -1.617  6.388   1.00 0.00 ? 43  LEU B HB2  2  
ATOM 5429  H HB3  . LEU B 1 43  ? 11.351  -3.203  5.777   1.00 0.00 ? 43  LEU B HB3  2  
ATOM 5430  H HG   . LEU B 1 43  ? 9.574   -1.407  7.428   1.00 0.00 ? 43  LEU B HG   2  
ATOM 5431  H HD11 . LEU B 1 43  ? 9.058   -2.257  4.613   1.00 0.00 ? 43  LEU B HD11 2  
ATOM 5432  H HD12 . LEU B 1 43  ? 10.111  -0.882  4.944   1.00 0.00 ? 43  LEU B HD12 2  
ATOM 5433  H HD13 . LEU B 1 43  ? 8.436   -0.864  5.496   1.00 0.00 ? 43  LEU B HD13 2  
ATOM 5434  H HD21 . LEU B 1 43  ? 9.516   -4.167  7.252   1.00 0.00 ? 43  LEU B HD21 2  
ATOM 5435  H HD22 . LEU B 1 43  ? 8.325   -3.641  6.060   1.00 0.00 ? 43  LEU B HD22 2  
ATOM 5436  H HD23 . LEU B 1 43  ? 8.184   -3.119  7.738   1.00 0.00 ? 43  LEU B HD23 2  
ATOM 5437  N N    . ALA B 1 44  ? 13.580  -4.581  8.490   1.00 0.00 ? 44  ALA B N    2  
ATOM 5438  C CA   . ALA B 1 44  ? 14.569  -5.630  8.322   1.00 0.00 ? 44  ALA B CA   2  
ATOM 5439  C C    . ALA B 1 44  ? 13.958  -7.000  8.585   1.00 0.00 ? 44  ALA B C    2  
ATOM 5440  O O    . ALA B 1 44  ? 14.391  -8.003  8.017   1.00 0.00 ? 44  ALA B O    2  
ATOM 5441  C CB   . ALA B 1 44  ? 15.747  -5.377  9.248   1.00 0.00 ? 44  ALA B CB   2  
ATOM 5442  H H    . ALA B 1 44  ? 13.555  -4.081  9.333   1.00 0.00 ? 44  ALA B H    2  
ATOM 5443  H HA   . ALA B 1 44  ? 14.927  -5.594  7.304   1.00 0.00 ? 44  ALA B HA   2  
ATOM 5444  H HB1  . ALA B 1 44  ? 15.647  -5.985  10.134  1.00 0.00 ? 44  ALA B HB1  2  
ATOM 5445  H HB2  . ALA B 1 44  ? 15.761  -4.332  9.527   1.00 0.00 ? 44  ALA B HB2  2  
ATOM 5446  H HB3  . ALA B 1 44  ? 16.666  -5.627  8.739   1.00 0.00 ? 44  ALA B HB3  2  
ATOM 5447  N N    . ALA B 1 45  ? 12.941  -7.036  9.439   1.00 0.00 ? 45  ALA B N    2  
ATOM 5448  C CA   . ALA B 1 45  ? 12.261  -8.283  9.768   1.00 0.00 ? 45  ALA B CA   2  
ATOM 5449  C C    . ALA B 1 45  ? 11.792  -8.995  8.502   1.00 0.00 ? 45  ALA B C    2  
ATOM 5450  O O    . ALA B 1 45  ? 11.634  -10.215 8.486   1.00 0.00 ? 45  ALA B O    2  
ATOM 5451  C CB   . ALA B 1 45  ? 11.085  -8.010  10.693  1.00 0.00 ? 45  ALA B CB   2  
ATOM 5452  H H    . ALA B 1 45  ? 12.634  -6.202  9.853   1.00 0.00 ? 45  ALA B H    2  
ATOM 5453  H HA   . ALA B 1 45  ? 12.961  -8.917  10.290  1.00 0.00 ? 45  ALA B HA   2  
ATOM 5454  H HB1  . ALA B 1 45  ? 10.236  -8.601  10.383  1.00 0.00 ? 45  ALA B HB1  2  
ATOM 5455  H HB2  . ALA B 1 45  ? 10.828  -6.962  10.650  1.00 0.00 ? 45  ALA B HB2  2  
ATOM 5456  H HB3  . ALA B 1 45  ? 11.355  -8.272  11.706  1.00 0.00 ? 45  ALA B HB3  2  
ATOM 5457  N N    . PHE B 1 46  ? 11.576  -8.221  7.442   1.00 0.00 ? 46  PHE B N    2  
ATOM 5458  C CA   . PHE B 1 46  ? 11.130  -8.772  6.168   1.00 0.00 ? 46  PHE B CA   2  
ATOM 5459  C C    . PHE B 1 46  ? 12.288  -8.868  5.175   1.00 0.00 ? 46  PHE B C    2  
ATOM 5460  O O    . PHE B 1 46  ? 12.071  -9.006  3.971   1.00 0.00 ? 46  PHE B O    2  
ATOM 5461  C CB   . PHE B 1 46  ? 10.016  -7.903  5.581   1.00 0.00 ? 46  PHE B CB   2  
ATOM 5462  C CG   . PHE B 1 46  ? 8.671   -8.138  6.209   1.00 0.00 ? 46  PHE B CG   2  
ATOM 5463  C CD1  . PHE B 1 46  ? 8.523   -8.124  7.587   1.00 0.00 ? 46  PHE B CD1  2  
ATOM 5464  C CD2  . PHE B 1 46  ? 7.556   -8.373  5.420   1.00 0.00 ? 46  PHE B CD2  2  
ATOM 5465  C CE1  . PHE B 1 46  ? 7.286   -8.339  8.166   1.00 0.00 ? 46  PHE B CE1  2  
ATOM 5466  C CE2  . PHE B 1 46  ? 6.318   -8.588  5.993   1.00 0.00 ? 46  PHE B CE2  2  
ATOM 5467  C CZ   . PHE B 1 46  ? 6.183   -8.571  7.368   1.00 0.00 ? 46  PHE B CZ   2  
ATOM 5468  H H    . PHE B 1 46  ? 11.721  -7.255  7.518   1.00 0.00 ? 46  PHE B H    2  
ATOM 5469  H HA   . PHE B 1 46  ? 10.743  -9.763  6.351   1.00 0.00 ? 46  PHE B HA   2  
ATOM 5470  H HB2  . PHE B 1 46  ? 10.268  -6.862  5.723   1.00 0.00 ? 46  PHE B HB2  2  
ATOM 5471  H HB3  . PHE B 1 46  ? 9.931   -8.106  4.523   1.00 0.00 ? 46  PHE B HB3  2  
ATOM 5472  H HD1  . PHE B 1 46  ? 9.384   -7.942  8.211   1.00 0.00 ? 46  PHE B HD1  2  
ATOM 5473  H HD2  . PHE B 1 46  ? 7.661   -8.386  4.346   1.00 0.00 ? 46  PHE B HD2  2  
ATOM 5474  H HE1  . PHE B 1 46  ? 7.182   -8.324  9.241   1.00 0.00 ? 46  PHE B HE1  2  
ATOM 5475  H HE2  . PHE B 1 46  ? 5.456   -8.769  5.368   1.00 0.00 ? 46  PHE B HE2  2  
ATOM 5476  H HZ   . PHE B 1 46  ? 5.215   -8.739  7.819   1.00 0.00 ? 46  PHE B HZ   2  
ATOM 5477  N N    . THR B 1 47  ? 13.517  -8.792  5.684   1.00 0.00 ? 47  THR B N    2  
ATOM 5478  C CA   . THR B 1 47  ? 14.702  -8.870  4.836   1.00 0.00 ? 47  THR B CA   2  
ATOM 5479  C C    . THR B 1 47  ? 15.978  -8.799  5.671   1.00 0.00 ? 47  THR B C    2  
ATOM 5480  O O    . THR B 1 47  ? 16.914  -8.073  5.334   1.00 0.00 ? 47  THR B O    2  
ATOM 5481  C CB   . THR B 1 47  ? 14.690  -7.742  3.802   1.00 0.00 ? 47  THR B CB   2  
ATOM 5482  O OG1  . THR B 1 47  ? 15.846  -7.799  2.984   1.00 0.00 ? 47  THR B OG1  2  
ATOM 5483  C CG2  . THR B 1 47  ? 14.636  -6.362  4.421   1.00 0.00 ? 47  THR B CG2  2  
ATOM 5484  H H    . THR B 1 47  ? 13.629  -8.682  6.651   1.00 0.00 ? 47  THR B H    2  
ATOM 5485  H HA   . THR B 1 47  ? 14.678  -9.818  4.319   1.00 0.00 ? 47  THR B HA   2  
ATOM 5486  H HB   . THR B 1 47  ? 13.821  -7.855  3.170   1.00 0.00 ? 47  THR B HB   2  
ATOM 5487  H HG1  . THR B 1 47  ? 16.628  -7.676  3.527   1.00 0.00 ? 47  THR B HG1  2  
ATOM 5488  H HG21 . THR B 1 47  ? 15.580  -5.862  4.268   1.00 0.00 ? 47  THR B HG21 2  
ATOM 5489  H HG22 . THR B 1 47  ? 14.442  -6.450  5.479   1.00 0.00 ? 47  THR B HG22 2  
ATOM 5490  H HG23 . THR B 1 47  ? 13.846  -5.790  3.956   1.00 0.00 ? 47  THR B HG23 2  
ATOM 5491  N N    . LYS B 1 48  ? 16.009  -9.558  6.762   1.00 0.00 ? 48  LYS B N    2  
ATOM 5492  C CA   . LYS B 1 48  ? 17.173  -9.581  7.645   1.00 0.00 ? 48  LYS B CA   2  
ATOM 5493  C C    . LYS B 1 48  ? 17.760  -10.985 7.740   1.00 0.00 ? 48  LYS B C    2  
ATOM 5494  O O    . LYS B 1 48  ? 18.979  -11.156 7.798   1.00 0.00 ? 48  LYS B O    2  
ATOM 5495  C CB   . LYS B 1 48  ? 16.797  -9.075  9.040   1.00 0.00 ? 48  LYS B CB   2  
ATOM 5496  C CG   . LYS B 1 48  ? 15.619  -9.811  9.664   1.00 0.00 ? 48  LYS B CG   2  
ATOM 5497  C CD   . LYS B 1 48  ? 16.059  -10.694 10.823  1.00 0.00 ? 48  LYS B CD   2  
ATOM 5498  C CE   . LYS B 1 48  ? 15.119  -10.561 12.013  1.00 0.00 ? 48  LYS B CE   2  
ATOM 5499  N NZ   . LYS B 1 48  ? 14.742  -11.888 12.574  1.00 0.00 ? 48  LYS B NZ   2  
ATOM 5500  H H    . LYS B 1 48  ? 15.234  -10.115 6.978   1.00 0.00 ? 48  LYS B H    2  
ATOM 5501  H HA   . LYS B 1 48  ? 17.918  -8.922  7.225   1.00 0.00 ? 48  LYS B HA   2  
ATOM 5502  H HB2  . LYS B 1 48  ? 17.651  -9.187  9.692   1.00 0.00 ? 48  LYS B HB2  2  
ATOM 5503  H HB3  . LYS B 1 48  ? 16.542  -8.028  8.973   1.00 0.00 ? 48  LYS B HB3  2  
ATOM 5504  H HG2  . LYS B 1 48  ? 14.908  -9.086  10.028  1.00 0.00 ? 48  LYS B HG2  2  
ATOM 5505  H HG3  . LYS B 1 48  ? 15.153  -10.428 8.910   1.00 0.00 ? 48  LYS B HG3  2  
ATOM 5506  H HD2  . LYS B 1 48  ? 16.065  -11.722 10.497  1.00 0.00 ? 48  LYS B HD2  2  
ATOM 5507  H HD3  . LYS B 1 48  ? 17.053  -10.403 11.128  1.00 0.00 ? 48  LYS B HD3  2  
ATOM 5508  H HE2  . LYS B 1 48  ? 15.612  -9.983  12.780  1.00 0.00 ? 48  LYS B HE2  2  
ATOM 5509  H HE3  . LYS B 1 48  ? 14.225  -10.046 11.694  1.00 0.00 ? 48  LYS B HE3  2  
ATOM 5510  H HZ1  . LYS B 1 48  ? 13.752  -11.873 12.891  1.00 0.00 ? 48  LYS B HZ1  2  
ATOM 5511  H HZ2  . LYS B 1 48  ? 15.351  -12.119 13.386  1.00 0.00 ? 48  LYS B HZ2  2  
ATOM 5512  H HZ3  . LYS B 1 48  ? 14.854  -12.626 11.850  1.00 0.00 ? 48  LYS B HZ3  2  
ATOM 5513  N N    . ASN B 1 49  ? 16.890  -11.988 7.754   1.00 0.00 ? 49  ASN B N    2  
ATOM 5514  C CA   . ASN B 1 49  ? 17.323  -13.378 7.840   1.00 0.00 ? 49  ASN B CA   2  
ATOM 5515  C C    . ASN B 1 49  ? 16.290  -14.308 7.211   1.00 0.00 ? 49  ASN B C    2  
ATOM 5516  O O    . ASN B 1 49  ? 16.163  -15.468 7.605   1.00 0.00 ? 49  ASN B O    2  
ATOM 5517  C CB   . ASN B 1 49  ? 17.564  -13.770 9.300   1.00 0.00 ? 49  ASN B CB   2  
ATOM 5518  C CG   . ASN B 1 49  ? 18.882  -14.494 9.493   1.00 0.00 ? 49  ASN B CG   2  
ATOM 5519  O OD1  . ASN B 1 49  ? 19.106  -15.563 8.926   1.00 0.00 ? 49  ASN B OD1  2  
ATOM 5520  N ND2  . ASN B 1 49  ? 19.765  -13.910 10.296  1.00 0.00 ? 49  ASN B ND2  2  
ATOM 5521  H H    . ASN B 1 49  ? 15.932  -11.790 7.704   1.00 0.00 ? 49  ASN B H    2  
ATOM 5522  H HA   . ASN B 1 49  ? 18.250  -13.469 7.294   1.00 0.00 ? 49  ASN B HA   2  
ATOM 5523  H HB2  . ASN B 1 49  ? 17.573  -12.878 9.909   1.00 0.00 ? 49  ASN B HB2  2  
ATOM 5524  H HB3  . ASN B 1 49  ? 16.766  -14.420 9.629   1.00 0.00 ? 49  ASN B HB3  2  
ATOM 5525  H HD21 . ASN B 1 49  ? 19.516  -13.054 10.713  1.00 0.00 ? 49  ASN B HD21 2  
ATOM 5526  H HD22 . ASN B 1 49  ? 20.629  -14.358 10.438  1.00 0.00 ? 49  ASN B HD22 2  
ATOM 5527  N N    . GLN B 1 50  ? 15.554  -13.792 6.233   1.00 0.00 ? 50  GLN B N    2  
ATOM 5528  C CA   . GLN B 1 50  ? 14.531  -14.575 5.548   1.00 0.00 ? 50  GLN B CA   2  
ATOM 5529  C C    . GLN B 1 50  ? 15.156  -15.507 4.512   1.00 0.00 ? 50  GLN B C    2  
ATOM 5530  O O    . GLN B 1 50  ? 14.557  -16.509 4.125   1.00 0.00 ? 50  GLN B O    2  
ATOM 5531  C CB   . GLN B 1 50  ? 13.518  -13.652 4.869   1.00 0.00 ? 50  GLN B CB   2  
ATOM 5532  C CG   . GLN B 1 50  ? 13.093  -12.472 5.729   1.00 0.00 ? 50  GLN B CG   2  
ATOM 5533  C CD   . GLN B 1 50  ? 12.431  -12.903 7.023   1.00 0.00 ? 50  GLN B CD   2  
ATOM 5534  O OE1  . GLN B 1 50  ? 11.269  -13.307 7.035   1.00 0.00 ? 50  GLN B OE1  2  
ATOM 5535  N NE2  . GLN B 1 50  ? 13.171  -12.818 8.122   1.00 0.00 ? 50  GLN B NE2  2  
ATOM 5536  H H    . GLN B 1 50  ? 15.702  -12.861 5.963   1.00 0.00 ? 50  GLN B H    2  
ATOM 5537  H HA   . GLN B 1 50  ? 14.021  -15.172 6.289   1.00 0.00 ? 50  GLN B HA   2  
ATOM 5538  H HB2  . GLN B 1 50  ? 13.954  -13.266 3.959   1.00 0.00 ? 50  GLN B HB2  2  
ATOM 5539  H HB3  . GLN B 1 50  ? 12.637  -14.224 4.621   1.00 0.00 ? 50  GLN B HB3  2  
ATOM 5540  H HG2  . GLN B 1 50  ? 13.966  -11.884 5.968   1.00 0.00 ? 50  GLN B HG2  2  
ATOM 5541  H HG3  . GLN B 1 50  ? 12.395  -11.868 5.168   1.00 0.00 ? 50  GLN B HG3  2  
ATOM 5542  H HE21 . GLN B 1 50  ? 14.094  -12.486 8.034   1.00 0.00 ? 50  GLN B HE21 2  
ATOM 5543  H HE22 . GLN B 1 50  ? 12.767  -13.089 8.976   1.00 0.00 ? 50  GLN B HE22 2  
ATOM 5544  N N    . LYS B 1 51  ? 16.361  -15.167 4.063   1.00 0.00 ? 51  LYS B N    2  
ATOM 5545  C CA   . LYS B 1 51  ? 17.061  -15.971 3.068   1.00 0.00 ? 51  LYS B CA   2  
ATOM 5546  C C    . LYS B 1 51  ? 16.315  -15.956 1.738   1.00 0.00 ? 51  LYS B C    2  
ATOM 5547  O O    . LYS B 1 51  ? 16.356  -16.925 0.981   1.00 0.00 ? 51  LYS B O    2  
ATOM 5548  C CB   . LYS B 1 51  ? 17.225  -17.411 3.562   1.00 0.00 ? 51  LYS B CB   2  
ATOM 5549  C CG   . LYS B 1 51  ? 18.564  -18.030 3.196   1.00 0.00 ? 51  LYS B CG   2  
ATOM 5550  C CD   . LYS B 1 51  ? 18.921  -19.177 4.128   1.00 0.00 ? 51  LYS B CD   2  
ATOM 5551  C CE   . LYS B 1 51  ? 19.873  -20.158 3.466   1.00 0.00 ? 51  LYS B CE   2  
ATOM 5552  N NZ   . LYS B 1 51  ? 19.159  -21.345 2.920   1.00 0.00 ? 51  LYS B NZ   2  
ATOM 5553  H H    . LYS B 1 51  ? 16.788  -14.354 4.405   1.00 0.00 ? 51  LYS B H    2  
ATOM 5554  H HA   . LYS B 1 51  ? 18.040  -15.538 2.922   1.00 0.00 ? 51  LYS B HA   2  
ATOM 5555  H HB2  . LYS B 1 51  ? 17.128  -17.424 4.637   1.00 0.00 ? 51  LYS B HB2  2  
ATOM 5556  H HB3  . LYS B 1 51  ? 16.442  -18.018 3.132   1.00 0.00 ? 51  LYS B HB3  2  
ATOM 5557  H HG2  . LYS B 1 51  ? 18.512  -18.405 2.185   1.00 0.00 ? 51  LYS B HG2  2  
ATOM 5558  H HG3  . LYS B 1 51  ? 19.329  -17.272 3.262   1.00 0.00 ? 51  LYS B HG3  2  
ATOM 5559  H HD2  . LYS B 1 51  ? 19.392  -18.775 5.013   1.00 0.00 ? 51  LYS B HD2  2  
ATOM 5560  H HD3  . LYS B 1 51  ? 18.016  -19.698 4.405   1.00 0.00 ? 51  LYS B HD3  2  
ATOM 5561  H HE2  . LYS B 1 51  ? 20.385  -19.655 2.658   1.00 0.00 ? 51  LYS B HE2  2  
ATOM 5562  H HE3  . LYS B 1 51  ? 20.597  -20.488 4.198   1.00 0.00 ? 51  LYS B HE3  2  
ATOM 5563  H HZ1  . LYS B 1 51  ? 19.600  -21.651 2.029   1.00 0.00 ? 51  LYS B HZ1  2  
ATOM 5564  H HZ2  . LYS B 1 51  ? 18.162  -21.110 2.737   1.00 0.00 ? 51  LYS B HZ2  2  
ATOM 5565  H HZ3  . LYS B 1 51  ? 19.198  -22.131 3.602   1.00 0.00 ? 51  LYS B HZ3  2  
ATOM 5566  N N    . ASP B 1 52  ? 15.632  -14.849 1.462   1.00 0.00 ? 52  ASP B N    2  
ATOM 5567  C CA   . ASP B 1 52  ? 14.875  -14.707 0.224   1.00 0.00 ? 52  ASP B CA   2  
ATOM 5568  C C    . ASP B 1 52  ? 15.180  -13.372 -0.450  1.00 0.00 ? 52  ASP B C    2  
ATOM 5569  O O    . ASP B 1 52  ? 14.438  -12.402 -0.290  1.00 0.00 ? 52  ASP B O    2  
ATOM 5570  C CB   . ASP B 1 52  ? 13.376  -14.821 0.503   1.00 0.00 ? 52  ASP B CB   2  
ATOM 5571  C CG   . ASP B 1 52  ? 12.644  -15.587 -0.581  1.00 0.00 ? 52  ASP B CG   2  
ATOM 5572  O OD1  . ASP B 1 52  ? 13.045  -15.476 -1.760  1.00 0.00 ? 52  ASP B OD1  2  
ATOM 5573  O OD2  . ASP B 1 52  ? 11.670  -16.295 -0.253  1.00 0.00 ? 52  ASP B OD2  2  
ATOM 5574  H H    . ASP B 1 52  ? 15.638  -14.111 2.106   1.00 0.00 ? 52  ASP B H    2  
ATOM 5575  H HA   . ASP B 1 52  ? 15.171  -15.506 -0.438  1.00 0.00 ? 52  ASP B HA   2  
ATOM 5576  H HB2  . ASP B 1 52  ? 13.228  -15.335 1.441   1.00 0.00 ? 52  ASP B HB2  2  
ATOM 5577  H HB3  . ASP B 1 52  ? 12.951  -13.831 0.570   1.00 0.00 ? 52  ASP B HB3  2  
ATOM 5578  N N    . PRO B 1 53  ? 16.280  -13.304 -1.218  1.00 0.00 ? 53  PRO B N    2  
ATOM 5579  C CA   . PRO B 1 53  ? 16.682  -12.081 -1.922  1.00 0.00 ? 53  PRO B CA   2  
ATOM 5580  C C    . PRO B 1 53  ? 15.635  -11.622 -2.934  1.00 0.00 ? 53  PRO B C    2  
ATOM 5581  O O    . PRO B 1 53  ? 15.659  -10.479 -3.391  1.00 0.00 ? 53  PRO B O    2  
ATOM 5582  C CB   . PRO B 1 53  ? 17.976  -12.479 -2.641  1.00 0.00 ? 53  PRO B CB   2  
ATOM 5583  C CG   . PRO B 1 53  ? 18.453  -13.704 -1.938  1.00 0.00 ? 53  PRO B CG   2  
ATOM 5584  C CD   . PRO B 1 53  ? 17.218  -14.411 -1.465  1.00 0.00 ? 53  PRO B CD   2  
ATOM 5585  H HA   . PRO B 1 53  ? 16.884  -11.277 -1.230  1.00 0.00 ? 53  PRO B HA   2  
ATOM 5586  H HB2  . PRO B 1 53  ? 17.765  -12.680 -3.682  1.00 0.00 ? 53  PRO B HB2  2  
ATOM 5587  H HB3  . PRO B 1 53  ? 18.695  -11.677 -2.564  1.00 0.00 ? 53  PRO B HB3  2  
ATOM 5588  H HG2  . PRO B 1 53  ? 19.005  -14.330 -2.623  1.00 0.00 ? 53  PRO B HG2  2  
ATOM 5589  H HG3  . PRO B 1 53  ? 19.072  -13.428 -1.097  1.00 0.00 ? 53  PRO B HG3  2  
ATOM 5590  H HD2  . PRO B 1 53  ? 16.843  -15.073 -2.231  1.00 0.00 ? 53  PRO B HD2  2  
ATOM 5591  H HD3  . PRO B 1 53  ? 17.418  -14.957 -0.554  1.00 0.00 ? 53  PRO B HD3  2  
ATOM 5592  N N    . GLY B 1 54  ? 14.719  -12.521 -3.283  1.00 0.00 ? 54  GLY B N    2  
ATOM 5593  C CA   . GLY B 1 54  ? 13.680  -12.191 -4.240  1.00 0.00 ? 54  GLY B CA   2  
ATOM 5594  C C    . GLY B 1 54  ? 12.638  -11.244 -3.675  1.00 0.00 ? 54  GLY B C    2  
ATOM 5595  O O    . GLY B 1 54  ? 11.847  -10.672 -4.422  1.00 0.00 ? 54  GLY B O    2  
ATOM 5596  H H    . GLY B 1 54  ? 14.748  -13.416 -2.888  1.00 0.00 ? 54  GLY B H    2  
ATOM 5597  H HA2  . GLY B 1 54  ? 14.136  -11.731 -5.104  1.00 0.00 ? 54  GLY B HA2  2  
ATOM 5598  H HA3  . GLY B 1 54  ? 13.190  -13.103 -4.550  1.00 0.00 ? 54  GLY B HA3  2  
ATOM 5599  N N    . VAL B 1 55  ? 12.633  -11.081 -2.355  1.00 0.00 ? 55  VAL B N    2  
ATOM 5600  C CA   . VAL B 1 55  ? 11.677  -10.197 -1.697  1.00 0.00 ? 55  VAL B CA   2  
ATOM 5601  C C    . VAL B 1 55  ? 12.165  -8.753  -1.705  1.00 0.00 ? 55  VAL B C    2  
ATOM 5602  O O    . VAL B 1 55  ? 11.501  -7.866  -2.242  1.00 0.00 ? 55  VAL B O    2  
ATOM 5603  C CB   . VAL B 1 55  ? 11.419  -10.637 -0.241  1.00 0.00 ? 55  VAL B CB   2  
ATOM 5604  C CG1  . VAL B 1 55  ? 10.394  -9.730  0.424   1.00 0.00 ? 55  VAL B CG1  2  
ATOM 5605  C CG2  . VAL B 1 55  ? 10.968  -12.089 -0.196  1.00 0.00 ? 55  VAL B CG2  2  
ATOM 5606  H H    . VAL B 1 55  ? 13.287  -11.567 -1.810  1.00 0.00 ? 55  VAL B H    2  
ATOM 5607  H HA   . VAL B 1 55  ? 10.745  -10.251 -2.239  1.00 0.00 ? 55  VAL B HA   2  
ATOM 5608  H HB   . VAL B 1 55  ? 12.345  -10.554 0.308   1.00 0.00 ? 55  VAL B HB   2  
ATOM 5609  H HG11 . VAL B 1 55  ? 10.902  -8.993  1.027   1.00 0.00 ? 55  VAL B HG11 2  
ATOM 5610  H HG12 . VAL B 1 55  ? 9.742   -10.321 1.051   1.00 0.00 ? 55  VAL B HG12 2  
ATOM 5611  H HG13 . VAL B 1 55  ? 9.809   -9.232  -0.335  1.00 0.00 ? 55  VAL B HG13 2  
ATOM 5612  H HG21 . VAL B 1 55  ? 10.726  -12.360 0.822   1.00 0.00 ? 55  VAL B HG21 2  
ATOM 5613  H HG22 . VAL B 1 55  ? 11.763  -12.724 -0.559  1.00 0.00 ? 55  VAL B HG22 2  
ATOM 5614  H HG23 . VAL B 1 55  ? 10.094  -12.215 -0.818  1.00 0.00 ? 55  VAL B HG23 2  
ATOM 5615  N N    . LEU B 1 56  ? 13.327  -8.523  -1.105  1.00 0.00 ? 56  LEU B N    2  
ATOM 5616  C CA   . LEU B 1 56  ? 13.904  -7.190  -1.039  1.00 0.00 ? 56  LEU B CA   2  
ATOM 5617  C C    . LEU B 1 56  ? 14.275  -6.695  -2.436  1.00 0.00 ? 56  LEU B C    2  
ATOM 5618  O O    . LEU B 1 56  ? 13.901  -5.594  -2.838  1.00 0.00 ? 56  LEU B O    2  
ATOM 5619  C CB   . LEU B 1 56  ? 15.130  -7.221  -0.124  1.00 0.00 ? 56  LEU B CB   2  
ATOM 5620  C CG   . LEU B 1 56  ? 16.153  -6.104  -0.324  1.00 0.00 ? 56  LEU B CG   2  
ATOM 5621  C CD1  . LEU B 1 56  ? 15.645  -4.800  0.270   1.00 0.00 ? 56  LEU B CD1  2  
ATOM 5622  C CD2  . LEU B 1 56  ? 17.476  -6.505  0.304   1.00 0.00 ? 56  LEU B CD2  2  
ATOM 5623  H H    . LEU B 1 56  ? 13.812  -9.271  -0.694  1.00 0.00 ? 56  LEU B H    2  
ATOM 5624  H HA   . LEU B 1 56  ? 13.165  -6.526  -0.617  1.00 0.00 ? 56  LEU B HA   2  
ATOM 5625  H HB2  . LEU B 1 56  ? 14.785  -7.181  0.898   1.00 0.00 ? 56  LEU B HB2  2  
ATOM 5626  H HB3  . LEU B 1 56  ? 15.633  -8.165  -0.275  1.00 0.00 ? 56  LEU B HB3  2  
ATOM 5627  H HG   . LEU B 1 56  ? 16.315  -5.950  -1.380  1.00 0.00 ? 56  LEU B HG   2  
ATOM 5628  H HD11 . LEU B 1 56  ? 15.337  -4.966  1.292   1.00 0.00 ? 56  LEU B HD11 2  
ATOM 5629  H HD12 . LEU B 1 56  ? 14.802  -4.447  -0.307  1.00 0.00 ? 56  LEU B HD12 2  
ATOM 5630  H HD13 . LEU B 1 56  ? 16.432  -4.062  0.246   1.00 0.00 ? 56  LEU B HD13 2  
ATOM 5631  H HD21 . LEU B 1 56  ? 18.287  -6.212  -0.345  1.00 0.00 ? 56  LEU B HD21 2  
ATOM 5632  H HD22 . LEU B 1 56  ? 17.493  -7.578  0.443   1.00 0.00 ? 56  LEU B HD22 2  
ATOM 5633  H HD23 . LEU B 1 56  ? 17.583  -6.017  1.261   1.00 0.00 ? 56  LEU B HD23 2  
ATOM 5634  N N    . ASP B 1 57  ? 15.012  -7.522  -3.166  1.00 0.00 ? 57  ASP B N    2  
ATOM 5635  C CA   . ASP B 1 57  ? 15.439  -7.186  -4.518  1.00 0.00 ? 57  ASP B CA   2  
ATOM 5636  C C    . ASP B 1 57  ? 14.241  -6.875  -5.410  1.00 0.00 ? 57  ASP B C    2  
ATOM 5637  O O    . ASP B 1 57  ? 14.357  -6.131  -6.383  1.00 0.00 ? 57  ASP B O    2  
ATOM 5638  C CB   . ASP B 1 57  ? 16.251  -8.335  -5.115  1.00 0.00 ? 57  ASP B CB   2  
ATOM 5639  C CG   . ASP B 1 57  ? 17.193  -7.870  -6.208  1.00 0.00 ? 57  ASP B CG   2  
ATOM 5640  O OD1  . ASP B 1 57  ? 16.734  -7.709  -7.359  1.00 0.00 ? 57  ASP B OD1  2  
ATOM 5641  O OD2  . ASP B 1 57  ? 18.389  -7.665  -5.913  1.00 0.00 ? 57  ASP B OD2  2  
ATOM 5642  H H    . ASP B 1 57  ? 15.275  -8.384  -2.786  1.00 0.00 ? 57  ASP B H    2  
ATOM 5643  H HA   . ASP B 1 57  ? 16.065  -6.308  -4.459  1.00 0.00 ? 57  ASP B HA   2  
ATOM 5644  H HB2  . ASP B 1 57  ? 16.836  -8.798  -4.334  1.00 0.00 ? 57  ASP B HB2  2  
ATOM 5645  H HB3  . ASP B 1 57  ? 15.576  -9.066  -5.534  1.00 0.00 ? 57  ASP B HB3  2  
ATOM 5646  N N    . ARG B 1 58  ? 13.089  -7.452  -5.075  1.00 0.00 ? 58  ARG B N    2  
ATOM 5647  C CA   . ARG B 1 58  ? 11.874  -7.234  -5.852  1.00 0.00 ? 58  ARG B CA   2  
ATOM 5648  C C    . ARG B 1 58  ? 11.523  -5.752  -5.904  1.00 0.00 ? 58  ARG B C    2  
ATOM 5649  O O    . ARG B 1 58  ? 11.271  -5.200  -6.975  1.00 0.00 ? 58  ARG B O    2  
ATOM 5650  C CB   . ARG B 1 58  ? 10.706  -8.016  -5.245  1.00 0.00 ? 58  ARG B CB   2  
ATOM 5651  C CG   . ARG B 1 58  ? 9.926   -8.835  -6.264  1.00 0.00 ? 58  ARG B CG   2  
ATOM 5652  C CD   . ARG B 1 58  ? 8.424   -8.640  -6.110  1.00 0.00 ? 58  ARG B CD   2  
ATOM 5653  N NE   . ARG B 1 58  ? 7.807   -8.151  -7.342  1.00 0.00 ? 58  ARG B NE   2  
ATOM 5654  C CZ   . ARG B 1 58  ? 6.632   -7.529  -7.388  1.00 0.00 ? 58  ARG B CZ   2  
ATOM 5655  N NH1  . ARG B 1 58  ? 5.941   -7.316  -6.274  1.00 0.00 ? 58  ARG B NH1  2  
ATOM 5656  N NH2  . ARG B 1 58  ? 6.145   -7.118  -8.550  1.00 0.00 ? 58  ARG B NH2  2  
ATOM 5657  H H    . ARG B 1 58  ? 13.057  -8.036  -4.290  1.00 0.00 ? 58  ARG B H    2  
ATOM 5658  H HA   . ARG B 1 58  ? 12.051  -7.587  -6.856  1.00 0.00 ? 58  ARG B HA   2  
ATOM 5659  H HB2  . ARG B 1 58  ? 11.090  -8.687  -4.494  1.00 0.00 ? 58  ARG B HB2  2  
ATOM 5660  H HB3  . ARG B 1 58  ? 10.025  -7.320  -4.777  1.00 0.00 ? 58  ARG B HB3  2  
ATOM 5661  H HG2  . ARG B 1 58  ? 10.217  -8.527  -7.257  1.00 0.00 ? 58  ARG B HG2  2  
ATOM 5662  H HG3  . ARG B 1 58  ? 10.160  -9.880  -6.126  1.00 0.00 ? 58  ARG B HG3  2  
ATOM 5663  H HD2  . ARG B 1 58  ? 7.977   -9.587  -5.846  1.00 0.00 ? 58  ARG B HD2  2  
ATOM 5664  H HD3  . ARG B 1 58  ? 8.244   -7.926  -5.321  1.00 0.00 ? 58  ARG B HD3  2  
ATOM 5665  H HE   . ARG B 1 58  ? 8.295   -8.296  -8.179  1.00 0.00 ? 58  ARG B HE   2  
ATOM 5666  H HH11 . ARG B 1 58  ? 6.300   -7.624  -5.394  1.00 0.00 ? 58  ARG B HH11 2  
ATOM 5667  H HH12 . ARG B 1 58  ? 5.058   -6.848  -6.317  1.00 0.00 ? 58  ARG B HH12 2  
ATOM 5668  H HH22 . ARG B 1 58  ? 5.262   -6.650  -8.585  1.00 0.00 ? 58  ARG B HH22 2  
ATOM 5669  N N    . MET B 1 59  ? 11.503  -5.115  -4.739  1.00 0.00 ? 59  MET B N    2  
ATOM 5670  C CA   . MET B 1 59  ? 11.177  -3.696  -4.655  1.00 0.00 ? 59  MET B CA   2  
ATOM 5671  C C    . MET B 1 59  ? 12.106  -2.867  -5.534  1.00 0.00 ? 59  MET B C    2  
ATOM 5672  O O    . MET B 1 59  ? 11.655  -2.077  -6.360  1.00 0.00 ? 59  MET B O    2  
ATOM 5673  C CB   . MET B 1 59  ? 11.253  -3.222  -3.194  1.00 0.00 ? 59  MET B CB   2  
ATOM 5674  C CG   . MET B 1 59  ? 12.592  -2.611  -2.778  1.00 0.00 ? 59  MET B CG   2  
ATOM 5675  S SD   . MET B 1 59  ? 12.546  -1.882  -1.130  1.00 0.00 ? 59  MET B SD   2  
ATOM 5676  C CE   . MET B 1 59  ? 11.404  -2.994  -0.328  1.00 0.00 ? 59  MET B CE   2  
ATOM 5677  H H    . MET B 1 59  ? 11.708  -5.611  -3.918  1.00 0.00 ? 59  MET B H    2  
ATOM 5678  H HA   . MET B 1 59  ? 10.165  -3.571  -5.009  1.00 0.00 ? 59  MET B HA   2  
ATOM 5679  H HB2  . MET B 1 59  ? 10.489  -2.481  -3.032  1.00 0.00 ? 59  MET B HB2  2  
ATOM 5680  H HB3  . MET B 1 59  ? 11.059  -4.066  -2.551  1.00 0.00 ? 59  MET B HB3  2  
ATOM 5681  H HG2  . MET B 1 59  ? 13.345  -3.384  -2.790  1.00 0.00 ? 59  MET B HG2  2  
ATOM 5682  H HG3  . MET B 1 59  ? 12.858  -1.840  -3.486  1.00 0.00 ? 59  MET B HG3  2  
ATOM 5683  H HE1  . MET B 1 59  ? 11.227  -2.665  0.684   1.00 0.00 ? 59  MET B HE1  2  
ATOM 5684  H HE2  . MET B 1 59  ? 11.828  -3.986  -0.319  1.00 0.00 ? 59  MET B HE2  2  
ATOM 5685  H HE3  . MET B 1 59  ? 10.471  -3.007  -0.874  1.00 0.00 ? 59  MET B HE3  2  
ATOM 5686  N N    . MET B 1 60  ? 13.403  -3.047  -5.334  1.00 0.00 ? 60  MET B N    2  
ATOM 5687  C CA   . MET B 1 60  ? 14.409  -2.308  -6.088  1.00 0.00 ? 60  MET B CA   2  
ATOM 5688  C C    . MET B 1 60  ? 14.365  -2.643  -7.572  1.00 0.00 ? 60  MET B C    2  
ATOM 5689  O O    . MET B 1 60  ? 14.809  -1.855  -8.406  1.00 0.00 ? 60  MET B O    2  
ATOM 5690  C CB   . MET B 1 60  ? 15.796  -2.583  -5.516  1.00 0.00 ? 60  MET B CB   2  
ATOM 5691  C CG   . MET B 1 60  ? 15.897  -2.252  -4.037  1.00 0.00 ? 60  MET B CG   2  
ATOM 5692  S SD   . MET B 1 60  ? 16.376  -0.540  -3.744  1.00 0.00 ? 60  MET B SD   2  
ATOM 5693  C CE   . MET B 1 60  ? 14.865  0.305   -4.203  1.00 0.00 ? 60  MET B CE   2  
ATOM 5694  H H    . MET B 1 60  ? 13.693  -3.688  -4.644  1.00 0.00 ? 60  MET B H    2  
ATOM 5695  H HA   . MET B 1 60  ? 14.191  -1.257  -5.972  1.00 0.00 ? 60  MET B HA   2  
ATOM 5696  H HB2  . MET B 1 60  ? 16.030  -3.630  -5.650  1.00 0.00 ? 60  MET B HB2  2  
ATOM 5697  H HB3  . MET B 1 60  ? 16.521  -1.987  -6.049  1.00 0.00 ? 60  MET B HB3  2  
ATOM 5698  H HG2  . MET B 1 60  ? 14.930  -2.421  -3.582  1.00 0.00 ? 60  MET B HG2  2  
ATOM 5699  H HG3  . MET B 1 60  ? 16.629  -2.903  -3.583  1.00 0.00 ? 60  MET B HG3  2  
ATOM 5700  H HE1  . MET B 1 60  ? 14.045  -0.400  -4.202  1.00 0.00 ? 60  MET B HE1  2  
ATOM 5701  H HE2  . MET B 1 60  ? 14.975  0.727   -5.191  1.00 0.00 ? 60  MET B HE2  2  
ATOM 5702  H HE3  . MET B 1 60  ? 14.663  1.094   -3.494  1.00 0.00 ? 60  MET B HE3  2  
ATOM 5703  N N    . LYS B 1 61  ? 13.825  -3.808  -7.904  1.00 0.00 ? 61  LYS B N    2  
ATOM 5704  C CA   . LYS B 1 61  ? 13.726  -4.223  -9.297  1.00 0.00 ? 61  LYS B CA   2  
ATOM 5705  C C    . LYS B 1 61  ? 12.557  -3.523  -9.985  1.00 0.00 ? 61  LYS B C    2  
ATOM 5706  O O    . LYS B 1 61  ? 12.744  -2.773  -10.943 1.00 0.00 ? 61  LYS B O    2  
ATOM 5707  C CB   . LYS B 1 61  ? 13.554  -5.740  -9.391  1.00 0.00 ? 61  LYS B CB   2  
ATOM 5708  C CG   . LYS B 1 61  ? 14.861  -6.511  -9.277  1.00 0.00 ? 61  LYS B CG   2  
ATOM 5709  C CD   . LYS B 1 61  ? 15.787  -6.220  -10.447 1.00 0.00 ? 61  LYS B CD   2  
ATOM 5710  C CE   . LYS B 1 61  ? 15.138  -6.575  -11.776 1.00 0.00 ? 61  LYS B CE   2  
ATOM 5711  N NZ   . LYS B 1 61  ? 16.108  -7.201  -12.717 1.00 0.00 ? 61  LYS B NZ   2  
ATOM 5712  H H    . LYS B 1 61  ? 13.483  -4.395  -7.198  1.00 0.00 ? 61  LYS B H    2  
ATOM 5713  H HA   . LYS B 1 61  ? 14.642  -3.940  -9.793  1.00 0.00 ? 61  LYS B HA   2  
ATOM 5714  H HB2  . LYS B 1 61  ? 12.900  -6.066  -8.595  1.00 0.00 ? 61  LYS B HB2  2  
ATOM 5715  H HB3  . LYS B 1 61  ? 13.101  -5.982  -10.340 1.00 0.00 ? 61  LYS B HB3  2  
ATOM 5716  H HG2  . LYS B 1 61  ? 15.356  -6.226  -8.362  1.00 0.00 ? 61  LYS B HG2  2  
ATOM 5717  H HG3  . LYS B 1 61  ? 14.641  -7.569  -9.257  1.00 0.00 ? 61  LYS B HG3  2  
ATOM 5718  H HD2  . LYS B 1 61  ? 16.031  -5.169  -10.448 1.00 0.00 ? 61  LYS B HD2  2  
ATOM 5719  H HD3  . LYS B 1 61  ? 16.689  -6.801  -10.331 1.00 0.00 ? 61  LYS B HD3  2  
ATOM 5720  H HE2  . LYS B 1 61  ? 14.329  -7.267  -11.594 1.00 0.00 ? 61  LYS B HE2  2  
ATOM 5721  H HE3  . LYS B 1 61  ? 14.745  -5.673  -12.223 1.00 0.00 ? 61  LYS B HE3  2  
ATOM 5722  H HZ1  . LYS B 1 61  ? 17.079  -6.935  -12.460 1.00 0.00 ? 61  LYS B HZ1  2  
ATOM 5723  H HZ2  . LYS B 1 61  ? 15.919  -6.884  -13.689 1.00 0.00 ? 61  LYS B HZ2  2  
ATOM 5724  H HZ3  . LYS B 1 61  ? 16.022  -8.237  -12.681 1.00 0.00 ? 61  LYS B HZ3  2  
ATOM 5725  N N    . LYS B 1 62  ? 11.350  -3.775  -9.486  1.00 0.00 ? 62  LYS B N    2  
ATOM 5726  C CA   . LYS B 1 62  ? 10.142  -3.172  -10.044 1.00 0.00 ? 62  LYS B CA   2  
ATOM 5727  C C    . LYS B 1 62  ? 9.923   -1.744  -9.535  1.00 0.00 ? 62  LYS B C    2  
ATOM 5728  O O    . LYS B 1 62  ? 8.887   -1.137  -9.807  1.00 0.00 ? 62  LYS B O    2  
ATOM 5729  C CB   . LYS B 1 62  ? 8.922   -4.034  -9.711  1.00 0.00 ? 62  LYS B CB   2  
ATOM 5730  C CG   . LYS B 1 62  ? 8.048   -4.347  -10.917 1.00 0.00 ? 62  LYS B CG   2  
ATOM 5731  C CD   . LYS B 1 62  ? 7.636   -3.082  -11.654 1.00 0.00 ? 62  LYS B CD   2  
ATOM 5732  C CE   . LYS B 1 62  ? 6.387   -2.465  -11.045 1.00 0.00 ? 62  LYS B CE   2  
ATOM 5733  N NZ   . LYS B 1 62  ? 6.337   -0.991  -11.252 1.00 0.00 ? 62  LYS B NZ   2  
ATOM 5734  H H    . LYS B 1 62  ? 11.268  -4.381  -8.720  1.00 0.00 ? 62  LYS B H    2  
ATOM 5735  H HA   . LYS B 1 62  ? 10.259  -3.139  -11.116 1.00 0.00 ? 62  LYS B HA   2  
ATOM 5736  H HB2  . LYS B 1 62  ? 9.261   -4.969  -9.289  1.00 0.00 ? 62  LYS B HB2  2  
ATOM 5737  H HB3  . LYS B 1 62  ? 8.317   -3.519  -8.980  1.00 0.00 ? 62  LYS B HB3  2  
ATOM 5738  H HG2  . LYS B 1 62  ? 8.600   -4.981  -11.595 1.00 0.00 ? 62  LYS B HG2  2  
ATOM 5739  H HG3  . LYS B 1 62  ? 7.160   -4.863  -10.581 1.00 0.00 ? 62  LYS B HG3  2  
ATOM 5740  H HD2  . LYS B 1 62  ? 8.442   -2.365  -11.600 1.00 0.00 ? 62  LYS B HD2  2  
ATOM 5741  H HD3  . LYS B 1 62  ? 7.439   -3.327  -12.687 1.00 0.00 ? 62  LYS B HD3  2  
ATOM 5742  H HE2  . LYS B 1 62  ? 5.519   -2.913  -11.504 1.00 0.00 ? 62  LYS B HE2  2  
ATOM 5743  H HE3  . LYS B 1 62  ? 6.380   -2.671  -9.985  1.00 0.00 ? 62  LYS B HE3  2  
ATOM 5744  H HZ1  . LYS B 1 62  ? 7.300   -0.614  -11.371 1.00 0.00 ? 62  LYS B HZ1  2  
ATOM 5745  H HZ2  . LYS B 1 62  ? 5.896   -0.529  -10.433 1.00 0.00 ? 62  LYS B HZ2  2  
ATOM 5746  H HZ3  . LYS B 1 62  ? 5.782   -0.769  -12.103 1.00 0.00 ? 62  LYS B HZ3  2  
ATOM 5747  N N    . LEU B 1 63  ? 10.886  -1.214  -8.784  1.00 0.00 ? 63  LEU B N    2  
ATOM 5748  C CA   . LEU B 1 63  ? 10.772  0.135   -8.233  1.00 0.00 ? 63  LEU B CA   2  
ATOM 5749  C C    . LEU B 1 63  ? 10.392  1.153   -9.297  1.00 0.00 ? 63  LEU B C    2  
ATOM 5750  O O    . LEU B 1 63  ? 9.824   2.202   -8.992  1.00 0.00 ? 63  LEU B O    2  
ATOM 5751  C CB   . LEU B 1 63  ? 12.077  0.551   -7.542  1.00 0.00 ? 63  LEU B CB   2  
ATOM 5752  C CG   . LEU B 1 63  ? 13.117  1.220   -8.444  1.00 0.00 ? 63  LEU B CG   2  
ATOM 5753  C CD1  . LEU B 1 63  ? 14.312  1.684   -7.625  1.00 0.00 ? 63  LEU B CD1  2  
ATOM 5754  C CD2  . LEU B 1 63  ? 13.558  0.268   -9.548  1.00 0.00 ? 63  LEU B CD2  2  
ATOM 5755  H H    . LEU B 1 63  ? 11.685  -1.743  -8.586  1.00 0.00 ? 63  LEU B H    2  
ATOM 5756  H HA   . LEU B 1 63  ? 9.987   0.117   -7.505  1.00 0.00 ? 63  LEU B HA   2  
ATOM 5757  H HB2  . LEU B 1 63  ? 11.833  1.236   -6.743  1.00 0.00 ? 63  LEU B HB2  2  
ATOM 5758  H HB3  . LEU B 1 63  ? 12.527  -0.329  -7.110  1.00 0.00 ? 63  LEU B HB3  2  
ATOM 5759  H HG   . LEU B 1 63  ? 12.674  2.089   -8.909  1.00 0.00 ? 63  LEU B HG   2  
ATOM 5760  H HD11 . LEU B 1 63  ? 13.965  2.101   -6.690  1.00 0.00 ? 63  LEU B HD11 2  
ATOM 5761  H HD12 . LEU B 1 63  ? 14.855  2.438   -8.175  1.00 0.00 ? 63  LEU B HD12 2  
ATOM 5762  H HD13 . LEU B 1 63  ? 14.961  0.845   -7.427  1.00 0.00 ? 63  LEU B HD13 2  
ATOM 5763  H HD21 . LEU B 1 63  ? 13.181  -0.723  -9.341  1.00 0.00 ? 63  LEU B HD21 2  
ATOM 5764  H HD22 . LEU B 1 63  ? 14.635  0.241   -9.594  1.00 0.00 ? 63  LEU B HD22 2  
ATOM 5765  H HD23 . LEU B 1 63  ? 13.166  0.610   -10.494 1.00 0.00 ? 63  LEU B HD23 2  
ATOM 5766  N N    . ASP B 1 64  ? 10.709  0.843   -10.541 1.00 0.00 ? 64  ASP B N    2  
ATOM 5767  C CA   . ASP B 1 64  ? 10.401  1.733   -11.644 1.00 0.00 ? 64  ASP B CA   2  
ATOM 5768  C C    . ASP B 1 64  ? 11.259  2.993   -11.578 1.00 0.00 ? 64  ASP B C    2  
ATOM 5769  O O    . ASP B 1 64  ? 10.748  4.098   -11.396 1.00 0.00 ? 64  ASP B O    2  
ATOM 5770  C CB   . ASP B 1 64  ? 8.916   2.105   -11.640 1.00 0.00 ? 64  ASP B CB   2  
ATOM 5771  C CG   . ASP B 1 64  ? 8.353   2.259   -13.039 1.00 0.00 ? 64  ASP B CG   2  
ATOM 5772  O OD1  . ASP B 1 64  ? 8.421   3.379   -13.586 1.00 0.00 ? 64  ASP B OD1  2  
ATOM 5773  O OD2  . ASP B 1 64  ? 7.843   1.259   -13.587 1.00 0.00 ? 64  ASP B OD2  2  
ATOM 5774  H H    . ASP B 1 64  ? 11.164  -0.004  -10.725 1.00 0.00 ? 64  ASP B H    2  
ATOM 5775  H HA   . ASP B 1 64  ? 10.626  1.204   -12.548 1.00 0.00 ? 64  ASP B HA   2  
ATOM 5776  H HB2  . ASP B 1 64  ? 8.359   1.333   -11.131 1.00 0.00 ? 64  ASP B HB2  2  
ATOM 5777  H HB3  . ASP B 1 64  ? 8.787   3.041   -11.114 1.00 0.00 ? 64  ASP B HB3  2  
ATOM 5778  N N    . LEU B 1 65  ? 12.568  2.816   -11.720 1.00 0.00 ? 65  LEU B N    2  
ATOM 5779  C CA   . LEU B 1 65  ? 13.504  3.933   -11.673 1.00 0.00 ? 65  LEU B CA   2  
ATOM 5780  C C    . LEU B 1 65  ? 14.313  4.014   -12.964 1.00 0.00 ? 65  LEU B C    2  
ATOM 5781  O O    . LEU B 1 65  ? 14.467  3.021   -13.675 1.00 0.00 ? 65  LEU B O    2  
ATOM 5782  C CB   . LEU B 1 65  ? 14.442  3.786   -10.470 1.00 0.00 ? 65  LEU B CB   2  
ATOM 5783  C CG   . LEU B 1 65  ? 14.227  4.803   -9.346  1.00 0.00 ? 65  LEU B CG   2  
ATOM 5784  C CD1  . LEU B 1 65  ? 14.219  6.219   -9.901  1.00 0.00 ? 65  LEU B CD1  2  
ATOM 5785  C CD2  . LEU B 1 65  ? 12.932  4.513   -8.602  1.00 0.00 ? 65  LEU B CD2  2  
ATOM 5786  H H    . LEU B 1 65  ? 12.913  1.911   -11.860 1.00 0.00 ? 65  LEU B H    2  
ATOM 5787  H HA   . LEU B 1 65  ? 12.932  4.842   -11.562 1.00 0.00 ? 65  LEU B HA   2  
ATOM 5788  H HB2  . LEU B 1 65  ? 14.312  2.795   -10.059 1.00 0.00 ? 65  LEU B HB2  2  
ATOM 5789  H HB3  . LEU B 1 65  ? 15.461  3.880   -10.817 1.00 0.00 ? 65  LEU B HB3  2  
ATOM 5790  H HG   . LEU B 1 65  ? 15.042  4.728   -8.641  1.00 0.00 ? 65  LEU B HG   2  
ATOM 5791  H HD11 . LEU B 1 65  ? 14.932  6.294   -10.708 1.00 0.00 ? 65  LEU B HD11 2  
ATOM 5792  H HD12 . LEU B 1 65  ? 14.485  6.915   -9.118  1.00 0.00 ? 65  LEU B HD12 2  
ATOM 5793  H HD13 . LEU B 1 65  ? 13.231  6.455   -10.271 1.00 0.00 ? 65  LEU B HD13 2  
ATOM 5794  H HD21 . LEU B 1 65  ? 12.242  4.008   -9.262  1.00 0.00 ? 65  LEU B HD21 2  
ATOM 5795  H HD22 . LEU B 1 65  ? 12.493  5.441   -8.265  1.00 0.00 ? 65  LEU B HD22 2  
ATOM 5796  H HD23 . LEU B 1 65  ? 13.139  3.883   -7.748  1.00 0.00 ? 65  LEU B HD23 2  
ATOM 5797  N N    . ASN B 1 66  ? 14.828  5.203   -13.263 1.00 0.00 ? 66  ASN B N    2  
ATOM 5798  C CA   . ASN B 1 66  ? 15.619  5.410   -14.470 1.00 0.00 ? 66  ASN B CA   2  
ATOM 5799  C C    . ASN B 1 66  ? 16.549  6.608   -14.313 1.00 0.00 ? 66  ASN B C    2  
ATOM 5800  O O    . ASN B 1 66  ? 17.758  6.451   -14.144 1.00 0.00 ? 66  ASN B O    2  
ATOM 5801  C CB   . ASN B 1 66  ? 14.701  5.617   -15.676 1.00 0.00 ? 66  ASN B CB   2  
ATOM 5802  C CG   . ASN B 1 66  ? 14.051  4.327   -16.139 1.00 0.00 ? 66  ASN B CG   2  
ATOM 5803  O OD1  . ASN B 1 66  ? 14.595  3.611   -16.979 1.00 0.00 ? 66  ASN B OD1  2  
ATOM 5804  N ND2  . ASN B 1 66  ? 12.881  4.025   -15.590 1.00 0.00 ? 66  ASN B ND2  2  
ATOM 5805  H H    . ASN B 1 66  ? 14.670  5.957   -12.658 1.00 0.00 ? 66  ASN B H    2  
ATOM 5806  H HA   . ASN B 1 66  ? 16.215  4.524   -14.631 1.00 0.00 ? 66  ASN B HA   2  
ATOM 5807  H HB2  . ASN B 1 66  ? 13.921  6.316   -15.411 1.00 0.00 ? 66  ASN B HB2  2  
ATOM 5808  H HB3  . ASN B 1 66  ? 15.278  6.022   -16.495 1.00 0.00 ? 66  ASN B HB3  2  
ATOM 5809  H HD21 . ASN B 1 66  ? 12.506  4.647   -14.924 1.00 0.00 ? 66  ASN B HD21 2  
ATOM 5810  H HD22 . ASN B 1 66  ? 12.437  3.194   -15.872 1.00 0.00 ? 66  ASN B HD22 2  
ATOM 5811  N N    . SER B 1 67  ? 15.974  7.805   -14.371 1.00 0.00 ? 67  SER B N    2  
ATOM 5812  C CA   . SER B 1 67  ? 16.750  9.032   -14.236 1.00 0.00 ? 67  SER B CA   2  
ATOM 5813  C C    . SER B 1 67  ? 15.834  10.232  -14.019 1.00 0.00 ? 67  SER B C    2  
ATOM 5814  O O    . SER B 1 67  ? 14.865  10.426  -14.752 1.00 0.00 ? 67  SER B O    2  
ATOM 5815  C CB   . SER B 1 67  ? 17.613  9.254   -15.479 1.00 0.00 ? 67  SER B CB   2  
ATOM 5816  O OG   . SER B 1 67  ? 16.871  9.023   -16.663 1.00 0.00 ? 67  SER B OG   2  
ATOM 5817  H H    . SER B 1 67  ? 15.007  7.865   -14.508 1.00 0.00 ? 67  SER B H    2  
ATOM 5818  H HA   . SER B 1 67  ? 17.393  8.925   -13.376 1.00 0.00 ? 67  SER B HA   2  
ATOM 5819  H HB2  . SER B 1 67  ? 17.974  10.272  -15.488 1.00 0.00 ? 67  SER B HB2  2  
ATOM 5820  H HB3  . SER B 1 67  ? 18.453  8.576   -15.457 1.00 0.00 ? 67  SER B HB3  2  
ATOM 5821  H HG   . SER B 1 67  ? 16.491  8.142   -16.637 1.00 0.00 ? 67  SER B HG   2  
ATOM 5822  N N    . ASP B 1 68  ? 16.147  11.035  -13.007 1.00 0.00 ? 68  ASP B N    2  
ATOM 5823  C CA   . ASP B 1 68  ? 15.351  12.216  -12.694 1.00 0.00 ? 68  ASP B CA   2  
ATOM 5824  C C    . ASP B 1 68  ? 13.916  11.827  -12.348 1.00 0.00 ? 68  ASP B C    2  
ATOM 5825  O O    . ASP B 1 68  ? 13.100  11.575  -13.234 1.00 0.00 ? 68  ASP B O    2  
ATOM 5826  C CB   . ASP B 1 68  ? 15.359  13.189  -13.876 1.00 0.00 ? 68  ASP B CB   2  
ATOM 5827  C CG   . ASP B 1 68  ? 15.673  14.610  -13.451 1.00 0.00 ? 68  ASP B CG   2  
ATOM 5828  O OD1  . ASP B 1 68  ? 16.848  14.887  -13.127 1.00 0.00 ? 68  ASP B OD1  2  
ATOM 5829  O OD2  . ASP B 1 68  ? 14.745  15.445  -13.439 1.00 0.00 ? 68  ASP B OD2  2  
ATOM 5830  H H    . ASP B 1 68  ? 16.932  10.829  -12.457 1.00 0.00 ? 68  ASP B H    2  
ATOM 5831  H HA   . ASP B 1 68  ? 15.796  12.698  -11.838 1.00 0.00 ? 68  ASP B HA   2  
ATOM 5832  H HB2  . ASP B 1 68  ? 16.107  12.874  -14.588 1.00 0.00 ? 68  ASP B HB2  2  
ATOM 5833  H HB3  . ASP B 1 68  ? 14.389  13.181  -14.350 1.00 0.00 ? 68  ASP B HB3  2  
ATOM 5834  N N    . GLY B 1 69  ? 13.617  11.778  -11.054 1.00 0.00 ? 69  GLY B N    2  
ATOM 5835  C CA   . GLY B 1 69  ? 12.282  11.419  -10.614 1.00 0.00 ? 69  GLY B CA   2  
ATOM 5836  C C    . GLY B 1 69  ? 12.254  10.949  -9.173  1.00 0.00 ? 69  GLY B C    2  
ATOM 5837  O O    . GLY B 1 69  ? 11.251  11.115  -8.479  1.00 0.00 ? 69  GLY B O    2  
ATOM 5838  H H    . GLY B 1 69  ? 14.309  11.988  -10.393 1.00 0.00 ? 69  GLY B H    2  
ATOM 5839  H HA2  . GLY B 1 69  ? 11.638  12.279  -10.713 1.00 0.00 ? 69  GLY B HA2  2  
ATOM 5840  H HA3  . GLY B 1 69  ? 11.907  10.627  -11.247 1.00 0.00 ? 69  GLY B HA3  2  
ATOM 5841  N N    . GLN B 1 70  ? 13.357  10.361  -8.723  1.00 0.00 ? 70  GLN B N    2  
ATOM 5842  C CA   . GLN B 1 70  ? 13.458  9.866   -7.354  1.00 0.00 ? 70  GLN B CA   2  
ATOM 5843  C C    . GLN B 1 70  ? 12.398  8.802   -7.081  1.00 0.00 ? 70  GLN B C    2  
ATOM 5844  O O    . GLN B 1 70  ? 11.752  8.311   -8.007  1.00 0.00 ? 70  GLN B O    2  
ATOM 5845  C CB   . GLN B 1 70  ? 13.313  11.024  -6.362  1.00 0.00 ? 70  GLN B CB   2  
ATOM 5846  C CG   . GLN B 1 70  ? 14.619  11.753  -6.088  1.00 0.00 ? 70  GLN B CG   2  
ATOM 5847  C CD   . GLN B 1 70  ? 15.382  11.173  -4.913  1.00 0.00 ? 70  GLN B CD   2  
ATOM 5848  O OE1  . GLN B 1 70  ? 15.839  11.904  -4.032  1.00 0.00 ? 70  GLN B OE1  2  
ATOM 5849  N NE2  . GLN B 1 70  ? 15.529  9.852   -4.891  1.00 0.00 ? 70  GLN B NE2  2  
ATOM 5850  H H    . GLN B 1 70  ? 14.123  10.258  -9.325  1.00 0.00 ? 70  GLN B H    2  
ATOM 5851  H HA   . GLN B 1 70  ? 14.433  9.422   -7.239  1.00 0.00 ? 70  GLN B HA   2  
ATOM 5852  H HB2  . GLN B 1 70  ? 12.604  11.736  -6.759  1.00 0.00 ? 70  GLN B HB2  2  
ATOM 5853  H HB3  . GLN B 1 70  ? 12.935  10.643  -5.425  1.00 0.00 ? 70  GLN B HB3  2  
ATOM 5854  H HG2  . GLN B 1 70  ? 15.243  11.689  -6.968  1.00 0.00 ? 70  GLN B HG2  2  
ATOM 5855  H HG3  . GLN B 1 70  ? 14.400  12.791  -5.879  1.00 0.00 ? 70  GLN B HG3  2  
ATOM 5856  H HE21 . GLN B 1 70  ? 15.142  9.331   -5.626  1.00 0.00 ? 70  GLN B HE21 2  
ATOM 5857  H HE22 . GLN B 1 70  ? 16.017  9.452   -4.138  1.00 0.00 ? 70  GLN B HE22 2  
ATOM 5858  N N    . LEU B 1 71  ? 12.218  8.454   -5.808  1.00 0.00 ? 71  LEU B N    2  
ATOM 5859  C CA   . LEU B 1 71  ? 11.231  7.461   -5.423  1.00 0.00 ? 71  LEU B CA   2  
ATOM 5860  C C    . LEU B 1 71  ? 9.828   7.975   -5.782  1.00 0.00 ? 71  LEU B C    2  
ATOM 5861  O O    . LEU B 1 71  ? 9.640   8.506   -6.876  1.00 0.00 ? 71  LEU B O    2  
ATOM 5862  C CB   . LEU B 1 71  ? 11.388  7.142   -3.923  1.00 0.00 ? 71  LEU B CB   2  
ATOM 5863  C CG   . LEU B 1 71  ? 12.075  5.808   -3.584  1.00 0.00 ? 71  LEU B CG   2  
ATOM 5864  C CD1  . LEU B 1 71  ? 11.041  4.714   -3.371  1.00 0.00 ? 71  LEU B CD1  2  
ATOM 5865  C CD2  . LEU B 1 71  ? 13.072  5.403   -4.663  1.00 0.00 ? 71  LEU B CD2  2  
ATOM 5866  H H    . LEU B 1 71  ? 12.755  8.880   -5.113  1.00 0.00 ? 71  LEU B H    2  
ATOM 5867  H HA   . LEU B 1 71  ? 11.427  6.571   -5.997  1.00 0.00 ? 71  LEU B HA   2  
ATOM 5868  H HB2  . LEU B 1 71  ? 11.969  7.931   -3.477  1.00 0.00 ? 71  LEU B HB2  2  
ATOM 5869  H HB3  . LEU B 1 71  ? 10.418  7.139   -3.465  1.00 0.00 ? 71  LEU B HB3  2  
ATOM 5870  H HG   . LEU B 1 71  ? 12.620  5.926   -2.658  1.00 0.00 ? 71  LEU B HG   2  
ATOM 5871  H HD11 . LEU B 1 71  ? 11.054  4.034   -4.210  1.00 0.00 ? 71  LEU B HD11 2  
ATOM 5872  H HD12 . LEU B 1 71  ? 10.058  5.161   -3.284  1.00 0.00 ? 71  LEU B HD12 2  
ATOM 5873  H HD13 . LEU B 1 71  ? 11.275  4.172   -2.464  1.00 0.00 ? 71  LEU B HD13 2  
ATOM 5874  H HD21 . LEU B 1 71  ? 13.735  6.230   -4.869  1.00 0.00 ? 71  LEU B HD21 2  
ATOM 5875  H HD22 . LEU B 1 71  ? 12.539  5.133   -5.563  1.00 0.00 ? 71  LEU B HD22 2  
ATOM 5876  H HD23 . LEU B 1 71  ? 13.647  4.557   -4.321  1.00 0.00 ? 71  LEU B HD23 2  
ATOM 5877  N N    . ASP B 1 72  ? 8.845   7.838   -4.890  1.00 0.00 ? 72  ASP B N    2  
ATOM 5878  C CA   . ASP B 1 72  ? 7.490   8.319   -5.187  1.00 0.00 ? 72  ASP B CA   2  
ATOM 5879  C C    . ASP B 1 72  ? 6.495   7.907   -4.108  1.00 0.00 ? 72  ASP B C    2  
ATOM 5880  O O    . ASP B 1 72  ? 6.878   7.437   -3.038  1.00 0.00 ? 72  ASP B O    2  
ATOM 5881  C CB   . ASP B 1 72  ? 7.012   7.796   -6.547  1.00 0.00 ? 72  ASP B CB   2  
ATOM 5882  C CG   . ASP B 1 72  ? 6.295   8.860   -7.357  1.00 0.00 ? 72  ASP B CG   2  
ATOM 5883  O OD1  . ASP B 1 72  ? 6.875   9.949   -7.552  1.00 0.00 ? 72  ASP B OD1  2  
ATOM 5884  O OD2  . ASP B 1 72  ? 5.154   8.603   -7.796  1.00 0.00 ? 72  ASP B OD2  2  
ATOM 5885  H H    . ASP B 1 72  ? 9.028   7.422   -4.022  1.00 0.00 ? 72  ASP B H    2  
ATOM 5886  H HA   . ASP B 1 72  ? 7.527   9.398   -5.225  1.00 0.00 ? 72  ASP B HA   2  
ATOM 5887  H HB2  . ASP B 1 72  ? 7.859   7.452   -7.116  1.00 0.00 ? 72  ASP B HB2  2  
ATOM 5888  H HB3  . ASP B 1 72  ? 6.331   6.971   -6.390  1.00 0.00 ? 72  ASP B HB3  2  
ATOM 5889  N N    . PHE B 1 73  ? 5.208   8.092   -4.404  1.00 0.00 ? 73  PHE B N    2  
ATOM 5890  C CA   . PHE B 1 73  ? 4.150   7.749   -3.464  1.00 0.00 ? 73  PHE B CA   2  
ATOM 5891  C C    . PHE B 1 73  ? 3.912   6.240   -3.412  1.00 0.00 ? 73  PHE B C    2  
ATOM 5892  O O    . PHE B 1 73  ? 4.078   5.624   -2.357  1.00 0.00 ? 73  PHE B O    2  
ATOM 5893  C CB   . PHE B 1 73  ? 2.858   8.492   -3.813  1.00 0.00 ? 73  PHE B CB   2  
ATOM 5894  C CG   . PHE B 1 73  ? 2.191   8.021   -5.074  1.00 0.00 ? 73  PHE B CG   2  
ATOM 5895  C CD1  . PHE B 1 73  ? 2.645   8.440   -6.315  1.00 0.00 ? 73  PHE B CD1  2  
ATOM 5896  C CD2  . PHE B 1 73  ? 1.110   7.157   -5.017  1.00 0.00 ? 73  PHE B CD2  2  
ATOM 5897  C CE1  . PHE B 1 73  ? 2.032   8.007   -7.475  1.00 0.00 ? 73  PHE B CE1  2  
ATOM 5898  C CE2  . PHE B 1 73  ? 0.492   6.720   -6.173  1.00 0.00 ? 73  PHE B CE2  2  
ATOM 5899  C CZ   . PHE B 1 73  ? 0.955   7.145   -7.404  1.00 0.00 ? 73  PHE B CZ   2  
ATOM 5900  H H    . PHE B 1 73  ? 4.969   8.472   -5.275  1.00 0.00 ? 73  PHE B H    2  
ATOM 5901  H HA   . PHE B 1 73  ? 4.474   8.070   -2.487  1.00 0.00 ? 73  PHE B HA   2  
ATOM 5902  H HB2  . PHE B 1 73  ? 2.157   8.363   -3.005  1.00 0.00 ? 73  PHE B HB2  2  
ATOM 5903  H HB3  . PHE B 1 73  ? 3.076   9.544   -3.925  1.00 0.00 ? 73  PHE B HB3  2  
ATOM 5904  H HD1  . PHE B 1 73  ? 3.488   9.113   -6.372  1.00 0.00 ? 73  PHE B HD1  2  
ATOM 5905  H HD2  . PHE B 1 73  ? 0.745   6.825   -4.052  1.00 0.00 ? 73  PHE B HD2  2  
ATOM 5906  H HE1  . PHE B 1 73  ? 2.396   8.340   -8.436  1.00 0.00 ? 73  PHE B HE1  2  
ATOM 5907  H HE2  . PHE B 1 73  ? -0.350  6.047   -6.116  1.00 0.00 ? 73  PHE B HE2  2  
ATOM 5908  H HZ   . PHE B 1 73  ? 0.473   6.806   -8.309  1.00 0.00 ? 73  PHE B HZ   2  
ATOM 5909  N N    . GLN B 1 74  ? 3.536   5.633   -4.539  1.00 0.00 ? 74  GLN B N    2  
ATOM 5910  C CA   . GLN B 1 74  ? 3.306   4.197   -4.554  1.00 0.00 ? 74  GLN B CA   2  
ATOM 5911  C C    . GLN B 1 74  ? 4.620   3.452   -4.663  1.00 0.00 ? 74  GLN B C    2  
ATOM 5912  O O    . GLN B 1 74  ? 4.724   2.317   -4.217  1.00 0.00 ? 74  GLN B O    2  
ATOM 5913  C CB   . GLN B 1 74  ? 2.368   3.764   -5.681  1.00 0.00 ? 74  GLN B CB   2  
ATOM 5914  C CG   . GLN B 1 74  ? 1.492   2.576   -5.291  1.00 0.00 ? 74  GLN B CG   2  
ATOM 5915  C CD   . GLN B 1 74  ? 1.896   1.282   -5.979  1.00 0.00 ? 74  GLN B CD   2  
ATOM 5916  O OE1  . GLN B 1 74  ? 1.797   1.165   -7.201  1.00 0.00 ? 74  GLN B OE1  2  
ATOM 5917  N NE2  . GLN B 1 74  ? 2.353   0.294   -5.202  1.00 0.00 ? 74  GLN B NE2  2  
ATOM 5918  H H    . GLN B 1 74  ? 3.426   6.150   -5.361  1.00 0.00 ? 74  GLN B H    2  
ATOM 5919  H HA   . GLN B 1 74  ? 2.849   3.939   -3.609  1.00 0.00 ? 74  GLN B HA   2  
ATOM 5920  H HB2  . GLN B 1 74  ? 1.725   4.593   -5.941  1.00 0.00 ? 74  GLN B HB2  2  
ATOM 5921  H HB3  . GLN B 1 74  ? 2.955   3.486   -6.542  1.00 0.00 ? 74  GLN B HB3  2  
ATOM 5922  H HG2  . GLN B 1 74  ? 1.563   2.432   -4.223  1.00 0.00 ? 74  GLN B HG2  2  
ATOM 5923  H HG3  . GLN B 1 74  ? 0.469   2.802   -5.554  1.00 0.00 ? 74  GLN B HG3  2  
ATOM 5924  H HE21 . GLN B 1 74  ? 2.415   0.447   -4.228  1.00 0.00 ? 74  GLN B HE21 2  
ATOM 5925  H HE22 . GLN B 1 74  ? 2.597   -0.554  -5.634  1.00 0.00 ? 74  GLN B HE22 2  
ATOM 5926  N N    . GLU B 1 75  ? 5.640   4.098   -5.235  1.00 0.00 ? 75  GLU B N    2  
ATOM 5927  C CA   . GLU B 1 75  ? 6.948   3.466   -5.355  1.00 0.00 ? 75  GLU B CA   2  
ATOM 5928  C C    . GLU B 1 75  ? 7.315   2.828   -4.023  1.00 0.00 ? 75  GLU B C    2  
ATOM 5929  O O    . GLU B 1 75  ? 7.973   1.791   -3.973  1.00 0.00 ? 75  GLU B O    2  
ATOM 5930  C CB   . GLU B 1 75  ? 8.014   4.483   -5.771  1.00 0.00 ? 75  GLU B CB   2  
ATOM 5931  C CG   . GLU B 1 75  ? 8.634   4.185   -7.127  1.00 0.00 ? 75  GLU B CG   2  
ATOM 5932  C CD   . GLU B 1 75  ? 8.971   5.441   -7.906  1.00 0.00 ? 75  GLU B CD   2  
ATOM 5933  O OE1  . GLU B 1 75  ? 10.076  5.988   -7.702  1.00 0.00 ? 75  GLU B OE1  2  
ATOM 5934  O OE2  . GLU B 1 75  ? 8.131   5.878   -8.720  1.00 0.00 ? 75  GLU B OE2  2  
ATOM 5935  H H    . GLU B 1 75  ? 5.513   5.013   -5.563  1.00 0.00 ? 75  GLU B H    2  
ATOM 5936  H HA   . GLU B 1 75  ? 6.878   2.694   -6.107  1.00 0.00 ? 75  GLU B HA   2  
ATOM 5937  H HB2  . GLU B 1 75  ? 7.565   5.465   -5.811  1.00 0.00 ? 75  GLU B HB2  2  
ATOM 5938  H HB3  . GLU B 1 75  ? 8.804   4.486   -5.032  1.00 0.00 ? 75  GLU B HB3  2  
ATOM 5939  H HG2  . GLU B 1 75  ? 9.542   3.619   -6.976  1.00 0.00 ? 75  GLU B HG2  2  
ATOM 5940  H HG3  . GLU B 1 75  ? 7.936   3.597   -7.703  1.00 0.00 ? 75  GLU B HG3  2  
ATOM 5941  N N    . PHE B 1 76  ? 6.842   3.452   -2.945  1.00 0.00 ? 76  PHE B N    2  
ATOM 5942  C CA   . PHE B 1 76  ? 7.070   2.950   -1.604  1.00 0.00 ? 76  PHE B CA   2  
ATOM 5943  C C    . PHE B 1 76  ? 6.089   1.828   -1.300  1.00 0.00 ? 76  PHE B C    2  
ATOM 5944  O O    . PHE B 1 76  ? 6.487   0.722   -0.939  1.00 0.00 ? 76  PHE B O    2  
ATOM 5945  C CB   . PHE B 1 76  ? 6.908   4.065   -0.576  1.00 0.00 ? 76  PHE B CB   2  
ATOM 5946  C CG   . PHE B 1 76  ? 7.820   3.904   0.603   1.00 0.00 ? 76  PHE B CG   2  
ATOM 5947  C CD1  . PHE B 1 76  ? 7.450   3.109   1.673   1.00 0.00 ? 76  PHE B CD1  2  
ATOM 5948  C CD2  . PHE B 1 76  ? 9.050   4.538   0.634   1.00 0.00 ? 76  PHE B CD2  2  
ATOM 5949  C CE1  . PHE B 1 76  ? 8.291   2.949   2.756   1.00 0.00 ? 76  PHE B CE1  2  
ATOM 5950  C CE2  . PHE B 1 76  ? 9.895   4.382   1.716   1.00 0.00 ? 76  PHE B CE2  2  
ATOM 5951  C CZ   . PHE B 1 76  ? 9.514   3.586   2.778   1.00 0.00 ? 76  PHE B CZ   2  
ATOM 5952  H H    . PHE B 1 76  ? 6.303   4.262   -3.061  1.00 0.00 ? 76  PHE B H    2  
ATOM 5953  H HA   . PHE B 1 76  ? 8.076   2.563   -1.556  1.00 0.00 ? 76  PHE B HA   2  
ATOM 5954  H HB2  . PHE B 1 76  ? 7.125   5.014   -1.043  1.00 0.00 ? 76  PHE B HB2  2  
ATOM 5955  H HB3  . PHE B 1 76  ? 5.886   4.069   -0.215  1.00 0.00 ? 76  PHE B HB3  2  
ATOM 5956  H HD1  . PHE B 1 76  ? 6.492   2.609   1.657   1.00 0.00 ? 76  PHE B HD1  2  
ATOM 5957  H HD2  . PHE B 1 76  ? 9.348   5.160   -0.196  1.00 0.00 ? 76  PHE B HD2  2  
ATOM 5958  H HE1  . PHE B 1 76  ? 7.991   2.325   3.585   1.00 0.00 ? 76  PHE B HE1  2  
ATOM 5959  H HE2  . PHE B 1 76  ? 10.852  4.882   1.733   1.00 0.00 ? 76  PHE B HE2  2  
ATOM 5960  H HZ   . PHE B 1 76  ? 10.173  3.462   3.622   1.00 0.00 ? 76  PHE B HZ   2  
ATOM 5961  N N    . LEU B 1 77  ? 4.800   2.118   -1.466  1.00 0.00 ? 77  LEU B N    2  
ATOM 5962  C CA   . LEU B 1 77  ? 3.763   1.125   -1.227  1.00 0.00 ? 77  LEU B CA   2  
ATOM 5963  C C    . LEU B 1 77  ? 4.028   -0.109  -2.080  1.00 0.00 ? 77  LEU B C    2  
ATOM 5964  O O    . LEU B 1 77  ? 3.770   -1.234  -1.663  1.00 0.00 ? 77  LEU B O    2  
ATOM 5965  C CB   . LEU B 1 77  ? 2.381   1.709   -1.524  1.00 0.00 ? 77  LEU B CB   2  
ATOM 5966  C CG   . LEU B 1 77  ? 1.668   2.289   -0.301  1.00 0.00 ? 77  LEU B CG   2  
ATOM 5967  C CD1  . LEU B 1 77  ? 0.499   3.168   -0.718  1.00 0.00 ? 77  LEU B CD1  2  
ATOM 5968  C CD2  . LEU B 1 77  ? 1.207   1.170   0.618   1.00 0.00 ? 77  LEU B CD2  2  
ATOM 5969  H H    . LEU B 1 77  ? 4.544   3.014   -1.768  1.00 0.00 ? 77  LEU B H    2  
ATOM 5970  H HA   . LEU B 1 77  ? 3.812   0.842   -0.186  1.00 0.00 ? 77  LEU B HA   2  
ATOM 5971  H HB2  . LEU B 1 77  ? 2.492   2.492   -2.259  1.00 0.00 ? 77  LEU B HB2  2  
ATOM 5972  H HB3  . LEU B 1 77  ? 1.761   0.930   -1.938  1.00 0.00 ? 77  LEU B HB3  2  
ATOM 5973  H HG   . LEU B 1 77  ? 2.364   2.906   0.251   1.00 0.00 ? 77  LEU B HG   2  
ATOM 5974  H HD11 . LEU B 1 77  ? 0.804   4.204   -0.683  1.00 0.00 ? 77  LEU B HD11 2  
ATOM 5975  H HD12 . LEU B 1 77  ? -0.333  3.011   -0.043  1.00 0.00 ? 77  LEU B HD12 2  
ATOM 5976  H HD13 . LEU B 1 77  ? 0.200   2.914   -1.723  1.00 0.00 ? 77  LEU B HD13 2  
ATOM 5977  H HD21 . LEU B 1 77  ? 1.857   1.123   1.478   1.00 0.00 ? 77  LEU B HD21 2  
ATOM 5978  H HD22 . LEU B 1 77  ? 1.246   0.231   0.086   1.00 0.00 ? 77  LEU B HD22 2  
ATOM 5979  H HD23 . LEU B 1 77  ? 0.194   1.360   0.941   1.00 0.00 ? 77  LEU B HD23 2  
ATOM 5980  N N    . ASN B 1 78  ? 4.583   0.118   -3.264  1.00 0.00 ? 78  ASN B N    2  
ATOM 5981  C CA   . ASN B 1 78  ? 4.935   -0.964  -4.169  1.00 0.00 ? 78  ASN B CA   2  
ATOM 5982  C C    . ASN B 1 78  ? 6.202   -1.631  -3.652  1.00 0.00 ? 78  ASN B C    2  
ATOM 5983  O O    . ASN B 1 78  ? 6.356   -2.850  -3.722  1.00 0.00 ? 78  ASN B O    2  
ATOM 5984  C CB   . ASN B 1 78  ? 5.147   -0.428  -5.596  1.00 0.00 ? 78  ASN B CB   2  
ATOM 5985  C CG   . ASN B 1 78  ? 6.327   -1.065  -6.311  1.00 0.00 ? 78  ASN B CG   2  
ATOM 5986  O OD1  . ASN B 1 78  ? 6.345   -2.272  -6.553  1.00 0.00 ? 78  ASN B OD1  2  
ATOM 5987  N ND2  . ASN B 1 78  ? 7.320   -0.252  -6.650  1.00 0.00 ? 78  ASN B ND2  2  
ATOM 5988  H H    . ASN B 1 78  ? 4.789   1.038   -3.523  1.00 0.00 ? 78  ASN B H    2  
ATOM 5989  H HA   . ASN B 1 78  ? 4.129   -1.683  -4.167  1.00 0.00 ? 78  ASN B HA   2  
ATOM 5990  H HB2  . ASN B 1 78  ? 4.261   -0.622  -6.180  1.00 0.00 ? 78  ASN B HB2  2  
ATOM 5991  H HB3  . ASN B 1 78  ? 5.311   0.637   -5.550  1.00 0.00 ? 78  ASN B HB3  2  
ATOM 5992  H HD21 . ASN B 1 78  ? 7.236   0.702   -6.425  1.00 0.00 ? 78  ASN B HD21 2  
ATOM 5993  H HD22 . ASN B 1 78  ? 8.097   -0.639  -7.114  1.00 0.00 ? 78  ASN B HD22 2  
ATOM 5994  N N    . LEU B 1 79  ? 7.103   -0.808  -3.119  1.00 0.00 ? 79  LEU B N    2  
ATOM 5995  C CA   . LEU B 1 79  ? 8.353   -1.298  -2.575  1.00 0.00 ? 79  LEU B CA   2  
ATOM 5996  C C    . LEU B 1 79  ? 8.088   -2.158  -1.346  1.00 0.00 ? 79  LEU B C    2  
ATOM 5997  O O    . LEU B 1 79  ? 8.446   -3.331  -1.314  1.00 0.00 ? 79  LEU B O    2  
ATOM 5998  C CB   . LEU B 1 79  ? 9.260   -0.117  -2.208  1.00 0.00 ? 79  LEU B CB   2  
ATOM 5999  C CG   . LEU B 1 79  ? 10.459  0.116   -3.134  1.00 0.00 ? 79  LEU B CG   2  
ATOM 6000  C CD1  . LEU B 1 79  ? 10.058  0.049   -4.598  1.00 0.00 ? 79  LEU B CD1  2  
ATOM 6001  C CD2  . LEU B 1 79  ? 11.116  1.451   -2.826  1.00 0.00 ? 79  LEU B CD2  2  
ATOM 6002  H H    . LEU B 1 79  ? 6.916   0.152   -3.089  1.00 0.00 ? 79  LEU B H    2  
ATOM 6003  H HA   . LEU B 1 79  ? 8.834   -1.898  -3.330  1.00 0.00 ? 79  LEU B HA   2  
ATOM 6004  H HB2  . LEU B 1 79  ? 8.659   0.779   -2.200  1.00 0.00 ? 79  LEU B HB2  2  
ATOM 6005  H HB3  . LEU B 1 79  ? 9.638   -0.281  -1.208  1.00 0.00 ? 79  LEU B HB3  2  
ATOM 6006  H HG   . LEU B 1 79  ? 11.184  -0.656  -2.960  1.00 0.00 ? 79  LEU B HG   2  
ATOM 6007  H HD11 . LEU B 1 79  ? 9.942   1.051   -4.986  1.00 0.00 ? 79  LEU B HD11 2  
ATOM 6008  H HD12 . LEU B 1 79  ? 9.127   -0.488  -4.697  1.00 0.00 ? 79  LEU B HD12 2  
ATOM 6009  H HD13 . LEU B 1 79  ? 10.831  -0.463  -5.153  1.00 0.00 ? 79  LEU B HD13 2  
ATOM 6010  H HD21 . LEU B 1 79  ? 10.427  2.074   -2.274  1.00 0.00 ? 79  LEU B HD21 2  
ATOM 6011  H HD22 . LEU B 1 79  ? 11.383  1.944   -3.751  1.00 0.00 ? 79  LEU B HD22 2  
ATOM 6012  H HD23 . LEU B 1 79  ? 12.004  1.284   -2.235  1.00 0.00 ? 79  LEU B HD23 2  
ATOM 6013  N N    . ILE B 1 80  ? 7.432   -1.571  -0.344  1.00 0.00 ? 80  ILE B N    2  
ATOM 6014  C CA   . ILE B 1 80  ? 7.101   -2.294  0.875   1.00 0.00 ? 80  ILE B CA   2  
ATOM 6015  C C    . ILE B 1 80  ? 5.958   -3.267  0.625   1.00 0.00 ? 80  ILE B C    2  
ATOM 6016  O O    . ILE B 1 80  ? 6.017   -4.425  1.039   1.00 0.00 ? 80  ILE B O    2  
ATOM 6017  C CB   . ILE B 1 80  ? 6.752   -1.349  2.044   1.00 0.00 ? 80  ILE B CB   2  
ATOM 6018  C CG1  . ILE B 1 80  ? 6.903   -2.091  3.370   1.00 0.00 ? 80  ILE B CG1  2  
ATOM 6019  C CG2  . ILE B 1 80  ? 5.345   -0.806  1.911   1.00 0.00 ? 80  ILE B CG2  2  
ATOM 6020  C CD1  . ILE B 1 80  ? 5.673   -2.882  3.758   1.00 0.00 ? 80  ILE B CD1  2  
ATOM 6021  H H    . ILE B 1 80  ? 7.158   -0.639  -0.437  1.00 0.00 ? 80  ILE B H    2  
ATOM 6022  H HA   . ILE B 1 80  ? 7.966   -2.858  1.161   1.00 0.00 ? 80  ILE B HA   2  
ATOM 6023  H HB   . ILE B 1 80  ? 7.438   -0.517  2.026   1.00 0.00 ? 80  ILE B HB   2  
ATOM 6024  H HG12 . ILE B 1 80  ? 7.730   -2.779  3.297   1.00 0.00 ? 80  ILE B HG12 2  
ATOM 6025  H HG13 . ILE B 1 80  ? 7.102   -1.376  4.154   1.00 0.00 ? 80  ILE B HG13 2  
ATOM 6026  H HG21 . ILE B 1 80  ? 4.649   -1.635  1.909   1.00 0.00 ? 80  ILE B HG21 2  
ATOM 6027  H HG22 . ILE B 1 80  ? 5.258   -0.254  0.990   1.00 0.00 ? 80  ILE B HG22 2  
ATOM 6028  H HG23 . ILE B 1 80  ? 5.133   -0.158  2.754   1.00 0.00 ? 80  ILE B HG23 2  
ATOM 6029  H HD11 . ILE B 1 80  ? 5.138   -2.353  4.533   1.00 0.00 ? 80  ILE B HD11 2  
ATOM 6030  H HD12 . ILE B 1 80  ? 5.974   -3.852  4.121   1.00 0.00 ? 80  ILE B HD12 2  
ATOM 6031  H HD13 . ILE B 1 80  ? 5.029   -3.005  2.896   1.00 0.00 ? 80  ILE B HD13 2  
ATOM 6032  N N    . GLY B 1 81  ? 4.925   -2.803  -0.078  1.00 0.00 ? 81  GLY B N    2  
ATOM 6033  C CA   . GLY B 1 81  ? 3.806   -3.672  -0.390  1.00 0.00 ? 81  GLY B CA   2  
ATOM 6034  C C    . GLY B 1 81  ? 4.295   -4.941  -1.043  1.00 0.00 ? 81  GLY B C    2  
ATOM 6035  O O    . GLY B 1 81  ? 3.943   -6.044  -0.624  1.00 0.00 ? 81  GLY B O    2  
ATOM 6036  H H    . GLY B 1 81  ? 4.935   -1.879  -0.403  1.00 0.00 ? 81  GLY B H    2  
ATOM 6037  H HA2  . GLY B 1 81  ? 3.281   -3.918  0.522   1.00 0.00 ? 81  GLY B HA2  2  
ATOM 6038  H HA3  . GLY B 1 81  ? 3.132   -3.164  -1.062  1.00 0.00 ? 81  GLY B HA3  2  
ATOM 6039  N N    . GLY B 1 82  ? 5.143   -4.780  -2.056  1.00 0.00 ? 82  GLY B N    2  
ATOM 6040  C CA   . GLY B 1 82  ? 5.710   -5.935  -2.730  1.00 0.00 ? 82  GLY B CA   2  
ATOM 6041  C C    . GLY B 1 82  ? 6.325   -6.909  -1.740  1.00 0.00 ? 82  GLY B C    2  
ATOM 6042  O O    . GLY B 1 82  ? 6.119   -8.118  -1.843  1.00 0.00 ? 82  GLY B O    2  
ATOM 6043  H H    . GLY B 1 82  ? 5.400   -3.868  -2.332  1.00 0.00 ? 82  GLY B H    2  
ATOM 6044  H HA2  . GLY B 1 82  ? 4.928   -6.442  -3.282  1.00 0.00 ? 82  GLY B HA2  2  
ATOM 6045  H HA3  . GLY B 1 82  ? 6.473   -5.604  -3.418  1.00 0.00 ? 82  GLY B HA3  2  
ATOM 6046  N N    . LEU B 1 83  ? 7.066   -6.385  -0.758  1.00 0.00 ? 83  LEU B N    2  
ATOM 6047  C CA   . LEU B 1 83  ? 7.675   -7.239  0.260   1.00 0.00 ? 83  LEU B CA   2  
ATOM 6048  C C    . LEU B 1 83  ? 6.603   -8.062  0.959   1.00 0.00 ? 83  LEU B C    2  
ATOM 6049  O O    . LEU B 1 83  ? 6.765   -9.264  1.167   1.00 0.00 ? 83  LEU B O    2  
ATOM 6050  C CB   . LEU B 1 83  ? 8.434   -6.409  1.295   1.00 0.00 ? 83  LEU B CB   2  
ATOM 6051  C CG   . LEU B 1 83  ? 9.181   -5.203  0.737   1.00 0.00 ? 83  LEU B CG   2  
ATOM 6052  C CD1  . LEU B 1 83  ? 10.012  -4.539  1.823   1.00 0.00 ? 83  LEU B CD1  2  
ATOM 6053  C CD2  . LEU B 1 83  ? 10.054  -5.617  -0.438  1.00 0.00 ? 83  LEU B CD2  2  
ATOM 6054  H H    . LEU B 1 83  ? 7.195   -5.410  -0.711  1.00 0.00 ? 83  LEU B H    2  
ATOM 6055  H HA   . LEU B 1 83  ? 8.363   -7.907  -0.234  1.00 0.00 ? 83  LEU B HA   2  
ATOM 6056  H HB2  . LEU B 1 83  ? 7.726   -6.059  2.033   1.00 0.00 ? 83  LEU B HB2  2  
ATOM 6057  H HB3  . LEU B 1 83  ? 9.149   -7.052  1.785   1.00 0.00 ? 83  LEU B HB3  2  
ATOM 6058  H HG   . LEU B 1 83  ? 8.463   -4.484  0.384   1.00 0.00 ? 83  LEU B HG   2  
ATOM 6059  H HD11 . LEU B 1 83  ? 11.060  -4.707  1.631   1.00 0.00 ? 83  LEU B HD11 2  
ATOM 6060  H HD12 . LEU B 1 83  ? 9.749   -4.957  2.784   1.00 0.00 ? 83  LEU B HD12 2  
ATOM 6061  H HD13 . LEU B 1 83  ? 9.811   -3.476  1.828   1.00 0.00 ? 83  LEU B HD13 2  
ATOM 6062  H HD21 . LEU B 1 83  ? 11.076  -5.724  -0.105  1.00 0.00 ? 83  LEU B HD21 2  
ATOM 6063  H HD22 . LEU B 1 83  ? 10.002  -4.860  -1.205  1.00 0.00 ? 83  LEU B HD22 2  
ATOM 6064  H HD23 . LEU B 1 83  ? 9.706   -6.557  -0.837  1.00 0.00 ? 83  LEU B HD23 2  
ATOM 6065  N N    . ALA B 1 84  ? 5.498   -7.406  1.314   1.00 0.00 ? 84  ALA B N    2  
ATOM 6066  C CA   . ALA B 1 84  ? 4.397   -8.089  1.982   1.00 0.00 ? 84  ALA B CA   2  
ATOM 6067  C C    . ALA B 1 84  ? 3.922   -9.276  1.166   1.00 0.00 ? 84  ALA B C    2  
ATOM 6068  O O    . ALA B 1 84  ? 3.633   -10.341 1.702   1.00 0.00 ? 84  ALA B O    2  
ATOM 6069  C CB   . ALA B 1 84  ? 3.229   -7.147  2.187   1.00 0.00 ? 84  ALA B CB   2  
ATOM 6070  H H    . ALA B 1 84  ? 5.423   -6.439  1.119   1.00 0.00 ? 84  ALA B H    2  
ATOM 6071  H HA   . ALA B 1 84  ? 4.737   -8.429  2.948   1.00 0.00 ? 84  ALA B HA   2  
ATOM 6072  H HB1  . ALA B 1 84  ? 3.592   -6.138  2.310   1.00 0.00 ? 84  ALA B HB1  2  
ATOM 6073  H HB2  . ALA B 1 84  ? 2.681   -7.446  3.068   1.00 0.00 ? 84  ALA B HB2  2  
ATOM 6074  H HB3  . ALA B 1 84  ? 2.575   -7.195  1.321   1.00 0.00 ? 84  ALA B HB3  2  
ATOM 6075  N N    . VAL B 1 85  ? 3.839   -9.076  -0.136  1.00 0.00 ? 85  VAL B N    2  
ATOM 6076  C CA   . VAL B 1 85  ? 3.386   -10.126 -1.036  1.00 0.00 ? 85  VAL B CA   2  
ATOM 6077  C C    . VAL B 1 85  ? 4.447   -11.191 -1.213  1.00 0.00 ? 85  VAL B C    2  
ATOM 6078  O O    . VAL B 1 85  ? 4.170   -12.296 -1.679  1.00 0.00 ? 85  VAL B O    2  
ATOM 6079  C CB   . VAL B 1 85  ? 2.959   -9.592  -2.424  1.00 0.00 ? 85  VAL B CB   2  
ATOM 6080  C CG1  . VAL B 1 85  ? 1.528   -10.002 -2.698  1.00 0.00 ? 85  VAL B CG1  2  
ATOM 6081  C CG2  . VAL B 1 85  ? 3.090   -8.078  -2.529  1.00 0.00 ? 85  VAL B CG2  2  
ATOM 6082  H H    . VAL B 1 85  ? 4.086   -8.203  -0.498  1.00 0.00 ? 85  VAL B H    2  
ATOM 6083  H HA   . VAL B 1 85  ? 2.533   -10.588 -0.580  1.00 0.00 ? 85  VAL B HA   2  
ATOM 6084  H HB   . VAL B 1 85  ? 3.596   -10.042 -3.174  1.00 0.00 ? 85  VAL B HB   2  
ATOM 6085  H HG11 . VAL B 1 85  ? 1.373   -11.015 -2.361  1.00 0.00 ? 85  VAL B HG11 2  
ATOM 6086  H HG12 . VAL B 1 85  ? 1.330   -9.939  -3.755  1.00 0.00 ? 85  VAL B HG12 2  
ATOM 6087  H HG13 . VAL B 1 85  ? 0.864   -9.339  -2.159  1.00 0.00 ? 85  VAL B HG13 2  
ATOM 6088  H HG21 . VAL B 1 85  ? 4.051   -7.771  -2.153  1.00 0.00 ? 85  VAL B HG21 2  
ATOM 6089  H HG22 . VAL B 1 85  ? 2.308   -7.607  -1.949  1.00 0.00 ? 85  VAL B HG22 2  
ATOM 6090  H HG23 . VAL B 1 85  ? 2.999   -7.782  -3.563  1.00 0.00 ? 85  VAL B HG23 2  
ATOM 6091  N N    . ALA B 1 86  ? 5.662   -10.844 -0.853  1.00 0.00 ? 86  ALA B N    2  
ATOM 6092  C CA   . ALA B 1 86  ? 6.778   -11.748 -0.977  1.00 0.00 ? 86  ALA B CA   2  
ATOM 6093  C C    . ALA B 1 86  ? 7.256   -12.237 0.385   1.00 0.00 ? 86  ALA B C    2  
ATOM 6094  O O    . ALA B 1 86  ? 8.365   -12.757 0.512   1.00 0.00 ? 86  ALA B O    2  
ATOM 6095  C CB   . ALA B 1 86  ? 7.879   -11.025 -1.703  1.00 0.00 ? 86  ALA B CB   2  
ATOM 6096  H H    . ALA B 1 86  ? 5.819   -9.945  -0.498  1.00 0.00 ? 86  ALA B H    2  
ATOM 6097  H HA   . ALA B 1 86  ? 6.473   -12.593 -1.575  1.00 0.00 ? 86  ALA B HA   2  
ATOM 6098  H HB1  . ALA B 1 86  ? 8.337   -11.685 -2.421  1.00 0.00 ? 86  ALA B HB1  2  
ATOM 6099  H HB2  . ALA B 1 86  ? 8.614   -10.691 -0.989  1.00 0.00 ? 86  ALA B HB2  2  
ATOM 6100  H HB3  . ALA B 1 86  ? 7.451   -10.171 -2.211  1.00 0.00 ? 86  ALA B HB3  2  
ATOM 6101  N N    . CYS B 1 87  ? 6.421   -12.061 1.403   1.00 0.00 ? 87  CYS B N    2  
ATOM 6102  C CA   . CYS B 1 87  ? 6.781   -12.484 2.751   1.00 0.00 ? 87  CYS B CA   2  
ATOM 6103  C C    . CYS B 1 87  ? 5.554   -12.688 3.641   1.00 0.00 ? 87  CYS B C    2  
ATOM 6104  O O    . CYS B 1 87  ? 5.550   -13.577 4.492   1.00 0.00 ? 87  CYS B O    2  
ATOM 6105  C CB   . CYS B 1 87  ? 7.719   -11.459 3.389   1.00 0.00 ? 87  CYS B CB   2  
ATOM 6106  S SG   . CYS B 1 87  ? 8.306   -11.921 5.036   1.00 0.00 ? 87  CYS B SG   2  
ATOM 6107  H H    . CYS B 1 87  ? 5.555   -11.637 1.246   1.00 0.00 ? 87  CYS B H    2  
ATOM 6108  H HA   . CYS B 1 87  ? 7.304   -13.425 2.668   1.00 0.00 ? 87  CYS B HA   2  
ATOM 6109  H HB2  . CYS B 1 87  ? 8.587   -11.332 2.757   1.00 0.00 ? 87  CYS B HB2  2  
ATOM 6110  H HB3  . CYS B 1 87  ? 7.203   -10.515 3.477   1.00 0.00 ? 87  CYS B HB3  2  
ATOM 6111  H HG   . CYS B 1 87  ? 9.260   -12.027 4.993   1.00 0.00 ? 87  CYS B HG   2  
ATOM 6112  N N    . HIS B 1 88  ? 4.523   -11.857 3.471   1.00 0.00 ? 88  HIS B N    2  
ATOM 6113  C CA   . HIS B 1 88  ? 3.327   -11.978 4.309   1.00 0.00 ? 88  HIS B CA   2  
ATOM 6114  C C    . HIS B 1 88  ? 2.059   -12.298 3.512   1.00 0.00 ? 88  HIS B C    2  
ATOM 6115  O O    . HIS B 1 88  ? 1.488   -13.377 3.663   1.00 0.00 ? 88  HIS B O    2  
ATOM 6116  C CB   . HIS B 1 88  ? 3.116   -10.698 5.117   1.00 0.00 ? 88  HIS B CB   2  
ATOM 6117  C CG   . HIS B 1 88  ? 3.674   -10.768 6.504   1.00 0.00 ? 88  HIS B CG   2  
ATOM 6118  N ND1  . HIS B 1 88  ? 4.836   -11.442 6.814   1.00 0.00 ? 88  HIS B ND1  2  
ATOM 6119  C CD2  . HIS B 1 88  ? 3.221   -10.247 7.670   1.00 0.00 ? 88  HIS B CD2  2  
ATOM 6120  C CE1  . HIS B 1 88  ? 5.072   -11.335 8.109   1.00 0.00 ? 88  HIS B CE1  2  
ATOM 6121  N NE2  . HIS B 1 88  ? 4.109   -10.614 8.651   1.00 0.00 ? 88  HIS B NE2  2  
ATOM 6122  H H    . HIS B 1 88  ? 4.575   -11.145 2.792   1.00 0.00 ? 88  HIS B H    2  
ATOM 6123  H HA   . HIS B 1 88  ? 3.500   -12.788 5.002   1.00 0.00 ? 88  HIS B HA   2  
ATOM 6124  H HB2  . HIS B 1 88  ? 3.591   -9.874  4.607   1.00 0.00 ? 88  HIS B HB2  2  
ATOM 6125  H HB3  . HIS B 1 88  ? 2.056   -10.505 5.195   1.00 0.00 ? 88  HIS B HB3  2  
ATOM 6126  H HD1  . HIS B 1 88  ? 5.402   -11.929 6.179   1.00 0.00 ? 88  HIS B HD1  2  
ATOM 6127  H HD2  . HIS B 1 88  ? 2.327   -9.653  7.802   1.00 0.00 ? 88  HIS B HD2  2  
ATOM 6128  H HE1  . HIS B 1 88  ? 5.913   -11.763 8.636   1.00 0.00 ? 88  HIS B HE1  2  
ATOM 6129  H HE2  . HIS B 1 88  ? 3.986   -10.466 9.612   1.00 0.00 ? 88  HIS B HE2  2  
ATOM 6130  N N    . GLU B 1 89  ? 1.605   -11.344 2.694   1.00 0.00 ? 89  GLU B N    2  
ATOM 6131  C CA   . GLU B 1 89  ? 0.379   -11.514 1.900   1.00 0.00 ? 89  GLU B CA   2  
ATOM 6132  C C    . GLU B 1 89  ? 0.211   -12.940 1.395   1.00 0.00 ? 89  GLU B C    2  
ATOM 6133  O O    . GLU B 1 89  ? 1.180   -13.690 1.273   1.00 0.00 ? 89  GLU B O    2  
ATOM 6134  C CB   . GLU B 1 89  ? 0.343   -10.548 0.713   1.00 0.00 ? 89  GLU B CB   2  
ATOM 6135  C CG   . GLU B 1 89  ? 0.756   -9.124  1.054   1.00 0.00 ? 89  GLU B CG   2  
ATOM 6136  C CD   . GLU B 1 89  ? -0.347  -8.115  0.797   1.00 0.00 ? 89  GLU B CD   2  
ATOM 6137  O OE1  . GLU B 1 89  ? -1.527  -8.523  0.750   1.00 0.00 ? 89  GLU B OE1  2  
ATOM 6138  O OE2  . GLU B 1 89  ? -0.031  -6.917  0.641   1.00 0.00 ? 89  GLU B OE2  2  
ATOM 6139  H H    . GLU B 1 89  ? 2.093   -10.497 2.638   1.00 0.00 ? 89  GLU B H    2  
ATOM 6140  H HA   . GLU B 1 89  ? -0.454  -11.291 2.547   1.00 0.00 ? 89  GLU B HA   2  
ATOM 6141  H HB2  . GLU B 1 89  ? 1.004   -10.918 -0.053  1.00 0.00 ? 89  GLU B HB2  2  
ATOM 6142  H HB3  . GLU B 1 89  ? -0.662  -10.522 0.320   1.00 0.00 ? 89  GLU B HB3  2  
ATOM 6143  H HG2  . GLU B 1 89  ? 1.024   -9.081  2.097   1.00 0.00 ? 89  GLU B HG2  2  
ATOM 6144  H HG3  . GLU B 1 89  ? 1.611   -8.858  0.451   1.00 0.00 ? 89  GLU B HG3  2  
ATOM 6145  N N    . SER B 1 90  ? -1.034  -13.306 1.110   1.00 0.00 ? 90  SER B N    2  
ATOM 6146  C CA   . SER B 1 90  ? -1.347  -14.640 0.625   1.00 0.00 ? 90  SER B CA   2  
ATOM 6147  C C    . SER B 1 90  ? -0.789  -14.861 -0.779  1.00 0.00 ? 90  SER B C    2  
ATOM 6148  O O    . SER B 1 90  ? -1.544  -15.019 -1.740  1.00 0.00 ? 90  SER B O    2  
ATOM 6149  C CB   . SER B 1 90  ? -2.860  -14.864 0.631   1.00 0.00 ? 90  SER B CB   2  
ATOM 6150  O OG   . SER B 1 90  ? -3.176  -16.214 0.924   1.00 0.00 ? 90  SER B OG   2  
ATOM 6151  H H    . SER B 1 90  ? -1.761  -12.660 1.235   1.00 0.00 ? 90  SER B H    2  
ATOM 6152  H HA   . SER B 1 90  ? -0.888  -15.344 1.300   1.00 0.00 ? 90  SER B HA   2  
ATOM 6153  H HB2  . SER B 1 90  ? -3.314  -14.231 1.379   1.00 0.00 ? 90  SER B HB2  2  
ATOM 6154  H HB3  . SER B 1 90  ? -3.263  -14.617 -0.341  1.00 0.00 ? 90  SER B HB3  2  
ATOM 6155  H HG   . SER B 1 90  ? -3.113  -16.359 1.871   1.00 0.00 ? 90  SER B HG   2  
ATOM 6156  N N    . PHE B 1 91  ? 0.534   -14.875 -0.890  1.00 0.00 ? 91  PHE B N    2  
ATOM 6157  C CA   . PHE B 1 91  ? 1.195   -15.078 -2.173  1.00 0.00 ? 91  PHE B CA   2  
ATOM 6158  C C    . PHE B 1 91  ? 2.449   -15.926 -2.005  1.00 0.00 ? 91  PHE B C    2  
ATOM 6159  O O    . PHE B 1 91  ? 2.659   -16.896 -2.733  1.00 0.00 ? 91  PHE B O    2  
ATOM 6160  C CB   . PHE B 1 91  ? 1.556   -13.734 -2.807  1.00 0.00 ? 91  PHE B CB   2  
ATOM 6161  C CG   . PHE B 1 91  ? 1.319   -13.688 -4.290  1.00 0.00 ? 91  PHE B CG   2  
ATOM 6162  C CD1  . PHE B 1 91  ? 1.916   -14.617 -5.128  1.00 0.00 ? 91  PHE B CD1  2  
ATOM 6163  C CD2  . PHE B 1 91  ? 0.502   -12.718 -4.845  1.00 0.00 ? 91  PHE B CD2  2  
ATOM 6164  C CE1  . PHE B 1 91  ? 1.702   -14.578 -6.492  1.00 0.00 ? 91  PHE B CE1  2  
ATOM 6165  C CE2  . PHE B 1 91  ? 0.283   -12.673 -6.209  1.00 0.00 ? 91  PHE B CE2  2  
ATOM 6166  C CZ   . PHE B 1 91  ? 0.885   -13.605 -7.034  1.00 0.00 ? 91  PHE B CZ   2  
ATOM 6167  H H    . PHE B 1 91  ? 1.082   -14.745 -0.087  1.00 0.00 ? 91  PHE B H    2  
ATOM 6168  H HA   . PHE B 1 91  ? 0.506   -15.599 -2.822  1.00 0.00 ? 91  PHE B HA   2  
ATOM 6169  H HB2  . PHE B 1 91  ? 0.962   -12.956 -2.352  1.00 0.00 ? 91  PHE B HB2  2  
ATOM 6170  H HB3  . PHE B 1 91  ? 2.603   -13.530 -2.631  1.00 0.00 ? 91  PHE B HB3  2  
ATOM 6171  H HD1  . PHE B 1 91  ? 2.556   -15.378 -4.705  1.00 0.00 ? 91  PHE B HD1  2  
ATOM 6172  H HD2  . PHE B 1 91  ? 0.032   -11.988 -4.201  1.00 0.00 ? 91  PHE B HD2  2  
ATOM 6173  H HE1  . PHE B 1 91  ? 2.173   -15.307 -7.135  1.00 0.00 ? 91  PHE B HE1  2  
ATOM 6174  H HE2  . PHE B 1 91  ? -0.357  -11.912 -6.630  1.00 0.00 ? 91  PHE B HE2  2  
ATOM 6175  H HZ   . PHE B 1 91  ? 0.715   -13.572 -8.100  1.00 0.00 ? 91  PHE B HZ   2  
ATOM 6176  N N    . VAL B 1 92  ? 3.281   -15.553 -1.038  1.00 0.00 ? 92  VAL B N    2  
ATOM 6177  C CA   . VAL B 1 92  ? 4.515   -16.278 -0.770  1.00 0.00 ? 92  VAL B CA   2  
ATOM 6178  C C    . VAL B 1 92  ? 4.228   -17.662 -0.193  1.00 0.00 ? 92  VAL B C    2  
ATOM 6179  O O    . VAL B 1 92  ? 5.039   -18.580 -0.319  1.00 0.00 ? 92  VAL B O    2  
ATOM 6180  C CB   . VAL B 1 92  ? 5.423   -15.500 0.203   1.00 0.00 ? 92  VAL B CB   2  
ATOM 6181  C CG1  . VAL B 1 92  ? 4.722   -15.282 1.535   1.00 0.00 ? 92  VAL B CG1  2  
ATOM 6182  C CG2  . VAL B 1 92  ? 6.747   -16.226 0.401   1.00 0.00 ? 92  VAL B CG2  2  
ATOM 6183  H H    . VAL B 1 92  ? 3.057   -14.772 -0.491  1.00 0.00 ? 92  VAL B H    2  
ATOM 6184  H HA   . VAL B 1 92  ? 5.041   -16.392 -1.706  1.00 0.00 ? 92  VAL B HA   2  
ATOM 6185  H HB   . VAL B 1 92  ? 5.632   -14.532 -0.229  1.00 0.00 ? 92  VAL B HB   2  
ATOM 6186  H HG11 . VAL B 1 92  ? 5.444   -15.343 2.337   1.00 0.00 ? 92  VAL B HG11 2  
ATOM 6187  H HG12 . VAL B 1 92  ? 3.966   -16.039 1.674   1.00 0.00 ? 92  VAL B HG12 2  
ATOM 6188  H HG13 . VAL B 1 92  ? 4.259   -14.306 1.543   1.00 0.00 ? 92  VAL B HG13 2  
ATOM 6189  H HG21 . VAL B 1 92  ? 6.910   -16.907 -0.421  1.00 0.00 ? 92  VAL B HG21 2  
ATOM 6190  H HG22 . VAL B 1 92  ? 6.719   -16.779 1.327   1.00 0.00 ? 92  VAL B HG22 2  
ATOM 6191  H HG23 . VAL B 1 92  ? 7.550   -15.505 0.436   1.00 0.00 ? 92  VAL B HG23 2  
ATOM 6192  N N    . LYS B 1 93  ? 3.068   -17.806 0.440   1.00 0.00 ? 93  LYS B N    2  
ATOM 6193  C CA   . LYS B 1 93  ? 2.673   -19.077 1.037   1.00 0.00 ? 93  LYS B CA   2  
ATOM 6194  C C    . LYS B 1 93  ? 2.155   -20.047 -0.023  1.00 0.00 ? 93  LYS B C    2  
ATOM 6195  O O    . LYS B 1 93  ? 2.134   -21.260 0.191   1.00 0.00 ? 93  LYS B O    2  
ATOM 6196  C CB   . LYS B 1 93  ? 1.602   -18.850 2.106   1.00 0.00 ? 93  LYS B CB   2  
ATOM 6197  C CG   . LYS B 1 93  ? 1.861   -19.607 3.398   1.00 0.00 ? 93  LYS B CG   2  
ATOM 6198  C CD   . LYS B 1 93  ? 0.577   -19.827 4.182   1.00 0.00 ? 93  LYS B CD   2  
ATOM 6199  C CE   . LYS B 1 93  ? 0.706   -20.996 5.146   1.00 0.00 ? 93  LYS B CE   2  
ATOM 6200  N NZ   . LYS B 1 93  ? -0.214  -20.859 6.309   1.00 0.00 ? 93  LYS B NZ   2  
ATOM 6201  H H    . LYS B 1 93  ? 2.463   -17.039 0.509   1.00 0.00 ? 93  LYS B H    2  
ATOM 6202  H HA   . LYS B 1 93  ? 3.546   -19.508 1.504   1.00 0.00 ? 93  LYS B HA   2  
ATOM 6203  H HB2  . LYS B 1 93  ? 1.558   -17.796 2.336   1.00 0.00 ? 93  LYS B HB2  2  
ATOM 6204  H HB3  . LYS B 1 93  ? 0.645   -19.164 1.715   1.00 0.00 ? 93  LYS B HB3  2  
ATOM 6205  H HG2  . LYS B 1 93  ? 2.294   -20.568 3.160   1.00 0.00 ? 93  LYS B HG2  2  
ATOM 6206  H HG3  . LYS B 1 93  ? 2.550   -19.040 4.005   1.00 0.00 ? 93  LYS B HG3  2  
ATOM 6207  H HD2  . LYS B 1 93  ? 0.353   -18.933 4.744   1.00 0.00 ? 93  LYS B HD2  2  
ATOM 6208  H HD3  . LYS B 1 93  ? -0.226  -20.030 3.489   1.00 0.00 ? 93  LYS B HD3  2  
ATOM 6209  H HE2  . LYS B 1 93  ? 0.472   -21.908 4.619   1.00 0.00 ? 93  LYS B HE2  2  
ATOM 6210  H HE3  . LYS B 1 93  ? 1.723   -21.038 5.505   1.00 0.00 ? 93  LYS B HE3  2  
ATOM 6211  H HZ1  . LYS B 1 93  ? 0.294   -20.447 7.119   1.00 0.00 ? 93  LYS B HZ1  2  
ATOM 6212  H HZ2  . LYS B 1 93  ? -0.583  -21.791 6.584   1.00 0.00 ? 93  LYS B HZ2  2  
ATOM 6213  H HZ3  . LYS B 1 93  ? -1.012  -20.240 6.063   1.00 0.00 ? 93  LYS B HZ3  2  
ATOM 6214  N N    . ALA B 1 94  ? 1.738   -19.509 -1.167  1.00 0.00 ? 94  ALA B N    2  
ATOM 6215  C CA   . ALA B 1 94  ? 1.222   -20.331 -2.254  1.00 0.00 ? 94  ALA B CA   2  
ATOM 6216  C C    . ALA B 1 94  ? 2.311   -20.648 -3.275  1.00 0.00 ? 94  ALA B C    2  
ATOM 6217  O O    . ALA B 1 94  ? 2.027   -20.861 -4.454  1.00 0.00 ? 94  ALA B O    2  
ATOM 6218  C CB   . ALA B 1 94  ? 0.050   -19.634 -2.929  1.00 0.00 ? 94  ALA B CB   2  
ATOM 6219  H H    . ALA B 1 94  ? 1.778   -18.537 -1.282  1.00 0.00 ? 94  ALA B H    2  
ATOM 6220  H HA   . ALA B 1 94  ? 0.862   -21.258 -1.829  1.00 0.00 ? 94  ALA B HA   2  
ATOM 6221  H HB1  . ALA B 1 94  ? -0.704  -20.365 -3.186  1.00 0.00 ? 94  ALA B HB1  2  
ATOM 6222  H HB2  . ALA B 1 94  ? 0.394   -19.142 -3.827  1.00 0.00 ? 94  ALA B HB2  2  
ATOM 6223  H HB3  . ALA B 1 94  ? -0.370  -18.903 -2.256  1.00 0.00 ? 94  ALA B HB3  2  
ATOM 6224  N N    . ALA B 1 95  ? 3.559   -20.679 -2.816  1.00 0.00 ? 95  ALA B N    2  
ATOM 6225  C CA   . ALA B 1 95  ? 4.688   -20.971 -3.692  1.00 0.00 ? 95  ALA B CA   2  
ATOM 6226  C C    . ALA B 1 95  ? 4.946   -22.475 -3.777  1.00 0.00 ? 95  ALA B C    2  
ATOM 6227  O O    . ALA B 1 95  ? 5.040   -23.034 -4.870  1.00 0.00 ? 95  ALA B O    2  
ATOM 6228  C CB   . ALA B 1 95  ? 5.933   -20.245 -3.205  1.00 0.00 ? 95  ALA B CB   2  
ATOM 6229  H H    . ALA B 1 95  ? 3.724   -20.502 -1.868  1.00 0.00 ? 95  ALA B H    2  
ATOM 6230  H HA   . ALA B 1 95  ? 4.448   -20.602 -4.677  1.00 0.00 ? 95  ALA B HA   2  
ATOM 6231  H HB1  . ALA B 1 95  ? 6.099   -19.366 -3.812  1.00 0.00 ? 95  ALA B HB1  2  
ATOM 6232  H HB2  . ALA B 1 95  ? 6.788   -20.902 -3.282  1.00 0.00 ? 95  ALA B HB2  2  
ATOM 6233  H HB3  . ALA B 1 95  ? 5.798   -19.949 -2.174  1.00 0.00 ? 95  ALA B HB3  2  
ATOM 6234  N N    . PRO B 1 96  ? 5.060   -23.153 -2.621  1.00 0.00 ? 96  PRO B N    2  
ATOM 6235  C CA   . PRO B 1 96  ? 5.306   -24.597 -2.570  1.00 0.00 ? 96  PRO B CA   2  
ATOM 6236  C C    . PRO B 1 96  ? 4.283   -25.403 -3.374  1.00 0.00 ? 96  PRO B C    2  
ATOM 6237  O O    . PRO B 1 96  ? 4.654   -26.295 -4.137  1.00 0.00 ? 96  PRO B O    2  
ATOM 6238  C CB   . PRO B 1 96  ? 5.196   -24.923 -1.078  1.00 0.00 ? 96  PRO B CB   2  
ATOM 6239  C CG   . PRO B 1 96  ? 5.531   -23.645 -0.395  1.00 0.00 ? 96  PRO B CG   2  
ATOM 6240  C CD   . PRO B 1 96  ? 4.958   -22.570 -1.270  1.00 0.00 ? 96  PRO B CD   2  
ATOM 6241  H HA   . PRO B 1 96  ? 6.300   -24.838 -2.920  1.00 0.00 ? 96  PRO B HA   2  
ATOM 6242  H HB2  . PRO B 1 96  ? 4.190   -25.239 -0.850  1.00 0.00 ? 96  PRO B HB2  2  
ATOM 6243  H HB3  . PRO B 1 96  ? 5.895   -25.703 -0.821  1.00 0.00 ? 96  PRO B HB3  2  
ATOM 6244  H HG2  . PRO B 1 96  ? 5.076   -23.620 0.584   1.00 0.00 ? 96  PRO B HG2  2  
ATOM 6245  H HG3  . PRO B 1 96  ? 6.602   -23.537 -0.318  1.00 0.00 ? 96  PRO B HG3  2  
ATOM 6246  H HD2  . PRO B 1 96  ? 3.928   -22.384 -1.006  1.00 0.00 ? 96  PRO B HD2  2  
ATOM 6247  H HD3  . PRO B 1 96  ? 5.542   -21.666 -1.192  1.00 0.00 ? 96  PRO B HD3  2  
ATOM 6248  N N    . PRO B 1 97  ? 2.977   -25.108 -3.218  1.00 0.00 ? 97  PRO B N    2  
ATOM 6249  C CA   . PRO B 1 97  ? 1.923   -25.825 -3.942  1.00 0.00 ? 97  PRO B CA   2  
ATOM 6250  C C    . PRO B 1 97  ? 1.863   -25.436 -5.414  1.00 0.00 ? 97  PRO B C    2  
ATOM 6251  O O    . PRO B 1 97  ? 1.555   -26.262 -6.273  1.00 0.00 ? 97  PRO B O    2  
ATOM 6252  C CB   . PRO B 1 97  ? 0.645   -25.399 -3.221  1.00 0.00 ? 97  PRO B CB   2  
ATOM 6253  C CG   . PRO B 1 97  ? 0.955   -24.052 -2.669  1.00 0.00 ? 97  PRO B CG   2  
ATOM 6254  C CD   . PRO B 1 97  ? 2.422   -24.064 -2.330  1.00 0.00 ? 97  PRO B CD   2  
ATOM 6255  H HA   . PRO B 1 97  ? 2.047   -26.895 -3.859  1.00 0.00 ? 97  PRO B HA   2  
ATOM 6256  H HB2  . PRO B 1 97  ? -0.173  -25.360 -3.926  1.00 0.00 ? 97  PRO B HB2  2  
ATOM 6257  H HB3  . PRO B 1 97  ? 0.418   -26.104 -2.436  1.00 0.00 ? 97  PRO B HB3  2  
ATOM 6258  H HG2  . PRO B 1 97  ? 0.748   -23.295 -3.410  1.00 0.00 ? 97  PRO B HG2  2  
ATOM 6259  H HG3  . PRO B 1 97  ? 0.368   -23.876 -1.779  1.00 0.00 ? 97  PRO B HG3  2  
ATOM 6260  H HD2  . PRO B 1 97  ? 2.861   -23.101 -2.545  1.00 0.00 ? 97  PRO B HD2  2  
ATOM 6261  H HD3  . PRO B 1 97  ? 2.566   -24.323 -1.292  1.00 0.00 ? 97  PRO B HD3  2  
ATOM 6262  N N    . GLN B 1 98  ? 2.159   -24.172 -5.700  1.00 0.00 ? 98  GLN B N    2  
ATOM 6263  C CA   . GLN B 1 98  ? 2.139   -23.675 -7.072  1.00 0.00 ? 98  GLN B CA   2  
ATOM 6264  C C    . GLN B 1 98  ? 3.384   -24.125 -7.829  1.00 0.00 ? 98  GLN B C    2  
ATOM 6265  O O    . GLN B 1 98  ? 4.497   -24.064 -7.306  1.00 0.00 ? 98  GLN B O    2  
ATOM 6266  C CB   . GLN B 1 98  ? 2.044   -22.148 -7.082  1.00 0.00 ? 98  GLN B CB   2  
ATOM 6267  C CG   . GLN B 1 98  ? 1.946   -21.555 -8.480  1.00 0.00 ? 98  GLN B CG   2  
ATOM 6268  C CD   . GLN B 1 98  ? 0.752   -20.635 -8.642  1.00 0.00 ? 98  GLN B CD   2  
ATOM 6269  O OE1  . GLN B 1 98  ? -0.251  -20.769 -7.941  1.00 0.00 ? 98  GLN B OE1  2  
ATOM 6270  N NE2  . GLN B 1 98  ? 0.855   -19.692 -9.571  1.00 0.00 ? 98  GLN B NE2  2  
ATOM 6271  H H    . GLN B 1 98  ? 2.397   -23.560 -4.973  1.00 0.00 ? 98  GLN B H    2  
ATOM 6272  H HA   . GLN B 1 98  ? 1.268   -24.085 -7.560  1.00 0.00 ? 98  GLN B HA   2  
ATOM 6273  H HB2  . GLN B 1 98  ? 1.168   -21.850 -6.525  1.00 0.00 ? 98  GLN B HB2  2  
ATOM 6274  H HB3  . GLN B 1 98  ? 2.921   -21.741 -6.603  1.00 0.00 ? 98  GLN B HB3  2  
ATOM 6275  H HG2  . GLN B 1 98  ? 2.845   -20.992 -8.681  1.00 0.00 ? 98  GLN B HG2  2  
ATOM 6276  H HG3  . GLN B 1 98  ? 1.861   -22.363 -9.193  1.00 0.00 ? 98  GLN B HG3  2  
ATOM 6277  H HE21 . GLN B 1 98  ? 1.688   -19.644 -10.094 1.00 0.00 ? 98  GLN B HE21 2  
ATOM 6278  H HE22 . GLN B 1 98  ? 0.094   -19.080 -9.697  1.00 0.00 ? 98  GLN B HE22 2  
ATOM 6279  N N    . LYS B 1 99  ? 3.189   -24.579 -9.063  1.00 0.00 ? 99  LYS B N    2  
ATOM 6280  C CA   . LYS B 1 99  ? 4.296   -25.041 -9.892  1.00 0.00 ? 99  LYS B CA   2  
ATOM 6281  C C    . LYS B 1 99  ? 4.503   -24.119 -11.089 1.00 0.00 ? 99  LYS B C    2  
ATOM 6282  O O    . LYS B 1 99  ? 3.576   -23.865 -11.857 1.00 0.00 ? 99  LYS B O    2  
ATOM 6283  C CB   . LYS B 1 99  ? 4.040   -26.470 -10.371 1.00 0.00 ? 99  LYS B CB   2  
ATOM 6284  C CG   . LYS B 1 99  ? 3.811   -27.459 -9.240  1.00 0.00 ? 99  LYS B CG   2  
ATOM 6285  C CD   . LYS B 1 99  ? 3.138   -28.728 -9.737  1.00 0.00 ? 99  LYS B CD   2  
ATOM 6286  C CE   . LYS B 1 99  ? 2.439   -29.466 -8.607  1.00 0.00 ? 99  LYS B CE   2  
ATOM 6287  N NZ   . LYS B 1 99  ? 1.374   -30.376 -9.112  1.00 0.00 ? 99  LYS B NZ   2  
ATOM 6288  H H    . LYS B 1 99  ? 2.278   -24.605 -9.424  1.00 0.00 ? 99  LYS B H    2  
ATOM 6289  H HA   . LYS B 1 99  ? 5.190   -25.029 -9.285  1.00 0.00 ? 99  LYS B HA   2  
ATOM 6290  H HB2  . LYS B 1 99  ? 3.165   -26.473 -11.005 1.00 0.00 ? 99  LYS B HB2  2  
ATOM 6291  H HB3  . LYS B 1 99  ? 4.891   -26.804 -10.946 1.00 0.00 ? 99  LYS B HB3  2  
ATOM 6292  H HG2  . LYS B 1 99  ? 4.764   -27.717 -8.802  1.00 0.00 ? 99  LYS B HG2  2  
ATOM 6293  H HG3  . LYS B 1 99  ? 3.183   -26.996 -8.493  1.00 0.00 ? 99  LYS B HG3  2  
ATOM 6294  H HD2  . LYS B 1 99  ? 2.407   -28.465 -10.487 1.00 0.00 ? 99  LYS B HD2  2  
ATOM 6295  H HD3  . LYS B 1 99  ? 3.885   -29.375 -10.170 1.00 0.00 ? 99  LYS B HD3  2  
ATOM 6296  H HE2  . LYS B 1 99  ? 3.171   -30.049 -8.068  1.00 0.00 ? 99  LYS B HE2  2  
ATOM 6297  H HE3  . LYS B 1 99  ? 1.996   -28.741 -7.939  1.00 0.00 ? 99  LYS B HE3  2  
ATOM 6298  H HZ1  . LYS B 1 99  ? 1.800   -31.180 -9.615  1.00 0.00 ? 99  LYS B HZ1  2  
ATOM 6299  H HZ2  . LYS B 1 99  ? 0.748   -29.864 -9.766  1.00 0.00 ? 99  LYS B HZ2  2  
ATOM 6300  H HZ3  . LYS B 1 99  ? 0.807   -30.737 -8.318  1.00 0.00 ? 99  LYS B HZ3  2  
ATOM 6301  N N    . ARG B 1 100 ? 5.727   -23.622 -11.240 1.00 0.00 ? 100 ARG B N    2  
ATOM 6302  C CA   . ARG B 1 100 ? 6.057   -22.728 -12.344 1.00 0.00 ? 100 ARG B CA   2  
ATOM 6303  C C    . ARG B 1 100 ? 7.281   -23.229 -13.103 1.00 0.00 ? 100 ARG B C    2  
ATOM 6304  O O    . ARG B 1 100 ? 7.296   -23.250 -14.334 1.00 0.00 ? 100 ARG B O    2  
ATOM 6305  C CB   . ARG B 1 100 ? 6.311   -21.313 -11.823 1.00 0.00 ? 100 ARG B CB   2  
ATOM 6306  C CG   . ARG B 1 100 ? 7.426   -21.234 -10.793 1.00 0.00 ? 100 ARG B CG   2  
ATOM 6307  C CD   . ARG B 1 100 ? 7.218   -20.075 -9.833  1.00 0.00 ? 100 ARG B CD   2  
ATOM 6308  N NE   . ARG B 1 100 ? 8.483   -19.467 -9.425  1.00 0.00 ? 100 ARG B NE   2  
ATOM 6309  C CZ   . ARG B 1 100 ? 8.571   -18.373 -8.672  1.00 0.00 ? 100 ARG B CZ   2  
ATOM 6310  N NH1  . ARG B 1 100 ? 7.473   -17.764 -8.243  1.00 0.00 ? 100 ARG B NH1  2  
ATOM 6311  N NH2  . ARG B 1 100 ? 9.760   -17.886 -8.347  1.00 0.00 ? 100 ARG B NH2  2  
ATOM 6312  H H    . ARG B 1 100 ? 6.423   -23.862 -10.594 1.00 0.00 ? 100 ARG B H    2  
ATOM 6313  H HA   . ARG B 1 100 ? 5.214   -22.707 -13.019 1.00 0.00 ? 100 ARG B HA   2  
ATOM 6314  H HB2  . ARG B 1 100 ? 6.575   -20.676 -12.655 1.00 0.00 ? 100 ARG B HB2  2  
ATOM 6315  H HB3  . ARG B 1 100 ? 5.405   -20.940 -11.369 1.00 0.00 ? 100 ARG B HB3  2  
ATOM 6316  H HG2  . ARG B 1 100 ? 7.448   -22.156 -10.229 1.00 0.00 ? 100 ARG B HG2  2  
ATOM 6317  H HG3  . ARG B 1 100 ? 8.368   -21.102 -11.305 1.00 0.00 ? 100 ARG B HG3  2  
ATOM 6318  H HD2  . ARG B 1 100 ? 6.611   -19.326 -10.319 1.00 0.00 ? 100 ARG B HD2  2  
ATOM 6319  H HD3  . ARG B 1 100 ? 6.705   -20.439 -8.955  1.00 0.00 ? 100 ARG B HD3  2  
ATOM 6320  H HE   . ARG B 1 100 ? 9.310   -19.896 -9.728  1.00 0.00 ? 100 ARG B HE   2  
ATOM 6321  H HH11 . ARG B 1 100 ? 6.572   -18.126 -8.483  1.00 0.00 ? 100 ARG B HH11 2  
ATOM 6322  H HH12 . ARG B 1 100 ? 7.545   -16.942 -7.678  1.00 0.00 ? 100 ARG B HH12 2  
ATOM 6323  H HH22 . ARG B 1 100 ? 9.827   -17.065 -7.781  1.00 0.00 ? 100 ARG B HH22 2  
ATOM 6324  N N    . PHE B 1 101 ? 8.306   -23.634 -12.361 1.00 0.00 ? 101 PHE B N    2  
ATOM 6325  C CA   . PHE B 1 101 ? 9.536   -24.137 -12.963 1.00 0.00 ? 101 PHE B CA   2  
ATOM 6326  C C    . PHE B 1 101 ? 9.763   -25.599 -12.595 1.00 0.00 ? 101 PHE B C    2  
ATOM 6327  O O    . PHE B 1 101 ? 9.532   -25.956 -11.421 1.00 0.00 ? 101 PHE B O    2  
ATOM 6328  C CB   . PHE B 1 101 ? 10.731  -23.294 -12.512 1.00 0.00 ? 101 PHE B CB   2  
ATOM 6329  C CG   . PHE B 1 101 ? 11.865  -23.284 -13.497 1.00 0.00 ? 101 PHE B CG   2  
ATOM 6330  C CD1  . PHE B 1 101 ? 12.743  -24.352 -13.573 1.00 0.00 ? 101 PHE B CD1  2  
ATOM 6331  C CD2  . PHE B 1 101 ? 12.050  -22.206 -14.347 1.00 0.00 ? 101 PHE B CD2  2  
ATOM 6332  C CE1  . PHE B 1 101 ? 13.788  -24.345 -14.479 1.00 0.00 ? 101 PHE B CE1  2  
ATOM 6333  C CE2  . PHE B 1 101 ? 13.092  -22.192 -15.254 1.00 0.00 ? 101 PHE B CE2  2  
ATOM 6334  C CZ   . PHE B 1 101 ? 13.962  -23.264 -15.321 1.00 0.00 ? 101 PHE B CZ   2  
ATOM 6335  O OXT  . PHE B 1 101 ? 10.172  -26.376 -13.484 1.00 0.00 ? 101 PHE B OXT  2  
ATOM 6336  H H    . PHE B 1 101 ? 8.235   -23.594 -11.384 1.00 0.00 ? 101 PHE B H    2  
ATOM 6337  H HA   . PHE B 1 101 ? 9.436   -24.059 -14.035 1.00 0.00 ? 101 PHE B HA   2  
ATOM 6338  H HB2  . PHE B 1 101 ? 10.409  -22.274 -12.366 1.00 0.00 ? 101 PHE B HB2  2  
ATOM 6339  H HB3  . PHE B 1 101 ? 11.105  -23.685 -11.577 1.00 0.00 ? 101 PHE B HB3  2  
ATOM 6340  H HD1  . PHE B 1 101 ? 12.608  -25.198 -12.916 1.00 0.00 ? 101 PHE B HD1  2  
ATOM 6341  H HD2  . PHE B 1 101 ? 11.371  -21.367 -14.296 1.00 0.00 ? 101 PHE B HD2  2  
ATOM 6342  H HE1  . PHE B 1 101 ? 14.466  -25.183 -14.528 1.00 0.00 ? 101 PHE B HE1  2  
ATOM 6343  H HE2  . PHE B 1 101 ? 13.227  -21.346 -15.912 1.00 0.00 ? 101 PHE B HE2  2  
ATOM 6344  H HZ   . PHE B 1 101 ? 14.777  -23.256 -16.029 1.00 0.00 ? 101 PHE B HZ   2  
ATOM 6345  N N    . SER A 1 1   ? 10.643  -10.674 20.297  1.00 0.00 ? 1   SER A N    3  
ATOM 6346  C CA   . SER A 1 1   ? 11.839  -9.796  20.387  1.00 0.00 ? 1   SER A CA   3  
ATOM 6347  C C    . SER A 1 1   ? 11.513  -8.374  19.941  1.00 0.00 ? 1   SER A C    3  
ATOM 6348  O O    . SER A 1 1   ? 12.311  -7.726  19.264  1.00 0.00 ? 1   SER A O    3  
ATOM 6349  C CB   . SER A 1 1   ? 12.943  -10.384 19.506  1.00 0.00 ? 1   SER A CB   3  
ATOM 6350  O OG   . SER A 1 1   ? 14.215  -9.876  19.872  1.00 0.00 ? 1   SER A OG   3  
ATOM 6351  H H1   . SER A 1 1   ? 10.008  -10.426 21.080  1.00 0.00 ? 1   SER A H1   3  
ATOM 6352  H H2   . SER A 1 1   ? 10.969  -11.660 20.373  1.00 0.00 ? 1   SER A H2   3  
ATOM 6353  H H3   . SER A 1 1   ? 10.190  -10.499 19.378  1.00 0.00 ? 1   SER A H3   3  
ATOM 6354  H HA   . SER A 1 1   ? 12.175  -9.776  21.413  1.00 0.00 ? 1   SER A HA   3  
ATOM 6355  H HB2  . SER A 1 1   ? 12.956  -11.458 19.616  1.00 0.00 ? 1   SER A HB2  3  
ATOM 6356  H HB3  . SER A 1 1   ? 12.752  -10.130 18.474  1.00 0.00 ? 1   SER A HB3  3  
ATOM 6357  H HG   . SER A 1 1   ? 14.478  -10.246 20.717  1.00 0.00 ? 1   SER A HG   3  
ATOM 6358  N N    . ARG A 1 2   ? 10.335  -7.895  20.326  1.00 0.00 ? 2   ARG A N    3  
ATOM 6359  C CA   . ARG A 1 2   ? 9.903   -6.549  19.968  1.00 0.00 ? 2   ARG A CA   3  
ATOM 6360  C C    . ARG A 1 2   ? 9.812   -6.393  18.450  1.00 0.00 ? 2   ARG A C    3  
ATOM 6361  O O    . ARG A 1 2   ? 10.831  -6.259  17.771  1.00 0.00 ? 2   ARG A O    3  
ATOM 6362  C CB   . ARG A 1 2   ? 10.872  -5.512  20.540  1.00 0.00 ? 2   ARG A CB   3  
ATOM 6363  C CG   . ARG A 1 2   ? 10.310  -4.099  20.555  1.00 0.00 ? 2   ARG A CG   3  
ATOM 6364  C CD   . ARG A 1 2   ? 11.272  -3.125  21.217  1.00 0.00 ? 2   ARG A CD   3  
ATOM 6365  N NE   . ARG A 1 2   ? 10.670  -1.807  21.409  1.00 0.00 ? 2   ARG A NE   3  
ATOM 6366  C CZ   . ARG A 1 2   ? 9.808   -1.520  22.381  1.00 0.00 ? 2   ARG A CZ   3  
ATOM 6367  N NH1  . ARG A 1 2   ? 9.444   -2.453  23.252  1.00 0.00 ? 2   ARG A NH1  3  
ATOM 6368  N NH2  . ARG A 1 2   ? 9.308   -0.296  22.483  1.00 0.00 ? 2   ARG A NH2  3  
ATOM 6369  H H    . ARG A 1 2   ? 9.742   -8.459  20.865  1.00 0.00 ? 2   ARG A H    3  
ATOM 6370  H HA   . ARG A 1 2   ? 8.926   -6.389  20.396  1.00 0.00 ? 2   ARG A HA   3  
ATOM 6371  H HB2  . ARG A 1 2   ? 11.119  -5.788  21.553  1.00 0.00 ? 2   ARG A HB2  3  
ATOM 6372  H HB3  . ARG A 1 2   ? 11.773  -5.511  19.944  1.00 0.00 ? 2   ARG A HB3  3  
ATOM 6373  H HG2  . ARG A 1 2   ? 10.135  -3.780  19.538  1.00 0.00 ? 2   ARG A HG2  3  
ATOM 6374  H HG3  . ARG A 1 2   ? 9.378   -4.099  21.100  1.00 0.00 ? 2   ARG A HG3  3  
ATOM 6375  H HD2  . ARG A 1 2   ? 11.559  -3.522  22.179  1.00 0.00 ? 2   ARG A HD2  3  
ATOM 6376  H HD3  . ARG A 1 2   ? 12.148  -3.024  20.594  1.00 0.00 ? 2   ARG A HD3  3  
ATOM 6377  H HE   . ARG A 1 2   ? 10.923  -1.099  20.780  1.00 0.00 ? 2   ARG A HE   3  
ATOM 6378  H HH11 . ARG A 1 2   ? 9.817   -3.378  23.180  1.00 0.00 ? 2   ARG A HH11 3  
ATOM 6379  H HH12 . ARG A 1 2   ? 8.795   -2.231  23.980  1.00 0.00 ? 2   ARG A HH12 3  
ATOM 6380  H HH22 . ARG A 1 2   ? 8.659   -0.081  23.213  1.00 0.00 ? 2   ARG A HH22 3  
ATOM 6381  N N    . PRO A 1 3   ? 8.587   -6.406  17.893  1.00 0.00 ? 3   PRO A N    3  
ATOM 6382  C CA   . PRO A 1 3   ? 8.366   -6.265  16.448  1.00 0.00 ? 3   PRO A CA   3  
ATOM 6383  C C    . PRO A 1 3   ? 8.885   -4.922  15.919  1.00 0.00 ? 3   PRO A C    3  
ATOM 6384  O O    . PRO A 1 3   ? 10.056  -4.594  16.107  1.00 0.00 ? 3   PRO A O    3  
ATOM 6385  C CB   . PRO A 1 3   ? 6.834   -6.384  16.324  1.00 0.00 ? 3   PRO A CB   3  
ATOM 6386  C CG   . PRO A 1 3   ? 6.424   -7.113  17.548  1.00 0.00 ? 3   PRO A CG   3  
ATOM 6387  C CD   . PRO A 1 3   ? 7.314   -6.560  18.611  1.00 0.00 ? 3   PRO A CD   3  
ATOM 6388  H HA   . PRO A 1 3   ? 8.837   -7.069  15.900  1.00 0.00 ? 3   PRO A HA   3  
ATOM 6389  H HB2  . PRO A 1 3   ? 6.393   -5.400  16.297  1.00 0.00 ? 3   PRO A HB2  3  
ATOM 6390  H HB3  . PRO A 1 3   ? 6.577   -6.931  15.431  1.00 0.00 ? 3   PRO A HB3  3  
ATOM 6391  H HG2  . PRO A 1 3   ? 5.386   -6.913  17.773  1.00 0.00 ? 3   PRO A HG2  3  
ATOM 6392  H HG3  . PRO A 1 3   ? 6.593   -8.172  17.427  1.00 0.00 ? 3   PRO A HG3  3  
ATOM 6393  H HD2  . PRO A 1 3   ? 6.942   -5.602  18.945  1.00 0.00 ? 3   PRO A HD2  3  
ATOM 6394  H HD3  . PRO A 1 3   ? 7.408   -7.249  19.435  1.00 0.00 ? 3   PRO A HD3  3  
ATOM 6395  N N    . THR A 1 4   ? 8.026   -4.147  15.259  1.00 0.00 ? 4   THR A N    3  
ATOM 6396  C CA   . THR A 1 4   ? 8.429   -2.854  14.719  1.00 0.00 ? 4   THR A CA   3  
ATOM 6397  C C    . THR A 1 4   ? 7.229   -2.071  14.210  1.00 0.00 ? 4   THR A C    3  
ATOM 6398  O O    . THR A 1 4   ? 6.281   -2.635  13.667  1.00 0.00 ? 4   THR A O    3  
ATOM 6399  C CB   . THR A 1 4   ? 9.467   -3.030  13.602  1.00 0.00 ? 4   THR A CB   3  
ATOM 6400  O OG1  . THR A 1 4   ? 9.491   -1.895  12.755  1.00 0.00 ? 4   THR A OG1  3  
ATOM 6401  C CG2  . THR A 1 4   ? 9.227   -4.246  12.731  1.00 0.00 ? 4   THR A CG2  3  
ATOM 6402  H H    . THR A 1 4   ? 7.104   -4.448  15.133  1.00 0.00 ? 4   THR A H    3  
ATOM 6403  H HA   . THR A 1 4   ? 8.876   -2.287  15.519  1.00 0.00 ? 4   THR A HA   3  
ATOM 6404  H HB   . THR A 1 4   ? 10.444  -3.135  14.052  1.00 0.00 ? 4   THR A HB   3  
ATOM 6405  H HG1  . THR A 1 4   ? 10.154  -2.020  12.071  1.00 0.00 ? 4   THR A HG1  3  
ATOM 6406  H HG21 . THR A 1 4   ? 8.895   -5.070  13.343  1.00 0.00 ? 4   THR A HG21 3  
ATOM 6407  H HG22 . THR A 1 4   ? 10.146  -4.516  12.231  1.00 0.00 ? 4   THR A HG22 3  
ATOM 6408  H HG23 . THR A 1 4   ? 8.472   -4.017  11.994  1.00 0.00 ? 4   THR A HG23 3  
ATOM 6409  N N    . GLU A 1 5   ? 7.289   -0.758  14.398  1.00 0.00 ? 5   GLU A N    3  
ATOM 6410  C CA   . GLU A 1 5   ? 6.227   0.139   13.970  1.00 0.00 ? 5   GLU A CA   3  
ATOM 6411  C C    . GLU A 1 5   ? 5.758   -0.204  12.559  1.00 0.00 ? 5   GLU A C    3  
ATOM 6412  O O    . GLU A 1 5   ? 4.560   -0.215  12.276  1.00 0.00 ? 5   GLU A O    3  
ATOM 6413  C CB   . GLU A 1 5   ? 6.734   1.575   14.028  1.00 0.00 ? 5   GLU A CB   3  
ATOM 6414  C CG   . GLU A 1 5   ? 5.708   2.566   14.553  1.00 0.00 ? 5   GLU A CG   3  
ATOM 6415  C CD   . GLU A 1 5   ? 5.084   3.398   13.450  1.00 0.00 ? 5   GLU A CD   3  
ATOM 6416  O OE1  . GLU A 1 5   ? 5.797   4.240   12.866  1.00 0.00 ? 5   GLU A OE1  3  
ATOM 6417  O OE2  . GLU A 1 5   ? 3.882   3.208   13.170  1.00 0.00 ? 5   GLU A OE2  3  
ATOM 6418  H H    . GLU A 1 5   ? 8.078   -0.380  14.839  1.00 0.00 ? 5   GLU A H    3  
ATOM 6419  H HA   . GLU A 1 5   ? 5.399   0.029   14.653  1.00 0.00 ? 5   GLU A HA   3  
ATOM 6420  H HB2  . GLU A 1 5   ? 7.599   1.602   14.676  1.00 0.00 ? 5   GLU A HB2  3  
ATOM 6421  H HB3  . GLU A 1 5   ? 7.028   1.881   13.035  1.00 0.00 ? 5   GLU A HB3  3  
ATOM 6422  H HG2  . GLU A 1 5   ? 4.925   2.020   15.058  1.00 0.00 ? 5   GLU A HG2  3  
ATOM 6423  H HG3  . GLU A 1 5   ? 6.193   3.229   15.254  1.00 0.00 ? 5   GLU A HG3  3  
ATOM 6424  N N    . THR A 1 6   ? 6.712   -0.501  11.686  1.00 0.00 ? 6   THR A N    3  
ATOM 6425  C CA   . THR A 1 6   ? 6.404   -0.866  10.312  1.00 0.00 ? 6   THR A CA   3  
ATOM 6426  C C    . THR A 1 6   ? 5.697   -2.214  10.276  1.00 0.00 ? 6   THR A C    3  
ATOM 6427  O O    . THR A 1 6   ? 4.766   -2.421  9.504   1.00 0.00 ? 6   THR A O    3  
ATOM 6428  C CB   . THR A 1 6   ? 7.686   -0.929  9.483   1.00 0.00 ? 6   THR A CB   3  
ATOM 6429  O OG1  . THR A 1 6   ? 8.647   -0.015  9.977   1.00 0.00 ? 6   THR A OG1  3  
ATOM 6430  C CG2  . THR A 1 6   ? 7.466   -0.620  8.019   1.00 0.00 ? 6   THR A CG2  3  
ATOM 6431  H H    . THR A 1 6   ? 7.647   -0.487  11.978  1.00 0.00 ? 6   THR A H    3  
ATOM 6432  H HA   . THR A 1 6   ? 5.748   -0.113  9.896   1.00 0.00 ? 6   THR A HA   3  
ATOM 6433  H HB   . THR A 1 6   ? 8.098   -1.925  9.552   1.00 0.00 ? 6   THR A HB   3  
ATOM 6434  H HG1  . THR A 1 6   ? 8.254   0.859   10.041  1.00 0.00 ? 6   THR A HG1  3  
ATOM 6435  H HG21 . THR A 1 6   ? 7.019   -1.474  7.536   1.00 0.00 ? 6   THR A HG21 3  
ATOM 6436  H HG22 . THR A 1 6   ? 8.413   -0.397  7.553   1.00 0.00 ? 6   THR A HG22 3  
ATOM 6437  H HG23 . THR A 1 6   ? 6.810   0.230   7.926   1.00 0.00 ? 6   THR A HG23 3  
ATOM 6438  N N    . GLU A 1 7   ? 6.138   -3.127  11.133  1.00 0.00 ? 7   GLU A N    3  
ATOM 6439  C CA   . GLU A 1 7   ? 5.545   -4.459  11.198  1.00 0.00 ? 7   GLU A CA   3  
ATOM 6440  C C    . GLU A 1 7   ? 4.029   -4.361  11.334  1.00 0.00 ? 7   GLU A C    3  
ATOM 6441  O O    . GLU A 1 7   ? 3.294   -5.193  10.805  1.00 0.00 ? 7   GLU A O    3  
ATOM 6442  C CB   . GLU A 1 7   ? 6.129   -5.242  12.379  1.00 0.00 ? 7   GLU A CB   3  
ATOM 6443  C CG   . GLU A 1 7   ? 6.875   -6.499  11.963  1.00 0.00 ? 7   GLU A CG   3  
ATOM 6444  C CD   . GLU A 1 7   ? 6.323   -7.751  12.617  1.00 0.00 ? 7   GLU A CD   3  
ATOM 6445  O OE1  . GLU A 1 7   ? 5.104   -7.794  12.883  1.00 0.00 ? 7   GLU A OE1  3  
ATOM 6446  O OE2  . GLU A 1 7   ? 7.111   -8.689  12.865  1.00 0.00 ? 7   GLU A OE2  3  
ATOM 6447  H H    . GLU A 1 7   ? 6.879   -2.900  11.730  1.00 0.00 ? 7   GLU A H    3  
ATOM 6448  H HA   . GLU A 1 7   ? 5.782   -4.974  10.280  1.00 0.00 ? 7   GLU A HA   3  
ATOM 6449  H HB2  . GLU A 1 7   ? 6.816   -4.604  12.918  1.00 0.00 ? 7   GLU A HB2  3  
ATOM 6450  H HB3  . GLU A 1 7   ? 5.326   -5.529  13.041  1.00 0.00 ? 7   GLU A HB3  3  
ATOM 6451  H HG2  . GLU A 1 7   ? 6.797   -6.610  10.891  1.00 0.00 ? 7   GLU A HG2  3  
ATOM 6452  H HG3  . GLU A 1 7   ? 7.915   -6.395  12.237  1.00 0.00 ? 7   GLU A HG3  3  
ATOM 6453  N N    . ARG A 1 8   ? 3.571   -3.326  12.026  1.00 0.00 ? 8   ARG A N    3  
ATOM 6454  C CA   . ARG A 1 8   ? 2.144   -3.104  12.206  1.00 0.00 ? 8   ARG A CA   3  
ATOM 6455  C C    . ARG A 1 8   ? 1.540   -2.461  10.960  1.00 0.00 ? 8   ARG A C    3  
ATOM 6456  O O    . ARG A 1 8   ? 0.352   -2.624  10.679  1.00 0.00 ? 8   ARG A O    3  
ATOM 6457  C CB   . ARG A 1 8   ? 1.891   -2.218  13.428  1.00 0.00 ? 8   ARG A CB   3  
ATOM 6458  C CG   . ARG A 1 8   ? 1.759   -2.996  14.728  1.00 0.00 ? 8   ARG A CG   3  
ATOM 6459  C CD   . ARG A 1 8   ? 2.996   -2.844  15.600  1.00 0.00 ? 8   ARG A CD   3  
ATOM 6460  N NE   . ARG A 1 8   ? 2.670   -2.884  17.024  1.00 0.00 ? 8   ARG A NE   3  
ATOM 6461  C CZ   . ARG A 1 8   ? 2.440   -4.007  17.700  1.00 0.00 ? 8   ARG A CZ   3  
ATOM 6462  N NH1  . ARG A 1 8   ? 2.494   -5.182  17.086  1.00 0.00 ? 8   ARG A NH1  3  
ATOM 6463  N NH2  . ARG A 1 8   ? 2.155   -3.954  18.994  1.00 0.00 ? 8   ARG A NH2  3  
ATOM 6464  H H    . ARG A 1 8   ? 4.208   -2.687  12.410  1.00 0.00 ? 8   ARG A H    3  
ATOM 6465  H HA   . ARG A 1 8   ? 1.676   -4.065  12.364  1.00 0.00 ? 8   ARG A HA   3  
ATOM 6466  H HB2  . ARG A 1 8   ? 2.711   -1.522  13.530  1.00 0.00 ? 8   ARG A HB2  3  
ATOM 6467  H HB3  . ARG A 1 8   ? 0.978   -1.664  13.272  1.00 0.00 ? 8   ARG A HB3  3  
ATOM 6468  H HG2  . ARG A 1 8   ? 0.902   -2.628  15.271  1.00 0.00 ? 8   ARG A HG2  3  
ATOM 6469  H HG3  . ARG A 1 8   ? 1.619   -4.042  14.497  1.00 0.00 ? 8   ARG A HG3  3  
ATOM 6470  H HD2  . ARG A 1 8   ? 3.680   -3.648  15.375  1.00 0.00 ? 8   ARG A HD2  3  
ATOM 6471  H HD3  . ARG A 1 8   ? 3.465   -1.898  15.373  1.00 0.00 ? 8   ARG A HD3  3  
ATOM 6472  H HE   . ARG A 1 8   ? 2.622   -2.030  17.501  1.00 0.00 ? 8   ARG A HE   3  
ATOM 6473  H HH11 . ARG A 1 8   ? 2.709   -5.229  16.112  1.00 0.00 ? 8   ARG A HH11 3  
ATOM 6474  H HH12 . ARG A 1 8   ? 2.320   -6.023  17.601  1.00 0.00 ? 8   ARG A HH12 3  
ATOM 6475  H HH22 . ARG A 1 8   ? 1.981   -4.798  19.503  1.00 0.00 ? 8   ARG A HH22 3  
ATOM 6476  N N    . CYS A 1 9   ? 2.367   -1.723  10.217  1.00 0.00 ? 9   CYS A N    3  
ATOM 6477  C CA   . CYS A 1 9   ? 1.914   -1.048  9.004   1.00 0.00 ? 9   CYS A CA   3  
ATOM 6478  C C    . CYS A 1 9   ? 1.590   -2.052  7.900   1.00 0.00 ? 9   CYS A C    3  
ATOM 6479  O O    . CYS A 1 9   ? 0.563   -1.941  7.230   1.00 0.00 ? 9   CYS A O    3  
ATOM 6480  C CB   . CYS A 1 9   ? 2.969   -0.029  8.526   1.00 0.00 ? 9   CYS A CB   3  
ATOM 6481  S SG   . CYS A 1 9   ? 4.255   -0.686  7.431   1.00 0.00 ? 9   CYS A SG   3  
ATOM 6482  H H    . CYS A 1 9   ? 3.301   -1.626  10.495  1.00 0.00 ? 9   CYS A H    3  
ATOM 6483  H HA   . CYS A 1 9   ? 1.008   -0.514  9.252   1.00 0.00 ? 9   CYS A HA   3  
ATOM 6484  H HB2  . CYS A 1 9   ? 2.470   0.762   7.991   1.00 0.00 ? 9   CYS A HB2  3  
ATOM 6485  H HB3  . CYS A 1 9   ? 3.461   0.391   9.392   1.00 0.00 ? 9   CYS A HB3  3  
ATOM 6486  H HG   . CYS A 1 9   ? 4.953   -0.032  7.369   1.00 0.00 ? 9   CYS A HG   3  
ATOM 6487  N N    . ILE A 1 10  ? 2.472   -3.027  7.712   1.00 0.00 ? 10  ILE A N    3  
ATOM 6488  C CA   . ILE A 1 10  ? 2.278   -4.038  6.687   1.00 0.00 ? 10  ILE A CA   3  
ATOM 6489  C C    . ILE A 1 10  ? 1.071   -4.915  6.990   1.00 0.00 ? 10  ILE A C    3  
ATOM 6490  O O    . ILE A 1 10  ? 0.161   -5.033  6.175   1.00 0.00 ? 10  ILE A O    3  
ATOM 6491  C CB   . ILE A 1 10  ? 3.523   -4.934  6.547   1.00 0.00 ? 10  ILE A CB   3  
ATOM 6492  C CG1  . ILE A 1 10  ? 4.785   -4.083  6.436   1.00 0.00 ? 10  ILE A CG1  3  
ATOM 6493  C CG2  . ILE A 1 10  ? 3.390   -5.839  5.334   1.00 0.00 ? 10  ILE A CG2  3  
ATOM 6494  C CD1  . ILE A 1 10  ? 5.633   -4.084  7.683   1.00 0.00 ? 10  ILE A CD1  3  
ATOM 6495  H H    . ILE A 1 10  ? 3.273   -3.065  8.271   1.00 0.00 ? 10  ILE A H    3  
ATOM 6496  H HA   . ILE A 1 10  ? 2.117   -3.533  5.745   1.00 0.00 ? 10  ILE A HA   3  
ATOM 6497  H HB   . ILE A 1 10  ? 3.593   -5.557  7.425   1.00 0.00 ? 10  ILE A HB   3  
ATOM 6498  H HG12 . ILE A 1 10  ? 5.394   -4.458  5.631   1.00 0.00 ? 10  ILE A HG12 3  
ATOM 6499  H HG13 . ILE A 1 10  ? 4.506   -3.060  6.227   1.00 0.00 ? 10  ILE A HG13 3  
ATOM 6500  H HG21 . ILE A 1 10  ? 3.300   -6.864  5.659   1.00 0.00 ? 10  ILE A HG21 3  
ATOM 6501  H HG22 . ILE A 1 10  ? 4.267   -5.734  4.711   1.00 0.00 ? 10  ILE A HG22 3  
ATOM 6502  H HG23 . ILE A 1 10  ? 2.513   -5.559  4.771   1.00 0.00 ? 10  ILE A HG23 3  
ATOM 6503  H HD11 . ILE A 1 10  ? 6.018   -3.090  7.851   1.00 0.00 ? 10  ILE A HD11 3  
ATOM 6504  H HD12 . ILE A 1 10  ? 6.454   -4.774  7.560   1.00 0.00 ? 10  ILE A HD12 3  
ATOM 6505  H HD13 . ILE A 1 10  ? 5.031   -4.385  8.527   1.00 0.00 ? 10  ILE A HD13 3  
ATOM 6506  N N    . GLU A 1 11  ? 1.072   -5.536  8.165   1.00 0.00 ? 11  GLU A N    3  
ATOM 6507  C CA   . GLU A 1 11  ? -0.019  -6.418  8.567   1.00 0.00 ? 11  GLU A CA   3  
ATOM 6508  C C    . GLU A 1 11  ? -1.375  -5.736  8.427   1.00 0.00 ? 11  GLU A C    3  
ATOM 6509  O O    . GLU A 1 11  ? -2.396  -6.397  8.240   1.00 0.00 ? 11  GLU A O    3  
ATOM 6510  C CB   . GLU A 1 11  ? 0.184   -6.893  10.005  1.00 0.00 ? 11  GLU A CB   3  
ATOM 6511  C CG   . GLU A 1 11  ? 0.245   -8.406  10.131  1.00 0.00 ? 11  GLU A CG   3  
ATOM 6512  C CD   . GLU A 1 11  ? -0.657  -8.939  11.228  1.00 0.00 ? 11  GLU A CD   3  
ATOM 6513  O OE1  . GLU A 1 11  ? -1.825  -8.502  11.300  1.00 0.00 ? 11  GLU A OE1  3  
ATOM 6514  O OE2  . GLU A 1 11  ? -0.196  -9.794  12.012  1.00 0.00 ? 11  GLU A OE2  3  
ATOM 6515  H H    . GLU A 1 11  ? 1.830   -5.407  8.771   1.00 0.00 ? 11  GLU A H    3  
ATOM 6516  H HA   . GLU A 1 11  ? -0.001  -7.275  7.918   1.00 0.00 ? 11  GLU A HA   3  
ATOM 6517  H HB2  . GLU A 1 11  ? 1.109   -6.483  10.382  1.00 0.00 ? 11  GLU A HB2  3  
ATOM 6518  H HB3  . GLU A 1 11  ? -0.634  -6.535  10.613  1.00 0.00 ? 11  GLU A HB3  3  
ATOM 6519  H HG2  . GLU A 1 11  ? -0.058  -8.845  9.190   1.00 0.00 ? 11  GLU A HG2  3  
ATOM 6520  H HG3  . GLU A 1 11  ? 1.263   -8.693  10.350  1.00 0.00 ? 11  GLU A HG3  3  
ATOM 6521  N N    . SER A 1 12  ? -1.383  -4.416  8.532   1.00 0.00 ? 12  SER A N    3  
ATOM 6522  C CA   . SER A 1 12  ? -2.620  -3.655  8.430   1.00 0.00 ? 12  SER A CA   3  
ATOM 6523  C C    . SER A 1 12  ? -3.185  -3.664  7.006   1.00 0.00 ? 12  SER A C    3  
ATOM 6524  O O    . SER A 1 12  ? -4.338  -4.034  6.799   1.00 0.00 ? 12  SER A O    3  
ATOM 6525  C CB   . SER A 1 12  ? -2.382  -2.219  8.896   1.00 0.00 ? 12  SER A CB   3  
ATOM 6526  O OG   . SER A 1 12  ? -3.510  -1.714  9.589   1.00 0.00 ? 12  SER A OG   3  
ATOM 6527  H H    . SER A 1 12  ? -0.540  -3.941  8.691   1.00 0.00 ? 12  SER A H    3  
ATOM 6528  H HA   . SER A 1 12  ? -3.340  -4.116  9.088   1.00 0.00 ? 12  SER A HA   3  
ATOM 6529  H HB2  . SER A 1 12  ? -1.530  -2.196  9.560   1.00 0.00 ? 12  SER A HB2  3  
ATOM 6530  H HB3  . SER A 1 12  ? -2.186  -1.591  8.041   1.00 0.00 ? 12  SER A HB3  3  
ATOM 6531  H HG   . SER A 1 12  ? -3.712  -2.287  10.333  1.00 0.00 ? 12  SER A HG   3  
ATOM 6532  N N    . LEU A 1 13  ? -2.381  -3.242  6.030   1.00 0.00 ? 13  LEU A N    3  
ATOM 6533  C CA   . LEU A 1 13  ? -2.820  -3.183  4.639   1.00 0.00 ? 13  LEU A CA   3  
ATOM 6534  C C    . LEU A 1 13  ? -3.042  -4.569  4.021   1.00 0.00 ? 13  LEU A C    3  
ATOM 6535  O O    . LEU A 1 13  ? -3.848  -4.727  3.106   1.00 0.00 ? 13  LEU A O    3  
ATOM 6536  C CB   . LEU A 1 13  ? -1.814  -2.388  3.822   1.00 0.00 ? 13  LEU A CB   3  
ATOM 6537  C CG   . LEU A 1 13  ? -2.116  -0.894  3.732   1.00 0.00 ? 13  LEU A CG   3  
ATOM 6538  C CD1  . LEU A 1 13  ? -3.484  -0.661  3.115   1.00 0.00 ? 13  LEU A CD1  3  
ATOM 6539  C CD2  . LEU A 1 13  ? -2.051  -0.234  5.098   1.00 0.00 ? 13  LEU A CD2  3  
ATOM 6540  H H    . LEU A 1 13  ? -1.474  -2.938  6.249   1.00 0.00 ? 13  LEU A H    3  
ATOM 6541  H HA   . LEU A 1 13  ? -3.761  -2.654  4.624   1.00 0.00 ? 13  LEU A HA   3  
ATOM 6542  H HB2  . LEU A 1 13  ? -0.838  -2.515  4.267   1.00 0.00 ? 13  LEU A HB2  3  
ATOM 6543  H HB3  . LEU A 1 13  ? -1.794  -2.790  2.821   1.00 0.00 ? 13  LEU A HB3  3  
ATOM 6544  H HG   . LEU A 1 13  ? -1.377  -0.430  3.107   1.00 0.00 ? 13  LEU A HG   3  
ATOM 6545  H HD11 . LEU A 1 13  ? -4.195  -0.407  3.894   1.00 0.00 ? 13  LEU A HD11 3  
ATOM 6546  H HD12 . LEU A 1 13  ? -3.809  -1.558  2.609   1.00 0.00 ? 13  LEU A HD12 3  
ATOM 6547  H HD13 . LEU A 1 13  ? -3.422  0.152   2.407   1.00 0.00 ? 13  LEU A HD13 3  
ATOM 6548  H HD21 . LEU A 1 13  ? -2.120  -0.984  5.868   1.00 0.00 ? 13  LEU A HD21 3  
ATOM 6549  H HD22 . LEU A 1 13  ? -2.873  0.461   5.194   1.00 0.00 ? 13  LEU A HD22 3  
ATOM 6550  H HD23 . LEU A 1 13  ? -1.120  0.302   5.194   1.00 0.00 ? 13  LEU A HD23 3  
ATOM 6551  N N    . ILE A 1 14  ? -2.343  -5.572  4.513   1.00 0.00 ? 14  ILE A N    3  
ATOM 6552  C CA   . ILE A 1 14  ? -2.508  -6.916  3.997   1.00 0.00 ? 14  ILE A CA   3  
ATOM 6553  C C    . ILE A 1 14  ? -3.853  -7.471  4.375   1.00 0.00 ? 14  ILE A C    3  
ATOM 6554  O O    . ILE A 1 14  ? -4.447  -8.248  3.641   1.00 0.00 ? 14  ILE A O    3  
ATOM 6555  C CB   . ILE A 1 14  ? -1.488  -7.871  4.599   1.00 0.00 ? 14  ILE A CB   3  
ATOM 6556  C CG1  . ILE A 1 14  ? -0.091  -7.298  4.558   1.00 0.00 ? 14  ILE A CG1  3  
ATOM 6557  C CG2  . ILE A 1 14  ? -1.546  -9.199  3.894   1.00 0.00 ? 14  ILE A CG2  3  
ATOM 6558  C CD1  . ILE A 1 14  ? 0.754   -7.846  5.669   1.00 0.00 ? 14  ILE A CD1  3  
ATOM 6559  H H    . ILE A 1 14  ? -1.715  -5.419  5.240   1.00 0.00 ? 14  ILE A H    3  
ATOM 6560  H HA   . ILE A 1 14  ? -2.399  -6.916  2.930   1.00 0.00 ? 14  ILE A HA   3  
ATOM 6561  H HB   . ILE A 1 14  ? -1.763  -8.039  5.630   1.00 0.00 ? 14  ILE A HB   3  
ATOM 6562  H HG12 . ILE A 1 14  ? 0.376   -7.546  3.616   1.00 0.00 ? 14  ILE A HG12 3  
ATOM 6563  H HG13 . ILE A 1 14  ? -0.144  -6.230  4.668   1.00 0.00 ? 14  ILE A HG13 3  
ATOM 6564  H HG21 . ILE A 1 14  ? -2.231  -9.125  3.064   1.00 0.00 ? 14  ILE A HG21 3  
ATOM 6565  H HG22 . ILE A 1 14  ? -1.893  -9.949  4.588   1.00 0.00 ? 14  ILE A HG22 3  
ATOM 6566  H HG23 . ILE A 1 14  ? -0.564  -9.458  3.537   1.00 0.00 ? 14  ILE A HG23 3  
ATOM 6567  H HD11 . ILE A 1 14  ? 0.103   -8.225  6.447   1.00 0.00 ? 14  ILE A HD11 3  
ATOM 6568  H HD12 . ILE A 1 14  ? 1.380   -7.066  6.067   1.00 0.00 ? 14  ILE A HD12 3  
ATOM 6569  H HD13 . ILE A 1 14  ? 1.366   -8.648  5.292   1.00 0.00 ? 14  ILE A HD13 3  
ATOM 6570  N N    . ALA A 1 15  ? -4.281  -7.099  5.561   1.00 0.00 ? 15  ALA A N    3  
ATOM 6571  C CA   . ALA A 1 15  ? -5.515  -7.585  6.132   1.00 0.00 ? 15  ALA A CA   3  
ATOM 6572  C C    . ALA A 1 15  ? -6.739  -6.900  5.544   1.00 0.00 ? 15  ALA A C    3  
ATOM 6573  O O    . ALA A 1 15  ? -7.814  -7.495  5.473   1.00 0.00 ? 15  ALA A O    3  
ATOM 6574  C CB   . ALA A 1 15  ? -5.420  -7.411  7.632   1.00 0.00 ? 15  ALA A CB   3  
ATOM 6575  H H    . ALA A 1 15  ? -3.725  -6.494  6.091   1.00 0.00 ? 15  ALA A H    3  
ATOM 6576  H HA   . ALA A 1 15  ? -5.579  -8.644  5.925   1.00 0.00 ? 15  ALA A HA   3  
ATOM 6577  H HB1  . ALA A 1 15  ? -4.367  -7.389  7.910   1.00 0.00 ? 15  ALA A HB1  3  
ATOM 6578  H HB2  . ALA A 1 15  ? -5.908  -8.238  8.124   1.00 0.00 ? 15  ALA A HB2  3  
ATOM 6579  H HB3  . ALA A 1 15  ? -5.889  -6.484  7.921   1.00 0.00 ? 15  ALA A HB3  3  
ATOM 6580  N N    . VAL A 1 16  ? -6.576  -5.664  5.100   1.00 0.00 ? 16  VAL A N    3  
ATOM 6581  C CA   . VAL A 1 16  ? -7.670  -4.934  4.498   1.00 0.00 ? 16  VAL A CA   3  
ATOM 6582  C C    . VAL A 1 16  ? -8.118  -5.630  3.221   1.00 0.00 ? 16  VAL A C    3  
ATOM 6583  O O    . VAL A 1 16  ? -9.304  -5.656  2.892   1.00 0.00 ? 16  VAL A O    3  
ATOM 6584  C CB   . VAL A 1 16  ? -7.245  -3.494  4.158   1.00 0.00 ? 16  VAL A CB   3  
ATOM 6585  C CG1  . VAL A 1 16  ? -6.791  -2.766  5.391   1.00 0.00 ? 16  VAL A CG1  3  
ATOM 6586  C CG2  . VAL A 1 16  ? -6.123  -3.487  3.149   1.00 0.00 ? 16  VAL A CG2  3  
ATOM 6587  H H    . VAL A 1 16  ? -5.698  -5.237  5.161   1.00 0.00 ? 16  VAL A H    3  
ATOM 6588  H HA   . VAL A 1 16  ? -8.491  -4.900  5.199   1.00 0.00 ? 16  VAL A HA   3  
ATOM 6589  H HB   . VAL A 1 16  ? -8.085  -2.974  3.743   1.00 0.00 ? 16  VAL A HB   3  
ATOM 6590  H HG11 . VAL A 1 16  ? -7.645  -2.497  5.991   1.00 0.00 ? 16  VAL A HG11 3  
ATOM 6591  H HG12 . VAL A 1 16  ? -6.254  -1.872  5.094   1.00 0.00 ? 16  VAL A HG12 3  
ATOM 6592  H HG13 . VAL A 1 16  ? -6.138  -3.415  5.952   1.00 0.00 ? 16  VAL A HG13 3  
ATOM 6593  H HG21 . VAL A 1 16  ? -6.350  -4.161  2.346   1.00 0.00 ? 16  VAL A HG21 3  
ATOM 6594  H HG22 . VAL A 1 16  ? -5.218  -3.804  3.642   1.00 0.00 ? 16  VAL A HG22 3  
ATOM 6595  H HG23 . VAL A 1 16  ? -5.991  -2.488  2.760   1.00 0.00 ? 16  VAL A HG23 3  
ATOM 6596  N N    . PHE A 1 17  ? -7.145  -6.169  2.494   1.00 0.00 ? 17  PHE A N    3  
ATOM 6597  C CA   . PHE A 1 17  ? -7.425  -6.846  1.222   1.00 0.00 ? 17  PHE A CA   3  
ATOM 6598  C C    . PHE A 1 17  ? -7.927  -8.282  1.410   1.00 0.00 ? 17  PHE A C    3  
ATOM 6599  O O    . PHE A 1 17  ? -9.024  -8.618  0.969   1.00 0.00 ? 17  PHE A O    3  
ATOM 6600  C CB   . PHE A 1 17  ? -6.166  -6.833  0.338   1.00 0.00 ? 17  PHE A CB   3  
ATOM 6601  C CG   . PHE A 1 17  ? -5.860  -8.144  -0.339  1.00 0.00 ? 17  PHE A CG   3  
ATOM 6602  C CD1  . PHE A 1 17  ? -6.715  -8.658  -1.301  1.00 0.00 ? 17  PHE A CD1  3  
ATOM 6603  C CD2  . PHE A 1 17  ? -4.718  -8.858  -0.013  1.00 0.00 ? 17  PHE A CD2  3  
ATOM 6604  C CE1  . PHE A 1 17  ? -6.436  -9.861  -1.924  1.00 0.00 ? 17  PHE A CE1  3  
ATOM 6605  C CE2  . PHE A 1 17  ? -4.435  -10.060 -0.633  1.00 0.00 ? 17  PHE A CE2  3  
ATOM 6606  C CZ   . PHE A 1 17  ? -5.295  -10.562 -1.589  1.00 0.00 ? 17  PHE A CZ   3  
ATOM 6607  H H    . PHE A 1 17  ? -6.211  -6.086  2.812   1.00 0.00 ? 17  PHE A H    3  
ATOM 6608  H HA   . PHE A 1 17  ? -8.199  -6.283  0.721   1.00 0.00 ? 17  PHE A HA   3  
ATOM 6609  H HB2  . PHE A 1 17  ? -6.287  -6.089  -0.434  1.00 0.00 ? 17  PHE A HB2  3  
ATOM 6610  H HB3  . PHE A 1 17  ? -5.313  -6.570  0.948   1.00 0.00 ? 17  PHE A HB3  3  
ATOM 6611  H HD1  . PHE A 1 17  ? -7.608  -8.112  -1.564  1.00 0.00 ? 17  PHE A HD1  3  
ATOM 6612  H HD2  . PHE A 1 17  ? -4.044  -8.467  0.735   1.00 0.00 ? 17  PHE A HD2  3  
ATOM 6613  H HE1  . PHE A 1 17  ? -7.111  -10.251 -2.671  1.00 0.00 ? 17  PHE A HE1  3  
ATOM 6614  H HE2  . PHE A 1 17  ? -3.541  -10.607 -0.369  1.00 0.00 ? 17  PHE A HE2  3  
ATOM 6615  H HZ   . PHE A 1 17  ? -5.075  -11.502 -2.074  1.00 0.00 ? 17  PHE A HZ   3  
ATOM 6616  N N    . GLN A 1 18  ? -7.114  -9.127  2.040   1.00 0.00 ? 18  GLN A N    3  
ATOM 6617  C CA   . GLN A 1 18  ? -7.483  -10.531 2.242   1.00 0.00 ? 18  GLN A CA   3  
ATOM 6618  C C    . GLN A 1 18  ? -8.784  -10.684 3.015   1.00 0.00 ? 18  GLN A C    3  
ATOM 6619  O O    . GLN A 1 18  ? -9.478  -11.688 2.862   1.00 0.00 ? 18  GLN A O    3  
ATOM 6620  C CB   . GLN A 1 18  ? -6.372  -11.304 2.952   1.00 0.00 ? 18  GLN A CB   3  
ATOM 6621  C CG   . GLN A 1 18  ? -5.656  -10.507 4.019   1.00 0.00 ? 18  GLN A CG   3  
ATOM 6622  C CD   . GLN A 1 18  ? -4.243  -10.992 4.247   1.00 0.00 ? 18  GLN A CD   3  
ATOM 6623  O OE1  . GLN A 1 18  ? -3.844  -11.279 5.376   1.00 0.00 ? 18  GLN A OE1  3  
ATOM 6624  N NE2  . GLN A 1 18  ? -3.476  -11.087 3.168   1.00 0.00 ? 18  GLN A NE2  3  
ATOM 6625  H H    . GLN A 1 18  ? -6.240  -8.809  2.350   1.00 0.00 ? 18  GLN A H    3  
ATOM 6626  H HA   . GLN A 1 18  ? -7.621  -10.967 1.267   1.00 0.00 ? 18  GLN A HA   3  
ATOM 6627  H HB2  . GLN A 1 18  ? -6.801  -12.178 3.418   1.00 0.00 ? 18  GLN A HB2  3  
ATOM 6628  H HB3  . GLN A 1 18  ? -5.645  -11.619 2.220   1.00 0.00 ? 18  GLN A HB3  3  
ATOM 6629  H HG2  . GLN A 1 18  ? -5.618  -9.476  3.706   1.00 0.00 ? 18  GLN A HG2  3  
ATOM 6630  H HG3  . GLN A 1 18  ? -6.208  -10.584 4.941   1.00 0.00 ? 18  GLN A HG3  3  
ATOM 6631  H HE21 . GLN A 1 18  ? -3.866  -10.839 2.299   1.00 0.00 ? 18  GLN A HE21 3  
ATOM 6632  H HE22 . GLN A 1 18  ? -2.552  -11.394 3.283   1.00 0.00 ? 18  GLN A HE22 3  
ATOM 6633  N N    . LYS A 1 19  ? -9.126  -9.702  3.848   1.00 0.00 ? 19  LYS A N    3  
ATOM 6634  C CA   . LYS A 1 19  ? -10.361 -9.789  4.622   1.00 0.00 ? 19  LYS A CA   3  
ATOM 6635  C C    . LYS A 1 19  ? -11.528 -10.106 3.694   1.00 0.00 ? 19  LYS A C    3  
ATOM 6636  O O    . LYS A 1 19  ? -12.255 -11.077 3.901   1.00 0.00 ? 19  LYS A O    3  
ATOM 6637  C CB   . LYS A 1 19  ? -10.618 -8.476  5.367   1.00 0.00 ? 19  LYS A CB   3  
ATOM 6638  C CG   . LYS A 1 19  ? -11.914 -8.466  6.162   1.00 0.00 ? 19  LYS A CG   3  
ATOM 6639  C CD   . LYS A 1 19  ? -11.728 -9.081  7.540   1.00 0.00 ? 19  LYS A CD   3  
ATOM 6640  C CE   . LYS A 1 19  ? -10.715 -8.304  8.365   1.00 0.00 ? 19  LYS A CE   3  
ATOM 6641  N NZ   . LYS A 1 19  ? -10.915 -8.507  9.826   1.00 0.00 ? 19  LYS A NZ   3  
ATOM 6642  H H    . LYS A 1 19  ? -8.544  -8.920  3.944   1.00 0.00 ? 19  LYS A H    3  
ATOM 6643  H HA   . LYS A 1 19  ? -10.253 -10.591 5.338   1.00 0.00 ? 19  LYS A HA   3  
ATOM 6644  H HB2  . LYS A 1 19  ? -9.801  -8.299  6.051   1.00 0.00 ? 19  LYS A HB2  3  
ATOM 6645  H HB3  . LYS A 1 19  ? -10.656 -7.670  4.649   1.00 0.00 ? 19  LYS A HB3  3  
ATOM 6646  H HG2  . LYS A 1 19  ? -12.247 -7.446  6.276   1.00 0.00 ? 19  LYS A HG2  3  
ATOM 6647  H HG3  . LYS A 1 19  ? -12.660 -9.032  5.622   1.00 0.00 ? 19  LYS A HG3  3  
ATOM 6648  H HD2  . LYS A 1 19  ? -12.676 -9.076  8.056   1.00 0.00 ? 19  LYS A HD2  3  
ATOM 6649  H HD3  . LYS A 1 19  ? -11.383 -10.098 7.426   1.00 0.00 ? 19  LYS A HD3  3  
ATOM 6650  H HE2  . LYS A 1 19  ? -9.723  -8.634  8.097   1.00 0.00 ? 19  LYS A HE2  3  
ATOM 6651  H HE3  . LYS A 1 19  ? -10.816 -7.252  8.139   1.00 0.00 ? 19  LYS A HE3  3  
ATOM 6652  H HZ1  . LYS A 1 19  ? -11.395 -9.414  9.998   1.00 0.00 ? 19  LYS A HZ1  3  
ATOM 6653  H HZ2  . LYS A 1 19  ? -11.496 -7.740  10.218  1.00 0.00 ? 19  LYS A HZ2  3  
ATOM 6654  H HZ3  . LYS A 1 19  ? -9.997  -8.515  10.315  1.00 0.00 ? 19  LYS A HZ3  3  
ATOM 6655  N N    . TYR A 1 20  ? -11.662 -9.312  2.637   1.00 0.00 ? 20  TYR A N    3  
ATOM 6656  C CA   . TYR A 1 20  ? -12.692 -9.543  1.635   1.00 0.00 ? 20  TYR A CA   3  
ATOM 6657  C C    . TYR A 1 20  ? -12.227 -10.633 0.680   1.00 0.00 ? 20  TYR A C    3  
ATOM 6658  O O    . TYR A 1 20  ? -13.027 -11.375 0.108   1.00 0.00 ? 20  TYR A O    3  
ATOM 6659  C CB   . TYR A 1 20  ? -13.013 -8.254  0.878   1.00 0.00 ? 20  TYR A CB   3  
ATOM 6660  C CG   . TYR A 1 20  ? -14.244 -7.549  1.403   1.00 0.00 ? 20  TYR A CG   3  
ATOM 6661  C CD1  . TYR A 1 20  ? -14.236 -6.936  2.649   1.00 0.00 ? 20  TYR A CD1  3  
ATOM 6662  C CD2  . TYR A 1 20  ? -15.415 -7.503  0.657   1.00 0.00 ? 20  TYR A CD2  3  
ATOM 6663  C CE1  . TYR A 1 20  ? -15.359 -6.296  3.138   1.00 0.00 ? 20  TYR A CE1  3  
ATOM 6664  C CE2  . TYR A 1 20  ? -16.541 -6.864  1.139   1.00 0.00 ? 20  TYR A CE2  3  
ATOM 6665  C CZ   . TYR A 1 20  ? -16.508 -6.262  2.379   1.00 0.00 ? 20  TYR A CZ   3  
ATOM 6666  O OH   . TYR A 1 20  ? -17.629 -5.625  2.861   1.00 0.00 ? 20  TYR A OH   3  
ATOM 6667  H H    . TYR A 1 20  ? -11.016 -8.587  2.499   1.00 0.00 ? 20  TYR A H    3  
ATOM 6668  H HA   . TYR A 1 20  ? -13.580 -9.884  2.148   1.00 0.00 ? 20  TYR A HA   3  
ATOM 6669  H HB2  . TYR A 1 20  ? -12.178 -7.575  0.964   1.00 0.00 ? 20  TYR A HB2  3  
ATOM 6670  H HB3  . TYR A 1 20  ? -13.179 -8.486  -0.162  1.00 0.00 ? 20  TYR A HB3  3  
ATOM 6671  H HD1  . TYR A 1 20  ? -13.333 -6.963  3.242   1.00 0.00 ? 20  TYR A HD1  3  
ATOM 6672  H HD2  . TYR A 1 20  ? -15.438 -7.976  -0.313  1.00 0.00 ? 20  TYR A HD2  3  
ATOM 6673  H HE1  . TYR A 1 20  ? -15.332 -5.825  4.109   1.00 0.00 ? 20  TYR A HE1  3  
ATOM 6674  H HE2  . TYR A 1 20  ? -17.443 -6.838  0.543   1.00 0.00 ? 20  TYR A HE2  3  
ATOM 6675  H HH   . TYR A 1 20  ? -17.463 -4.681  2.912   1.00 0.00 ? 20  TYR A HH   3  
ATOM 6676  N N    . ALA A 1 21  ? -10.907 -10.698 0.516   1.00 0.00 ? 21  ALA A N    3  
ATOM 6677  C CA   . ALA A 1 21  ? -10.260 -11.658 -0.363  1.00 0.00 ? 21  ALA A CA   3  
ATOM 6678  C C    . ALA A 1 21  ? -10.063 -13.017 0.310   1.00 0.00 ? 21  ALA A C    3  
ATOM 6679  O O    . ALA A 1 21  ? -9.229  -13.813 -0.123  1.00 0.00 ? 21  ALA A O    3  
ATOM 6680  C CB   . ALA A 1 21  ? -8.922  -11.084 -0.806  1.00 0.00 ? 21  ALA A CB   3  
ATOM 6681  H H    . ALA A 1 21  ? -10.345 -10.062 1.002   1.00 0.00 ? 21  ALA A H    3  
ATOM 6682  H HA   . ALA A 1 21  ? -10.875 -11.786 -1.238  1.00 0.00 ? 21  ALA A HA   3  
ATOM 6683  H HB1  . ALA A 1 21  ? -8.602  -10.338 -0.088  1.00 0.00 ? 21  ALA A HB1  3  
ATOM 6684  H HB2  . ALA A 1 21  ? -9.028  -10.625 -1.781  1.00 0.00 ? 21  ALA A HB2  3  
ATOM 6685  H HB3  . ALA A 1 21  ? -8.187  -11.873 -0.855  1.00 0.00 ? 21  ALA A HB3  3  
ATOM 6686  N N    . GLY A 1 22  ? -10.827 -13.281 1.366   1.00 0.00 ? 22  GLY A N    3  
ATOM 6687  C CA   . GLY A 1 22  ? -10.709 -14.547 2.066   1.00 0.00 ? 22  GLY A CA   3  
ATOM 6688  C C    . GLY A 1 22  ? -9.660  -14.510 3.158   1.00 0.00 ? 22  GLY A C    3  
ATOM 6689  O O    . GLY A 1 22  ? -8.500  -14.186 2.904   1.00 0.00 ? 22  GLY A O    3  
ATOM 6690  H H    . GLY A 1 22  ? -11.476 -12.616 1.672   1.00 0.00 ? 22  GLY A H    3  
ATOM 6691  H HA2  . GLY A 1 22  ? -11.664 -14.792 2.507   1.00 0.00 ? 22  GLY A HA2  3  
ATOM 6692  H HA3  . GLY A 1 22  ? -10.446 -15.315 1.354   1.00 0.00 ? 22  GLY A HA3  3  
ATOM 6693  N N    . LYS A 1 23  ? -10.068 -14.845 4.378   1.00 0.00 ? 23  LYS A N    3  
ATOM 6694  C CA   . LYS A 1 23  ? -9.154  -14.850 5.515   1.00 0.00 ? 23  LYS A CA   3  
ATOM 6695  C C    . LYS A 1 23  ? -8.969  -16.265 6.056   1.00 0.00 ? 23  LYS A C    3  
ATOM 6696  O O    . LYS A 1 23  ? -8.741  -16.458 7.250   1.00 0.00 ? 23  LYS A O    3  
ATOM 6697  C CB   . LYS A 1 23  ? -9.678  -13.933 6.621   1.00 0.00 ? 23  LYS A CB   3  
ATOM 6698  C CG   . LYS A 1 23  ? -8.611  -13.512 7.618   1.00 0.00 ? 23  LYS A CG   3  
ATOM 6699  C CD   . LYS A 1 23  ? -7.722  -12.417 7.052   1.00 0.00 ? 23  LYS A CD   3  
ATOM 6700  C CE   . LYS A 1 23  ? -7.115  -11.565 8.156   1.00 0.00 ? 23  LYS A CE   3  
ATOM 6701  N NZ   . LYS A 1 23  ? -5.713  -11.170 7.846   1.00 0.00 ? 23  LYS A NZ   3  
ATOM 6702  H H    . LYS A 1 23  ? -11.005 -15.095 4.517   1.00 0.00 ? 23  LYS A H    3  
ATOM 6703  H HA   . LYS A 1 23  ? -8.199  -14.480 5.175   1.00 0.00 ? 23  LYS A HA   3  
ATOM 6704  H HB2  . LYS A 1 23  ? -10.091 -13.043 6.170   1.00 0.00 ? 23  LYS A HB2  3  
ATOM 6705  H HB3  . LYS A 1 23  ? -10.460 -14.448 7.160   1.00 0.00 ? 23  LYS A HB3  3  
ATOM 6706  H HG2  . LYS A 1 23  ? -9.092  -13.145 8.513   1.00 0.00 ? 23  LYS A HG2  3  
ATOM 6707  H HG3  . LYS A 1 23  ? -8.001  -14.370 7.861   1.00 0.00 ? 23  LYS A HG3  3  
ATOM 6708  H HD2  . LYS A 1 23  ? -6.924  -12.872 6.484   1.00 0.00 ? 23  LYS A HD2  3  
ATOM 6709  H HD3  . LYS A 1 23  ? -8.312  -11.785 6.405   1.00 0.00 ? 23  LYS A HD3  3  
ATOM 6710  H HE2  . LYS A 1 23  ? -7.713  -10.674 8.275   1.00 0.00 ? 23  LYS A HE2  3  
ATOM 6711  H HE3  . LYS A 1 23  ? -7.126  -12.131 9.076   1.00 0.00 ? 23  LYS A HE3  3  
ATOM 6712  H HZ1  . LYS A 1 23  ? -5.695  -10.218 7.426   1.00 0.00 ? 23  LYS A HZ1  3  
ATOM 6713  H HZ2  . LYS A 1 23  ? -5.292  -11.842 7.173   1.00 0.00 ? 23  LYS A HZ2  3  
ATOM 6714  H HZ3  . LYS A 1 23  ? -5.143  -11.164 8.715   1.00 0.00 ? 23  LYS A HZ3  3  
ATOM 6715  N N    . ASP A 1 24  ? -9.071  -17.250 5.170   1.00 0.00 ? 24  ASP A N    3  
ATOM 6716  C CA   . ASP A 1 24  ? -8.916  -18.648 5.557   1.00 0.00 ? 24  ASP A CA   3  
ATOM 6717  C C    . ASP A 1 24  ? -8.051  -19.399 4.552   1.00 0.00 ? 24  ASP A C    3  
ATOM 6718  O O    . ASP A 1 24  ? -7.097  -20.082 4.926   1.00 0.00 ? 24  ASP A O    3  
ATOM 6719  C CB   . ASP A 1 24  ? -10.285 -19.321 5.675   1.00 0.00 ? 24  ASP A CB   3  
ATOM 6720  C CG   . ASP A 1 24  ? -10.339 -20.325 6.811   1.00 0.00 ? 24  ASP A CG   3  
ATOM 6721  O OD1  . ASP A 1 24  ? -9.994  -19.950 7.951   1.00 0.00 ? 24  ASP A OD1  3  
ATOM 6722  O OD2  . ASP A 1 24  ? -10.727 -21.485 6.559   1.00 0.00 ? 24  ASP A OD2  3  
ATOM 6723  H H    . ASP A 1 24  ? -9.256  -17.033 4.232   1.00 0.00 ? 24  ASP A H    3  
ATOM 6724  H HA   . ASP A 1 24  ? -8.429  -18.671 6.521   1.00 0.00 ? 24  ASP A HA   3  
ATOM 6725  H HB2  . ASP A 1 24  ? -11.036 -18.566 5.851   1.00 0.00 ? 24  ASP A HB2  3  
ATOM 6726  H HB3  . ASP A 1 24  ? -10.506 -19.836 4.752   1.00 0.00 ? 24  ASP A HB3  3  
ATOM 6727  N N    . GLY A 1 25  ? -8.390  -19.269 3.273   1.00 0.00 ? 25  GLY A N    3  
ATOM 6728  C CA   . GLY A 1 25  ? -7.634  -19.942 2.234   1.00 0.00 ? 25  GLY A CA   3  
ATOM 6729  C C    . GLY A 1 25  ? -8.465  -20.217 0.997   1.00 0.00 ? 25  GLY A C    3  
ATOM 6730  O O    . GLY A 1 25  ? -8.811  -21.364 0.715   1.00 0.00 ? 25  GLY A O    3  
ATOM 6731  H H    . GLY A 1 25  ? -9.161  -18.713 3.034   1.00 0.00 ? 25  GLY A H    3  
ATOM 6732  H HA2  . GLY A 1 25  ? -6.793  -19.324 1.960   1.00 0.00 ? 25  GLY A HA2  3  
ATOM 6733  H HA3  . GLY A 1 25  ? -7.267  -20.881 2.622   1.00 0.00 ? 25  GLY A HA3  3  
ATOM 6734  N N    . HIS A 1 26  ? -8.784  -19.162 0.254   1.00 0.00 ? 26  HIS A N    3  
ATOM 6735  C CA   . HIS A 1 26  ? -9.579  -19.296 -0.962  1.00 0.00 ? 26  HIS A CA   3  
ATOM 6736  C C    . HIS A 1 26  ? -9.188  -18.235 -1.985  1.00 0.00 ? 26  HIS A C    3  
ATOM 6737  O O    . HIS A 1 26  ? -9.656  -17.098 -1.925  1.00 0.00 ? 26  HIS A O    3  
ATOM 6738  C CB   . HIS A 1 26  ? -11.069 -19.184 -0.636  1.00 0.00 ? 26  HIS A CB   3  
ATOM 6739  C CG   . HIS A 1 26  ? -11.943 -19.978 -1.556  1.00 0.00 ? 26  HIS A CG   3  
ATOM 6740  N ND1  . HIS A 1 26  ? -13.241 -20.325 -1.248  1.00 0.00 ? 26  HIS A ND1  3  
ATOM 6741  C CD2  . HIS A 1 26  ? -11.700 -20.494 -2.785  1.00 0.00 ? 26  HIS A CD2  3  
ATOM 6742  C CE1  . HIS A 1 26  ? -13.758 -21.021 -2.246  1.00 0.00 ? 26  HIS A CE1  3  
ATOM 6743  N NE2  . HIS A 1 26  ? -12.843 -21.137 -3.190  1.00 0.00 ? 26  HIS A NE2  3  
ATOM 6744  H H    . HIS A 1 26  ? -8.478  -18.273 0.529   1.00 0.00 ? 26  HIS A H    3  
ATOM 6745  H HA   . HIS A 1 26  ? -9.383  -20.271 -1.379  1.00 0.00 ? 26  HIS A HA   3  
ATOM 6746  H HB2  . HIS A 1 26  ? -11.239 -19.536 0.370   1.00 0.00 ? 26  HIS A HB2  3  
ATOM 6747  H HB3  . HIS A 1 26  ? -11.368 -18.148 -0.705  1.00 0.00 ? 26  HIS A HB3  3  
ATOM 6748  H HD1  . HIS A 1 26  ? -13.714 -20.097 -0.421  1.00 0.00 ? 26  HIS A HD1  3  
ATOM 6749  H HD2  . HIS A 1 26  ? -10.776 -20.415 -3.342  1.00 0.00 ? 26  HIS A HD2  3  
ATOM 6750  H HE1  . HIS A 1 26  ? -14.759 -21.425 -2.283  1.00 0.00 ? 26  HIS A HE1  3  
ATOM 6751  H HE2  . HIS A 1 26  ? -12.992 -21.530 -4.075  1.00 0.00 ? 26  HIS A HE2  3  
ATOM 6752  N N    . SER A 1 27  ? -8.328  -18.614 -2.925  1.00 0.00 ? 27  SER A N    3  
ATOM 6753  C CA   . SER A 1 27  ? -7.872  -17.697 -3.964  1.00 0.00 ? 27  SER A CA   3  
ATOM 6754  C C    . SER A 1 27  ? -7.118  -16.518 -3.358  1.00 0.00 ? 27  SER A C    3  
ATOM 6755  O O    . SER A 1 27  ? -7.418  -16.081 -2.247  1.00 0.00 ? 27  SER A O    3  
ATOM 6756  C CB   . SER A 1 27  ? -9.060  -17.191 -4.785  1.00 0.00 ? 27  SER A CB   3  
ATOM 6757  O OG   . SER A 1 27  ? -9.397  -18.106 -5.813  1.00 0.00 ? 27  SER A OG   3  
ATOM 6758  H H    . SER A 1 27  ? -7.991  -19.535 -2.920  1.00 0.00 ? 27  SER A H    3  
ATOM 6759  H HA   . SER A 1 27  ? -7.204  -18.240 -4.614  1.00 0.00 ? 27  SER A HA   3  
ATOM 6760  H HB2  . SER A 1 27  ? -9.915  -17.065 -4.139  1.00 0.00 ? 27  SER A HB2  3  
ATOM 6761  H HB3  . SER A 1 27  ? -8.806  -16.242 -5.233  1.00 0.00 ? 27  SER A HB3  3  
ATOM 6762  H HG   . SER A 1 27  ? -9.945  -18.806 -5.451  1.00 0.00 ? 27  SER A HG   3  
ATOM 6763  N N    . VAL A 1 28  ? -6.136  -16.009 -4.094  1.00 0.00 ? 28  VAL A N    3  
ATOM 6764  C CA   . VAL A 1 28  ? -5.338  -14.881 -3.628  1.00 0.00 ? 28  VAL A CA   3  
ATOM 6765  C C    . VAL A 1 28  ? -5.744  -13.591 -4.337  1.00 0.00 ? 28  VAL A C    3  
ATOM 6766  O O    . VAL A 1 28  ? -4.901  -12.752 -4.654  1.00 0.00 ? 28  VAL A O    3  
ATOM 6767  C CB   . VAL A 1 28  ? -3.833  -15.129 -3.850  1.00 0.00 ? 28  VAL A CB   3  
ATOM 6768  C CG1  . VAL A 1 28  ? -3.330  -16.234 -2.931  1.00 0.00 ? 28  VAL A CG1  3  
ATOM 6769  C CG2  . VAL A 1 28  ? -3.558  -15.471 -5.306  1.00 0.00 ? 28  VAL A CG2  3  
ATOM 6770  H H    . VAL A 1 28  ? -5.943  -16.401 -4.971  1.00 0.00 ? 28  VAL A H    3  
ATOM 6771  H HA   . VAL A 1 28  ? -5.510  -14.767 -2.568  1.00 0.00 ? 28  VAL A HA   3  
ATOM 6772  H HB   . VAL A 1 28  ? -3.300  -14.221 -3.609  1.00 0.00 ? 28  VAL A HB   3  
ATOM 6773  H HG11 . VAL A 1 28  ? -4.156  -16.865 -2.640  1.00 0.00 ? 28  VAL A HG11 3  
ATOM 6774  H HG12 . VAL A 1 28  ? -2.885  -15.794 -2.051  1.00 0.00 ? 28  VAL A HG12 3  
ATOM 6775  H HG13 . VAL A 1 28  ? -2.591  -16.826 -3.450  1.00 0.00 ? 28  VAL A HG13 3  
ATOM 6776  H HG21 . VAL A 1 28  ? -3.957  -14.693 -5.941  1.00 0.00 ? 28  VAL A HG21 3  
ATOM 6777  H HG22 . VAL A 1 28  ? -4.030  -16.411 -5.551  1.00 0.00 ? 28  VAL A HG22 3  
ATOM 6778  H HG23 . VAL A 1 28  ? -2.493  -15.551 -5.463  1.00 0.00 ? 28  VAL A HG23 3  
ATOM 6779  N N    . THR A 1 29  ? -7.043  -13.441 -4.580  1.00 0.00 ? 29  THR A N    3  
ATOM 6780  C CA   . THR A 1 29  ? -7.568  -12.257 -5.246  1.00 0.00 ? 29  THR A CA   3  
ATOM 6781  C C    . THR A 1 29  ? -8.948  -11.895 -4.713  1.00 0.00 ? 29  THR A C    3  
ATOM 6782  O O    . THR A 1 29  ? -9.651  -12.733 -4.149  1.00 0.00 ? 29  THR A O    3  
ATOM 6783  C CB   . THR A 1 29  ? -7.645  -12.481 -6.753  1.00 0.00 ? 29  THR A CB   3  
ATOM 6784  O OG1  . THR A 1 29  ? -8.136  -13.776 -7.048  1.00 0.00 ? 29  THR A OG1  3  
ATOM 6785  C CG2  . THR A 1 29  ? -6.313  -12.320 -7.446  1.00 0.00 ? 29  THR A CG2  3  
ATOM 6786  H H    . THR A 1 29  ? -7.665  -14.143 -4.301  1.00 0.00 ? 29  THR A H    3  
ATOM 6787  H HA   . THR A 1 29  ? -6.895  -11.436 -5.054  1.00 0.00 ? 29  THR A HA   3  
ATOM 6788  H HB   . THR A 1 29  ? -8.324  -11.754 -7.173  1.00 0.00 ? 29  THR A HB   3  
ATOM 6789  H HG1  . THR A 1 29  ? -8.367  -13.827 -7.978  1.00 0.00 ? 29  THR A HG1  3  
ATOM 6790  H HG21 . THR A 1 29  ? -6.049  -11.274 -7.475  1.00 0.00 ? 29  THR A HG21 3  
ATOM 6791  H HG22 . THR A 1 29  ? -6.383  -12.703 -8.453  1.00 0.00 ? 29  THR A HG22 3  
ATOM 6792  H HG23 . THR A 1 29  ? -5.557  -12.868 -6.903  1.00 0.00 ? 29  THR A HG23 3  
ATOM 6793  N N    . LEU A 1 30  ? -9.329  -10.640 -4.905  1.00 0.00 ? 30  LEU A N    3  
ATOM 6794  C CA   . LEU A 1 30  ? -10.628 -10.149 -4.458  1.00 0.00 ? 30  LEU A CA   3  
ATOM 6795  C C    . LEU A 1 30  ? -11.456 -9.702  -5.660  1.00 0.00 ? 30  LEU A C    3  
ATOM 6796  O O    . LEU A 1 30  ? -11.215 -10.145 -6.779  1.00 0.00 ? 30  LEU A O    3  
ATOM 6797  C CB   . LEU A 1 30  ? -10.441 -8.982  -3.472  1.00 0.00 ? 30  LEU A CB   3  
ATOM 6798  C CG   . LEU A 1 30  ? -11.451 -8.885  -2.309  1.00 0.00 ? 30  LEU A CG   3  
ATOM 6799  C CD1  . LEU A 1 30  ? -12.134 -7.526  -2.306  1.00 0.00 ? 30  LEU A CD1  3  
ATOM 6800  C CD2  . LEU A 1 30  ? -12.495 -9.993  -2.367  1.00 0.00 ? 30  LEU A CD2  3  
ATOM 6801  H H    . LEU A 1 30  ? -8.720  -10.027 -5.368  1.00 0.00 ? 30  LEU A H    3  
ATOM 6802  H HA   . LEU A 1 30  ? -11.135 -10.962 -3.963  1.00 0.00 ? 30  LEU A HA   3  
ATOM 6803  H HB2  . LEU A 1 30  ? -9.453  -9.064  -3.046  1.00 0.00 ? 30  LEU A HB2  3  
ATOM 6804  H HB3  . LEU A 1 30  ? -10.491 -8.062  -4.036  1.00 0.00 ? 30  LEU A HB3  3  
ATOM 6805  H HG   . LEU A 1 30  ? -10.913 -8.981  -1.374  1.00 0.00 ? 30  LEU A HG   3  
ATOM 6806  H HD11 . LEU A 1 30  ? -13.150 -7.634  -1.960  1.00 0.00 ? 30  LEU A HD11 3  
ATOM 6807  H HD12 . LEU A 1 30  ? -12.136 -7.119  -3.306  1.00 0.00 ? 30  LEU A HD12 3  
ATOM 6808  H HD13 . LEU A 1 30  ? -11.600 -6.860  -1.648  1.00 0.00 ? 30  LEU A HD13 3  
ATOM 6809  H HD21 . LEU A 1 30  ? -13.187 -9.879  -1.546  1.00 0.00 ? 30  LEU A HD21 3  
ATOM 6810  H HD22 . LEU A 1 30  ? -12.006 -10.952 -2.293  1.00 0.00 ? 30  LEU A HD22 3  
ATOM 6811  H HD23 . LEU A 1 30  ? -13.033 -9.934  -3.302  1.00 0.00 ? 30  LEU A HD23 3  
ATOM 6812  N N    . SER A 1 31  ? -12.414 -8.813  -5.436  1.00 0.00 ? 31  SER A N    3  
ATOM 6813  C CA   . SER A 1 31  ? -13.245 -8.309  -6.518  1.00 0.00 ? 31  SER A CA   3  
ATOM 6814  C C    . SER A 1 31  ? -13.453 -6.808  -6.376  1.00 0.00 ? 31  SER A C    3  
ATOM 6815  O O    . SER A 1 31  ? -13.705 -6.305  -5.282  1.00 0.00 ? 31  SER A O    3  
ATOM 6816  C CB   . SER A 1 31  ? -14.591 -9.035  -6.540  1.00 0.00 ? 31  SER A CB   3  
ATOM 6817  O OG   . SER A 1 31  ? -15.639 -8.174  -6.955  1.00 0.00 ? 31  SER A OG   3  
ATOM 6818  H H    . SER A 1 31  ? -12.559 -8.478  -4.531  1.00 0.00 ? 31  SER A H    3  
ATOM 6819  H HA   . SER A 1 31  ? -12.727 -8.500  -7.446  1.00 0.00 ? 31  SER A HA   3  
ATOM 6820  H HB2  . SER A 1 31  ? -14.536 -9.866  -7.226  1.00 0.00 ? 31  SER A HB2  3  
ATOM 6821  H HB3  . SER A 1 31  ? -14.814 -9.402  -5.549  1.00 0.00 ? 31  SER A HB3  3  
ATOM 6822  H HG   . SER A 1 31  ? -16.480 -8.521  -6.650  1.00 0.00 ? 31  SER A HG   3  
ATOM 6823  N N    . LYS A 1 32  ? -13.343 -6.099  -7.493  1.00 0.00 ? 32  LYS A N    3  
ATOM 6824  C CA   . LYS A 1 32  ? -13.517 -4.651  -7.500  1.00 0.00 ? 32  LYS A CA   3  
ATOM 6825  C C    . LYS A 1 32  ? -14.804 -4.260  -6.784  1.00 0.00 ? 32  LYS A C    3  
ATOM 6826  O O    . LYS A 1 32  ? -14.844 -3.271  -6.053  1.00 0.00 ? 32  LYS A O    3  
ATOM 6827  C CB   . LYS A 1 32  ? -13.546 -4.124  -8.937  1.00 0.00 ? 32  LYS A CB   3  
ATOM 6828  C CG   . LYS A 1 32  ? -12.296 -4.452  -9.737  1.00 0.00 ? 32  LYS A CG   3  
ATOM 6829  C CD   . LYS A 1 32  ? -12.481 -4.141  -11.214 1.00 0.00 ? 32  LYS A CD   3  
ATOM 6830  C CE   . LYS A 1 32  ? -12.595 -5.411  -12.044 1.00 0.00 ? 32  LYS A CE   3  
ATOM 6831  N NZ   . LYS A 1 32  ? -12.786 -5.113  -13.490 1.00 0.00 ? 32  LYS A NZ   3  
ATOM 6832  H H    . LYS A 1 32  ? -13.139 -6.561  -8.330  1.00 0.00 ? 32  LYS A H    3  
ATOM 6833  H HA   . LYS A 1 32  ? -12.679 -4.211  -6.980  1.00 0.00 ? 32  LYS A HA   3  
ATOM 6834  H HB2  . LYS A 1 32  ? -14.396 -4.553  -9.448  1.00 0.00 ? 32  LYS A HB2  3  
ATOM 6835  H HB3  . LYS A 1 32  ? -13.659 -3.050  -8.912  1.00 0.00 ? 32  LYS A HB3  3  
ATOM 6836  H HG2  . LYS A 1 32  ? -11.473 -3.866  -9.357  1.00 0.00 ? 32  LYS A HG2  3  
ATOM 6837  H HG3  . LYS A 1 32  ? -12.073 -5.503  -9.624  1.00 0.00 ? 32  LYS A HG3  3  
ATOM 6838  H HD2  . LYS A 1 32  ? -13.383 -3.561  -11.340 1.00 0.00 ? 32  LYS A HD2  3  
ATOM 6839  H HD3  . LYS A 1 32  ? -11.632 -3.571  -11.561 1.00 0.00 ? 32  LYS A HD3  3  
ATOM 6840  H HE2  . LYS A 1 32  ? -11.692 -5.989  -11.921 1.00 0.00 ? 32  LYS A HE2  3  
ATOM 6841  H HE3  . LYS A 1 32  ? -13.438 -5.984  -11.688 1.00 0.00 ? 32  LYS A HE3  3  
ATOM 6842  H HZ1  . LYS A 1 32  ? -13.790 -4.927  -13.687 1.00 0.00 ? 32  LYS A HZ1  3  
ATOM 6843  H HZ2  . LYS A 1 32  ? -12.477 -5.922  -14.066 1.00 0.00 ? 32  LYS A HZ2  3  
ATOM 6844  H HZ3  . LYS A 1 32  ? -12.230 -4.278  -13.760 1.00 0.00 ? 32  LYS A HZ3  3  
ATOM 6845  N N    . THR A 1 33  ? -15.855 -5.043  -7.001  1.00 0.00 ? 33  THR A N    3  
ATOM 6846  C CA   . THR A 1 33  ? -17.142 -4.783  -6.385  1.00 0.00 ? 33  THR A CA   3  
ATOM 6847  C C    . THR A 1 33  ? -17.131 -5.150  -4.900  1.00 0.00 ? 33  THR A C    3  
ATOM 6848  O O    . THR A 1 33  ? -17.629 -4.397  -4.066  1.00 0.00 ? 33  THR A O    3  
ATOM 6849  C CB   . THR A 1 33  ? -18.236 -5.559  -7.118  1.00 0.00 ? 33  THR A CB   3  
ATOM 6850  O OG1  . THR A 1 33  ? -18.734 -4.811  -8.213  1.00 0.00 ? 33  THR A OG1  3  
ATOM 6851  C CG2  . THR A 1 33  ? -19.406 -5.912  -6.235  1.00 0.00 ? 33  THR A CG2  3  
ATOM 6852  H H    . THR A 1 33  ? -15.763 -5.815  -7.594  1.00 0.00 ? 33  THR A H    3  
ATOM 6853  H HA   . THR A 1 33  ? -17.344 -3.728  -6.477  1.00 0.00 ? 33  THR A HA   3  
ATOM 6854  H HB   . THR A 1 33  ? -17.818 -6.480  -7.498  1.00 0.00 ? 33  THR A HB   3  
ATOM 6855  H HG1  . THR A 1 33  ? -19.153 -4.010  -7.889  1.00 0.00 ? 33  THR A HG1  3  
ATOM 6856  H HG21 . THR A 1 33  ? -19.774 -5.016  -5.758  1.00 0.00 ? 33  THR A HG21 3  
ATOM 6857  H HG22 . THR A 1 33  ? -19.081 -6.613  -5.481  1.00 0.00 ? 33  THR A HG22 3  
ATOM 6858  H HG23 . THR A 1 33  ? -20.189 -6.355  -6.830  1.00 0.00 ? 33  THR A HG23 3  
ATOM 6859  N N    . GLU A 1 34  ? -16.568 -6.306  -4.566  1.00 0.00 ? 34  GLU A N    3  
ATOM 6860  C CA   . GLU A 1 34  ? -16.514 -6.733  -3.174  1.00 0.00 ? 34  GLU A CA   3  
ATOM 6861  C C    . GLU A 1 34  ? -15.742 -5.711  -2.346  1.00 0.00 ? 34  GLU A C    3  
ATOM 6862  O O    . GLU A 1 34  ? -15.996 -5.530  -1.154  1.00 0.00 ? 34  GLU A O    3  
ATOM 6863  C CB   . GLU A 1 34  ? -15.869 -8.115  -3.060  1.00 0.00 ? 34  GLU A CB   3  
ATOM 6864  C CG   . GLU A 1 34  ? -16.675 -9.092  -2.222  1.00 0.00 ? 34  GLU A CG   3  
ATOM 6865  C CD   . GLU A 1 34  ? -15.847 -10.265 -1.735  1.00 0.00 ? 34  GLU A CD   3  
ATOM 6866  O OE1  . GLU A 1 34  ? -15.717 -11.254 -2.487  1.00 0.00 ? 34  GLU A OE1  3  
ATOM 6867  O OE2  . GLU A 1 34  ? -15.328 -10.195 -0.601  1.00 0.00 ? 34  GLU A OE2  3  
ATOM 6868  H H    . GLU A 1 34  ? -16.181 -6.878  -5.261  1.00 0.00 ? 34  GLU A H    3  
ATOM 6869  H HA   . GLU A 1 34  ? -17.528 -6.784  -2.805  1.00 0.00 ? 34  GLU A HA   3  
ATOM 6870  H HB2  . GLU A 1 34  ? -15.759 -8.530  -4.051  1.00 0.00 ? 34  GLU A HB2  3  
ATOM 6871  H HB3  . GLU A 1 34  ? -14.893 -8.010  -2.613  1.00 0.00 ? 34  GLU A HB3  3  
ATOM 6872  H HG2  . GLU A 1 34  ? -17.070 -8.569  -1.363  1.00 0.00 ? 34  GLU A HG2  3  
ATOM 6873  H HG3  . GLU A 1 34  ? -17.492 -9.470  -2.819  1.00 0.00 ? 34  GLU A HG3  3  
ATOM 6874  N N    . PHE A 1 35  ? -14.805 -5.033  -2.997  1.00 0.00 ? 35  PHE A N    3  
ATOM 6875  C CA   . PHE A 1 35  ? -14.002 -4.021  -2.331  1.00 0.00 ? 35  PHE A CA   3  
ATOM 6876  C C    . PHE A 1 35  ? -14.814 -2.745  -2.121  1.00 0.00 ? 35  PHE A C    3  
ATOM 6877  O O    . PHE A 1 35  ? -14.554 -1.984  -1.189  1.00 0.00 ? 35  PHE A O    3  
ATOM 6878  C CB   . PHE A 1 35  ? -12.722 -3.734  -3.124  1.00 0.00 ? 35  PHE A CB   3  
ATOM 6879  C CG   . PHE A 1 35  ? -11.524 -4.464  -2.589  1.00 0.00 ? 35  PHE A CG   3  
ATOM 6880  C CD1  . PHE A 1 35  ? -11.247 -4.471  -1.231  1.00 0.00 ? 35  PHE A CD1  3  
ATOM 6881  C CD2  . PHE A 1 35  ? -10.679 -5.145  -3.445  1.00 0.00 ? 35  PHE A CD2  3  
ATOM 6882  C CE1  . PHE A 1 35  ? -10.145 -5.146  -0.740  1.00 0.00 ? 35  PHE A CE1  3  
ATOM 6883  C CE2  . PHE A 1 35  ? -9.576  -5.821  -2.962  1.00 0.00 ? 35  PHE A CE2  3  
ATOM 6884  C CZ   . PHE A 1 35  ? -9.308  -5.821  -1.607  1.00 0.00 ? 35  PHE A CZ   3  
ATOM 6885  H H    . PHE A 1 35  ? -14.660 -5.212  -3.951  1.00 0.00 ? 35  PHE A H    3  
ATOM 6886  H HA   . PHE A 1 35  ? -13.729 -4.413  -1.363  1.00 0.00 ? 35  PHE A HA   3  
ATOM 6887  H HB2  . PHE A 1 35  ? -12.858 -4.038  -4.153  1.00 0.00 ? 35  PHE A HB2  3  
ATOM 6888  H HB3  . PHE A 1 35  ? -12.510 -2.677  -3.091  1.00 0.00 ? 35  PHE A HB3  3  
ATOM 6889  H HD1  . PHE A 1 35  ? -11.901 -3.942  -0.554  1.00 0.00 ? 35  PHE A HD1  3  
ATOM 6890  H HD2  . PHE A 1 35  ? -10.890 -5.145  -4.503  1.00 0.00 ? 35  PHE A HD2  3  
ATOM 6891  H HE1  . PHE A 1 35  ? -9.938  -5.144  0.320   1.00 0.00 ? 35  PHE A HE1  3  
ATOM 6892  H HE2  . PHE A 1 35  ? -8.925  -6.349  -3.641  1.00 0.00 ? 35  PHE A HE2  3  
ATOM 6893  H HZ   . PHE A 1 35  ? -8.447  -6.349  -1.227  1.00 0.00 ? 35  PHE A HZ   3  
ATOM 6894  N N    . LEU A 1 36  ? -15.811 -2.520  -2.980  1.00 0.00 ? 36  LEU A N    3  
ATOM 6895  C CA   . LEU A 1 36  ? -16.669 -1.345  -2.866  1.00 0.00 ? 36  LEU A CA   3  
ATOM 6896  C C    . LEU A 1 36  ? -17.217 -1.219  -1.462  1.00 0.00 ? 36  LEU A C    3  
ATOM 6897  O O    . LEU A 1 36  ? -17.008 -0.221  -0.774  1.00 0.00 ? 36  LEU A O    3  
ATOM 6898  C CB   . LEU A 1 36  ? -17.850 -1.472  -3.822  1.00 0.00 ? 36  LEU A CB   3  
ATOM 6899  C CG   . LEU A 1 36  ? -17.727 -0.668  -5.093  1.00 0.00 ? 36  LEU A CG   3  
ATOM 6900  C CD1  . LEU A 1 36  ? -17.673 0.814   -4.764  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 6901  C CD2  . LEU A 1 36  ? -16.498 -1.109  -5.864  1.00 0.00 ? 36  LEU A CD2  3  
ATOM 6902  H H    . LEU A 1 36  ? -15.984 -3.165  -3.698  1.00 0.00 ? 36  LEU A H    3  
ATOM 6903  H HA   . LEU A 1 36  ? -16.093 -0.468  -3.115  1.00 0.00 ? 36  LEU A HA   3  
ATOM 6904  H HB2  . LEU A 1 36  ? -17.962 -2.508  -4.088  1.00 0.00 ? 36  LEU A HB2  3  
ATOM 6905  H HB3  . LEU A 1 36  ? -18.743 -1.151  -3.307  1.00 0.00 ? 36  LEU A HB3  3  
ATOM 6906  H HG   . LEU A 1 36  ? -18.593 -0.851  -5.702  1.00 0.00 ? 36  LEU A HG   3  
ATOM 6907  H HD11 . LEU A 1 36  ? -18.419 1.339   -5.342  1.00 0.00 ? 36  LEU A HD11 3  
ATOM 6908  H HD12 . LEU A 1 36  ? -16.693 1.201   -5.000  1.00 0.00 ? 36  LEU A HD12 3  
ATOM 6909  H HD13 . LEU A 1 36  ? -17.871 0.950   -3.708  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 6910  H HD21 . LEU A 1 36  ? -16.775 -1.883  -6.564  1.00 0.00 ? 36  LEU A HD21 3  
ATOM 6911  H HD22 . LEU A 1 36  ? -15.766 -1.497  -5.169  1.00 0.00 ? 36  LEU A HD22 3  
ATOM 6912  H HD23 . LEU A 1 36  ? -16.083 -0.267  -6.397  1.00 0.00 ? 36  LEU A HD23 3  
ATOM 6913  N N    . SER A 1 37  ? -17.931 -2.255  -1.060  1.00 0.00 ? 37  SER A N    3  
ATOM 6914  C CA   . SER A 1 37  ? -18.539 -2.299  0.256   1.00 0.00 ? 37  SER A CA   3  
ATOM 6915  C C    . SER A 1 37  ? -17.496 -2.034  1.334   1.00 0.00 ? 37  SER A C    3  
ATOM 6916  O O    . SER A 1 37  ? -17.718 -1.239  2.247   1.00 0.00 ? 37  SER A O    3  
ATOM 6917  C CB   . SER A 1 37  ? -19.210 -3.654  0.491   1.00 0.00 ? 37  SER A CB   3  
ATOM 6918  O OG   . SER A 1 37  ? -18.462 -4.704  -0.097  1.00 0.00 ? 37  SER A OG   3  
ATOM 6919  H H    . SER A 1 37  ? -18.055 -3.004  -1.678  1.00 0.00 ? 37  SER A H    3  
ATOM 6920  H HA   . SER A 1 37  ? -19.288 -1.522  0.290   1.00 0.00 ? 37  SER A HA   3  
ATOM 6921  H HB2  . SER A 1 37  ? -19.289 -3.835  1.553   1.00 0.00 ? 37  SER A HB2  3  
ATOM 6922  H HB3  . SER A 1 37  ? -20.198 -3.645  0.054   1.00 0.00 ? 37  SER A HB3  3  
ATOM 6923  H HG   . SER A 1 37  ? -17.598 -4.755  0.321   1.00 0.00 ? 37  SER A HG   3  
ATOM 6924  N N    . PHE A 1 38  ? -16.348 -2.697  1.212   1.00 0.00 ? 38  PHE A N    3  
ATOM 6925  C CA   . PHE A 1 38  ? -15.260 -2.520  2.166   1.00 0.00 ? 38  PHE A CA   3  
ATOM 6926  C C    . PHE A 1 38  ? -14.837 -1.054  2.225   1.00 0.00 ? 38  PHE A C    3  
ATOM 6927  O O    . PHE A 1 38  ? -14.360 -0.573  3.253   1.00 0.00 ? 38  PHE A O    3  
ATOM 6928  C CB   . PHE A 1 38  ? -14.067 -3.398  1.772   1.00 0.00 ? 38  PHE A CB   3  
ATOM 6929  C CG   . PHE A 1 38  ? -12.854 -3.206  2.641   1.00 0.00 ? 38  PHE A CG   3  
ATOM 6930  C CD1  . PHE A 1 38  ? -12.055 -2.082  2.501   1.00 0.00 ? 38  PHE A CD1  3  
ATOM 6931  C CD2  . PHE A 1 38  ? -12.513 -4.152  3.594   1.00 0.00 ? 38  PHE A CD2  3  
ATOM 6932  C CE1  . PHE A 1 38  ? -10.939 -1.906  3.295   1.00 0.00 ? 38  PHE A CE1  3  
ATOM 6933  C CE2  . PHE A 1 38  ? -11.398 -3.979  4.392   1.00 0.00 ? 38  PHE A CE2  3  
ATOM 6934  C CZ   . PHE A 1 38  ? -10.609 -2.856  4.242   1.00 0.00 ? 38  PHE A CZ   3  
ATOM 6935  H H    . PHE A 1 38  ? -16.227 -3.311  0.453   1.00 0.00 ? 38  PHE A H    3  
ATOM 6936  H HA   . PHE A 1 38  ? -15.616 -2.821  3.141   1.00 0.00 ? 38  PHE A HA   3  
ATOM 6937  H HB2  . PHE A 1 38  ? -14.357 -4.434  1.835   1.00 0.00 ? 38  PHE A HB2  3  
ATOM 6938  H HB3  . PHE A 1 38  ? -13.786 -3.169  0.755   1.00 0.00 ? 38  PHE A HB3  3  
ATOM 6939  H HD1  . PHE A 1 38  ? -12.312 -1.338  1.761   1.00 0.00 ? 38  PHE A HD1  3  
ATOM 6940  H HD2  . PHE A 1 38  ? -13.128 -5.030  3.714   1.00 0.00 ? 38  PHE A HD2  3  
ATOM 6941  H HE1  . PHE A 1 38  ? -10.323 -1.026  3.176   1.00 0.00 ? 38  PHE A HE1  3  
ATOM 6942  H HE2  . PHE A 1 38  ? -11.142 -4.724  5.133   1.00 0.00 ? 38  PHE A HE2  3  
ATOM 6943  H HZ   . PHE A 1 38  ? -9.737  -2.719  4.864   1.00 0.00 ? 38  PHE A HZ   3  
ATOM 6944  N N    . MET A 1 39  ? -15.016 -0.353  1.110   1.00 0.00 ? 39  MET A N    3  
ATOM 6945  C CA   . MET A 1 39  ? -14.660 1.058   1.020   1.00 0.00 ? 39  MET A CA   3  
ATOM 6946  C C    . MET A 1 39  ? -15.712 1.932   1.692   1.00 0.00 ? 39  MET A C    3  
ATOM 6947  O O    . MET A 1 39  ? -15.390 2.949   2.302   1.00 0.00 ? 39  MET A O    3  
ATOM 6948  C CB   . MET A 1 39  ? -14.507 1.467   -0.445  1.00 0.00 ? 39  MET A CB   3  
ATOM 6949  C CG   . MET A 1 39  ? -14.000 2.888   -0.631  1.00 0.00 ? 39  MET A CG   3  
ATOM 6950  S SD   . MET A 1 39  ? -12.343 2.946   -1.335  1.00 0.00 ? 39  MET A SD   3  
ATOM 6951  C CE   . MET A 1 39  ? -11.376 2.294   0.024   1.00 0.00 ? 39  MET A CE   3  
ATOM 6952  H H    . MET A 1 39  ? -15.402 -0.795  0.324   1.00 0.00 ? 39  MET A H    3  
ATOM 6953  H HA   . MET A 1 39  ? -13.715 1.197   1.525   1.00 0.00 ? 39  MET A HA   3  
ATOM 6954  H HB2  . MET A 1 39  ? -13.813 0.794   -0.925  1.00 0.00 ? 39  MET A HB2  3  
ATOM 6955  H HB3  . MET A 1 39  ? -15.468 1.385   -0.931  1.00 0.00 ? 39  MET A HB3  3  
ATOM 6956  H HG2  . MET A 1 39  ? -14.674 3.413   -1.291  1.00 0.00 ? 39  MET A HG2  3  
ATOM 6957  H HG3  . MET A 1 39  ? -13.986 3.379   0.331   1.00 0.00 ? 39  MET A HG3  3  
ATOM 6958  H HE1  . MET A 1 39  ? -10.539 1.730   -0.365  1.00 0.00 ? 39  MET A HE1  3  
ATOM 6959  H HE2  . MET A 1 39  ? -11.994 1.649   0.630   1.00 0.00 ? 39  MET A HE2  3  
ATOM 6960  H HE3  . MET A 1 39  ? -11.008 3.111   0.628   1.00 0.00 ? 39  MET A HE3  3  
ATOM 6961  N N    . ASN A 1 40  ? -16.971 1.529   1.572   1.00 0.00 ? 40  ASN A N    3  
ATOM 6962  C CA   . ASN A 1 40  ? -18.072 2.275   2.168   1.00 0.00 ? 40  ASN A CA   3  
ATOM 6963  C C    . ASN A 1 40  ? -18.098 2.104   3.684   1.00 0.00 ? 40  ASN A C    3  
ATOM 6964  O O    . ASN A 1 40  ? -18.705 2.902   4.398   1.00 0.00 ? 40  ASN A O    3  
ATOM 6965  C CB   . ASN A 1 40  ? -19.405 1.819   1.570   1.00 0.00 ? 40  ASN A CB   3  
ATOM 6966  C CG   . ASN A 1 40  ? -19.613 2.332   0.159   1.00 0.00 ? 40  ASN A CG   3  
ATOM 6967  O OD1  . ASN A 1 40  ? -20.005 3.481   -0.044  1.00 0.00 ? 40  ASN A OD1  3  
ATOM 6968  N ND2  . ASN A 1 40  ? -19.351 1.479   -0.824  1.00 0.00 ? 40  ASN A ND2  3  
ATOM 6969  H H    . ASN A 1 40  ? -17.164 0.709   1.073   1.00 0.00 ? 40  ASN A H    3  
ATOM 6970  H HA   . ASN A 1 40  ? -17.926 3.321   1.938   1.00 0.00 ? 40  ASN A HA   3  
ATOM 6971  H HB2  . ASN A 1 40  ? -19.431 0.739   1.548   1.00 0.00 ? 40  ASN A HB2  3  
ATOM 6972  H HB3  . ASN A 1 40  ? -20.213 2.181   2.189   1.00 0.00 ? 40  ASN A HB3  3  
ATOM 6973  H HD21 . ASN A 1 40  ? -19.042 0.577   -0.585  1.00 0.00 ? 40  ASN A HD21 3  
ATOM 6974  H HD22 . ASN A 1 40  ? -19.479 1.787   -1.751  1.00 0.00 ? 40  ASN A HD22 3  
ATOM 6975  N N    . THR A 1 41  ? -17.446 1.051   4.170   1.00 0.00 ? 41  THR A N    3  
ATOM 6976  C CA   . THR A 1 41  ? -17.407 0.768   5.599   1.00 0.00 ? 41  THR A CA   3  
ATOM 6977  C C    . THR A 1 41  ? -16.031 1.055   6.191   1.00 0.00 ? 41  THR A C    3  
ATOM 6978  O O    . THR A 1 41  ? -15.818 2.080   6.840   1.00 0.00 ? 41  THR A O    3  
ATOM 6979  C CB   . THR A 1 41  ? -17.773 -0.696  5.848   1.00 0.00 ? 41  THR A CB   3  
ATOM 6980  O OG1  . THR A 1 41  ? -17.231 -1.525  4.834   1.00 0.00 ? 41  THR A OG1  3  
ATOM 6981  C CG2  . THR A 1 41  ? -19.261 -0.945  5.892   1.00 0.00 ? 41  THR A CG2  3  
ATOM 6982  H H    . THR A 1 41  ? -16.990 0.445   3.551   1.00 0.00 ? 41  THR A H    3  
ATOM 6983  H HA   . THR A 1 41  ? -18.136 1.398   6.084   1.00 0.00 ? 41  THR A HA   3  
ATOM 6984  H HB   . THR A 1 41  ? -17.356 -1.005  6.795   1.00 0.00 ? 41  THR A HB   3  
ATOM 6985  H HG1  . THR A 1 41  ? -17.688 -1.362  4.007   1.00 0.00 ? 41  THR A HG1  3  
ATOM 6986  H HG21 . THR A 1 41  ? -19.689 -0.731  4.925   1.00 0.00 ? 41  THR A HG21 3  
ATOM 6987  H HG22 . THR A 1 41  ? -19.710 -0.303  6.636   1.00 0.00 ? 41  THR A HG22 3  
ATOM 6988  H HG23 . THR A 1 41  ? -19.444 -1.977  6.148   1.00 0.00 ? 41  THR A HG23 3  
ATOM 6989  N N    . GLU A 1 42  ? -15.106 0.127   5.973   1.00 0.00 ? 42  GLU A N    3  
ATOM 6990  C CA   . GLU A 1 42  ? -13.745 0.246   6.493   1.00 0.00 ? 42  GLU A CA   3  
ATOM 6991  C C    . GLU A 1 42  ? -13.113 1.592   6.142   1.00 0.00 ? 42  GLU A C    3  
ATOM 6992  O O    . GLU A 1 42  ? -12.255 2.089   6.870   1.00 0.00 ? 42  GLU A O    3  
ATOM 6993  C CB   . GLU A 1 42  ? -12.885 -0.897  5.955   1.00 0.00 ? 42  GLU A CB   3  
ATOM 6994  C CG   . GLU A 1 42  ? -13.449 -2.273  6.273   1.00 0.00 ? 42  GLU A CG   3  
ATOM 6995  C CD   . GLU A 1 42  ? -12.552 -3.075  7.196   1.00 0.00 ? 42  GLU A CD   3  
ATOM 6996  O OE1  . GLU A 1 42  ? -11.321 -3.073  6.978   1.00 0.00 ? 42  GLU A OE1  3  
ATOM 6997  O OE2  . GLU A 1 42  ? -13.080 -3.703  8.138   1.00 0.00 ? 42  GLU A OE2  3  
ATOM 6998  H H    . GLU A 1 42  ? -15.351 -0.671  5.458   1.00 0.00 ? 42  GLU A H    3  
ATOM 6999  H HA   . GLU A 1 42  ? -13.798 0.162   7.567   1.00 0.00 ? 42  GLU A HA   3  
ATOM 7000  H HB2  . GLU A 1 42  ? -12.809 -0.801  4.882   1.00 0.00 ? 42  GLU A HB2  3  
ATOM 7001  H HB3  . GLU A 1 42  ? -11.899 -0.826  6.386   1.00 0.00 ? 42  GLU A HB3  3  
ATOM 7002  H HG2  . GLU A 1 42  ? -14.411 -2.152  6.748   1.00 0.00 ? 42  GLU A HG2  3  
ATOM 7003  H HG3  . GLU A 1 42  ? -13.572 -2.819  5.350   1.00 0.00 ? 42  GLU A HG3  3  
ATOM 7004  N N    . LEU A 1 43  ? -13.539 2.175   5.029   1.00 0.00 ? 43  LEU A N    3  
ATOM 7005  C CA   . LEU A 1 43  ? -13.009 3.462   4.594   1.00 0.00 ? 43  LEU A CA   3  
ATOM 7006  C C    . LEU A 1 43  ? -14.140 4.385   4.161   1.00 0.00 ? 43  LEU A C    3  
ATOM 7007  O O    . LEU A 1 43  ? -14.113 4.954   3.069   1.00 0.00 ? 43  LEU A O    3  
ATOM 7008  C CB   . LEU A 1 43  ? -12.010 3.265   3.452   1.00 0.00 ? 43  LEU A CB   3  
ATOM 7009  C CG   . LEU A 1 43  ? -10.632 2.765   3.887   1.00 0.00 ? 43  LEU A CG   3  
ATOM 7010  C CD1  . LEU A 1 43  ? -9.745  2.508   2.680   1.00 0.00 ? 43  LEU A CD1  3  
ATOM 7011  C CD2  . LEU A 1 43  ? -9.977  3.764   4.831   1.00 0.00 ? 43  LEU A CD2  3  
ATOM 7012  H H    . LEU A 1 43  ? -14.224 1.734   4.489   1.00 0.00 ? 43  LEU A H    3  
ATOM 7013  H HA   . LEU A 1 43  ? -12.498 3.911   5.433   1.00 0.00 ? 43  LEU A HA   3  
ATOM 7014  H HB2  . LEU A 1 43  ? -12.427 2.553   2.755   1.00 0.00 ? 43  LEU A HB2  3  
ATOM 7015  H HB3  . LEU A 1 43  ? -11.882 4.209   2.945   1.00 0.00 ? 43  LEU A HB3  3  
ATOM 7016  H HG   . LEU A 1 43  ? -10.747 1.831   4.419   1.00 0.00 ? 43  LEU A HG   3  
ATOM 7017  H HD11 . LEU A 1 43  ? -10.157 1.699   2.096   1.00 0.00 ? 43  LEU A HD11 3  
ATOM 7018  H HD12 . LEU A 1 43  ? -8.753  2.243   3.014   1.00 0.00 ? 43  LEU A HD12 3  
ATOM 7019  H HD13 . LEU A 1 43  ? -9.693  3.401   2.074   1.00 0.00 ? 43  LEU A HD13 3  
ATOM 7020  H HD21 . LEU A 1 43  ? -9.728  3.271   5.759   1.00 0.00 ? 43  LEU A HD21 3  
ATOM 7021  H HD22 . LEU A 1 43  ? -10.663 4.575   5.029   1.00 0.00 ? 43  LEU A HD22 3  
ATOM 7022  H HD23 . LEU A 1 43  ? -9.076  4.155   4.378   1.00 0.00 ? 43  LEU A HD23 3  
ATOM 7023  N N    . ALA A 1 44  ? -15.135 4.527   5.029   1.00 0.00 ? 44  ALA A N    3  
ATOM 7024  C CA   . ALA A 1 44  ? -16.283 5.377   4.749   1.00 0.00 ? 44  ALA A CA   3  
ATOM 7025  C C    . ALA A 1 44  ? -15.929 6.847   4.930   1.00 0.00 ? 44  ALA A C    3  
ATOM 7026  O O    . ALA A 1 44  ? -16.545 7.723   4.327   1.00 0.00 ? 44  ALA A O    3  
ATOM 7027  C CB   . ALA A 1 44  ? -17.449 4.994   5.647   1.00 0.00 ? 44  ALA A CB   3  
ATOM 7028  H H    . ALA A 1 44  ? -15.095 4.047   5.883   1.00 0.00 ? 44  ALA A H    3  
ATOM 7029  H HA   . ALA A 1 44  ? -16.578 5.211   3.723   1.00 0.00 ? 44  ALA A HA   3  
ATOM 7030  H HB1  . ALA A 1 44  ? -17.378 3.947   5.901   1.00 0.00 ? 44  ALA A HB1  3  
ATOM 7031  H HB2  . ALA A 1 44  ? -18.379 5.177   5.128   1.00 0.00 ? 44  ALA A HB2  3  
ATOM 7032  H HB3  . ALA A 1 44  ? -17.418 5.587   6.550   1.00 0.00 ? 44  ALA A HB3  3  
ATOM 7033  N N    . ALA A 1 45  ? -14.928 7.107   5.761   1.00 0.00 ? 45  ALA A N    3  
ATOM 7034  C CA   . ALA A 1 45  ? -14.484 8.469   6.021   1.00 0.00 ? 45  ALA A CA   3  
ATOM 7035  C C    . ALA A 1 45  ? -13.836 9.084   4.780   1.00 0.00 ? 45  ALA A C    3  
ATOM 7036  O O    . ALA A 1 45  ? -13.636 10.296  4.710   1.00 0.00 ? 45  ALA A O    3  
ATOM 7037  C CB   . ALA A 1 45  ? -13.514 8.482   7.192   1.00 0.00 ? 45  ALA A CB   3  
ATOM 7038  H H    . ALA A 1 45  ? -14.473 6.365   6.211   1.00 0.00 ? 45  ALA A H    3  
ATOM 7039  H HA   . ALA A 1 45  ? -15.348 9.057   6.292   1.00 0.00 ? 45  ALA A HA   3  
ATOM 7040  H HB1  . ALA A 1 45  ? -13.342 7.468   7.525   1.00 0.00 ? 45  ALA A HB1  3  
ATOM 7041  H HB2  . ALA A 1 45  ? -13.935 9.060   8.001   1.00 0.00 ? 45  ALA A HB2  3  
ATOM 7042  H HB3  . ALA A 1 45  ? -12.578 8.923   6.883   1.00 0.00 ? 45  ALA A HB3  3  
ATOM 7043  N N    . PHE A 1 46  ? -13.507 8.240   3.804   1.00 0.00 ? 46  PHE A N    3  
ATOM 7044  C CA   . PHE A 1 46  ? -12.880 8.699   2.571   1.00 0.00 ? 46  PHE A CA   3  
ATOM 7045  C C    . PHE A 1 46  ? -13.904 8.830   1.444   1.00 0.00 ? 46  PHE A C    3  
ATOM 7046  O O    . PHE A 1 46  ? -13.677 9.548   0.470   1.00 0.00 ? 46  PHE A O    3  
ATOM 7047  C CB   . PHE A 1 46  ? -11.770 7.730   2.153   1.00 0.00 ? 46  PHE A CB   3  
ATOM 7048  C CG   . PHE A 1 46  ? -10.585 7.742   3.075   1.00 0.00 ? 46  PHE A CG   3  
ATOM 7049  C CD1  . PHE A 1 46  ? -10.705 7.300   4.383   1.00 0.00 ? 46  PHE A CD1  3  
ATOM 7050  C CD2  . PHE A 1 46  ? -9.351  8.193   2.634   1.00 0.00 ? 46  PHE A CD2  3  
ATOM 7051  C CE1  . PHE A 1 46  ? -9.616  7.308   5.234   1.00 0.00 ? 46  PHE A CE1  3  
ATOM 7052  C CE2  . PHE A 1 46  ? -8.259  8.204   3.480   1.00 0.00 ? 46  PHE A CE2  3  
ATOM 7053  C CZ   . PHE A 1 46  ? -8.391  7.760   4.782   1.00 0.00 ? 46  PHE A CZ   3  
ATOM 7054  H H    . PHE A 1 46  ? -13.688 7.284   3.917   1.00 0.00 ? 46  PHE A H    3  
ATOM 7055  H HA   . PHE A 1 46  ? -12.446 9.669   2.760   1.00 0.00 ? 46  PHE A HA   3  
ATOM 7056  H HB2  . PHE A 1 46  ? -12.166 6.725   2.137   1.00 0.00 ? 46  PHE A HB2  3  
ATOM 7057  H HB3  . PHE A 1 46  ? -11.426 7.993   1.163   1.00 0.00 ? 46  PHE A HB3  3  
ATOM 7058  H HD1  . PHE A 1 46  ? -11.661 6.946   4.737   1.00 0.00 ? 46  PHE A HD1  3  
ATOM 7059  H HD2  . PHE A 1 46  ? -9.247  8.540   1.617   1.00 0.00 ? 46  PHE A HD2  3  
ATOM 7060  H HE1  . PHE A 1 46  ? -9.722  6.961   6.251   1.00 0.00 ? 46  PHE A HE1  3  
ATOM 7061  H HE2  . PHE A 1 46  ? -7.303  8.558   3.124   1.00 0.00 ? 46  PHE A HE2  3  
ATOM 7062  H HZ   . PHE A 1 46  ? -7.539  7.767   5.445   1.00 0.00 ? 46  PHE A HZ   3  
ATOM 7063  N N    . THR A 1 47  ? -15.026 8.129   1.578   1.00 0.00 ? 47  THR A N    3  
ATOM 7064  C CA   . THR A 1 47  ? -16.076 8.166   0.563   1.00 0.00 ? 47  THR A CA   3  
ATOM 7065  C C    . THR A 1 47  ? -17.295 8.947   1.051   1.00 0.00 ? 47  THR A C    3  
ATOM 7066  O O    . THR A 1 47  ? -18.102 9.418   0.249   1.00 0.00 ? 47  THR A O    3  
ATOM 7067  C CB   . THR A 1 47  ? -16.490 6.745   0.177   1.00 0.00 ? 47  THR A CB   3  
ATOM 7068  O OG1  . THR A 1 47  ? -17.356 6.192   1.153   1.00 0.00 ? 47  THR A OG1  3  
ATOM 7069  C CG2  . THR A 1 47  ? -15.317 5.800   0.016   1.00 0.00 ? 47  THR A CG2  3  
ATOM 7070  H H    . THR A 1 47  ? -15.151 7.569   2.371   1.00 0.00 ? 47  THR A H    3  
ATOM 7071  H HA   . THR A 1 47  ? -15.673 8.661   -0.309  1.00 0.00 ? 47  THR A HA   3  
ATOM 7072  H HB   . THR A 1 47  ? -17.019 6.779   -0.765  1.00 0.00 ? 47  THR A HB   3  
ATOM 7073  H HG1  . THR A 1 47  ? -17.702 5.355   0.836   1.00 0.00 ? 47  THR A HG1  3  
ATOM 7074  H HG21 . THR A 1 47  ? -14.790 5.717   0.956   1.00 0.00 ? 47  THR A HG21 3  
ATOM 7075  H HG22 . THR A 1 47  ? -14.648 6.183   -0.740  1.00 0.00 ? 47  THR A HG22 3  
ATOM 7076  H HG23 . THR A 1 47  ? -15.678 4.826   -0.281  1.00 0.00 ? 47  THR A HG23 3  
ATOM 7077  N N    . LYS A 1 48  ? -17.426 9.081   2.368   1.00 0.00 ? 48  LYS A N    3  
ATOM 7078  C CA   . LYS A 1 48  ? -18.550 9.804   2.958   1.00 0.00 ? 48  LYS A CA   3  
ATOM 7079  C C    . LYS A 1 48  ? -18.649 11.219  2.397   1.00 0.00 ? 48  LYS A C    3  
ATOM 7080  O O    . LYS A 1 48  ? -17.644 11.919  2.277   1.00 0.00 ? 48  LYS A O    3  
ATOM 7081  C CB   . LYS A 1 48  ? -18.405 9.855   4.480   1.00 0.00 ? 48  LYS A CB   3  
ATOM 7082  C CG   . LYS A 1 48  ? -19.162 8.752   5.201   1.00 0.00 ? 48  LYS A CG   3  
ATOM 7083  C CD   . LYS A 1 48  ? -18.518 8.418   6.537   1.00 0.00 ? 48  LYS A CD   3  
ATOM 7084  C CE   . LYS A 1 48  ? -19.190 7.223   7.194   1.00 0.00 ? 48  LYS A CE   3  
ATOM 7085  N NZ   . LYS A 1 48  ? -20.525 7.573   7.751   1.00 0.00 ? 48  LYS A NZ   3  
ATOM 7086  H H    . LYS A 1 48  ? -16.753 8.684   2.958   1.00 0.00 ? 48  LYS A H    3  
ATOM 7087  H HA   . LYS A 1 48  ? -19.455 9.267   2.710   1.00 0.00 ? 48  LYS A HA   3  
ATOM 7088  H HB2  . LYS A 1 48  ? -17.359 9.769   4.733   1.00 0.00 ? 48  LYS A HB2  3  
ATOM 7089  H HB3  . LYS A 1 48  ? -18.775 10.807  4.834   1.00 0.00 ? 48  LYS A HB3  3  
ATOM 7090  H HG2  . LYS A 1 48  ? -20.177 9.079   5.374   1.00 0.00 ? 48  LYS A HG2  3  
ATOM 7091  H HG3  . LYS A 1 48  ? -19.167 7.868   4.581   1.00 0.00 ? 48  LYS A HG3  3  
ATOM 7092  H HD2  . LYS A 1 48  ? -17.476 8.188   6.376   1.00 0.00 ? 48  LYS A HD2  3  
ATOM 7093  H HD3  . LYS A 1 48  ? -18.605 9.273   7.191   1.00 0.00 ? 48  LYS A HD3  3  
ATOM 7094  H HE2  . LYS A 1 48  ? -19.310 6.444   6.456   1.00 0.00 ? 48  LYS A HE2  3  
ATOM 7095  H HE3  . LYS A 1 48  ? -18.557 6.866   7.994   1.00 0.00 ? 48  LYS A HE3  3  
ATOM 7096  H HZ1  . LYS A 1 48  ? -21.072 6.707   7.937   1.00 0.00 ? 48  LYS A HZ1  3  
ATOM 7097  H HZ2  . LYS A 1 48  ? -21.050 8.164   7.077   1.00 0.00 ? 48  LYS A HZ2  3  
ATOM 7098  H HZ3  . LYS A 1 48  ? -20.414 8.098   8.642   1.00 0.00 ? 48  LYS A HZ3  3  
ATOM 7099  N N    . ASN A 1 49  ? -19.870 11.632  2.057   1.00 0.00 ? 49  ASN A N    3  
ATOM 7100  C CA   . ASN A 1 49  ? -20.120 12.966  1.507   1.00 0.00 ? 49  ASN A CA   3  
ATOM 7101  C C    . ASN A 1 49  ? -19.792 13.028  0.015   1.00 0.00 ? 49  ASN A C    3  
ATOM 7102  O O    . ASN A 1 49  ? -20.545 13.606  -0.768  1.00 0.00 ? 49  ASN A O    3  
ATOM 7103  C CB   . ASN A 1 49  ? -19.314 14.028  2.264   1.00 0.00 ? 49  ASN A CB   3  
ATOM 7104  C CG   . ASN A 1 49  ? -20.159 15.224  2.657   1.00 0.00 ? 49  ASN A CG   3  
ATOM 7105  O OD1  . ASN A 1 49  ? -20.198 16.230  1.948   1.00 0.00 ? 49  ASN A OD1  3  
ATOM 7106  N ND2  . ASN A 1 49  ? -20.841 15.120  3.791   1.00 0.00 ? 49  ASN A ND2  3  
ATOM 7107  H H    . ASN A 1 49  ? -20.627 11.021  2.180   1.00 0.00 ? 49  ASN A H    3  
ATOM 7108  H HA   . ASN A 1 49  ? -21.171 13.176  1.634   1.00 0.00 ? 49  ASN A HA   3  
ATOM 7109  H HB2  . ASN A 1 49  ? -18.907 13.589  3.163   1.00 0.00 ? 49  ASN A HB2  3  
ATOM 7110  H HB3  . ASN A 1 49  ? -18.503 14.372  1.638   1.00 0.00 ? 49  ASN A HB3  3  
ATOM 7111  H HD21 . ASN A 1 49  ? -20.761 14.285  4.305   1.00 0.00 ? 49  ASN A HD21 3  
ATOM 7112  H HD22 . ASN A 1 49  ? -21.398 15.883  4.069   1.00 0.00 ? 49  ASN A HD22 3  
ATOM 7113  N N    . GLN A 1 50  ? -18.667 12.432  -0.374  1.00 0.00 ? 50  GLN A N    3  
ATOM 7114  C CA   . GLN A 1 50  ? -18.245 12.427  -1.771  1.00 0.00 ? 50  GLN A CA   3  
ATOM 7115  C C    . GLN A 1 50  ? -17.817 13.823  -2.212  1.00 0.00 ? 50  GLN A C    3  
ATOM 7116  O O    . GLN A 1 50  ? -17.959 14.188  -3.378  1.00 0.00 ? 50  GLN A O    3  
ATOM 7117  C CB   . GLN A 1 50  ? -19.374 11.911  -2.667  1.00 0.00 ? 50  GLN A CB   3  
ATOM 7118  C CG   . GLN A 1 50  ? -18.978 10.708  -3.507  1.00 0.00 ? 50  GLN A CG   3  
ATOM 7119  C CD   . GLN A 1 50  ? -17.870 11.023  -4.493  1.00 0.00 ? 50  GLN A CD   3  
ATOM 7120  O OE1  . GLN A 1 50  ? -18.125 11.486  -5.606  1.00 0.00 ? 50  GLN A OE1  3  
ATOM 7121  N NE2  . GLN A 1 50  ? -16.630 10.774  -4.089  1.00 0.00 ? 50  GLN A NE2  3  
ATOM 7122  H H    . GLN A 1 50  ? -18.104 11.991  0.290   1.00 0.00 ? 50  GLN A H    3  
ATOM 7123  H HA   . GLN A 1 50  ? -17.398 11.763  -1.855  1.00 0.00 ? 50  GLN A HA   3  
ATOM 7124  H HB2  . GLN A 1 50  ? -20.208 11.627  -2.043  1.00 0.00 ? 50  GLN A HB2  3  
ATOM 7125  H HB3  . GLN A 1 50  ? -19.684 12.702  -3.333  1.00 0.00 ? 50  GLN A HB3  3  
ATOM 7126  H HG2  . GLN A 1 50  ? -18.639 9.921   -2.850  1.00 0.00 ? 50  GLN A HG2  3  
ATOM 7127  H HG3  . GLN A 1 50  ? -19.844 10.368  -4.057  1.00 0.00 ? 50  GLN A HG3  3  
ATOM 7128  H HE21 . GLN A 1 50  ? -16.503 10.404  -3.186  1.00 0.00 ? 50  GLN A HE21 3  
ATOM 7129  H HE22 . GLN A 1 50  ? -15.892 10.970  -4.710  1.00 0.00 ? 50  GLN A HE22 3  
ATOM 7130  N N    . LYS A 1 51  ? -17.289 14.598  -1.269  1.00 0.00 ? 51  LYS A N    3  
ATOM 7131  C CA   . LYS A 1 51  ? -16.837 15.954  -1.557  1.00 0.00 ? 51  LYS A CA   3  
ATOM 7132  C C    . LYS A 1 51  ? -15.571 15.933  -2.409  1.00 0.00 ? 51  LYS A C    3  
ATOM 7133  O O    . LYS A 1 51  ? -15.307 16.866  -3.168  1.00 0.00 ? 51  LYS A O    3  
ATOM 7134  C CB   . LYS A 1 51  ? -16.576 16.713  -0.255  1.00 0.00 ? 51  LYS A CB   3  
ATOM 7135  C CG   . LYS A 1 51  ? -17.817 16.894  0.604   1.00 0.00 ? 51  LYS A CG   3  
ATOM 7136  C CD   . LYS A 1 51  ? -18.437 18.268  0.406   1.00 0.00 ? 51  LYS A CD   3  
ATOM 7137  C CE   . LYS A 1 51  ? -19.505 18.246  -0.676  1.00 0.00 ? 51  LYS A CE   3  
ATOM 7138  N NZ   . LYS A 1 51  ? -20.766 17.617  -0.200  1.00 0.00 ? 51  LYS A NZ   3  
ATOM 7139  H H    . LYS A 1 51  ? -17.201 14.249  -0.358  1.00 0.00 ? 51  LYS A H    3  
ATOM 7140  H HA   . LYS A 1 51  ? -17.618 16.455  -2.106  1.00 0.00 ? 51  LYS A HA   3  
ATOM 7141  H HB2  . LYS A 1 51  ? -15.841 16.173  0.323   1.00 0.00 ? 51  LYS A HB2  3  
ATOM 7142  H HB3  . LYS A 1 51  ? -16.184 17.692  -0.494  1.00 0.00 ? 51  LYS A HB3  3  
ATOM 7143  H HG2  . LYS A 1 51  ? -18.543 16.141  0.333   1.00 0.00 ? 51  LYS A HG2  3  
ATOM 7144  H HG3  . LYS A 1 51  ? -17.544 16.777  1.643   1.00 0.00 ? 51  LYS A HG3  3  
ATOM 7145  H HD2  . LYS A 1 51  ? -18.887 18.586  1.335   1.00 0.00 ? 51  LYS A HD2  3  
ATOM 7146  H HD3  . LYS A 1 51  ? -17.662 18.964  0.122   1.00 0.00 ? 51  LYS A HD3  3  
ATOM 7147  H HE2  . LYS A 1 51  ? -19.711 19.262  -0.978  1.00 0.00 ? 51  LYS A HE2  3  
ATOM 7148  H HE3  . LYS A 1 51  ? -19.130 17.689  -1.522  1.00 0.00 ? 51  LYS A HE3  3  
ATOM 7149  H HZ1  . LYS A 1 51  ? -21.507 17.708  -0.924  1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 7150  H HZ2  . LYS A 1 51  ? -21.092 18.080  0.672   1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 7151  H HZ3  . LYS A 1 51  ? -20.609 16.606  -0.004  1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 7152  N N    . ASP A 1 52  ? -14.793 14.863  -2.280  1.00 0.00 ? 52  ASP A N    3  
ATOM 7153  C CA   . ASP A 1 52  ? -13.558 14.719  -3.040  1.00 0.00 ? 52  ASP A CA   3  
ATOM 7154  C C    . ASP A 1 52  ? -13.723 13.686  -4.152  1.00 0.00 ? 52  ASP A C    3  
ATOM 7155  O O    . ASP A 1 52  ? -13.231 12.562  -4.045  1.00 0.00 ? 52  ASP A O    3  
ATOM 7156  C CB   . ASP A 1 52  ? -12.411 14.310  -2.114  1.00 0.00 ? 52  ASP A CB   3  
ATOM 7157  C CG   . ASP A 1 52  ? -11.683 15.505  -1.530  1.00 0.00 ? 52  ASP A CG   3  
ATOM 7158  O OD1  . ASP A 1 52  ? -12.362 16.469  -1.116  1.00 0.00 ? 52  ASP A OD1  3  
ATOM 7159  O OD2  . ASP A 1 52  ? -10.435 15.477  -1.487  1.00 0.00 ? 52  ASP A OD2  3  
ATOM 7160  H H    . ASP A 1 52  ? -15.058 14.152  -1.660  1.00 0.00 ? 52  ASP A H    3  
ATOM 7161  H HA   . ASP A 1 52  ? -13.327 15.676  -3.484  1.00 0.00 ? 52  ASP A HA   3  
ATOM 7162  H HB2  . ASP A 1 52  ? -12.806 13.720  -1.300  1.00 0.00 ? 52  ASP A HB2  3  
ATOM 7163  H HB3  . ASP A 1 52  ? -11.701 13.717  -2.671  1.00 0.00 ? 52  ASP A HB3  3  
ATOM 7164  N N    . PRO A 1 53  ? -14.422 14.054  -5.240  1.00 0.00 ? 53  PRO A N    3  
ATOM 7165  C CA   . PRO A 1 53  ? -14.651 13.152  -6.373  1.00 0.00 ? 53  PRO A CA   3  
ATOM 7166  C C    . PRO A 1 53  ? -13.369 12.855  -7.142  1.00 0.00 ? 53  PRO A C    3  
ATOM 7167  O O    . PRO A 1 53  ? -13.040 13.541  -8.110  1.00 0.00 ? 53  PRO A O    3  
ATOM 7168  C CB   . PRO A 1 53  ? -15.637 13.925  -7.252  1.00 0.00 ? 53  PRO A CB   3  
ATOM 7169  C CG   . PRO A 1 53  ? -15.412 15.356  -6.907  1.00 0.00 ? 53  PRO A CG   3  
ATOM 7170  C CD   . PRO A 1 53  ? -15.044 15.375  -5.450  1.00 0.00 ? 53  PRO A CD   3  
ATOM 7171  H HA   . PRO A 1 53  ? -15.100 12.223  -6.053  1.00 0.00 ? 53  PRO A HA   3  
ATOM 7172  H HB2  . PRO A 1 53  ? -15.423 13.731  -8.293  1.00 0.00 ? 53  PRO A HB2  3  
ATOM 7173  H HB3  . PRO A 1 53  ? -16.646 13.618  -7.022  1.00 0.00 ? 53  PRO A HB3  3  
ATOM 7174  H HG2  . PRO A 1 53  ? -14.604 15.756  -7.503  1.00 0.00 ? 53  PRO A HG2  3  
ATOM 7175  H HG3  . PRO A 1 53  ? -16.318 15.921  -7.071  1.00 0.00 ? 53  PRO A HG3  3  
ATOM 7176  H HD2  . PRO A 1 53  ? -14.339 16.169  -5.248  1.00 0.00 ? 53  PRO A HD2  3  
ATOM 7177  H HD3  . PRO A 1 53  ? -15.926 15.487  -4.839  1.00 0.00 ? 53  PRO A HD3  3  
ATOM 7178  N N    . GLY A 1 54  ? -12.649 11.827  -6.706  1.00 0.00 ? 54  GLY A N    3  
ATOM 7179  C CA   . GLY A 1 54  ? -11.411 11.455  -7.363  1.00 0.00 ? 54  GLY A CA   3  
ATOM 7180  C C    . GLY A 1 54  ? -10.657 10.379  -6.608  1.00 0.00 ? 54  GLY A C    3  
ATOM 7181  O O    . GLY A 1 54  ? -10.080 9.476   -7.213  1.00 0.00 ? 54  GLY A O    3  
ATOM 7182  H H    . GLY A 1 54  ? -12.962 11.316  -5.930  1.00 0.00 ? 54  GLY A H    3  
ATOM 7183  H HA2  . GLY A 1 54  ? -11.637 11.092  -8.355  1.00 0.00 ? 54  GLY A HA2  3  
ATOM 7184  H HA3  . GLY A 1 54  ? -10.783 12.329  -7.446  1.00 0.00 ? 54  GLY A HA3  3  
ATOM 7185  N N    . VAL A 1 55  ? -10.662 10.476  -5.282  1.00 0.00 ? 55  VAL A N    3  
ATOM 7186  C CA   . VAL A 1 55  ? -9.974  9.506   -4.436  1.00 0.00 ? 55  VAL A CA   3  
ATOM 7187  C C    . VAL A 1 55  ? -10.377 8.077   -4.787  1.00 0.00 ? 55  VAL A C    3  
ATOM 7188  O O    . VAL A 1 55  ? -9.548  7.273   -5.213  1.00 0.00 ? 55  VAL A O    3  
ATOM 7189  C CB   . VAL A 1 55  ? -10.271 9.755   -2.945  1.00 0.00 ? 55  VAL A CB   3  
ATOM 7190  C CG1  . VAL A 1 55  ? -9.411  8.856   -2.069  1.00 0.00 ? 55  VAL A CG1  3  
ATOM 7191  C CG2  . VAL A 1 55  ? -10.056 11.219  -2.594  1.00 0.00 ? 55  VAL A CG2  3  
ATOM 7192  H H    . VAL A 1 55  ? -11.141 11.220  -4.861  1.00 0.00 ? 55  VAL A H    3  
ATOM 7193  H HA   . VAL A 1 55  ? -8.911  9.618   -4.593  1.00 0.00 ? 55  VAL A HA   3  
ATOM 7194  H HB   . VAL A 1 55  ? -11.307 9.511   -2.760  1.00 0.00 ? 55  VAL A HB   3  
ATOM 7195  H HG11 . VAL A 1 55  ? -9.555  7.827   -2.359  1.00 0.00 ? 55  VAL A HG11 3  
ATOM 7196  H HG12 . VAL A 1 55  ? -9.695  8.983   -1.035  1.00 0.00 ? 55  VAL A HG12 3  
ATOM 7197  H HG13 . VAL A 1 55  ? -8.372  9.123   -2.192  1.00 0.00 ? 55  VAL A HG13 3  
ATOM 7198  H HG21 . VAL A 1 55  ? -9.351  11.656  -3.285  1.00 0.00 ? 55  VAL A HG21 3  
ATOM 7199  H HG22 . VAL A 1 55  ? -9.670  11.295  -1.588  1.00 0.00 ? 55  VAL A HG22 3  
ATOM 7200  H HG23 . VAL A 1 55  ? -10.997 11.746  -2.659  1.00 0.00 ? 55  VAL A HG23 3  
ATOM 7201  N N    . LEU A 1 56  ? -11.655 7.770   -4.602  1.00 0.00 ? 56  LEU A N    3  
ATOM 7202  C CA   . LEU A 1 56  ? -12.177 6.444   -4.893  1.00 0.00 ? 56  LEU A CA   3  
ATOM 7203  C C    . LEU A 1 56  ? -12.004 6.107   -6.372  1.00 0.00 ? 56  LEU A C    3  
ATOM 7204  O O    . LEU A 1 56  ? -11.484 5.049   -6.723  1.00 0.00 ? 56  LEU A O    3  
ATOM 7205  C CB   . LEU A 1 56  ? -13.654 6.389   -4.493  1.00 0.00 ? 56  LEU A CB   3  
ATOM 7206  C CG   . LEU A 1 56  ? -14.503 5.324   -5.187  1.00 0.00 ? 56  LEU A CG   3  
ATOM 7207  C CD1  . LEU A 1 56  ? -14.237 3.953   -4.587  1.00 0.00 ? 56  LEU A CD1  3  
ATOM 7208  C CD2  . LEU A 1 56  ? -15.973 5.687   -5.075  1.00 0.00 ? 56  LEU A CD2  3  
ATOM 7209  H H    . LEU A 1 56  ? -12.269 8.453   -4.257  1.00 0.00 ? 56  LEU A H    3  
ATOM 7210  H HA   . LEU A 1 56  ? -11.625 5.729   -4.303  1.00 0.00 ? 56  LEU A HA   3  
ATOM 7211  H HB2  . LEU A 1 56  ? -13.706 6.219   -3.428  1.00 0.00 ? 56  LEU A HB2  3  
ATOM 7212  H HB3  . LEU A 1 56  ? -14.091 7.354   -4.704  1.00 0.00 ? 56  LEU A HB3  3  
ATOM 7213  H HG   . LEU A 1 56  ? -14.246 5.287   -6.235  1.00 0.00 ? 56  LEU A HG   3  
ATOM 7214  H HD11 . LEU A 1 56  ? -13.206 3.681   -4.755  1.00 0.00 ? 56  LEU A HD11 3  
ATOM 7215  H HD12 . LEU A 1 56  ? -14.882 3.224   -5.055  1.00 0.00 ? 56  LEU A HD12 3  
ATOM 7216  H HD13 . LEU A 1 56  ? -14.435 3.980   -3.526  1.00 0.00 ? 56  LEU A HD13 3  
ATOM 7217  H HD21 . LEU A 1 56  ? -16.063 6.744   -4.860  1.00 0.00 ? 56  LEU A HD21 3  
ATOM 7218  H HD22 . LEU A 1 56  ? -16.425 5.118   -4.277  1.00 0.00 ? 56  LEU A HD22 3  
ATOM 7219  H HD23 . LEU A 1 56  ? -16.471 5.465   -6.006  1.00 0.00 ? 56  LEU A HD23 3  
ATOM 7220  N N    . ASP A 1 57  ? -12.451 7.013   -7.232  1.00 0.00 ? 57  ASP A N    3  
ATOM 7221  C CA   . ASP A 1 57  ? -12.355 6.817   -8.673  1.00 0.00 ? 57  ASP A CA   3  
ATOM 7222  C C    . ASP A 1 57  ? -10.914 6.554   -9.104  1.00 0.00 ? 57  ASP A C    3  
ATOM 7223  O O    . ASP A 1 57  ? -10.670 5.843   -10.078 1.00 0.00 ? 57  ASP A O    3  
ATOM 7224  C CB   . ASP A 1 57  ? -12.905 8.040   -9.406  1.00 0.00 ? 57  ASP A CB   3  
ATOM 7225  C CG   . ASP A 1 57  ? -13.483 7.691   -10.763 1.00 0.00 ? 57  ASP A CG   3  
ATOM 7226  O OD1  . ASP A 1 57  ? -12.798 6.989   -11.537 1.00 0.00 ? 57  ASP A OD1  3  
ATOM 7227  O OD2  . ASP A 1 57  ? -14.619 8.120   -11.054 1.00 0.00 ? 57  ASP A OD2  3  
ATOM 7228  H H    . ASP A 1 57  ? -12.860 7.834   -6.888  1.00 0.00 ? 57  ASP A H    3  
ATOM 7229  H HA   . ASP A 1 57  ? -12.957 5.957   -8.929  1.00 0.00 ? 57  ASP A HA   3  
ATOM 7230  H HB2  . ASP A 1 57  ? -13.685 8.488   -8.807  1.00 0.00 ? 57  ASP A HB2  3  
ATOM 7231  H HB3  . ASP A 1 57  ? -12.108 8.756   -9.545  1.00 0.00 ? 57  ASP A HB3  3  
ATOM 7232  N N    . ARG A 1 58  ? -9.965  7.131   -8.375  1.00 0.00 ? 58  ARG A N    3  
ATOM 7233  C CA   . ARG A 1 58  ? -8.550  6.956   -8.688  1.00 0.00 ? 58  ARG A CA   3  
ATOM 7234  C C    . ARG A 1 58  ? -8.157  5.481   -8.640  1.00 0.00 ? 58  ARG A C    3  
ATOM 7235  O O    . ARG A 1 58  ? -7.421  4.996   -9.500  1.00 0.00 ? 58  ARG A O    3  
ATOM 7236  C CB   . ARG A 1 58  ? -7.685  7.757   -7.710  1.00 0.00 ? 58  ARG A CB   3  
ATOM 7237  C CG   . ARG A 1 58  ? -6.908  8.886   -8.367  1.00 0.00 ? 58  ARG A CG   3  
ATOM 7238  C CD   . ARG A 1 58  ? -7.835  9.891   -9.031  1.00 0.00 ? 58  ARG A CD   3  
ATOM 7239  N NE   . ARG A 1 58  ? -7.106  10.834  -9.875  1.00 0.00 ? 58  ARG A NE   3  
ATOM 7240  C CZ   . ARG A 1 58  ? -6.366  11.833  -9.400  1.00 0.00 ? 58  ARG A CZ   3  
ATOM 7241  N NH1  . ARG A 1 58  ? -6.256  12.024  -8.090  1.00 0.00 ? 58  ARG A NH1  3  
ATOM 7242  N NH2  . ARG A 1 58  ? -5.734  12.645  -10.236 1.00 0.00 ? 58  ARG A NH2  3  
ATOM 7243  H H    . ARG A 1 58  ? -10.220 7.687   -7.610  1.00 0.00 ? 58  ARG A H    3  
ATOM 7244  H HA   . ARG A 1 58  ? -8.384  7.327   -9.688  1.00 0.00 ? 58  ARG A HA   3  
ATOM 7245  H HB2  . ARG A 1 58  ? -8.322  8.183   -6.950  1.00 0.00 ? 58  ARG A HB2  3  
ATOM 7246  H HB3  . ARG A 1 58  ? -6.977  7.089   -7.239  1.00 0.00 ? 58  ARG A HB3  3  
ATOM 7247  H HG2  . ARG A 1 58  ? -6.323  9.393   -7.615  1.00 0.00 ? 58  ARG A HG2  3  
ATOM 7248  H HG3  . ARG A 1 58  ? -6.249  8.468   -9.116  1.00 0.00 ? 58  ARG A HG3  3  
ATOM 7249  H HD2  . ARG A 1 58  ? -8.548  9.355   -9.640  1.00 0.00 ? 58  ARG A HD2  3  
ATOM 7250  H HD3  . ARG A 1 58  ? -8.359  10.439  -8.262  1.00 0.00 ? 58  ARG A HD3  3  
ATOM 7251  H HE   . ARG A 1 58  ? -7.170  10.717  -10.845 1.00 0.00 ? 58  ARG A HE   3  
ATOM 7252  H HH11 . ARG A 1 58  ? -6.731  11.416  -7.454  1.00 0.00 ? 58  ARG A HH11 3  
ATOM 7253  H HH12 . ARG A 1 58  ? -5.697  12.776  -7.740  1.00 0.00 ? 58  ARG A HH12 3  
ATOM 7254  H HH22 . ARG A 1 58  ? -5.178  13.397  -9.879  1.00 0.00 ? 58  ARG A HH22 3  
ATOM 7255  N N    . MET A 1 59  ? -8.646  4.777   -7.625  1.00 0.00 ? 59  MET A N    3  
ATOM 7256  C CA   . MET A 1 59  ? -8.340  3.359   -7.459  1.00 0.00 ? 59  MET A CA   3  
ATOM 7257  C C    . MET A 1 59  ? -8.883  2.536   -8.618  1.00 0.00 ? 59  MET A C    3  
ATOM 7258  O O    . MET A 1 59  ? -8.152  1.776   -9.247  1.00 0.00 ? 59  MET A O    3  
ATOM 7259  C CB   . MET A 1 59  ? -8.908  2.858   -6.125  1.00 0.00 ? 59  MET A CB   3  
ATOM 7260  C CG   . MET A 1 59  ? -10.284 2.199   -6.208  1.00 0.00 ? 59  MET A CG   3  
ATOM 7261  S SD   . MET A 1 59  ? -10.800 1.487   -4.635  1.00 0.00 ? 59  MET A SD   3  
ATOM 7262  C CE   . MET A 1 59  ? -9.926  2.560   -3.505  1.00 0.00 ? 59  MET A CE   3  
ATOM 7263  H H    . MET A 1 59  ? -9.222  5.221   -6.968  1.00 0.00 ? 59  MET A H    3  
ATOM 7264  H HA   . MET A 1 59  ? -7.267  3.254   -7.437  1.00 0.00 ? 59  MET A HA   3  
ATOM 7265  H HB2  . MET A 1 59  ? -8.223  2.141   -5.708  1.00 0.00 ? 59  MET A HB2  3  
ATOM 7266  H HB3  . MET A 1 59  ? -8.981  3.698   -5.452  1.00 0.00 ? 59  MET A HB3  3  
ATOM 7267  H HG2  . MET A 1 59  ? -11.009 2.941   -6.502  1.00 0.00 ? 59  MET A HG2  3  
ATOM 7268  H HG3  . MET A 1 59  ? -10.251 1.413   -6.947  1.00 0.00 ? 59  MET A HG3  3  
ATOM 7269  H HE1  . MET A 1 59  ? -10.307 3.564   -3.610  1.00 0.00 ? 59  MET A HE1  3  
ATOM 7270  H HE2  . MET A 1 59  ? -8.871  2.552   -3.744  1.00 0.00 ? 59  MET A HE2  3  
ATOM 7271  H HE3  . MET A 1 59  ? -10.071 2.219   -2.494  1.00 0.00 ? 59  MET A HE3  3  
ATOM 7272  N N    . MET A 1 60  ? -10.171 2.687   -8.885  1.00 0.00 ? 60  MET A N    3  
ATOM 7273  C CA   . MET A 1 60  ? -10.816 1.947   -9.962  1.00 0.00 ? 60  MET A CA   3  
ATOM 7274  C C    . MET A 1 60  ? -10.183 2.269   -11.312 1.00 0.00 ? 60  MET A C    3  
ATOM 7275  O O    . MET A 1 60  ? -10.163 1.429   -12.212 1.00 0.00 ? 60  MET A O    3  
ATOM 7276  C CB   . MET A 1 60  ? -12.312 2.253   -9.989  1.00 0.00 ? 60  MET A CB   3  
ATOM 7277  C CG   . MET A 1 60  ? -13.082 1.564   -8.874  1.00 0.00 ? 60  MET A CG   3  
ATOM 7278  S SD   . MET A 1 60  ? -14.006 0.128   -9.451  1.00 0.00 ? 60  MET A SD   3  
ATOM 7279  C CE   . MET A 1 60  ? -12.700 -0.824  -10.225 1.00 0.00 ? 60  MET A CE   3  
ATOM 7280  H H    . MET A 1 60  ? -10.702 3.303   -8.334  1.00 0.00 ? 60  MET A H    3  
ATOM 7281  H HA   . MET A 1 60  ? -10.681 0.895   -9.761  1.00 0.00 ? 60  MET A HA   3  
ATOM 7282  H HB2  . MET A 1 60  ? -12.454 3.319   -9.893  1.00 0.00 ? 60  MET A HB2  3  
ATOM 7283  H HB3  . MET A 1 60  ? -12.719 1.926   -10.935 1.00 0.00 ? 60  MET A HB3  3  
ATOM 7284  H HG2  . MET A 1 60  ? -12.377 1.240   -8.119  1.00 0.00 ? 60  MET A HG2  3  
ATOM 7285  H HG3  . MET A 1 60  ? -13.772 2.272   -8.441  1.00 0.00 ? 60  MET A HG3  3  
ATOM 7286  H HE1  . MET A 1 60  ? -13.134 -1.559  -10.886 1.00 0.00 ? 60  MET A HE1  3  
ATOM 7287  H HE2  . MET A 1 60  ? -12.119 -1.322  -9.463  1.00 0.00 ? 60  MET A HE2  3  
ATOM 7288  H HE3  . MET A 1 60  ? -12.060 -0.162  -10.790 1.00 0.00 ? 60  MET A HE3  3  
ATOM 7289  N N    . LYS A 1 61  ? -9.663  3.484   -11.448 1.00 0.00 ? 61  LYS A N    3  
ATOM 7290  C CA   . LYS A 1 61  ? -9.025  3.904   -12.692 1.00 0.00 ? 61  LYS A CA   3  
ATOM 7291  C C    . LYS A 1 61  ? -7.616  3.327   -12.800 1.00 0.00 ? 61  LYS A C    3  
ATOM 7292  O O    . LYS A 1 61  ? -7.303  2.595   -13.739 1.00 0.00 ? 61  LYS A O    3  
ATOM 7293  C CB   . LYS A 1 61  ? -8.974  5.430   -12.777 1.00 0.00 ? 61  LYS A CB   3  
ATOM 7294  C CG   . LYS A 1 61  ? -9.382  5.977   -14.135 1.00 0.00 ? 61  LYS A CG   3  
ATOM 7295  C CD   . LYS A 1 61  ? -10.888 5.908   -14.334 1.00 0.00 ? 61  LYS A CD   3  
ATOM 7296  C CE   . LYS A 1 61  ? -11.303 4.609   -15.004 1.00 0.00 ? 61  LYS A CE   3  
ATOM 7297  N NZ   . LYS A 1 61  ? -12.568 4.763   -15.777 1.00 0.00 ? 61  LYS A NZ   3  
ATOM 7298  H H    . LYS A 1 61  ? -9.705  4.110   -10.696 1.00 0.00 ? 61  LYS A H    3  
ATOM 7299  H HA   . LYS A 1 61  ? -9.618  3.526   -13.511 1.00 0.00 ? 61  LYS A HA   3  
ATOM 7300  H HB2  . LYS A 1 61  ? -9.638  5.843   -12.034 1.00 0.00 ? 61  LYS A HB2  3  
ATOM 7301  H HB3  . LYS A 1 61  ? -7.967  5.759   -12.569 1.00 0.00 ? 61  LYS A HB3  3  
ATOM 7302  H HG2  . LYS A 1 61  ? -9.065  7.006   -14.209 1.00 0.00 ? 61  LYS A HG2  3  
ATOM 7303  H HG3  . LYS A 1 61  ? -8.900  5.394   -14.907 1.00 0.00 ? 61  LYS A HG3  3  
ATOM 7304  H HD2  . LYS A 1 61  ? -11.371 5.975   -13.371 1.00 0.00 ? 61  LYS A HD2  3  
ATOM 7305  H HD3  . LYS A 1 61  ? -11.196 6.738   -14.952 1.00 0.00 ? 61  LYS A HD3  3  
ATOM 7306  H HE2  . LYS A 1 61  ? -10.518 4.297   -15.675 1.00 0.00 ? 61  LYS A HE2  3  
ATOM 7307  H HE3  . LYS A 1 61  ? -11.446 3.856   -14.243 1.00 0.00 ? 61  LYS A HE3  3  
ATOM 7308  H HZ1  . LYS A 1 61  ? -13.236 5.362   -15.252 1.00 0.00 ? 61  LYS A HZ1  3  
ATOM 7309  H HZ2  . LYS A 1 61  ? -13.004 3.833   -15.936 1.00 0.00 ? 61  LYS A HZ2  3  
ATOM 7310  H HZ3  . LYS A 1 61  ? -12.371 5.204   -16.698 1.00 0.00 ? 61  LYS A HZ3  3  
ATOM 7311  N N    . LYS A 1 62  ? -6.770  3.666   -11.830 1.00 0.00 ? 62  LYS A N    3  
ATOM 7312  C CA   . LYS A 1 62  ? -5.390  3.187   -11.808 1.00 0.00 ? 62  LYS A CA   3  
ATOM 7313  C C    . LYS A 1 62  ? -5.290  1.762   -11.261 1.00 0.00 ? 62  LYS A C    3  
ATOM 7314  O O    . LYS A 1 62  ? -4.191  1.249   -11.056 1.00 0.00 ? 62  LYS A O    3  
ATOM 7315  C CB   . LYS A 1 62  ? -4.520  4.123   -10.966 1.00 0.00 ? 62  LYS A CB   3  
ATOM 7316  C CG   . LYS A 1 62  ? -4.135  5.406   -11.683 1.00 0.00 ? 62  LYS A CG   3  
ATOM 7317  C CD   . LYS A 1 62  ? -5.249  6.438   -11.613 1.00 0.00 ? 62  LYS A CD   3  
ATOM 7318  C CE   . LYS A 1 62  ? -5.131  7.465   -12.727 1.00 0.00 ? 62  LYS A CE   3  
ATOM 7319  N NZ   . LYS A 1 62  ? -4.685  8.791   -12.216 1.00 0.00 ? 62  LYS A NZ   3  
ATOM 7320  H H    . LYS A 1 62  ? -7.081  4.253   -11.110 1.00 0.00 ? 62  LYS A H    3  
ATOM 7321  H HA   . LYS A 1 62  ? -5.024  3.192   -12.824 1.00 0.00 ? 62  LYS A HA   3  
ATOM 7322  H HB2  . LYS A 1 62  ? -5.059  4.385   -10.068 1.00 0.00 ? 62  LYS A HB2  3  
ATOM 7323  H HB3  . LYS A 1 62  ? -3.614  3.603   -10.691 1.00 0.00 ? 62  LYS A HB3  3  
ATOM 7324  H HG2  . LYS A 1 62  ? -3.250  5.815   -11.218 1.00 0.00 ? 62  LYS A HG2  3  
ATOM 7325  H HG3  . LYS A 1 62  ? -3.928  5.182   -12.718 1.00 0.00 ? 62  LYS A HG3  3  
ATOM 7326  H HD2  . LYS A 1 62  ? -6.198  5.932   -11.701 1.00 0.00 ? 62  LYS A HD2  3  
ATOM 7327  H HD3  . LYS A 1 62  ? -5.197  6.944   -10.660 1.00 0.00 ? 62  LYS A HD3  3  
ATOM 7328  H HE2  . LYS A 1 62  ? -4.415  7.111   -13.454 1.00 0.00 ? 62  LYS A HE2  3  
ATOM 7329  H HE3  . LYS A 1 62  ? -6.097  7.576   -13.199 1.00 0.00 ? 62  LYS A HE3  3  
ATOM 7330  H HZ1  . LYS A 1 62  ? -4.190  8.676   -11.309 1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 7331  H HZ2  . LYS A 1 62  ? -5.506  9.413   -12.074 1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 7332  H HZ3  . LYS A 1 62  ? -4.039  9.237   -12.897 1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 7333  N N    . LEU A 1 63  ? -6.437  1.129   -11.012 1.00 0.00 ? 63  LEU A N    3  
ATOM 7334  C CA   . LEU A 1 63  ? -6.466  -0.231  -10.474 1.00 0.00 ? 63  LEU A CA   3  
ATOM 7335  C C    . LEU A 1 63  ? -5.475  -1.133  -11.187 1.00 0.00 ? 63  LEU A C    3  
ATOM 7336  O O    . LEU A 1 63  ? -4.892  -2.035  -10.585 1.00 0.00 ? 63  LEU A O    3  
ATOM 7337  C CB   . LEU A 1 63  ? -7.882  -0.814  -10.562 1.00 0.00 ? 63  LEU A CB   3  
ATOM 7338  C CG   . LEU A 1 63  ? -8.251  -1.456  -11.902 1.00 0.00 ? 63  LEU A CG   3  
ATOM 7339  C CD1  . LEU A 1 63  ? -9.585  -2.178  -11.791 1.00 0.00 ? 63  LEU A CD1  3  
ATOM 7340  C CD2  . LEU A 1 63  ? -8.295  -0.410  -13.008 1.00 0.00 ? 63  LEU A CD2  3  
ATOM 7341  H H    . LEU A 1 63  ? -7.284  1.589   -11.182 1.00 0.00 ? 63  LEU A H    3  
ATOM 7342  H HA   . LEU A 1 63  ? -6.176  -0.178  -9.450  1.00 0.00 ? 63  LEU A HA   3  
ATOM 7343  H HB2  . LEU A 1 63  ? -7.987  -1.562  -9.790  1.00 0.00 ? 63  LEU A HB2  3  
ATOM 7344  H HB3  . LEU A 1 63  ? -8.587  -0.021  -10.367 1.00 0.00 ? 63  LEU A HB3  3  
ATOM 7345  H HG   . LEU A 1 63  ? -7.497  -2.186  -12.161 1.00 0.00 ? 63  LEU A HG   3  
ATOM 7346  H HD11 . LEU A 1 63  ? -10.375 -1.453  -11.660 1.00 0.00 ? 63  LEU A HD11 3  
ATOM 7347  H HD12 . LEU A 1 63  ? -9.564  -2.845  -10.942 1.00 0.00 ? 63  LEU A HD12 3  
ATOM 7348  H HD13 . LEU A 1 63  ? -9.763  -2.746  -12.692 1.00 0.00 ? 63  LEU A HD13 3  
ATOM 7349  H HD21 . LEU A 1 63  ? -8.143  0.571   -12.584 1.00 0.00 ? 63  LEU A HD21 3  
ATOM 7350  H HD22 . LEU A 1 63  ? -9.256  -0.444  -13.500 1.00 0.00 ? 63  LEU A HD22 3  
ATOM 7351  H HD23 . LEU A 1 63  ? -7.515  -0.614  -13.728 1.00 0.00 ? 63  LEU A HD23 3  
ATOM 7352  N N    . ASP A 1 64  ? -5.285  -0.873  -12.465 1.00 0.00 ? 64  ASP A N    3  
ATOM 7353  C CA   . ASP A 1 64  ? -4.361  -1.643  -13.275 1.00 0.00 ? 64  ASP A CA   3  
ATOM 7354  C C    . ASP A 1 64  ? -4.490  -3.144  -13.016 1.00 0.00 ? 64  ASP A C    3  
ATOM 7355  O O    . ASP A 1 64  ? -3.721  -3.717  -12.246 1.00 0.00 ? 64  ASP A O    3  
ATOM 7356  C CB   . ASP A 1 64  ? -2.923  -1.190  -13.017 1.00 0.00 ? 64  ASP A CB   3  
ATOM 7357  C CG   . ASP A 1 64  ? -1.938  -1.810  -13.987 1.00 0.00 ? 64  ASP A CG   3  
ATOM 7358  O OD1  . ASP A 1 64  ? -2.132  -1.654  -15.211 1.00 0.00 ? 64  ASP A OD1  3  
ATOM 7359  O OD2  . ASP A 1 64  ? -0.973  -2.454  -13.524 1.00 0.00 ? 64  ASP A OD2  3  
ATOM 7360  H H    . ASP A 1 64  ? -5.778  -0.134  -12.878 1.00 0.00 ? 64  ASP A H    3  
ATOM 7361  H HA   . ASP A 1 64  ? -4.609  -1.446  -14.294 1.00 0.00 ? 64  ASP A HA   3  
ATOM 7362  H HB2  . ASP A 1 64  ? -2.867  -0.116  -13.114 1.00 0.00 ? 64  ASP A HB2  3  
ATOM 7363  H HB3  . ASP A 1 64  ? -2.638  -1.472  -12.013 1.00 0.00 ? 64  ASP A HB3  3  
ATOM 7364  N N    . LEU A 1 65  ? -5.462  -3.776  -13.668 1.00 0.00 ? 65  LEU A N    3  
ATOM 7365  C CA   . LEU A 1 65  ? -5.678  -5.210  -13.506 1.00 0.00 ? 65  LEU A CA   3  
ATOM 7366  C C    . LEU A 1 65  ? -4.836  -5.997  -14.504 1.00 0.00 ? 65  LEU A C    3  
ATOM 7367  O O    . LEU A 1 65  ? -5.127  -6.016  -15.700 1.00 0.00 ? 65  LEU A O    3  
ATOM 7368  C CB   . LEU A 1 65  ? -7.159  -5.557  -13.685 1.00 0.00 ? 65  LEU A CB   3  
ATOM 7369  C CG   . LEU A 1 65  ? -8.134  -4.707  -12.866 1.00 0.00 ? 65  LEU A CG   3  
ATOM 7370  C CD1  . LEU A 1 65  ? -9.562  -5.186  -13.079 1.00 0.00 ? 65  LEU A CD1  3  
ATOM 7371  C CD2  . LEU A 1 65  ? -7.773  -4.747  -11.386 1.00 0.00 ? 65  LEU A CD2  3  
ATOM 7372  H H    . LEU A 1 65  ? -6.043  -3.268  -14.272 1.00 0.00 ? 65  LEU A H    3  
ATOM 7373  H HA   . LEU A 1 65  ? -5.372  -5.479  -12.507 1.00 0.00 ? 65  LEU A HA   3  
ATOM 7374  H HB2  . LEU A 1 65  ? -7.408  -5.444  -14.730 1.00 0.00 ? 65  LEU A HB2  3  
ATOM 7375  H HB3  . LEU A 1 65  ? -7.299  -6.590  -13.409 1.00 0.00 ? 65  LEU A HB3  3  
ATOM 7376  H HG   . LEU A 1 65  ? -8.074  -3.682  -13.199 1.00 0.00 ? 65  LEU A HG   3  
ATOM 7377  H HD11 . LEU A 1 65  ? -9.599  -6.261  -12.978 1.00 0.00 ? 65  LEU A HD11 3  
ATOM 7378  H HD12 . LEU A 1 65  ? -9.891  -4.906  -14.069 1.00 0.00 ? 65  LEU A HD12 3  
ATOM 7379  H HD13 . LEU A 1 65  ? -10.208 -4.732  -12.342 1.00 0.00 ? 65  LEU A HD13 3  
ATOM 7380  H HD21 . LEU A 1 65  ? -8.483  -5.365  -10.858 1.00 0.00 ? 65  LEU A HD21 3  
ATOM 7381  H HD22 . LEU A 1 65  ? -7.798  -3.747  -10.981 1.00 0.00 ? 65  LEU A HD22 3  
ATOM 7382  H HD23 . LEU A 1 65  ? -6.782  -5.158  -11.267 1.00 0.00 ? 65  LEU A HD23 3  
ATOM 7383  N N    . ASN A 1 66  ? -3.789  -6.645  -14.003 1.00 0.00 ? 66  ASN A N    3  
ATOM 7384  C CA   . ASN A 1 66  ? -2.902  -7.434  -14.851 1.00 0.00 ? 66  ASN A CA   3  
ATOM 7385  C C    . ASN A 1 66  ? -3.318  -8.901  -14.862 1.00 0.00 ? 66  ASN A C    3  
ATOM 7386  O O    . ASN A 1 66  ? -3.179  -9.588  -15.873 1.00 0.00 ? 66  ASN A O    3  
ATOM 7387  C CB   . ASN A 1 66  ? -1.455  -7.305  -14.370 1.00 0.00 ? 66  ASN A CB   3  
ATOM 7388  C CG   . ASN A 1 66  ? -0.708  -6.191  -15.075 1.00 0.00 ? 66  ASN A CG   3  
ATOM 7389  O OD1  . ASN A 1 66  ? 0.352   -6.412  -15.660 1.00 0.00 ? 66  ASN A OD1  3  
ATOM 7390  N ND2  . ASN A 1 66  ? -1.259  -4.983  -15.021 1.00 0.00 ? 66  ASN A ND2  3  
ATOM 7391  H H    . ASN A 1 66  ? -3.609  -6.591  -13.042 1.00 0.00 ? 66  ASN A H    3  
ATOM 7392  H HA   . ASN A 1 66  ? -2.972  -7.046  -15.856 1.00 0.00 ? 66  ASN A HA   3  
ATOM 7393  H HB2  . ASN A 1 66  ? -1.452  -7.101  -13.309 1.00 0.00 ? 66  ASN A HB2  3  
ATOM 7394  H HB3  . ASN A 1 66  ? -0.937  -8.235  -14.554 1.00 0.00 ? 66  ASN A HB3  3  
ATOM 7395  H HD21 . ASN A 1 66  ? -2.108  -4.882  -14.534 1.00 0.00 ? 66  ASN A HD21 3  
ATOM 7396  H HD22 . ASN A 1 66  ? -0.794  -4.242  -15.472 1.00 0.00 ? 66  ASN A HD22 3  
ATOM 7397  N N    . SER A 1 67  ? -3.830  -9.375  -13.730 1.00 0.00 ? 67  SER A N    3  
ATOM 7398  C CA   . SER A 1 67  ? -4.266  -10.762 -13.611 1.00 0.00 ? 67  SER A CA   3  
ATOM 7399  C C    . SER A 1 67  ? -5.350  -11.080 -14.635 1.00 0.00 ? 67  SER A C    3  
ATOM 7400  O O    . SER A 1 67  ? -5.684  -10.248 -15.479 1.00 0.00 ? 67  SER A O    3  
ATOM 7401  C CB   . SER A 1 67  ? -4.786  -11.036 -12.198 1.00 0.00 ? 67  SER A CB   3  
ATOM 7402  O OG   . SER A 1 67  ? -3.763  -11.564 -11.372 1.00 0.00 ? 67  SER A OG   3  
ATOM 7403  H H    . SER A 1 67  ? -3.915  -8.779  -12.957 1.00 0.00 ? 67  SER A H    3  
ATOM 7404  H HA   . SER A 1 67  ? -3.412  -11.394 -13.800 1.00 0.00 ? 67  SER A HA   3  
ATOM 7405  H HB2  . SER A 1 67  ? -5.141  -10.113 -11.763 1.00 0.00 ? 67  SER A HB2  3  
ATOM 7406  H HB3  . SER A 1 67  ? -5.596  -11.747 -12.247 1.00 0.00 ? 67  SER A HB3  3  
ATOM 7407  H HG   . SER A 1 67  ? -3.796  -11.141 -10.510 1.00 0.00 ? 67  SER A HG   3  
ATOM 7408  N N    . ASP A 1 68  ? -5.895  -12.290 -14.557 1.00 0.00 ? 68  ASP A N    3  
ATOM 7409  C CA   . ASP A 1 68  ? -6.943  -12.719 -15.477 1.00 0.00 ? 68  ASP A CA   3  
ATOM 7410  C C    . ASP A 1 68  ? -8.121  -11.747 -15.460 1.00 0.00 ? 68  ASP A C    3  
ATOM 7411  O O    . ASP A 1 68  ? -8.881  -11.662 -16.425 1.00 0.00 ? 68  ASP A O    3  
ATOM 7412  C CB   . ASP A 1 68  ? -7.423  -14.125 -15.116 1.00 0.00 ? 68  ASP A CB   3  
ATOM 7413  C CG   . ASP A 1 68  ? -7.740  -14.960 -16.342 1.00 0.00 ? 68  ASP A CG   3  
ATOM 7414  O OD1  . ASP A 1 68  ? -6.803  -15.562 -16.909 1.00 0.00 ? 68  ASP A OD1  3  
ATOM 7415  O OD2  . ASP A 1 68  ? -8.925  -15.012 -16.734 1.00 0.00 ? 68  ASP A OD2  3  
ATOM 7416  H H    . ASP A 1 68  ? -5.587  -12.909 -13.863 1.00 0.00 ? 68  ASP A H    3  
ATOM 7417  H HA   . ASP A 1 68  ? -6.523  -12.738 -16.472 1.00 0.00 ? 68  ASP A HA   3  
ATOM 7418  H HB2  . ASP A 1 68  ? -6.653  -14.629 -14.551 1.00 0.00 ? 68  ASP A HB2  3  
ATOM 7419  H HB3  . ASP A 1 68  ? -8.316  -14.051 -14.513 1.00 0.00 ? 68  ASP A HB3  3  
ATOM 7420  N N    . GLY A 1 69  ? -8.267  -11.018 -14.359 1.00 0.00 ? 69  GLY A N    3  
ATOM 7421  C CA   . GLY A 1 69  ? -9.354  -10.064 -14.240 1.00 0.00 ? 69  GLY A CA   3  
ATOM 7422  C C    . GLY A 1 69  ? -9.717  -9.774  -12.796 1.00 0.00 ? 69  GLY A C    3  
ATOM 7423  O O    . GLY A 1 69  ? -10.262 -8.714  -12.488 1.00 0.00 ? 69  GLY A O    3  
ATOM 7424  H H    . GLY A 1 69  ? -7.632  -11.128 -13.620 1.00 0.00 ? 69  GLY A H    3  
ATOM 7425  H HA2  . GLY A 1 69  ? -9.064  -9.142  -14.720 1.00 0.00 ? 69  GLY A HA2  3  
ATOM 7426  H HA3  . GLY A 1 69  ? -10.223 -10.462 -14.744 1.00 0.00 ? 69  GLY A HA3  3  
ATOM 7427  N N    . GLN A 1 70  ? -9.414  -10.716 -11.909 1.00 0.00 ? 70  GLN A N    3  
ATOM 7428  C CA   . GLN A 1 70  ? -9.714  -10.555 -10.491 1.00 0.00 ? 70  GLN A CA   3  
ATOM 7429  C C    . GLN A 1 70  ? -8.826  -9.489  -9.861  1.00 0.00 ? 70  GLN A C    3  
ATOM 7430  O O    . GLN A 1 70  ? -7.902  -8.983  -10.499 1.00 0.00 ? 70  GLN A O    3  
ATOM 7431  C CB   . GLN A 1 70  ? -9.533  -11.886 -9.757  1.00 0.00 ? 70  GLN A CB   3  
ATOM 7432  C CG   . GLN A 1 70  ? -10.827 -12.662 -9.580  1.00 0.00 ? 70  GLN A CG   3  
ATOM 7433  C CD   . GLN A 1 70  ? -11.715 -12.056 -8.515  1.00 0.00 ? 70  GLN A CD   3  
ATOM 7434  O OE1  . GLN A 1 70  ? -11.760 -12.533 -7.382  1.00 0.00 ? 70  GLN A OE1  3  
ATOM 7435  N NE2  . GLN A 1 70  ? -12.431 -10.996 -8.874  1.00 0.00 ? 70  GLN A NE2  3  
ATOM 7436  H H    . GLN A 1 70  ? -8.981  -11.540 -12.214 1.00 0.00 ? 70  GLN A H    3  
ATOM 7437  H HA   . GLN A 1 70  ? -10.742 -10.244 -10.405 1.00 0.00 ? 70  GLN A HA   3  
ATOM 7438  H HB2  . GLN A 1 70  ? -8.841  -12.501 -10.313 1.00 0.00 ? 70  GLN A HB2  3  
ATOM 7439  H HB3  . GLN A 1 70  ? -9.117  -11.691 -8.776  1.00 0.00 ? 70  GLN A HB3  3  
ATOM 7440  H HG2  . GLN A 1 70  ? -11.362 -12.664 -10.518 1.00 0.00 ? 70  GLN A HG2  3  
ATOM 7441  H HG3  . GLN A 1 70  ? -10.589 -13.677 -9.298  1.00 0.00 ? 70  GLN A HG3  3  
ATOM 7442  H HE21 . GLN A 1 70  ? -12.352 -10.675 -9.800  1.00 0.00 ? 70  GLN A HE21 3  
ATOM 7443  H HE22 . GLN A 1 70  ? -12.994 -10.566 -8.195  1.00 0.00 ? 70  GLN A HE22 3  
ATOM 7444  N N    . LEU A 1 71  ? -9.103  -9.158  -8.602  1.00 0.00 ? 71  LEU A N    3  
ATOM 7445  C CA   . LEU A 1 71  ? -8.320  -8.165  -7.892  1.00 0.00 ? 71  LEU A CA   3  
ATOM 7446  C C    . LEU A 1 71  ? -6.895  -8.699  -7.698  1.00 0.00 ? 71  LEU A C    3  
ATOM 7447  O O    . LEU A 1 71  ? -6.332  -9.281  -8.625  1.00 0.00 ? 71  LEU A O    3  
ATOM 7448  C CB   . LEU A 1 71  ? -9.007  -7.816  -6.561  1.00 0.00 ? 71  LEU A CB   3  
ATOM 7449  C CG   . LEU A 1 71  ? -9.772  -6.485  -6.535  1.00 0.00 ? 71  LEU A CG   3  
ATOM 7450  C CD1  . LEU A 1 71  ? -8.848  -5.349  -6.128  1.00 0.00 ? 71  LEU A CD1  3  
ATOM 7451  C CD2  . LEU A 1 71  ? -10.418 -6.191  -7.883  1.00 0.00 ? 71  LEU A CD2  3  
ATOM 7452  H H    . LEU A 1 71  ? -9.842  -9.599  -8.140  1.00 0.00 ? 71  LEU A H    3  
ATOM 7453  H HA   . LEU A 1 71  ? -8.278  -7.284  -8.511  1.00 0.00 ? 71  LEU A HA   3  
ATOM 7454  H HB2  . LEU A 1 71  ? -9.700  -8.602  -6.334  1.00 0.00 ? 71  LEU A HB2  3  
ATOM 7455  H HB3  . LEU A 1 71  ? -8.269  -7.785  -5.784  1.00 0.00 ? 71  LEU A HB3  3  
ATOM 7456  H HG   . LEU A 1 71  ? -10.558 -6.551  -5.798  1.00 0.00 ? 71  LEU A HG   3  
ATOM 7457  H HD11 . LEU A 1 71  ? -8.544  -4.796  -7.007  1.00 0.00 ? 71  LEU A HD11 3  
ATOM 7458  H HD12 . LEU A 1 71  ? -7.973  -5.757  -5.637  1.00 0.00 ? 71  LEU A HD12 3  
ATOM 7459  H HD13 . LEU A 1 71  ? -9.370  -4.686  -5.450  1.00 0.00 ? 71  LEU A HD13 3  
ATOM 7460  H HD21 . LEU A 1 71  ? -10.916 -7.079  -8.244  1.00 0.00 ? 71  LEU A HD21 3  
ATOM 7461  H HD22 . LEU A 1 71  ? -9.657  -5.890  -8.588  1.00 0.00 ? 71  LEU A HD22 3  
ATOM 7462  H HD23 . LEU A 1 71  ? -11.138 -5.396  -7.768  1.00 0.00 ? 71  LEU A HD23 3  
ATOM 7463  N N    . ASP A 1 72  ? -6.304  -8.527  -6.514  1.00 0.00 ? 72  ASP A N    3  
ATOM 7464  C CA   . ASP A 1 72  ? -4.949  -9.025  -6.271  1.00 0.00 ? 72  ASP A CA   3  
ATOM 7465  C C    . ASP A 1 72  ? -4.408  -8.548  -4.927  1.00 0.00 ? 72  ASP A C    3  
ATOM 7466  O O    . ASP A 1 72  ? -5.159  -8.081  -4.070  1.00 0.00 ? 72  ASP A O    3  
ATOM 7467  C CB   . ASP A 1 72  ? -4.001  -8.584  -7.394  1.00 0.00 ? 72  ASP A CB   3  
ATOM 7468  C CG   . ASP A 1 72  ? -3.255  -9.751  -8.012  1.00 0.00 ? 72  ASP A CG   3  
ATOM 7469  O OD1  . ASP A 1 72  ? -3.793  -10.878 -7.994  1.00 0.00 ? 72  ASP A OD1  3  
ATOM 7470  O OD2  . ASP A 1 72  ? -2.131  -9.537  -8.515  1.00 0.00 ? 72  ASP A OD2  3  
ATOM 7471  H H    . ASP A 1 72  ? -6.783  -8.070  -5.794  1.00 0.00 ? 72  ASP A H    3  
ATOM 7472  H HA   . ASP A 1 72  ? -4.996  -10.103 -6.260  1.00 0.00 ? 72  ASP A HA   3  
ATOM 7473  H HB2  . ASP A 1 72  ? -4.570  -8.098  -8.167  1.00 0.00 ? 72  ASP A HB2  3  
ATOM 7474  H HB3  . ASP A 1 72  ? -3.278  -7.889  -6.994  1.00 0.00 ? 72  ASP A HB3  3  
ATOM 7475  N N    . PHE A 1 73  ? -3.096  -8.680  -4.753  1.00 0.00 ? 73  PHE A N    3  
ATOM 7476  C CA   . PHE A 1 73  ? -2.437  -8.275  -3.520  1.00 0.00 ? 73  PHE A CA   3  
ATOM 7477  C C    . PHE A 1 73  ? -2.166  -6.773  -3.502  1.00 0.00 ? 73  PHE A C    3  
ATOM 7478  O O    . PHE A 1 73  ? -2.616  -6.070  -2.597  1.00 0.00 ? 73  PHE A O    3  
ATOM 7479  C CB   . PHE A 1 73  ? -1.131  -9.046  -3.332  1.00 0.00 ? 73  PHE A CB   3  
ATOM 7480  C CG   . PHE A 1 73  ? -0.134  -8.839  -4.439  1.00 0.00 ? 73  PHE A CG   3  
ATOM 7481  C CD1  . PHE A 1 73  ? -0.215  -9.575  -5.611  1.00 0.00 ? 73  PHE A CD1  3  
ATOM 7482  C CD2  . PHE A 1 73  ? 0.885   -7.911  -4.304  1.00 0.00 ? 73  PHE A CD2  3  
ATOM 7483  C CE1  . PHE A 1 73  ? 0.701   -9.388  -6.628  1.00 0.00 ? 73  PHE A CE1  3  
ATOM 7484  C CE2  . PHE A 1 73  ? 1.805   -7.719  -5.319  1.00 0.00 ? 73  PHE A CE2  3  
ATOM 7485  C CZ   . PHE A 1 73  ? 1.712   -8.458  -6.482  1.00 0.00 ? 73  PHE A CZ   3  
ATOM 7486  H H    . PHE A 1 73  ? -2.558  -9.065  -5.475  1.00 0.00 ? 73  PHE A H    3  
ATOM 7487  H HA   . PHE A 1 73  ? -3.100  -8.513  -2.702  1.00 0.00 ? 73  PHE A HA   3  
ATOM 7488  H HB2  . PHE A 1 73  ? -0.672  -8.729  -2.411  1.00 0.00 ? 73  PHE A HB2  3  
ATOM 7489  H HB3  . PHE A 1 73  ? -1.351  -10.102 -3.275  1.00 0.00 ? 73  PHE A HB3  3  
ATOM 7490  H HD1  . PHE A 1 73  ? -1.005  -10.302 -5.726  1.00 0.00 ? 73  PHE A HD1  3  
ATOM 7491  H HD2  . PHE A 1 73  ? 0.959   -7.332  -3.395  1.00 0.00 ? 73  PHE A HD2  3  
ATOM 7492  H HE1  . PHE A 1 73  ? 0.626   -9.967  -7.536  1.00 0.00 ? 73  PHE A HE1  3  
ATOM 7493  H HE2  . PHE A 1 73  ? 2.594   -6.991  -5.203  1.00 0.00 ? 73  PHE A HE2  3  
ATOM 7494  H HZ   . PHE A 1 73  ? 2.429   -8.310  -7.276  1.00 0.00 ? 73  PHE A HZ   3  
ATOM 7495  N N    . GLN A 1 74  ? -1.437  -6.277  -4.501  1.00 0.00 ? 74  GLN A N    3  
ATOM 7496  C CA   . GLN A 1 74  ? -1.136  -4.855  -4.565  1.00 0.00 ? 74  GLN A CA   3  
ATOM 7497  C C    . GLN A 1 74  ? -2.318  -4.091  -5.133  1.00 0.00 ? 74  GLN A C    3  
ATOM 7498  O O    . GLN A 1 74  ? -2.508  -2.920  -4.821  1.00 0.00 ? 74  GLN A O    3  
ATOM 7499  C CB   . GLN A 1 74  ? 0.114   -4.569  -5.399  1.00 0.00 ? 74  GLN A CB   3  
ATOM 7500  C CG   . GLN A 1 74  ? 0.437   -3.080  -5.517  1.00 0.00 ? 74  GLN A CG   3  
ATOM 7501  C CD   . GLN A 1 74  ? 0.403   -2.357  -4.176  1.00 0.00 ? 74  GLN A CD   3  
ATOM 7502  O OE1  . GLN A 1 74  ? 0.836   -2.899  -3.159  1.00 0.00 ? 74  GLN A OE1  3  
ATOM 7503  N NE2  . GLN A 1 74  ? -0.113  -1.125  -4.164  1.00 0.00 ? 74  GLN A NE2  3  
ATOM 7504  H H    . GLN A 1 74  ? -1.109  -6.869  -5.206  1.00 0.00 ? 74  GLN A H    3  
ATOM 7505  H HA   . GLN A 1 74  ? -0.963  -4.517  -3.554  1.00 0.00 ? 74  GLN A HA   3  
ATOM 7506  H HB2  . GLN A 1 74  ? 0.958   -5.065  -4.944  1.00 0.00 ? 74  GLN A HB2  3  
ATOM 7507  H HB3  . GLN A 1 74  ? -0.032  -4.964  -6.393  1.00 0.00 ? 74  GLN A HB3  3  
ATOM 7508  H HG2  . GLN A 1 74  ? 1.424   -2.972  -5.939  1.00 0.00 ? 74  GLN A HG2  3  
ATOM 7509  H HG3  . GLN A 1 74  ? -0.286  -2.620  -6.175  1.00 0.00 ? 74  GLN A HG3  3  
ATOM 7510  H HE21 . GLN A 1 74  ? -0.443  -0.747  -5.010  1.00 0.00 ? 74  GLN A HE21 3  
ATOM 7511  H HE22 . GLN A 1 74  ? -0.142  -0.641  -3.307  1.00 0.00 ? 74  GLN A HE22 3  
ATOM 7512  N N    . GLU A 1 75  ? -3.117  -4.757  -5.969  1.00 0.00 ? 75  GLU A N    3  
ATOM 7513  C CA   . GLU A 1 75  ? -4.282  -4.116  -6.561  1.00 0.00 ? 75  GLU A CA   3  
ATOM 7514  C C    . GLU A 1 75  ? -5.034  -3.334  -5.497  1.00 0.00 ? 75  GLU A C    3  
ATOM 7515  O O    . GLU A 1 75  ? -5.543  -2.245  -5.756  1.00 0.00 ? 75  GLU A O    3  
ATOM 7516  C CB   . GLU A 1 75  ? -5.200  -5.149  -7.215  1.00 0.00 ? 75  GLU A CB   3  
ATOM 7517  C CG   . GLU A 1 75  ? -5.367  -4.931  -8.707  1.00 0.00 ? 75  GLU A CG   3  
ATOM 7518  C CD   . GLU A 1 75  ? -5.402  -6.227  -9.493  1.00 0.00 ? 75  GLU A CD   3  
ATOM 7519  O OE1  . GLU A 1 75  ? -4.321  -6.710  -9.889  1.00 0.00 ? 75  GLU A OE1  3  
ATOM 7520  O OE2  . GLU A 1 75  ? -6.511  -6.756  -9.715  1.00 0.00 ? 75  GLU A OE2  3  
ATOM 7521  H H    . GLU A 1 75  ? -2.922  -5.690  -6.186  1.00 0.00 ? 75  GLU A H    3  
ATOM 7522  H HA   . GLU A 1 75  ? -3.931  -3.427  -7.315  1.00 0.00 ? 75  GLU A HA   3  
ATOM 7523  H HB2  . GLU A 1 75  ? -4.787  -6.135  -7.058  1.00 0.00 ? 75  GLU A HB2  3  
ATOM 7524  H HB3  . GLU A 1 75  ? -6.176  -5.097  -6.754  1.00 0.00 ? 75  GLU A HB3  3  
ATOM 7525  H HG2  . GLU A 1 75  ? -6.289  -4.397  -8.879  1.00 0.00 ? 75  GLU A HG2  3  
ATOM 7526  H HG3  . GLU A 1 75  ? -4.536  -4.337  -9.060  1.00 0.00 ? 75  GLU A HG3  3  
ATOM 7527  N N    . PHE A 1 76  ? -5.069  -3.882  -4.286  1.00 0.00 ? 76  PHE A N    3  
ATOM 7528  C CA   . PHE A 1 76  ? -5.726  -3.205  -3.186  1.00 0.00 ? 76  PHE A CA   3  
ATOM 7529  C C    . PHE A 1 76  ? -4.812  -2.140  -2.611  1.00 0.00 ? 76  PHE A C    3  
ATOM 7530  O O    . PHE A 1 76  ? -5.187  -0.976  -2.518  1.00 0.00 ? 76  PHE A O    3  
ATOM 7531  C CB   . PHE A 1 76  ? -6.144  -4.168  -2.082  1.00 0.00 ? 76  PHE A CB   3  
ATOM 7532  C CG   . PHE A 1 76  ? -7.253  -3.612  -1.227  1.00 0.00 ? 76  PHE A CG   3  
ATOM 7533  C CD1  . PHE A 1 76  ? -8.258  -2.831  -1.788  1.00 0.00 ? 76  PHE A CD1  3  
ATOM 7534  C CD2  . PHE A 1 76  ? -7.286  -3.852  0.132   1.00 0.00 ? 76  PHE A CD2  3  
ATOM 7535  C CE1  . PHE A 1 76  ? -9.268  -2.307  -1.006  1.00 0.00 ? 76  PHE A CE1  3  
ATOM 7536  C CE2  . PHE A 1 76  ? -8.296  -3.328  0.918   1.00 0.00 ? 76  PHE A CE2  3  
ATOM 7537  C CZ   . PHE A 1 76  ? -9.286  -2.555  0.350   1.00 0.00 ? 76  PHE A CZ   3  
ATOM 7538  H H    . PHE A 1 76  ? -4.623  -4.741  -4.129  1.00 0.00 ? 76  PHE A H    3  
ATOM 7539  H HA   . PHE A 1 76  ? -6.605  -2.726  -3.583  1.00 0.00 ? 76  PHE A HA   3  
ATOM 7540  H HB2  . PHE A 1 76  ? -6.484  -5.094  -2.522  1.00 0.00 ? 76  PHE A HB2  3  
ATOM 7541  H HB3  . PHE A 1 76  ? -5.288  -4.366  -1.440  1.00 0.00 ? 76  PHE A HB3  3  
ATOM 7542  H HD1  . PHE A 1 76  ? -8.248  -2.635  -2.849  1.00 0.00 ? 76  PHE A HD1  3  
ATOM 7543  H HD2  . PHE A 1 76  ? -6.513  -4.454  0.580   1.00 0.00 ? 76  PHE A HD2  3  
ATOM 7544  H HE1  . PHE A 1 76  ? -10.042 -1.701  -1.456  1.00 0.00 ? 76  PHE A HE1  3  
ATOM 7545  H HE2  . PHE A 1 76  ? -8.310  -3.526  1.976   1.00 0.00 ? 76  PHE A HE2  3  
ATOM 7546  H HZ   . PHE A 1 76  ? -10.074 -2.146  0.964   1.00 0.00 ? 76  PHE A HZ   3  
ATOM 7547  N N    . LEU A 1 77  ? -3.599  -2.539  -2.235  1.00 0.00 ? 77  LEU A N    3  
ATOM 7548  C CA   . LEU A 1 77  ? -2.635  -1.599  -1.687  1.00 0.00 ? 77  LEU A CA   3  
ATOM 7549  C C    . LEU A 1 77  ? -2.527  -0.387  -2.602  1.00 0.00 ? 77  LEU A C    3  
ATOM 7550  O O    . LEU A 1 77  ? -2.371  0.741   -2.143  1.00 0.00 ? 77  LEU A O    3  
ATOM 7551  C CB   . LEU A 1 77  ? -1.279  -2.276  -1.505  1.00 0.00 ? 77  LEU A CB   3  
ATOM 7552  C CG   . LEU A 1 77  ? -1.048  -2.846  -0.106  1.00 0.00 ? 77  LEU A CG   3  
ATOM 7553  C CD1  . LEU A 1 77  ? 0.053   -3.895  -0.121  1.00 0.00 ? 77  LEU A CD1  3  
ATOM 7554  C CD2  . LEU A 1 77  ? -0.720  -1.725  0.860   1.00 0.00 ? 77  LEU A CD2  3  
ATOM 7555  H H    . LEU A 1 77  ? -3.347  -3.479  -2.340  1.00 0.00 ? 77  LEU A H    3  
ATOM 7556  H HA   . LEU A 1 77  ? -3.002  -1.275  -0.724  1.00 0.00 ? 77  LEU A HA   3  
ATOM 7557  H HB2  . LEU A 1 77  ? -1.199  -3.080  -2.222  1.00 0.00 ? 77  LEU A HB2  3  
ATOM 7558  H HB3  . LEU A 1 77  ? -0.505  -1.553  -1.706  1.00 0.00 ? 77  LEU A HB3  3  
ATOM 7559  H HG   . LEU A 1 77  ? -1.955  -3.324  0.233   1.00 0.00 ? 77  LEU A HG   3  
ATOM 7560  H HD11 . LEU A 1 77  ? -0.393  -4.876  -0.019  1.00 0.00 ? 77  LEU A HD11 3  
ATOM 7561  H HD12 . LEU A 1 77  ? 0.738   -3.720  0.702   1.00 0.00 ? 77  LEU A HD12 3  
ATOM 7562  H HD13 . LEU A 1 77  ? 0.590   -3.841  -1.054  1.00 0.00 ? 77  LEU A HD13 3  
ATOM 7563  H HD21 . LEU A 1 77  ? -0.339  -0.879  0.308   1.00 0.00 ? 77  LEU A HD21 3  
ATOM 7564  H HD22 . LEU A 1 77  ? 0.024   -2.061  1.566   1.00 0.00 ? 77  LEU A HD22 3  
ATOM 7565  H HD23 . LEU A 1 77  ? -1.615  -1.435  1.387   1.00 0.00 ? 77  LEU A HD23 3  
ATOM 7566  N N    . ASN A 1 78  ? -2.659  -0.633  -3.901  1.00 0.00 ? 78  ASN A N    3  
ATOM 7567  C CA   . ASN A 1 78  ? -2.634  0.429   -4.891  1.00 0.00 ? 78  ASN A CA   3  
ATOM 7568  C C    . ASN A 1 78  ? -3.978  1.143   -4.865  1.00 0.00 ? 78  ASN A C    3  
ATOM 7569  O O    . ASN A 1 78  ? -4.056  2.365   -4.982  1.00 0.00 ? 78  ASN A O    3  
ATOM 7570  C CB   . ASN A 1 78  ? -2.331  -0.146  -6.288  1.00 0.00 ? 78  ASN A CB   3  
ATOM 7571  C CG   . ASN A 1 78  ? -3.206  0.429   -7.386  1.00 0.00 ? 78  ASN A CG   3  
ATOM 7572  O OD1  . ASN A 1 78  ? -3.374  1.643   -7.493  1.00 0.00 ? 78  ASN A OD1  3  
ATOM 7573  N ND2  . ASN A 1 78  ? -3.765  -0.448  -8.209  1.00 0.00 ? 78  ASN A ND2  3  
ATOM 7574  H H    . ASN A 1 78  ? -2.816  -1.553  -4.195  1.00 0.00 ? 78  ASN A H    3  
ATOM 7575  H HA   . ASN A 1 78  ? -1.858  1.128   -4.614  1.00 0.00 ? 78  ASN A HA   3  
ATOM 7576  H HB2  . ASN A 1 78  ? -1.302  0.064   -6.537  1.00 0.00 ? 78  ASN A HB2  3  
ATOM 7577  H HB3  . ASN A 1 78  ? -2.476  -1.217  -6.263  1.00 0.00 ? 78  ASN A HB3  3  
ATOM 7578  H HD21 . ASN A 1 78  ? -3.584  -1.404  -8.062  1.00 0.00 ? 78  ASN A HD21 3  
ATOM 7579  H HD22 . ASN A 1 78  ? -4.335  -0.105  -8.932  1.00 0.00 ? 78  ASN A HD22 3  
ATOM 7580  N N    . LEU A 1 79  ? -5.037  0.351   -4.688  1.00 0.00 ? 79  LEU A N    3  
ATOM 7581  C CA   . LEU A 1 79  ? -6.387  0.881   -4.617  1.00 0.00 ? 79  LEU A CA   3  
ATOM 7582  C C    . LEU A 1 79  ? -6.524  1.784   -3.395  1.00 0.00 ? 79  LEU A C    3  
ATOM 7583  O O    . LEU A 1 79  ? -6.834  2.968   -3.521  1.00 0.00 ? 79  LEU A O    3  
ATOM 7584  C CB   . LEU A 1 79  ? -7.395  -0.272  -4.534  1.00 0.00 ? 79  LEU A CB   3  
ATOM 7585  C CG   . LEU A 1 79  ? -8.233  -0.523  -5.792  1.00 0.00 ? 79  LEU A CG   3  
ATOM 7586  C CD1  . LEU A 1 79  ? -7.354  -0.666  -7.018  1.00 0.00 ? 79  LEU A CD1  3  
ATOM 7587  C CD2  . LEU A 1 79  ? -9.095  -1.764  -5.619  1.00 0.00 ? 79  LEU A CD2  3  
ATOM 7588  H H    . LEU A 1 79  ? -4.899  -0.613  -4.588  1.00 0.00 ? 79  LEU A H    3  
ATOM 7589  H HA   . LEU A 1 79  ? -6.570  1.457   -5.512  1.00 0.00 ? 79  LEU A HA   3  
ATOM 7590  H HB2  . LEU A 1 79  ? -6.850  -1.172  -4.310  1.00 0.00 ? 79  LEU A HB2  3  
ATOM 7591  H HB3  . LEU A 1 79  ? -8.071  -0.071  -3.716  1.00 0.00 ? 79  LEU A HB3  3  
ATOM 7592  H HG   . LEU A 1 79  ? -8.886  0.314   -5.952  1.00 0.00 ? 79  LEU A HG   3  
ATOM 7593  H HD11 . LEU A 1 79  ? -7.354  -1.701  -7.342  1.00 0.00 ? 79  LEU A HD11 3  
ATOM 7594  H HD12 . LEU A 1 79  ? -6.347  -0.360  -6.778  1.00 0.00 ? 79  LEU A HD12 3  
ATOM 7595  H HD13 . LEU A 1 79  ? -7.743  -0.042  -7.809  1.00 0.00 ? 79  LEU A HD13 3  
ATOM 7596  H HD21 . LEU A 1 79  ? -9.165  -2.011  -4.570  1.00 0.00 ? 79  LEU A HD21 3  
ATOM 7597  H HD22 . LEU A 1 79  ? -8.648  -2.590  -6.156  1.00 0.00 ? 79  LEU A HD22 3  
ATOM 7598  H HD23 . LEU A 1 79  ? -10.082 -1.571  -6.011  1.00 0.00 ? 79  LEU A HD23 3  
ATOM 7599  N N    . ILE A 1 80  ? -6.258  1.223   -2.214  1.00 0.00 ? 80  ILE A N    3  
ATOM 7600  C CA   . ILE A 1 80  ? -6.327  1.986   -0.977  1.00 0.00 ? 80  ILE A CA   3  
ATOM 7601  C C    . ILE A 1 80  ? -5.152  2.946   -0.887  1.00 0.00 ? 80  ILE A C    3  
ATOM 7602  O O    . ILE A 1 80  ? -5.316  4.109   -0.517  1.00 0.00 ? 80  ILE A O    3  
ATOM 7603  C CB   . ILE A 1 80  ? -6.373  1.091   0.279   1.00 0.00 ? 80  ILE A CB   3  
ATOM 7604  C CG1  . ILE A 1 80  ? -6.839  1.909   1.481   1.00 0.00 ? 80  ILE A CG1  3  
ATOM 7605  C CG2  . ILE A 1 80  ? -5.019  0.478   0.564   1.00 0.00 ? 80  ILE A CG2  3  
ATOM 7606  C CD1  . ILE A 1 80  ? -5.733  2.723   2.123   1.00 0.00 ? 80  ILE A CD1  3  
ATOM 7607  H H    . ILE A 1 80  ? -5.996  0.282   -2.181  1.00 0.00 ? 80  ILE A H    3  
ATOM 7608  H HA   . ILE A 1 80  ? -7.232  2.559   -1.001  1.00 0.00 ? 80  ILE A HA   3  
ATOM 7609  H HB   . ILE A 1 80  ? -7.077  0.292   0.103   1.00 0.00 ? 80  ILE A HB   3  
ATOM 7610  H HG12 . ILE A 1 80  ? -7.613  2.592   1.164   1.00 0.00 ? 80  ILE A HG12 3  
ATOM 7611  H HG13 . ILE A 1 80  ? -7.238  1.241   2.229   1.00 0.00 ? 80  ILE A HG13 3  
ATOM 7612  H HG21 . ILE A 1 80  ? -4.716  -0.127  -0.273  1.00 0.00 ? 80  ILE A HG21 3  
ATOM 7613  H HG22 . ILE A 1 80  ? -5.086  -0.134  1.459   1.00 0.00 ? 80  ILE A HG22 3  
ATOM 7614  H HG23 . ILE A 1 80  ? -4.302  1.273   0.720   1.00 0.00 ? 80  ILE A HG23 3  
ATOM 7615  H HD11 . ILE A 1 80  ? -6.064  3.742   2.244   1.00 0.00 ? 80  ILE A HD11 3  
ATOM 7616  H HD12 . ILE A 1 80  ? -4.849  2.702   1.496   1.00 0.00 ? 80  ILE A HD12 3  
ATOM 7617  H HD13 . ILE A 1 80  ? -5.498  2.301   3.087   1.00 0.00 ? 80  ILE A HD13 3  
ATOM 7618  N N    . GLY A 1 81  ? -3.966  2.464   -1.259  1.00 0.00 ? 81  GLY A N    3  
ATOM 7619  C CA   . GLY A 1 81  ? -2.794  3.317   -1.239  1.00 0.00 ? 81  GLY A CA   3  
ATOM 7620  C C    . GLY A 1 81  ? -3.064  4.582   -2.012  1.00 0.00 ? 81  GLY A C    3  
ATOM 7621  O O    . GLY A 1 81  ? -2.853  5.686   -1.511  1.00 0.00 ? 81  GLY A O    3  
ATOM 7622  H H    . GLY A 1 81  ? -3.895  1.537   -1.568  1.00 0.00 ? 81  GLY A H    3  
ATOM 7623  H HA2  . GLY A 1 81  ? -2.552  3.566   -0.215  1.00 0.00 ? 81  GLY A HA2  3  
ATOM 7624  H HA3  . GLY A 1 81  ? -1.962  2.799   -1.688  1.00 0.00 ? 81  GLY A HA3  3  
ATOM 7625  N N    . GLY A 1 82  ? -3.576  4.414   -3.229  1.00 0.00 ? 82  GLY A N    3  
ATOM 7626  C CA   . GLY A 1 82  ? -3.917  5.564   -4.047  1.00 0.00 ? 82  GLY A CA   3  
ATOM 7627  C C    . GLY A 1 82  ? -4.798  6.544   -3.288  1.00 0.00 ? 82  GLY A C    3  
ATOM 7628  O O    . GLY A 1 82  ? -4.608  7.756   -3.381  1.00 0.00 ? 82  GLY A O    3  
ATOM 7629  H H    . GLY A 1 82  ? -3.738  3.498   -3.563  1.00 0.00 ? 82  GLY A H    3  
ATOM 7630  H HA2  . GLY A 1 82  ? -3.007  6.070   -4.345  1.00 0.00 ? 82  GLY A HA2  3  
ATOM 7631  H HA3  . GLY A 1 82  ? -4.443  5.229   -4.928  1.00 0.00 ? 82  GLY A HA3  3  
ATOM 7632  N N    . LEU A 1 83  ? -5.753  6.023   -2.512  1.00 0.00 ? 83  LEU A N    3  
ATOM 7633  C CA   . LEU A 1 83  ? -6.628  6.884   -1.722  1.00 0.00 ? 83  LEU A CA   3  
ATOM 7634  C C    . LEU A 1 83  ? -5.809  7.712   -0.739  1.00 0.00 ? 83  LEU A C    3  
ATOM 7635  O O    . LEU A 1 83  ? -6.021  8.916   -0.603  1.00 0.00 ? 83  LEU A O    3  
ATOM 7636  C CB   . LEU A 1 83  ? -7.659  6.063   -0.951  1.00 0.00 ? 83  LEU A CB   3  
ATOM 7637  C CG   . LEU A 1 83  ? -8.213  4.856   -1.696  1.00 0.00 ? 83  LEU A CG   3  
ATOM 7638  C CD1  . LEU A 1 83  ? -9.324  4.207   -0.890  1.00 0.00 ? 83  LEU A CD1  3  
ATOM 7639  C CD2  . LEU A 1 83  ? -8.713  5.261   -3.074  1.00 0.00 ? 83  LEU A CD2  3  
ATOM 7640  H H    . LEU A 1 83  ? -5.863  5.044   -2.462  1.00 0.00 ? 83  LEU A H    3  
ATOM 7641  H HA   . LEU A 1 83  ? -7.140  7.551   -2.399  1.00 0.00 ? 83  LEU A HA   3  
ATOM 7642  H HB2  . LEU A 1 83  ? -7.201  5.717   -0.037  1.00 0.00 ? 83  LEU A HB2  3  
ATOM 7643  H HB3  . LEU A 1 83  ? -8.485  6.711   -0.697  1.00 0.00 ? 83  LEU A HB3  3  
ATOM 7644  H HG   . LEU A 1 83  ? -7.426  4.132   -1.824  1.00 0.00 ? 83  LEU A HG   3  
ATOM 7645  H HD11 . LEU A 1 83  ? -10.278 4.567   -1.240  1.00 0.00 ? 83  LEU A HD11 3  
ATOM 7646  H HD12 . LEU A 1 83  ? -9.204  4.457   0.154   1.00 0.00 ? 83  LEU A HD12 3  
ATOM 7647  H HD13 . LEU A 1 83  ? -9.277  3.135   -1.010  1.00 0.00 ? 83  LEU A HD13 3  
ATOM 7648  H HD21 . LEU A 1 83  ? -9.788  5.357   -3.052  1.00 0.00 ? 83  LEU A HD21 3  
ATOM 7649  H HD22 . LEU A 1 83  ? -8.432  4.504   -3.792  1.00 0.00 ? 83  LEU A HD22 3  
ATOM 7650  H HD23 . LEU A 1 83  ? -8.272  6.204   -3.358  1.00 0.00 ? 83  LEU A HD23 3  
ATOM 7651  N N    . ALA A 1 84  ? -4.867  7.060   -0.055  1.00 0.00 ? 84  ALA A N    3  
ATOM 7652  C CA   . ALA A 1 84  ? -4.020  7.755   0.911   1.00 0.00 ? 84  ALA A CA   3  
ATOM 7653  C C    . ALA A 1 84  ? -3.315  8.934   0.262   1.00 0.00 ? 84  ALA A C    3  
ATOM 7654  O O    . ALA A 1 84  ? -3.025  9.939   0.911   1.00 0.00 ? 84  ALA A O    3  
ATOM 7655  C CB   . ALA A 1 84  ? -2.979  6.815   1.483   1.00 0.00 ? 84  ALA A CB   3  
ATOM 7656  H H    . ALA A 1 84  ? -4.740  6.092   -0.202  1.00 0.00 ? 84  ALA A H    3  
ATOM 7657  H HA   . ALA A 1 84  ? -4.644  8.108   1.718   1.00 0.00 ? 84  ALA A HA   3  
ATOM 7658  H HB1  . ALA A 1 84  ? -2.071  6.890   0.893   1.00 0.00 ? 84  ALA A HB1  3  
ATOM 7659  H HB2  . ALA A 1 84  ? -3.350  5.802   1.450   1.00 0.00 ? 84  ALA A HB2  3  
ATOM 7660  H HB3  . ALA A 1 84  ? -2.769  7.093   2.503   1.00 0.00 ? 84  ALA A HB3  3  
ATOM 7661  N N    . VAL A 1 85  ? -3.039  8.793   -1.022  1.00 0.00 ? 85  VAL A N    3  
ATOM 7662  C CA   . VAL A 1 85  ? -2.360  9.834   -1.777  1.00 0.00 ? 85  VAL A CA   3  
ATOM 7663  C C    . VAL A 1 85  ? -3.345  10.870  -2.291  1.00 0.00 ? 85  VAL A C    3  
ATOM 7664  O O    . VAL A 1 85  ? -2.961  11.978  -2.667  1.00 0.00 ? 85  VAL A O    3  
ATOM 7665  C CB   . VAL A 1 85  ? -1.527  9.274   -2.957  1.00 0.00 ? 85  VAL A CB   3  
ATOM 7666  C CG1  . VAL A 1 85  ? -0.079  9.671   -2.783  1.00 0.00 ? 85  VAL A CG1  3  
ATOM 7667  C CG2  . VAL A 1 85  ? -1.626  7.757   -3.076  1.00 0.00 ? 85  VAL A CG2  3  
ATOM 7668  H H    . VAL A 1 85  ? -3.301  7.966   -1.473  1.00 0.00 ? 85  VAL A H    3  
ATOM 7669  H HA   . VAL A 1 85  ? -1.687  10.328  -1.100  1.00 0.00 ? 85  VAL A HA   3  
ATOM 7670  H HB   . VAL A 1 85  ? -1.894  9.710   -3.876  1.00 0.00 ? 85  VAL A HB   3  
ATOM 7671  H HG11 . VAL A 1 85  ? -0.023  10.593  -2.228  1.00 0.00 ? 85  VAL A HG11 3  
ATOM 7672  H HG12 . VAL A 1 85  ? 0.380   9.803   -3.750  1.00 0.00 ? 85  VAL A HG12 3  
ATOM 7673  H HG13 . VAL A 1 85  ? 0.434   8.892   -2.237  1.00 0.00 ? 85  VAL A HG13 3  
ATOM 7674  H HG21 . VAL A 1 85  ? -1.398  7.462   -4.088  1.00 0.00 ? 85  VAL A HG21 3  
ATOM 7675  H HG22 . VAL A 1 85  ? -2.620  7.437   -2.829  1.00 0.00 ? 85  VAL A HG22 3  
ATOM 7676  H HG23 . VAL A 1 85  ? -0.920  7.296   -2.401  1.00 0.00 ? 85  VAL A HG23 3  
ATOM 7677  N N    . ALA A 1 86  ? -4.613  10.503  -2.303  1.00 0.00 ? 86  ALA A N    3  
ATOM 7678  C CA   . ALA A 1 86  ? -5.658  11.391  -2.767  1.00 0.00 ? 86  ALA A CA   3  
ATOM 7679  C C    . ALA A 1 86  ? -6.600  11.775  -1.631  1.00 0.00 ? 86  ALA A C    3  
ATOM 7680  O O    . ALA A 1 86  ? -7.677  12.323  -1.863  1.00 0.00 ? 86  ALA A O    3  
ATOM 7681  C CB   . ALA A 1 86  ? -6.416  10.709  -3.880  1.00 0.00 ? 86  ALA A CB   3  
ATOM 7682  H H    . ALA A 1 86  ? -4.854  9.608   -1.991  1.00 0.00 ? 86  ALA A H    3  
ATOM 7683  H HA   . ALA A 1 86  ? -5.197  12.282  -3.165  1.00 0.00 ? 86  ALA A HA   3  
ATOM 7684  H HB1  . ALA A 1 86  ? -6.662  11.428  -4.645  1.00 0.00 ? 86  ALA A HB1  3  
ATOM 7685  H HB2  . ALA A 1 86  ? -7.319  10.273  -3.482  1.00 0.00 ? 86  ALA A HB2  3  
ATOM 7686  H HB3  . ALA A 1 86  ? -5.793  9.931   -4.300  1.00 0.00 ? 86  ALA A HB3  3  
ATOM 7687  N N    . CYS A 1 87  ? -6.190  11.481  -0.400  1.00 0.00 ? 87  CYS A N    3  
ATOM 7688  C CA   . CYS A 1 87  ? -7.001  11.792  0.769   1.00 0.00 ? 87  CYS A CA   3  
ATOM 7689  C C    . CYS A 1 87  ? -6.136  12.015  2.007   1.00 0.00 ? 87  CYS A C    3  
ATOM 7690  O O    . CYS A 1 87  ? -6.441  12.874  2.835   1.00 0.00 ? 87  CYS A O    3  
ATOM 7691  C CB   . CYS A 1 87  ? -8.004  10.666  1.031   1.00 0.00 ? 87  CYS A CB   3  
ATOM 7692  S SG   . CYS A 1 87  ? -9.618  11.237  1.612   1.00 0.00 ? 87  CYS A SG   3  
ATOM 7693  H H    . CYS A 1 87  ? -5.325  11.042  -0.277  1.00 0.00 ? 87  CYS A H    3  
ATOM 7694  H HA   . CYS A 1 87  ? -7.546  12.701  0.559   1.00 0.00 ? 87  CYS A HA   3  
ATOM 7695  H HB2  . CYS A 1 87  ? -8.161  10.113  0.117   1.00 0.00 ? 87  CYS A HB2  3  
ATOM 7696  H HB3  . CYS A 1 87  ? -7.599  10.003  1.783   1.00 0.00 ? 87  CYS A HB3  3  
ATOM 7697  H HG   . CYS A 1 87  ? -9.952  11.878  0.979   1.00 0.00 ? 87  CYS A HG   3  
ATOM 7698  N N    . HIS A 1 88  ? -5.060  11.240  2.138   1.00 0.00 ? 88  HIS A N    3  
ATOM 7699  C CA   . HIS A 1 88  ? -4.174  11.373  3.292   1.00 0.00 ? 88  HIS A CA   3  
ATOM 7700  C C    . HIS A 1 88  ? -3.071  12.393  3.029   1.00 0.00 ? 88  HIS A C    3  
ATOM 7701  O O    . HIS A 1 88  ? -3.100  13.113  2.030   1.00 0.00 ? 88  HIS A O    3  
ATOM 7702  C CB   . HIS A 1 88  ? -3.563  10.019  3.662   1.00 0.00 ? 88  HIS A CB   3  
ATOM 7703  C CG   . HIS A 1 88  ? -4.054  9.484   4.972   1.00 0.00 ? 88  HIS A CG   3  
ATOM 7704  N ND1  . HIS A 1 88  ? -5.062  8.547   5.074   1.00 0.00 ? 88  HIS A ND1  3  
ATOM 7705  C CD2  . HIS A 1 88  ? -3.669  9.757   6.242   1.00 0.00 ? 88  HIS A CD2  3  
ATOM 7706  C CE1  . HIS A 1 88  ? -5.274  8.269   6.348   1.00 0.00 ? 88  HIS A CE1  3  
ATOM 7707  N NE2  . HIS A 1 88  ? -4.442  8.989   7.076   1.00 0.00 ? 88  HIS A NE2  3  
ATOM 7708  H H    . HIS A 1 88  ? -4.861  10.565  1.451   1.00 0.00 ? 88  HIS A H    3  
ATOM 7709  H HA   . HIS A 1 88  ? -4.771  11.721  4.122   1.00 0.00 ? 88  HIS A HA   3  
ATOM 7710  H HB2  . HIS A 1 88  ? -3.808  9.301   2.897   1.00 0.00 ? 88  HIS A HB2  3  
ATOM 7711  H HB3  . HIS A 1 88  ? -2.489  10.120  3.726   1.00 0.00 ? 88  HIS A HB3  3  
ATOM 7712  H HD1  . HIS A 1 88  ? -5.549  8.147   4.323   1.00 0.00 ? 88  HIS A HD1  3  
ATOM 7713  H HD2  . HIS A 1 88  ? -2.895  10.451  6.542   1.00 0.00 ? 88  HIS A HD2  3  
ATOM 7714  H HE1  . HIS A 1 88  ? -6.004  7.569   6.729   1.00 0.00 ? 88  HIS A HE1  3  
ATOM 7715  H HE2  . HIS A 1 88  ? -4.444  9.036   8.056   1.00 0.00 ? 88  HIS A HE2  3  
ATOM 7716  N N    . GLU A 1 89  ? -2.104  12.458  3.940   1.00 0.00 ? 89  GLU A N    3  
ATOM 7717  C CA   . GLU A 1 89  ? -0.996  13.398  3.818   1.00 0.00 ? 89  GLU A CA   3  
ATOM 7718  C C    . GLU A 1 89  ? 0.140   12.815  2.978   1.00 0.00 ? 89  GLU A C    3  
ATOM 7719  O O    . GLU A 1 89  ? 1.288   12.761  3.419   1.00 0.00 ? 89  GLU A O    3  
ATOM 7720  C CB   . GLU A 1 89  ? -0.475  13.782  5.204   1.00 0.00 ? 89  GLU A CB   3  
ATOM 7721  C CG   . GLU A 1 89  ? 0.017   12.598  6.020   1.00 0.00 ? 89  GLU A CG   3  
ATOM 7722  C CD   . GLU A 1 89  ? -0.967  12.181  7.094   1.00 0.00 ? 89  GLU A CD   3  
ATOM 7723  O OE1  . GLU A 1 89  ? -2.157  12.545  6.983   1.00 0.00 ? 89  GLU A OE1  3  
ATOM 7724  O OE2  . GLU A 1 89  ? -0.549  11.489  8.047   1.00 0.00 ? 89  GLU A OE2  3  
ATOM 7725  H H    . GLU A 1 89  ? -2.142  11.863  4.719   1.00 0.00 ? 89  GLU A H    3  
ATOM 7726  H HA   . GLU A 1 89  ? -1.368  14.284  3.327   1.00 0.00 ? 89  GLU A HA   3  
ATOM 7727  H HB2  . GLU A 1 89  ? 0.344   14.477  5.088   1.00 0.00 ? 89  GLU A HB2  3  
ATOM 7728  H HB3  . GLU A 1 89  ? -1.270  14.265  5.753   1.00 0.00 ? 89  GLU A HB3  3  
ATOM 7729  H HG2  . GLU A 1 89  ? 0.179   11.762  5.357   1.00 0.00 ? 89  GLU A HG2  3  
ATOM 7730  H HG3  . GLU A 1 89  ? 0.952   12.867  6.493   1.00 0.00 ? 89  GLU A HG3  3  
ATOM 7731  N N    . SER A 1 90  ? -0.185  12.391  1.761   1.00 0.00 ? 90  SER A N    3  
ATOM 7732  C CA   . SER A 1 90  ? 0.812   11.827  0.858   1.00 0.00 ? 90  SER A CA   3  
ATOM 7733  C C    . SER A 1 90  ? 0.941   12.686  -0.395  1.00 0.00 ? 90  SER A C    3  
ATOM 7734  O O    . SER A 1 90  ? 2.045   13.034  -0.813  1.00 0.00 ? 90  SER A O    3  
ATOM 7735  C CB   . SER A 1 90  ? 0.442   10.393  0.477   1.00 0.00 ? 90  SER A CB   3  
ATOM 7736  O OG   . SER A 1 90  ? 1.111   9.457   1.304   1.00 0.00 ? 90  SER A OG   3  
ATOM 7737  H H    . SER A 1 90  ? -1.115  12.468  1.460   1.00 0.00 ? 90  SER A H    3  
ATOM 7738  H HA   . SER A 1 90  ? 1.761   11.821  1.374   1.00 0.00 ? 90  SER A HA   3  
ATOM 7739  H HB2  . SER A 1 90  ? -0.622  10.254  0.588   1.00 0.00 ? 90  SER A HB2  3  
ATOM 7740  H HB3  . SER A 1 90  ? 0.724   10.212  -0.548  1.00 0.00 ? 90  SER A HB3  3  
ATOM 7741  H HG   . SER A 1 90  ? 1.189   8.620   0.841   1.00 0.00 ? 90  SER A HG   3  
ATOM 7742  N N    . PHE A 1 91  ? -0.200  13.035  -0.983  1.00 0.00 ? 91  PHE A N    3  
ATOM 7743  C CA   . PHE A 1 91  ? -0.222  13.867  -2.179  1.00 0.00 ? 91  PHE A CA   3  
ATOM 7744  C C    . PHE A 1 91  ? -1.291  14.950  -2.055  1.00 0.00 ? 91  PHE A C    3  
ATOM 7745  O O    . PHE A 1 91  ? -0.986  16.089  -1.707  1.00 0.00 ? 91  PHE A O    3  
ATOM 7746  C CB   . PHE A 1 91  ? -0.471  13.017  -3.428  1.00 0.00 ? 91  PHE A CB   3  
ATOM 7747  C CG   . PHE A 1 91  ? 0.744   12.855  -4.295  1.00 0.00 ? 91  PHE A CG   3  
ATOM 7748  C CD1  . PHE A 1 91  ? 1.856   12.172  -3.830  1.00 0.00 ? 91  PHE A CD1  3  
ATOM 7749  C CD2  . PHE A 1 91  ? 0.776   13.388  -5.573  1.00 0.00 ? 91  PHE A CD2  3  
ATOM 7750  C CE1  . PHE A 1 91  ? 2.978   12.022  -4.625  1.00 0.00 ? 91  PHE A CE1  3  
ATOM 7751  C CE2  . PHE A 1 91  ? 1.894   13.243  -6.373  1.00 0.00 ? 91  PHE A CE2  3  
ATOM 7752  C CZ   . PHE A 1 91  ? 2.997   12.559  -5.898  1.00 0.00 ? 91  PHE A CZ   3  
ATOM 7753  H H    . PHE A 1 91  ? -1.048  12.734  -0.596  1.00 0.00 ? 91  PHE A H    3  
ATOM 7754  H HA   . PHE A 1 91  ? 0.744   14.343  -2.267  1.00 0.00 ? 91  PHE A HA   3  
ATOM 7755  H HB2  . PHE A 1 91  ? -0.798  12.035  -3.127  1.00 0.00 ? 91  PHE A HB2  3  
ATOM 7756  H HB3  . PHE A 1 91  ? -1.245  13.480  -4.023  1.00 0.00 ? 91  PHE A HB3  3  
ATOM 7757  H HD1  . PHE A 1 91  ? 1.843   11.751  -2.836  1.00 0.00 ? 91  PHE A HD1  3  
ATOM 7758  H HD2  . PHE A 1 91  ? -0.085  13.923  -5.946  1.00 0.00 ? 91  PHE A HD2  3  
ATOM 7759  H HE1  . PHE A 1 91  ? 3.838   11.487  -4.251  1.00 0.00 ? 91  PHE A HE1  3  
ATOM 7760  H HE2  . PHE A 1 91  ? 1.906   13.664  -7.367  1.00 0.00 ? 91  PHE A HE2  3  
ATOM 7761  H HZ   . PHE A 1 91  ? 3.871   12.444  -6.521  1.00 0.00 ? 91  PHE A HZ   3  
ATOM 7762  N N    . VAL A 1 92  ? -2.543  14.582  -2.339  1.00 0.00 ? 92  VAL A N    3  
ATOM 7763  C CA   . VAL A 1 92  ? -3.673  15.508  -2.254  1.00 0.00 ? 92  VAL A CA   3  
ATOM 7764  C C    . VAL A 1 92  ? -3.370  16.868  -2.889  1.00 0.00 ? 92  VAL A C    3  
ATOM 7765  O O    . VAL A 1 92  ? -4.046  17.854  -2.607  1.00 0.00 ? 92  VAL A O    3  
ATOM 7766  C CB   . VAL A 1 92  ? -4.096  15.713  -0.790  1.00 0.00 ? 92  VAL A CB   3  
ATOM 7767  C CG1  . VAL A 1 92  ? -4.292  14.370  -0.101  1.00 0.00 ? 92  VAL A CG1  3  
ATOM 7768  C CG2  . VAL A 1 92  ? -3.069  16.556  -0.048  1.00 0.00 ? 92  VAL A CG2  3  
ATOM 7769  H H    . VAL A 1 92  ? -2.715  13.657  -2.604  1.00 0.00 ? 92  VAL A H    3  
ATOM 7770  H HA   . VAL A 1 92  ? -4.504  15.062  -2.780  1.00 0.00 ? 92  VAL A HA   3  
ATOM 7771  H HB   . VAL A 1 92  ? -5.037  16.237  -0.781  1.00 0.00 ? 92  VAL A HB   3  
ATOM 7772  H HG11 . VAL A 1 92  ? -4.455  14.528  0.955   1.00 0.00 ? 92  VAL A HG11 3  
ATOM 7773  H HG12 . VAL A 1 92  ? -3.412  13.761  -0.243  1.00 0.00 ? 92  VAL A HG12 3  
ATOM 7774  H HG13 . VAL A 1 92  ? -5.149  13.869  -0.526  1.00 0.00 ? 92  VAL A HG13 3  
ATOM 7775  H HG21 . VAL A 1 92  ? -3.574  17.223  0.634   1.00 0.00 ? 92  VAL A HG21 3  
ATOM 7776  H HG22 . VAL A 1 92  ? -2.497  17.133  -0.761  1.00 0.00 ? 92  VAL A HG22 3  
ATOM 7777  H HG23 . VAL A 1 92  ? -2.405  15.909  0.505   1.00 0.00 ? 92  VAL A HG23 3  
ATOM 7778  N N    . LYS A 1 93  ? -2.347  16.910  -3.733  1.00 0.00 ? 93  LYS A N    3  
ATOM 7779  C CA   . LYS A 1 93  ? -1.941  18.142  -4.402  1.00 0.00 ? 93  LYS A CA   3  
ATOM 7780  C C    . LYS A 1 93  ? -1.514  19.201  -3.385  1.00 0.00 ? 93  LYS A C    3  
ATOM 7781  O O    . LYS A 1 93  ? -1.537  20.398  -3.669  1.00 0.00 ? 93  LYS A O    3  
ATOM 7782  C CB   . LYS A 1 93  ? -3.072  18.661  -5.309  1.00 0.00 ? 93  LYS A CB   3  
ATOM 7783  C CG   . LYS A 1 93  ? -3.934  19.762  -4.699  1.00 0.00 ? 93  LYS A CG   3  
ATOM 7784  C CD   . LYS A 1 93  ? -5.370  19.690  -5.201  1.00 0.00 ? 93  LYS A CD   3  
ATOM 7785  C CE   . LYS A 1 93  ? -6.042  18.386  -4.802  1.00 0.00 ? 93  LYS A CE   3  
ATOM 7786  N NZ   . LYS A 1 93  ? -7.075  18.591  -3.751  1.00 0.00 ? 93  LYS A NZ   3  
ATOM 7787  H H    . LYS A 1 93  ? -1.846  16.094  -3.902  1.00 0.00 ? 93  LYS A H    3  
ATOM 7788  H HA   . LYS A 1 93  ? -1.087  17.905  -5.020  1.00 0.00 ? 93  LYS A HA   3  
ATOM 7789  H HB2  . LYS A 1 93  ? -2.634  19.048  -6.216  1.00 0.00 ? 93  LYS A HB2  3  
ATOM 7790  H HB3  . LYS A 1 93  ? -3.716  17.832  -5.563  1.00 0.00 ? 93  LYS A HB3  3  
ATOM 7791  H HG2  . LYS A 1 93  ? -3.934  19.659  -3.626  1.00 0.00 ? 93  LYS A HG2  3  
ATOM 7792  H HG3  . LYS A 1 93  ? -3.517  20.720  -4.969  1.00 0.00 ? 93  LYS A HG3  3  
ATOM 7793  H HD2  . LYS A 1 93  ? -5.928  20.513  -4.780  1.00 0.00 ? 93  LYS A HD2  3  
ATOM 7794  H HD3  . LYS A 1 93  ? -5.367  19.769  -6.278  1.00 0.00 ? 93  LYS A HD3  3  
ATOM 7795  H HE2  . LYS A 1 93  ? -6.511  17.956  -5.674  1.00 0.00 ? 93  LYS A HE2  3  
ATOM 7796  H HE3  . LYS A 1 93  ? -5.290  17.705  -4.427  1.00 0.00 ? 93  LYS A HE3  3  
ATOM 7797  H HZ1  . LYS A 1 93  ? -6.887  19.473  -3.231  1.00 0.00 ? 93  LYS A HZ1  3  
ATOM 7798  H HZ2  . LYS A 1 93  ? -7.065  17.798  -3.078  1.00 0.00 ? 93  LYS A HZ2  3  
ATOM 7799  H HZ3  . LYS A 1 93  ? -8.019  18.651  -4.184  1.00 0.00 ? 93  LYS A HZ3  3  
ATOM 7800  N N    . ALA A 1 94  ? -1.120  18.747  -2.196  1.00 0.00 ? 94  ALA A N    3  
ATOM 7801  C CA   . ALA A 1 94  ? -0.685  19.649  -1.137  1.00 0.00 ? 94  ALA A CA   3  
ATOM 7802  C C    . ALA A 1 94  ? -1.731  20.729  -0.874  1.00 0.00 ? 94  ALA A C    3  
ATOM 7803  O O    . ALA A 1 94  ? -1.511  21.905  -1.163  1.00 0.00 ? 94  ALA A O    3  
ATOM 7804  C CB   . ALA A 1 94  ? 0.655   20.277  -1.498  1.00 0.00 ? 94  ALA A CB   3  
ATOM 7805  H H    . ALA A 1 94  ? -1.118  17.781  -2.029  1.00 0.00 ? 94  ALA A H    3  
ATOM 7806  H HA   . ALA A 1 94  ? -0.551  19.066  -0.237  1.00 0.00 ? 94  ALA A HA   3  
ATOM 7807  H HB1  . ALA A 1 94  ? 1.009   20.870  -0.668  1.00 0.00 ? 94  ALA A HB1  3  
ATOM 7808  H HB2  . ALA A 1 94  ? 0.534   20.906  -2.368  1.00 0.00 ? 94  ALA A HB2  3  
ATOM 7809  H HB3  . ALA A 1 94  ? 1.371   19.497  -1.716  1.00 0.00 ? 94  ALA A HB3  3  
ATOM 7810  N N    . ALA A 1 95  ? -2.872  20.317  -0.330  1.00 0.00 ? 95  ALA A N    3  
ATOM 7811  C CA   . ALA A 1 95  ? -3.956  21.245  -0.035  1.00 0.00 ? 95  ALA A CA   3  
ATOM 7812  C C    . ALA A 1 95  ? -4.611  20.934  1.313   1.00 0.00 ? 95  ALA A C    3  
ATOM 7813  O O    . ALA A 1 95  ? -5.818  20.703  1.385   1.00 0.00 ? 95  ALA A O    3  
ATOM 7814  C CB   . ALA A 1 95  ? -4.989  21.201  -1.152  1.00 0.00 ? 95  ALA A CB   3  
ATOM 7815  H H    . ALA A 1 95  ? -2.989  19.365  -0.127  1.00 0.00 ? 95  ALA A H    3  
ATOM 7816  H HA   . ALA A 1 95  ? -3.542  22.242  -0.001  1.00 0.00 ? 95  ALA A HA   3  
ATOM 7817  H HB1  . ALA A 1 95  ? -5.979  21.312  -0.734  1.00 0.00 ? 95  ALA A HB1  3  
ATOM 7818  H HB2  . ALA A 1 95  ? -4.921  20.252  -1.667  1.00 0.00 ? 95  ALA A HB2  3  
ATOM 7819  H HB3  . ALA A 1 95  ? -4.800  22.003  -1.849  1.00 0.00 ? 95  ALA A HB3  3  
ATOM 7820  N N    . PRO A 1 96  ? -3.825  20.921  2.407   1.00 0.00 ? 96  PRO A N    3  
ATOM 7821  C CA   . PRO A 1 96  ? -4.347  20.633  3.748   1.00 0.00 ? 96  PRO A CA   3  
ATOM 7822  C C    . PRO A 1 96  ? -5.425  21.626  4.186   1.00 0.00 ? 96  PRO A C    3  
ATOM 7823  O O    . PRO A 1 96  ? -6.482  21.224  4.672   1.00 0.00 ? 96  PRO A O    3  
ATOM 7824  C CB   . PRO A 1 96  ? -3.111  20.745  4.650   1.00 0.00 ? 96  PRO A CB   3  
ATOM 7825  C CG   . PRO A 1 96  ? -1.954  20.561  3.734   1.00 0.00 ? 96  PRO A CG   3  
ATOM 7826  C CD   . PRO A 1 96  ? -2.373  21.176  2.433   1.00 0.00 ? 96  PRO A CD   3  
ATOM 7827  H HA   . PRO A 1 96  ? -4.744  19.631  3.806   1.00 0.00 ? 96  PRO A HA   3  
ATOM 7828  H HB2  . PRO A 1 96  ? -3.091  21.717  5.117   1.00 0.00 ? 96  PRO A HB2  3  
ATOM 7829  H HB3  . PRO A 1 96  ? -3.142  19.976  5.405   1.00 0.00 ? 96  PRO A HB3  3  
ATOM 7830  H HG2  . PRO A 1 96  ? -1.086  21.070  4.130   1.00 0.00 ? 96  PRO A HG2  3  
ATOM 7831  H HG3  . PRO A 1 96  ? -1.748  19.510  3.604   1.00 0.00 ? 96  PRO A HG3  3  
ATOM 7832  H HD2  . PRO A 1 96  ? -2.164  22.235  2.434   1.00 0.00 ? 96  PRO A HD2  3  
ATOM 7833  H HD3  . PRO A 1 96  ? -1.877  20.691  1.609   1.00 0.00 ? 96  PRO A HD3  3  
ATOM 7834  N N    . PRO A 1 97  ? -5.175  22.942  4.031   1.00 0.00 ? 97  PRO A N    3  
ATOM 7835  C CA   . PRO A 1 97  ? -6.126  23.978  4.421   1.00 0.00 ? 97  PRO A CA   3  
ATOM 7836  C C    . PRO A 1 97  ? -7.076  24.364  3.290   1.00 0.00 ? 97  PRO A C    3  
ATOM 7837  O O    . PRO A 1 97  ? -7.539  25.503  3.220   1.00 0.00 ? 97  PRO A O    3  
ATOM 7838  C CB   . PRO A 1 97  ? -5.205  25.142  4.759   1.00 0.00 ? 97  PRO A CB   3  
ATOM 7839  C CG   . PRO A 1 97  ? -4.068  25.006  3.798   1.00 0.00 ? 97  PRO A CG   3  
ATOM 7840  C CD   . PRO A 1 97  ? -3.944  23.533  3.473   1.00 0.00 ? 97  PRO A CD   3  
ATOM 7841  H HA   . PRO A 1 97  ? -6.693  23.696  5.294   1.00 0.00 ? 97  PRO A HA   3  
ATOM 7842  H HB2  . PRO A 1 97  ? -5.732  26.076  4.622   1.00 0.00 ? 97  PRO A HB2  3  
ATOM 7843  H HB3  . PRO A 1 97  ? -4.870  25.057  5.781   1.00 0.00 ? 97  PRO A HB3  3  
ATOM 7844  H HG2  . PRO A 1 97  ? -4.279  25.569  2.902   1.00 0.00 ? 97  PRO A HG2  3  
ATOM 7845  H HG3  . PRO A 1 97  ? -3.158  25.364  4.258   1.00 0.00 ? 97  PRO A HG3  3  
ATOM 7846  H HD2  . PRO A 1 97  ? -3.899  23.388  2.403   1.00 0.00 ? 97  PRO A HD2  3  
ATOM 7847  H HD3  . PRO A 1 97  ? -3.067  23.120  3.946   1.00 0.00 ? 97  PRO A HD3  3  
ATOM 7848  N N    . GLN A 1 98  ? -7.360  23.416  2.405   1.00 0.00 ? 98  GLN A N    3  
ATOM 7849  C CA   . GLN A 1 98  ? -8.251  23.668  1.278   1.00 0.00 ? 98  GLN A CA   3  
ATOM 7850  C C    . GLN A 1 98  ? -9.675  23.214  1.588   1.00 0.00 ? 98  GLN A C    3  
ATOM 7851  O O    . GLN A 1 98  ? -10.638 23.745  1.035   1.00 0.00 ? 98  GLN A O    3  
ATOM 7852  C CB   . GLN A 1 98  ? -7.736  22.956  0.026   1.00 0.00 ? 98  GLN A CB   3  
ATOM 7853  C CG   . GLN A 1 98  ? -8.243  23.565  -1.272  1.00 0.00 ? 98  GLN A CG   3  
ATOM 7854  C CD   . GLN A 1 98  ? -9.045  22.584  -2.104  1.00 0.00 ? 98  GLN A CD   3  
ATOM 7855  O OE1  . GLN A 1 98  ? -10.138 22.170  -1.715  1.00 0.00 ? 98  GLN A OE1  3  
ATOM 7856  N NE2  . GLN A 1 98  ? -8.506  22.206  -3.257  1.00 0.00 ? 98  GLN A NE2  3  
ATOM 7857  H H    . GLN A 1 98  ? -6.960  22.528  2.507   1.00 0.00 ? 98  GLN A H    3  
ATOM 7858  H HA   . GLN A 1 98  ? -8.259  24.733  1.096   1.00 0.00 ? 98  GLN A HA   3  
ATOM 7859  H HB2  . GLN A 1 98  ? -6.657  22.998  0.022   1.00 0.00 ? 98  GLN A HB2  3  
ATOM 7860  H HB3  . GLN A 1 98  ? -8.047  21.922  0.061   1.00 0.00 ? 98  GLN A HB3  3  
ATOM 7861  H HG2  . GLN A 1 98  ? -8.871  24.411  -1.036  1.00 0.00 ? 98  GLN A HG2  3  
ATOM 7862  H HG3  . GLN A 1 98  ? -7.395  23.898  -1.852  1.00 0.00 ? 98  GLN A HG3  3  
ATOM 7863  H HE21 . GLN A 1 98  ? -7.628  22.577  -3.502  1.00 0.00 ? 98  GLN A HE21 3  
ATOM 7864  H HE22 . GLN A 1 98  ? -9.006  21.570  -3.817  1.00 0.00 ? 98  GLN A HE22 3  
ATOM 7865  N N    . LYS A 1 99  ? -9.803  22.230  2.472   1.00 0.00 ? 99  LYS A N    3  
ATOM 7866  C CA   . LYS A 1 99  ? -11.112 21.708  2.848   1.00 0.00 ? 99  LYS A CA   3  
ATOM 7867  C C    . LYS A 1 99  ? -11.997 22.812  3.425   1.00 0.00 ? 99  LYS A C    3  
ATOM 7868  O O    . LYS A 1 99  ? -13.131 23.003  2.984   1.00 0.00 ? 99  LYS A O    3  
ATOM 7869  C CB   . LYS A 1 99  ? -10.964 20.570  3.860   1.00 0.00 ? 99  LYS A CB   3  
ATOM 7870  C CG   . LYS A 1 99  ? -10.170 20.949  5.101   1.00 0.00 ? 99  LYS A CG   3  
ATOM 7871  C CD   . LYS A 1 99  ? -9.765  19.721  5.902   1.00 0.00 ? 99  LYS A CD   3  
ATOM 7872  C CE   . LYS A 1 99  ? -8.253  19.600  6.013   1.00 0.00 ? 99  LYS A CE   3  
ATOM 7873  N NZ   . LYS A 1 99  ? -7.849  18.449  6.868   1.00 0.00 ? 99  LYS A NZ   3  
ATOM 7874  H H    . LYS A 1 99  ? -8.999  21.843  2.879   1.00 0.00 ? 99  LYS A H    3  
ATOM 7875  H HA   . LYS A 1 99  ? -11.581 21.323  1.955   1.00 0.00 ? 99  LYS A HA   3  
ATOM 7876  H HB2  . LYS A 1 99  ? -11.948 20.251  4.173   1.00 0.00 ? 99  LYS A HB2  3  
ATOM 7877  H HB3  . LYS A 1 99  ? -10.464 19.740  3.380   1.00 0.00 ? 99  LYS A HB3  3  
ATOM 7878  H HG2  . LYS A 1 99  ? -9.281  21.480  4.798   1.00 0.00 ? 99  LYS A HG2  3  
ATOM 7879  H HG3  . LYS A 1 99  ? -10.779 21.589  5.723   1.00 0.00 ? 99  LYS A HG3  3  
ATOM 7880  H HD2  . LYS A 1 99  ? -10.182 19.798  6.896   1.00 0.00 ? 99  LYS A HD2  3  
ATOM 7881  H HD3  . LYS A 1 99  ? -10.153 18.839  5.415   1.00 0.00 ? 99  LYS A HD3  3  
ATOM 7882  H HE2  . LYS A 1 99  ? -7.843  19.464  5.024   1.00 0.00 ? 99  LYS A HE2  3  
ATOM 7883  H HE3  . LYS A 1 99  ? -7.862  20.511  6.442   1.00 0.00 ? 99  LYS A HE3  3  
ATOM 7884  H HZ1  . LYS A 1 99  ? -6.829  18.491  7.064   1.00 0.00 ? 99  LYS A HZ1  3  
ATOM 7885  H HZ2  . LYS A 1 99  ? -8.062  17.554  6.384   1.00 0.00 ? 99  LYS A HZ2  3  
ATOM 7886  H HZ3  . LYS A 1 99  ? -8.367  18.474  7.770   1.00 0.00 ? 99  LYS A HZ3  3  
ATOM 7887  N N    . ARG A 1 100 ? -11.472 23.537  4.411   1.00 0.00 ? 100 ARG A N    3  
ATOM 7888  C CA   . ARG A 1 100 ? -12.214 24.624  5.047   1.00 0.00 ? 100 ARG A CA   3  
ATOM 7889  C C    . ARG A 1 100 ? -13.641 24.201  5.386   1.00 0.00 ? 100 ARG A C    3  
ATOM 7890  O O    . ARG A 1 100 ? -14.556 25.023  5.402   1.00 0.00 ? 100 ARG A O    3  
ATOM 7891  C CB   . ARG A 1 100 ? -12.240 25.854  4.136   1.00 0.00 ? 100 ARG A CB   3  
ATOM 7892  C CG   . ARG A 1 100 ? -12.748 27.111  4.824   1.00 0.00 ? 100 ARG A CG   3  
ATOM 7893  C CD   . ARG A 1 100 ? -11.610 28.044  5.205   1.00 0.00 ? 100 ARG A CD   3  
ATOM 7894  N NE   . ARG A 1 100 ? -10.783 27.491  6.276   1.00 0.00 ? 100 ARG A NE   3  
ATOM 7895  C CZ   . ARG A 1 100 ? -9.614  26.881  6.081   1.00 0.00 ? 100 ARG A CZ   3  
ATOM 7896  N NH1  . ARG A 1 100 ? -9.119  26.741  4.857   1.00 0.00 ? 100 ARG A NH1  3  
ATOM 7897  N NH2  . ARG A 1 100 ? -8.937  26.408  7.118   1.00 0.00 ? 100 ARG A NH2  3  
ATOM 7898  H H    . ARG A 1 100 ? -10.563 23.338  4.716   1.00 0.00 ? 100 ARG A H    3  
ATOM 7899  H HA   . ARG A 1 100 ? -11.702 24.880  5.964   1.00 0.00 ? 100 ARG A HA   3  
ATOM 7900  H HB2  . ARG A 1 100 ? -11.239 26.044  3.779   1.00 0.00 ? 100 ARG A HB2  3  
ATOM 7901  H HB3  . ARG A 1 100 ? -12.880 25.647  3.293   1.00 0.00 ? 100 ARG A HB3  3  
ATOM 7902  H HG2  . ARG A 1 100 ? -13.416 27.630  4.154   1.00 0.00 ? 100 ARG A HG2  3  
ATOM 7903  H HG3  . ARG A 1 100 ? -13.283 26.827  5.720   1.00 0.00 ? 100 ARG A HG3  3  
ATOM 7904  H HD2  . ARG A 1 100 ? -10.995 28.215  4.335   1.00 0.00 ? 100 ARG A HD2  3  
ATOM 7905  H HD3  . ARG A 1 100 ? -12.029 28.982  5.536   1.00 0.00 ? 100 ARG A HD3  3  
ATOM 7906  H HE   . ARG A 1 100 ? -11.116 27.578  7.193   1.00 0.00 ? 100 ARG A HE   3  
ATOM 7907  H HH11 . ARG A 1 100 ? -9.619  27.095  4.069   1.00 0.00 ? 100 ARG A HH11 3  
ATOM 7908  H HH12 . ARG A 1 100 ? -8.241  26.281  4.724   1.00 0.00 ? 100 ARG A HH12 3  
ATOM 7909  H HH22 . ARG A 1 100 ? -8.060  25.948  6.976   1.00 0.00 ? 100 ARG A HH22 3  
ATOM 7910  N N    . PHE A 1 101 ? -13.824 22.912  5.655   1.00 0.00 ? 101 PHE A N    3  
ATOM 7911  C CA   . PHE A 1 101 ? -15.141 22.381  5.991   1.00 0.00 ? 101 PHE A CA   3  
ATOM 7912  C C    . PHE A 1 101 ? -15.018 21.119  6.839   1.00 0.00 ? 101 PHE A C    3  
ATOM 7913  O O    . PHE A 1 101 ? -15.535 21.118  7.977   1.00 0.00 ? 101 PHE A O    3  
ATOM 7914  C CB   . PHE A 1 101 ? -15.933 22.084  4.716   1.00 0.00 ? 101 PHE A CB   3  
ATOM 7915  C CG   . PHE A 1 101 ? -17.151 22.949  4.549   1.00 0.00 ? 101 PHE A CG   3  
ATOM 7916  C CD1  . PHE A 1 101 ? -17.038 24.239  4.057   1.00 0.00 ? 101 PHE A CD1  3  
ATOM 7917  C CD2  . PHE A 1 101 ? -18.407 22.472  4.887   1.00 0.00 ? 101 PHE A CD2  3  
ATOM 7918  C CE1  . PHE A 1 101 ? -18.156 25.037  3.903   1.00 0.00 ? 101 PHE A CE1  3  
ATOM 7919  C CE2  . PHE A 1 101 ? -19.529 23.264  4.735   1.00 0.00 ? 101 PHE A CE2  3  
ATOM 7920  C CZ   . PHE A 1 101 ? -19.403 24.550  4.243   1.00 0.00 ? 101 PHE A CZ   3  
ATOM 7921  O OXT  . PHE A 1 101 ? -14.407 20.141  6.358   1.00 0.00 ? 101 PHE A OXT  3  
ATOM 7922  H H    . PHE A 1 101 ? -13.057 22.303  5.626   1.00 0.00 ? 101 PHE A H    3  
ATOM 7923  H HA   . PHE A 1 101 ? -15.664 23.134  6.562   1.00 0.00 ? 101 PHE A HA   3  
ATOM 7924  H HB2  . PHE A 1 101 ? -15.295 22.242  3.859   1.00 0.00 ? 101 PHE A HB2  3  
ATOM 7925  H HB3  . PHE A 1 101 ? -16.257 21.053  4.731   1.00 0.00 ? 101 PHE A HB3  3  
ATOM 7926  H HD1  . PHE A 1 101 ? -16.064 24.622  3.790   1.00 0.00 ? 101 PHE A HD1  3  
ATOM 7927  H HD2  . PHE A 1 101 ? -18.506 21.467  5.272   1.00 0.00 ? 101 PHE A HD2  3  
ATOM 7928  H HE1  . PHE A 1 101 ? -18.056 26.041  3.518   1.00 0.00 ? 101 PHE A HE1  3  
ATOM 7929  H HE2  . PHE A 1 101 ? -20.502 22.880  5.001   1.00 0.00 ? 101 PHE A HE2  3  
ATOM 7930  H HZ   . PHE A 1 101 ? -20.278 25.171  4.123   1.00 0.00 ? 101 PHE A HZ   3  
ATOM 7931  N N    . SER B 1 1   ? -14.685 10.865  16.659  1.00 0.00 ? 1   SER B N    3  
ATOM 7932  C CA   . SER B 1 1   ? -15.869 9.984   16.470  1.00 0.00 ? 1   SER B CA   3  
ATOM 7933  C C    . SER B 1 1   ? -15.446 8.550   16.169  1.00 0.00 ? 1   SER B C    3  
ATOM 7934  O O    . SER B 1 1   ? -16.048 7.877   15.331  1.00 0.00 ? 1   SER B O    3  
ATOM 7935  C CB   . SER B 1 1   ? -16.710 10.539  15.318  1.00 0.00 ? 1   SER B CB   3  
ATOM 7936  O OG   . SER B 1 1   ? -18.035 10.037  15.365  1.00 0.00 ? 1   SER B OG   3  
ATOM 7937  H H1   . SER B 1 1   ? -14.272 10.645  17.587  1.00 0.00 ? 1   SER B H1   3  
ATOM 7938  H H2   . SER B 1 1   ? -15.016 11.851  16.618  1.00 0.00 ? 1   SER B H2   3  
ATOM 7939  H H3   . SER B 1 1   ? -14.013 10.661  15.893  1.00 0.00 ? 1   SER B H3   3  
ATOM 7940  H HA   . SER B 1 1   ? -16.455 9.996   17.376  1.00 0.00 ? 1   SER B HA   3  
ATOM 7941  H HB2  . SER B 1 1   ? -16.745 11.617  15.388  1.00 0.00 ? 1   SER B HB2  3  
ATOM 7942  H HB3  . SER B 1 1   ? -16.262 10.254  14.379  1.00 0.00 ? 1   SER B HB3  3  
ATOM 7943  H HG   . SER B 1 1   ? -18.503 10.433  16.104  1.00 0.00 ? 1   SER B HG   3  
ATOM 7944  N N    . ARG B 1 2   ? -14.407 8.088   16.857  1.00 0.00 ? 2   ARG B N    3  
ATOM 7945  C CA   . ARG B 1 2   ? -13.904 6.733   16.664  1.00 0.00 ? 2   ARG B CA   3  
ATOM 7946  C C    . ARG B 1 2   ? -13.429 6.528   15.225  1.00 0.00 ? 2   ARG B C    3  
ATOM 7947  O O    . ARG B 1 2   ? -14.243 6.368   14.315  1.00 0.00 ? 2   ARG B O    3  
ATOM 7948  C CB   . ARG B 1 2   ? -14.990 5.711   17.004  1.00 0.00 ? 2   ARG B CB   3  
ATOM 7949  C CG   . ARG B 1 2   ? -14.457 4.303   17.207  1.00 0.00 ? 2   ARG B CG   3  
ATOM 7950  C CD   . ARG B 1 2   ? -15.560 3.347   17.633  1.00 0.00 ? 2   ARG B CD   3  
ATOM 7951  N NE   . ARG B 1 2   ? -15.034 2.038   18.015  1.00 0.00 ? 2   ARG B NE   3  
ATOM 7952  C CZ   . ARG B 1 2   ? -14.447 1.786   19.182  1.00 0.00 ? 2   ARG B CZ   3  
ATOM 7953  N NH1  . ARG B 1 2   ? -14.313 2.749   20.086  1.00 0.00 ? 2   ARG B NH1  3  
ATOM 7954  N NH2  . ARG B 1 2   ? -13.996 0.569   19.448  1.00 0.00 ? 2   ARG B NH2  3  
ATOM 7955  H H    . ARG B 1 2   ? -13.969 8.672   17.511  1.00 0.00 ? 2   ARG B H    3  
ATOM 7956  H HA   . ARG B 1 2   ? -13.069 6.592   17.333  1.00 0.00 ? 2   ARG B HA   3  
ATOM 7957  H HB2  . ARG B 1 2   ? -15.487 6.020   17.911  1.00 0.00 ? 2   ARG B HB2  3  
ATOM 7958  H HB3  . ARG B 1 2   ? -15.710 5.688   16.199  1.00 0.00 ? 2   ARG B HB3  3  
ATOM 7959  H HG2  . ARG B 1 2   ? -14.029 3.952   16.279  1.00 0.00 ? 2   ARG B HG2  3  
ATOM 7960  H HG3  . ARG B 1 2   ? -13.695 4.323   17.972  1.00 0.00 ? 2   ARG B HG3  3  
ATOM 7961  H HD2  . ARG B 1 2   ? -16.082 3.773   18.476  1.00 0.00 ? 2   ARG B HD2  3  
ATOM 7962  H HD3  . ARG B 1 2   ? -16.248 3.222   16.810  1.00 0.00 ? 2   ARG B HD3  3  
ATOM 7963  H HE   . ARG B 1 2   ? -15.120 1.309   17.365  1.00 0.00 ? 2   ARG B HE   3  
ATOM 7964  H HH11 . ARG B 1 2   ? -14.652 3.669   19.892  1.00 0.00 ? 2   ARG B HH11 3  
ATOM 7965  H HH12 . ARG B 1 2   ? -13.872 2.554   20.962  1.00 0.00 ? 2   ARG B HH12 3  
ATOM 7966  H HH22 . ARG B 1 2   ? -13.555 0.379   20.326  1.00 0.00 ? 2   ARG B HH22 3  
ATOM 7967  N N    . PRO B 1 3   ? -12.103 6.530   14.999  1.00 0.00 ? 3   PRO B N    3  
ATOM 7968  C CA   . PRO B 1 3   ? -11.521 6.343   13.664  1.00 0.00 ? 3   PRO B CA   3  
ATOM 7969  C C    . PRO B 1 3   ? -11.894 4.982   13.063  1.00 0.00 ? 3   PRO B C    3  
ATOM 7970  O O    . PRO B 1 3   ? -13.075 4.655   12.957  1.00 0.00 ? 3   PRO B O    3  
ATOM 7971  C CB   . PRO B 1 3   ? -10.008 6.464   13.931  1.00 0.00 ? 3   PRO B CB   3  
ATOM 7972  C CG   . PRO B 1 3   ? -9.921  7.234   15.194  1.00 0.00 ? 3   PRO B CG   3  
ATOM 7973  C CD   . PRO B 1 3   ? -11.054 6.713   16.014  1.00 0.00 ? 3   PRO B CD   3  
ATOM 7974  H HA   . PRO B 1 3   ? -11.834 7.127   12.988  1.00 0.00 ? 3   PRO B HA   3  
ATOM 7975  H HB2  . PRO B 1 3   ? -9.579  5.482   14.049  1.00 0.00 ? 3   PRO B HB2  3  
ATOM 7976  H HB3  . PRO B 1 3   ? -9.530  6.984   13.114  1.00 0.00 ? 3   PRO B HB3  3  
ATOM 7977  H HG2  . PRO B 1 3   ? -8.976  7.045   15.683  1.00 0.00 ? 3   PRO B HG2  3  
ATOM 7978  H HG3  . PRO B 1 3   ? -10.049 8.289   15.001  1.00 0.00 ? 3   PRO B HG3  3  
ATOM 7979  H HD2  . PRO B 1 3   ? -10.784 5.768   16.461  1.00 0.00 ? 3   PRO B HD2  3  
ATOM 7980  H HD3  . PRO B 1 3   ? -11.353 7.428   16.762  1.00 0.00 ? 3   PRO B HD3  3  
ATOM 7981  N N    . THR B 1 4   ? -10.897 4.189   12.669  1.00 0.00 ? 4   THR B N    3  
ATOM 7982  C CA   . THR B 1 4   ? -11.155 2.878   12.087  1.00 0.00 ? 4   THR B CA   3  
ATOM 7983  C C    . THR B 1 4   ? -9.869  2.084   11.926  1.00 0.00 ? 4   THR B C    3  
ATOM 7984  O O    . THR B 1 4   ? -8.811  2.634   11.623  1.00 0.00 ? 4   THR B O    3  
ATOM 7985  C CB   . THR B 1 4   ? -11.874 3.014   10.737  1.00 0.00 ? 4   THR B CB   3  
ATOM 7986  O OG1  . THR B 1 4   ? -11.686 1.851   9.948   1.00 0.00 ? 4   THR B OG1  3  
ATOM 7987  C CG2  . THR B 1 4   ? -11.415 4.201   9.916   1.00 0.00 ? 4   THR B CG2  3  
ATOM 7988  H H    . THR B 1 4   ? -9.974  4.489   12.772  1.00 0.00 ? 4   THR B H    3  
ATOM 7989  H HA   . THR B 1 4   ? -11.793 2.335   12.764  1.00 0.00 ? 4   THR B HA   3  
ATOM 7990  H HB   . THR B 1 4   ? -12.933 3.129   10.919  1.00 0.00 ? 4   THR B HB   3  
ATOM 7991  H HG1  . THR B 1 4   ? -12.151 1.953   9.114   1.00 0.00 ? 4   THR B HG1  3  
ATOM 7992  H HG21 . THR B 1 4   ? -11.247 5.046   10.566  1.00 0.00 ? 4   THR B HG21 3  
ATOM 7993  H HG22 . THR B 1 4   ? -12.175 4.451   9.190   1.00 0.00 ? 4   THR B HG22 3  
ATOM 7994  H HG23 . THR B 1 4   ? -10.497 3.952   9.404   1.00 0.00 ? 4   THR B HG23 3  
ATOM 7995  N N    . GLU B 1 5   ? -9.980  0.779   12.134  1.00 0.00 ? 5   GLU B N    3  
ATOM 7996  C CA   . GLU B 1 5   ? -8.847  -0.128  12.020  1.00 0.00 ? 5   GLU B CA   3  
ATOM 7997  C C    . GLU B 1 5   ? -8.033  0.171   10.765  1.00 0.00 ? 5   GLU B C    3  
ATOM 7998  O O    . GLU B 1 5   ? -6.802  0.179   10.796  1.00 0.00 ? 5   GLU B O    3  
ATOM 7999  C CB   . GLU B 1 5   ? -9.358  -1.564  11.993  1.00 0.00 ? 5   GLU B CB   3  
ATOM 8000  C CG   . GLU B 1 5   ? -8.504  -2.533  12.793  1.00 0.00 ? 5   GLU B CG   3  
ATOM 8001  C CD   . GLU B 1 5   ? -7.624  -3.397  11.913  1.00 0.00 ? 5   GLU B CD   3  
ATOM 8002  O OE1  . GLU B 1 5   ? -8.169  -4.261  11.195  1.00 0.00 ? 5   GLU B OE1  3  
ATOM 8003  O OE2  . GLU B 1 5   ? -6.389  -3.212  11.942  1.00 0.00 ? 5   GLU B OE2  3  
ATOM 8004  H H    . GLU B 1 5   ? -10.857 0.410   12.372  1.00 0.00 ? 5   GLU B H    3  
ATOM 8005  H HA   . GLU B 1 5   ? -8.220  0.007   12.888  1.00 0.00 ? 5   GLU B HA   3  
ATOM 8006  H HB2  . GLU B 1 5   ? -10.360 -1.575  12.399  1.00 0.00 ? 5   GLU B HB2  3  
ATOM 8007  H HB3  . GLU B 1 5   ? -9.390  -1.903  10.969  1.00 0.00 ? 5   GLU B HB3  3  
ATOM 8008  H HG2  . GLU B 1 5   ? -7.873  -1.967  13.463  1.00 0.00 ? 5   GLU B HG2  3  
ATOM 8009  H HG3  . GLU B 1 5   ? -9.155  -3.175  13.370  1.00 0.00 ? 5   GLU B HG3  3  
ATOM 8010  N N    . THR B 1 6   ? -8.732  0.436   9.669   1.00 0.00 ? 6   THR B N    3  
ATOM 8011  C CA   . THR B 1 6   ? -8.082  0.758   8.407   1.00 0.00 ? 6   THR B CA   3  
ATOM 8012  C C    . THR B 1 6   ? -7.385  2.107   8.509   1.00 0.00 ? 6   THR B C    3  
ATOM 8013  O O    . THR B 1 6   ? -6.287  2.293   7.994   1.00 0.00 ? 6   THR B O    3  
ATOM 8014  C CB   . THR B 1 6   ? -9.110  0.789   7.277   1.00 0.00 ? 6   THR B CB   3  
ATOM 8015  O OG1  . THR B 1 6   ? -10.169 -0.113  7.540   1.00 0.00 ? 6   THR B OG1  3  
ATOM 8016  C CG2  . THR B 1 6   ? -8.526  0.434   5.929   1.00 0.00 ? 6   THR B CG2  3  
ATOM 8017  H H    . THR B 1 6   ? -9.711  0.427   9.714   1.00 0.00 ? 6   THR B H    3  
ATOM 8018  H HA   . THR B 1 6   ? -7.345  -0.006  8.197   1.00 0.00 ? 6   THR B HA   3  
ATOM 8019  H HB   . THR B 1 6   ? -9.522  1.786   7.206   1.00 0.00 ? 6   THR B HB   3  
ATOM 8020  H HG1  . THR B 1 6   ? -9.811  -0.984  7.726   1.00 0.00 ? 6   THR B HG1  3  
ATOM 8021  H HG21 . THR B 1 6   ? -7.966  1.274   5.549   1.00 0.00 ? 6   THR B HG21 3  
ATOM 8022  H HG22 . THR B 1 6   ? -9.324  0.193   5.243   1.00 0.00 ? 6   THR B HG22 3  
ATOM 8023  H HG23 . THR B 1 6   ? -7.871  -0.417  6.034   1.00 0.00 ? 6   THR B HG23 3  
ATOM 8024  N N    . GLU B 1 7   ? -8.025  3.045   9.195   1.00 0.00 ? 7   GLU B N    3  
ATOM 8025  C CA   . GLU B 1 7   ? -7.463  4.380   9.368   1.00 0.00 ? 7   GLU B CA   3  
ATOM 8026  C C    . GLU B 1 7   ? -6.033  4.293   9.888   1.00 0.00 ? 7   GLU B C    3  
ATOM 8027  O O    . GLU B 1 7   ? -5.182  5.112   9.537   1.00 0.00 ? 7   GLU B O    3  
ATOM 8028  C CB   . GLU B 1 7   ? -8.326  5.200   10.335  1.00 0.00 ? 7   GLU B CB   3  
ATOM 8029  C CG   . GLU B 1 7   ? -8.936  6.440   9.701   1.00 0.00 ? 7   GLU B CG   3  
ATOM 8030  C CD   . GLU B 1 7   ? -8.563  7.714   10.435  1.00 0.00 ? 7   GLU B CD   3  
ATOM 8031  O OE1  . GLU B 1 7   ? -7.452  7.769   11.003  1.00 0.00 ? 7   GLU B OE1  3  
ATOM 8032  O OE2  . GLU B 1 7   ? -9.381  8.657   10.441  1.00 0.00 ? 7   GLU B OE2  3  
ATOM 8033  H H    . GLU B 1 7   ? -8.894  2.835   9.592   1.00 0.00 ? 7   GLU B H    3  
ATOM 8034  H HA   . GLU B 1 7   ? -7.456  4.866   8.403   1.00 0.00 ? 7   GLU B HA   3  
ATOM 8035  H HB2  . GLU B 1 7   ? -9.130  4.576   10.701  1.00 0.00 ? 7   GLU B HB2  3  
ATOM 8036  H HB3  . GLU B 1 7   ? -7.716  5.510   11.171  1.00 0.00 ? 7   GLU B HB3  3  
ATOM 8037  H HG2  . GLU B 1 7   ? -8.587  6.516   8.683   1.00 0.00 ? 7   GLU B HG2  3  
ATOM 8038  H HG3  . GLU B 1 7   ? -10.011 6.340   9.706   1.00 0.00 ? 7   GLU B HG3  3  
ATOM 8039  N N    . ARG B 1 8   ? -5.770  3.283   10.707  1.00 0.00 ? 8   ARG B N    3  
ATOM 8040  C CA   . ARG B 1 8   ? -4.437  3.073   11.252  1.00 0.00 ? 8   ARG B CA   3  
ATOM 8041  C C    . ARG B 1 8   ? -3.538  2.393   10.221  1.00 0.00 ? 8   ARG B C    3  
ATOM 8042  O O    . ARG B 1 8   ? -2.318  2.552   10.247  1.00 0.00 ? 8   ARG B O    3  
ATOM 8043  C CB   . ARG B 1 8   ? -4.507  2.229   12.526  1.00 0.00 ? 8   ARG B CB   3  
ATOM 8044  C CG   . ARG B 1 8   ? -4.707  3.048   13.791  1.00 0.00 ? 8   ARG B CG   3  
ATOM 8045  C CD   . ARG B 1 8   ? -6.126  2.920   14.322  1.00 0.00 ? 8   ARG B CD   3  
ATOM 8046  N NE   . ARG B 1 8   ? -6.175  3.006   15.781  1.00 0.00 ? 8   ARG B NE   3  
ATOM 8047  C CZ   . ARG B 1 8   ? -6.120  4.151   16.457  1.00 0.00 ? 8   ARG B CZ   3  
ATOM 8048  N NH1  . ARG B 1 8   ? -6.011  5.307   15.813  1.00 0.00 ? 8   ARG B NH1  3  
ATOM 8049  N NH2  . ARG B 1 8   ? -6.173  4.141   17.783  1.00 0.00 ? 8   ARG B NH2  3  
ATOM 8050  H H    . ARG B 1 8   ? -6.486  2.654   10.936  1.00 0.00 ? 8   ARG B H    3  
ATOM 8051  H HA   . ARG B 1 8   ? -4.022  4.042   11.492  1.00 0.00 ? 8   ARG B HA   3  
ATOM 8052  H HB2  . ARG B 1 8   ? -5.329  1.533   12.437  1.00 0.00 ? 8   ARG B HB2  3  
ATOM 8053  H HB3  . ARG B 1 8   ? -3.587  1.673   12.625  1.00 0.00 ? 8   ARG B HB3  3  
ATOM 8054  H HG2  . ARG B 1 8   ? -4.018  2.700   14.546  1.00 0.00 ? 8   ARG B HG2  3  
ATOM 8055  H HG3  . ARG B 1 8   ? -4.509  4.087   13.570  1.00 0.00 ? 8   ARG B HG3  3  
ATOM 8056  H HD2  . ARG B 1 8   ? -6.727  3.713   13.905  1.00 0.00 ? 8   ARG B HD2  3  
ATOM 8057  H HD3  . ARG B 1 8   ? -6.527  1.965   14.015  1.00 0.00 ? 8   ARG B HD3  3  
ATOM 8058  H HE   . ARG B 1 8   ? -6.253  2.168   16.282  1.00 0.00 ? 8   ARG B HE   3  
ATOM 8059  H HH11 . ARG B 1 8   ? -5.970  5.321   14.814  1.00 0.00 ? 8   ARG B HH11 3  
ATOM 8060  H HH12 . ARG B 1 8   ? -5.970  6.164   16.327  1.00 0.00 ? 8   ARG B HH12 3  
ATOM 8061  H HH22 . ARG B 1 8   ? -6.132  5.002   18.291  1.00 0.00 ? 8   ARG B HH22 3  
ATOM 8062  N N    . CYS B 1 9   ? -4.152  1.628   9.317   1.00 0.00 ? 9   CYS B N    3  
ATOM 8063  C CA   . CYS B 1 9   ? -3.406  0.916   8.282   1.00 0.00 ? 9   CYS B CA   3  
ATOM 8064  C C    . CYS B 1 9   ? -2.808  1.886   7.266   1.00 0.00 ? 9   CYS B C    3  
ATOM 8065  O O    . CYS B 1 9   ? -1.645  1.759   6.883   1.00 0.00 ? 9   CYS B O    3  
ATOM 8066  C CB   . CYS B 1 9   ? -4.309  -0.122  7.584   1.00 0.00 ? 9   CYS B CB   3  
ATOM 8067  S SG   . CYS B 1 9   ? -5.270  0.494   6.177   1.00 0.00 ? 9   CYS B SG   3  
ATOM 8068  H H    . CYS B 1 9   ? -5.125  1.536   9.351   1.00 0.00 ? 9   CYS B H    3  
ATOM 8069  H HA   . CYS B 1 9   ? -2.596  0.394   8.769   1.00 0.00 ? 9   CYS B HA   3  
ATOM 8070  H HB2  . CYS B 1 9   ? -3.694  -0.928  7.219   1.00 0.00 ? 9   CYS B HB2  3  
ATOM 8071  H HB3  . CYS B 1 9   ? -5.007  -0.516  8.309   1.00 0.00 ? 9   CYS B HB3  3  
ATOM 8072  H HG   . CYS B 1 9   ? -5.933  -0.164  5.960   1.00 0.00 ? 9   CYS B HG   3  
ATOM 8073  N N    . ILE B 1 10  ? -3.608  2.851   6.828   1.00 0.00 ? 10  ILE B N    3  
ATOM 8074  C CA   . ILE B 1 10  ? -3.155  3.829   5.853   1.00 0.00 ? 10  ILE B CA   3  
ATOM 8075  C C    . ILE B 1 10  ? -2.062  4.721   6.427   1.00 0.00 ? 10  ILE B C    3  
ATOM 8076  O O    . ILE B 1 10  ? -0.973  4.816   5.867   1.00 0.00 ? 10  ILE B O    3  
ATOM 8077  C CB   . ILE B 1 10  ? -4.319  4.715   5.372   1.00 0.00 ? 10  ILE B CB   3  
ATOM 8078  C CG1  . ILE B 1 10  ? -5.516  3.855   4.971   1.00 0.00 ? 10  ILE B CG1  3  
ATOM 8079  C CG2  . ILE B 1 10  ? -3.879  5.581   4.204   1.00 0.00 ? 10  ILE B CG2  3  
ATOM 8080  C CD1  . ILE B 1 10  ? -6.653  3.893   5.959   1.00 0.00 ? 10  ILE B CD1  3  
ATOM 8081  H H    . ILE B 1 10  ? -4.526  2.903   7.162   1.00 0.00 ? 10  ILE B H    3  
ATOM 8082  H HA   . ILE B 1 10  ? -2.762  3.295   5.001   1.00 0.00 ? 10  ILE B HA   3  
ATOM 8083  H HB   . ILE B 1 10  ? -4.608  5.366   6.183   1.00 0.00 ? 10  ILE B HB   3  
ATOM 8084  H HG12 . ILE B 1 10  ? -5.897  4.202   4.025   1.00 0.00 ? 10  ILE B HG12 3  
ATOM 8085  H HG13 . ILE B 1 10  ? -5.196  2.827   4.873   1.00 0.00 ? 10  ILE B HG13 3  
ATOM 8086  H HG21 . ILE B 1 10  ? -3.871  6.615   4.508   1.00 0.00 ? 10  ILE B HG21 3  
ATOM 8087  H HG22 . ILE B 1 10  ? -4.568  5.451   3.382   1.00 0.00 ? 10  ILE B HG22 3  
ATOM 8088  H HG23 . ILE B 1 10  ? -2.887  5.287   3.894   1.00 0.00 ? 10  ILE B HG23 3  
ATOM 8089  H HD11 . ILE B 1 10  ? -7.073  2.903   6.056   1.00 0.00 ? 10  ILE B HD11 3  
ATOM 8090  H HD12 . ILE B 1 10  ? -7.413  4.574   5.609   1.00 0.00 ? 10  ILE B HD12 3  
ATOM 8091  H HD13 . ILE B 1 10  ? -6.285  4.223   6.919   1.00 0.00 ? 10  ILE B HD13 3  
ATOM 8092  N N    . GLU B 1 11  ? -2.360  5.378   7.541   1.00 0.00 ? 11  GLU B N    3  
ATOM 8093  C CA   . GLU B 1 11  ? -1.403  6.277   8.179   1.00 0.00 ? 11  GLU B CA   3  
ATOM 8094  C C    . GLU B 1 11  ? -0.060  5.596   8.412   1.00 0.00 ? 11  GLU B C    3  
ATOM 8095  O O    . GLU B 1 11  ? 0.978   6.257   8.471   1.00 0.00 ? 11  GLU B O    3  
ATOM 8096  C CB   . GLU B 1 11  ? -1.965  6.798   9.502   1.00 0.00 ? 11  GLU B CB   3  
ATOM 8097  C CG   . GLU B 1 11  ? -2.050  8.314   9.560   1.00 0.00 ? 11  GLU B CG   3  
ATOM 8098  C CD   . GLU B 1 11  ? -1.454  8.885   10.833  1.00 0.00 ? 11  GLU B CD   3  
ATOM 8099  O OE1  . GLU B 1 11  ? -0.345  8.456   11.214  1.00 0.00 ? 11  GLU B OE1  3  
ATOM 8100  O OE2  . GLU B 1 11  ? -2.096  9.763   11.446  1.00 0.00 ? 11  GLU B OE2  3  
ATOM 8101  H H    . GLU B 1 11  ? -3.249  5.266   7.939   1.00 0.00 ? 11  GLU B H    3  
ATOM 8102  H HA   . GLU B 1 11  ? -1.251  7.113   7.520   1.00 0.00 ? 11  GLU B HA   3  
ATOM 8103  H HB2  . GLU B 1 11  ? -2.957  6.395   9.644   1.00 0.00 ? 11  GLU B HB2  3  
ATOM 8104  H HB3  . GLU B 1 11  ? -1.331  6.462   10.310  1.00 0.00 ? 11  GLU B HB3  3  
ATOM 8105  H HG2  . GLU B 1 11  ? -1.514  8.724   8.714   1.00 0.00 ? 11  GLU B HG2  3  
ATOM 8106  H HG3  . GLU B 1 11  ? -3.089  8.604   9.504   1.00 0.00 ? 11  GLU B HG3  3  
ATOM 8107  N N    . SER B 1 12  ? -0.084  4.280   8.558   1.00 0.00 ? 12  SER B N    3  
ATOM 8108  C CA   . SER B 1 12  ? 1.134   3.523   8.800   1.00 0.00 ? 12  SER B CA   3  
ATOM 8109  C C    . SER B 1 12  ? 2.043   3.489   7.566   1.00 0.00 ? 12  SER B C    3  
ATOM 8110  O O    . SER B 1 12  ? 3.213   3.856   7.648   1.00 0.00 ? 12  SER B O    3  
ATOM 8111  C CB   . SER B 1 12  ? 0.779   2.101   9.235   1.00 0.00 ? 12  SER B CB   3  
ATOM 8112  O OG   . SER B 1 12  ? 1.691   1.624   10.209  1.00 0.00 ? 12  SER B OG   3  
ATOM 8113  H H    . SER B 1 12  ? -0.941  3.808   8.511   1.00 0.00 ? 12  SER B H    3  
ATOM 8114  H HA   . SER B 1 12  ? 1.666   4.007   9.603   1.00 0.00 ? 12  SER B HA   3  
ATOM 8115  H HB2  . SER B 1 12  ? -0.214  2.096   9.660   1.00 0.00 ? 12  SER B HB2  3  
ATOM 8116  H HB3  . SER B 1 12  ? 0.806   1.445   8.378   1.00 0.00 ? 12  SER B HB3  3  
ATOM 8117  H HG   . SER B 1 12  ? 1.701   2.223   10.960  1.00 0.00 ? 12  SER B HG   3  
ATOM 8118  N N    . LEU B 1 13  ? 1.513   3.031   6.432   1.00 0.00 ? 13  LEU B N    3  
ATOM 8119  C CA   . LEU B 1 13  ? 2.292   2.930   5.202   1.00 0.00 ? 13  LEU B CA   3  
ATOM 8120  C C    . LEU B 1 13  ? 2.670   4.296   4.616   1.00 0.00 ? 13  LEU B C    3  
ATOM 8121  O O    . LEU B 1 13  ? 3.684   4.428   3.933   1.00 0.00 ? 13  LEU B O    3  
ATOM 8122  C CB   . LEU B 1 13  ? 1.525   2.104   4.181   1.00 0.00 ? 13  LEU B CB   3  
ATOM 8123  C CG   . LEU B 1 13  ? 1.833   0.609   4.220   1.00 0.00 ? 13  LEU B CG   3  
ATOM 8124  C CD1  . LEU B 1 13  ? 3.312   0.362   3.979   1.00 0.00 ? 13  LEU B CD1  3  
ATOM 8125  C CD2  . LEU B 1 13  ? 1.419   -0.006  5.544   1.00 0.00 ? 13  LEU B CD2  3  
ATOM 8126  H H    . LEU B 1 13  ? 0.580   2.729   6.422   1.00 0.00 ? 13  LEU B H    3  
ATOM 8127  H HA   . LEU B 1 13  ? 3.204   2.404   5.443   1.00 0.00 ? 13  LEU B HA   3  
ATOM 8128  H HB2  . LEU B 1 13  ? 0.467   2.242   4.358   1.00 0.00 ? 13  LEU B HB2  3  
ATOM 8129  H HB3  . LEU B 1 13  ? 1.762   2.473   3.196   1.00 0.00 ? 13  LEU B HB3  3  
ATOM 8130  H HG   . LEU B 1 13  ? 1.277   0.124   3.441   1.00 0.00 ? 13  LEU B HG   3  
ATOM 8131  H HD11 . LEU B 1 13  ? 3.800   0.137   4.922   1.00 0.00 ? 13  LEU B HD11 3  
ATOM 8132  H HD12 . LEU B 1 13  ? 3.759   1.244   3.544   1.00 0.00 ? 13  LEU B HD12 3  
ATOM 8133  H HD13 . LEU B 1 13  ? 3.431   -0.473  3.307   1.00 0.00 ? 13  LEU B HD13 3  
ATOM 8134  H HD21 . LEU B 1 13  ? 1.293   0.769   6.282   1.00 0.00 ? 13  LEU B HD21 3  
ATOM 8135  H HD22 . LEU B 1 13  ? 2.187   -0.694  5.869   1.00 0.00 ? 13  LEU B HD22 3  
ATOM 8136  H HD23 . LEU B 1 13  ? 0.493   -0.542  5.417   1.00 0.00 ? 13  LEU B HD23 3  
ATOM 8137  N N    . ILE B 1 14  ? 1.873   5.311   4.881   1.00 0.00 ? 14  ILE B N    3  
ATOM 8138  C CA   . ILE B 1 14  ? 2.170   6.639   4.382   1.00 0.00 ? 14  ILE B CA   3  
ATOM 8139  C C    . ILE B 1 14  ? 3.377   7.212   5.072   1.00 0.00 ? 14  ILE B C    3  
ATOM 8140  O O    . ILE B 1 14  ? 4.141   7.967   4.489   1.00 0.00 ? 14  ILE B O    3  
ATOM 8141  C CB   . ILE B 1 14  ? 1.035   7.608   4.673   1.00 0.00 ? 14  ILE B CB   3  
ATOM 8142  C CG1  . ILE B 1 14  ? -0.308  7.029   4.295   1.00 0.00 ? 14  ILE B CG1  3  
ATOM 8143  C CG2  . ILE B 1 14  ? 1.275   8.913   3.963   1.00 0.00 ? 14  ILE B CG2  3  
ATOM 8144  C CD1  . ILE B 1 14  ? -1.407  7.609   5.136   1.00 0.00 ? 14  ILE B CD1  3  
ATOM 8145  H H    . ILE B 1 14  ? 1.080   5.179   5.428   1.00 0.00 ? 14  ILE B H    3  
ATOM 8146  H HA   . ILE B 1 14  ? 2.337   6.603   3.323   1.00 0.00 ? 14  ILE B HA   3  
ATOM 8147  H HB   . ILE B 1 14  ? 1.038   7.809   5.734   1.00 0.00 ? 14  ILE B HB   3  
ATOM 8148  H HG12 . ILE B 1 14  ? -0.519  7.245   3.257   1.00 0.00 ? 14  ILE B HG12 3  
ATOM 8149  H HG13 . ILE B 1 14  ? -0.290  5.965   4.450   1.00 0.00 ? 14  ILE B HG13 3  
ATOM 8150  H HG21 . ILE B 1 14  ? 2.150   8.816   3.337   1.00 0.00 ? 14  ILE B HG21 3  
ATOM 8151  H HG22 . ILE B 1 14  ? 1.438   9.687   4.698   1.00 0.00 ? 14  ILE B HG22 3  
ATOM 8152  H HG23 . ILE B 1 14  ? 0.418   9.156   3.359   1.00 0.00 ? 14  ILE B HG23 3  
ATOM 8153  H HD11 . ILE B 1 14  ? -0.973  8.015   6.042   1.00 0.00 ? 14  ILE B HD11 3  
ATOM 8154  H HD12 . ILE B 1 14  ? -2.116  6.839   5.386   1.00 0.00 ? 14  ILE B HD12 3  
ATOM 8155  H HD13 . ILE B 1 14  ? -1.899  8.396   4.590   1.00 0.00 ? 14  ILE B HD13 3  
ATOM 8156  N N    . ALA B 1 15  ? 3.487   6.880   6.339   1.00 0.00 ? 15  ALA B N    3  
ATOM 8157  C CA   . ALA B 1 15  ? 4.536   7.388   7.189   1.00 0.00 ? 15  ALA B CA   3  
ATOM 8158  C C    . ALA B 1 15  ? 5.867   6.690   6.956   1.00 0.00 ? 15  ALA B C    3  
ATOM 8159  O O    . ALA B 1 15  ? 6.927   7.287   7.141   1.00 0.00 ? 15  ALA B O    3  
ATOM 8160  C CB   . ALA B 1 15  ? 4.062   7.262   8.620   1.00 0.00 ? 15  ALA B CB   3  
ATOM 8161  H H    . ALA B 1 15  ? 2.812   6.289   6.729   1.00 0.00 ? 15  ALA B H    3  
ATOM 8162  H HA   . ALA B 1 15  ? 4.655   8.440   6.973   1.00 0.00 ? 15  ALA B HA   3  
ATOM 8163  H HB1  . ALA B 1 15  ? 2.973   7.245   8.622   1.00 0.00 ? 15  ALA B HB1  3  
ATOM 8164  H HB2  . ALA B 1 15  ? 4.412   8.107   9.194   1.00 0.00 ? 15  ALA B HB2  3  
ATOM 8165  H HB3  . ALA B 1 15  ? 4.437   6.347   9.049   1.00 0.00 ? 15  ALA B HB3  3  
ATOM 8166  N N    . VAL B 1 16  ? 5.816   5.439   6.525   1.00 0.00 ? 16  VAL B N    3  
ATOM 8167  C CA   . VAL B 1 16  ? 7.025   4.695   6.245   1.00 0.00 ? 16  VAL B CA   3  
ATOM 8168  C C    . VAL B 1 16  ? 7.788   5.352   5.103   1.00 0.00 ? 16  VAL B C    3  
ATOM 8169  O O    . VAL B 1 16  ? 9.019   5.374   5.087   1.00 0.00 ? 16  VAL B O    3  
ATOM 8170  C CB   . VAL B 1 16  ? 6.696   3.243   5.855   1.00 0.00 ? 16  VAL B CB   3  
ATOM 8171  C CG1  . VAL B 1 16  ? 5.940   2.553   6.954   1.00 0.00 ? 16  VAL B CG1  3  
ATOM 8172  C CG2  . VAL B 1 16  ? 5.867   3.199   4.594   1.00 0.00 ? 16  VAL B CG2  3  
ATOM 8173  H H    . VAL B 1 16  ? 4.951   5.012   6.373   1.00 0.00 ? 16  VAL B H    3  
ATOM 8174  H HA   . VAL B 1 16  ? 7.640   4.688   7.133   1.00 0.00 ? 16  VAL B HA   3  
ATOM 8175  H HB   . VAL B 1 16  ? 7.612   2.715   5.684   1.00 0.00 ? 16  VAL B HB   3  
ATOM 8176  H HG11 . VAL B 1 16  ? 6.610   2.308   7.761   1.00 0.00 ? 16  VAL B HG11 3  
ATOM 8177  H HG12 . VAL B 1 16  ? 5.492   1.648   6.558   1.00 0.00 ? 16  VAL B HG12 3  
ATOM 8178  H HG13 . VAL B 1 16  ? 5.168   3.216   7.309   1.00 0.00 ? 16  VAL B HG13 3  
ATOM 8179  H HG21 . VAL B 1 16  ? 6.294   3.849   3.854   1.00 0.00 ? 16  VAL B HG21 3  
ATOM 8180  H HG22 . VAL B 1 16  ? 4.868   3.528   4.830   1.00 0.00 ? 16  VAL B HG22 3  
ATOM 8181  H HG23 . VAL B 1 16  ? 5.835   2.187   4.216   1.00 0.00 ? 16  VAL B HG23 3  
ATOM 8182  N N    . PHE B 1 17  ? 7.033   5.862   4.134   1.00 0.00 ? 17  PHE B N    3  
ATOM 8183  C CA   . PHE B 1 17  ? 7.632   6.499   2.955   1.00 0.00 ? 17  PHE B CA   3  
ATOM 8184  C C    . PHE B 1 17  ? 8.075   7.942   3.218   1.00 0.00 ? 17  PHE B C    3  
ATOM 8185  O O    . PHE B 1 17  ? 9.250   8.269   3.061   1.00 0.00 ? 17  PHE B O    3  
ATOM 8186  C CB   . PHE B 1 17  ? 6.638   6.455   1.780   1.00 0.00 ? 17  PHE B CB   3  
ATOM 8187  C CG   . PHE B 1 17  ? 6.521   7.741   1.005   1.00 0.00 ? 17  PHE B CG   3  
ATOM 8188  C CD1  . PHE B 1 17  ? 7.595   8.228   0.277   1.00 0.00 ? 17  PHE B CD1  3  
ATOM 8189  C CD2  . PHE B 1 17  ? 5.336   8.460   1.008   1.00 0.00 ? 17  PHE B CD2  3  
ATOM 8190  C CE1  . PHE B 1 17  ? 7.490   9.408   -0.434  1.00 0.00 ? 17  PHE B CE1  3  
ATOM 8191  C CE2  . PHE B 1 17  ? 5.225   9.641   0.298   1.00 0.00 ? 17  PHE B CE2  3  
ATOM 8192  C CZ   . PHE B 1 17  ? 6.303   10.116  -0.423  1.00 0.00 ? 17  PHE B CZ   3  
ATOM 8193  H H    . PHE B 1 17  ? 6.049   5.785   4.207   1.00 0.00 ? 17  PHE B H    3  
ATOM 8194  H HA   . PHE B 1 17  ? 8.505   5.925   2.685   1.00 0.00 ? 17  PHE B HA   3  
ATOM 8195  H HB2  . PHE B 1 17  ? 6.951   5.686   1.088   1.00 0.00 ? 17  PHE B HB2  3  
ATOM 8196  H HB3  . PHE B 1 17  ? 5.658   6.206   2.161   1.00 0.00 ? 17  PHE B HB3  3  
ATOM 8197  H HD1  . PHE B 1 17  ? 8.523   7.676   0.268   1.00 0.00 ? 17  PHE B HD1  3  
ATOM 8198  H HD2  . PHE B 1 17  ? 4.493   8.090   1.571   1.00 0.00 ? 17  PHE B HD2  3  
ATOM 8199  H HE1  . PHE B 1 17  ? 8.335   9.777   -0.997  1.00 0.00 ? 17  PHE B HE1  3  
ATOM 8200  H HE2  . PHE B 1 17  ? 4.297   10.192  0.307   1.00 0.00 ? 17  PHE B HE2  3  
ATOM 8201  H HZ   . PHE B 1 17  ? 6.219   11.038  -0.979  1.00 0.00 ? 17  PHE B HZ   3  
ATOM 8202  N N    . GLN B 1 18  ? 7.132   8.805   3.593   1.00 0.00 ? 18  GLN B N    3  
ATOM 8203  C CA   . GLN B 1 18  ? 7.443   10.215  3.837   1.00 0.00 ? 18  GLN B CA   3  
ATOM 8204  C C    . GLN B 1 18  ? 8.505   10.398  4.911   1.00 0.00 ? 18  GLN B C    3  
ATOM 8205  O O    . GLN B 1 18  ? 9.219   11.400  4.908   1.00 0.00 ? 18  GLN B O    3  
ATOM 8206  C CB   . GLN B 1 18  ? 6.192   11.006  4.216   1.00 0.00 ? 18  GLN B CB   3  
ATOM 8207  C CG   . GLN B 1 18  ? 5.224   10.241  5.089   1.00 0.00 ? 18  GLN B CG   3  
ATOM 8208  C CD   . GLN B 1 18  ? 3.801   10.727  4.934   1.00 0.00 ? 18  GLN B CD   3  
ATOM 8209  O OE1  . GLN B 1 18  ? 3.128   11.049  5.914   1.00 0.00 ? 18  GLN B OE1  3  
ATOM 8210  N NE2  . GLN B 1 18  ? 3.335   10.784  3.693   1.00 0.00 ? 18  GLN B NE2  3  
ATOM 8211  H H    . GLN B 1 18  ? 6.207   8.494   3.680   1.00 0.00 ? 18  GLN B H    3  
ATOM 8212  H HA   . GLN B 1 18  ? 7.827   10.620  2.916   1.00 0.00 ? 18  GLN B HA   3  
ATOM 8213  H HB2  . GLN B 1 18  ? 6.492   11.897  4.748   1.00 0.00 ? 18  GLN B HB2  3  
ATOM 8214  H HB3  . GLN B 1 18  ? 5.677   11.295  3.313   1.00 0.00 ? 18  GLN B HB3  3  
ATOM 8215  H HG2  . GLN B 1 18  ? 5.263   9.202   4.810   1.00 0.00 ? 18  GLN B HG2  3  
ATOM 8216  H HG3  . GLN B 1 18  ? 5.522   10.351  6.119   1.00 0.00 ? 18  GLN B HG3  3  
ATOM 8217  H HE21 . GLN B 1 18  ? 3.932   10.510  2.960   1.00 0.00 ? 18  GLN B HE21 3  
ATOM 8218  H HE22 . GLN B 1 18  ? 2.413   11.091  3.559   1.00 0.00 ? 18  GLN B HE22 3  
ATOM 8219  N N    . LYS B 1 19  ? 8.618   9.446   5.835   1.00 0.00 ? 19  LYS B N    3  
ATOM 8220  C CA   . LYS B 1 19  ? 9.617   9.563   6.895   1.00 0.00 ? 19  LYS B CA   3  
ATOM 8221  C C    . LYS B 1 19  ? 10.983  9.854   6.285   1.00 0.00 ? 19  LYS B C    3  
ATOM 8222  O O    . LYS B 1 19  ? 11.636  10.836  6.639   1.00 0.00 ? 19  LYS B O    3  
ATOM 8223  C CB   . LYS B 1 19  ? 9.670   8.275   7.723   1.00 0.00 ? 19  LYS B CB   3  
ATOM 8224  C CG   . LYS B 1 19  ? 10.720  8.297   8.822   1.00 0.00 ? 19  LYS B CG   3  
ATOM 8225  C CD   . LYS B 1 19  ? 10.192  8.955   10.086  1.00 0.00 ? 19  LYS B CD   3  
ATOM 8226  C CE   . LYS B 1 19  ? 9.000   8.200   10.650  1.00 0.00 ? 19  LYS B CE   3  
ATOM 8227  N NZ   . LYS B 1 19  ? 8.821   8.453   12.107  1.00 0.00 ? 19  LYS B NZ   3  
ATOM 8228  H H    . LYS B 1 19  ? 8.029   8.665   5.805   1.00 0.00 ? 19  LYS B H    3  
ATOM 8229  H HA   . LYS B 1 19  ? 9.332   10.386  7.533   1.00 0.00 ? 19  LYS B HA   3  
ATOM 8230  H HB2  . LYS B 1 19  ? 8.705   8.118   8.181   1.00 0.00 ? 19  LYS B HB2  3  
ATOM 8231  H HB3  . LYS B 1 19  ? 9.885   7.447   7.064   1.00 0.00 ? 19  LYS B HB3  3  
ATOM 8232  H HG2  . LYS B 1 19  ? 11.009  7.282   9.050   1.00 0.00 ? 19  LYS B HG2  3  
ATOM 8233  H HG3  . LYS B 1 19  ? 11.582  8.848   8.472   1.00 0.00 ? 19  LYS B HG3  3  
ATOM 8234  H HD2  . LYS B 1 19  ? 10.977  8.972   10.826  1.00 0.00 ? 19  LYS B HD2  3  
ATOM 8235  H HD3  . LYS B 1 19  ? 9.891   9.967   9.855   1.00 0.00 ? 19  LYS B HD3  3  
ATOM 8236  H HE2  . LYS B 1 19  ? 8.109   8.517   10.128  1.00 0.00 ? 19  LYS B HE2  3  
ATOM 8237  H HE3  . LYS B 1 19  ? 9.151   7.142   10.492  1.00 0.00 ? 19  LYS B HE3  3  
ATOM 8238  H HZ1  . LYS B 1 19  ? 9.247   9.365   12.366  1.00 0.00 ? 19  LYS B HZ1  3  
ATOM 8239  H HZ2  . LYS B 1 19  ? 9.279   7.699   12.658  1.00 0.00 ? 19  LYS B HZ2  3  
ATOM 8240  H HZ3  . LYS B 1 19  ? 7.808   8.473   12.344  1.00 0.00 ? 19  LYS B HZ3  3  
ATOM 8241  N N    . TYR B 1 20  ? 11.378  9.029   5.323   1.00 0.00 ? 20  TYR B N    3  
ATOM 8242  C CA   . TYR B 1 20  ? 12.630  9.231   4.611   1.00 0.00 ? 20  TYR B CA   3  
ATOM 8243  C C    . TYR B 1 20  ? 12.429  10.288  3.534   1.00 0.00 ? 20  TYR B C    3  
ATOM 8244  O O    . TYR B 1 20  ? 13.352  11.014  3.160   1.00 0.00 ? 20  TYR B O    3  
ATOM 8245  C CB   . TYR B 1 20  ? 13.128  7.920   4.003   1.00 0.00 ? 20  TYR B CB   3  
ATOM 8246  C CG   . TYR B 1 20  ? 14.182  7.238   4.845   1.00 0.00 ? 20  TYR B CG   3  
ATOM 8247  C CD1  . TYR B 1 20  ? 13.854  6.665   6.068   1.00 0.00 ? 20  TYR B CD1  3  
ATOM 8248  C CD2  . TYR B 1 20  ? 15.504  7.173   4.425   1.00 0.00 ? 20  TYR B CD2  3  
ATOM 8249  C CE1  . TYR B 1 20  ? 14.813  6.045   6.846   1.00 0.00 ? 20  TYR B CE1  3  
ATOM 8250  C CE2  . TYR B 1 20  ? 16.470  6.554   5.198   1.00 0.00 ? 20  TYR B CE2  3  
ATOM 8251  C CZ   . TYR B 1 20  ? 16.118  5.993   6.406   1.00 0.00 ? 20  TYR B CZ   3  
ATOM 8252  O OH   . TYR B 1 20  ? 17.076  5.376   7.179   1.00 0.00 ? 20  TYR B OH   3  
ATOM 8253  H H    . TYR B 1 20  ? 10.787  8.296   5.048   1.00 0.00 ? 20  TYR B H    3  
ATOM 8254  H HA   . TYR B 1 20  ? 13.361  9.593   5.322   1.00 0.00 ? 20  TYR B HA   3  
ATOM 8255  H HB2  . TYR B 1 20  ? 12.296  7.240   3.895   1.00 0.00 ? 20  TYR B HB2  3  
ATOM 8256  H HB3  . TYR B 1 20  ? 13.555  8.118   3.031   1.00 0.00 ? 20  TYR B HB3  3  
ATOM 8257  H HD1  . TYR B 1 20  ? 12.831  6.706   6.409   1.00 0.00 ? 20  TYR B HD1  3  
ATOM 8258  H HD2  . TYR B 1 20  ? 15.776  7.614   3.477   1.00 0.00 ? 20  TYR B HD2  3  
ATOM 8259  H HE1  . TYR B 1 20  ? 14.537  5.605   7.793   1.00 0.00 ? 20  TYR B HE1  3  
ATOM 8260  H HE2  . TYR B 1 20  ? 17.491  6.513   4.853   1.00 0.00 ? 20  TYR B HE2  3  
ATOM 8261  H HH   . TYR B 1 20  ? 16.899  4.433   7.217   1.00 0.00 ? 20  TYR B HH   3  
ATOM 8262  N N    . ALA B 1 21  ? 11.195  10.342  3.036   1.00 0.00 ? 21  ALA B N    3  
ATOM 8263  C CA   . ALA B 1 21  ? 10.797  11.270  1.990   1.00 0.00 ? 21  ALA B CA   3  
ATOM 8264  C C    . ALA B 1 21  ? 10.440  12.649  2.547   1.00 0.00 ? 21  ALA B C    3  
ATOM 8265  O O    . ALA B 1 21  ? 9.748   13.428  1.891   1.00 0.00 ? 21  ALA B O    3  
ATOM 8266  C CB   . ALA B 1 21  ? 9.615   10.678  1.240   1.00 0.00 ? 21  ALA B CB   3  
ATOM 8267  H H    . ALA B 1 21  ? 10.525  9.719   3.382   1.00 0.00 ? 21  ALA B H    3  
ATOM 8268  H HA   . ALA B 1 21  ? 11.616  11.373  1.299   1.00 0.00 ? 21  ALA B HA   3  
ATOM 8269  H HB1  . ALA B 1 21  ? 9.118   9.952   1.876   1.00 0.00 ? 21  ALA B HB1  3  
ATOM 8270  H HB2  . ALA B 1 21  ? 9.963   10.187  0.340   1.00 0.00 ? 21  ALA B HB2  3  
ATOM 8271  H HB3  . ALA B 1 21  ? 8.919   11.460  0.980   1.00 0.00 ? 21  ALA B HB3  3  
ATOM 8272  N N    . GLY B 1 22  ? 10.912  12.950  3.754   1.00 0.00 ? 22  GLY B N    3  
ATOM 8273  C CA   . GLY B 1 22  ? 10.625  14.237  4.359   1.00 0.00 ? 22  GLY B CA   3  
ATOM 8274  C C    . GLY B 1 22  ? 9.331   14.232  5.149   1.00 0.00 ? 22  GLY B C    3  
ATOM 8275  O O    . GLY B 1 22  ? 8.272   13.896  4.618   1.00 0.00 ? 22  GLY B O    3  
ATOM 8276  H H    . GLY B 1 22  ? 11.458  12.298  4.236   1.00 0.00 ? 22  GLY B H    3  
ATOM 8277  H HA2  . GLY B 1 22  ? 11.436  14.501  5.021   1.00 0.00 ? 22  GLY B HA2  3  
ATOM 8278  H HA3  . GLY B 1 22  ? 10.555  14.981  3.581   1.00 0.00 ? 22  GLY B HA3  3  
ATOM 8279  N N    . LYS B 1 23  ? 9.416   14.607  6.422   1.00 0.00 ? 23  LYS B N    3  
ATOM 8280  C CA   . LYS B 1 23  ? 8.243   14.645  7.288   1.00 0.00 ? 23  LYS B CA   3  
ATOM 8281  C C    . LYS B 1 23  ? 7.932   16.076  7.717   1.00 0.00 ? 23  LYS B C    3  
ATOM 8282  O O    . LYS B 1 23  ? 7.407   16.306  8.807   1.00 0.00 ? 23  LYS B O    3  
ATOM 8283  C CB   . LYS B 1 23  ? 8.464   13.766  8.520   1.00 0.00 ? 23  LYS B CB   3  
ATOM 8284  C CG   . LYS B 1 23  ? 7.175   13.373  9.224   1.00 0.00 ? 23  LYS B CG   3  
ATOM 8285  C CD   . LYS B 1 23  ? 6.455   12.257  8.486   1.00 0.00 ? 23  LYS B CD   3  
ATOM 8286  C CE   . LYS B 1 23  ? 5.585   11.439  9.425   1.00 0.00 ? 23  LYS B CE   3  
ATOM 8287  N NZ   . LYS B 1 23  ? 4.307   11.027  8.782   1.00 0.00 ? 23  LYS B NZ   3  
ATOM 8288  H H    . LYS B 1 23  ? 10.288  14.864  6.787   1.00 0.00 ? 23  LYS B H    3  
ATOM 8289  H HA   . LYS B 1 23  ? 7.405   14.260  6.727   1.00 0.00 ? 23  LYS B HA   3  
ATOM 8290  H HB2  . LYS B 1 23  ? 8.974   12.863  8.217   1.00 0.00 ? 23  LYS B HB2  3  
ATOM 8291  H HB3  . LYS B 1 23  ? 9.085   14.302  9.223   1.00 0.00 ? 23  LYS B HB3  3  
ATOM 8292  H HG2  . LYS B 1 23  ? 7.411   13.036  10.223  1.00 0.00 ? 23  LYS B HG2  3  
ATOM 8293  H HG3  . LYS B 1 23  ? 6.528   14.235  9.276   1.00 0.00 ? 23  LYS B HG3  3  
ATOM 8294  H HD2  . LYS B 1 23  ? 5.830   12.691  7.720   1.00 0.00 ? 23  LYS B HD2  3  
ATOM 8295  H HD3  . LYS B 1 23  ? 7.188   11.607  8.030   1.00 0.00 ? 23  LYS B HD3  3  
ATOM 8296  H HE2  . LYS B 1 23  ? 6.129   10.554  9.721   1.00 0.00 ? 23  LYS B HE2  3  
ATOM 8297  H HE3  . LYS B 1 23  ? 5.365   12.032  10.300  1.00 0.00 ? 23  LYS B HE3  3  
ATOM 8298  H HZ1  . LYS B 1 23  ? 4.391   10.063  8.401   1.00 0.00 ? 23  LYS B HZ1  3  
ATOM 8299  H HZ2  . LYS B 1 23  ? 4.072   11.676  8.004   1.00 0.00 ? 23  LYS B HZ2  3  
ATOM 8300  H HZ3  . LYS B 1 23  ? 3.533   11.046  9.479   1.00 0.00 ? 23  LYS B HZ3  3  
ATOM 8301  N N    . ASP B 1 24  ? 8.261   17.032  6.855   1.00 0.00 ? 24  ASP B N    3  
ATOM 8302  C CA   . ASP B 1 24  ? 8.018   18.441  7.146   1.00 0.00 ? 24  ASP B CA   3  
ATOM 8303  C C    . ASP B 1 24  ? 7.441   19.157  5.929   1.00 0.00 ? 24  ASP B C    3  
ATOM 8304  O O    . ASP B 1 24  ? 6.426   19.846  6.025   1.00 0.00 ? 24  ASP B O    3  
ATOM 8305  C CB   . ASP B 1 24  ? 9.314   19.123  7.587   1.00 0.00 ? 24  ASP B CB   3  
ATOM 8306  C CG   . ASP B 1 24  ? 9.082   20.162  8.666   1.00 0.00 ? 24  ASP B CG   3  
ATOM 8307  O OD1  . ASP B 1 24  ? 8.456   19.823  9.692   1.00 0.00 ? 24  ASP B OD1  3  
ATOM 8308  O OD2  . ASP B 1 24  ? 9.526   21.316  8.485   1.00 0.00 ? 24  ASP B OD2  3  
ATOM 8309  H H    . ASP B 1 24  ? 8.678   16.786  6.004   1.00 0.00 ? 24  ASP B H    3  
ATOM 8310  H HA   . ASP B 1 24  ? 7.302   18.493  7.952   1.00 0.00 ? 24  ASP B HA   3  
ATOM 8311  H HB2  . ASP B 1 24  ? 9.993   18.378  7.971   1.00 0.00 ? 24  ASP B HB2  3  
ATOM 8312  H HB3  . ASP B 1 24  ? 9.765   19.610  6.734   1.00 0.00 ? 24  ASP B HB3  3  
ATOM 8313  N N    . GLY B 1 25  ? 8.095   18.988  4.784   1.00 0.00 ? 25  GLY B N    3  
ATOM 8314  C CA   . GLY B 1 25  ? 7.632   19.623  3.565   1.00 0.00 ? 25  GLY B CA   3  
ATOM 8315  C C    . GLY B 1 25  ? 8.752   19.862  2.571   1.00 0.00 ? 25  GLY B C    3  
ATOM 8316  O O    . GLY B 1 25  ? 9.165   21.001  2.353   1.00 0.00 ? 25  GLY B O    3  
ATOM 8317  H H    . GLY B 1 25  ? 8.899   18.426  4.768   1.00 0.00 ? 25  GLY B H    3  
ATOM 8318  H HA2  . GLY B 1 25  ? 6.886   18.992  3.105   1.00 0.00 ? 25  GLY B HA2  3  
ATOM 8319  H HA3  . GLY B 1 25  ? 7.181   20.572  3.816   1.00 0.00 ? 25  GLY B HA3  3  
ATOM 8320  N N    . HIS B 1 26  ? 9.244   18.784  1.969   1.00 0.00 ? 26  HIS B N    3  
ATOM 8321  C CA   . HIS B 1 26  ? 10.323  18.881  0.993   1.00 0.00 ? 26  HIS B CA   3  
ATOM 8322  C C    . HIS B 1 26  ? 10.202  17.786  -0.062  1.00 0.00 ? 26  HIS B C    3  
ATOM 8323  O O    . HIS B 1 26  ? 10.634  16.654  0.154   1.00 0.00 ? 26  HIS B O    3  
ATOM 8324  C CB   . HIS B 1 26  ? 11.681  18.786  1.690   1.00 0.00 ? 26  HIS B CB   3  
ATOM 8325  C CG   . HIS B 1 26  ? 12.764  19.554  0.999   1.00 0.00 ? 26  HIS B CG   3  
ATOM 8326  N ND1  . HIS B 1 26  ? 13.943  19.918  1.617   1.00 0.00 ? 26  HIS B ND1  3  
ATOM 8327  C CD2  . HIS B 1 26  ? 12.844  20.029  -0.267  1.00 0.00 ? 26  HIS B CD2  3  
ATOM 8328  C CE1  . HIS B 1 26  ? 14.698  20.584  0.761   1.00 0.00 ? 26  HIS B CE1  3  
ATOM 8329  N NE2  . HIS B 1 26  ? 14.056  20.664  -0.388  1.00 0.00 ? 26  HIS B NE2  3  
ATOM 8330  H H    . HIS B 1 26  ? 8.873   17.904  2.186   1.00 0.00 ? 26  HIS B H    3  
ATOM 8331  H HA   . HIS B 1 26  ? 10.245  19.842  0.508   1.00 0.00 ? 26  HIS B HA   3  
ATOM 8332  H HB2  . HIS B 1 26  ? 11.590  19.173  2.695   1.00 0.00 ? 26  HIS B HB2  3  
ATOM 8333  H HB3  . HIS B 1 26  ? 11.983  17.750  1.735   1.00 0.00 ? 26  HIS B HB3  3  
ATOM 8334  H HD1  . HIS B 1 26  ? 14.188  19.718  2.545   1.00 0.00 ? 26  HIS B HD1  3  
ATOM 8335  H HD2  . HIS B 1 26  ? 12.094  19.926  -1.039  1.00 0.00 ? 26  HIS B HD2  3  
ATOM 8336  H HE1  . HIS B 1 26  ? 15.677  20.991  0.969   1.00 0.00 ? 26  HIS B HE1  3  
ATOM 8337  H HE2  . HIS B 1 26  ? 14.427  21.028  -1.219  1.00 0.00 ? 26  HIS B HE2  3  
ATOM 8338  N N    . SER B 1 27  ? 9.611   18.132  -1.201  1.00 0.00 ? 27  SER B N    3  
ATOM 8339  C CA   . SER B 1 27  ? 9.433   17.180  -2.292  1.00 0.00 ? 27  SER B CA   3  
ATOM 8340  C C    . SER B 1 27  ? 8.543   16.018  -1.861  1.00 0.00 ? 27  SER B C    3  
ATOM 8341  O O    . SER B 1 27  ? 8.549   15.617  -0.696  1.00 0.00 ? 27  SER B O    3  
ATOM 8342  C CB   . SER B 1 27  ? 10.788  16.651  -2.766  1.00 0.00 ? 27  SER B CB   3  
ATOM 8343  O OG   . SER B 1 27  ? 11.381  17.535  -3.703  1.00 0.00 ? 27  SER B OG   3  
ATOM 8344  H H    . SER B 1 27  ? 9.288   19.050  -1.312  1.00 0.00 ? 27  SER B H    3  
ATOM 8345  H HA   . SER B 1 27  ? 8.953   17.699  -3.109  1.00 0.00 ? 27  SER B HA   3  
ATOM 8346  H HB2  . SER B 1 27  ? 11.450  16.550  -1.919  1.00 0.00 ? 27  SER B HB2  3  
ATOM 8347  H HB3  . SER B 1 27  ? 10.653  15.688  -3.235  1.00 0.00 ? 27  SER B HB3  3  
ATOM 8348  H HG   . SER B 1 27  ? 11.820  18.250  -3.236  1.00 0.00 ? 27  SER B HG   3  
ATOM 8349  N N    . VAL B 1 28  ? 7.778   15.481  -2.805  1.00 0.00 ? 28  VAL B N    3  
ATOM 8350  C CA   . VAL B 1 28  ? 6.884   14.367  -2.523  1.00 0.00 ? 28  VAL B CA   3  
ATOM 8351  C C    . VAL B 1 28  ? 7.451   13.056  -3.062  1.00 0.00 ? 28  VAL B C    3  
ATOM 8352  O O    . VAL B 1 28  ? 6.714   12.203  -3.557  1.00 0.00 ? 28  VAL B O    3  
ATOM 8353  C CB   . VAL B 1 28  ? 5.486   14.601  -3.129  1.00 0.00 ? 28  VAL B CB   3  
ATOM 8354  C CG1  . VAL B 1 28  ? 4.770   15.732  -2.404  1.00 0.00 ? 28  VAL B CG1  3  
ATOM 8355  C CG2  . VAL B 1 28  ? 5.593   14.894  -4.618  1.00 0.00 ? 28  VAL B CG2  3  
ATOM 8356  H H    . VAL B 1 28  ? 7.818   15.845  -3.715  1.00 0.00 ? 28  VAL B H    3  
ATOM 8357  H HA   . VAL B 1 28  ? 6.779   14.287  -1.450  1.00 0.00 ? 28  VAL B HA   3  
ATOM 8358  H HB   . VAL B 1 28  ? 4.906   13.699  -3.003  1.00 0.00 ? 28  VAL B HB   3  
ATOM 8359  H HG11 . VAL B 1 28  ? 5.497   16.375  -1.932  1.00 0.00 ? 28  VAL B HG11 3  
ATOM 8360  H HG12 . VAL B 1 28  ? 4.113   15.319  -1.653  1.00 0.00 ? 28  VAL B HG12 3  
ATOM 8361  H HG13 . VAL B 1 28  ? 4.189   16.305  -3.114  1.00 0.00 ? 28  VAL B HG13 3  
ATOM 8362  H HG21 . VAL B 1 28  ? 6.137   14.098  -5.103  1.00 0.00 ? 28  VAL B HG21 3  
ATOM 8363  H HG22 . VAL B 1 28  ? 6.115   15.828  -4.764  1.00 0.00 ? 28  VAL B HG22 3  
ATOM 8364  H HG23 . VAL B 1 28  ? 4.603   14.965  -5.042  1.00 0.00 ? 28  VAL B HG23 3  
ATOM 8365  N N    . THR B 1 29  ? 8.769   12.902  -2.960  1.00 0.00 ? 29  THR B N    3  
ATOM 8366  C CA   . THR B 1 29  ? 9.441   11.700  -3.433  1.00 0.00 ? 29  THR B CA   3  
ATOM 8367  C C    . THR B 1 29  ? 10.638  11.361  -2.554  1.00 0.00 ? 29  THR B C    3  
ATOM 8368  O O    . THR B 1 29  ? 11.177  12.220  -1.856  1.00 0.00 ? 29  THR B O    3  
ATOM 8369  C CB   . THR B 1 29  ? 9.901   11.875  -4.877  1.00 0.00 ? 29  THR B CB   3  
ATOM 8370  O OG1  . THR B 1 29  ? 10.456  13.162  -5.078  1.00 0.00 ? 29  THR B OG1  3  
ATOM 8371  C CG2  . THR B 1 29  ? 8.789   11.688  -5.881  1.00 0.00 ? 29  THR B CG2  3  
ATOM 8372  H H    . THR B 1 29  ? 9.302   13.616  -2.556  1.00 0.00 ? 29  THR B H    3  
ATOM 8373  H HA   . THR B 1 29  ? 8.738   10.884  -3.393  1.00 0.00 ? 29  THR B HA   3  
ATOM 8374  H HB   . THR B 1 29  ? 10.661  11.138  -5.086  1.00 0.00 ? 29  THR B HB   3  
ATOM 8375  H HG1  . THR B 1 29  ? 10.917  13.185  -5.920  1.00 0.00 ? 29  THR B HG1  3  
ATOM 8376  H HG21 . THR B 1 29  ? 8.535   10.640  -5.942  1.00 0.00 ? 29  THR B HG21 3  
ATOM 8377  H HG22 . THR B 1 29  ? 9.115   12.037  -6.850  1.00 0.00 ? 29  THR B HG22 3  
ATOM 8378  H HG23 . THR B 1 29  ? 7.922   12.251  -5.567  1.00 0.00 ? 29  THR B HG23 3  
ATOM 8379  N N    . LEU B 1 30  ? 11.050  10.102  -2.603  1.00 0.00 ? 30  LEU B N    3  
ATOM 8380  C CA   . LEU B 1 30  ? 12.190  9.631   -1.823  1.00 0.00 ? 30  LEU B CA   3  
ATOM 8381  C C    . LEU B 1 30  ? 13.296  9.149   -2.759  1.00 0.00 ? 30  LEU B C    3  
ATOM 8382  O O    . LEU B 1 30  ? 13.349  9.555   -3.918  1.00 0.00 ? 30  LEU B O    3  
ATOM 8383  C CB   . LEU B 1 30  ? 11.754  8.496   -0.881  1.00 0.00 ? 30  LEU B CB   3  
ATOM 8384  C CG   . LEU B 1 30  ? 12.433  8.441   0.504   1.00 0.00 ? 30  LEU B CG   3  
ATOM 8385  C CD1  . LEU B 1 30  ? 13.087  7.086   0.725   1.00 0.00 ? 30  LEU B CD1  3  
ATOM 8386  C CD2  . LEU B 1 30  ? 13.462  9.551   0.678   1.00 0.00 ? 30  LEU B CD2  3  
ATOM 8387  H H    . LEU B 1 30  ? 10.578  9.472   -3.187  1.00 0.00 ? 30  LEU B H    3  
ATOM 8388  H HA   . LEU B 1 30  ? 12.558  10.462  -1.243  1.00 0.00 ? 30  LEU B HA   3  
ATOM 8389  H HB2  . LEU B 1 30  ? 10.689  8.588   -0.724  1.00 0.00 ? 30  LEU B HB2  3  
ATOM 8390  H HB3  . LEU B 1 30  ? 11.941  7.559   -1.383  1.00 0.00 ? 30  LEU B HB3  3  
ATOM 8391  H HG   . LEU B 1 30  ? 11.675  8.564   1.266   1.00 0.00 ? 30  LEU B HG   3  
ATOM 8392  H HD11 . LEU B 1 30  ? 13.982  7.209   1.314   1.00 0.00 ? 30  LEU B HD11 3  
ATOM 8393  H HD12 . LEU B 1 30  ? 13.343  6.647   -0.228  1.00 0.00 ? 30  LEU B HD12 3  
ATOM 8394  H HD13 . LEU B 1 30  ? 12.400  6.440   1.246   1.00 0.00 ? 30  LEU B HD13 3  
ATOM 8395  H HD21 . LEU B 1 30  ? 13.921  9.466   1.651   1.00 0.00 ? 30  LEU B HD21 3  
ATOM 8396  H HD22 . LEU B 1 30  ? 12.975  10.509  0.594   1.00 0.00 ? 30  LEU B HD22 3  
ATOM 8397  H HD23 . LEU B 1 30  ? 14.220  9.464   -0.087  1.00 0.00 ? 30  LEU B HD23 3  
ATOM 8398  N N    . SER B 1 31  ? 14.161  8.272   -2.271  1.00 0.00 ? 31  SER B N    3  
ATOM 8399  C CA   . SER B 1 31  ? 15.238  7.737   -3.088  1.00 0.00 ? 31  SER B CA   3  
ATOM 8400  C C    . SER B 1 31  ? 15.397  6.242   -2.850  1.00 0.00 ? 31  SER B C    3  
ATOM 8401  O O    . SER B 1 31  ? 15.361  5.775   -1.712  1.00 0.00 ? 31  SER B O    3  
ATOM 8402  C CB   . SER B 1 31  ? 16.549  8.468   -2.790  1.00 0.00 ? 31  SER B CB   3  
ATOM 8403  O OG   . SER B 1 31  ? 17.664  7.598   -2.896  1.00 0.00 ? 31  SER B OG   3  
ATOM 8404  H H    . SER B 1 31  ? 14.070  7.968   -1.349  1.00 0.00 ? 31  SER B H    3  
ATOM 8405  H HA   . SER B 1 31  ? 14.974  7.896   -4.122  1.00 0.00 ? 31  SER B HA   3  
ATOM 8406  H HB2  . SER B 1 31  ? 16.674  9.275   -3.493  1.00 0.00 ? 31  SER B HB2  3  
ATOM 8407  H HB3  . SER B 1 31  ? 16.514  8.867   -1.788  1.00 0.00 ? 31  SER B HB3  3  
ATOM 8408  H HG   . SER B 1 31  ? 18.400  7.958   -2.396  1.00 0.00 ? 31  SER B HG   3  
ATOM 8409  N N    . LYS B 1 32  ? 15.572  5.496   -3.933  1.00 0.00 ? 32  LYS B N    3  
ATOM 8410  C CA   . LYS B 1 32  ? 15.736  4.050   -3.849  1.00 0.00 ? 32  LYS B CA   3  
ATOM 8411  C C    . LYS B 1 32  ? 16.797  3.688   -2.817  1.00 0.00 ? 32  LYS B C    3  
ATOM 8412  O O    . LYS B 1 32  ? 16.644  2.723   -2.069  1.00 0.00 ? 32  LYS B O    3  
ATOM 8413  C CB   . LYS B 1 32  ? 16.129  3.477   -5.214  1.00 0.00 ? 32  LYS B CB   3  
ATOM 8414  C CG   . LYS B 1 32  ? 15.125  3.775   -6.317  1.00 0.00 ? 32  LYS B CG   3  
ATOM 8415  C CD   . LYS B 1 32  ? 15.680  3.417   -7.688  1.00 0.00 ? 32  LYS B CD   3  
ATOM 8416  C CE   . LYS B 1 32  ? 16.007  4.661   -8.500  1.00 0.00 ? 32  LYS B CE   3  
ATOM 8417  N NZ   . LYS B 1 32  ? 16.559  4.316   -9.840  1.00 0.00 ? 32  LYS B NZ   3  
ATOM 8418  H H    . LYS B 1 32  ? 15.590  5.931   -4.810  1.00 0.00 ? 32  LYS B H    3  
ATOM 8419  H HA   . LYS B 1 32  ? 14.792  3.624   -3.547  1.00 0.00 ? 32  LYS B HA   3  
ATOM 8420  H HB2  . LYS B 1 32  ? 17.083  3.894   -5.505  1.00 0.00 ? 32  LYS B HB2  3  
ATOM 8421  H HB3  . LYS B 1 32  ? 16.226  2.405   -5.126  1.00 0.00 ? 32  LYS B HB3  3  
ATOM 8422  H HG2  . LYS B 1 32  ? 14.231  3.197   -6.140  1.00 0.00 ? 32  LYS B HG2  3  
ATOM 8423  H HG3  . LYS B 1 32  ? 14.885  4.828   -6.298  1.00 0.00 ? 32  LYS B HG3  3  
ATOM 8424  H HD2  . LYS B 1 32  ? 16.581  2.837   -7.561  1.00 0.00 ? 32  LYS B HD2  3  
ATOM 8425  H HD3  . LYS B 1 32  ? 14.945  2.832   -8.220  1.00 0.00 ? 32  LYS B HD3  3  
ATOM 8426  H HE2  . LYS B 1 32  ? 15.104  5.238   -8.631  1.00 0.00 ? 32  LYS B HE2  3  
ATOM 8427  H HE3  . LYS B 1 32  ? 16.734  5.248   -7.960  1.00 0.00 ? 32  LYS B HE3  3  
ATOM 8428  H HZ1  . LYS B 1 32  ? 17.579  4.128   -9.768  1.00 0.00 ? 32  LYS B HZ1  3  
ATOM 8429  H HZ2  . LYS B 1 32  ? 16.411  5.105   -10.502 1.00 0.00 ? 32  LYS B HZ2  3  
ATOM 8430  H HZ3  . LYS B 1 32  ? 16.086  3.470   -10.216 1.00 0.00 ? 32  LYS B HZ3  3  
ATOM 8431  N N    . THR B 1 33  ? 17.871  4.468   -2.784  1.00 0.00 ? 33  THR B N    3  
ATOM 8432  C CA   . THR B 1 33  ? 18.958  4.234   -1.852  1.00 0.00 ? 33  THR B CA   3  
ATOM 8433  C C    . THR B 1 33  ? 18.570  4.648   -0.432  1.00 0.00 ? 33  THR B C    3  
ATOM 8434  O O    . THR B 1 33  ? 18.836  3.926   0.524   1.00 0.00 ? 33  THR B O    3  
ATOM 8435  C CB   . THR B 1 33  ? 20.206  4.990   -2.307  1.00 0.00 ? 33  THR B CB   3  
ATOM 8436  O OG1  . THR B 1 33  ? 20.963  4.209   -3.215  1.00 0.00 ? 33  THR B OG1  3  
ATOM 8437  C CG2  . THR B 1 33  ? 21.114  5.376   -1.167  1.00 0.00 ? 33  THR B CG2  3  
ATOM 8438  H H    . THR B 1 33  ? 17.937  5.220   -3.404  1.00 0.00 ? 33  THR B H    3  
ATOM 8439  H HA   . THR B 1 33  ? 19.172  3.177   -1.855  1.00 0.00 ? 33  THR B HA   3  
ATOM 8440  H HB   . THR B 1 33  ? 19.903  5.896   -2.810  1.00 0.00 ? 33  THR B HB   3  
ATOM 8441  H HG1  . THR B 1 33  ? 21.282  3.420   -2.769  1.00 0.00 ? 33  THR B HG1  3  
ATOM 8442  H HG21 . THR B 1 33  ? 21.345  4.498   -0.584  1.00 0.00 ? 33  THR B HG21 3  
ATOM 8443  H HG22 . THR B 1 33  ? 20.609  6.100   -0.544  1.00 0.00 ? 33  THR B HG22 3  
ATOM 8444  H HG23 . THR B 1 33  ? 22.025  5.803   -1.557  1.00 0.00 ? 33  THR B HG23 3  
ATOM 8445  N N    . GLU B 1 34  ? 17.946  5.812   -0.290  1.00 0.00 ? 34  GLU B N    3  
ATOM 8446  C CA   . GLU B 1 34  ? 17.541  6.282   1.028   1.00 0.00 ? 34  GLU B CA   3  
ATOM 8447  C C    . GLU B 1 34  ? 16.578  5.286   1.663   1.00 0.00 ? 34  GLU B C    3  
ATOM 8448  O O    . GLU B 1 34  ? 16.520  5.144   2.887   1.00 0.00 ? 34  GLU B O    3  
ATOM 8449  C CB   . GLU B 1 34  ? 16.893  7.665   0.929   1.00 0.00 ? 34  GLU B CB   3  
ATOM 8450  C CG   . GLU B 1 34  ? 17.463  8.672   1.913   1.00 0.00 ? 34  GLU B CG   3  
ATOM 8451  C CD   . GLU B 1 34  ? 16.544  9.857   2.135   1.00 0.00 ? 34  GLU B CD   3  
ATOM 8452  O OE1  . GLU B 1 34  ? 16.613  10.820  1.342   1.00 0.00 ? 34  GLU B OE1  3  
ATOM 8453  O OE2  . GLU B 1 34  ? 15.752  9.823   3.101   1.00 0.00 ? 34  GLU B OE2  3  
ATOM 8454  H H    . GLU B 1 34  ? 17.751  6.360   -1.079  1.00 0.00 ? 34  GLU B H    3  
ATOM 8455  H HA   . GLU B 1 34  ? 18.427  6.351   1.641   1.00 0.00 ? 34  GLU B HA   3  
ATOM 8456  H HB2  . GLU B 1 34  ? 17.041  8.048   -0.070  1.00 0.00 ? 34  GLU B HB2  3  
ATOM 8457  H HB3  . GLU B 1 34  ? 15.835  7.571   1.114   1.00 0.00 ? 34  GLU B HB3  3  
ATOM 8458  H HG2  . GLU B 1 34  ? 17.623  8.178   2.861   1.00 0.00 ? 34  GLU B HG2  3  
ATOM 8459  H HG3  . GLU B 1 34  ? 18.408  9.034   1.533   1.00 0.00 ? 34  GLU B HG3  3  
ATOM 8460  N N    . PHE B 1 35  ? 15.836  4.583   0.818   1.00 0.00 ? 35  PHE B N    3  
ATOM 8461  C CA   . PHE B 1 35  ? 14.885  3.589   1.289   1.00 0.00 ? 35  PHE B CA   3  
ATOM 8462  C C    . PHE B 1 35  ? 15.611  2.323   1.741   1.00 0.00 ? 35  PHE B C    3  
ATOM 8463  O O    . PHE B 1 35  ? 15.119  1.592   2.600   1.00 0.00 ? 35  PHE B O    3  
ATOM 8464  C CB   . PHE B 1 35  ? 13.848  3.271   0.206   1.00 0.00 ? 35  PHE B CB   3  
ATOM 8465  C CG   . PHE B 1 35  ? 12.557  4.013   0.394   1.00 0.00 ? 35  PHE B CG   3  
ATOM 8466  C CD1  . PHE B 1 35  ? 11.943  4.063   1.635   1.00 0.00 ? 35  PHE B CD1  3  
ATOM 8467  C CD2  . PHE B 1 35  ? 11.962  4.663   -0.670  1.00 0.00 ? 35  PHE B CD2  3  
ATOM 8468  C CE1  . PHE B 1 35  ? 10.755  4.749   1.807   1.00 0.00 ? 35  PHE B CE1  3  
ATOM 8469  C CE2  . PHE B 1 35  ? 10.775  5.350   -0.506  1.00 0.00 ? 35  PHE B CE2  3  
ATOM 8470  C CZ   . PHE B 1 35  ? 10.170  5.393   0.735   1.00 0.00 ? 35  PHE B CZ   3  
ATOM 8471  H H    . PHE B 1 35  ? 15.939  4.730   -0.146  1.00 0.00 ? 35  PHE B H    3  
ATOM 8472  H HA   . PHE B 1 35  ? 14.376  4.010   2.143   1.00 0.00 ? 35  PHE B HA   3  
ATOM 8473  H HB2  . PHE B 1 35  ? 14.244  3.543   -0.764  1.00 0.00 ? 35  PHE B HB2  3  
ATOM 8474  H HB3  . PHE B 1 35  ? 13.630  2.215   0.219   1.00 0.00 ? 35  PHE B HB3  3  
ATOM 8475  H HD1  . PHE B 1 35  ? 12.400  3.559   2.473   1.00 0.00 ? 35  PHE B HD1  3  
ATOM 8476  H HD2  . PHE B 1 35  ? 12.434  4.630   -1.639  1.00 0.00 ? 35  PHE B HD2  3  
ATOM 8477  H HE1  . PHE B 1 35  ? 10.285  4.781   2.779   1.00 0.00 ? 35  PHE B HE1  3  
ATOM 8478  H HE2  . PHE B 1 35  ? 10.320  5.854   -1.347  1.00 0.00 ? 35  PHE B HE2  3  
ATOM 8479  H HZ   . PHE B 1 35  ? 9.242   5.930   0.866   1.00 0.00 ? 35  PHE B HZ   3  
ATOM 8480  N N    . LEU B 1 36  ? 16.794  2.076   1.172   1.00 0.00 ? 36  LEU B N    3  
ATOM 8481  C CA   . LEU B 1 36  ? 17.589  0.908   1.537   1.00 0.00 ? 36  LEU B CA   3  
ATOM 8482  C C    . LEU B 1 36  ? 17.761  0.830   3.038   1.00 0.00 ? 36  LEU B C    3  
ATOM 8483  O O    . LEU B 1 36  ? 17.379  -0.146  3.683   1.00 0.00 ? 36  LEU B O    3  
ATOM 8484  C CB   . LEU B 1 36  ? 18.974  1.009   0.911   1.00 0.00 ? 36  LEU B CB   3  
ATOM 8485  C CG   . LEU B 1 36  ? 19.177  0.164   -0.323  1.00 0.00 ? 36  LEU B CG   3  
ATOM 8486  C CD1  . LEU B 1 36  ? 19.035  -1.307  0.029   1.00 0.00 ? 36  LEU B CD1  3  
ATOM 8487  C CD2  . LEU B 1 36  ? 18.187  0.575   -1.395  1.00 0.00 ? 36  LEU B CD2  3  
ATOM 8488  H H    . LEU B 1 36  ? 17.146  2.698   0.501   1.00 0.00 ? 36  LEU B H    3  
ATOM 8489  H HA   . LEU B 1 36  ? 17.092  0.021   1.180   1.00 0.00 ? 36  LEU B HA   3  
ATOM 8490  H HB2  . LEU B 1 36  ? 19.156  2.037   0.649   1.00 0.00 ? 36  LEU B HB2  3  
ATOM 8491  H HB3  . LEU B 1 36  ? 19.707  0.710   1.646   1.00 0.00 ? 36  LEU B HB3  3  
ATOM 8492  H HG   . LEU B 1 36  ? 20.170  0.332   -0.696  1.00 0.00 ? 36  LEU B HG   3  
ATOM 8493  H HD11 . LEU B 1 36  ? 19.901  -1.846  -0.322  1.00 0.00 ? 36  LEU B HD11 3  
ATOM 8494  H HD12 . LEU B 1 36  ? 18.146  -1.705  -0.436  1.00 0.00 ? 36  LEU B HD12 3  
ATOM 8495  H HD13 . LEU B 1 36  ? 18.957  -1.409  1.104   1.00 0.00 ? 36  LEU B HD13 3  
ATOM 8496  H HD21 . LEU B 1 36  ? 18.636  1.327   -2.026  1.00 0.00 ? 36  LEU B HD21 3  
ATOM 8497  H HD22 . LEU B 1 36  ? 17.305  0.982   -0.923  1.00 0.00 ? 36  LEU B HD22 3  
ATOM 8498  H HD23 . LEU B 1 36  ? 17.918  -0.284  -1.989  1.00 0.00 ? 36  LEU B HD23 3  
ATOM 8499  N N    . SER B 1 37  ? 18.353  1.881   3.575   1.00 0.00 ? 37  SER B N    3  
ATOM 8500  C CA   . SER B 1 37  ? 18.607  1.971   5.001   1.00 0.00 ? 37  SER B CA   3  
ATOM 8501  C C    . SER B 1 37  ? 17.321  1.736   5.786   1.00 0.00 ? 37  SER B C    3  
ATOM 8502  O O    . SER B 1 37  ? 17.300  0.971   6.750   1.00 0.00 ? 37  SER B O    3  
ATOM 8503  C CB   . SER B 1 37  ? 19.201  3.335   5.356   1.00 0.00 ? 37  SER B CB   3  
ATOM 8504  O OG   . SER B 1 37  ? 18.631  4.362   4.564   1.00 0.00 ? 37  SER B OG   3  
ATOM 8505  H H    . SER B 1 37  ? 18.635  2.612   2.986   1.00 0.00 ? 37  SER B H    3  
ATOM 8506  H HA   . SER B 1 37  ? 19.318  1.197   5.249   1.00 0.00 ? 37  SER B HA   3  
ATOM 8507  H HB2  . SER B 1 37  ? 19.008  3.550   6.397   1.00 0.00 ? 37  SER B HB2  3  
ATOM 8508  H HB3  . SER B 1 37  ? 20.267  3.315   5.185   1.00 0.00 ? 37  SER B HB3  3  
ATOM 8509  H HG   . SER B 1 37  ? 17.690  4.424   4.748   1.00 0.00 ? 37  SER B HG   3  
ATOM 8510  N N    . PHE B 1 38  ? 16.245  2.390   5.353   1.00 0.00 ? 38  PHE B N    3  
ATOM 8511  C CA   . PHE B 1 38  ? 14.949  2.239   6.005   1.00 0.00 ? 38  PHE B CA   3  
ATOM 8512  C C    . PHE B 1 38  ? 14.519  0.774   6.001   1.00 0.00 ? 38  PHE B C    3  
ATOM 8513  O O    . PHE B 1 38  ? 13.795  0.324   6.889   1.00 0.00 ? 38  PHE B O    3  
ATOM 8514  C CB   . PHE B 1 38  ? 13.900  3.098   5.292   1.00 0.00 ? 38  PHE B CB   3  
ATOM 8515  C CG   . PHE B 1 38  ? 12.505  2.930   5.828   1.00 0.00 ? 38  PHE B CG   3  
ATOM 8516  C CD1  . PHE B 1 38  ? 11.763  1.800   5.524   1.00 0.00 ? 38  PHE B CD1  3  
ATOM 8517  C CD2  . PHE B 1 38  ? 11.935  3.904   6.632   1.00 0.00 ? 38  PHE B CD2  3  
ATOM 8518  C CE1  . PHE B 1 38  ? 10.480  1.644   6.014   1.00 0.00 ? 38  PHE B CE1  3  
ATOM 8519  C CE2  . PHE B 1 38  ? 10.653  3.753   7.124   1.00 0.00 ? 38  PHE B CE2  3  
ATOM 8520  C CZ   . PHE B 1 38  ? 9.925   2.622   6.815   1.00 0.00 ? 38  PHE B CZ   3  
ATOM 8521  H H    . PHE B 1 38  ? 16.325  2.979   4.570   1.00 0.00 ? 38  PHE B H    3  
ATOM 8522  H HA   . PHE B 1 38  ? 15.047  2.573   7.028   1.00 0.00 ? 38  PHE B HA   3  
ATOM 8523  H HB2  . PHE B 1 38  ? 14.169  4.139   5.393   1.00 0.00 ? 38  PHE B HB2  3  
ATOM 8524  H HB3  . PHE B 1 38  ? 13.887  2.837   4.243   1.00 0.00 ? 38  PHE B HB3  3  
ATOM 8525  H HD1  . PHE B 1 38  ? 12.197  1.034   4.899   1.00 0.00 ? 38  PHE B HD1  3  
ATOM 8526  H HD2  . PHE B 1 38  ? 12.504  4.788   6.875   1.00 0.00 ? 38  PHE B HD2  3  
ATOM 8527  H HE1  . PHE B 1 38  ? 9.913   0.758   5.769   1.00 0.00 ? 38  PHE B HE1  3  
ATOM 8528  H HE2  . PHE B 1 38  ? 10.221  4.520   7.750   1.00 0.00 ? 38  PHE B HE2  3  
ATOM 8529  H HZ   . PHE B 1 38  ? 8.922   2.503   7.198   1.00 0.00 ? 38  PHE B HZ   3  
ATOM 8530  N N    . MET B 1 39  ? 14.975  0.038   4.991   1.00 0.00 ? 39  MET B N    3  
ATOM 8531  C CA   . MET B 1 39  ? 14.646  -1.377  4.858   1.00 0.00 ? 39  MET B CA   3  
ATOM 8532  C C    . MET B 1 39  ? 15.490  -2.224  5.804   1.00 0.00 ? 39  MET B C    3  
ATOM 8533  O O    . MET B 1 39  ? 15.019  -3.222  6.345   1.00 0.00 ? 39  MET B O    3  
ATOM 8534  C CB   . MET B 1 39  ? 14.870  -1.834  3.417   1.00 0.00 ? 39  MET B CB   3  
ATOM 8535  C CG   . MET B 1 39  ? 14.422  -3.261  3.155   1.00 0.00 ? 39  MET B CG   3  
ATOM 8536  S SD   . MET B 1 39  ? 12.998  -3.348  2.054   1.00 0.00 ? 39  MET B SD   3  
ATOM 8537  C CE   . MET B 1 39  ? 11.718  -2.657  3.100   1.00 0.00 ? 39  MET B CE   3  
ATOM 8538  H H    . MET B 1 39  ? 15.548  0.457   4.316   1.00 0.00 ? 39  MET B H    3  
ATOM 8539  H HA   . MET B 1 39  ? 13.604  -1.503  5.111   1.00 0.00 ? 39  MET B HA   3  
ATOM 8540  H HB2  . MET B 1 39  ? 14.324  -1.178  2.755   1.00 0.00 ? 39  MET B HB2  3  
ATOM 8541  H HB3  . MET B 1 39  ? 15.923  -1.763  3.190   1.00 0.00 ? 39  MET B HB3  3  
ATOM 8542  H HG2  . MET B 1 39  ? 15.239  -3.804  2.706   1.00 0.00 ? 39  MET B HG2  3  
ATOM 8543  H HG3  . MET B 1 39  ? 14.160  -3.721  4.097   1.00 0.00 ? 39  MET B HG3  3  
ATOM 8544  H HE1  . MET B 1 39  ? 11.012  -2.110  2.492   1.00 0.00 ? 39  MET B HE1  3  
ATOM 8545  H HE2  . MET B 1 39  ? 12.164  -1.990  3.823   1.00 0.00 ? 39  MET B HE2  3  
ATOM 8546  H HE3  . MET B 1 39  ? 11.205  -3.456  3.615   1.00 0.00 ? 39  MET B HE3  3  
ATOM 8547  N N    . ASN B 1 40  ? 16.738  -1.820  5.997   1.00 0.00 ? 40  ASN B N    3  
ATOM 8548  C CA   . ASN B 1 40  ? 17.649  -2.541  6.877   1.00 0.00 ? 40  ASN B CA   3  
ATOM 8549  C C    . ASN B 1 40  ? 17.288  -2.321  8.345   1.00 0.00 ? 40  ASN B C    3  
ATOM 8550  O O    . ASN B 1 40  ? 17.691  -3.093  9.214   1.00 0.00 ? 40  ASN B O    3  
ATOM 8551  C CB   . ASN B 1 40  ? 19.091  -2.099  6.625   1.00 0.00 ? 40  ASN B CB   3  
ATOM 8552  C CG   . ASN B 1 40  ? 19.651  -2.655  5.331   1.00 0.00 ? 40  ASN B CG   3  
ATOM 8553  O OD1  . ASN B 1 40  ? 20.077  -3.809  5.270   1.00 0.00 ? 40  ASN B OD1  3  
ATOM 8554  N ND2  . ASN B 1 40  ? 19.651  -1.837  4.286   1.00 0.00 ? 40  ASN B ND2  3  
ATOM 8555  H H    . ASN B 1 40  ? 17.055  -1.015  5.538   1.00 0.00 ? 40  ASN B H    3  
ATOM 8556  H HA   . ASN B 1 40  ? 17.562  -3.594  6.652   1.00 0.00 ? 40  ASN B HA   3  
ATOM 8557  H HB2  . ASN B 1 40  ? 19.126  -1.020  6.575   1.00 0.00 ? 40  ASN B HB2  3  
ATOM 8558  H HB3  . ASN B 1 40  ? 19.713  -2.437  7.441   1.00 0.00 ? 40  ASN B HB3  3  
ATOM 8559  H HD21 . ASN B 1 40  ? 19.294  -0.928  4.409   1.00 0.00 ? 40  ASN B HD21 3  
ATOM 8560  H HD22 . ASN B 1 40  ? 20.009  -2.174  3.433   1.00 0.00 ? 40  ASN B HD22 3  
ATOM 8561  N N    . THR B 1 41  ? 16.538  -1.257  8.613   1.00 0.00 ? 41  THR B N    3  
ATOM 8562  C CA   . THR B 1 41  ? 16.137  -0.927  9.975   1.00 0.00 ? 41  THR B CA   3  
ATOM 8563  C C    . THR B 1 41  ? 14.653  -1.201  10.206  1.00 0.00 ? 41  THR B C    3  
ATOM 8564  O O    . THR B 1 41  ? 14.278  -2.204  10.813  1.00 0.00 ? 41  THR B O    3  
ATOM 8565  C CB   . THR B 1 41  ? 16.434  0.546   10.262  1.00 0.00 ? 41  THR B CB   3  
ATOM 8566  O OG1  . THR B 1 41  ? 16.171  1.340   9.118   1.00 0.00 ? 41  THR B OG1  3  
ATOM 8567  C CG2  . THR B 1 41  ? 17.862  0.801   10.677  1.00 0.00 ? 41  THR B CG2  3  
ATOM 8568  H H    . THR B 1 41  ? 16.256  -0.672  7.879   1.00 0.00 ? 41  THR B H    3  
ATOM 8569  H HA   . THR B 1 41  ? 16.715  -1.539  10.650  1.00 0.00 ? 41  THR B HA   3  
ATOM 8570  H HB   . THR B 1 41  ? 15.790  0.883   11.062  1.00 0.00 ? 41  THR B HB   3  
ATOM 8571  H HG1  . THR B 1 41  ? 16.824  1.152   8.440   1.00 0.00 ? 41  THR B HG1  3  
ATOM 8572  H HG21 . THR B 1 41  ? 18.521  0.563   9.857   1.00 0.00 ? 41  THR B HG21 3  
ATOM 8573  H HG22 . THR B 1 41  ? 18.104  0.183   11.527  1.00 0.00 ? 41  THR B HG22 3  
ATOM 8574  H HG23 . THR B 1 41  ? 17.976  1.841   10.941  1.00 0.00 ? 41  THR B HG23 3  
ATOM 8575  N N    . GLU B 1 42  ? 13.819  -0.284  9.730   1.00 0.00 ? 42  GLU B N    3  
ATOM 8576  C CA   . GLU B 1 42  ? 12.371  -0.392  9.889   1.00 0.00 ? 42  GLU B CA   3  
ATOM 8577  C C    . GLU B 1 42  ? 11.843  -1.750  9.432   1.00 0.00 ? 42  GLU B C    3  
ATOM 8578  O O    . GLU B 1 42  ? 10.826  -2.229  9.934   1.00 0.00 ? 42  GLU B O    3  
ATOM 8579  C CB   . GLU B 1 42  ? 11.680  0.730   9.113   1.00 0.00 ? 42  GLU B CB   3  
ATOM 8580  C CG   . GLU B 1 42  ? 12.151  2.117   9.519   1.00 0.00 ? 42  GLU B CG   3  
ATOM 8581  C CD   . GLU B 1 42  ? 11.051  2.944   10.156  1.00 0.00 ? 42  GLU B CD   3  
ATOM 8582  O OE1  . GLU B 1 42  ? 9.917   2.929   9.633   1.00 0.00 ? 42  GLU B OE1  3  
ATOM 8583  O OE2  . GLU B 1 42  ? 11.323  3.607   11.180  1.00 0.00 ? 42  GLU B OE2  3  
ATOM 8584  H H    . GLU B 1 42  ? 14.190  0.497   9.268   1.00 0.00 ? 42  GLU B H    3  
ATOM 8585  H HA   . GLU B 1 42  ? 12.148  -0.272  10.939  1.00 0.00 ? 42  GLU B HA   3  
ATOM 8586  H HB2  . GLU B 1 42  ? 11.879  0.598   8.060   1.00 0.00 ? 42  GLU B HB2  3  
ATOM 8587  H HB3  . GLU B 1 42  ? 10.617  0.668   9.282   1.00 0.00 ? 42  GLU B HB3  3  
ATOM 8588  H HG2  . GLU B 1 42  ? 12.960  2.016   10.229  1.00 0.00 ? 42  GLU B HG2  3  
ATOM 8589  H HG3  . GLU B 1 42  ? 12.507  2.633   8.641   1.00 0.00 ? 42  GLU B HG3  3  
ATOM 8590  N N    . LEU B 1 43  ? 12.535  -2.368  8.484   1.00 0.00 ? 43  LEU B N    3  
ATOM 8591  C CA   . LEU B 1 43  ? 12.128  -3.670  7.971   1.00 0.00 ? 43  LEU B CA   3  
ATOM 8592  C C    . LEU B 1 43  ? 13.329  -4.602  7.869   1.00 0.00 ? 43  LEU B C    3  
ATOM 8593  O O    . LEU B 1 43  ? 13.578  -5.205  6.824   1.00 0.00 ? 43  LEU B O    3  
ATOM 8594  C CB   . LEU B 1 43  ? 11.454  -3.514  6.605   1.00 0.00 ? 43  LEU B CB   3  
ATOM 8595  C CG   . LEU B 1 43  ? 10.012  -3.007  6.658   1.00 0.00 ? 43  LEU B CG   3  
ATOM 8596  C CD1  . LEU B 1 43  ? 9.463   -2.793  5.257   1.00 0.00 ? 43  LEU B CD1  3  
ATOM 8597  C CD2  . LEU B 1 43  ? 9.135   -3.978  7.436   1.00 0.00 ? 43  LEU B CD2  3  
ATOM 8598  H H    . LEU B 1 43  ? 13.338  -1.942  8.122   1.00 0.00 ? 43  LEU B H    3  
ATOM 8599  H HA   . LEU B 1 43  ? 11.419  -4.094  8.664   1.00 0.00 ? 43  LEU B HA   3  
ATOM 8600  H HB2  . LEU B 1 43  ? 12.038  -2.824  6.014   1.00 0.00 ? 43  LEU B HB2  3  
ATOM 8601  H HB3  . LEU B 1 43  ? 11.457  -4.475  6.113   1.00 0.00 ? 43  LEU B HB3  3  
ATOM 8602  H HG   . LEU B 1 43  ? 9.992   -2.056  7.171   1.00 0.00 ? 43  LEU B HG   3  
ATOM 8603  H HD11 . LEU B 1 43  ? 10.014  -2.001  4.771   1.00 0.00 ? 43  LEU B HD11 3  
ATOM 8604  H HD12 . LEU B 1 43  ? 8.421   -2.522  5.318   1.00 0.00 ? 43  LEU B HD12 3  
ATOM 8605  H HD13 . LEU B 1 43  ? 9.565   -3.706  4.687   1.00 0.00 ? 43  LEU B HD13 3  
ATOM 8606  H HD21 . LEU B 1 43  ? 8.660   -3.456  8.253   1.00 0.00 ? 43  LEU B HD21 3  
ATOM 8607  H HD22 . LEU B 1 43  ? 9.745   -4.778  7.827   1.00 0.00 ? 43  LEU B HD22 3  
ATOM 8608  H HD23 . LEU B 1 43  ? 8.379   -4.387  6.781   1.00 0.00 ? 43  LEU B HD23 3  
ATOM 8609  N N    . ALA B 1 44  ? 14.069  -4.712  8.966   1.00 0.00 ? 44  ALA B N    3  
ATOM 8610  C CA   . ALA B 1 44  ? 15.247  -5.566  9.014   1.00 0.00 ? 44  ALA B CA   3  
ATOM 8611  C C    . ALA B 1 44  ? 14.852  -7.031  9.147   1.00 0.00 ? 44  ALA B C    3  
ATOM 8612  O O    . ALA B 1 44  ? 15.599  -7.924  8.751   1.00 0.00 ? 44  ALA B O    3  
ATOM 8613  C CB   . ALA B 1 44  ? 16.148  -5.150  10.168  1.00 0.00 ? 44  ALA B CB   3  
ATOM 8614  H H    . ALA B 1 44  ? 13.814  -4.206  9.766   1.00 0.00 ? 44  ALA B H    3  
ATOM 8615  H HA   . ALA B 1 44  ? 15.795  -5.431  8.094   1.00 0.00 ? 44  ALA B HA   3  
ATOM 8616  H HB1  . ALA B 1 44  ? 16.018  -4.095  10.360  1.00 0.00 ? 44  ALA B HB1  3  
ATOM 8617  H HB2  . ALA B 1 44  ? 17.178  -5.346  9.909   1.00 0.00 ? 44  ALA B HB2  3  
ATOM 8618  H HB3  . ALA B 1 44  ? 15.884  -5.713  11.051  1.00 0.00 ? 44  ALA B HB3  3  
ATOM 8619  N N    . ALA B 1 45  ? 13.672  -7.269  9.704   1.00 0.00 ? 45  ALA B N    3  
ATOM 8620  C CA   . ALA B 1 45  ? 13.170  -8.623  9.885   1.00 0.00 ? 45  ALA B CA   3  
ATOM 8621  C C    . ALA B 1 45  ? 12.857  -9.280  8.541   1.00 0.00 ? 45  ALA B C    3  
ATOM 8622  O O    . ALA B 1 45  ? 12.676  -10.495 8.461   1.00 0.00 ? 45  ALA B O    3  
ATOM 8623  C CB   . ALA B 1 45  ? 11.934  -8.602  10.771  1.00 0.00 ? 45  ALA B CB   3  
ATOM 8624  H H    . ALA B 1 45  ? 13.120  -6.514  9.998   1.00 0.00 ? 45  ALA B H    3  
ATOM 8625  H HA   . ALA B 1 45  ? 13.935  -9.198  10.387  1.00 0.00 ? 45  ALA B HA   3  
ATOM 8626  H HB1  . ALA B 1 45  ? 11.689  -7.578  11.017  1.00 0.00 ? 45  ALA B HB1  3  
ATOM 8627  H HB2  . ALA B 1 45  ? 12.132  -9.152  11.678  1.00 0.00 ? 45  ALA B HB2  3  
ATOM 8628  H HB3  . ALA B 1 45  ? 11.105  -9.056  10.248  1.00 0.00 ? 45  ALA B HB3  3  
ATOM 8629  N N    . PHE B 1 46  ? 12.792  -8.468  7.487   1.00 0.00 ? 46  PHE B N    3  
ATOM 8630  C CA   . PHE B 1 46  ? 12.497  -8.970  6.149   1.00 0.00 ? 46  PHE B CA   3  
ATOM 8631  C C    . PHE B 1 46  ? 13.774  -9.133  5.326   1.00 0.00 ? 46  PHE B C    3  
ATOM 8632  O O    . PHE B 1 46  ? 13.799  -9.883  4.349   1.00 0.00 ? 46  PHE B O    3  
ATOM 8633  C CB   . PHE B 1 46  ? 11.535  -8.021  5.432   1.00 0.00 ? 46  PHE B CB   3  
ATOM 8634  C CG   . PHE B 1 46  ? 10.154  -8.008  6.022   1.00 0.00 ? 46  PHE B CG   3  
ATOM 8635  C CD1  . PHE B 1 46  ? 9.938   -7.524  7.302   1.00 0.00 ? 46  PHE B CD1  3  
ATOM 8636  C CD2  . PHE B 1 46  ? 9.071   -8.478  5.295   1.00 0.00 ? 46  PHE B CD2  3  
ATOM 8637  C CE1  . PHE B 1 46  ? 8.668   -7.509  7.847   1.00 0.00 ? 46  PHE B CE1  3  
ATOM 8638  C CE2  . PHE B 1 46  ? 7.799   -8.466  5.835   1.00 0.00 ? 46  PHE B CE2  3  
ATOM 8639  C CZ   . PHE B 1 46  ? 7.598   -7.981  7.113   1.00 0.00 ? 46  PHE B CZ   3  
ATOM 8640  H H    . PHE B 1 46  ? 12.942  -7.509  7.611   1.00 0.00 ? 46  PHE B H    3  
ATOM 8641  H HA   . PHE B 1 46  ? 12.025  -9.936  6.254   1.00 0.00 ? 46  PHE B HA   3  
ATOM 8642  H HB2  . PHE B 1 46  ? 11.926  -7.015  5.484   1.00 0.00 ? 46  PHE B HB2  3  
ATOM 8643  H HB3  . PHE B 1 46  ? 11.453  -8.317  4.396   1.00 0.00 ? 46  PHE B HB3  3  
ATOM 8644  H HD1  . PHE B 1 46  ? 10.773  -7.154  7.876   1.00 0.00 ? 46  PHE B HD1  3  
ATOM 8645  H HD2  . PHE B 1 46  ? 9.227   -8.859  4.297   1.00 0.00 ? 46  PHE B HD2  3  
ATOM 8646  H HE1  . PHE B 1 46  ? 8.513   -7.129  8.846   1.00 0.00 ? 46  PHE B HE1  3  
ATOM 8647  H HE2  . PHE B 1 46  ? 6.964   -8.836  5.260   1.00 0.00 ? 46  PHE B HE2  3  
ATOM 8648  H HZ   . PHE B 1 46  ? 6.604   -7.970  7.537   1.00 0.00 ? 46  PHE B HZ   3  
ATOM 8649  N N    . THR B 1 47  ? 14.829  -8.424  5.719   1.00 0.00 ? 47  THR B N    3  
ATOM 8650  C CA   . THR B 1 47  ? 16.102  -8.491  5.007   1.00 0.00 ? 47  THR B CA   3  
ATOM 8651  C C    . THR B 1 47  ? 17.153  -9.251  5.814   1.00 0.00 ? 47  THR B C    3  
ATOM 8652  O O    . THR B 1 47  ? 18.136  -9.742  5.260   1.00 0.00 ? 47  THR B O    3  
ATOM 8653  C CB   . THR B 1 47  ? 16.606  -7.080  4.694   1.00 0.00 ? 47  THR B CB   3  
ATOM 8654  O OG1  . THR B 1 47  ? 17.197  -6.493  5.840   1.00 0.00 ? 47  THR B OG1  3  
ATOM 8655  C CG2  . THR B 1 47  ? 15.518  -6.146  4.209   1.00 0.00 ? 47  THR B CG2  3  
ATOM 8656  H H    . THR B 1 47  ? 14.749  -7.840  6.500   1.00 0.00 ? 47  THR B H    3  
ATOM 8657  H HA   . THR B 1 47  ? 15.934  -9.015  4.078   1.00 0.00 ? 47  THR B HA   3  
ATOM 8658  H HB   . THR B 1 47  ? 17.357  -7.142  3.919   1.00 0.00 ? 47  THR B HB   3  
ATOM 8659  H HG1  . THR B 1 47  ? 17.617  -5.665  5.594   1.00 0.00 ? 47  THR B HG1  3  
ATOM 8660  H HG21 . THR B 1 47  ? 14.770  -6.034  4.980   1.00 0.00 ? 47  THR B HG21 3  
ATOM 8661  H HG22 . THR B 1 47  ? 15.060  -6.557  3.321   1.00 0.00 ? 47  THR B HG22 3  
ATOM 8662  H HG23 . THR B 1 47  ? 15.946  -5.181  3.980   1.00 0.00 ? 47  THR B HG23 3  
ATOM 8663  N N    . LYS B 1 48  ? 16.944  -9.340  7.125   1.00 0.00 ? 48  LYS B N    3  
ATOM 8664  C CA   . LYS B 1 48  ? 17.877  -10.038 8.004   1.00 0.00 ? 48  LYS B CA   3  
ATOM 8665  C C    . LYS B 1 48  ? 18.110  -11.471 7.534   1.00 0.00 ? 48  LYS B C    3  
ATOM 8666  O O    . LYS B 1 48  ? 17.167  -12.178 7.183   1.00 0.00 ? 48  LYS B O    3  
ATOM 8667  C CB   . LYS B 1 48  ? 17.350  -10.042 9.441   1.00 0.00 ? 48  LYS B CB   3  
ATOM 8668  C CG   . LYS B 1 48  ? 17.902  -8.913  10.295  1.00 0.00 ? 48  LYS B CG   3  
ATOM 8669  C CD   . LYS B 1 48  ? 16.941  -8.538  11.411  1.00 0.00 ? 48  LYS B CD   3  
ATOM 8670  C CE   . LYS B 1 48  ? 17.426  -7.320  12.179  1.00 0.00 ? 48  LYS B CE   3  
ATOM 8671  N NZ   . LYS B 1 48  ? 18.575  -7.646  13.069  1.00 0.00 ? 48  LYS B NZ   3  
ATOM 8672  H H    . LYS B 1 48  ? 16.144  -8.926  7.511   1.00 0.00 ? 48  LYS B H    3  
ATOM 8673  H HA   . LYS B 1 48  ? 18.816  -9.507  7.978   1.00 0.00 ? 48  LYS B HA   3  
ATOM 8674  H HB2  . LYS B 1 48  ? 16.273  -9.953  9.417   1.00 0.00 ? 48  LYS B HB2  3  
ATOM 8675  H HB3  . LYS B 1 48  ? 17.613  -10.980 9.908   1.00 0.00 ? 48  LYS B HB3  3  
ATOM 8676  H HG2  . LYS B 1 48  ? 18.838  -9.230  10.731  1.00 0.00 ? 48  LYS B HG2  3  
ATOM 8677  H HG3  . LYS B 1 48  ? 18.068  -8.049  9.669   1.00 0.00 ? 48  LYS B HG3  3  
ATOM 8678  H HD2  . LYS B 1 48  ? 15.974  -8.319  10.982  1.00 0.00 ? 48  LYS B HD2  3  
ATOM 8679  H HD3  . LYS B 1 48  ? 16.853  -9.371  12.093  1.00 0.00 ? 48  LYS B HD3  3  
ATOM 8680  H HE2  . LYS B 1 48  ? 17.735  -6.564  11.472  1.00 0.00 ? 48  LYS B HE2  3  
ATOM 8681  H HE3  . LYS B 1 48  ? 16.613  -6.940  12.779  1.00 0.00 ? 48  LYS B HE3  3  
ATOM 8682  H HZ1  . LYS B 1 48  ? 19.061  -6.773  13.360  1.00 0.00 ? 48  LYS B HZ1  3  
ATOM 8683  H HZ2  . LYS B 1 48  ? 19.253  -8.257  12.569  1.00 0.00 ? 48  LYS B HZ2  3  
ATOM 8684  H HZ3  . LYS B 1 48  ? 18.238  -8.143  13.918  1.00 0.00 ? 48  LYS B HZ3  3  
ATOM 8685  N N    . ASN B 1 49  ? 19.376  -11.889 7.530   1.00 0.00 ? 49  ASN B N    3  
ATOM 8686  C CA   . ASN B 1 49  ? 19.752  -13.240 7.105   1.00 0.00 ? 49  ASN B CA   3  
ATOM 8687  C C    . ASN B 1 49  ? 19.815  -13.350 5.581   1.00 0.00 ? 49  ASN B C    3  
ATOM 8688  O O    . ASN B 1 49  ? 20.741  -13.950 5.035   1.00 0.00 ? 49  ASN B O    3  
ATOM 8689  C CB   . ASN B 1 49  ? 18.775  -14.280 7.666   1.00 0.00 ? 49  ASN B CB   3  
ATOM 8690  C CG   . ASN B 1 49  ? 19.488  -15.459 8.298   1.00 0.00 ? 49  ASN B CG   3  
ATOM 8691  O OD1  . ASN B 1 49  ? 19.703  -16.486 7.657   1.00 0.00 ? 49  ASN B OD1  3  
ATOM 8692  N ND2  . ASN B 1 49  ? 19.857  -15.316 9.566   1.00 0.00 ? 49  ASN B ND2  3  
ATOM 8693  H H    . ASN B 1 49  ? 20.079  -11.272 7.822   1.00 0.00 ? 49  ASN B H    3  
ATOM 8694  H HA   . ASN B 1 49  ? 20.736  -13.441 7.502   1.00 0.00 ? 49  ASN B HA   3  
ATOM 8695  H HB2  . ASN B 1 49  ? 18.155  -13.813 8.417   1.00 0.00 ? 49  ASN B HB2  3  
ATOM 8696  H HB3  . ASN B 1 49  ? 18.149  -14.647 6.866   1.00 0.00 ? 49  ASN B HB3  3  
ATOM 8697  H HD21 . ASN B 1 49  ? 19.650  -14.466 10.016  1.00 0.00 ? 49  ASN B HD21 3  
ATOM 8698  H HD22 . ASN B 1 49  ? 20.322  -16.067 10.002  1.00 0.00 ? 49  ASN B HD22 3  
ATOM 8699  N N    . GLN B 1 50  ? 18.828  -12.773 4.900   1.00 0.00 ? 50  GLN B N    3  
ATOM 8700  C CA   . GLN B 1 50  ? 18.777  -12.814 3.442   1.00 0.00 ? 50  GLN B CA   3  
ATOM 8701  C C    . GLN B 1 50  ? 18.470  -14.226 2.951   1.00 0.00 ? 50  GLN B C    3  
ATOM 8702  O O    . GLN B 1 50  ? 18.904  -14.627 1.871   1.00 0.00 ? 50  GLN B O    3  
ATOM 8703  C CB   . GLN B 1 50  ? 20.098  -12.321 2.846   1.00 0.00 ? 50  GLN B CB   3  
ATOM 8704  C CG   . GLN B 1 50  ? 19.935  -11.148 1.895   1.00 0.00 ? 50  GLN B CG   3  
ATOM 8705  C CD   . GLN B 1 50  ? 19.114  -11.500 0.670   1.00 0.00 ? 50  GLN B CD   3  
ATOM 8706  O OE1  . GLN B 1 50  ? 19.642  -11.997 -0.324  1.00 0.00 ? 50  GLN B OE1  3  
ATOM 8707  N NE2  . GLN B 1 50  ? 17.812  -11.242 0.735   1.00 0.00 ? 50  GLN B NE2  3  
ATOM 8708  H H    . GLN B 1 50  ? 18.117  -12.313 5.384   1.00 0.00 ? 50  GLN B H    3  
ATOM 8709  H HA   . GLN B 1 50  ? 17.982  -12.157 3.123   1.00 0.00 ? 50  GLN B HA   3  
ATOM 8710  H HB2  . GLN B 1 50  ? 20.748  -12.015 3.653   1.00 0.00 ? 50  GLN B HB2  3  
ATOM 8711  H HB3  . GLN B 1 50  ? 20.566  -13.132 2.308   1.00 0.00 ? 50  GLN B HB3  3  
ATOM 8712  H HG2  . GLN B 1 50  ? 19.443  -10.342 2.419   1.00 0.00 ? 50  GLN B HG2  3  
ATOM 8713  H HG3  . GLN B 1 50  ? 20.913  -10.823 1.573   1.00 0.00 ? 50  GLN B HG3  3  
ATOM 8714  H HE21 . GLN B 1 50  ? 17.460  -10.843 1.564   1.00 0.00 ? 50  GLN B HE21 3  
ATOM 8715  H HE22 . GLN B 1 50  ? 17.256  -11.462 -0.046  1.00 0.00 ? 50  GLN B HE22 3  
ATOM 8716  N N    . LYS B 1 51  ? 17.716  -14.972 3.753   1.00 0.00 ? 51  LYS B N    3  
ATOM 8717  C CA   . LYS B 1 51  ? 17.345  -16.338 3.403   1.00 0.00 ? 51  LYS B CA   3  
ATOM 8718  C C    . LYS B 1 51  ? 16.340  -16.351 2.256   1.00 0.00 ? 51  LYS B C    3  
ATOM 8719  O O    . LYS B 1 51  ? 16.274  -17.308 1.484   1.00 0.00 ? 51  LYS B O    3  
ATOM 8720  C CB   . LYS B 1 51  ? 16.759  -17.057 4.619   1.00 0.00 ? 51  LYS B CB   3  
ATOM 8721  C CG   . LYS B 1 51  ? 17.740  -17.204 5.772   1.00 0.00 ? 51  LYS B CG   3  
ATOM 8722  C CD   . LYS B 1 51  ? 18.383  -18.581 5.783   1.00 0.00 ? 51  LYS B CD   3  
ATOM 8723  C CE   . LYS B 1 51  ? 19.692  -18.590 5.008   1.00 0.00 ? 51  LYS B CE   3  
ATOM 8724  N NZ   . LYS B 1 51  ? 20.793  -17.938 5.770   1.00 0.00 ? 51  LYS B NZ   3  
ATOM 8725  H H    . LYS B 1 51  ? 17.399  -14.594 4.600   1.00 0.00 ? 51  LYS B H    3  
ATOM 8726  H HA   . LYS B 1 51  ? 18.240  -16.854 3.087   1.00 0.00 ? 51  LYS B HA   3  
ATOM 8727  H HB2  . LYS B 1 51  ? 15.903  -16.501 4.973   1.00 0.00 ? 51  LYS B HB2  3  
ATOM 8728  H HB3  . LYS B 1 51  ? 16.438  -18.044 4.320   1.00 0.00 ? 51  LYS B HB3  3  
ATOM 8729  H HG2  . LYS B 1 51  ? 18.513  -16.457 5.670   1.00 0.00 ? 51  LYS B HG2  3  
ATOM 8730  H HG3  . LYS B 1 51  ? 17.212  -17.055 6.702   1.00 0.00 ? 51  LYS B HG3  3  
ATOM 8731  H HD2  . LYS B 1 51  ? 18.580  -18.868 6.804   1.00 0.00 ? 51  LYS B HD2  3  
ATOM 8732  H HD3  . LYS B 1 51  ? 17.703  -19.289 5.332   1.00 0.00 ? 51  LYS B HD3  3  
ATOM 8733  H HE2  . LYS B 1 51  ? 19.966  -19.614 4.802   1.00 0.00 ? 51  LYS B HE2  3  
ATOM 8734  H HE3  . LYS B 1 51  ? 19.548  -18.062 4.077   1.00 0.00 ? 51  LYS B HE3  3  
ATOM 8735  H HZ1  . LYS B 1 51  ? 21.693  -18.050 5.261   1.00 0.00 ? 51  LYS B HZ1  3  
ATOM 8736  H HZ2  . LYS B 1 51  ? 20.882  -18.373 6.711   1.00 0.00 ? 51  LYS B HZ2  3  
ATOM 8737  H HZ3  . LYS B 1 51  ? 20.595  -16.924 5.886   1.00 0.00 ? 51  LYS B HZ3  3  
ATOM 8738  N N    . ASP B 1 52  ? 15.559  -15.280 2.148   1.00 0.00 ? 52  ASP B N    3  
ATOM 8739  C CA   . ASP B 1 52  ? 14.558  -15.165 1.095   1.00 0.00 ? 52  ASP B CA   3  
ATOM 8740  C C    . ASP B 1 52  ? 15.006  -14.168 0.028   1.00 0.00 ? 52  ASP B C    3  
ATOM 8741  O O    . ASP B 1 52  ? 14.508  -13.043 -0.029  1.00 0.00 ? 52  ASP B O    3  
ATOM 8742  C CB   . ASP B 1 52  ? 13.214  -14.732 1.684   1.00 0.00 ? 52  ASP B CB   3  
ATOM 8743  C CG   . ASP B 1 52  ? 12.358  -15.911 2.102   1.00 0.00 ? 52  ASP B CG   3  
ATOM 8744  O OD1  . ASP B 1 52  ? 12.904  -16.858 2.705   1.00 0.00 ? 52  ASP B OD1  3  
ATOM 8745  O OD2  . ASP B 1 52  ? 11.140  -15.888 1.826   1.00 0.00 ? 52  ASP B OD2  3  
ATOM 8746  H H    . ASP B 1 52  ? 15.660  -14.548 2.792   1.00 0.00 ? 52  ASP B H    3  
ATOM 8747  H HA   . ASP B 1 52  ? 14.445  -16.137 0.637   1.00 0.00 ? 52  ASP B HA   3  
ATOM 8748  H HB2  . ASP B 1 52  ? 13.392  -14.115 2.553   1.00 0.00 ? 52  ASP B HB2  3  
ATOM 8749  H HB3  . ASP B 1 52  ? 12.672  -14.160 0.945   1.00 0.00 ? 52  ASP B HB3  3  
ATOM 8750  N N    . PRO B 1 53  ? 15.958  -14.568 -0.833  1.00 0.00 ? 53  PRO B N    3  
ATOM 8751  C CA   . PRO B 1 53  ? 16.471  -13.702 -1.899  1.00 0.00 ? 53  PRO B CA   3  
ATOM 8752  C C    . PRO B 1 53  ? 15.430  -13.435 -2.979  1.00 0.00 ? 53  PRO B C    3  
ATOM 8753  O O    . PRO B 1 53  ? 15.355  -14.154 -3.976  1.00 0.00 ? 53  PRO B O    3  
ATOM 8754  C CB   . PRO B 1 53  ? 17.646  -14.499 -2.472  1.00 0.00 ? 53  PRO B CB   3  
ATOM 8755  C CG   . PRO B 1 53  ? 17.335  -15.919 -2.150  1.00 0.00 ? 53  PRO B CG   3  
ATOM 8756  C CD   . PRO B 1 53  ? 16.606  -15.893 -0.835  1.00 0.00 ? 53  PRO B CD   3  
ATOM 8757  H HA   . PRO B 1 53  ? 16.829  -12.762 -1.506  1.00 0.00 ? 53  PRO B HA   3  
ATOM 8758  H HB2  . PRO B 1 53  ? 17.705  -14.339 -3.539  1.00 0.00 ? 53  PRO B HB2  3  
ATOM 8759  H HB3  . PRO B 1 53  ? 18.564  -14.181 -2.003  1.00 0.00 ? 53  PRO B HB3  3  
ATOM 8760  H HG2  . PRO B 1 53  ? 16.704  -16.340 -2.919  1.00 0.00 ? 53  PRO B HG2  3  
ATOM 8761  H HG3  . PRO B 1 53  ? 18.250  -16.485 -2.060  1.00 0.00 ? 53  PRO B HG3  3  
ATOM 8762  H HD2  . PRO B 1 53  ? 15.871  -16.683 -0.794  1.00 0.00 ? 53  PRO B HD2  3  
ATOM 8763  H HD3  . PRO B 1 53  ? 17.304  -15.981 -0.016  1.00 0.00 ? 53  PRO B HD3  3  
ATOM 8764  N N    . GLY B 1 54  ? 14.627  -12.397 -2.774  1.00 0.00 ? 54  GLY B N    3  
ATOM 8765  C CA   . GLY B 1 54  ? 13.598  -12.051 -3.737  1.00 0.00 ? 54  GLY B CA   3  
ATOM 8766  C C    . GLY B 1 54  ? 12.681  -10.955 -3.234  1.00 0.00 ? 54  GLY B C    3  
ATOM 8767  O O    . GLY B 1 54  ? 12.281  -10.074 -3.994  1.00 0.00 ? 54  GLY B O    3  
ATOM 8768  H H    . GLY B 1 54  ? 14.733  -11.860 -1.960  1.00 0.00 ? 54  GLY B H    3  
ATOM 8769  H HA2  . GLY B 1 54  ? 14.072  -11.720 -4.649  1.00 0.00 ? 54  GLY B HA2  3  
ATOM 8770  H HA3  . GLY B 1 54  ? 13.009  -12.931 -3.949  1.00 0.00 ? 54  GLY B HA3  3  
ATOM 8771  N N    . VAL B 1 55  ? 12.347  -11.010 -1.948  1.00 0.00 ? 55  VAL B N    3  
ATOM 8772  C CA   . VAL B 1 55  ? 11.470  -10.015 -1.337  1.00 0.00 ? 55  VAL B CA   3  
ATOM 8773  C C    . VAL B 1 55  ? 11.956  -8.597  -1.619  1.00 0.00 ? 55  VAL B C    3  
ATOM 8774  O O    . VAL B 1 55  ? 11.267  -7.810  -2.269  1.00 0.00 ? 55  VAL B O    3  
ATOM 8775  C CB   . VAL B 1 55  ? 11.376  -10.214 0.188   1.00 0.00 ? 55  VAL B CB   3  
ATOM 8776  C CG1  . VAL B 1 55  ? 10.325  -9.293  0.787   1.00 0.00 ? 55  VAL B CG1  3  
ATOM 8777  C CG2  . VAL B 1 55  ? 11.074  -11.668 0.520   1.00 0.00 ? 55  VAL B CG2  3  
ATOM 8778  H H    . VAL B 1 55  ? 12.700  -11.737 -1.394  1.00 0.00 ? 55  VAL B H    3  
ATOM 8779  H HA   . VAL B 1 55  ? 10.483  -10.137 -1.757  1.00 0.00 ? 55  VAL B HA   3  
ATOM 8780  H HB   . VAL B 1 55  ? 12.333  -9.961  0.622   1.00 0.00 ? 55  VAL B HB   3  
ATOM 8781  H HG11 . VAL B 1 55  ? 10.543  -8.272  0.511   1.00 0.00 ? 55  VAL B HG11 3  
ATOM 8782  H HG12 . VAL B 1 55  ? 10.336  -9.385  1.863   1.00 0.00 ? 55  VAL B HG12 3  
ATOM 8783  H HG13 . VAL B 1 55  ? 9.350   -9.567  0.412   1.00 0.00 ? 55  VAL B HG13 3  
ATOM 8784  H HG21 . VAL B 1 55  ? 10.567  -12.129 -0.315  1.00 0.00 ? 55  VAL B HG21 3  
ATOM 8785  H HG22 . VAL B 1 55  ? 10.443  -11.714 1.395   1.00 0.00 ? 55  VAL B HG22 3  
ATOM 8786  H HG23 . VAL B 1 55  ? 11.998  -12.192 0.714   1.00 0.00 ? 55  VAL B HG23 3  
ATOM 8787  N N    . LEU B 1 56  ? 13.146  -8.278  -1.123  1.00 0.00 ? 56  LEU B N    3  
ATOM 8788  C CA   . LEU B 1 56  ? 13.729  -6.960  -1.316  1.00 0.00 ? 56  LEU B CA   3  
ATOM 8789  C C    . LEU B 1 56  ? 13.942  -6.672  -2.799  1.00 0.00 ? 56  LEU B C    3  
ATOM 8790  O O    . LEU B 1 56  ? 13.532  -5.629  -3.305  1.00 0.00 ? 56  LEU B O    3  
ATOM 8791  C CB   . LEU B 1 56  ? 15.056  -6.886  -0.554  1.00 0.00 ? 56  LEU B CB   3  
ATOM 8792  C CG   . LEU B 1 56  ? 16.058  -5.840  -1.042  1.00 0.00 ? 56  LEU B CG   3  
ATOM 8793  C CD1  . LEU B 1 56  ? 15.654  -4.451  -0.574  1.00 0.00 ? 56  LEU B CD1  3  
ATOM 8794  C CD2  . LEU B 1 56  ? 17.450  -6.194  -0.548  1.00 0.00 ? 56  LEU B CD2  3  
ATOM 8795  H H    . LEU B 1 56  ? 13.648  -8.947  -0.613  1.00 0.00 ? 56  LEU B H    3  
ATOM 8796  H HA   . LEU B 1 56  ? 13.047  -6.229  -0.909  1.00 0.00 ? 56  LEU B HA   3  
ATOM 8797  H HB2  . LEU B 1 56  ? 14.835  -6.681  0.483   1.00 0.00 ? 56  LEU B HB2  3  
ATOM 8798  H HB3  . LEU B 1 56  ? 15.529  -7.855  -0.616  1.00 0.00 ? 56  LEU B HB3  3  
ATOM 8799  H HG   . LEU B 1 56  ? 16.077  -5.838  -2.121  1.00 0.00 ? 56  LEU B HG   3  
ATOM 8800  H HD11 . LEU B 1 56  ? 14.701  -4.190  -1.008  1.00 0.00 ? 56  LEU B HD11 3  
ATOM 8801  H HD12 . LEU B 1 56  ? 16.400  -3.735  -0.885  1.00 0.00 ? 56  LEU B HD12 3  
ATOM 8802  H HD13 . LEU B 1 56  ? 15.573  -4.443  0.503   1.00 0.00 ? 56  LEU B HD13 3  
ATOM 8803  H HD21 . LEU B 1 56  ? 17.478  -7.243  -0.284  1.00 0.00 ? 56  LEU B HD21 3  
ATOM 8804  H HD22 . LEU B 1 56  ? 17.687  -5.597  0.320   1.00 0.00 ? 56  LEU B HD22 3  
ATOM 8805  H HD23 . LEU B 1 56  ? 18.170  -6.000  -1.328  1.00 0.00 ? 56  LEU B HD23 3  
ATOM 8806  N N    . ASP B 1 57  ? 14.589  -7.603  -3.487  1.00 0.00 ? 57  ASP B N    3  
ATOM 8807  C CA   . ASP B 1 57  ? 14.865  -7.454  -4.911  1.00 0.00 ? 57  ASP B CA   3  
ATOM 8808  C C    . ASP B 1 57  ? 13.583  -7.211  -5.703  1.00 0.00 ? 57  ASP B C    3  
ATOM 8809  O O    . ASP B 1 57  ? 13.597  -6.532  -6.729  1.00 0.00 ? 57  ASP B O    3  
ATOM 8810  C CB   . ASP B 1 57  ? 15.579  -8.698  -5.439  1.00 0.00 ? 57  ASP B CB   3  
ATOM 8811  C CG   . ASP B 1 57  ? 16.485  -8.390  -6.615  1.00 0.00 ? 57  ASP B CG   3  
ATOM 8812  O OD1  . ASP B 1 57  ? 16.022  -7.716  -7.559  1.00 0.00 ? 57  ASP B OD1  3  
ATOM 8813  O OD2  . ASP B 1 57  ? 17.655  -8.823  -6.591  1.00 0.00 ? 57  ASP B OD2  3  
ATOM 8814  H H    . ASP B 1 57  ? 14.894  -8.410  -3.025  1.00 0.00 ? 57  ASP B H    3  
ATOM 8815  H HA   . ASP B 1 57  ? 15.515  -6.600  -5.032  1.00 0.00 ? 57  ASP B HA   3  
ATOM 8816  H HB2  . ASP B 1 57  ? 16.178  -9.122  -4.648  1.00 0.00 ? 57  ASP B HB2  3  
ATOM 8817  H HB3  . ASP B 1 57  ? 14.841  -9.421  -5.754  1.00 0.00 ? 57  ASP B HB3  3  
ATOM 8818  N N    . ARG B 1 58  ? 12.475  -7.768  -5.223  1.00 0.00 ? 58  ARG B N    3  
ATOM 8819  C CA   . ARG B 1 58  ? 11.188  -7.608  -5.891  1.00 0.00 ? 58  ARG B CA   3  
ATOM 8820  C C    . ARG B 1 58  ? 10.803  -6.135  -5.993  1.00 0.00 ? 58  ARG B C    3  
ATOM 8821  O O    . ARG B 1 58  ? 10.311  -5.682  -7.026  1.00 0.00 ? 58  ARG B O    3  
ATOM 8822  C CB   . ARG B 1 58  ? 10.100  -8.382  -5.141  1.00 0.00 ? 58  ARG B CB   3  
ATOM 8823  C CG   . ARG B 1 58  ? 9.510   -9.535  -5.938  1.00 0.00 ? 58  ARG B CG   3  
ATOM 8824  C CD   . ARG B 1 58  ? 10.572  -10.556 -6.310  1.00 0.00 ? 58  ARG B CD   3  
ATOM 8825  N NE   . ARG B 1 58  ? 10.077  -11.530 -7.281  1.00 0.00 ? 58  ARG B NE   3  
ATOM 8826  C CZ   . ARG B 1 58  ? 9.237   -12.517 -6.979  1.00 0.00 ? 58  ARG B CZ   3  
ATOM 8827  N NH1  . ARG B 1 58  ? 8.797   -12.666 -5.736  1.00 0.00 ? 58  ARG B NH1  3  
ATOM 8828  N NH2  . ARG B 1 58  ? 8.835   -13.358 -7.922  1.00 0.00 ? 58  ARG B NH2  3  
ATOM 8829  H H    . ARG B 1 58  ? 12.525  -8.298  -4.400  1.00 0.00 ? 58  ARG B H    3  
ATOM 8830  H HA   . ARG B 1 58  ? 11.281  -8.012  -6.888  1.00 0.00 ? 58  ARG B HA   3  
ATOM 8831  H HB2  . ARG B 1 58  ? 10.520  -8.780  -4.230  1.00 0.00 ? 58  ARG B HB2  3  
ATOM 8832  H HB3  . ARG B 1 58  ? 9.298   -7.703  -4.888  1.00 0.00 ? 58  ARG B HB3  3  
ATOM 8833  H HG2  . ARG B 1 58  ? 8.752   -10.020 -5.343  1.00 0.00 ? 58  ARG B HG2  3  
ATOM 8834  H HG3  . ARG B 1 58  ? 9.066   -9.143  -6.842  1.00 0.00 ? 58  ARG B HG3  3  
ATOM 8835  H HD2  . ARG B 1 58  ? 11.420  -10.038 -6.735  1.00 0.00 ? 58  ARG B HD2  3  
ATOM 8836  H HD3  . ARG B 1 58  ? 10.880  -11.078 -5.417  1.00 0.00 ? 58  ARG B HD3  3  
ATOM 8837  H HE   . ARG B 1 58  ? 10.387  -11.443 -8.207  1.00 0.00 ? 58  ARG B HE   3  
ATOM 8838  H HH11 . ARG B 1 58  ? 9.097   -12.034 -5.019  1.00 0.00 ? 58  ARG B HH11 3  
ATOM 8839  H HH12 . ARG B 1 58  ? 8.165   -13.409 -5.515  1.00 0.00 ? 58  ARG B HH12 3  
ATOM 8840  H HH22 . ARG B 1 58  ? 8.204   -14.100 -7.694  1.00 0.00 ? 58  ARG B HH22 3  
ATOM 8841  N N    . MET B 1 59  ? 11.020  -5.396  -4.910  1.00 0.00 ? 59  MET B N    3  
ATOM 8842  C CA   . MET B 1 59  ? 10.687  -3.976  -4.873  1.00 0.00 ? 59  MET B CA   3  
ATOM 8843  C C    . MET B 1 59  ? 11.511  -3.188  -5.881  1.00 0.00 ? 59  MET B C    3  
ATOM 8844  O O    . MET B 1 59  ? 10.967  -2.451  -6.699  1.00 0.00 ? 59  MET B O    3  
ATOM 8845  C CB   . MET B 1 59  ? 10.898  -3.430  -3.456  1.00 0.00 ? 59  MET B CB   3  
ATOM 8846  C CG   . MET B 1 59  ? 12.253  -2.768  -3.204  1.00 0.00 ? 59  MET B CG   3  
ATOM 8847  S SD   . MET B 1 59  ? 12.353  -2.004  -1.576  1.00 0.00 ? 59  MET B SD   3  
ATOM 8848  C CE   . MET B 1 59  ? 11.216  -3.043  -0.673  1.00 0.00 ? 59  MET B CE   3  
ATOM 8849  H H    . MET B 1 59  ? 11.408  -5.817  -4.114  1.00 0.00 ? 59  MET B H    3  
ATOM 8850  H HA   . MET B 1 59  ? 9.644   -3.874  -5.129  1.00 0.00 ? 59  MET B HA   3  
ATOM 8851  H HB2  . MET B 1 59  ? 10.132  -2.702  -3.250  1.00 0.00 ? 59  MET B HB2  3  
ATOM 8852  H HB3  . MET B 1 59  ? 10.794  -4.247  -2.759  1.00 0.00 ? 59  MET B HB3  3  
ATOM 8853  H HG2  . MET B 1 59  ? 13.025  -3.515  -3.281  1.00 0.00 ? 59  MET B HG2  3  
ATOM 8854  H HG3  . MET B 1 59  ? 12.413  -2.006  -3.953  1.00 0.00 ? 59  MET B HG3  3  
ATOM 8855  H HE1  . MET B 1 59  ? 11.607  -4.048  -0.644  1.00 0.00 ? 59  MET B HE1  3  
ATOM 8856  H HE2  . MET B 1 59  ? 10.256  -3.047  -1.172  1.00 0.00 ? 59  MET B HE2  3  
ATOM 8857  H HE3  . MET B 1 59  ? 11.100  -2.670  0.331   1.00 0.00 ? 59  MET B HE3  3  
ATOM 8858  N N    . MET B 1 60  ? 12.824  -3.342  -5.806  1.00 0.00 ? 60  MET B N    3  
ATOM 8859  C CA   . MET B 1 60  ? 13.725  -2.634  -6.706  1.00 0.00 ? 60  MET B CA   3  
ATOM 8860  C C    . MET B 1 60  ? 13.456  -3.002  -8.162  1.00 0.00 ? 60  MET B C    3  
ATOM 8861  O O    . MET B 1 60  ? 13.670  -2.192  -9.064  1.00 0.00 ? 60  MET B O    3  
ATOM 8862  C CB   . MET B 1 60  ? 15.177  -2.934  -6.341  1.00 0.00 ? 60  MET B CB   3  
ATOM 8863  C CG   . MET B 1 60  ? 15.640  -2.207  -5.089  1.00 0.00 ? 60  MET B CG   3  
ATOM 8864  S SD   . MET B 1 60  ? 16.687  -0.786  -5.457  1.00 0.00 ? 60  MET B SD   3  
ATOM 8865  C CE   . MET B 1 60  ? 15.625  0.134   -6.568  1.00 0.00 ? 60  MET B CE   3  
ATOM 8866  H H    . MET B 1 60  ? 13.195  -3.939  -5.117  1.00 0.00 ? 60  MET B H    3  
ATOM 8867  H HA   . MET B 1 60  ? 13.548  -1.577  -6.580  1.00 0.00 ? 60  MET B HA   3  
ATOM 8868  H HB2  . MET B 1 60  ? 15.285  -3.996  -6.177  1.00 0.00 ? 60  MET B HB2  3  
ATOM 8869  H HB3  . MET B 1 60  ? 15.814  -2.637  -7.161  1.00 0.00 ? 60  MET B HB3  3  
ATOM 8870  H HG2  . MET B 1 60  ? 14.768  -1.863  -4.549  1.00 0.00 ? 60  MET B HG2  3  
ATOM 8871  H HG3  . MET B 1 60  ? 16.195  -2.897  -4.472  1.00 0.00 ? 60  MET B HG3  3  
ATOM 8872  H HE1  . MET B 1 60  ? 16.217  0.850   -7.120  1.00 0.00 ? 60  MET B HE1  3  
ATOM 8873  H HE2  . MET B 1 60  ? 14.871  0.655   -5.997  1.00 0.00 ? 60  MET B HE2  3  
ATOM 8874  H HE3  . MET B 1 60  ? 15.149  -0.547  -7.257  1.00 0.00 ? 60  MET B HE3  3  
ATOM 8875  N N    . LYS B 1 61  ? 12.983  -4.223  -8.387  1.00 0.00 ? 61  LYS B N    3  
ATOM 8876  C CA   . LYS B 1 61  ? 12.681  -4.686  -9.737  1.00 0.00 ? 61  LYS B CA   3  
ATOM 8877  C C    . LYS B 1 61  ? 11.348  -4.119  -10.220 1.00 0.00 ? 61  LYS B C    3  
ATOM 8878  O O    . LYS B 1 61  ? 11.288  -3.418  -11.230 1.00 0.00 ? 61  LYS B O    3  
ATOM 8879  C CB   . LYS B 1 61  ? 12.648  -6.215  -9.783  1.00 0.00 ? 61  LYS B CB   3  
ATOM 8880  C CG   . LYS B 1 61  ? 13.386  -6.802  -10.975 1.00 0.00 ? 61  LYS B CG   3  
ATOM 8881  C CD   . LYS B 1 61  ? 14.892  -6.734  -10.785 1.00 0.00 ? 61  LYS B CD   3  
ATOM 8882  C CE   . LYS B 1 61  ? 15.471  -5.455  -11.368 1.00 0.00 ? 61  LYS B CE   3  
ATOM 8883  N NZ   . LYS B 1 61  ? 16.888  -5.628  -11.788 1.00 0.00 ? 61  LYS B NZ   3  
ATOM 8884  H H    . LYS B 1 61  ? 12.829  -4.825  -7.629  1.00 0.00 ? 61  LYS B H    3  
ATOM 8885  H HA   . LYS B 1 61  ? 13.465  -4.332  -10.390 1.00 0.00 ? 61  LYS B HA   3  
ATOM 8886  H HB2  . LYS B 1 61  ? 13.099  -6.601  -8.882  1.00 0.00 ? 61  LYS B HB2  3  
ATOM 8887  H HB3  . LYS B 1 61  ? 11.619  -6.541  -9.828  1.00 0.00 ? 61  LYS B HB3  3  
ATOM 8888  H HG2  . LYS B 1 61  ? 13.094  -7.835  -11.093 1.00 0.00 ? 61  LYS B HG2  3  
ATOM 8889  H HG3  . LYS B 1 61  ? 13.117  -6.246  -11.862 1.00 0.00 ? 61  LYS B HG3  3  
ATOM 8890  H HD2  . LYS B 1 61  ? 15.114  -6.769  -9.729  1.00 0.00 ? 61  LYS B HD2  3  
ATOM 8891  H HD3  . LYS B 1 61  ? 15.346  -7.582  -11.278 1.00 0.00 ? 61  LYS B HD3  3  
ATOM 8892  H HE2  . LYS B 1 61  ? 14.882  -5.168  -12.227 1.00 0.00 ? 61  LYS B HE2  3  
ATOM 8893  H HE3  . LYS B 1 61  ? 15.419  -4.679  -10.619 1.00 0.00 ? 61  LYS B HE3  3  
ATOM 8894  H HZ1  . LYS B 1 61  ? 17.400  -6.208  -11.091 1.00 0.00 ? 61  LYS B HZ1  3  
ATOM 8895  H HZ2  . LYS B 1 61  ? 17.356  -4.703  -11.862 1.00 0.00 ? 61  LYS B HZ2  3  
ATOM 8896  H HZ3  . LYS B 1 61  ? 16.932  -6.101  -12.714 1.00 0.00 ? 61  LYS B HZ3  3  
ATOM 8897  N N    . LYS B 1 62  ? 10.282  -4.429  -9.487  1.00 0.00 ? 62  LYS B N    3  
ATOM 8898  C CA   . LYS B 1 62  ? 8.944   -3.956  -9.833  1.00 0.00 ? 62  LYS B CA   3  
ATOM 8899  C C    . LYS B 1 62  ? 8.714   -2.514  -9.375  1.00 0.00 ? 62  LYS B C    3  
ATOM 8900  O O    . LYS B 1 62  ? 7.600   -1.999  -9.475  1.00 0.00 ? 62  LYS B O    3  
ATOM 8901  C CB   . LYS B 1 62  ? 7.885   -4.867  -9.212  1.00 0.00 ? 62  LYS B CB   3  
ATOM 8902  C CG   . LYS B 1 62  ? 7.689   -6.175  -9.960  1.00 0.00 ? 62  LYS B CG   3  
ATOM 8903  C CD   . LYS B 1 62  ? 8.744   -7.198  -9.575  1.00 0.00 ? 62  LYS B CD   3  
ATOM 8904  C CE   . LYS B 1 62  ? 8.910   -8.262  -10.650 1.00 0.00 ? 62  LYS B CE   3  
ATOM 8905  N NZ   . LYS B 1 62  ? 8.344   -9.573  -10.227 1.00 0.00 ? 62  LYS B NZ   3  
ATOM 8906  H H    . LYS B 1 62  ? 10.397  -4.992  -8.693  1.00 0.00 ? 62  LYS B H    3  
ATOM 8907  H HA   . LYS B 1 62  ? 8.848   -3.996  -10.908 1.00 0.00 ? 62  LYS B HA   3  
ATOM 8908  H HB2  . LYS B 1 62  ? 8.177   -5.099  -8.198  1.00 0.00 ? 62  LYS B HB2  3  
ATOM 8909  H HB3  . LYS B 1 62  ? 6.940   -4.344  -9.193  1.00 0.00 ? 62  LYS B HB3  3  
ATOM 8910  H HG2  . LYS B 1 62  ? 6.713   -6.573  -9.724  1.00 0.00 ? 62  LYS B HG2  3  
ATOM 8911  H HG3  . LYS B 1 62  ? 7.755   -5.985  -11.021 1.00 0.00 ? 62  LYS B HG3  3  
ATOM 8912  H HD2  . LYS B 1 62  ? 9.688   -6.693  -9.435  1.00 0.00 ? 62  LYS B HD2  3  
ATOM 8913  H HD3  . LYS B 1 62  ? 8.449   -7.676  -8.652  1.00 0.00 ? 62  LYS B HD3  3  
ATOM 8914  H HE2  . LYS B 1 62  ? 8.404   -7.934  -11.546 1.00 0.00 ? 62  LYS B HE2  3  
ATOM 8915  H HE3  . LYS B 1 62  ? 9.964   -8.385  -10.856 1.00 0.00 ? 62  LYS B HE3  3  
ATOM 8916  H HZ1  . LYS B 1 62  ? 7.634   -9.431  -9.479  1.00 0.00 ? 62  LYS B HZ1  3  
ATOM 8917  H HZ2  . LYS B 1 62  ? 9.098   -10.187 -9.861  1.00 0.00 ? 62  LYS B HZ2  3  
ATOM 8918  H HZ3  . LYS B 1 62  ? 7.891   -10.044 -11.035 1.00 0.00 ? 62  LYS B HZ3  3  
ATOM 8919  N N    . LEU B 1 63  ? 9.763   -1.869  -8.863  1.00 0.00 ? 63  LEU B N    3  
ATOM 8920  C CA   . LEU B 1 63  ? 9.659   -0.492  -8.380  1.00 0.00 ? 63  LEU B CA   3  
ATOM 8921  C C    . LEU B 1 63  ? 8.886   0.382   -9.349  1.00 0.00 ? 63  LEU B C    3  
ATOM 8922  O O    . LEU B 1 63  ? 8.172   1.301   -8.946  1.00 0.00 ? 63  LEU B O    3  
ATOM 8923  C CB   . LEU B 1 63  ? 11.053  0.094   -8.123  1.00 0.00 ? 63  LEU B CB   3  
ATOM 8924  C CG   . LEU B 1 63  ? 11.753  0.694   -9.345  1.00 0.00 ? 63  LEU B CG   3  
ATOM 8925  C CD1  . LEU B 1 63  ? 13.018  1.424   -8.921  1.00 0.00 ? 63  LEU B CD1  3  
ATOM 8926  C CD2  . LEU B 1 63  ? 12.074  -0.388  -10.368 1.00 0.00 ? 63  LEU B CD2  3  
ATOM 8927  H H    . LEU B 1 63  ? 10.622  -2.330  -8.797  1.00 0.00 ? 63  LEU B H    3  
ATOM 8928  H HA   . LEU B 1 63  ? 9.117   -0.513  -7.461  1.00 0.00 ? 63  LEU B HA   3  
ATOM 8929  H HB2  . LEU B 1 63  ? 10.960  0.866   -7.374  1.00 0.00 ? 63  LEU B HB2  3  
ATOM 8930  H HB3  . LEU B 1 63  ? 11.681  -0.690  -7.729  1.00 0.00 ? 63  LEU B HB3  3  
ATOM 8931  H HG   . LEU B 1 63  ? 11.095  1.411   -9.810  1.00 0.00 ? 63  LEU B HG   3  
ATOM 8932  H HD11 . LEU B 1 63  ? 13.746  0.707   -8.569  1.00 0.00 ? 63  LEU B HD11 3  
ATOM 8933  H HD12 . LEU B 1 63  ? 12.784  2.117   -8.126  1.00 0.00 ? 63  LEU B HD12 3  
ATOM 8934  H HD13 . LEU B 1 63  ? 13.423  1.963   -9.763  1.00 0.00 ? 63  LEU B HD13 3  
ATOM 8935  H HD21 . LEU B 1 63  ? 11.815  -1.355  -9.966  1.00 0.00 ? 63  LEU B HD21 3  
ATOM 8936  H HD22 . LEU B 1 63  ? 13.128  -0.366  -10.600 1.00 0.00 ? 63  LEU B HD22 3  
ATOM 8937  H HD23 . LEU B 1 63  ? 11.504  -0.209  -11.268 1.00 0.00 ? 63  LEU B HD23 3  
ATOM 8938  N N    . ASP B 1 64  ? 9.026   0.080   -10.625 1.00 0.00 ? 64  ASP B N    3  
ATOM 8939  C CA   . ASP B 1 64  ? 8.343   0.819   -11.668 1.00 0.00 ? 64  ASP B CA   3  
ATOM 8940  C C    . ASP B 1 64  ? 8.408   2.328   -11.434 1.00 0.00 ? 64  ASP B C    3  
ATOM 8941  O O    . ASP B 1 64  ? 7.470   2.923   -10.904 1.00 0.00 ? 64  ASP B O    3  
ATOM 8942  C CB   . ASP B 1 64  ? 6.885   0.369   -11.771 1.00 0.00 ? 64  ASP B CB   3  
ATOM 8943  C CG   . ASP B 1 64  ? 6.182   0.953   -12.980 1.00 0.00 ? 64  ASP B CG   3  
ATOM 8944  O OD1  . ASP B 1 64  ? 6.681   0.758   -14.108 1.00 0.00 ? 64  ASP B OD1  3  
ATOM 8945  O OD2  . ASP B 1 64  ? 5.133   1.606   -12.799 1.00 0.00 ? 64  ASP B OD2  3  
ATOM 8946  H H    . ASP B 1 64  ? 9.605   -0.669  -10.875 1.00 0.00 ? 64  ASP B H    3  
ATOM 8947  H HA   . ASP B 1 64  ? 8.842   0.590   -12.584 1.00 0.00 ? 64  ASP B HA   3  
ATOM 8948  H HB2  . ASP B 1 64  ? 6.851   -0.708  -11.843 1.00 0.00 ? 64  ASP B HB2  3  
ATOM 8949  H HB3  . ASP B 1 64  ? 6.354   0.683   -10.883 1.00 0.00 ? 64  ASP B HB3  3  
ATOM 8950  N N    . LEU B 1 65  ? 9.517   2.943   -11.836 1.00 0.00 ? 65  LEU B N    3  
ATOM 8951  C CA   . LEU B 1 65  ? 9.690   4.383   -11.671 1.00 0.00 ? 65  LEU B CA   3  
ATOM 8952  C C    . LEU B 1 65  ? 9.134   5.134   -12.875 1.00 0.00 ? 65  LEU B C    3  
ATOM 8953  O O    . LEU B 1 65  ? 9.720   5.116   -13.958 1.00 0.00 ? 65  LEU B O    3  
ATOM 8954  C CB   . LEU B 1 65  ? 11.169  4.730   -11.478 1.00 0.00 ? 65  LEU B CB   3  
ATOM 8955  C CG   . LEU B 1 65  ? 11.900  3.911   -10.410 1.00 0.00 ? 65  LEU B CG   3  
ATOM 8956  C CD1  . LEU B 1 65  ? 13.337  4.389   -10.268 1.00 0.00 ? 65  LEU B CD1  3  
ATOM 8957  C CD2  . LEU B 1 65  ? 11.174  3.998   -9.073  1.00 0.00 ? 65  LEU B CD2  3  
ATOM 8958  H H    . LEU B 1 65  ? 10.231  2.418   -12.256 1.00 0.00 ? 65  LEU B H    3  
ATOM 8959  H HA   . LEU B 1 65  ? 9.141   4.683   -10.792 1.00 0.00 ? 65  LEU B HA   3  
ATOM 8960  H HB2  . LEU B 1 65  ? 11.676  4.586   -12.421 1.00 0.00 ? 65  LEU B HB2  3  
ATOM 8961  H HB3  . LEU B 1 65  ? 11.238  5.773   -11.209 1.00 0.00 ? 65  LEU B HB3  3  
ATOM 8962  H HG   . LEU B 1 65  ? 11.923  2.876   -10.715 1.00 0.00 ? 65  LEU B HG   3  
ATOM 8963  H HD11 . LEU B 1 65  ? 13.352  5.466   -10.194 1.00 0.00 ? 65  LEU B HD11 3  
ATOM 8964  H HD12 . LEU B 1 65  ? 13.907  4.079   -11.131 1.00 0.00 ? 65  LEU B HD12 3  
ATOM 8965  H HD13 . LEU B 1 65  ? 13.772  3.961   -9.377  1.00 0.00 ? 65  LEU B HD13 3  
ATOM 8966  H HD21 . LEU B 1 65  ? 11.729  4.635   -8.401  1.00 0.00 ? 65  LEU B HD21 3  
ATOM 8967  H HD22 . LEU B 1 65  ? 11.091  3.010   -8.643  1.00 0.00 ? 65  LEU B HD22 3  
ATOM 8968  H HD23 . LEU B 1 65  ? 10.186  4.408   -9.224  1.00 0.00 ? 65  LEU B HD23 3  
ATOM 8969  N N    . ASN B 1 66  ? 7.997   5.794   -12.680 1.00 0.00 ? 66  ASN B N    3  
ATOM 8970  C CA   . ASN B 1 66  ? 7.358   6.551   -13.749 1.00 0.00 ? 66  ASN B CA   3  
ATOM 8971  C C    . ASN B 1 66  ? 7.769   8.019   -13.701 1.00 0.00 ? 66  ASN B C    3  
ATOM 8972  O O    . ASN B 1 66  ? 7.894   8.673   -14.736 1.00 0.00 ? 66  ASN B O    3  
ATOM 8973  C CB   . ASN B 1 66  ? 5.836   6.432   -13.649 1.00 0.00 ? 66  ASN B CB   3  
ATOM 8974  C CG   . ASN B 1 66  ? 5.289   5.292   -14.484 1.00 0.00 ? 66  ASN B CG   3  
ATOM 8975  O OD1  . ASN B 1 66  ? 4.415   5.488   -15.328 1.00 0.00 ? 66  ASN B OD1  3  
ATOM 8976  N ND2  . ASN B 1 66  ? 5.803   4.088   -14.252 1.00 0.00 ? 66  ASN B ND2  3  
ATOM 8977  H H    . ASN B 1 66  ? 7.578   5.769   -11.794 1.00 0.00 ? 66  ASN B H    3  
ATOM 8978  H HA   . ASN B 1 66  ? 7.681   6.131   -14.690 1.00 0.00 ? 66  ASN B HA   3  
ATOM 8979  H HB2  . ASN B 1 66  ? 5.561   6.261   -12.618 1.00 0.00 ? 66  ASN B HB2  3  
ATOM 8980  H HB3  . ASN B 1 66  ? 5.385   7.352   -13.989 1.00 0.00 ? 66  ASN B HB3  3  
ATOM 8981  H HD21 . ASN B 1 66  ? 6.499   4.007   -13.562 1.00 0.00 ? 66  ASN B HD21 3  
ATOM 8982  H HD22 . ASN B 1 66  ? 5.464   3.331   -14.782 1.00 0.00 ? 66  ASN B HD22 3  
ATOM 8983  N N    . SER B 1 67  ? 7.978   8.530   -12.492 1.00 0.00 ? 67  SER B N    3  
ATOM 8984  C CA   . SER B 1 67  ? 8.375   9.922   -12.310 1.00 0.00 ? 67  SER B CA   3  
ATOM 8985  C C    . SER B 1 67  ? 9.685   10.213  -13.036 1.00 0.00 ? 67  SER B C    3  
ATOM 8986  O O    . SER B 1 67  ? 10.219  9.354   -13.738 1.00 0.00 ? 67  SER B O    3  
ATOM 8987  C CB   . SER B 1 67  ? 8.518   10.243  -10.821 1.00 0.00 ? 67  SER B CB   3  
ATOM 8988  O OG   . SER B 1 67  ? 7.321   10.793  -10.300 1.00 0.00 ? 67  SER B OG   3  
ATOM 8989  H H    . SER B 1 67  ? 7.862   7.960   -11.704 1.00 0.00 ? 67  SER B H    3  
ATOM 8990  H HA   . SER B 1 67  ? 7.599   10.545  -12.731 1.00 0.00 ? 67  SER B HA   3  
ATOM 8991  H HB2  . SER B 1 67  ? 8.749   9.337   -10.280 1.00 0.00 ? 67  SER B HB2  3  
ATOM 8992  H HB3  . SER B 1 67  ? 9.317   10.957  -10.684 1.00 0.00 ? 67  SER B HB3  3  
ATOM 8993  H HG   . SER B 1 67  ? 7.132   10.397  -9.446  1.00 0.00 ? 67  SER B HG   3  
ATOM 8994  N N    . ASP B 1 68  ? 10.198  11.426  -12.859 1.00 0.00 ? 68  ASP B N    3  
ATOM 8995  C CA   . ASP B 1 68  ? 11.447  11.830  -13.495 1.00 0.00 ? 68  ASP B CA   3  
ATOM 8996  C C    . ASP B 1 68  ? 12.578  10.865  -13.147 1.00 0.00 ? 68  ASP B C    3  
ATOM 8997  O O    . ASP B 1 68  ? 13.558  10.752  -13.883 1.00 0.00 ? 68  ASP B O    3  
ATOM 8998  C CB   . ASP B 1 68  ? 11.825  13.249  -13.069 1.00 0.00 ? 68  ASP B CB   3  
ATOM 8999  C CG   . ASP B 1 68  ? 12.447  14.045  -14.199 1.00 0.00 ? 68  ASP B CG   3  
ATOM 9000  O OD1  . ASP B 1 68  ? 11.690  14.624  -15.005 1.00 0.00 ? 68  ASP B OD1  3  
ATOM 9001  O OD2  . ASP B 1 68  ? 13.694  14.088  -14.279 1.00 0.00 ? 68  ASP B OD2  3  
ATOM 9002  H H    . ASP B 1 68  ? 9.726   12.066  -12.286 1.00 0.00 ? 68  ASP B H    3  
ATOM 9003  H HA   . ASP B 1 68  ? 11.294  11.814  -14.564 1.00 0.00 ? 68  ASP B HA   3  
ATOM 9004  H HB2  . ASP B 1 68  ? 10.938  13.767  -12.736 1.00 0.00 ? 68  ASP B HB2  3  
ATOM 9005  H HB3  . ASP B 1 68  ? 12.533  13.198  -12.256 1.00 0.00 ? 68  ASP B HB3  3  
ATOM 9006  N N    . GLY B 1 69  ? 12.436  10.172  -12.021 1.00 0.00 ? 69  GLY B N    3  
ATOM 9007  C CA   . GLY B 1 69  ? 13.452  9.228   -11.599 1.00 0.00 ? 69  GLY B CA   3  
ATOM 9008  C C    . GLY B 1 69  ? 13.434  8.984   -10.102 1.00 0.00 ? 69  GLY B C    3  
ATOM 9009  O O    . GLY B 1 69  ? 13.879  7.937   -9.631  1.00 0.00 ? 69  GLY B O    3  
ATOM 9010  H H    . GLY B 1 69  ? 11.634  10.301  -11.474 1.00 0.00 ? 69  GLY B H    3  
ATOM 9011  H HA2  . GLY B 1 69  ? 13.290  8.289   -12.108 1.00 0.00 ? 69  GLY B HA2  3  
ATOM 9012  H HA3  . GLY B 1 69  ? 14.423  9.611   -11.878 1.00 0.00 ? 69  GLY B HA3  3  
ATOM 9013  N N    . GLN B 1 70  ? 12.919  9.953   -9.352  1.00 0.00 ? 70  GLN B N    3  
ATOM 9014  C CA   . GLN B 1 70  ? 12.846  9.839   -7.900  1.00 0.00 ? 70  GLN B CA   3  
ATOM 9015  C C    . GLN B 1 70  ? 11.823  8.790   -7.485  1.00 0.00 ? 70  GLN B C    3  
ATOM 9016  O O    . GLN B 1 70  ? 11.091  8.261   -8.319  1.00 0.00 ? 70  GLN B O    3  
ATOM 9017  C CB   . GLN B 1 70  ? 12.489  11.192  -7.279  1.00 0.00 ? 70  GLN B CB   3  
ATOM 9018  C CG   . GLN B 1 70  ? 13.699  11.979  -6.804  1.00 0.00 ? 70  GLN B CG   3  
ATOM 9019  C CD   . GLN B 1 70  ? 14.284  11.411  -5.529  1.00 0.00 ? 70  GLN B CD   3  
ATOM 9020  O OE1  . GLN B 1 70  ? 14.041  11.925  -4.437  1.00 0.00 ? 70  GLN B OE1  3  
ATOM 9021  N NE2  . GLN B 1 70  ? 15.063  10.343  -5.660  1.00 0.00 ? 70  GLN B NE2  3  
ATOM 9022  H H    . GLN B 1 70  ? 12.581  10.765  -9.784  1.00 0.00 ? 70  GLN B H    3  
ATOM 9023  H HA   . GLN B 1 70  ? 13.817  9.536   -7.545  1.00 0.00 ? 70  GLN B HA   3  
ATOM 9024  H HB2  . GLN B 1 70  ? 11.964  11.786  -8.013  1.00 0.00 ? 70  GLN B HB2  3  
ATOM 9025  H HB3  . GLN B 1 70  ? 11.837  11.027  -6.430  1.00 0.00 ? 70  GLN B HB3  3  
ATOM 9026  H HG2  . GLN B 1 70  ? 14.456  11.953  -7.574  1.00 0.00 ? 70  GLN B HG2  3  
ATOM 9027  H HG3  . GLN B 1 70  ? 13.403  13.002  -6.624  1.00 0.00 ? 70  GLN B HG3  3  
ATOM 9028  H HE21 . GLN B 1 70  ? 15.222  9.992   -6.564  1.00 0.00 ? 70  GLN B HE21 3  
ATOM 9029  H HE22 . GLN B 1 70  ? 15.433  9.937   -4.845  1.00 0.00 ? 70  GLN B HE22 3  
ATOM 9030  N N    . LEU B 1 71  ? 11.769  8.501   -6.186  1.00 0.00 ? 71  LEU B N    3  
ATOM 9031  C CA   . LEU B 1 71  ? 10.826  7.529   -5.667  1.00 0.00 ? 71  LEU B CA   3  
ATOM 9032  C C    . LEU B 1 71  ? 9.400   8.062   -5.860  1.00 0.00 ? 71  LEU B C    3  
ATOM 9033  O O    . LEU B 1 71  ? 9.095   8.611   -6.919  1.00 0.00 ? 71  LEU B O    3  
ATOM 9034  C CB   . LEU B 1 71  ? 11.150  7.225   -4.195  1.00 0.00 ? 71  LEU B CB   3  
ATOM 9035  C CG   . LEU B 1 71  ? 11.878  5.899   -3.932  1.00 0.00 ? 71  LEU B CG   3  
ATOM 9036  C CD1  . LEU B 1 71  ? 10.875  4.773   -3.737  1.00 0.00 ? 71  LEU B CD1  3  
ATOM 9037  C CD2  . LEU B 1 71  ? 12.843  5.565   -5.059  1.00 0.00 ? 71  LEU B CD2  3  
ATOM 9038  H H    . LEU B 1 71  ? 12.367  8.961   -5.564  1.00 0.00 ? 71  LEU B H    3  
ATOM 9039  H HA   . LEU B 1 71  ? 10.940  6.626   -6.246  1.00 0.00 ? 71  LEU B HA   3  
ATOM 9040  H HB2  . LEU B 1 71  ? 11.765  8.021   -3.822  1.00 0.00 ? 71  LEU B HB2  3  
ATOM 9041  H HB3  . LEU B 1 71  ? 10.237  7.216   -3.631  1.00 0.00 ? 71  LEU B HB3  3  
ATOM 9042  H HG   . LEU B 1 71  ? 12.450  5.992   -3.020  1.00 0.00 ? 71  LEU B HG   3  
ATOM 9043  H HD11 . LEU B 1 71  ? 10.802  4.191   -4.645  1.00 0.00 ? 71  LEU B HD11 3  
ATOM 9044  H HD12 . LEU B 1 71  ? 9.906   5.193   -3.498  1.00 0.00 ? 71  LEU B HD12 3  
ATOM 9045  H HD13 . LEU B 1 71  ? 11.204  4.134   -2.926  1.00 0.00 ? 71  LEU B HD13 3  
ATOM 9046  H HD21 . LEU B 1 71  ? 13.422  6.443   -5.310  1.00 0.00 ? 71  LEU B HD21 3  
ATOM 9047  H HD22 . LEU B 1 71  ? 12.287  5.238   -5.926  1.00 0.00 ? 71  LEU B HD22 3  
ATOM 9048  H HD23 . LEU B 1 71  ? 13.507  4.776   -4.740  1.00 0.00 ? 71  LEU B HD23 3  
ATOM 9049  N N    . ASP B 1 72  ? 8.527   7.926   -4.860  1.00 0.00 ? 72  ASP B N    3  
ATOM 9050  C CA   . ASP B 1 72  ? 7.157   8.426   -4.987  1.00 0.00 ? 72  ASP B CA   3  
ATOM 9051  C C    . ASP B 1 72  ? 6.289   7.991   -3.811  1.00 0.00 ? 72  ASP B C    3  
ATOM 9052  O O    . ASP B 1 72  ? 6.795   7.553   -2.777  1.00 0.00 ? 72  ASP B O    3  
ATOM 9053  C CB   . ASP B 1 72  ? 6.525   7.946   -6.299  1.00 0.00 ? 72  ASP B CB   3  
ATOM 9054  C CG   . ASP B 1 72  ? 5.966   9.089   -7.125  1.00 0.00 ? 72  ASP B CG   3  
ATOM 9055  O OD1  . ASP B 1 72  ? 6.486   10.218  -7.005  1.00 0.00 ? 72  ASP B OD1  3  
ATOM 9056  O OD2  . ASP B 1 72  ? 5.008   8.854   -7.891  1.00 0.00 ? 72  ASP B OD2  3  
ATOM 9057  H H    . ASP B 1 72  ? 8.805   7.495   -4.027  1.00 0.00 ? 72  ASP B H    3  
ATOM 9058  H HA   . ASP B 1 72  ? 7.203   9.505   -5.000  1.00 0.00 ? 72  ASP B HA   3  
ATOM 9059  H HB2  . ASP B 1 72  ? 7.270   7.436   -6.887  1.00 0.00 ? 72  ASP B HB2  3  
ATOM 9060  H HB3  . ASP B 1 72  ? 5.721   7.261   -6.076  1.00 0.00 ? 72  ASP B HB3  3  
ATOM 9061  N N    . PHE B 1 73  ? 4.976   8.123   -3.982  1.00 0.00 ? 73  PHE B N    3  
ATOM 9062  C CA   . PHE B 1 73  ? 4.023   7.754   -2.945  1.00 0.00 ? 73  PHE B CA   3  
ATOM 9063  C C    . PHE B 1 73  ? 3.750   6.253   -2.949  1.00 0.00 ? 73  PHE B C    3  
ATOM 9064  O O    . PHE B 1 73  ? 3.951   5.581   -1.937  1.00 0.00 ? 73  PHE B O    3  
ATOM 9065  C CB   . PHE B 1 73  ? 2.716   8.526   -3.121  1.00 0.00 ? 73  PHE B CB   3  
ATOM 9066  C CG   . PHE B 1 73  ? 2.033   8.280   -4.438  1.00 0.00 ? 73  PHE B CG   3  
ATOM 9067  C CD1  . PHE B 1 73  ? 2.413   8.978   -5.574  1.00 0.00 ? 73  PHE B CD1  3  
ATOM 9068  C CD2  . PHE B 1 73  ? 1.009   7.351   -4.539  1.00 0.00 ? 73  PHE B CD2  3  
ATOM 9069  C CE1  . PHE B 1 73  ? 1.786   8.753   -6.785  1.00 0.00 ? 73  PHE B CE1  3  
ATOM 9070  C CE2  . PHE B 1 73  ? 0.378   7.123   -5.748  1.00 0.00 ? 73  PHE B CE2  3  
ATOM 9071  C CZ   . PHE B 1 73  ? 0.767   7.825   -6.871  1.00 0.00 ? 73  PHE B CZ   3  
ATOM 9072  H H    . PHE B 1 73  ? 4.642   8.483   -4.829  1.00 0.00 ? 73  PHE B H    3  
ATOM 9073  H HA   . PHE B 1 73  ? 4.456   8.022   -1.993  1.00 0.00 ? 73  PHE B HA   3  
ATOM 9074  H HB2  . PHE B 1 73  ? 2.036   8.237   -2.337  1.00 0.00 ? 73  PHE B HB2  3  
ATOM 9075  H HB3  . PHE B 1 73  ? 2.919   9.584   -3.044  1.00 0.00 ? 73  PHE B HB3  3  
ATOM 9076  H HD1  . PHE B 1 73  ? 3.209   9.704   -5.507  1.00 0.00 ? 73  PHE B HD1  3  
ATOM 9077  H HD2  . PHE B 1 73  ? 0.704   6.801   -3.660  1.00 0.00 ? 73  PHE B HD2  3  
ATOM 9078  H HE1  . PHE B 1 73  ? 2.092   9.303   -7.662  1.00 0.00 ? 73  PHE B HE1  3  
ATOM 9079  H HE2  . PHE B 1 73  ? -0.417  6.396   -5.813  1.00 0.00 ? 73  PHE B HE2  3  
ATOM 9080  H HZ   . PHE B 1 73  ? 0.275   7.648   -7.816  1.00 0.00 ? 73  PHE B HZ   3  
ATOM 9081  N N    . GLN B 1 74  ? 3.298   5.721   -4.083  1.00 0.00 ? 74  GLN B N    3  
ATOM 9082  C CA   . GLN B 1 74  ? 3.018   4.297   -4.176  1.00 0.00 ? 74  GLN B CA   3  
ATOM 9083  C C    . GLN B 1 74  ? 4.301   3.521   -4.400  1.00 0.00 ? 74  GLN B C    3  
ATOM 9084  O O    . GLN B 1 74  ? 4.401   2.361   -4.012  1.00 0.00 ? 74  GLN B O    3  
ATOM 9085  C CB   . GLN B 1 74  ? 2.020   3.980   -5.292  1.00 0.00 ? 74  GLN B CB   3  
ATOM 9086  C CG   . GLN B 1 74  ? 1.731   2.486   -5.439  1.00 0.00 ? 74  GLN B CG   3  
ATOM 9087  C CD   . GLN B 1 74  ? 1.420   1.807   -4.112  1.00 0.00 ? 74  GLN B CD   3  
ATOM 9088  O OE1  . GLN B 1 74  ? 0.743   2.380   -3.258  1.00 0.00 ? 74  GLN B OE1  3  
ATOM 9089  N NE2  . GLN B 1 74  ? 1.910   0.577   -3.930  1.00 0.00 ? 74  GLN B NE2  3  
ATOM 9090  H H    . GLN B 1 74  ? 3.163   6.290   -4.867  1.00 0.00 ? 74  GLN B H    3  
ATOM 9091  H HA   . GLN B 1 74  ? 2.592   3.991   -3.232  1.00 0.00 ? 74  GLN B HA   3  
ATOM 9092  H HB2  . GLN B 1 74  ? 1.089   4.487   -5.083  1.00 0.00 ? 74  GLN B HB2  3  
ATOM 9093  H HB3  . GLN B 1 74  ? 2.417   4.342   -6.228  1.00 0.00 ? 74  GLN B HB3  3  
ATOM 9094  H HG2  . GLN B 1 74  ? 0.884   2.361   -6.096  1.00 0.00 ? 74  GLN B HG2  3  
ATOM 9095  H HG3  . GLN B 1 74  ? 2.596   2.009   -5.876  1.00 0.00 ? 74  GLN B HG3  3  
ATOM 9096  H HE21 . GLN B 1 74  ? 2.443   0.174   -4.650  1.00 0.00 ? 74  GLN B HE21 3  
ATOM 9097  H HE22 . GLN B 1 74  ? 1.719   0.122   -3.078  1.00 0.00 ? 74  GLN B HE22 3  
ATOM 9098  N N    . GLU B 1 75  ? 5.291   4.162   -5.024  1.00 0.00 ? 75  GLU B N    3  
ATOM 9099  C CA   . GLU B 1 75  ? 6.564   3.508   -5.280  1.00 0.00 ? 75  GLU B CA   3  
ATOM 9100  C C    . GLU B 1 75  ? 7.018   2.764   -4.035  1.00 0.00 ? 75  GLU B C    3  
ATOM 9101  O O    . GLU B 1 75  ? 7.571   1.668   -4.121  1.00 0.00 ? 75  GLU B O    3  
ATOM 9102  C CB   . GLU B 1 75  ? 7.624   4.523   -5.712  1.00 0.00 ? 75  GLU B CB   3  
ATOM 9103  C CG   . GLU B 1 75  ? 8.165   4.257   -7.104  1.00 0.00 ? 75  GLU B CG   3  
ATOM 9104  C CD   . GLU B 1 75  ? 8.405   5.527   -7.895  1.00 0.00 ? 75  GLU B CD   3  
ATOM 9105  O OE1  . GLU B 1 75  ? 7.462   5.993   -8.569  1.00 0.00 ? 75  GLU B OE1  3  
ATOM 9106  O OE2  . GLU B 1 75  ? 9.536   6.054   -7.845  1.00 0.00 ? 75  GLU B OE2  3  
ATOM 9107  H H    . GLU B 1 75  ? 5.161   5.088   -5.315  1.00 0.00 ? 75  GLU B H    3  
ATOM 9108  H HA   . GLU B 1 75  ? 6.415   2.793   -6.076  1.00 0.00 ? 75  GLU B HA   3  
ATOM 9109  H HB2  . GLU B 1 75  ? 7.189   5.512   -5.696  1.00 0.00 ? 75  GLU B HB2  3  
ATOM 9110  H HB3  . GLU B 1 75  ? 8.450   4.489   -5.015  1.00 0.00 ? 75  GLU B HB3  3  
ATOM 9111  H HG2  . GLU B 1 75  ? 9.099   3.722   -7.017  1.00 0.00 ? 75  GLU B HG2  3  
ATOM 9112  H HG3  . GLU B 1 75  ? 7.449   3.649   -7.636  1.00 0.00 ? 75  GLU B HG3  3  
ATOM 9113  N N    . PHE B 1 76  ? 6.745   3.351   -2.872  1.00 0.00 ? 76  PHE B N    3  
ATOM 9114  C CA   . PHE B 1 76  ? 7.097   2.712   -1.620  1.00 0.00 ? 76  PHE B CA   3  
ATOM 9115  C C    . PHE B 1 76  ? 6.063   1.661   -1.263  1.00 0.00 ? 76  PHE B C    3  
ATOM 9116  O O    . PHE B 1 76  ? 6.397   0.504   -1.040  1.00 0.00 ? 76  PHE B O    3  
ATOM 9117  C CB   . PHE B 1 76  ? 7.224   3.713   -0.477  1.00 0.00 ? 76  PHE B CB   3  
ATOM 9118  C CG   . PHE B 1 76  ? 8.076   3.188   0.649   1.00 0.00 ? 76  PHE B CG   3  
ATOM 9119  C CD1  . PHE B 1 76  ? 9.188   2.393   0.388   1.00 0.00 ? 76  PHE B CD1  3  
ATOM 9120  C CD2  . PHE B 1 76  ? 7.764   3.472   1.962   1.00 0.00 ? 76  PHE B CD2  3  
ATOM 9121  C CE1  . PHE B 1 76  ? 9.963   1.899   1.417   1.00 0.00 ? 76  PHE B CE1  3  
ATOM 9122  C CE2  . PHE B 1 76  ? 8.536   2.979   2.997   1.00 0.00 ? 76  PHE B CE2  3  
ATOM 9123  C CZ   . PHE B 1 76  ? 9.636   2.191   2.725   1.00 0.00 ? 76  PHE B CZ   3  
ATOM 9124  H H    . PHE B 1 76  ? 6.277   4.211   -2.862  1.00 0.00 ? 76  PHE B H    3  
ATOM 9125  H HA   . PHE B 1 76  ? 8.046   2.224   -1.765  1.00 0.00 ? 76  PHE B HA   3  
ATOM 9126  H HB2  . PHE B 1 76  ? 7.670   4.624   -0.847  1.00 0.00 ? 76  PHE B HB2  3  
ATOM 9127  H HB3  . PHE B 1 76  ? 6.234   3.927   -0.082  1.00 0.00 ? 76  PHE B HB3  3  
ATOM 9128  H HD1  . PHE B 1 76  ? 9.448   2.164   -0.634  1.00 0.00 ? 76  PHE B HD1  3  
ATOM 9129  H HD2  . PHE B 1 76  ? 6.904   4.085   2.179   1.00 0.00 ? 76  PHE B HD2  3  
ATOM 9130  H HE1  . PHE B 1 76  ? 10.823  1.282   1.199   1.00 0.00 ? 76  PHE B HE1  3  
ATOM 9131  H HE2  . PHE B 1 76  ? 8.283   3.210   4.017   1.00 0.00 ? 76  PHE B HE2  3  
ATOM 9132  H HZ   . PHE B 1 76  ? 10.239  1.806   3.533   1.00 0.00 ? 76  PHE B HZ   3  
ATOM 9133  N N    . LEU B 1 77  ? 4.796   2.068   -1.223  1.00 0.00 ? 77  LEU B N    3  
ATOM 9134  C CA   . LEU B 1 77  ? 3.720   1.143   -0.908  1.00 0.00 ? 77  LEU B CA   3  
ATOM 9135  C C    . LEU B 1 77  ? 3.844   -0.100  -1.781  1.00 0.00 ? 77  LEU B C    3  
ATOM 9136  O O    . LEU B 1 77  ? 3.571   -1.213  -1.341  1.00 0.00 ? 77  LEU B O    3  
ATOM 9137  C CB   . LEU B 1 77  ? 2.365   1.819   -1.099  1.00 0.00 ? 77  LEU B CB   3  
ATOM 9138  C CG   . LEU B 1 77  ? 1.787   2.433   0.174   1.00 0.00 ? 77  LEU B CG   3  
ATOM 9139  C CD1  . LEU B 1 77  ? 0.731   3.476   -0.153  1.00 0.00 ? 77  LEU B CD1  3  
ATOM 9140  C CD2  . LEU B 1 77  ? 1.219   1.341   1.060   1.00 0.00 ? 77  LEU B CD2  3  
ATOM 9141  H H    . LEU B 1 77  ? 4.582   3.004   -1.418  1.00 0.00 ? 77  LEU B H    3  
ATOM 9142  H HA   . LEU B 1 77  ? 3.828   0.851   0.127   1.00 0.00 ? 77  LEU B HA   3  
ATOM 9143  H HB2  . LEU B 1 77  ? 2.473   2.599   -1.838  1.00 0.00 ? 77  LEU B HB2  3  
ATOM 9144  H HB3  . LEU B 1 77  ? 1.665   1.087   -1.467  1.00 0.00 ? 77  LEU B HB3  3  
ATOM 9145  H HG   . LEU B 1 77  ? 2.580   2.925   0.718   1.00 0.00 ? 77  LEU B HG   3  
ATOM 9146  H HD11 . LEU B 1 77  ? 1.140   4.461   0.029   1.00 0.00 ? 77  LEU B HD11 3  
ATOM 9147  H HD12 . LEU B 1 77  ? -0.143  3.324   0.473   1.00 0.00 ? 77  LEU B HD12 3  
ATOM 9148  H HD13 . LEU B 1 77  ? 0.449   3.390   -1.191  1.00 0.00 ? 77  LEU B HD13 3  
ATOM 9149  H HD21 . LEU B 1 77  ? 0.989   0.478   0.458   1.00 0.00 ? 77  LEU B HD21 3  
ATOM 9150  H HD22 . LEU B 1 77  ? 0.321   1.697   1.544   1.00 0.00 ? 77  LEU B HD22 3  
ATOM 9151  H HD23 . LEU B 1 77  ? 1.950   1.073   1.807   1.00 0.00 ? 77  LEU B HD23 3  
ATOM 9152  N N    . ASN B 1 78  ? 4.304   0.105   -3.009  1.00 0.00 ? 78  ASN B N    3  
ATOM 9153  C CA   . ASN B 1 78  ? 4.527   -0.987  -3.940  1.00 0.00 ? 78  ASN B CA   3  
ATOM 9154  C C    . ASN B 1 78  ? 5.818   -1.695  -3.548  1.00 0.00 ? 78  ASN B C    3  
ATOM 9155  O O    . ASN B 1 78  ? 5.917   -2.920  -3.602  1.00 0.00 ? 78  ASN B O    3  
ATOM 9156  C CB   . ASN B 1 78  ? 4.592   -0.459  -5.385  1.00 0.00 ? 78  ASN B CB   3  
ATOM 9157  C CG   . ASN B 1 78  ? 5.716   -1.065  -6.205  1.00 0.00 ? 78  ASN B CG   3  
ATOM 9158  O OD1  . ASN B 1 78  ? 5.901   -2.283  -6.226  1.00 0.00 ? 78  ASN B OD1  3  
ATOM 9159  N ND2  . ASN B 1 78  ? 6.471   -0.214  -6.886  1.00 0.00 ? 78  ASN B ND2  3  
ATOM 9160  H H    . ASN B 1 78  ? 4.533   1.016   -3.284  1.00 0.00 ? 78  ASN B H    3  
ATOM 9161  H HA   . ASN B 1 78  ? 3.702   -1.681  -3.848  1.00 0.00 ? 78  ASN B HA   3  
ATOM 9162  H HB2  . ASN B 1 78  ? 3.660   -0.681  -5.881  1.00 0.00 ? 78  ASN B HB2  3  
ATOM 9163  H HB3  . ASN B 1 78  ? 4.730   0.612   -5.359  1.00 0.00 ? 78  ASN B HB3  3  
ATOM 9164  H HD21 . ASN B 1 78  ? 6.262   0.746   -6.820  1.00 0.00 ? 78  ASN B HD21 3  
ATOM 9165  H HD22 . ASN B 1 78  ? 7.205   -0.578  -7.427  1.00 0.00 ? 78  ASN B HD22 3  
ATOM 9166  N N    . LEU B 1 79  ? 6.798   -0.895  -3.134  1.00 0.00 ? 79  LEU B N    3  
ATOM 9167  C CA   . LEU B 1 79  ? 8.085   -1.416  -2.704  1.00 0.00 ? 79  LEU B CA   3  
ATOM 9168  C C    . LEU B 1 79  ? 7.901   -2.279  -1.459  1.00 0.00 ? 79  LEU B C    3  
ATOM 9169  O O    . LEU B 1 79  ? 8.229   -3.463  -1.463  1.00 0.00 ? 79  LEU B O    3  
ATOM 9170  C CB   . LEU B 1 79  ? 9.043   -0.257  -2.403  1.00 0.00 ? 79  LEU B CB   3  
ATOM 9171  C CG   . LEU B 1 79  ? 10.175  -0.041  -3.414  1.00 0.00 ? 79  LEU B CG   3  
ATOM 9172  C CD1  . LEU B 1 79  ? 9.637   0.058   -4.828  1.00 0.00 ? 79  LEU B CD1  3  
ATOM 9173  C CD2  . LEU B 1 79  ? 10.969  1.207   -3.067  1.00 0.00 ? 79  LEU B CD2  3  
ATOM 9174  H H    . LEU B 1 79  ? 6.645   0.073   -3.103  1.00 0.00 ? 79  LEU B H    3  
ATOM 9175  H HA   . LEU B 1 79  ? 8.486   -2.018  -3.502  1.00 0.00 ? 79  LEU B HA   3  
ATOM 9176  H HB2  . LEU B 1 79  ? 8.462   0.649   -2.355  1.00 0.00 ? 79  LEU B HB2  3  
ATOM 9177  H HB3  . LEU B 1 79  ? 9.487   -0.427  -1.434  1.00 0.00 ? 79  LEU B HB3  3  
ATOM 9178  H HG   . LEU B 1 79  ? 10.844  -0.882  -3.375  1.00 0.00 ? 79  LEU B HG   3  
ATOM 9179  H HD11 . LEU B 1 79  ? 9.724   1.082   -5.174  1.00 0.00 ? 79  LEU B HD11 3  
ATOM 9180  H HD12 . LEU B 1 79  ? 8.602   -0.245  -4.842  1.00 0.00 ? 79  LEU B HD12 3  
ATOM 9181  H HD13 . LEU B 1 79  ? 10.213  -0.591  -5.473  1.00 0.00 ? 79  LEU B HD13 3  
ATOM 9182  H HD21 . LEU B 1 79  ? 10.771  1.488   -2.044  1.00 0.00 ? 79  LEU B HD21 3  
ATOM 9183  H HD22 . LEU B 1 79  ? 10.677  2.014   -3.727  1.00 0.00 ? 79  LEU B HD22 3  
ATOM 9184  H HD23 . LEU B 1 79  ? 12.023  1.007   -3.189  1.00 0.00 ? 79  LEU B HD23 3  
ATOM 9185  N N    . ILE B 1 80  ? 7.345   -1.680  -0.403  1.00 0.00 ? 80  ILE B N    3  
ATOM 9186  C CA   . ILE B 1 80  ? 7.095   -2.403  0.835   1.00 0.00 ? 80  ILE B CA   3  
ATOM 9187  C C    . ILE B 1 80  ? 5.931   -3.365  0.654   1.00 0.00 ? 80  ILE B C    3  
ATOM 9188  O O    . ILE B 1 80  ? 5.990   -4.514  1.091   1.00 0.00 ? 80  ILE B O    3  
ATOM 9189  C CB   . ILE B 1 80  ? 6.823   -1.467  2.031   1.00 0.00 ? 80  ILE B CB   3  
ATOM 9190  C CG1  . ILE B 1 80  ? 6.962   -2.244  3.337   1.00 0.00 ? 80  ILE B CG1  3  
ATOM 9191  C CG2  . ILE B 1 80  ? 5.443   -0.851  1.942   1.00 0.00 ? 80  ILE B CG2  3  
ATOM 9192  C CD1  . ILE B 1 80  ? 5.726   -3.042  3.703   1.00 0.00 ? 80  ILE B CD1  3  
ATOM 9193  H H    . ILE B 1 80  ? 7.087   -0.740  -0.468  1.00 0.00 ? 80  ILE B H    3  
ATOM 9194  H HA   . ILE B 1 80  ? 7.972   -2.973  1.061   1.00 0.00 ? 80  ILE B HA   3  
ATOM 9195  H HB   . ILE B 1 80  ? 7.550   -0.672  2.014   1.00 0.00 ? 80  ILE B HB   3  
ATOM 9196  H HG12 . ILE B 1 80  ? 7.789   -2.934  3.251   1.00 0.00 ? 80  ILE B HG12 3  
ATOM 9197  H HG13 . ILE B 1 80  ? 7.160   -1.551  4.142   1.00 0.00 ? 80  ILE B HG13 3  
ATOM 9198  H HG21 . ILE B 1 80  ? 5.365   -0.274  1.036   1.00 0.00 ? 80  ILE B HG21 3  
ATOM 9199  H HG22 . ILE B 1 80  ? 5.282   -0.211  2.804   1.00 0.00 ? 80  ILE B HG22 3  
ATOM 9200  H HG23 . ILE B 1 80  ? 4.707   -1.644  1.935   1.00 0.00 ? 80  ILE B HG23 3  
ATOM 9201  H HD11 . ILE B 1 80  ? 6.011   -4.056  3.937   1.00 0.00 ? 80  ILE B HD11 3  
ATOM 9202  H HD12 . ILE B 1 80  ? 5.030   -3.046  2.871   1.00 0.00 ? 80  ILE B HD12 3  
ATOM 9203  H HD13 . ILE B 1 80  ? 5.254   -2.591  4.561   1.00 0.00 ? 80  ILE B HD13 3  
ATOM 9204  N N    . GLY B 1 81  ? 4.881   -2.899  -0.023  1.00 0.00 ? 81  GLY B N    3  
ATOM 9205  C CA   . GLY B 1 81  ? 3.738   -3.756  -0.276  1.00 0.00 ? 81  GLY B CA   3  
ATOM 9206  C C    . GLY B 1 81  ? 4.191   -5.044  -0.913  1.00 0.00 ? 81  GLY B C    3  
ATOM 9207  O O    . GLY B 1 81  ? 3.856   -6.132  -0.449  1.00 0.00 ? 81  GLY B O    3  
ATOM 9208  H H    . GLY B 1 81  ? 4.894   -1.983  -0.370  1.00 0.00 ? 81  GLY B H    3  
ATOM 9209  H HA2  . GLY B 1 81  ? 3.242   -3.973  0.660   1.00 0.00 ? 81  GLY B HA2  3  
ATOM 9210  H HA3  . GLY B 1 81  ? 3.051   -3.256  -0.939  1.00 0.00 ? 81  GLY B HA3  3  
ATOM 9211  N N    . GLY B 1 82  ? 4.996   -4.914  -1.965  1.00 0.00 ? 82  GLY B N    3  
ATOM 9212  C CA   . GLY B 1 82  ? 5.531   -6.089  -2.631  1.00 0.00 ? 82  GLY B CA   3  
ATOM 9213  C C    . GLY B 1 82  ? 6.184   -7.040  -1.641  1.00 0.00 ? 82  GLY B C    3  
ATOM 9214  O O    . GLY B 1 82  ? 6.019   -8.255  -1.741  1.00 0.00 ? 82  GLY B O    3  
ATOM 9215  H H    . GLY B 1 82  ? 5.244   -4.009  -2.276  1.00 0.00 ? 82  GLY B H    3  
ATOM 9216  H HA2  . GLY B 1 82  ? 4.725   -6.607  -3.136  1.00 0.00 ? 82  GLY B HA2  3  
ATOM 9217  H HA3  . GLY B 1 82  ? 6.265   -5.780  -3.360  1.00 0.00 ? 82  GLY B HA3  3  
ATOM 9218  N N    . LEU B 1 83  ? 6.912   -6.490  -0.666  1.00 0.00 ? 83  LEU B N    3  
ATOM 9219  C CA   . LEU B 1 83  ? 7.553   -7.321  0.350   1.00 0.00 ? 83  LEU B CA   3  
ATOM 9220  C C    . LEU B 1 83  ? 6.508   -8.119  1.117   1.00 0.00 ? 83  LEU B C    3  
ATOM 9221  O O    . LEU B 1 83  ? 6.673   -9.318  1.341   1.00 0.00 ? 83  LEU B O    3  
ATOM 9222  C CB   . LEU B 1 83  ? 8.358   -6.472  1.330   1.00 0.00 ? 83  LEU B CB   3  
ATOM 9223  C CG   . LEU B 1 83  ? 9.088   -5.287  0.713   1.00 0.00 ? 83  LEU B CG   3  
ATOM 9224  C CD1  . LEU B 1 83  ? 9.960   -4.607  1.754   1.00 0.00 ? 83  LEU B CD1  3  
ATOM 9225  C CD2  . LEU B 1 83  ? 9.922   -5.733  -0.478  1.00 0.00 ? 83  LEU B CD2  3  
ATOM 9226  H H    . LEU B 1 83  ? 7.010   -5.510  -0.621  1.00 0.00 ? 83  LEU B H    3  
ATOM 9227  H HA   . LEU B 1 83  ? 8.218   -8.008  -0.152  1.00 0.00 ? 83  LEU B HA   3  
ATOM 9228  H HB2  . LEU B 1 83  ? 7.683   -6.097  2.087   1.00 0.00 ? 83  LEU B HB2  3  
ATOM 9229  H HB3  . LEU B 1 83  ? 9.089   -7.107  1.807   1.00 0.00 ? 83  LEU B HB3  3  
ATOM 9230  H HG   . LEU B 1 83  ? 8.363   -4.570  0.366   1.00 0.00 ? 83  LEU B HG   3  
ATOM 9231  H HD11 . LEU B 1 83  ? 10.971  -4.975  1.671   1.00 0.00 ? 83  LEU B HD11 3  
ATOM 9232  H HD12 . LEU B 1 83  ? 9.578   -4.824  2.740   1.00 0.00 ? 83  LEU B HD12 3  
ATOM 9233  H HD13 . LEU B 1 83  ? 9.949   -3.540  1.591   1.00 0.00 ? 83  LEU B HD13 3  
ATOM 9234  H HD21 . LEU B 1 83  ? 10.955  -5.825  -0.180  1.00 0.00 ? 83  LEU B HD21 3  
ATOM 9235  H HD22 . LEU B 1 83  ? 9.836   -5.002  -1.267  1.00 0.00 ? 83  LEU B HD22 3  
ATOM 9236  H HD23 . LEU B 1 83  ? 9.564   -6.688  -0.834  1.00 0.00 ? 83  LEU B HD23 3  
ATOM 9237  N N    . ALA B 1 84  ? 5.426   -7.451  1.518   1.00 0.00 ? 84  ALA B N    3  
ATOM 9238  C CA   . ALA B 1 84  ? 4.358   -8.118  2.257   1.00 0.00 ? 84  ALA B CA   3  
ATOM 9239  C C    . ALA B 1 84  ? 3.837   -9.320  1.489   1.00 0.00 ? 84  ALA B C    3  
ATOM 9240  O O    . ALA B 1 84  ? 3.386   -10.305 2.073   1.00 0.00 ? 84  ALA B O    3  
ATOM 9241  C CB   . ALA B 1 84  ? 3.209   -7.164  2.513   1.00 0.00 ? 84  ALA B CB   3  
ATOM 9242  H H    . ALA B 1 84  ? 5.344   -6.488  1.311   1.00 0.00 ? 84  ALA B H    3  
ATOM 9243  H HA   . ALA B 1 84  ? 4.754   -8.442  3.207   1.00 0.00 ? 84  ALA B HA   3  
ATOM 9244  H HB1  . ALA B 1 84  ? 2.481   -7.262  1.715   1.00 0.00 ? 84  ALA B HB1  3  
ATOM 9245  H HB2  . ALA B 1 84  ? 3.580   -6.151  2.544   1.00 0.00 ? 84  ALA B HB2  3  
ATOM 9246  H HB3  . ALA B 1 84  ? 2.746   -7.410  3.456   1.00 0.00 ? 84  ALA B HB3  3  
ATOM 9247  N N    . VAL B 1 85  ? 3.898   -9.221  0.172   1.00 0.00 ? 85  VAL B N    3  
ATOM 9248  C CA   . VAL B 1 85  ? 3.429   -10.289 -0.696  1.00 0.00 ? 85  VAL B CA   3  
ATOM 9249  C C    . VAL B 1 85  ? 4.507   -11.337 -0.910  1.00 0.00 ? 85  VAL B C    3  
ATOM 9250  O O    . VAL B 1 85  ? 4.229   -12.457 -1.336  1.00 0.00 ? 85  VAL B O    3  
ATOM 9251  C CB   . VAL B 1 85  ? 2.926   -9.770  -2.069  1.00 0.00 ? 85  VAL B CB   3  
ATOM 9252  C CG1  . VAL B 1 85  ? 1.480   -10.168 -2.257  1.00 0.00 ? 85  VAL B CG1  3  
ATOM 9253  C CG2  . VAL B 1 85  ? 3.060   -8.258  -2.207  1.00 0.00 ? 85  VAL B CG2  3  
ATOM 9254  H H    . VAL B 1 85  ? 4.269   -8.408  -0.223  1.00 0.00 ? 85  VAL B H    3  
ATOM 9255  H HA   . VAL B 1 85  ? 2.604   -10.764 -0.198  1.00 0.00 ? 85  VAL B HA   3  
ATOM 9256  H HB   . VAL B 1 85  ? 3.514   -10.235 -2.848  1.00 0.00 ? 85  VAL B HB   3  
ATOM 9257  H HG11 . VAL B 1 85  ? 1.281   -11.072 -1.704  1.00 0.00 ? 85  VAL B HG11 3  
ATOM 9258  H HG12 . VAL B 1 85  ? 1.283   -10.333 -3.303  1.00 0.00 ? 85  VAL B HG12 3  
ATOM 9259  H HG13 . VAL B 1 85  ? 0.848   -9.374  -1.885  1.00 0.00 ? 85  VAL B HG13 3  
ATOM 9260  H HG21 . VAL B 1 85  ? 3.098   -7.996  -3.252  1.00 0.00 ? 85  VAL B HG21 3  
ATOM 9261  H HG22 . VAL B 1 85  ? 3.959   -7.926  -1.726  1.00 0.00 ? 85  VAL B HG22 3  
ATOM 9262  H HG23 . VAL B 1 85  ? 2.206   -7.778  -1.748  1.00 0.00 ? 85  VAL B HG23 3  
ATOM 9263  N N    . ALA B 1 86  ? 5.738   -10.965 -0.609  1.00 0.00 ? 86  ALA B N    3  
ATOM 9264  C CA   . ALA B 1 86  ? 6.864   -11.863 -0.763  1.00 0.00 ? 86  ALA B CA   3  
ATOM 9265  C C    . ALA B 1 86  ? 7.484   -12.207 0.588   1.00 0.00 ? 86  ALA B C    3  
ATOM 9266  O O    . ALA B 1 86  ? 8.582   -12.758 0.655   1.00 0.00 ? 86  ALA B O    3  
ATOM 9267  C CB   . ALA B 1 86  ? 7.883   -11.213 -1.667  1.00 0.00 ? 86  ALA B CB   3  
ATOM 9268  H H    . ALA B 1 86  ? 5.897   -10.060 -0.275  1.00 0.00 ? 86  ALA B H    3  
ATOM 9269  H HA   . ALA B 1 86  ? 6.516   -12.768 -1.237  1.00 0.00 ? 86  ALA B HA   3  
ATOM 9270  H HB1  . ALA B 1 86  ? 8.313   -11.956 -2.320  1.00 0.00 ? 86  ALA B HB1  3  
ATOM 9271  H HB2  . ALA B 1 86  ? 8.657   -10.761 -1.067  1.00 0.00 ? 86  ALA B HB2  3  
ATOM 9272  H HB3  . ALA B 1 86  ? 7.391   -10.452 -2.257  1.00 0.00 ? 86  ALA B HB3  3  
ATOM 9273  N N    . CYS B 1 87  ? 6.774   -11.875 1.663   1.00 0.00 ? 87  CYS B N    3  
ATOM 9274  C CA   . CYS B 1 87  ? 7.260   -12.145 3.009   1.00 0.00 ? 87  CYS B CA   3  
ATOM 9275  C C    . CYS B 1 87  ? 6.106   -12.332 3.993   1.00 0.00 ? 87  CYS B C    3  
ATOM 9276  O O    . CYS B 1 87  ? 6.187   -13.161 4.898   1.00 0.00 ? 87  CYS B O    3  
ATOM 9277  C CB   . CYS B 1 87  ? 8.167   -11.007 3.482   1.00 0.00 ? 87  CYS B CB   3  
ATOM 9278  S SG   . CYS B 1 87  ? 9.576   -11.551 4.477   1.00 0.00 ? 87  CYS B SG   3  
ATOM 9279  H H    . CYS B 1 87  ? 5.908   -11.436 1.547   1.00 0.00 ? 87  CYS B H    3  
ATOM 9280  H HA   . CYS B 1 87  ? 7.836   -13.057 2.975   1.00 0.00 ? 87  CYS B HA   3  
ATOM 9281  H HB2  . CYS B 1 87  ? 8.555   -10.485 2.621   1.00 0.00 ? 87  CYS B HB2  3  
ATOM 9282  H HB3  . CYS B 1 87  ? 7.587   -10.321 4.082   1.00 0.00 ? 87  CYS B HB3  3  
ATOM 9283  H HG   . CYS B 1 87  ? 10.061  -12.206 3.968   1.00 0.00 ? 87  CYS B HG   3  
ATOM 9284  N N    . HIS B 1 88  ? 5.036   -11.557 3.820   1.00 0.00 ? 88  HIS B N    3  
ATOM 9285  C CA   . HIS B 1 88  ? 3.884   -11.657 4.713   1.00 0.00 ? 88  HIS B CA   3  
ATOM 9286  C C    . HIS B 1 88  ? 2.880   -12.690 4.211   1.00 0.00 ? 88  HIS B C    3  
ATOM 9287  O O    . HIS B 1 88  ? 3.160   -13.439 3.277   1.00 0.00 ? 88  HIS B O    3  
ATOM 9288  C CB   . HIS B 1 88  ? 3.205   -10.295 4.872   1.00 0.00 ? 88  HIS B CB   3  
ATOM 9289  C CG   . HIS B 1 88  ? 3.348   -9.715  6.246   1.00 0.00 ? 88  HIS B CG   3  
ATOM 9290  N ND1  . HIS B 1 88  ? 4.299   -8.772  6.571   1.00 0.00 ? 88  HIS B ND1  3  
ATOM 9291  C CD2  . HIS B 1 88  ? 2.651   -9.949  7.384   1.00 0.00 ? 88  HIS B CD2  3  
ATOM 9292  C CE1  . HIS B 1 88  ? 4.182   -8.451  7.848   1.00 0.00 ? 88  HIS B CE1  3  
ATOM 9293  N NE2  . HIS B 1 88  ? 3.189   -9.151  8.363   1.00 0.00 ? 88  HIS B NE2  3  
ATOM 9294  H H    . HIS B 1 88  ? 5.022   -10.905 3.084   1.00 0.00 ? 88  HIS B H    3  
ATOM 9295  H HA   . HIS B 1 88  ? 4.249   -11.975 5.679   1.00 0.00 ? 88  HIS B HA   3  
ATOM 9296  H HB2  . HIS B 1 88  ? 3.640   -9.600  4.172   1.00 0.00 ? 88  HIS B HB2  3  
ATOM 9297  H HB3  . HIS B 1 88  ? 2.150   -10.397 4.662   1.00 0.00 ? 88  HIS B HB3  3  
ATOM 9298  H HD1  . HIS B 1 88  ? 4.964   -8.393  5.957   1.00 0.00 ? 88  HIS B HD1  3  
ATOM 9299  H HD2  . HIS B 1 88  ? 1.824   -10.637 7.499   1.00 0.00 ? 88  HIS B HD2  3  
ATOM 9300  H HE1  . HIS B 1 88  ? 4.793   -7.736  8.378   1.00 0.00 ? 88  HIS B HE1  3  
ATOM 9301  H HE2  . HIS B 1 88  ? 2.942   -9.167  9.311   1.00 0.00 ? 88  HIS B HE2  3  
ATOM 9302  N N    . GLU B 1 89  ? 1.713   -12.728 4.848   1.00 0.00 ? 89  GLU B N    3  
ATOM 9303  C CA   . GLU B 1 89  ? 0.668   -13.676 4.477   1.00 0.00 ? 89  GLU B CA   3  
ATOM 9304  C C    . GLU B 1 89  ? -0.213  -13.126 3.357   1.00 0.00 ? 89  GLU B C    3  
ATOM 9305  O O    . GLU B 1 89  ? -1.435  -13.062 3.489   1.00 0.00 ? 89  GLU B O    3  
ATOM 9306  C CB   . GLU B 1 89  ? -0.190  -14.019 5.696   1.00 0.00 ? 89  GLU B CB   3  
ATOM 9307  C CG   . GLU B 1 89  ? -0.869  -12.811 6.321   1.00 0.00 ? 89  GLU B CG   3  
ATOM 9308  C CD   . GLU B 1 89  ? -0.189  -12.355 7.597   1.00 0.00 ? 89  GLU B CD   3  
ATOM 9309  O OE1  . GLU B 1 89  ? 0.988   -12.718 7.805   1.00 0.00 ? 89  GLU B OE1  3  
ATOM 9310  O OE2  . GLU B 1 89  ? -0.833  -11.634 8.388   1.00 0.00 ? 89  GLU B OE2  3  
ATOM 9311  H H    . GLU B 1 89  ? 1.554   -12.108 5.590   1.00 0.00 ? 89  GLU B H    3  
ATOM 9312  H HA   . GLU B 1 89  ? 1.151   -14.576 4.127   1.00 0.00 ? 89  GLU B HA   3  
ATOM 9313  H HB2  . GLU B 1 89  ? -0.956  -14.720 5.398   1.00 0.00 ? 89  GLU B HB2  3  
ATOM 9314  H HB3  . GLU B 1 89  ? 0.436   -14.480 6.445   1.00 0.00 ? 89  GLU B HB3  3  
ATOM 9315  H HG2  . GLU B 1 89  ? -0.852  -11.997 5.612   1.00 0.00 ? 89  GLU B HG2  3  
ATOM 9316  H HG3  . GLU B 1 89  ? -1.894  -13.068 6.548   1.00 0.00 ? 89  GLU B HG3  3  
ATOM 9317  N N    . SER B 1 90  ? 0.414   -12.740 2.250   1.00 0.00 ? 90  SER B N    3  
ATOM 9318  C CA   . SER B 1 90  ? -0.318  -12.210 1.105   1.00 0.00 ? 90  SER B CA   3  
ATOM 9319  C C    . SER B 1 90  ? -0.126  -13.109 -0.111  1.00 0.00 ? 90  SER B C    3  
ATOM 9320  O O    . SER B 1 90  ? -1.089  -13.475 -0.786  1.00 0.00 ? 90  SER B O    3  
ATOM 9321  C CB   . SER B 1 90  ? 0.142   -10.786 0.786   1.00 0.00 ? 90  SER B CB   3  
ATOM 9322  O OG   . SER B 1 90  ? -0.712  -9.828  1.384   1.00 0.00 ? 90  SER B OG   3  
ATOM 9323  H H    . SER B 1 90  ? 1.389   -12.823 2.199   1.00 0.00 ? 90  SER B H    3  
ATOM 9324  H HA   . SER B 1 90  ? -1.367  -12.192 1.362   1.00 0.00 ? 90  SER B HA   3  
ATOM 9325  H HB2  . SER B 1 90  ? 1.144   -10.641 1.160   1.00 0.00 ? 90  SER B HB2  3  
ATOM 9326  H HB3  . SER B 1 90  ? 0.131   -10.640 -0.282  1.00 0.00 ? 90  SER B HB3  3  
ATOM 9327  H HG   . SER B 1 90  ? -0.666  -9.007  0.890   1.00 0.00 ? 90  SER B HG   3  
ATOM 9328  N N    . PHE B 1 91  ? 1.125   -13.473 -0.377  1.00 0.00 ? 91  PHE B N    3  
ATOM 9329  C CA   . PHE B 1 91  ? 1.448   -14.343 -1.501  1.00 0.00 ? 91  PHE B CA   3  
ATOM 9330  C C    . PHE B 1 91  ? 2.445   -15.416 -1.074  1.00 0.00 ? 91  PHE B C    3  
ATOM 9331  O O    . PHE B 1 91  ? 2.057   -16.545 -0.777  1.00 0.00 ? 91  PHE B O    3  
ATOM 9332  C CB   . PHE B 1 91  ? 2.011   -13.531 -2.671  1.00 0.00 ? 91  PHE B CB   3  
ATOM 9333  C CG   . PHE B 1 91  ? 1.057   -13.403 -3.824  1.00 0.00 ? 91  PHE B CG   3  
ATOM 9334  C CD1  . PHE B 1 91  ? -0.133  -12.708 -3.681  1.00 0.00 ? 91  PHE B CD1  3  
ATOM 9335  C CD2  . PHE B 1 91  ? 1.349   -13.979 -5.050  1.00 0.00 ? 91  PHE B CD2  3  
ATOM 9336  C CE1  . PHE B 1 91  ? -1.014  -12.591 -4.741  1.00 0.00 ? 91  PHE B CE1  3  
ATOM 9337  C CE2  . PHE B 1 91  ? 0.473   -13.863 -6.112  1.00 0.00 ? 91  PHE B CE2  3  
ATOM 9338  C CZ   . PHE B 1 91  ? -0.710  -13.168 -5.957  1.00 0.00 ? 91  PHE B CZ   3  
ATOM 9339  H H    . PHE B 1 91  ? 1.847   -13.156 0.205   1.00 0.00 ? 91  PHE B H    3  
ATOM 9340  H HA   . PHE B 1 91  ? 0.535   -14.825 -1.817  1.00 0.00 ? 91  PHE B HA   3  
ATOM 9341  H HB2  . PHE B 1 91  ? 2.254   -12.538 -2.329  1.00 0.00 ? 91  PHE B HB2  3  
ATOM 9342  H HB3  . PHE B 1 91  ? 2.909   -14.011 -3.035  1.00 0.00 ? 91  PHE B HB3  3  
ATOM 9343  H HD1  . PHE B 1 91  ? -0.372  -12.255 -2.730  1.00 0.00 ? 91  PHE B HD1  3  
ATOM 9344  H HD2  . PHE B 1 91  ? 2.275   -14.522 -5.172  1.00 0.00 ? 91  PHE B HD2  3  
ATOM 9345  H HE1  . PHE B 1 91  ? -1.939  -12.047 -4.616  1.00 0.00 ? 91  PHE B HE1  3  
ATOM 9346  H HE2  . PHE B 1 91  ? 0.714   -14.317 -7.062  1.00 0.00 ? 91  PHE B HE2  3  
ATOM 9347  H HZ   . PHE B 1 91  ? -1.397  -13.078 -6.786  1.00 0.00 ? 91  PHE B HZ   3  
ATOM 9348  N N    . VAL B 1 92  ? 3.730   -15.051 -1.040  1.00 0.00 ? 92  VAL B N    3  
ATOM 9349  C CA   . VAL B 1 92  ? 4.797   -15.970 -0.641  1.00 0.00 ? 92  VAL B CA   3  
ATOM 9350  C C    . VAL B 1 92  ? 4.660   -17.351 -1.289  1.00 0.00 ? 92  VAL B C    3  
ATOM 9351  O O    . VAL B 1 92  ? 5.239   -18.325 -0.811  1.00 0.00 ? 92  VAL B O    3  
ATOM 9352  C CB   . VAL B 1 92  ? 4.832   -16.126 0.889   1.00 0.00 ? 92  VAL B CB   3  
ATOM 9353  C CG1  . VAL B 1 92  ? 4.852   -14.762 1.561   1.00 0.00 ? 92  VAL B CG1  3  
ATOM 9354  C CG2  . VAL B 1 92  ? 3.646   -16.949 1.371   1.00 0.00 ? 92  VAL B CG2  3  
ATOM 9355  H H    . VAL B 1 92  ? 3.968   -14.135 -1.283  1.00 0.00 ? 92  VAL B H    3  
ATOM 9356  H HA   . VAL B 1 92  ? 5.737   -15.538 -0.952  1.00 0.00 ? 92  VAL B HA   3  
ATOM 9357  H HB   . VAL B 1 92  ? 5.738   -16.646 1.153   1.00 0.00 ? 92  VAL B HB   3  
ATOM 9358  H HG11 . VAL B 1 92  ? 4.738   -14.884 2.628   1.00 0.00 ? 92  VAL B HG11 3  
ATOM 9359  H HG12 . VAL B 1 92  ? 4.040   -14.160 1.180   1.00 0.00 ? 92  VAL B HG12 3  
ATOM 9360  H HG13 . VAL B 1 92  ? 5.791   -14.270 1.354   1.00 0.00 ? 92  VAL B HG13 3  
ATOM 9361  H HG21 . VAL B 1 92  ? 3.958   -17.592 2.180   1.00 0.00 ? 92  VAL B HG21 3  
ATOM 9362  H HG22 . VAL B 1 92  ? 3.273   -17.552 0.555   1.00 0.00 ? 92  VAL B HG22 3  
ATOM 9363  H HG23 . VAL B 1 92  ? 2.866   -16.288 1.715   1.00 0.00 ? 92  VAL B HG23 3  
ATOM 9364  N N    . LYS B 1 93  ? 3.886   -17.425 -2.362  1.00 0.00 ? 93  LYS B N    3  
ATOM 9365  C CA   . LYS B 1 93  ? 3.659   -18.679 -3.074  1.00 0.00 ? 93  LYS B CA   3  
ATOM 9366  C C    . LYS B 1 93  ? 2.982   -19.705 -2.165  1.00 0.00 ? 93  LYS B C    3  
ATOM 9367  O O    . LYS B 1 93  ? 3.072   -20.911 -2.396  1.00 0.00 ? 93  LYS B O    3  
ATOM 9368  C CB   . LYS B 1 93  ? 4.982   -19.222 -3.645  1.00 0.00 ? 93  LYS B CB   3  
ATOM 9369  C CG   . LYS B 1 93  ? 5.656   -20.299 -2.800  1.00 0.00 ? 93  LYS B CG   3  
ATOM 9370  C CD   . LYS B 1 93  ? 7.170   -20.239 -2.922  1.00 0.00 ? 93  LYS B CD   3  
ATOM 9371  C CE   . LYS B 1 93  ? 7.725   -18.919 -2.406  1.00 0.00 ? 93  LYS B CE   3  
ATOM 9372  N NZ   . LYS B 1 93  ? 8.455   -19.087 -1.119  1.00 0.00 ? 93  LYS B NZ   3  
ATOM 9373  H H    . LYS B 1 93  ? 3.448   -16.617 -2.680  1.00 0.00 ? 93  LYS B H    3  
ATOM 9374  H HA   . LYS B 1 93  ? 2.992   -18.465 -3.897  1.00 0.00 ? 93  LYS B HA   3  
ATOM 9375  H HB2  . LYS B 1 93  ? 4.788   -19.641 -4.621  1.00 0.00 ? 93  LYS B HB2  3  
ATOM 9376  H HB3  . LYS B 1 93  ? 5.673   -18.399 -3.753  1.00 0.00 ? 93  LYS B HB3  3  
ATOM 9377  H HG2  . LYS B 1 93  ? 5.381   -20.161 -1.767  1.00 0.00 ? 93  LYS B HG2  3  
ATOM 9378  H HG3  . LYS B 1 93  ? 5.316   -21.268 -3.136  1.00 0.00 ? 93  LYS B HG3  3  
ATOM 9379  H HD2  . LYS B 1 93  ? 7.600   -21.045 -2.346  1.00 0.00 ? 93  LYS B HD2  3  
ATOM 9380  H HD3  . LYS B 1 93  ? 7.443   -20.352 -3.960  1.00 0.00 ? 93  LYS B HD3  3  
ATOM 9381  H HE2  . LYS B 1 93  ? 8.404   -18.516 -3.143  1.00 0.00 ? 93  LYS B HE2  3  
ATOM 9382  H HE3  . LYS B 1 93  ? 6.907   -18.230 -2.259  1.00 0.00 ? 93  LYS B HE3  3  
ATOM 9383  H HZ1  . LYS B 1 93  ? 8.136   -19.951 -0.638  1.00 0.00 ? 93  LYS B HZ1  3  
ATOM 9384  H HZ2  . LYS B 1 93  ? 8.277   -18.272 -0.498  1.00 0.00 ? 93  LYS B HZ2  3  
ATOM 9385  H HZ3  . LYS B 1 93  ? 9.478   -19.157 -1.295  1.00 0.00 ? 93  LYS B HZ3  3  
ATOM 9386  N N    . ALA B 1 94  ? 2.300   -19.215 -1.131  1.00 0.00 ? 94  ALA B N    3  
ATOM 9387  C CA   . ALA B 1 94  ? 1.605   -20.085 -0.190  1.00 0.00 ? 94  ALA B CA   3  
ATOM 9388  C C    . ALA B 1 94  ? 2.545   -21.151 0.366   1.00 0.00 ? 94  ALA B C    3  
ATOM 9389  O O    . ALA B 1 94  ? 2.402   -22.338 0.068   1.00 0.00 ? 94  ALA B O    3  
ATOM 9390  C CB   . ALA B 1 94  ? 0.400   -20.730 -0.861  1.00 0.00 ? 94  ALA B CB   3  
ATOM 9391  H H    . ALA B 1 94  ? 2.260   -18.246 -1.002  1.00 0.00 ? 94  ALA B H    3  
ATOM 9392  H HA   . ALA B 1 94  ? 1.248   -19.474 0.627   1.00 0.00 ? 94  ALA B HA   3  
ATOM 9393  H HB1  . ALA B 1 94  ? -0.158  -21.296 -0.130  1.00 0.00 ? 94  ALA B HB1  3  
ATOM 9394  H HB2  . ALA B 1 94  ? 0.736   -21.388 -1.648  1.00 0.00 ? 94  ALA B HB2  3  
ATOM 9395  H HB3  . ALA B 1 94  ? -0.234  -19.959 -1.280  1.00 0.00 ? 94  ALA B HB3  3  
ATOM 9396  N N    . ALA B 1 95  ? 3.512   -20.717 1.169   1.00 0.00 ? 95  ALA B N    3  
ATOM 9397  C CA   . ALA B 1 95  ? 4.480   -21.631 1.761   1.00 0.00 ? 95  ALA B CA   3  
ATOM 9398  C C    . ALA B 1 95  ? 4.771   -21.274 3.220   1.00 0.00 ? 95  ALA B C    3  
ATOM 9399  O O    . ALA B 1 95  ? 5.921   -21.036 3.590   1.00 0.00 ? 95  ALA B O    3  
ATOM 9400  C CB   . ALA B 1 95  ? 5.764   -21.618 0.943   1.00 0.00 ? 95  ALA B CB   3  
ATOM 9401  H H    . ALA B 1 95  ? 3.577   -19.759 1.364   1.00 0.00 ? 95  ALA B H    3  
ATOM 9402  H HA   . ALA B 1 95  ? 4.067   -22.628 1.720   1.00 0.00 ? 95  ALA B HA   3  
ATOM 9403  H HB1  . ALA B 1 95  ? 6.614   -21.712 1.603   1.00 0.00 ? 95  ALA B HB1  3  
ATOM 9404  H HB2  . ALA B 1 95  ? 5.834   -20.687 0.397   1.00 0.00 ? 95  ALA B HB2  3  
ATOM 9405  H HB3  . ALA B 1 95  ? 5.756   -22.444 0.246   1.00 0.00 ? 95  ALA B HB3  3  
ATOM 9406  N N    . PRO B 1 96  ? 3.732   -21.229 4.076   1.00 0.00 ? 96  PRO B N    3  
ATOM 9407  C CA   . PRO B 1 96  ? 3.896   -20.896 5.496   1.00 0.00 ? 96  PRO B CA   3  
ATOM 9408  C C    . PRO B 1 96  ? 4.823   -21.870 6.227   1.00 0.00 ? 96  PRO B C    3  
ATOM 9409  O O    . PRO B 1 96  ? 5.723   -21.448 6.953   1.00 0.00 ? 96  PRO B O    3  
ATOM 9410  C CB   . PRO B 1 96  ? 2.471   -20.985 6.056   1.00 0.00 ? 96  PRO B CB   3  
ATOM 9411  C CG   . PRO B 1 96  ? 1.586   -20.836 4.870   1.00 0.00 ? 96  PRO B CG   3  
ATOM 9412  C CD   . PRO B 1 96  ? 2.321   -21.490 3.740   1.00 0.00 ? 96  PRO B CD   3  
ATOM 9413  H HA   . PRO B 1 96  ? 4.270   -19.891 5.621   1.00 0.00 ? 96  PRO B HA   3  
ATOM 9414  H HB2  . PRO B 1 96  ? 2.329   -21.941 6.534   1.00 0.00 ? 96  PRO B HB2  3  
ATOM 9415  H HB3  . PRO B 1 96  ? 2.312   -20.191 6.770   1.00 0.00 ? 96  PRO B HB3  3  
ATOM 9416  H HG2  . PRO B 1 96  ? 0.644   -21.335 5.048   1.00 0.00 ? 96  PRO B HG2  3  
ATOM 9417  H HG3  . PRO B 1 96  ? 1.425   -19.789 4.658   1.00 0.00 ? 96  PRO B HG3  3  
ATOM 9418  H HD2  . PRO B 1 96  ? 2.114   -22.549 3.722   1.00 0.00 ? 96  PRO B HD2  3  
ATOM 9419  H HD3  . PRO B 1 96  ? 2.053   -21.033 2.801   1.00 0.00 ? 96  PRO B HD3  3  
ATOM 9420  N N    . PRO B 1 97  ? 4.616   -23.191 6.056   1.00 0.00 ? 97  PRO B N    3  
ATOM 9421  C CA   . PRO B 1 97  ? 5.433   -24.210 6.709   1.00 0.00 ? 97  PRO B CA   3  
ATOM 9422  C C    . PRO B 1 97  ? 6.637   -24.628 5.871   1.00 0.00 ? 97  PRO B C    3  
ATOM 9423  O O    . PRO B 1 97  ? 7.098   -25.767 5.957   1.00 0.00 ? 97  PRO B O    3  
ATOM 9424  C CB   . PRO B 1 97  ? 4.449   -25.367 6.838   1.00 0.00 ? 97  PRO B CB   3  
ATOM 9425  C CG   . PRO B 1 97  ? 3.597   -25.266 5.616   1.00 0.00 ? 97  PRO B CG   3  
ATOM 9426  C CD   . PRO B 1 97  ? 3.565   -23.805 5.222   1.00 0.00 ? 97  PRO B CD   3  
ATOM 9427  H HA   . PRO B 1 97  ? 5.759   -23.897 7.689   1.00 0.00 ? 97  PRO B HA   3  
ATOM 9428  H HB2  . PRO B 1 97  ? 4.992   -26.301 6.870   1.00 0.00 ? 97  PRO B HB2  3  
ATOM 9429  H HB3  . PRO B 1 97  ? 3.865   -25.251 7.737   1.00 0.00 ? 97  PRO B HB3  3  
ATOM 9430  H HG2  . PRO B 1 97  ? 4.027   -25.857 4.820   1.00 0.00 ? 97  PRO B HG2  3  
ATOM 9431  H HG3  . PRO B 1 97  ? 2.598   -25.614 5.839   1.00 0.00 ? 97  PRO B HG3  3  
ATOM 9432  H HD2  . PRO B 1 97  ? 3.795   -23.694 4.173   1.00 0.00 ? 97  PRO B HD2  3  
ATOM 9433  H HD3  . PRO B 1 97  ? 2.598   -23.381 5.441   1.00 0.00 ? 97  PRO B HD3  3  
ATOM 9434  N N    . GLN B 1 98  ? 7.141   -23.709 5.055   1.00 0.00 ? 98  GLN B N    3  
ATOM 9435  C CA   . GLN B 1 98  ? 8.288   -23.993 4.202   1.00 0.00 ? 98  GLN B CA   3  
ATOM 9436  C C    . GLN B 1 98  ? 9.588   -23.524 4.851   1.00 0.00 ? 98  GLN B C    3  
ATOM 9437  O O    . GLN B 1 98  ? 10.659  -24.068 4.578   1.00 0.00 ? 98  GLN B O    3  
ATOM 9438  C CB   . GLN B 1 98  ? 8.113   -23.324 2.839   1.00 0.00 ? 98  GLN B CB   3  
ATOM 9439  C CG   . GLN B 1 98  ? 8.931   -23.972 1.733   1.00 0.00 ? 98  GLN B CG   3  
ATOM 9440  C CD   . GLN B 1 98  ? 9.924   -23.015 1.102   1.00 0.00 ? 98  GLN B CD   3  
ATOM 9441  O OE1  . GLN B 1 98  ? 10.883  -22.586 1.742   1.00 0.00 ? 98  GLN B OE1  3  
ATOM 9442  N NE2  . GLN B 1 98  ? 9.696   -22.675 -0.161  1.00 0.00 ? 98  GLN B NE2  3  
ATOM 9443  H H    . GLN B 1 98  ? 6.732   -22.819 5.025   1.00 0.00 ? 98  GLN B H    3  
ATOM 9444  H HA   . GLN B 1 98  ? 8.338   -25.063 4.063   1.00 0.00 ? 98  GLN B HA   3  
ATOM 9445  H HB2  . GLN B 1 98  ? 7.070   -23.370 2.560   1.00 0.00 ? 98  GLN B HB2  3  
ATOM 9446  H HB3  . GLN B 1 98  ? 8.409   -22.288 2.918   1.00 0.00 ? 98  GLN B HB3  3  
ATOM 9447  H HG2  . GLN B 1 98  ? 9.475   -24.807 2.148   1.00 0.00 ? 98  GLN B HG2  3  
ATOM 9448  H HG3  . GLN B 1 98  ? 8.259   -24.328 0.967   1.00 0.00 ? 98  GLN B HG3  3  
ATOM 9449  H HE21 . GLN B 1 98  ? 8.908   -23.058 -0.610  1.00 0.00 ? 98  GLN B HE21 3  
ATOM 9450  H HE22 . GLN B 1 98  ? 10.326  -22.054 -0.595  1.00 0.00 ? 98  GLN B HE22 3  
ATOM 9451  N N    . LYS B 1 99  ? 9.491   -22.511 5.706   1.00 0.00 ? 99  LYS B N    3  
ATOM 9452  C CA   . LYS B 1 99  ? 10.664  -21.972 6.387   1.00 0.00 ? 99  LYS B CA   3  
ATOM 9453  C C    . LYS B 1 99  ? 11.368  -23.053 7.205   1.00 0.00 ? 99  LYS B C    3  
ATOM 9454  O O    . LYS B 1 99  ? 12.575  -23.253 7.074   1.00 0.00 ? 99  LYS B O    3  
ATOM 9455  C CB   . LYS B 1 99  ? 10.267  -20.801 7.290   1.00 0.00 ? 99  LYS B CB   3  
ATOM 9456  C CG   . LYS B 1 99  ? 9.182   -21.144 8.299   1.00 0.00 ? 99  LYS B CG   3  
ATOM 9457  C CD   . LYS B 1 99  ? 8.589   -19.893 8.931   1.00 0.00 ? 99  LYS B CD   3  
ATOM 9458  C CE   . LYS B 1 99  ? 7.100   -19.774 8.649   1.00 0.00 ? 99  LYS B CE   3  
ATOM 9459  N NZ   . LYS B 1 99  ? 6.496   -18.598 9.333   1.00 0.00 ? 99  LYS B NZ   3  
ATOM 9460  H H    . LYS B 1 99  ? 8.612   -22.116 5.882   1.00 0.00 ? 99  LYS B H    3  
ATOM 9461  H HA   . LYS B 1 99  ? 11.346  -21.613 5.631   1.00 0.00 ? 99  LYS B HA   3  
ATOM 9462  H HB2  . LYS B 1 99  ? 11.139  -20.470 7.833   1.00 0.00 ? 99  LYS B HB2  3  
ATOM 9463  H HB3  . LYS B 1 99  ? 9.910   -19.991 6.672   1.00 0.00 ? 99  LYS B HB3  3  
ATOM 9464  H HG2  . LYS B 1 99  ? 8.396   -21.689 7.797   1.00 0.00 ? 99  LYS B HG2  3  
ATOM 9465  H HG3  . LYS B 1 99  ? 9.610   -21.761 9.076   1.00 0.00 ? 99  LYS B HG3  3  
ATOM 9466  H HD2  . LYS B 1 99  ? 8.740   -19.936 9.999   1.00 0.00 ? 99  LYS B HD2  3  
ATOM 9467  H HD3  . LYS B 1 99  ? 9.093   -19.025 8.530   1.00 0.00 ? 99  LYS B HD3  3  
ATOM 9468  H HE2  . LYS B 1 99  ? 6.955   -19.672 7.583   1.00 0.00 ? 99  LYS B HE2  3  
ATOM 9469  H HE3  . LYS B 1 99  ? 6.609   -20.672 8.993   1.00 0.00 ? 99  LYS B HE3  3  
ATOM 9470  H HZ1  . LYS B 1 99  ? 5.460   -18.638 9.265   1.00 0.00 ? 99  LYS B HZ1  3  
ATOM 9471  H HZ2  . LYS B 1 99  ? 6.829   -17.717 8.892   1.00 0.00 ? 99  LYS B HZ2  3  
ATOM 9472  H HZ3  . LYS B 1 99  ? 6.767   -18.592 10.338  1.00 0.00 ? 99  LYS B HZ3  3  
ATOM 9473  N N    . ARG B 1 100 ? 10.606  -23.747 8.047   1.00 0.00 ? 100 ARG B N    3  
ATOM 9474  C CA   . ARG B 1 100 ? 11.156  -24.811 8.886   1.00 0.00 ? 100 ARG B CA   3  
ATOM 9475  C C    . ARG B 1 100 ? 12.451  -24.371 9.565   1.00 0.00 ? 100 ARG B C    3  
ATOM 9476  O O    . ARG B 1 100 ? 13.328  -25.189 9.839   1.00 0.00 ? 100 ARG B O    3  
ATOM 9477  C CB   . ARG B 1 100 ? 11.407  -26.068 8.052   1.00 0.00 ? 100 ARG B CB   3  
ATOM 9478  C CG   . ARG B 1 100 ? 11.719  -27.301 8.887   1.00 0.00 ? 100 ARG B CG   3  
ATOM 9479  C CD   . ARG B 1 100 ? 10.517  -28.226 8.994   1.00 0.00 ? 100 ARG B CD   3  
ATOM 9480  N NE   . ARG B 1 100 ? 9.446   -27.642 9.802   1.00 0.00 ? 100 ARG B NE   3  
ATOM 9481  C CZ   . ARG B 1 100 ? 8.369   -27.043 9.296   1.00 0.00 ? 100 ARG B CZ   3  
ATOM 9482  N NH1  . ARG B 1 100 ? 8.202   -26.946 7.982   1.00 0.00 ? 100 ARG B NH1  3  
ATOM 9483  N NH2  . ARG B 1 100 ? 7.451   -26.540 10.110  1.00 0.00 ? 100 ARG B NH2  3  
ATOM 9484  H H    . ARG B 1 100 ? 9.650   -23.544 8.105   1.00 0.00 ? 100 ARG B H    3  
ATOM 9485  H HA   . ARG B 1 100 ? 10.426  -25.039 9.650   1.00 0.00 ? 100 ARG B HA   3  
ATOM 9486  H HB2  . ARG B 1 100 ? 10.530  -26.274 7.458   1.00 0.00 ? 100 ARG B HB2  3  
ATOM 9487  H HB3  . ARG B 1 100 ? 12.243  -25.887 7.393   1.00 0.00 ? 100 ARG B HB3  3  
ATOM 9488  H HG2  . ARG B 1 100 ? 12.533  -27.839 8.426   1.00 0.00 ? 100 ARG B HG2  3  
ATOM 9489  H HG3  . ARG B 1 100 ? 12.009  -26.987 9.880   1.00 0.00 ? 100 ARG B HG3  3  
ATOM 9490  H HD2  . ARG B 1 100 ? 10.143  -28.428 8.003   1.00 0.00 ? 100 ARG B HD2  3  
ATOM 9491  H HD3  . ARG B 1 100 ? 10.834  -29.152 9.452   1.00 0.00 ? 100 ARG B HD3  3  
ATOM 9492  H HE   . ARG B 1 100 ? 9.536   -27.699 10.776  1.00 0.00 ? 100 ARG B HE   3  
ATOM 9493  H HH11 . ARG B 1 100 ? 8.886   -27.323 7.360   1.00 0.00 ? 100 ARG B HH11 3  
ATOM 9494  H HH12 . ARG B 1 100 ? 7.389   -26.493 7.615   1.00 0.00 ? 100 ARG B HH12 3  
ATOM 9495  H HH22 . ARG B 1 100 ? 6.642   -26.089 9.733   1.00 0.00 ? 100 ARG B HH22 3  
ATOM 9496  N N    . PHE B 1 101 ? 12.565  -23.073 9.829   1.00 0.00 ? 101 PHE B N    3  
ATOM 9497  C CA   . PHE B 1 101 ? 13.755  -22.528 10.472  1.00 0.00 ? 101 PHE B CA   3  
ATOM 9498  C C    . PHE B 1 101 ? 13.426  -21.238 11.220  1.00 0.00 ? 101 PHE B C    3  
ATOM 9499  O O    . PHE B 1 101 ? 13.639  -21.198 12.450  1.00 0.00 ? 101 PHE B O    3  
ATOM 9500  C CB   . PHE B 1 101 ? 14.848  -22.268 9.433   1.00 0.00 ? 101 PHE B CB   3  
ATOM 9501  C CG   . PHE B 1 101 ? 16.064  -23.132 9.610   1.00 0.00 ? 101 PHE B CG   3  
ATOM 9502  C CD1  . PHE B 1 101 ? 16.075  -24.439 9.147   1.00 0.00 ? 101 PHE B CD1  3  
ATOM 9503  C CD2  . PHE B 1 101 ? 17.195  -22.639 10.240  1.00 0.00 ? 101 PHE B CD2  3  
ATOM 9504  C CE1  . PHE B 1 101 ? 17.192  -25.236 9.309   1.00 0.00 ? 101 PHE B CE1  3  
ATOM 9505  C CE2  . PHE B 1 101 ? 18.315  -23.432 10.405  1.00 0.00 ? 101 PHE B CE2  3  
ATOM 9506  C CZ   . PHE B 1 101 ? 18.314  -24.732 9.938   1.00 0.00 ? 101 PHE B CZ   3  
ATOM 9507  O OXT  . PHE B 1 101 ? 12.959  -20.280 10.569  1.00 0.00 ? 101 PHE B OXT  3  
ATOM 9508  H H    . PHE B 1 101 ? 11.834  -22.469 9.585   1.00 0.00 ? 101 PHE B H    3  
ATOM 9509  H HA   . PHE B 1 101 ? 14.113  -23.258 11.182  1.00 0.00 ? 101 PHE B HA   3  
ATOM 9510  H HB2  . PHE B 1 101 ? 14.449  -22.456 8.447   1.00 0.00 ? 101 PHE B HB2  3  
ATOM 9511  H HB3  . PHE B 1 101 ? 15.161  -21.235 9.496   1.00 0.00 ? 101 PHE B HB3  3  
ATOM 9512  H HD1  . PHE B 1 101 ? 15.199  -24.833 8.653   1.00 0.00 ? 101 PHE B HD1  3  
ATOM 9513  H HD2  . PHE B 1 101 ? 17.197  -21.622 10.605  1.00 0.00 ? 101 PHE B HD2  3  
ATOM 9514  H HE1  . PHE B 1 101 ? 17.188  -26.253 8.944   1.00 0.00 ? 101 PHE B HE1  3  
ATOM 9515  H HE2  . PHE B 1 101 ? 19.190  -23.034 10.897  1.00 0.00 ? 101 PHE B HE2  3  
ATOM 9516  H HZ   . PHE B 1 101 ? 19.187  -25.353 10.066  1.00 0.00 ? 101 PHE B HZ   3  
ATOM 9517  N N    . SER A 1 1   ? 10.528  -7.108  21.694  1.00 0.00 ? 1   SER A N    4  
ATOM 9518  C CA   . SER A 1 1   ? 11.865  -6.799  21.121  1.00 0.00 ? 1   SER A CA   4  
ATOM 9519  C C    . SER A 1 1   ? 12.238  -7.794  20.027  1.00 0.00 ? 1   SER A C    4  
ATOM 9520  O O    . SER A 1 1   ? 12.902  -8.798  20.288  1.00 0.00 ? 1   SER A O    4  
ATOM 9521  C CB   . SER A 1 1   ? 12.899  -6.838  22.247  1.00 0.00 ? 1   SER A CB   4  
ATOM 9522  O OG   . SER A 1 1   ? 13.156  -5.538  22.751  1.00 0.00 ? 1   SER A OG   4  
ATOM 9523  H H1   . SER A 1 1   ? 10.642  -7.907  22.349  1.00 0.00 ? 1   SER A H1   4  
ATOM 9524  H H2   . SER A 1 1   ? 9.895   -7.353  20.907  1.00 0.00 ? 1   SER A H2   4  
ATOM 9525  H H3   . SER A 1 1   ? 10.195  -6.259  22.194  1.00 0.00 ? 1   SER A H3   4  
ATOM 9526  H HA   . SER A 1 1   ? 11.837  -5.806  20.699  1.00 0.00 ? 1   SER A HA   4  
ATOM 9527  H HB2  . SER A 1 1   ? 12.529  -7.456  23.053  1.00 0.00 ? 1   SER A HB2  4  
ATOM 9528  H HB3  . SER A 1 1   ? 13.822  -7.255  21.870  1.00 0.00 ? 1   SER A HB3  4  
ATOM 9529  H HG   . SER A 1 1   ? 12.327  -5.065  22.854  1.00 0.00 ? 1   SER A HG   4  
ATOM 9530  N N    . ARG A 1 2   ? 11.807  -7.509  18.802  1.00 0.00 ? 2   ARG A N    4  
ATOM 9531  C CA   . ARG A 1 2   ? 12.097  -8.380  17.667  1.00 0.00 ? 2   ARG A CA   4  
ATOM 9532  C C    . ARG A 1 2   ? 11.484  -7.827  16.380  1.00 0.00 ? 2   ARG A C    4  
ATOM 9533  O O    . ARG A 1 2   ? 12.171  -7.695  15.368  1.00 0.00 ? 2   ARG A O    4  
ATOM 9534  C CB   . ARG A 1 2   ? 11.573  -9.795  17.930  1.00 0.00 ? 2   ARG A CB   4  
ATOM 9535  C CG   . ARG A 1 2   ? 12.550  -10.890 17.530  1.00 0.00 ? 2   ARG A CG   4  
ATOM 9536  C CD   . ARG A 1 2   ? 12.634  -11.035 16.019  1.00 0.00 ? 2   ARG A CD   4  
ATOM 9537  N NE   . ARG A 1 2   ? 11.351  -11.416 15.433  1.00 0.00 ? 2   ARG A NE   4  
ATOM 9538  C CZ   . ARG A 1 2   ? 11.183  -11.714 14.147  1.00 0.00 ? 2   ARG A CZ   4  
ATOM 9539  N NH1  . ARG A 1 2   ? 12.212  -11.679 13.310  1.00 0.00 ? 2   ARG A NH1  4  
ATOM 9540  N NH2  . ARG A 1 2   ? 9.982   -12.050 13.697  1.00 0.00 ? 2   ARG A NH2  4  
ATOM 9541  H H    . ARG A 1 2   ? 11.283  -6.694  18.658  1.00 0.00 ? 2   ARG A H    4  
ATOM 9542  H HA   . ARG A 1 2   ? 13.169  -8.420  17.550  1.00 0.00 ? 2   ARG A HA   4  
ATOM 9543  H HB2  . ARG A 1 2   ? 11.364  -9.897  18.986  1.00 0.00 ? 2   ARG A HB2  4  
ATOM 9544  H HB3  . ARG A 1 2   ? 10.658  -9.938  17.376  1.00 0.00 ? 2   ARG A HB3  4  
ATOM 9545  H HG2  . ARG A 1 2   ? 13.529  -10.643 17.913  1.00 0.00 ? 2   ARG A HG2  4  
ATOM 9546  H HG3  . ARG A 1 2   ? 12.219  -11.825 17.955  1.00 0.00 ? 2   ARG A HG3  4  
ATOM 9547  H HD2  . ARG A 1 2   ? 12.946  -10.091 15.596  1.00 0.00 ? 2   ARG A HD2  4  
ATOM 9548  H HD3  . ARG A 1 2   ? 13.366  -11.793 15.784  1.00 0.00 ? 2   ARG A HD3  4  
ATOM 9549  H HE   . ARG A 1 2   ? 10.574  -11.450 16.029  1.00 0.00 ? 2   ARG A HE   4  
ATOM 9550  H HH11 . ARG A 1 2   ? 13.121  -11.427 13.643  1.00 0.00 ? 2   ARG A HH11 4  
ATOM 9551  H HH12 . ARG A 1 2   ? 12.079  -11.905 12.344  1.00 0.00 ? 2   ARG A HH12 4  
ATOM 9552  H HH22 . ARG A 1 2   ? 9.855   -12.274 12.730  1.00 0.00 ? 2   ARG A HH22 4  
ATOM 9553  N N    . PRO A 1 3   ? 10.179  -7.499  16.401  1.00 0.00 ? 3   PRO A N    4  
ATOM 9554  C CA   . PRO A 1 3   ? 9.472   -6.961  15.235  1.00 0.00 ? 3   PRO A CA   4  
ATOM 9555  C C    . PRO A 1 3   ? 9.950   -5.549  14.876  1.00 0.00 ? 3   PRO A C    4  
ATOM 9556  O O    . PRO A 1 3   ? 11.153  -5.299  14.806  1.00 0.00 ? 3   PRO A O    4  
ATOM 9557  C CB   . PRO A 1 3   ? 7.997   -6.969  15.692  1.00 0.00 ? 3   PRO A CB   4  
ATOM 9558  C CG   . PRO A 1 3   ? 7.972   -7.877  16.867  1.00 0.00 ? 3   PRO A CG   4  
ATOM 9559  C CD   . PRO A 1 3   ? 9.274   -7.618  17.547  1.00 0.00 ? 3   PRO A CD   4  
ATOM 9560  H HA   . PRO A 1 3   ? 9.588   -7.606  14.375  1.00 0.00 ? 3   PRO A HA   4  
ATOM 9561  H HB2  . PRO A 1 3   ? 7.698   -5.972  15.973  1.00 0.00 ? 3   PRO A HB2  4  
ATOM 9562  H HB3  . PRO A 1 3   ? 7.367   -7.335  14.896  1.00 0.00 ? 3   PRO A HB3  4  
ATOM 9563  H HG2  . PRO A 1 3   ? 7.144   -7.629  17.515  1.00 0.00 ? 3   PRO A HG2  4  
ATOM 9564  H HG3  . PRO A 1 3   ? 7.913   -8.906  16.544  1.00 0.00 ? 3   PRO A HG3  4  
ATOM 9565  H HD2  . PRO A 1 3   ? 9.224   -6.690  18.098  1.00 0.00 ? 3   PRO A HD2  4  
ATOM 9566  H HD3  . PRO A 1 3   ? 9.550   -8.440  18.186  1.00 0.00 ? 3   PRO A HD3  4  
ATOM 9567  N N    . THR A 1 4   ? 9.012   -4.631  14.646  1.00 0.00 ? 4   THR A N    4  
ATOM 9568  C CA   . THR A 1 4   ? 9.353   -3.255  14.293  1.00 0.00 ? 4   THR A CA   4  
ATOM 9569  C C    . THR A 1 4   ? 8.105   -2.450  13.974  1.00 0.00 ? 4   THR A C    4  
ATOM 9570  O O    . THR A 1 4   ? 7.096   -2.986  13.517  1.00 0.00 ? 4   THR A O    4  
ATOM 9571  C CB   . THR A 1 4   ? 10.324  -3.224  13.107  1.00 0.00 ? 4   THR A CB   4  
ATOM 9572  O OG1  . THR A 1 4   ? 10.378  -1.929  12.534  1.00 0.00 ? 4   THR A OG1  4  
ATOM 9573  C CG2  . THR A 1 4   ? 9.966   -4.200  12.006  1.00 0.00 ? 4   THR A CG2  4  
ATOM 9574  H H    . THR A 1 4   ? 8.071   -4.883  14.715  1.00 0.00 ? 4   THR A H    4  
ATOM 9575  H HA   . THR A 1 4   ? 9.830   -2.796  15.146  1.00 0.00 ? 4   THR A HA   4  
ATOM 9576  H HB   . THR A 1 4   ? 11.314  -3.476  13.462  1.00 0.00 ? 4   THR A HB   4  
ATOM 9577  H HG1  . THR A 1 4   ? 9.598   -1.784  11.994  1.00 0.00 ? 4   THR A HG1  4  
ATOM 9578  H HG21 . THR A 1 4   ? 9.183   -3.780  11.393  1.00 0.00 ? 4   THR A HG21 4  
ATOM 9579  H HG22 . THR A 1 4   ? 9.625   -5.127  12.443  1.00 0.00 ? 4   THR A HG22 4  
ATOM 9580  H HG23 . THR A 1 4   ? 10.838  -4.390  11.396  1.00 0.00 ? 4   THR A HG23 4  
ATOM 9581  N N    . GLU A 1 5   ? 8.191   -1.155  14.232  1.00 0.00 ? 5   GLU A N    4  
ATOM 9582  C CA   . GLU A 1 5   ? 7.088   -0.236  13.995  1.00 0.00 ? 5   GLU A CA   4  
ATOM 9583  C C    . GLU A 1 5   ? 6.436   -0.485  12.637  1.00 0.00 ? 5   GLU A C    4  
ATOM 9584  O O    . GLU A 1 5   ? 5.215   -0.607  12.537  1.00 0.00 ? 5   GLU A O    4  
ATOM 9585  C CB   . GLU A 1 5   ? 7.613   1.190   14.084  1.00 0.00 ? 5   GLU A CB   4  
ATOM 9586  C CG   . GLU A 1 5   ? 6.694   2.136   14.839  1.00 0.00 ? 5   GLU A CG   4  
ATOM 9587  C CD   . GLU A 1 5   ? 5.818   2.959   13.916  1.00 0.00 ? 5   GLU A CD   4  
ATOM 9588  O OE1  . GLU A 1 5   ? 5.542   2.495   12.789  1.00 0.00 ? 5   GLU A OE1  4  
ATOM 9589  O OE2  . GLU A 1 5   ? 5.408   4.069   14.318  1.00 0.00 ? 5   GLU A OE2  4  
ATOM 9590  H H    . GLU A 1 5   ? 9.027   -0.801  14.602  1.00 0.00 ? 5   GLU A H    4  
ATOM 9591  H HA   . GLU A 1 5   ? 6.353   -0.389  14.770  1.00 0.00 ? 5   GLU A HA   4  
ATOM 9592  H HB2  . GLU A 1 5   ? 8.570   1.166   14.589  1.00 0.00 ? 5   GLU A HB2  4  
ATOM 9593  H HB3  . GLU A 1 5   ? 7.754   1.574   13.084  1.00 0.00 ? 5   GLU A HB3  4  
ATOM 9594  H HG2  . GLU A 1 5   ? 6.058   1.556   15.490  1.00 0.00 ? 5   GLU A HG2  4  
ATOM 9595  H HG3  . GLU A 1 5   ? 7.298   2.808   15.432  1.00 0.00 ? 5   GLU A HG3  4  
ATOM 9596  N N    . THR A 1 6   ? 7.257   -0.573  11.595  1.00 0.00 ? 6   THR A N    4  
ATOM 9597  C CA   . THR A 1 6   ? 6.754   -0.824  10.252  1.00 0.00 ? 6   THR A CA   4  
ATOM 9598  C C    . THR A 1 6   ? 6.099   -2.198  10.176  1.00 0.00 ? 6   THR A C    4  
ATOM 9599  O O    . THR A 1 6   ? 5.138   -2.395  9.436   1.00 0.00 ? 6   THR A O    4  
ATOM 9600  C CB   . THR A 1 6   ? 7.886   -0.730  9.232   1.00 0.00 ? 6   THR A CB   4  
ATOM 9601  O OG1  . THR A 1 6   ? 8.735   0.367   9.523   1.00 0.00 ? 6   THR A OG1  4  
ATOM 9602  C CG2  . THR A 1 6   ? 7.392   -0.567  7.813   1.00 0.00 ? 6   THR A CG2  4  
ATOM 9603  H H    . THR A 1 6   ? 8.220   -0.478  11.735  1.00 0.00 ? 6   THR A H    4  
ATOM 9604  H HA   . THR A 1 6   ? 6.012   -0.072  10.023  1.00 0.00 ? 6   THR A HA   4  
ATOM 9605  H HB   . THR A 1 6   ? 8.474   -1.635  9.276   1.00 0.00 ? 6   THR A HB   4  
ATOM 9606  H HG1  . THR A 1 6   ? 8.202   1.149   9.687   1.00 0.00 ? 6   THR A HG1  4  
ATOM 9607  H HG21 . THR A 1 6   ? 6.342   -0.317  7.828   1.00 0.00 ? 6   THR A HG21 4  
ATOM 9608  H HG22 . THR A 1 6   ? 7.534   -1.490  7.275   1.00 0.00 ? 6   THR A HG22 4  
ATOM 9609  H HG23 . THR A 1 6   ? 7.943   0.224   7.328   1.00 0.00 ? 6   THR A HG23 4  
ATOM 9610  N N    . GLU A 1 7   ? 6.621   -3.142  10.960  1.00 0.00 ? 7   GLU A N    4  
ATOM 9611  C CA   . GLU A 1 7   ? 6.083   -4.502  10.986  1.00 0.00 ? 7   GLU A CA   4  
ATOM 9612  C C    . GLU A 1 7   ? 4.581   -4.472  11.226  1.00 0.00 ? 7   GLU A C    4  
ATOM 9613  O O    . GLU A 1 7   ? 3.825   -5.222  10.605  1.00 0.00 ? 7   GLU A O    4  
ATOM 9614  C CB   . GLU A 1 7   ? 6.769   -5.327  12.078  1.00 0.00 ? 7   GLU A CB   4  
ATOM 9615  C CG   . GLU A 1 7   ? 7.184   -6.716  11.620  1.00 0.00 ? 7   GLU A CG   4  
ATOM 9616  C CD   . GLU A 1 7   ? 6.368   -7.815  12.272  1.00 0.00 ? 7   GLU A CD   4  
ATOM 9617  O OE1  . GLU A 1 7   ? 5.184   -7.570  12.584  1.00 0.00 ? 7   GLU A OE1  4  
ATOM 9618  O OE2  . GLU A 1 7   ? 6.914   -8.921  12.472  1.00 0.00 ? 7   GLU A OE2  4  
ATOM 9619  H H    . GLU A 1 7   ? 7.382   -2.918  11.532  1.00 0.00 ? 7   GLU A H    4  
ATOM 9620  H HA   . GLU A 1 7   ? 6.278   -4.957  10.028  1.00 0.00 ? 7   GLU A HA   4  
ATOM 9621  H HB2  . GLU A 1 7   ? 7.651   -4.802  12.409  1.00 0.00 ? 7   GLU A HB2  4  
ATOM 9622  H HB3  . GLU A 1 7   ? 6.091   -5.434  12.912  1.00 0.00 ? 7   GLU A HB3  4  
ATOM 9623  H HG2  . GLU A 1 7   ? 7.057   -6.782  10.550  1.00 0.00 ? 7   GLU A HG2  4  
ATOM 9624  H HG3  . GLU A 1 7   ? 8.225   -6.865  11.866  1.00 0.00 ? 7   GLU A HG3  4  
ATOM 9625  N N    . ARG A 1 8   ? 4.154   -3.591  12.119  1.00 0.00 ? 8   ARG A N    4  
ATOM 9626  C CA   . ARG A 1 8   ? 2.739   -3.449  12.431  1.00 0.00 ? 8   ARG A CA   4  
ATOM 9627  C C    . ARG A 1 8   ? 2.016   -2.718  11.301  1.00 0.00 ? 8   ARG A C    4  
ATOM 9628  O O    . ARG A 1 8   ? 0.817   -2.904  11.100  1.00 0.00 ? 8   ARG A O    4  
ATOM 9629  C CB   . ARG A 1 8   ? 2.560   -2.693  13.750  1.00 0.00 ? 8   ARG A CB   4  
ATOM 9630  C CG   . ARG A 1 8   ? 1.782   -3.473  14.795  1.00 0.00 ? 8   ARG A CG   4  
ATOM 9631  C CD   . ARG A 1 8   ? 2.691   -4.392  15.594  1.00 0.00 ? 8   ARG A CD   4  
ATOM 9632  N NE   . ARG A 1 8   ? 2.005   -5.612  16.012  1.00 0.00 ? 8   ARG A NE   4  
ATOM 9633  C CZ   . ARG A 1 8   ? 2.431   -6.404  16.994  1.00 0.00 ? 8   ARG A CZ   4  
ATOM 9634  N NH1  . ARG A 1 8   ? 3.541   -6.109  17.660  1.00 0.00 ? 8   ARG A NH1  4  
ATOM 9635  N NH2  . ARG A 1 8   ? 1.747   -7.495  17.310  1.00 0.00 ? 8   ARG A NH2  4  
ATOM 9636  H H    . ARG A 1 8   ? 4.805   -3.015  12.574  1.00 0.00 ? 8   ARG A H    4  
ATOM 9637  H HA   . ARG A 1 8   ? 2.320   -4.439  12.531  1.00 0.00 ? 8   ARG A HA   4  
ATOM 9638  H HB2  . ARG A 1 8   ? 3.534   -2.463  14.154  1.00 0.00 ? 8   ARG A HB2  4  
ATOM 9639  H HB3  . ARG A 1 8   ? 2.034   -1.770  13.556  1.00 0.00 ? 8   ARG A HB3  4  
ATOM 9640  H HG2  . ARG A 1 8   ? 1.307   -2.778  15.469  1.00 0.00 ? 8   ARG A HG2  4  
ATOM 9641  H HG3  . ARG A 1 8   ? 1.029   -4.069  14.299  1.00 0.00 ? 8   ARG A HG3  4  
ATOM 9642  H HD2  . ARG A 1 8   ? 3.539   -4.660  14.983  1.00 0.00 ? 8   ARG A HD2  4  
ATOM 9643  H HD3  . ARG A 1 8   ? 3.034   -3.865  16.472  1.00 0.00 ? 8   ARG A HD3  4  
ATOM 9644  H HE   . ARG A 1 8   ? 1.183   -5.855  15.537  1.00 0.00 ? 8   ARG A HE   4  
ATOM 9645  H HH11 . ARG A 1 8   ? 4.062   -5.288  17.427  1.00 0.00 ? 8   ARG A HH11 4  
ATOM 9646  H HH12 . ARG A 1 8   ? 3.855   -6.708  18.397  1.00 0.00 ? 8   ARG A HH12 4  
ATOM 9647  H HH22 . ARG A 1 8   ? 2.067   -8.089  18.048  1.00 0.00 ? 8   ARG A HH22 4  
ATOM 9648  N N    . CYS A 1 9   ? 2.756   -1.886  10.571  1.00 0.00 ? 9   CYS A N    4  
ATOM 9649  C CA   . CYS A 1 9   ? 2.194   -1.119  9.463   1.00 0.00 ? 9   CYS A CA   4  
ATOM 9650  C C    . CYS A 1 9   ? 1.794   -2.025  8.301   1.00 0.00 ? 9   CYS A C    4  
ATOM 9651  O O    . CYS A 1 9   ? 0.656   -1.982  7.835   1.00 0.00 ? 9   CYS A O    4  
ATOM 9652  C CB   . CYS A 1 9   ? 3.199   -0.071  8.981   1.00 0.00 ? 9   CYS A CB   4  
ATOM 9653  S SG   . CYS A 1 9   ? 3.647   1.153   10.233  1.00 0.00 ? 9   CYS A SG   4  
ATOM 9654  H H    . CYS A 1 9   ? 3.707   -1.781  10.786  1.00 0.00 ? 9   CYS A H    4  
ATOM 9655  H HA   . CYS A 1 9   ? 1.313   -0.614  9.823   1.00 0.00 ? 9   CYS A HA   4  
ATOM 9656  H HB2  . CYS A 1 9   ? 4.106   -0.569  8.671   1.00 0.00 ? 9   CYS A HB2  4  
ATOM 9657  H HB3  . CYS A 1 9   ? 2.780   0.457   8.138   1.00 0.00 ? 9   CYS A HB3  4  
ATOM 9658  H HG   . CYS A 1 9   ? 3.354   0.826   11.087  1.00 0.00 ? 9   CYS A HG   4  
ATOM 9659  N N    . ILE A 1 10  ? 2.734   -2.840  7.832   1.00 0.00 ? 10  ILE A N    4  
ATOM 9660  C CA   . ILE A 1 10  ? 2.472   -3.746  6.721   1.00 0.00 ? 10  ILE A CA   4  
ATOM 9661  C C    . ILE A 1 10  ? 1.207   -4.566  6.959   1.00 0.00 ? 10  ILE A C    4  
ATOM 9662  O O    . ILE A 1 10  ? 0.287   -4.555  6.145   1.00 0.00 ? 10  ILE A O    4  
ATOM 9663  C CB   . ILE A 1 10  ? 3.652   -4.716  6.494   1.00 0.00 ? 10  ILE A CB   4  
ATOM 9664  C CG1  . ILE A 1 10  ? 4.986   -3.968  6.530   1.00 0.00 ? 10  ILE A CG1  4  
ATOM 9665  C CG2  . ILE A 1 10  ? 3.489   -5.448  5.170   1.00 0.00 ? 10  ILE A CG2  4  
ATOM 9666  C CD1  . ILE A 1 10  ? 5.817   -4.281  7.748   1.00 0.00 ? 10  ILE A CD1  4  
ATOM 9667  H H    . ILE A 1 10  ? 3.624   -2.830  8.239   1.00 0.00 ? 10  ILE A H    4  
ATOM 9668  H HA   . ILE A 1 10  ? 2.340   -3.154  5.827   1.00 0.00 ? 10  ILE A HA   4  
ATOM 9669  H HB   . ILE A 1 10  ? 3.639   -5.451  7.284   1.00 0.00 ? 10  ILE A HB   4  
ATOM 9670  H HG12 . ILE A 1 10  ? 5.567   -4.240  5.663   1.00 0.00 ? 10  ILE A HG12 4  
ATOM 9671  H HG13 . ILE A 1 10  ? 4.799   -2.905  6.516   1.00 0.00 ? 10  ILE A HG13 4  
ATOM 9672  H HG21 . ILE A 1 10  ? 3.350   -6.502  5.358   1.00 0.00 ? 10  ILE A HG21 4  
ATOM 9673  H HG22 . ILE A 1 10  ? 4.375   -5.305  4.570   1.00 0.00 ? 10  ILE A HG22 4  
ATOM 9674  H HG23 . ILE A 1 10  ? 2.631   -5.058  4.645   1.00 0.00 ? 10  ILE A HG23 4  
ATOM 9675  H HD11 . ILE A 1 10  ? 6.420   -5.157  7.559   1.00 0.00 ? 10  ILE A HD11 4  
ATOM 9676  H HD12 . ILE A 1 10  ? 5.164   -4.466  8.587   1.00 0.00 ? 10  ILE A HD12 4  
ATOM 9677  H HD13 . ILE A 1 10  ? 6.460   -3.442  7.968   1.00 0.00 ? 10  ILE A HD13 4  
ATOM 9678  N N    . GLU A 1 11  ? 1.176   -5.281  8.077   1.00 0.00 ? 11  GLU A N    4  
ATOM 9679  C CA   . GLU A 1 11  ? 0.034   -6.120  8.423   1.00 0.00 ? 11  GLU A CA   4  
ATOM 9680  C C    . GLU A 1 11  ? -1.276  -5.335  8.403   1.00 0.00 ? 11  GLU A C    4  
ATOM 9681  O O    . GLU A 1 11  ? -2.343  -5.903  8.177   1.00 0.00 ? 11  GLU A O    4  
ATOM 9682  C CB   . GLU A 1 11  ? 0.242   -6.758  9.798   1.00 0.00 ? 11  GLU A CB   4  
ATOM 9683  C CG   . GLU A 1 11  ? 0.461   -8.262  9.738   1.00 0.00 ? 11  GLU A CG   4  
ATOM 9684  C CD   . GLU A 1 11  ? -0.034  -8.973  10.983  1.00 0.00 ? 11  GLU A CD   4  
ATOM 9685  O OE1  . GLU A 1 11  ? -0.035  -8.347  12.064  1.00 0.00 ? 11  GLU A OE1  4  
ATOM 9686  O OE2  . GLU A 1 11  ? -0.421  -10.156 10.877  1.00 0.00 ? 11  GLU A OE2  4  
ATOM 9687  H H    . GLU A 1 11  ? 1.946   -5.251  8.683   1.00 0.00 ? 11  GLU A H    4  
ATOM 9688  H HA   . GLU A 1 11  ? -0.029  -6.905  7.686   1.00 0.00 ? 11  GLU A HA   4  
ATOM 9689  H HB2  . GLU A 1 11  ? 1.105   -6.308  10.264  1.00 0.00 ? 11  GLU A HB2  4  
ATOM 9690  H HB3  . GLU A 1 11  ? -0.627  -6.567  10.410  1.00 0.00 ? 11  GLU A HB3  4  
ATOM 9691  H HG2  . GLU A 1 11  ? -0.068  -8.656  8.883   1.00 0.00 ? 11  GLU A HG2  4  
ATOM 9692  H HG3  . GLU A 1 11  ? 1.518   -8.453  9.628   1.00 0.00 ? 11  GLU A HG3  4  
ATOM 9693  N N    . SER A 1 12  ? -1.197  -4.033  8.655   1.00 0.00 ? 12  SER A N    4  
ATOM 9694  C CA   . SER A 1 12  ? -2.390  -3.195  8.676   1.00 0.00 ? 12  SER A CA   4  
ATOM 9695  C C    . SER A 1 12  ? -3.095  -3.174  7.322   1.00 0.00 ? 12  SER A C    4  
ATOM 9696  O O    . SER A 1 12  ? -4.285  -3.468  7.235   1.00 0.00 ? 12  SER A O    4  
ATOM 9697  C CB   . SER A 1 12  ? -2.034  -1.766  9.092   1.00 0.00 ? 12  SER A CB   4  
ATOM 9698  O OG   . SER A 1 12  ? -0.807  -1.727  9.796   1.00 0.00 ? 12  SER A OG   4  
ATOM 9699  H H    . SER A 1 12  ? -0.323  -3.631  8.840   1.00 0.00 ? 12  SER A H    4  
ATOM 9700  H HA   . SER A 1 12  ? -3.066  -3.608  9.409   1.00 0.00 ? 12  SER A HA   4  
ATOM 9701  H HB2  . SER A 1 12  ? -1.949  -1.148  8.211   1.00 0.00 ? 12  SER A HB2  4  
ATOM 9702  H HB3  . SER A 1 12  ? -2.813  -1.376  9.731   1.00 0.00 ? 12  SER A HB3  4  
ATOM 9703  H HG   . SER A 1 12  ? -0.947  -2.014  10.700  1.00 0.00 ? 12  SER A HG   4  
ATOM 9704  N N    . LEU A 1 13  ? -2.366  -2.804  6.272   1.00 0.00 ? 13  LEU A N    4  
ATOM 9705  C CA   . LEU A 1 13  ? -2.938  -2.720  4.936   1.00 0.00 ? 13  LEU A CA   4  
ATOM 9706  C C    . LEU A 1 13  ? -3.268  -4.090  4.345   1.00 0.00 ? 13  LEU A C    4  
ATOM 9707  O O    . LEU A 1 13  ? -4.357  -4.301  3.833   1.00 0.00 ? 13  LEU A O    4  
ATOM 9708  C CB   . LEU A 1 13  ? -1.977  -1.975  4.021   1.00 0.00 ? 13  LEU A CB   4  
ATOM 9709  C CG   . LEU A 1 13  ? -2.251  -0.481  3.896   1.00 0.00 ? 13  LEU A CG   4  
ATOM 9710  C CD1  . LEU A 1 13  ? -3.608  -0.241  3.264   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 9711  C CD2  . LEU A 1 13  ? -2.192  0.201   5.247   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 9712  H H    . LEU A 1 13  ? -1.425  -2.556  6.398   1.00 0.00 ? 13  LEU A H    4  
ATOM 9713  H HA   . LEU A 1 13  ? -3.852  -2.150  5.009   1.00 0.00 ? 13  LEU A HA   4  
ATOM 9714  H HB2  . LEU A 1 13  ? -0.975  -2.109  4.399   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 9715  H HB3  . LEU A 1 13  ? -2.035  -2.412  3.034   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 9716  H HG   . LEU A 1 13  ? -1.498  -0.042  3.269   1.00 0.00 ? 13  LEU A HG   4  
ATOM 9717  H HD11 . LEU A 1 13  ? -3.884  -1.099  2.670   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 9718  H HD12 . LEU A 1 13  ? -3.561  0.635   2.636   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 9719  H HD13 . LEU A 1 13  ? -4.345  -0.089  4.044   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 9720  H HD21 . LEU A 1 13  ? -2.383  -0.521  6.024   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 9721  H HD22 . LEU A 1 13  ? -2.945  0.976   5.280   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 9722  H HD23 . LEU A 1 13  ? -1.217  0.639   5.388   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 9723  N N    . ILE A 1 14  ? -2.330  -5.018  4.406   1.00 0.00 ? 14  ILE A N    4  
ATOM 9724  C CA   . ILE A 1 14  ? -2.548  -6.350  3.861   1.00 0.00 ? 14  ILE A CA   4  
ATOM 9725  C C    . ILE A 1 14  ? -3.845  -6.954  4.336   1.00 0.00 ? 14  ILE A C    4  
ATOM 9726  O O    . ILE A 1 14  ? -4.425  -7.802  3.676   1.00 0.00 ? 14  ILE A O    4  
ATOM 9727  C CB   . ILE A 1 14  ? -1.473  -7.337  4.315   1.00 0.00 ? 14  ILE A CB   4  
ATOM 9728  C CG1  . ILE A 1 14  ? -0.076  -6.756  4.227   1.00 0.00 ? 14  ILE A CG1  4  
ATOM 9729  C CG2  . ILE A 1 14  ? -1.570  -8.604  3.508   1.00 0.00 ? 14  ILE A CG2  4  
ATOM 9730  C CD1  . ILE A 1 14  ? 0.830   -7.351  5.266   1.00 0.00 ? 14  ILE A CD1  4  
ATOM 9731  H H    . ILE A 1 14  ? -1.478  -4.810  4.819   1.00 0.00 ? 14  ILE A H    4  
ATOM 9732  H HA   . ILE A 1 14  ? -2.538  -6.304  2.790   1.00 0.00 ? 14  ILE A HA   4  
ATOM 9733  H HB   . ILE A 1 14  ? -1.676  -7.591  5.345   1.00 0.00 ? 14  ILE A HB   4  
ATOM 9734  H HG12 . ILE A 1 14  ? 0.342   -6.961  3.253   1.00 0.00 ? 14  ILE A HG12 4  
ATOM 9735  H HG13 . ILE A 1 14  ? -0.117  -5.697  4.389   1.00 0.00 ? 14  ILE A HG13 4  
ATOM 9736  H HG21 . ILE A 1 14  ? -0.808  -8.602  2.747   1.00 0.00 ? 14  ILE A HG21 4  
ATOM 9737  H HG22 . ILE A 1 14  ? -2.546  -8.654  3.048   1.00 0.00 ? 14  ILE A HG22 4  
ATOM 9738  H HG23 . ILE A 1 14  ? -1.434  -9.451  4.160   1.00 0.00 ? 14  ILE A HG23 4  
ATOM 9739  H HD11 . ILE A 1 14  ? 1.418   -6.574  5.718   1.00 0.00 ? 14  ILE A HD11 4  
ATOM 9740  H HD12 . ILE A 1 14  ? 1.479   -8.077  4.804   1.00 0.00 ? 14  ILE A HD12 4  
ATOM 9741  H HD13 . ILE A 1 14  ? 0.224   -7.832  6.023   1.00 0.00 ? 14  ILE A HD13 4  
ATOM 9742  N N    . ALA A 1 15  ? -4.247  -6.558  5.516   1.00 0.00 ? 15  ALA A N    4  
ATOM 9743  C CA   . ALA A 1 15  ? -5.418  -7.117  6.139   1.00 0.00 ? 15  ALA A CA   4  
ATOM 9744  C C    . ALA A 1 15  ? -6.697  -6.416  5.724   1.00 0.00 ? 15  ALA A C    4  
ATOM 9745  O O    . ALA A 1 15  ? -7.743  -7.054  5.606   1.00 0.00 ? 15  ALA A O    4  
ATOM 9746  C CB   . ALA A 1 15  ? -5.196  -7.116  7.629   1.00 0.00 ? 15  ALA A CB   4  
ATOM 9747  H H    . ALA A 1 15  ? -3.718  -5.899  6.003   1.00 0.00 ? 15  ALA A H    4  
ATOM 9748  H HA   . ALA A 1 15  ? -5.486  -8.148  5.824   1.00 0.00 ? 15  ALA A HA   4  
ATOM 9749  H HB1  . ALA A 1 15  ? -4.123  -7.133  7.810   1.00 0.00 ? 15  ALA A HB1  4  
ATOM 9750  H HB2  . ALA A 1 15  ? -5.649  -7.997  8.057   1.00 0.00 ? 15  ALA A HB2  4  
ATOM 9751  H HB3  . ALA A 1 15  ? -5.625  -6.230  8.063   1.00 0.00 ? 15  ALA A HB3  4  
ATOM 9752  N N    . VAL A 1 16  ? -6.616  -5.121  5.445   1.00 0.00 ? 16  VAL A N    4  
ATOM 9753  C CA   . VAL A 1 16  ? -7.780  -4.398  4.980   1.00 0.00 ? 16  VAL A CA   4  
ATOM 9754  C C    . VAL A 1 16  ? -8.349  -5.143  3.776   1.00 0.00 ? 16  VAL A C    4  
ATOM 9755  O O    . VAL A 1 16  ? -9.560  -5.194  3.560   1.00 0.00 ? 16  VAL A O    4  
ATOM 9756  C CB   . VAL A 1 16  ? -7.411  -2.963  4.557   1.00 0.00 ? 16  VAL A CB   4  
ATOM 9757  C CG1  . VAL A 1 16  ? -6.692  -2.226  5.663   1.00 0.00 ? 16  VAL A CG1  4  
ATOM 9758  C CG2  . VAL A 1 16  ? -6.541  -2.993  3.326   1.00 0.00 ? 16  VAL A CG2  4  
ATOM 9759  H H    . VAL A 1 16  ? -5.758  -4.659  5.508   1.00 0.00 ? 16  VAL A H    4  
ATOM 9760  H HA   . VAL A 1 16  ? -8.514  -4.362  5.774   1.00 0.00 ? 16  VAL A HA   4  
ATOM 9761  H HB   . VAL A 1 16  ? -8.313  -2.434  4.323   1.00 0.00 ? 16  VAL A HB   4  
ATOM 9762  H HG11 . VAL A 1 16  ? -7.411  -1.827  6.360   1.00 0.00 ? 16  VAL A HG11 4  
ATOM 9763  H HG12 . VAL A 1 16  ? -6.113  -1.418  5.228   1.00 0.00 ? 16  VAL A HG12 4  
ATOM 9764  H HG13 . VAL A 1 16  ? -6.032  -2.909  6.169   1.00 0.00 ? 16  VAL A HG13 4  
ATOM 9765  H HG21 . VAL A 1 16  ? -5.966  -3.910  3.325   1.00 0.00 ? 16  VAL A HG21 4  
ATOM 9766  H HG22 . VAL A 1 16  ? -5.870  -2.148  3.337   1.00 0.00 ? 16  VAL A HG22 4  
ATOM 9767  H HG23 . VAL A 1 16  ? -7.162  -2.953  2.446   1.00 0.00 ? 16  VAL A HG23 4  
ATOM 9768  N N    . PHE A 1 17  ? -7.430  -5.739  3.012   1.00 0.00 ? 17  PHE A N    4  
ATOM 9769  C CA   . PHE A 1 17  ? -7.778  -6.518  1.827   1.00 0.00 ? 17  PHE A CA   4  
ATOM 9770  C C    . PHE A 1 17  ? -8.223  -7.924  2.215   1.00 0.00 ? 17  PHE A C    4  
ATOM 9771  O O    . PHE A 1 17  ? -9.318  -8.356  1.863   1.00 0.00 ? 17  PHE A O    4  
ATOM 9772  C CB   . PHE A 1 17  ? -6.587  -6.611  0.867   1.00 0.00 ? 17  PHE A CB   4  
ATOM 9773  C CG   . PHE A 1 17  ? -5.650  -5.438  0.932   1.00 0.00 ? 17  PHE A CG   4  
ATOM 9774  C CD1  . PHE A 1 17  ? -6.112  -4.153  0.709   1.00 0.00 ? 17  PHE A CD1  4  
ATOM 9775  C CD2  . PHE A 1 17  ? -4.307  -5.625  1.210   1.00 0.00 ? 17  PHE A CD2  4  
ATOM 9776  C CE1  . PHE A 1 17  ? -5.251  -3.073  0.761   1.00 0.00 ? 17  PHE A CE1  4  
ATOM 9777  C CE2  . PHE A 1 17  ? -3.441  -4.550  1.265   1.00 0.00 ? 17  PHE A CE2  4  
ATOM 9778  C CZ   . PHE A 1 17  ? -3.914  -3.272  1.040   1.00 0.00 ? 17  PHE A CZ   4  
ATOM 9779  H H    . PHE A 1 17  ? -6.483  -5.661  3.267   1.00 0.00 ? 17  PHE A H    4  
ATOM 9780  H HA   . PHE A 1 17  ? -8.595  -6.019  1.328   1.00 0.00 ? 17  PHE A HA   4  
ATOM 9781  H HB2  . PHE A 1 17  ? -6.019  -7.499  1.098   1.00 0.00 ? 17  PHE A HB2  4  
ATOM 9782  H HB3  . PHE A 1 17  ? -6.959  -6.683  -0.145  1.00 0.00 ? 17  PHE A HB3  4  
ATOM 9783  H HD1  . PHE A 1 17  ? -7.158  -3.997  0.494   1.00 0.00 ? 17  PHE A HD1  4  
ATOM 9784  H HD2  . PHE A 1 17  ? -3.936  -6.624  1.386   1.00 0.00 ? 17  PHE A HD2  4  
ATOM 9785  H HE1  . PHE A 1 17  ? -5.625  -2.075  0.585   1.00 0.00 ? 17  PHE A HE1  4  
ATOM 9786  H HE2  . PHE A 1 17  ? -2.395  -4.708  1.484   1.00 0.00 ? 17  PHE A HE2  4  
ATOM 9787  H HZ   . PHE A 1 17  ? -3.239  -2.430  1.080   1.00 0.00 ? 17  PHE A HZ   4  
ATOM 9788  N N    . GLN A 1 18  ? -7.357  -8.642  2.936   1.00 0.00 ? 18  GLN A N    4  
ATOM 9789  C CA   . GLN A 1 18  ? -7.661  -10.013 3.354   1.00 0.00 ? 18  GLN A CA   4  
ATOM 9790  C C    . GLN A 1 18  ? -9.046  -10.111 3.977   1.00 0.00 ? 18  GLN A C    4  
ATOM 9791  O O    . GLN A 1 18  ? -9.675  -11.168 3.942   1.00 0.00 ? 18  GLN A O    4  
ATOM 9792  C CB   . GLN A 1 18  ? -6.627  -10.519 4.359   1.00 0.00 ? 18  GLN A CB   4  
ATOM 9793  C CG   . GLN A 1 18  ? -5.196  -10.296 3.925   1.00 0.00 ? 18  GLN A CG   4  
ATOM 9794  C CD   . GLN A 1 18  ? -4.684  -11.397 3.025   1.00 0.00 ? 18  GLN A CD   4  
ATOM 9795  O OE1  . GLN A 1 18  ? -4.067  -12.359 3.482   1.00 0.00 ? 18  GLN A OE1  4  
ATOM 9796  N NE2  . GLN A 1 18  ? -4.941  -11.252 1.732   1.00 0.00 ? 18  GLN A NE2  4  
ATOM 9797  H H    . GLN A 1 18  ? -6.487  -8.249  3.175   1.00 0.00 ? 18  GLN A H    4  
ATOM 9798  H HA   . GLN A 1 18  ? -7.631  -10.641 2.476   1.00 0.00 ? 18  GLN A HA   4  
ATOM 9799  H HB2  . GLN A 1 18  ? -6.777  -10.010 5.299   1.00 0.00 ? 18  GLN A HB2  4  
ATOM 9800  H HB3  . GLN A 1 18  ? -6.775  -11.578 4.505   1.00 0.00 ? 18  GLN A HB3  4  
ATOM 9801  H HG2  . GLN A 1 18  ? -5.147  -9.371  3.382   1.00 0.00 ? 18  GLN A HG2  4  
ATOM 9802  H HG3  . GLN A 1 18  ? -4.569  -10.235 4.804   1.00 0.00 ? 18  GLN A HG3  4  
ATOM 9803  H HE21 . GLN A 1 18  ? -5.440  -10.454 1.444   1.00 0.00 ? 18  GLN A HE21 4  
ATOM 9804  H HE22 . GLN A 1 18  ? -4.624  -11.946 1.117   1.00 0.00 ? 18  GLN A HE22 4  
ATOM 9805  N N    . LYS A 1 19  ? -9.530  -9.010  4.535   1.00 0.00 ? 19  LYS A N    4  
ATOM 9806  C CA   . LYS A 1 19  ? -10.849 -9.004  5.140   1.00 0.00 ? 19  LYS A CA   4  
ATOM 9807  C C    . LYS A 1 19  ? -11.906 -9.281  4.076   1.00 0.00 ? 19  LYS A C    4  
ATOM 9808  O O    . LYS A 1 19  ? -12.745 -10.168 4.231   1.00 0.00 ? 19  LYS A O    4  
ATOM 9809  C CB   . LYS A 1 19  ? -11.116 -7.653  5.811   1.00 0.00 ? 19  LYS A CB   4  
ATOM 9810  C CG   . LYS A 1 19  ? -12.119 -7.721  6.951   1.00 0.00 ? 19  LYS A CG   4  
ATOM 9811  C CD   . LYS A 1 19  ? -11.719 -8.759  7.990   1.00 0.00 ? 19  LYS A CD   4  
ATOM 9812  C CE   . LYS A 1 19  ? -12.597 -9.997  7.907   1.00 0.00 ? 19  LYS A CE   4  
ATOM 9813  N NZ   . LYS A 1 19  ? -12.441 -10.869 9.103   1.00 0.00 ? 19  LYS A NZ   4  
ATOM 9814  H H    . LYS A 1 19  ? -8.994  -8.190  4.532   1.00 0.00 ? 19  LYS A H    4  
ATOM 9815  H HA   . LYS A 1 19  ? -10.883 -9.786  5.884   1.00 0.00 ? 19  LYS A HA   4  
ATOM 9816  H HB2  . LYS A 1 19  ? -10.185 -7.270  6.201   1.00 0.00 ? 19  LYS A HB2  4  
ATOM 9817  H HB3  . LYS A 1 19  ? -11.494 -6.966  5.069   1.00 0.00 ? 19  LYS A HB3  4  
ATOM 9818  H HG2  . LYS A 1 19  ? -12.169 -6.753  7.428   1.00 0.00 ? 19  LYS A HG2  4  
ATOM 9819  H HG3  . LYS A 1 19  ? -13.088 -7.978  6.550   1.00 0.00 ? 19  LYS A HG3  4  
ATOM 9820  H HD2  . LYS A 1 19  ? -10.692 -9.048  7.821   1.00 0.00 ? 19  LYS A HD2  4  
ATOM 9821  H HD3  . LYS A 1 19  ? -11.815 -8.324  8.974   1.00 0.00 ? 19  LYS A HD3  4  
ATOM 9822  H HE2  . LYS A 1 19  ? -13.629 -9.685  7.832   1.00 0.00 ? 19  LYS A HE2  4  
ATOM 9823  H HE3  . LYS A 1 19  ? -12.327 -10.556 7.024   1.00 0.00 ? 19  LYS A HE3  4  
ATOM 9824  H HZ1  . LYS A 1 19  ? -12.588 -11.865 8.840   1.00 0.00 ? 19  LYS A HZ1  4  
ATOM 9825  H HZ2  . LYS A 1 19  ? -13.137 -10.608 9.831   1.00 0.00 ? 19  LYS A HZ2  4  
ATOM 9826  H HZ3  . LYS A 1 19  ? -11.486 -10.764 9.501   1.00 0.00 ? 19  LYS A HZ3  4  
ATOM 9827  N N    . TYR A 1 20  ? -11.836 -8.530  2.980   1.00 0.00 ? 20  TYR A N    4  
ATOM 9828  C CA   . TYR A 1 20  ? -12.759 -8.702  1.865   1.00 0.00 ? 20  TYR A CA   4  
ATOM 9829  C C    . TYR A 1 20  ? -12.315 -9.874  1.005   1.00 0.00 ? 20  TYR A C    4  
ATOM 9830  O O    . TYR A 1 20  ? -13.096 -10.760 0.658   1.00 0.00 ? 20  TYR A O    4  
ATOM 9831  C CB   . TYR A 1 20  ? -12.826 -7.427  1.015   1.00 0.00 ? 20  TYR A CB   4  
ATOM 9832  C CG   . TYR A 1 20  ? -12.495 -6.155  1.770   1.00 0.00 ? 20  TYR A CG   4  
ATOM 9833  C CD1  . TYR A 1 20  ? -12.908 -5.973  3.084   1.00 0.00 ? 20  TYR A CD1  4  
ATOM 9834  C CD2  . TYR A 1 20  ? -11.770 -5.136  1.165   1.00 0.00 ? 20  TYR A CD2  4  
ATOM 9835  C CE1  . TYR A 1 20  ? -12.607 -4.813  3.773   1.00 0.00 ? 20  TYR A CE1  4  
ATOM 9836  C CE2  . TYR A 1 20  ? -11.465 -3.974  1.848   1.00 0.00 ? 20  TYR A CE2  4  
ATOM 9837  C CZ   . TYR A 1 20  ? -11.886 -3.817  3.151   1.00 0.00 ? 20  TYR A CZ   4  
ATOM 9838  O OH   . TYR A 1 20  ? -11.585 -2.660  3.833   1.00 0.00 ? 20  TYR A OH   4  
ATOM 9839  H H    . TYR A 1 20  ? -11.119 -7.864  2.903   1.00 0.00 ? 20  TYR A H    4  
ATOM 9840  H HA   . TYR A 1 20  ? -13.737 -8.912  2.269   1.00 0.00 ? 20  TYR A HA   4  
ATOM 9841  H HB2  . TYR A 1 20  ? -12.126 -7.514  0.197   1.00 0.00 ? 20  TYR A HB2  4  
ATOM 9842  H HB3  . TYR A 1 20  ? -13.824 -7.326  0.613   1.00 0.00 ? 20  TYR A HB3  4  
ATOM 9843  H HD1  . TYR A 1 20  ? -13.473 -6.755  3.570   1.00 0.00 ? 20  TYR A HD1  4  
ATOM 9844  H HD2  . TYR A 1 20  ? -11.441 -5.260  0.144   1.00 0.00 ? 20  TYR A HD2  4  
ATOM 9845  H HE1  . TYR A 1 20  ? -12.937 -4.691  4.794   1.00 0.00 ? 20  TYR A HE1  4  
ATOM 9846  H HE2  . TYR A 1 20  ? -10.900 -3.193  1.359   1.00 0.00 ? 20  TYR A HE2  4  
ATOM 9847  H HH   . TYR A 1 20  ? -12.334 -2.404  4.375   1.00 0.00 ? 20  TYR A HH   4  
ATOM 9848  N N    . ALA A 1 21  ? -11.039 -9.829  0.653   1.00 0.00 ? 21  ALA A N    4  
ATOM 9849  C CA   . ALA A 1 21  ? -10.402 -10.829 -0.189  1.00 0.00 ? 21  ALA A CA   4  
ATOM 9850  C C    . ALA A 1 21  ? -10.430 -12.217 0.444   1.00 0.00 ? 21  ALA A C    4  
ATOM 9851  O O    . ALA A 1 21  ? -10.863 -13.185 -0.182  1.00 0.00 ? 21  ALA A O    4  
ATOM 9852  C CB   . ALA A 1 21  ? -8.975  -10.374 -0.467  1.00 0.00 ? 21  ALA A CB   4  
ATOM 9853  H H    . ALA A 1 21  ? -10.499 -9.073  0.965   1.00 0.00 ? 21  ALA A H    4  
ATOM 9854  H HA   . ALA A 1 21  ? -10.931 -10.860 -1.130  1.00 0.00 ? 21  ALA A HA   4  
ATOM 9855  H HB1  . ALA A 1 21  ? -8.856  -10.166 -1.524  1.00 0.00 ? 21  ALA A HB1  4  
ATOM 9856  H HB2  . ALA A 1 21  ? -8.280  -11.145 -0.166  1.00 0.00 ? 21  ALA A HB2  4  
ATOM 9857  H HB3  . ALA A 1 21  ? -8.781  -9.470  0.101   1.00 0.00 ? 21  ALA A HB3  4  
ATOM 9858  N N    . GLY A 1 22  ? -9.969  -12.308 1.683   1.00 0.00 ? 22  GLY A N    4  
ATOM 9859  C CA   . GLY A 1 22  ? -9.952  -13.582 2.377   1.00 0.00 ? 22  GLY A CA   4  
ATOM 9860  C C    . GLY A 1 22  ? -11.334 -14.016 2.825   1.00 0.00 ? 22  GLY A C    4  
ATOM 9861  O O    . GLY A 1 22  ? -12.067 -14.651 2.068   1.00 0.00 ? 22  GLY A O    4  
ATOM 9862  H H    . GLY A 1 22  ? -9.637  -11.504 2.130   1.00 0.00 ? 22  GLY A H    4  
ATOM 9863  H HA2  . GLY A 1 22  ? -9.548  -14.335 1.717   1.00 0.00 ? 22  GLY A HA2  4  
ATOM 9864  H HA3  . GLY A 1 22  ? -9.315  -13.499 3.245   1.00 0.00 ? 22  GLY A HA3  4  
ATOM 9865  N N    . LYS A 1 23  ? -11.690 -13.670 4.059   1.00 0.00 ? 23  LYS A N    4  
ATOM 9866  C CA   . LYS A 1 23  ? -12.994 -14.024 4.613   1.00 0.00 ? 23  LYS A CA   4  
ATOM 9867  C C    . LYS A 1 23  ? -13.106 -15.531 4.829   1.00 0.00 ? 23  LYS A C    4  
ATOM 9868  O O    . LYS A 1 23  ? -13.155 -16.002 5.966   1.00 0.00 ? 23  LYS A O    4  
ATOM 9869  C CB   . LYS A 1 23  ? -14.118 -13.543 3.691   1.00 0.00 ? 23  LYS A CB   4  
ATOM 9870  C CG   . LYS A 1 23  ? -15.387 -13.158 4.430   1.00 0.00 ? 23  LYS A CG   4  
ATOM 9871  C CD   . LYS A 1 23  ? -16.581 -13.098 3.491   1.00 0.00 ? 23  LYS A CD   4  
ATOM 9872  C CE   . LYS A 1 23  ? -17.244 -14.458 3.347   1.00 0.00 ? 23  LYS A CE   4  
ATOM 9873  N NZ   . LYS A 1 23  ? -17.700 -14.708 1.952   1.00 0.00 ? 23  LYS A NZ   4  
ATOM 9874  H H    . LYS A 1 23  ? -11.060 -13.161 4.612   1.00 0.00 ? 23  LYS A H    4  
ATOM 9875  H HA   . LYS A 1 23  ? -13.091 -13.530 5.568   1.00 0.00 ? 23  LYS A HA   4  
ATOM 9876  H HB2  . LYS A 1 23  ? -13.771 -12.682 3.140   1.00 0.00 ? 23  LYS A HB2  4  
ATOM 9877  H HB3  . LYS A 1 23  ? -14.358 -14.332 2.993   1.00 0.00 ? 23  LYS A HB3  4  
ATOM 9878  H HG2  . LYS A 1 23  ? -15.583 -13.891 5.198   1.00 0.00 ? 23  LYS A HG2  4  
ATOM 9879  H HG3  . LYS A 1 23  ? -15.247 -12.186 4.883   1.00 0.00 ? 23  LYS A HG3  4  
ATOM 9880  H HD2  . LYS A 1 23  ? -17.303 -12.398 3.886   1.00 0.00 ? 23  LYS A HD2  4  
ATOM 9881  H HD3  . LYS A 1 23  ? -16.248 -12.765 2.520   1.00 0.00 ? 23  LYS A HD3  4  
ATOM 9882  H HE2  . LYS A 1 23  ? -16.534 -15.222 3.626   1.00 0.00 ? 23  LYS A HE2  4  
ATOM 9883  H HE3  . LYS A 1 23  ? -18.097 -14.502 4.008   1.00 0.00 ? 23  LYS A HE3  4  
ATOM 9884  H HZ1  . LYS A 1 23  ? -18.426 -15.453 1.940   1.00 0.00 ? 23  LYS A HZ1  4  
ATOM 9885  H HZ2  . LYS A 1 23  ? -16.900 -15.014 1.363   1.00 0.00 ? 23  LYS A HZ2  4  
ATOM 9886  H HZ3  . LYS A 1 23  ? -18.103 -13.839 1.546   1.00 0.00 ? 23  LYS A HZ3  4  
ATOM 9887  N N    . ASP A 1 24  ? -13.144 -16.281 3.733   1.00 0.00 ? 24  ASP A N    4  
ATOM 9888  C CA   . ASP A 1 24  ? -13.250 -17.733 3.805   1.00 0.00 ? 24  ASP A CA   4  
ATOM 9889  C C    . ASP A 1 24  ? -12.503 -18.388 2.647   1.00 0.00 ? 24  ASP A C    4  
ATOM 9890  O O    . ASP A 1 24  ? -12.643 -17.980 1.494   1.00 0.00 ? 24  ASP A O    4  
ATOM 9891  C CB   . ASP A 1 24  ? -14.719 -18.160 3.786   1.00 0.00 ? 24  ASP A CB   4  
ATOM 9892  C CG   . ASP A 1 24  ? -14.990 -19.338 4.701   1.00 0.00 ? 24  ASP A CG   4  
ATOM 9893  O OD1  . ASP A 1 24  ? -14.502 -20.448 4.401   1.00 0.00 ? 24  ASP A OD1  4  
ATOM 9894  O OD2  . ASP A 1 24  ? -15.691 -19.151 5.718   1.00 0.00 ? 24  ASP A OD2  4  
ATOM 9895  H H    . ASP A 1 24  ? -13.101 -15.847 2.856   1.00 0.00 ? 24  ASP A H    4  
ATOM 9896  H HA   . ASP A 1 24  ? -12.803 -18.053 4.733   1.00 0.00 ? 24  ASP A HA   4  
ATOM 9897  H HB2  . ASP A 1 24  ? -15.333 -17.332 4.106   1.00 0.00 ? 24  ASP A HB2  4  
ATOM 9898  H HB3  . ASP A 1 24  ? -14.994 -18.438 2.779   1.00 0.00 ? 24  ASP A HB3  4  
ATOM 9899  N N    . GLY A 1 25  ? -11.707 -19.405 2.962   1.00 0.00 ? 25  GLY A N    4  
ATOM 9900  C CA   . GLY A 1 25  ? -10.951 -20.098 1.936   1.00 0.00 ? 25  GLY A CA   4  
ATOM 9901  C C    . GLY A 1 25  ? -9.530  -19.581 1.814   1.00 0.00 ? 25  GLY A C    4  
ATOM 9902  O O    . GLY A 1 25  ? -8.626  -20.318 1.423   1.00 0.00 ? 25  GLY A O    4  
ATOM 9903  H H    . GLY A 1 25  ? -11.634 -19.687 3.897   1.00 0.00 ? 25  GLY A H    4  
ATOM 9904  H HA2  . GLY A 1 25  ? -10.920 -21.151 2.177   1.00 0.00 ? 25  GLY A HA2  4  
ATOM 9905  H HA3  . GLY A 1 25  ? -11.452 -19.972 0.987   1.00 0.00 ? 25  GLY A HA3  4  
ATOM 9906  N N    . HIS A 1 26  ? -9.335  -18.309 2.148   1.00 0.00 ? 26  HIS A N    4  
ATOM 9907  C CA   . HIS A 1 26  ? -8.015  -17.694 2.073   1.00 0.00 ? 26  HIS A CA   4  
ATOM 9908  C C    . HIS A 1 26  ? -7.484  -17.718 0.643   1.00 0.00 ? 26  HIS A C    4  
ATOM 9909  O O    . HIS A 1 26  ? -6.720  -18.609 0.269   1.00 0.00 ? 26  HIS A O    4  
ATOM 9910  C CB   . HIS A 1 26  ? -7.041  -18.412 3.011   1.00 0.00 ? 26  HIS A CB   4  
ATOM 9911  C CG   . HIS A 1 26  ? -6.502  -17.534 4.099   1.00 0.00 ? 26  HIS A CG   4  
ATOM 9912  N ND1  . HIS A 1 26  ? -5.888  -18.029 5.230   1.00 0.00 ? 26  HIS A ND1  4  
ATOM 9913  C CD2  . HIS A 1 26  ? -6.485  -16.186 4.223   1.00 0.00 ? 26  HIS A CD2  4  
ATOM 9914  C CE1  . HIS A 1 26  ? -5.519  -17.024 6.004   1.00 0.00 ? 26  HIS A CE1  4  
ATOM 9915  N NE2  . HIS A 1 26  ? -5.870  -15.895 5.416   1.00 0.00 ? 26  HIS A NE2  4  
ATOM 9916  H H    . HIS A 1 26  ? -10.096 -17.772 2.452   1.00 0.00 ? 26  HIS A H    4  
ATOM 9917  H HA   . HIS A 1 26  ? -8.112  -16.666 2.389   1.00 0.00 ? 26  HIS A HA   4  
ATOM 9918  H HB2  . HIS A 1 26  ? -7.548  -19.244 3.477   1.00 0.00 ? 26  HIS A HB2  4  
ATOM 9919  H HB3  . HIS A 1 26  ? -6.204  -18.783 2.437   1.00 0.00 ? 26  HIS A HB3  4  
ATOM 9920  H HD1  . HIS A 1 26  ? -5.745  -18.977 5.436   1.00 0.00 ? 26  HIS A HD1  4  
ATOM 9921  H HD2  . HIS A 1 26  ? -6.883  -15.472 3.516   1.00 0.00 ? 26  HIS A HD2  4  
ATOM 9922  H HE1  . HIS A 1 26  ? -5.016  -17.111 6.956   1.00 0.00 ? 26  HIS A HE1  4  
ATOM 9923  H HE2  . HIS A 1 26  ? -5.633  -14.998 5.730   1.00 0.00 ? 26  HIS A HE2  4  
ATOM 9924  N N    . SER A 1 27  ? -7.894  -16.736 -0.152  1.00 0.00 ? 27  SER A N    4  
ATOM 9925  C CA   . SER A 1 27  ? -7.460  -16.644 -1.542  1.00 0.00 ? 27  SER A CA   4  
ATOM 9926  C C    . SER A 1 27  ? -6.462  -15.507 -1.726  1.00 0.00 ? 27  SER A C    4  
ATOM 9927  O O    . SER A 1 27  ? -6.287  -14.671 -0.840  1.00 0.00 ? 27  SER A O    4  
ATOM 9928  C CB   . SER A 1 27  ? -8.665  -16.436 -2.461  1.00 0.00 ? 27  SER A CB   4  
ATOM 9929  O OG   . SER A 1 27  ? -9.848  -16.957 -1.879  1.00 0.00 ? 27  SER A OG   4  
ATOM 9930  H H    . SER A 1 27  ? -8.503  -16.056 0.204   1.00 0.00 ? 27  SER A H    4  
ATOM 9931  H HA   . SER A 1 27  ? -6.979  -17.576 -1.799  1.00 0.00 ? 27  SER A HA   4  
ATOM 9932  H HB2  . SER A 1 27  ? -8.802  -15.379 -2.637  1.00 0.00 ? 27  SER A HB2  4  
ATOM 9933  H HB3  . SER A 1 27  ? -8.489  -16.938 -3.401  1.00 0.00 ? 27  SER A HB3  4  
ATOM 9934  H HG   . SER A 1 27  ? -10.529 -16.281 -1.879  1.00 0.00 ? 27  SER A HG   4  
ATOM 9935  N N    . VAL A 1 28  ? -5.808  -15.481 -2.884  1.00 0.00 ? 28  VAL A N    4  
ATOM 9936  C CA   . VAL A 1 28  ? -4.826  -14.445 -3.183  1.00 0.00 ? 28  VAL A CA   4  
ATOM 9937  C C    . VAL A 1 28  ? -5.435  -13.335 -4.033  1.00 0.00 ? 28  VAL A C    4  
ATOM 9938  O O    . VAL A 1 28  ? -4.731  -12.655 -4.780  1.00 0.00 ? 28  VAL A O    4  
ATOM 9939  C CB   . VAL A 1 28  ? -3.605  -15.026 -3.922  1.00 0.00 ? 28  VAL A CB   4  
ATOM 9940  C CG1  . VAL A 1 28  ? -2.839  -15.983 -3.022  1.00 0.00 ? 28  VAL A CG1  4  
ATOM 9941  C CG2  . VAL A 1 28  ? -4.039  -15.721 -5.204  1.00 0.00 ? 28  VAL A CG2  4  
ATOM 9942  H H    . VAL A 1 28  ? -5.990  -16.175 -3.551  1.00 0.00 ? 28  VAL A H    4  
ATOM 9943  H HA   . VAL A 1 28  ? -4.487  -14.025 -2.248  1.00 0.00 ? 28  VAL A HA   4  
ATOM 9944  H HB   . VAL A 1 28  ? -2.947  -14.211 -4.185  1.00 0.00 ? 28  VAL A HB   4  
ATOM 9945  H HG11 . VAL A 1 28  ? -3.055  -15.754 -1.988  1.00 0.00 ? 28  VAL A HG11 4  
ATOM 9946  H HG12 . VAL A 1 28  ? -1.780  -15.875 -3.201  1.00 0.00 ? 28  VAL A HG12 4  
ATOM 9947  H HG13 . VAL A 1 28  ? -3.141  -16.998 -3.235  1.00 0.00 ? 28  VAL A HG13 4  
ATOM 9948  H HG21 . VAL A 1 28  ? -4.107  -16.784 -5.032  1.00 0.00 ? 28  VAL A HG21 4  
ATOM 9949  H HG22 . VAL A 1 28  ? -3.314  -15.527 -5.981  1.00 0.00 ? 28  VAL A HG22 4  
ATOM 9950  H HG23 . VAL A 1 28  ? -5.004  -15.343 -5.509  1.00 0.00 ? 28  VAL A HG23 4  
ATOM 9951  N N    . THR A 1 29  ? -6.747  -13.155 -3.917  1.00 0.00 ? 29  THR A N    4  
ATOM 9952  C CA   . THR A 1 29  ? -7.447  -12.127 -4.677  1.00 0.00 ? 29  THR A CA   4  
ATOM 9953  C C    . THR A 1 29  ? -8.654  -11.599 -3.907  1.00 0.00 ? 29  THR A C    4  
ATOM 9954  O O    . THR A 1 29  ? -8.907  -12.002 -2.772  1.00 0.00 ? 29  THR A O    4  
ATOM 9955  C CB   . THR A 1 29  ? -7.887  -12.677 -6.033  1.00 0.00 ? 29  THR A CB   4  
ATOM 9956  O OG1  . THR A 1 29  ? -8.437  -13.975 -5.894  1.00 0.00 ? 29  THR A OG1  4  
ATOM 9957  C CG2  . THR A 1 29  ? -6.759  -12.759 -7.038  1.00 0.00 ? 29  THR A CG2  4  
ATOM 9958  H H    . THR A 1 29  ? -7.257  -13.728 -3.308  1.00 0.00 ? 29  THR A H    4  
ATOM 9959  H HA   . THR A 1 29  ? -6.758  -11.311 -4.842  1.00 0.00 ? 29  THR A HA   4  
ATOM 9960  H HB   . THR A 1 29  ? -8.647  -12.028 -6.441  1.00 0.00 ? 29  THR A HB   4  
ATOM 9961  H HG1  . THR A 1 29  ? -9.053  -13.985 -5.157  1.00 0.00 ? 29  THR A HG1  4  
ATOM 9962  H HG21 . THR A 1 29  ? -6.443  -11.761 -7.309  1.00 0.00 ? 29  THR A HG21 4  
ATOM 9963  H HG22 . THR A 1 29  ? -7.100  -13.280 -7.921  1.00 0.00 ? 29  THR A HG22 4  
ATOM 9964  H HG23 . THR A 1 29  ? -5.928  -13.293 -6.602  1.00 0.00 ? 29  THR A HG23 4  
ATOM 9965  N N    . LEU A 1 30  ? -9.391  -10.691 -4.536  1.00 0.00 ? 30  LEU A N    4  
ATOM 9966  C CA   . LEU A 1 30  ? -10.573 -10.089 -3.925  1.00 0.00 ? 30  LEU A CA   4  
ATOM 9967  C C    . LEU A 1 30  ? -11.677 -9.904  -4.979  1.00 0.00 ? 30  LEU A C    4  
ATOM 9968  O O    . LEU A 1 30  ? -12.058 -10.862 -5.646  1.00 0.00 ? 30  LEU A O    4  
ATOM 9969  C CB   . LEU A 1 30  ? -10.186 -8.752  -3.275  1.00 0.00 ? 30  LEU A CB   4  
ATOM 9970  C CG   . LEU A 1 30  ? -11.051 -8.294  -2.095  1.00 0.00 ? 30  LEU A CG   4  
ATOM 9971  C CD1  . LEU A 1 30  ? -10.858 -6.811  -1.841  1.00 0.00 ? 30  LEU A CD1  4  
ATOM 9972  C CD2  . LEU A 1 30  ? -12.523 -8.613  -2.321  1.00 0.00 ? 30  LEU A CD2  4  
ATOM 9973  H H    . LEU A 1 30  ? -9.129  -10.413 -5.438  1.00 0.00 ? 30  LEU A H    4  
ATOM 9974  H HA   . LEU A 1 30  ? -10.931 -10.764 -3.161  1.00 0.00 ? 30  LEU A HA   4  
ATOM 9975  H HB2  . LEU A 1 30  ? -9.172  -8.842  -2.920  1.00 0.00 ? 30  LEU A HB2  4  
ATOM 9976  H HB3  . LEU A 1 30  ? -10.212 -7.984  -4.032  1.00 0.00 ? 30  LEU A HB3  4  
ATOM 9977  H HG   . LEU A 1 30  ? -10.731 -8.813  -1.212  1.00 0.00 ? 30  LEU A HG   4  
ATOM 9978  H HD11 . LEU A 1 30  ? -11.772 -6.391  -1.448  1.00 0.00 ? 30  LEU A HD11 4  
ATOM 9979  H HD12 . LEU A 1 30  ? -10.600 -6.317  -2.765  1.00 0.00 ? 30  LEU A HD12 4  
ATOM 9980  H HD13 . LEU A 1 30  ? -10.061 -6.675  -1.123  1.00 0.00 ? 30  LEU A HD13 4  
ATOM 9981  H HD21 . LEU A 1 30  ? -12.936 -7.923  -3.041  1.00 0.00 ? 30  LEU A HD21 4  
ATOM 9982  H HD22 . LEU A 1 30  ? -13.057 -8.519  -1.386  1.00 0.00 ? 30  LEU A HD22 4  
ATOM 9983  H HD23 . LEU A 1 30  ? -12.621 -9.622  -2.689  1.00 0.00 ? 30  LEU A HD23 4  
ATOM 9984  N N    . SER A 1 31  ? -12.183 -8.680  -5.136  1.00 0.00 ? 31  SER A N    4  
ATOM 9985  C CA   . SER A 1 31  ? -13.221 -8.402  -6.115  1.00 0.00 ? 31  SER A CA   4  
ATOM 9986  C C    . SER A 1 31  ? -13.454 -6.899  -6.222  1.00 0.00 ? 31  SER A C    4  
ATOM 9987  O O    . SER A 1 31  ? -13.654 -6.221  -5.215  1.00 0.00 ? 31  SER A O    4  
ATOM 9988  C CB   . SER A 1 31  ? -14.518 -9.125  -5.738  1.00 0.00 ? 31  SER A CB   4  
ATOM 9989  O OG   . SER A 1 31  ? -15.640 -8.259  -5.811  1.00 0.00 ? 31  SER A OG   4  
ATOM 9990  H H    . SER A 1 31  ? -11.849 -7.946  -4.589  1.00 0.00 ? 31  SER A H    4  
ATOM 9991  H HA   . SER A 1 31  ? -12.880 -8.769  -7.072  1.00 0.00 ? 31  SER A HA   4  
ATOM 9992  H HB2  . SER A 1 31  ? -14.675 -9.950  -6.415  1.00 0.00 ? 31  SER A HB2  4  
ATOM 9993  H HB3  . SER A 1 31  ? -14.434 -9.501  -4.730  1.00 0.00 ? 31  SER A HB3  4  
ATOM 9994  H HG   . SER A 1 31  ? -16.013 -8.294  -6.695  1.00 0.00 ? 31  SER A HG   4  
ATOM 9995  N N    . LYS A 1 32  ? -13.420 -6.384  -7.445  1.00 0.00 ? 32  LYS A N    4  
ATOM 9996  C CA   . LYS A 1 32  ? -13.622 -4.959  -7.681  1.00 0.00 ? 32  LYS A CA   4  
ATOM 9997  C C    . LYS A 1 32  ? -14.873 -4.461  -6.962  1.00 0.00 ? 32  LYS A C    4  
ATOM 9998  O O    . LYS A 1 32  ? -14.878 -3.376  -6.381  1.00 0.00 ? 32  LYS A O    4  
ATOM 9999  C CB   . LYS A 1 32  ? -13.745 -4.689  -9.182  1.00 0.00 ? 32  LYS A CB   4  
ATOM 10000 C CG   . LYS A 1 32  ? -12.563 -5.199  -9.990  1.00 0.00 ? 32  LYS A CG   4  
ATOM 10001 C CD   . LYS A 1 32  ? -12.611 -4.697  -11.425 1.00 0.00 ? 32  LYS A CD   4  
ATOM 10002 C CE   . LYS A 1 32  ? -13.246 -5.720  -12.352 1.00 0.00 ? 32  LYS A CE   4  
ATOM 10003 N NZ   . LYS A 1 32  ? -12.359 -6.896  -12.573 1.00 0.00 ? 32  LYS A NZ   4  
ATOM 10004 H H    . LYS A 1 32  ? -13.253 -6.976  -8.208  1.00 0.00 ? 32  LYS A H    4  
ATOM 10005 H HA   . LYS A 1 32  ? -12.760 -4.431  -7.296  1.00 0.00 ? 32  LYS A HA   4  
ATOM 10006 H HB2  . LYS A 1 32  ? -14.639 -5.171  -9.550  1.00 0.00 ? 32  LYS A HB2  4  
ATOM 10007 H HB3  . LYS A 1 32  ? -13.830 -3.624  -9.340  1.00 0.00 ? 32  LYS A HB3  4  
ATOM 10008 H HG2  . LYS A 1 32  ? -11.649 -4.855  -9.530  1.00 0.00 ? 32  LYS A HG2  4  
ATOM 10009 H HG3  . LYS A 1 32  ? -12.582 -6.279  -9.995  1.00 0.00 ? 32  LYS A HG3  4  
ATOM 10010 H HD2  . LYS A 1 32  ? -13.192 -3.787  -11.458 1.00 0.00 ? 32  LYS A HD2  4  
ATOM 10011 H HD3  . LYS A 1 32  ? -11.604 -4.496  -11.759 1.00 0.00 ? 32  LYS A HD3  4  
ATOM 10012 H HE2  . LYS A 1 32  ? -14.174 -6.058  -11.915 1.00 0.00 ? 32  LYS A HE2  4  
ATOM 10013 H HE3  . LYS A 1 32  ? -13.447 -5.249  -13.303 1.00 0.00 ? 32  LYS A HE3  4  
ATOM 10014 H HZ1  . LYS A 1 32  ? -11.736 -7.032  -11.751 1.00 0.00 ? 32  LYS A HZ1  4  
ATOM 10015 H HZ2  . LYS A 1 32  ? -11.772 -6.748  -13.418 1.00 0.00 ? 32  LYS A HZ2  4  
ATOM 10016 H HZ3  . LYS A 1 32  ? -12.931 -7.755  -12.707 1.00 0.00 ? 32  LYS A HZ3  4  
ATOM 10017 N N    . THR A 1 33  ? -15.929 -5.265  -7.006  1.00 0.00 ? 33  THR A N    4  
ATOM 10018 C CA   . THR A 1 33  ? -17.184 -4.917  -6.364  1.00 0.00 ? 33  THR A CA   4  
ATOM 10019 C C    . THR A 1 33  ? -17.090 -5.075  -4.846  1.00 0.00 ? 33  THR A C    4  
ATOM 10020 O O    . THR A 1 33  ? -17.593 -4.242  -4.097  1.00 0.00 ? 33  THR A O    4  
ATOM 10021 C CB   . THR A 1 33  ? -18.312 -5.784  -6.927  1.00 0.00 ? 33  THR A CB   4  
ATOM 10022 O OG1  . THR A 1 33  ? -18.875 -5.185  -8.081  1.00 0.00 ? 33  THR A OG1  4  
ATOM 10023 C CG2  . THR A 1 33  ? -19.433 -6.023  -5.945  1.00 0.00 ? 33  THR A CG2  4  
ATOM 10024 H H    . THR A 1 33  ? -15.862 -6.117  -7.481  1.00 0.00 ? 33  THR A H    4  
ATOM 10025 H HA   . THR A 1 33  ? -17.393 -3.883  -6.591  1.00 0.00 ? 33  THR A HA   4  
ATOM 10026 H HB   . THR A 1 33  ? -17.907 -6.745  -7.208  1.00 0.00 ? 33  THR A HB   4  
ATOM 10027 H HG1  . THR A 1 33  ? -19.246 -4.330  -7.849  1.00 0.00 ? 33  THR A HG1  4  
ATOM 10028 H HG21 . THR A 1 33  ? -20.222 -6.581  -6.426  1.00 0.00 ? 33  THR A HG21 4  
ATOM 10029 H HG22 . THR A 1 33  ? -19.817 -5.073  -5.602  1.00 0.00 ? 33  THR A HG22 4  
ATOM 10030 H HG23 . THR A 1 33  ? -19.053 -6.584  -5.104  1.00 0.00 ? 33  THR A HG23 4  
ATOM 10031 N N    . GLU A 1 34  ? -16.452 -6.147  -4.390  1.00 0.00 ? 34  GLU A N    4  
ATOM 10032 C CA   . GLU A 1 34  ? -16.316 -6.384  -2.958  1.00 0.00 ? 34  GLU A CA   4  
ATOM 10033 C C    . GLU A 1 34  ? -15.658 -5.187  -2.283  1.00 0.00 ? 34  GLU A C    4  
ATOM 10034 O O    . GLU A 1 34  ? -15.909 -4.902  -1.113  1.00 0.00 ? 34  GLU A O    4  
ATOM 10035 C CB   . GLU A 1 34  ? -15.508 -7.653  -2.690  1.00 0.00 ? 34  GLU A CB   4  
ATOM 10036 C CG   . GLU A 1 34  ? -16.311 -8.739  -1.997  1.00 0.00 ? 34  GLU A CG   4  
ATOM 10037 C CD   . GLU A 1 34  ? -15.433 -9.807  -1.374  1.00 0.00 ? 34  GLU A CD   4  
ATOM 10038 O OE1  . GLU A 1 34  ? -14.898 -10.648 -2.126  1.00 0.00 ? 34  GLU A OE1  4  
ATOM 10039 O OE2  . GLU A 1 34  ? -15.282 -9.802  -0.135  1.00 0.00 ? 34  GLU A OE2  4  
ATOM 10040 H H    . GLU A 1 34  ? -16.068 -6.790  -5.025  1.00 0.00 ? 34  GLU A H    4  
ATOM 10041 H HA   . GLU A 1 34  ? -17.309 -6.508  -2.549  1.00 0.00 ? 34  GLU A HA   4  
ATOM 10042 H HB2  . GLU A 1 34  ? -15.151 -8.042  -3.630  1.00 0.00 ? 34  GLU A HB2  4  
ATOM 10043 H HB3  . GLU A 1 34  ? -14.662 -7.406  -2.066  1.00 0.00 ? 34  GLU A HB3  4  
ATOM 10044 H HG2  . GLU A 1 34  ? -16.906 -8.284  -1.218  1.00 0.00 ? 34  GLU A HG2  4  
ATOM 10045 H HG3  . GLU A 1 34  ? -16.963 -9.204  -2.721  1.00 0.00 ? 34  GLU A HG3  4  
ATOM 10046 N N    . PHE A 1 35  ? -14.827 -4.483  -3.040  1.00 0.00 ? 35  PHE A N    4  
ATOM 10047 C CA   . PHE A 1 35  ? -14.144 -3.305  -2.528  1.00 0.00 ? 35  PHE A CA   4  
ATOM 10048 C C    . PHE A 1 35  ? -15.114 -2.129  -2.439  1.00 0.00 ? 35  PHE A C    4  
ATOM 10049 O O    . PHE A 1 35  ? -14.937 -1.225  -1.624  1.00 0.00 ? 35  PHE A O    4  
ATOM 10050 C CB   . PHE A 1 35  ? -12.953 -2.947  -3.423  1.00 0.00 ? 35  PHE A CB   4  
ATOM 10051 C CG   . PHE A 1 35  ? -11.723 -2.556  -2.655  1.00 0.00 ? 35  PHE A CG   4  
ATOM 10052 C CD1  . PHE A 1 35  ? -11.125 -3.448  -1.780  1.00 0.00 ? 35  PHE A CD1  4  
ATOM 10053 C CD2  . PHE A 1 35  ? -11.164 -1.297  -2.808  1.00 0.00 ? 35  PHE A CD2  4  
ATOM 10054 C CE1  . PHE A 1 35  ? -9.993  -3.093  -1.072  1.00 0.00 ? 35  PHE A CE1  4  
ATOM 10055 C CE2  . PHE A 1 35  ? -10.031 -0.936  -2.102  1.00 0.00 ? 35  PHE A CE2  4  
ATOM 10056 C CZ   . PHE A 1 35  ? -9.446  -1.836  -1.233  1.00 0.00 ? 35  PHE A CZ   4  
ATOM 10057 H H    . PHE A 1 35  ? -14.680 -4.755  -3.970  1.00 0.00 ? 35  PHE A H    4  
ATOM 10058 H HA   . PHE A 1 35  ? -13.784 -3.535  -1.536  1.00 0.00 ? 35  PHE A HA   4  
ATOM 10059 H HB2  . PHE A 1 35  ? -12.701 -3.801  -4.036  1.00 0.00 ? 35  PHE A HB2  4  
ATOM 10060 H HB3  . PHE A 1 35  ? -13.225 -2.121  -4.061  1.00 0.00 ? 35  PHE A HB3  4  
ATOM 10061 H HD1  . PHE A 1 35  ? -11.553 -4.431  -1.653  1.00 0.00 ? 35  PHE A HD1  4  
ATOM 10062 H HD2  . PHE A 1 35  ? -11.622 -0.594  -3.487  1.00 0.00 ? 35  PHE A HD2  4  
ATOM 10063 H HE1  . PHE A 1 35  ? -9.537  -3.799  -0.392  1.00 0.00 ? 35  PHE A HE1  4  
ATOM 10064 H HE2  . PHE A 1 35  ? -9.605  0.047   -2.230  1.00 0.00 ? 35  PHE A HE2  4  
ATOM 10065 H HZ   . PHE A 1 35  ? -8.560  -1.557  -0.681  1.00 0.00 ? 35  PHE A HZ   4  
ATOM 10066 N N    . LEU A 1 36  ? -16.140 -2.152  -3.288  1.00 0.00 ? 36  LEU A N    4  
ATOM 10067 C CA   . LEU A 1 36  ? -17.141 -1.096  -3.314  1.00 0.00 ? 36  LEU A CA   4  
ATOM 10068 C C    . LEU A 1 36  ? -17.872 -0.987  -1.995  1.00 0.00 ? 36  LEU A C    4  
ATOM 10069 O O    . LEU A 1 36  ? -17.890 0.064   -1.355  1.00 0.00 ? 36  LEU A O    4  
ATOM 10070 C CB   . LEU A 1 36  ? -18.178 -1.397  -4.390  1.00 0.00 ? 36  LEU A CB   4  
ATOM 10071 C CG   . LEU A 1 36  ? -17.933 -0.710  -5.709  1.00 0.00 ? 36  LEU A CG   4  
ATOM 10072 C CD1  . LEU A 1 36  ? -17.898 0.792   -5.501  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 10073 C CD2  . LEU A 1 36  ? -16.642 -1.221  -6.322  1.00 0.00 ? 36  LEU A CD2  4  
ATOM 10074 H H    . LEU A 1 36  ? -16.228 -2.899  -3.917  1.00 0.00 ? 36  LEU A H    4  
ATOM 10075 H HA   . LEU A 1 36  ? -16.654 -0.160  -3.538  1.00 0.00 ? 36  LEU A HA   4  
ATOM 10076 H HB2  . LEU A 1 36  ? -18.196 -2.459  -4.560  1.00 0.00 ? 36  LEU A HB2  4  
ATOM 10077 H HB3  . LEU A 1 36  ? -19.148 -1.092  -4.027  1.00 0.00 ? 36  LEU A HB3  4  
ATOM 10078 H HG   . LEU A 1 36  ? -18.742 -0.945  -6.376  1.00 0.00 ? 36  LEU A HG   4  
ATOM 10079 H HD11 . LEU A 1 36  ? -16.886 1.150   -5.618  1.00 0.00 ? 36  LEU A HD11 4  
ATOM 10080 H HD12 . LEU A 1 36  ? -18.248 1.019   -4.499  1.00 0.00 ? 36  LEU A HD12 4  
ATOM 10081 H HD13 . LEU A 1 36  ? -18.539 1.272   -6.224  1.00 0.00 ? 36  LEU A HD13 4  
ATOM 10082 H HD21 . LEU A 1 36  ? -16.869 -1.999  -7.035  1.00 0.00 ? 36  LEU A HD21 4  
ATOM 10083 H HD22 . LEU A 1 36  ? -16.014 -1.623  -5.541  1.00 0.00 ? 36  LEU A HD22 4  
ATOM 10084 H HD23 . LEU A 1 36  ? -16.132 -0.411  -6.819  1.00 0.00 ? 36  LEU A HD23 4  
ATOM 10085 N N    . SER A 1 37  ? -18.503 -2.081  -1.623  1.00 0.00 ? 37  SER A N    4  
ATOM 10086 C CA   . SER A 1 37  ? -19.284 -2.125  -0.403  1.00 0.00 ? 37  SER A CA   4  
ATOM 10087 C C    . SER A 1 37  ? -18.408 -1.938  0.832   1.00 0.00 ? 37  SER A C    4  
ATOM 10088 O O    . SER A 1 37  ? -18.699 -1.104  1.688   1.00 0.00 ? 37  SER A O    4  
ATOM 10089 C CB   . SER A 1 37  ? -20.052 -3.445  -0.306  1.00 0.00 ? 37  SER A CB   4  
ATOM 10090 O OG   . SER A 1 37  ? -19.178 -4.554  -0.439  1.00 0.00 ? 37  SER A OG   4  
ATOM 10091 H H    . SER A 1 37  ? -18.465 -2.871  -2.204  1.00 0.00 ? 37  SER A H    4  
ATOM 10092 H HA   . SER A 1 37  ? -19.992 -1.312  -0.459  1.00 0.00 ? 37  SER A HA   4  
ATOM 10093 H HB2  . SER A 1 37  ? -20.544 -3.503  0.653   1.00 0.00 ? 37  SER A HB2  4  
ATOM 10094 H HB3  . SER A 1 37  ? -20.790 -3.488  -1.093  1.00 0.00 ? 37  SER A HB3  4  
ATOM 10095 H HG   . SER A 1 37  ? -19.683 -5.368  -0.377  1.00 0.00 ? 37  SER A HG   4  
ATOM 10096 N N    . PHE A 1 38  ? -17.340 -2.722  0.921   1.00 0.00 ? 38  PHE A N    4  
ATOM 10097 C CA   . PHE A 1 38  ? -16.430 -2.641  2.057   1.00 0.00 ? 38  PHE A CA   4  
ATOM 10098 C C    . PHE A 1 38  ? -15.855 -1.235  2.197   1.00 0.00 ? 38  PHE A C    4  
ATOM 10099 O O    . PHE A 1 38  ? -15.904 -0.641  3.274   1.00 0.00 ? 38  PHE A O    4  
ATOM 10100 C CB   . PHE A 1 38  ? -15.305 -3.665  1.911   1.00 0.00 ? 38  PHE A CB   4  
ATOM 10101 C CG   . PHE A 1 38  ? -15.626 -4.989  2.544   1.00 0.00 ? 38  PHE A CG   4  
ATOM 10102 C CD1  . PHE A 1 38  ? -15.881 -5.076  3.903   1.00 0.00 ? 38  PHE A CD1  4  
ATOM 10103 C CD2  . PHE A 1 38  ? -15.674 -6.144  1.780   1.00 0.00 ? 38  PHE A CD2  4  
ATOM 10104 C CE1  . PHE A 1 38  ? -16.177 -6.293  4.489   1.00 0.00 ? 38  PHE A CE1  4  
ATOM 10105 C CE2  . PHE A 1 38  ? -15.970 -7.362  2.361   1.00 0.00 ? 38  PHE A CE2  4  
ATOM 10106 C CZ   . PHE A 1 38  ? -16.222 -7.437  3.717   1.00 0.00 ? 38  PHE A CZ   4  
ATOM 10107 H H    . PHE A 1 38  ? -17.162 -3.372  0.210   1.00 0.00 ? 38  PHE A H    4  
ATOM 10108 H HA   . PHE A 1 38  ? -16.997 -2.869  2.948   1.00 0.00 ? 38  PHE A HA   4  
ATOM 10109 H HB2  . PHE A 1 38  ? -15.114 -3.836  0.861   1.00 0.00 ? 38  PHE A HB2  4  
ATOM 10110 H HB3  . PHE A 1 38  ? -14.411 -3.280  2.377   1.00 0.00 ? 38  PHE A HB3  4  
ATOM 10111 H HD1  . PHE A 1 38  ? -15.847 -4.182  4.507   1.00 0.00 ? 38  PHE A HD1  4  
ATOM 10112 H HD2  . PHE A 1 38  ? -15.478 -6.086  0.721   1.00 0.00 ? 38  PHE A HD2  4  
ATOM 10113 H HE1  . PHE A 1 38  ? -16.373 -6.348  5.550   1.00 0.00 ? 38  PHE A HE1  4  
ATOM 10114 H HE2  . PHE A 1 38  ? -16.004 -8.255  1.755   1.00 0.00 ? 38  PHE A HE2  4  
ATOM 10115 H HZ   . PHE A 1 38  ? -16.453 -8.388  4.173   1.00 0.00 ? 38  PHE A HZ   4  
ATOM 10116 N N    . MET A 1 39  ? -15.319 -0.699  1.104   1.00 0.00 ? 39  MET A N    4  
ATOM 10117 C CA   . MET A 1 39  ? -14.752 0.644   1.118   1.00 0.00 ? 39  MET A CA   4  
ATOM 10118 C C    . MET A 1 39  ? -15.805 1.666   1.537   1.00 0.00 ? 39  MET A C    4  
ATOM 10119 O O    . MET A 1 39  ? -15.481 2.714   2.089   1.00 0.00 ? 39  MET A O    4  
ATOM 10120 C CB   . MET A 1 39  ? -14.194 1.006   -0.259  1.00 0.00 ? 39  MET A CB   4  
ATOM 10121 C CG   . MET A 1 39  ? -13.590 2.400   -0.321  1.00 0.00 ? 39  MET A CG   4  
ATOM 10122 S SD   . MET A 1 39  ? -12.039 2.446   -1.237  1.00 0.00 ? 39  MET A SD   4  
ATOM 10123 C CE   . MET A 1 39  ? -10.929 1.687   -0.054  1.00 0.00 ? 39  MET A CE   4  
ATOM 10124 H H    . MET A 1 39  ? -15.314 -1.214  0.270   1.00 0.00 ? 39  MET A H    4  
ATOM 10125 H HA   . MET A 1 39  ? -13.947 0.656   1.839   1.00 0.00 ? 39  MET A HA   4  
ATOM 10126 H HB2  . MET A 1 39  ? -13.427 0.292   -0.523  1.00 0.00 ? 39  MET A HB2  4  
ATOM 10127 H HB3  . MET A 1 39  ? -14.992 0.950   -0.985  1.00 0.00 ? 39  MET A HB3  4  
ATOM 10128 H HG2  . MET A 1 39  ? -14.295 3.063   -0.801  1.00 0.00 ? 39  MET A HG2  4  
ATOM 10129 H HG3  . MET A 1 39  ? -13.407 2.743   0.687   1.00 0.00 ? 39  MET A HG3  4  
ATOM 10130 H HE1  . MET A 1 39  ? -10.669 2.408   0.707   1.00 0.00 ? 39  MET A HE1  4  
ATOM 10131 H HE2  . MET A 1 39  ? -10.033 1.360   -0.560  1.00 0.00 ? 39  MET A HE2  4  
ATOM 10132 H HE3  . MET A 1 39  ? -11.416 0.839   0.404   1.00 0.00 ? 39  MET A HE3  4  
ATOM 10133 N N    . ASN A 1 40  ? -17.067 1.344   1.278   1.00 0.00 ? 40  ASN A N    4  
ATOM 10134 C CA   . ASN A 1 40  ? -18.171 2.225   1.636   1.00 0.00 ? 40  ASN A CA   4  
ATOM 10135 C C    . ASN A 1 40  ? -18.406 2.209   3.144   1.00 0.00 ? 40  ASN A C    4  
ATOM 10136 O O    . ASN A 1 40  ? -19.040 3.110   3.693   1.00 0.00 ? 40  ASN A O    4  
ATOM 10137 C CB   . ASN A 1 40  ? -19.446 1.807   0.902   1.00 0.00 ? 40  ASN A CB   4  
ATOM 10138 C CG   . ASN A 1 40  ? -19.621 2.539   -0.415  1.00 0.00 ? 40  ASN A CG   4  
ATOM 10139 O OD1  . ASN A 1 40  ? -19.583 3.767   -0.465  1.00 0.00 ? 40  ASN A OD1  4  
ATOM 10140 N ND2  . ASN A 1 40  ? -19.817 1.783   -1.489  1.00 0.00 ? 40  ASN A ND2  4  
ATOM 10141 H H    . ASN A 1 40  ? -17.263 0.489   0.843   1.00 0.00 ? 40  ASN A H    4  
ATOM 10142 H HA   . ASN A 1 40  ? -17.905 3.227   1.336   1.00 0.00 ? 40  ASN A HA   4  
ATOM 10143 H HB2  . ASN A 1 40  ? -19.409 0.748   0.700   1.00 0.00 ? 40  ASN A HB2  4  
ATOM 10144 H HB3  . ASN A 1 40  ? -20.300 2.020   1.528   1.00 0.00 ? 40  ASN A HB3  4  
ATOM 10145 H HD21 . ASN A 1 40  ? -19.837 0.806   -1.373  1.00 0.00 ? 40  ASN A HD21 4  
ATOM 10146 H HD22 . ASN A 1 40  ? -19.934 2.233   -2.357  1.00 0.00 ? 40  ASN A HD22 4  
ATOM 10147 N N    . THR A 1 41  ? -17.905 1.168   3.806   1.00 0.00 ? 41  THR A N    4  
ATOM 10148 C CA   . THR A 1 41  ? -18.071 1.024   5.247   1.00 0.00 ? 41  THR A CA   4  
ATOM 10149 C C    . THR A 1 41  ? -16.737 1.158   5.981   1.00 0.00 ? 41  THR A C    4  
ATOM 10150 O O    . THR A 1 41  ? -16.427 2.207   6.545   1.00 0.00 ? 41  THR A O    4  
ATOM 10151 C CB   . THR A 1 41  ? -18.697 -0.335  5.562   1.00 0.00 ? 41  THR A CB   4  
ATOM 10152 O OG1  . THR A 1 41  ? -18.282 -1.307  4.618   1.00 0.00 ? 41  THR A OG1  4  
ATOM 10153 C CG2  . THR A 1 41  ? -20.205 -0.314  5.562   1.00 0.00 ? 41  THR A CG2  4  
ATOM 10154 H H    . THR A 1 41  ? -17.419 0.476   3.312   1.00 0.00 ? 41  THR A H    4  
ATOM 10155 H HA   . THR A 1 41  ? -18.736 1.803   5.586   1.00 0.00 ? 41  THR A HA   4  
ATOM 10156 H HB   . THR A 1 41  ? -18.369 -0.654  6.541   1.00 0.00 ? 41  THR A HB   4  
ATOM 10157 H HG1  . THR A 1 41  ? -18.648 -1.093  3.757   1.00 0.00 ? 41  THR A HG1  4  
ATOM 10158 H HG21 . THR A 1 41  ? -20.579 -1.321  5.670   1.00 0.00 ? 41  THR A HG21 4  
ATOM 10159 H HG22 . THR A 1 41  ? -20.558 0.102   4.629   1.00 0.00 ? 41  THR A HG22 4  
ATOM 10160 H HG23 . THR A 1 41  ? -20.557 0.291   6.383   1.00 0.00 ? 41  THR A HG23 4  
ATOM 10161 N N    . GLU A 1 42  ? -15.964 0.077   5.981   1.00 0.00 ? 42  GLU A N    4  
ATOM 10162 C CA   . GLU A 1 42  ? -14.668 0.045   6.658   1.00 0.00 ? 42  GLU A CA   4  
ATOM 10163 C C    . GLU A 1 42  ? -13.775 1.217   6.253   1.00 0.00 ? 42  GLU A C    4  
ATOM 10164 O O    . GLU A 1 42  ? -13.168 1.868   7.103   1.00 0.00 ? 42  GLU A O    4  
ATOM 10165 C CB   . GLU A 1 42  ? -13.953 -1.275  6.359   1.00 0.00 ? 42  GLU A CB   4  
ATOM 10166 C CG   . GLU A 1 42  ? -14.782 -2.504  6.696   1.00 0.00 ? 42  GLU A CG   4  
ATOM 10167 C CD   . GLU A 1 42  ? -14.265 -3.240  7.917   1.00 0.00 ? 42  GLU A CD   4  
ATOM 10168 O OE1  . GLU A 1 42  ? -14.260 -2.640  9.013   1.00 0.00 ? 42  GLU A OE1  4  
ATOM 10169 O OE2  . GLU A 1 42  ? -13.866 -4.415  7.777   1.00 0.00 ? 42  GLU A OE2  4  
ATOM 10170 H H    . GLU A 1 42  ? -16.281 -0.730  5.522   1.00 0.00 ? 42  GLU A H    4  
ATOM 10171 H HA   . GLU A 1 42  ? -14.852 0.104   7.720   1.00 0.00 ? 42  GLU A HA   4  
ATOM 10172 H HB2  . GLU A 1 42  ? -13.710 -1.309  5.308   1.00 0.00 ? 42  GLU A HB2  4  
ATOM 10173 H HB3  . GLU A 1 42  ? -13.040 -1.314  6.933   1.00 0.00 ? 42  GLU A HB3  4  
ATOM 10174 H HG2  . GLU A 1 42  ? -15.799 -2.196  6.885   1.00 0.00 ? 42  GLU A HG2  4  
ATOM 10175 H HG3  . GLU A 1 42  ? -14.762 -3.178  5.853   1.00 0.00 ? 42  GLU A HG3  4  
ATOM 10176 N N    . LEU A 1 43  ? -13.696 1.480   4.954   1.00 0.00 ? 43  LEU A N    4  
ATOM 10177 C CA   . LEU A 1 43  ? -12.875 2.569   4.441   1.00 0.00 ? 43  LEU A CA   4  
ATOM 10178 C C    . LEU A 1 43  ? -13.755 3.674   3.879   1.00 0.00 ? 43  LEU A C    4  
ATOM 10179 O O    . LEU A 1 43  ? -13.440 4.285   2.858   1.00 0.00 ? 43  LEU A O    4  
ATOM 10180 C CB   . LEU A 1 43  ? -11.916 2.049   3.366   1.00 0.00 ? 43  LEU A CB   4  
ATOM 10181 C CG   . LEU A 1 43  ? -10.488 1.807   3.849   1.00 0.00 ? 43  LEU A CG   4  
ATOM 10182 C CD1  . LEU A 1 43  ? -9.593  1.378   2.696   1.00 0.00 ? 43  LEU A CD1  4  
ATOM 10183 C CD2  . LEU A 1 43  ? -9.943  3.059   4.515   1.00 0.00 ? 43  LEU A CD2  4  
ATOM 10184 H H    . LEU A 1 43  ? -14.201 0.932   4.324   1.00 0.00 ? 43  LEU A H    4  
ATOM 10185 H HA   . LEU A 1 43  ? -12.300 2.967   5.264   1.00 0.00 ? 43  LEU A HA   4  
ATOM 10186 H HB2  . LEU A 1 43  ? -12.310 1.118   2.983   1.00 0.00 ? 43  LEU A HB2  4  
ATOM 10187 H HB3  . LEU A 1 43  ? -11.884 2.765   2.559   1.00 0.00 ? 43  LEU A HB3  4  
ATOM 10188 H HG   . LEU A 1 43  ? -10.492 1.013   4.581   1.00 0.00 ? 43  LEU A HG   4  
ATOM 10189 H HD11 . LEU A 1 43  ? -9.311  2.245   2.117   1.00 0.00 ? 43  LEU A HD11 4  
ATOM 10190 H HD12 . LEU A 1 43  ? -10.126 0.682   2.066   1.00 0.00 ? 43  LEU A HD12 4  
ATOM 10191 H HD13 . LEU A 1 43  ? -8.706  0.902   3.087   1.00 0.00 ? 43  LEU A HD13 4  
ATOM 10192 H HD21 . LEU A 1 43  ? -8.867  3.078   4.428   1.00 0.00 ? 43  LEU A HD21 4  
ATOM 10193 H HD22 . LEU A 1 43  ? -10.222 3.058   5.558   1.00 0.00 ? 43  LEU A HD22 4  
ATOM 10194 H HD23 . LEU A 1 43  ? -10.359 3.930   4.033   1.00 0.00 ? 43  LEU A HD23 4  
ATOM 10195 N N    . ALA A 1 44  ? -14.865 3.920   4.561   1.00 0.00 ? 44  ALA A N    4  
ATOM 10196 C CA   . ALA A 1 44  ? -15.807 4.944   4.147   1.00 0.00 ? 44  ALA A CA   4  
ATOM 10197 C C    . ALA A 1 44  ? -15.282 6.331   4.490   1.00 0.00 ? 44  ALA A C    4  
ATOM 10198 O O    . ALA A 1 44  ? -15.571 7.305   3.797   1.00 0.00 ? 44  ALA A O    4  
ATOM 10199 C CB   . ALA A 1 44  ? -17.152 4.696   4.806   1.00 0.00 ? 44  ALA A CB   4  
ATOM 10200 H H    . ALA A 1 44  ? -15.053 3.396   5.367   1.00 0.00 ? 44  ALA A H    4  
ATOM 10201 H HA   . ALA A 1 44  ? -15.935 4.870   3.077   1.00 0.00 ? 44  ALA A HA   4  
ATOM 10202 H HB1  . ALA A 1 44  ? -17.251 3.641   5.024   1.00 0.00 ? 44  ALA A HB1  4  
ATOM 10203 H HB2  . ALA A 1 44  ? -17.943 5.005   4.139   1.00 0.00 ? 44  ALA A HB2  4  
ATOM 10204 H HB3  . ALA A 1 44  ? -17.213 5.261   5.725   1.00 0.00 ? 44  ALA A HB3  4  
ATOM 10205 N N    . ALA A 1 45  ? -14.501 6.409   5.562   1.00 0.00 ? 45  ALA A N    4  
ATOM 10206 C CA   . ALA A 1 45  ? -13.924 7.672   5.999   1.00 0.00 ? 45  ALA A CA   4  
ATOM 10207 C C    . ALA A 1 45  ? -13.170 8.353   4.858   1.00 0.00 ? 45  ALA A C    4  
ATOM 10208 O O    . ALA A 1 45  ? -13.011 9.573   4.848   1.00 0.00 ? 45  ALA A O    4  
ATOM 10209 C CB   . ALA A 1 45  ? -13.002 7.438   7.185   1.00 0.00 ? 45  ALA A CB   4  
ATOM 10210 H H    . ALA A 1 45  ? -14.304 5.594   6.068   1.00 0.00 ? 45  ALA A H    4  
ATOM 10211 H HA   . ALA A 1 45  ? -14.730 8.315   6.319   1.00 0.00 ? 45  ALA A HA   4  
ATOM 10212 H HB1  . ALA A 1 45  ? -11.997 7.739   6.929   1.00 0.00 ? 45  ALA A HB1  4  
ATOM 10213 H HB2  . ALA A 1 45  ? -13.008 6.387   7.441   1.00 0.00 ? 45  ALA A HB2  4  
ATOM 10214 H HB3  . ALA A 1 45  ? -13.348 8.015   8.029   1.00 0.00 ? 45  ALA A HB3  4  
ATOM 10215 N N    . PHE A 1 46  ? -12.710 7.554   3.900   1.00 0.00 ? 46  PHE A N    4  
ATOM 10216 C CA   . PHE A 1 46  ? -11.975 8.075   2.754   1.00 0.00 ? 46  PHE A CA   4  
ATOM 10217 C C    . PHE A 1 46  ? -12.809 7.976   1.477   1.00 0.00 ? 46  PHE A C    4  
ATOM 10218 O O    . PHE A 1 46  ? -12.266 7.944   0.373   1.00 0.00 ? 46  PHE A O    4  
ATOM 10219 C CB   . PHE A 1 46  ? -10.663 7.310   2.576   1.00 0.00 ? 46  PHE A CB   4  
ATOM 10220 C CG   . PHE A 1 46  ? -9.518  7.893   3.355   1.00 0.00 ? 46  PHE A CG   4  
ATOM 10221 C CD1  . PHE A 1 46  ? -9.652  8.170   4.706   1.00 0.00 ? 46  PHE A CD1  4  
ATOM 10222 C CD2  . PHE A 1 46  ? -8.308  8.163   2.736   1.00 0.00 ? 46  PHE A CD2  4  
ATOM 10223 C CE1  . PHE A 1 46  ? -8.600  8.707   5.424   1.00 0.00 ? 46  PHE A CE1  4  
ATOM 10224 C CE2  . PHE A 1 46  ? -7.254  8.699   3.449   1.00 0.00 ? 46  PHE A CE2  4  
ATOM 10225 C CZ   . PHE A 1 46  ? -7.400  8.972   4.796   1.00 0.00 ? 46  PHE A CZ   4  
ATOM 10226 H H    . PHE A 1 46  ? -12.869 6.588   3.964   1.00 0.00 ? 46  PHE A H    4  
ATOM 10227 H HA   . PHE A 1 46  ? -11.753 9.114   2.946   1.00 0.00 ? 46  PHE A HA   4  
ATOM 10228 H HB2  . PHE A 1 46  ? -10.802 6.290   2.905   1.00 0.00 ? 46  PHE A HB2  4  
ATOM 10229 H HB3  . PHE A 1 46  ? -10.391 7.313   1.531   1.00 0.00 ? 46  PHE A HB3  4  
ATOM 10230 H HD1  . PHE A 1 46  ? -10.590 7.963   5.199   1.00 0.00 ? 46  PHE A HD1  4  
ATOM 10231 H HD2  . PHE A 1 46  ? -8.194  7.951   1.683   1.00 0.00 ? 46  PHE A HD2  4  
ATOM 10232 H HE1  . PHE A 1 46  ? -8.718  8.918   6.478   1.00 0.00 ? 46  PHE A HE1  4  
ATOM 10233 H HE2  . PHE A 1 46  ? -6.316  8.906   2.955   1.00 0.00 ? 46  PHE A HE2  4  
ATOM 10234 H HZ   . PHE A 1 46  ? -6.576  9.391   5.355   1.00 0.00 ? 46  PHE A HZ   4  
ATOM 10235 N N    . THR A 1 47  ? -14.130 7.928   1.635   1.00 0.00 ? 47  THR A N    4  
ATOM 10236 C CA   . THR A 1 47  ? -15.034 7.832   0.493   1.00 0.00 ? 47  THR A CA   4  
ATOM 10237 C C    . THR A 1 47  ? -16.490 7.800   0.950   1.00 0.00 ? 47  THR A C    4  
ATOM 10238 O O    . THR A 1 47  ? -17.308 7.059   0.403   1.00 0.00 ? 47  THR A O    4  
ATOM 10239 C CB   . THR A 1 47  ? -14.719 6.582   -0.331  1.00 0.00 ? 47  THR A CB   4  
ATOM 10240 O OG1  . THR A 1 47  ? -15.670 6.411   -1.367  1.00 0.00 ? 47  THR A OG1  4  
ATOM 10241 C CG2  . THR A 1 47  ? -14.702 5.311   0.490   1.00 0.00 ? 47  THR A CG2  4  
ATOM 10242 H H    . THR A 1 47  ? -14.506 7.958   2.539   1.00 0.00 ? 47  THR A H    4  
ATOM 10243 H HA   . THR A 1 47  ? -14.883 8.705   -0.123  1.00 0.00 ? 47  THR A HA   4  
ATOM 10244 H HB   . THR A 1 47  ? -13.743 6.697   -0.782  1.00 0.00 ? 47  THR A HB   4  
ATOM 10245 H HG1  . THR A 1 47  ? -15.523 7.070   -2.050  1.00 0.00 ? 47  THR A HG1  4  
ATOM 10246 H HG21 . THR A 1 47  ? -14.846 5.555   1.532   1.00 0.00 ? 47  THR A HG21 4  
ATOM 10247 H HG22 . THR A 1 47  ? -13.753 4.814   0.364   1.00 0.00 ? 47  THR A HG22 4  
ATOM 10248 H HG23 . THR A 1 47  ? -15.498 4.659   0.160   1.00 0.00 ? 47  THR A HG23 4  
ATOM 10249 N N    . LYS A 1 48  ? -16.809 8.607   1.959   1.00 0.00 ? 48  LYS A N    4  
ATOM 10250 C CA   . LYS A 1 48  ? -18.167 8.668   2.490   1.00 0.00 ? 48  LYS A CA   4  
ATOM 10251 C C    . LYS A 1 48  ? -18.760 10.064  2.321   1.00 0.00 ? 48  LYS A C    4  
ATOM 10252 O O    . LYS A 1 48  ? -19.956 10.213  2.069   1.00 0.00 ? 48  LYS A O    4  
ATOM 10253 C CB   . LYS A 1 48  ? -18.179 8.273   3.968   1.00 0.00 ? 48  LYS A CB   4  
ATOM 10254 C CG   . LYS A 1 48  ? -17.286 9.141   4.841   1.00 0.00 ? 48  LYS A CG   4  
ATOM 10255 C CD   . LYS A 1 48  ? -18.102 10.065  5.733   1.00 0.00 ? 48  LYS A CD   4  
ATOM 10256 C CE   . LYS A 1 48  ? -18.119 9.577   7.174   1.00 0.00 ? 48  LYS A CE   4  
ATOM 10257 N NZ   . LYS A 1 48  ? -18.312 10.696  8.137   1.00 0.00 ? 48  LYS A NZ   4  
ATOM 10258 H H    . LYS A 1 48  ? -16.113 9.173   2.356   1.00 0.00 ? 48  LYS A H    4  
ATOM 10259 H HA   . LYS A 1 48  ? -18.770 7.966   1.935   1.00 0.00 ? 48  LYS A HA   4  
ATOM 10260 H HB2  . LYS A 1 48  ? -19.191 8.345   4.340   1.00 0.00 ? 48  LYS A HB2  4  
ATOM 10261 H HB3  . LYS A 1 48  ? -17.845 7.249   4.056   1.00 0.00 ? 48  LYS A HB3  4  
ATOM 10262 H HG2  . LYS A 1 48  ? -16.677 8.503   5.463   1.00 0.00 ? 48  LYS A HG2  4  
ATOM 10263 H HG3  . LYS A 1 48  ? -16.649 9.739   4.206   1.00 0.00 ? 48  LYS A HG3  4  
ATOM 10264 H HD2  . LYS A 1 48  ? -17.667 11.053  5.705   1.00 0.00 ? 48  LYS A HD2  4  
ATOM 10265 H HD3  . LYS A 1 48  ? -19.115 10.106  5.364   1.00 0.00 ? 48  LYS A HD3  4  
ATOM 10266 H HE2  . LYS A 1 48  ? -18.928 8.870   7.291   1.00 0.00 ? 48  LYS A HE2  4  
ATOM 10267 H HE3  . LYS A 1 48  ? -17.179 9.087   7.385   1.00 0.00 ? 48  LYS A HE3  4  
ATOM 10268 H HZ1  . LYS A 1 48  ? -19.325 10.909  8.241   1.00 0.00 ? 48  LYS A HZ1  4  
ATOM 10269 H HZ2  . LYS A 1 48  ? -17.823 11.548  7.797   1.00 0.00 ? 48  LYS A HZ2  4  
ATOM 10270 H HZ3  . LYS A 1 48  ? -17.926 10.437  9.068   1.00 0.00 ? 48  LYS A HZ3  4  
ATOM 10271 N N    . ASN A 1 49  ? -17.919 11.084  2.462   1.00 0.00 ? 49  ASN A N    4  
ATOM 10272 C CA   . ASN A 1 49  ? -18.365 12.465  2.326   1.00 0.00 ? 49  ASN A CA   4  
ATOM 10273 C C    . ASN A 1 49  ? -17.178 13.401  2.116   1.00 0.00 ? 49  ASN A C    4  
ATOM 10274 O O    . ASN A 1 49  ? -17.212 14.564  2.521   1.00 0.00 ? 49  ASN A O    4  
ATOM 10275 C CB   . ASN A 1 49  ? -19.155 12.891  3.564   1.00 0.00 ? 49  ASN A CB   4  
ATOM 10276 C CG   . ASN A 1 49  ? -20.651 12.719  3.383   1.00 0.00 ? 49  ASN A CG   4  
ATOM 10277 O OD1  . ASN A 1 49  ? -21.320 13.573  2.802   1.00 0.00 ? 49  ASN A OD1  4  
ATOM 10278 N ND2  . ASN A 1 49  ? -21.184 11.609  3.881   1.00 0.00 ? 49  ASN A ND2  4  
ATOM 10279 H H    . ASN A 1 49  ? -16.977 10.903  2.663   1.00 0.00 ? 49  ASN A H    4  
ATOM 10280 H HA   . ASN A 1 49  ? -19.008 12.521  1.461   1.00 0.00 ? 49  ASN A HA   4  
ATOM 10281 H HB2  . ASN A 1 49  ? -18.843 12.294  4.407   1.00 0.00 ? 49  ASN A HB2  4  
ATOM 10282 H HB3  . ASN A 1 49  ? -18.954 13.933  3.773   1.00 0.00 ? 49  ASN A HB3  4  
ATOM 10283 H HD21 . ASN A 1 49  ? -20.587 10.971  4.334   1.00 0.00 ? 49  ASN A HD21 4  
ATOM 10284 H HD22 . ASN A 1 49  ? -22.153 11.472  3.778   1.00 0.00 ? 49  ASN A HD22 4  
ATOM 10285 N N    . GLN A 1 50  ? -16.131 12.888  1.480   1.00 0.00 ? 50  GLN A N    4  
ATOM 10286 C CA   . GLN A 1 50  ? -14.935 13.679  1.216   1.00 0.00 ? 50  GLN A CA   4  
ATOM 10287 C C    . GLN A 1 50  ? -15.205 14.729  0.143   1.00 0.00 ? 50  GLN A C    4  
ATOM 10288 O O    . GLN A 1 50  ? -16.139 14.597  -0.647  1.00 0.00 ? 50  GLN A O    4  
ATOM 10289 C CB   . GLN A 1 50  ? -13.783 12.772  0.779   1.00 0.00 ? 50  GLN A CB   4  
ATOM 10290 C CG   . GLN A 1 50  ? -13.608 11.543  1.656   1.00 0.00 ? 50  GLN A CG   4  
ATOM 10291 C CD   . GLN A 1 50  ? -13.376 11.894  3.112   1.00 0.00 ? 50  GLN A CD   4  
ATOM 10292 O OE1  . GLN A 1 50  ? -12.279 12.296  3.499   1.00 0.00 ? 50  GLN A OE1  4  
ATOM 10293 N NE2  . GLN A 1 50  ? -14.412 11.742  3.930   1.00 0.00 ? 50  GLN A NE2  4  
ATOM 10294 H H    . GLN A 1 50  ? -16.162 11.955  1.180   1.00 0.00 ? 50  GLN A H    4  
ATOM 10295 H HA   . GLN A 1 50  ? -14.660 14.180  2.132   1.00 0.00 ? 50  GLN A HA   4  
ATOM 10296 H HB2  . GLN A 1 50  ? -13.964 12.442  -0.233  1.00 0.00 ? 50  GLN A HB2  4  
ATOM 10297 H HB3  . GLN A 1 50  ? -12.864 13.339  0.804   1.00 0.00 ? 50  GLN A HB3  4  
ATOM 10298 H HG2  . GLN A 1 50  ? -14.499 10.937  1.586   1.00 0.00 ? 50  GLN A HG2  4  
ATOM 10299 H HG3  . GLN A 1 50  ? -12.760 10.978  1.298   1.00 0.00 ? 50  GLN A HG3  4  
ATOM 10300 H HE21 . GLN A 1 50  ? -15.258 11.415  3.550   1.00 0.00 ? 50  GLN A HE21 4  
ATOM 10301 H HE22 . GLN A 1 50  ? -14.287 11.963  4.880   1.00 0.00 ? 50  GLN A HE22 4  
ATOM 10302 N N    . LYS A 1 51  ? -14.380 15.772  0.122   1.00 0.00 ? 51  LYS A N    4  
ATOM 10303 C CA   . LYS A 1 51  ? -14.531 16.843  -0.856  1.00 0.00 ? 51  LYS A CA   4  
ATOM 10304 C C    . LYS A 1 51  ? -14.445 16.300  -2.279  1.00 0.00 ? 51  LYS A C    4  
ATOM 10305 O O    . LYS A 1 51  ? -15.030 16.862  -3.205  1.00 0.00 ? 51  LYS A O    4  
ATOM 10306 C CB   . LYS A 1 51  ? -13.459 17.913  -0.641  1.00 0.00 ? 51  LYS A CB   4  
ATOM 10307 C CG   . LYS A 1 51  ? -13.920 19.317  -1.001  1.00 0.00 ? 51  LYS A CG   4  
ATOM 10308 C CD   . LYS A 1 51  ? -13.130 19.887  -2.171  1.00 0.00 ? 51  LYS A CD   4  
ATOM 10309 C CE   . LYS A 1 51  ? -12.194 20.999  -1.724  1.00 0.00 ? 51  LYS A CE   4  
ATOM 10310 N NZ   . LYS A 1 51  ? -10.854 20.477  -1.337  1.00 0.00 ? 51  LYS A NZ   4  
ATOM 10311 H H    . LYS A 1 51  ? -13.654 15.821  0.777   1.00 0.00 ? 51  LYS A H    4  
ATOM 10312 H HA   . LYS A 1 51  ? -15.504 17.289  -0.712  1.00 0.00 ? 51  LYS A HA   4  
ATOM 10313 H HB2  . LYS A 1 51  ? -13.168 17.909  0.400   1.00 0.00 ? 51  LYS A HB2  4  
ATOM 10314 H HB3  . LYS A 1 51  ? -12.598 17.672  -1.247  1.00 0.00 ? 51  LYS A HB3  4  
ATOM 10315 H HG2  . LYS A 1 51  ? -14.965 19.284  -1.270  1.00 0.00 ? 51  LYS A HG2  4  
ATOM 10316 H HG3  . LYS A 1 51  ? -13.790 19.960  -0.142  1.00 0.00 ? 51  LYS A HG3  4  
ATOM 10317 H HD2  . LYS A 1 51  ? -12.545 19.098  -2.618  1.00 0.00 ? 51  LYS A HD2  4  
ATOM 10318 H HD3  . LYS A 1 51  ? -13.822 20.283  -2.900  1.00 0.00 ? 51  LYS A HD3  4  
ATOM 10319 H HE2  . LYS A 1 51  ? -12.075 21.701  -2.535  1.00 0.00 ? 51  LYS A HE2  4  
ATOM 10320 H HE3  . LYS A 1 51  ? -12.633 21.503  -0.874  1.00 0.00 ? 51  LYS A HE3  4  
ATOM 10321 H HZ1  . LYS A 1 51  ? -10.913 19.983  -0.423  1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 10322 H HZ2  . LYS A 1 51  ? -10.175 21.260  -1.252  1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 10323 H HZ3  . LYS A 1 51  ? -10.509 19.810  -2.057  1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 10324 N N    . ASP A 1 52  ? -13.713 15.202  -2.446  1.00 0.00 ? 52  ASP A N    4  
ATOM 10325 C CA   . ASP A 1 52  ? -13.551 14.583  -3.755  1.00 0.00 ? 52  ASP A CA   4  
ATOM 10326 C C    . ASP A 1 52  ? -14.236 13.216  -3.799  1.00 0.00 ? 52  ASP A C    4  
ATOM 10327 O O    . ASP A 1 52  ? -13.744 12.250  -3.215  1.00 0.00 ? 52  ASP A O    4  
ATOM 10328 C CB   . ASP A 1 52  ? -12.065 14.434  -4.090  1.00 0.00 ? 52  ASP A CB   4  
ATOM 10329 C CG   . ASP A 1 52  ? -11.740 14.900  -5.495  1.00 0.00 ? 52  ASP A CG   4  
ATOM 10330 O OD1  . ASP A 1 52  ? -12.178 16.008  -5.870  1.00 0.00 ? 52  ASP A OD1  4  
ATOM 10331 O OD2  . ASP A 1 52  ? -11.048 14.156  -6.223  1.00 0.00 ? 52  ASP A OD2  4  
ATOM 10332 H H    . ASP A 1 52  ? -13.271 14.800  -1.669  1.00 0.00 ? 52  ASP A H    4  
ATOM 10333 H HA   . ASP A 1 52  ? -14.011 15.229  -4.486  1.00 0.00 ? 52  ASP A HA   4  
ATOM 10334 H HB2  . ASP A 1 52  ? -11.485 15.020  -3.394  1.00 0.00 ? 52  ASP A HB2  4  
ATOM 10335 H HB3  . ASP A 1 52  ? -11.782 13.394  -4.000  1.00 0.00 ? 52  ASP A HB3  4  
ATOM 10336 N N    . PRO A 1 53  ? -15.386 13.115  -4.491  1.00 0.00 ? 53  PRO A N    4  
ATOM 10337 C CA   . PRO A 1 53  ? -16.131 11.859  -4.601  1.00 0.00 ? 53  PRO A CA   4  
ATOM 10338 C C    . PRO A 1 53  ? -15.570 10.928  -5.674  1.00 0.00 ? 53  PRO A C    4  
ATOM 10339 O O    . PRO A 1 53  ? -16.170 9.901   -5.991  1.00 0.00 ? 53  PRO A O    4  
ATOM 10340 C CB   . PRO A 1 53  ? -17.530 12.333  -4.987  1.00 0.00 ? 53  PRO A CB   4  
ATOM 10341 C CG   . PRO A 1 53  ? -17.298 13.573  -5.781  1.00 0.00 ? 53  PRO A CG   4  
ATOM 10342 C CD   . PRO A 1 53  ? -16.054 14.214  -5.216  1.00 0.00 ? 53  PRO A CD   4  
ATOM 10343 H HA   . PRO A 1 53  ? -16.173 11.338  -3.657  1.00 0.00 ? 53  PRO A HA   4  
ATOM 10344 H HB2  . PRO A 1 53  ? -18.022 11.571  -5.575  1.00 0.00 ? 53  PRO A HB2  4  
ATOM 10345 H HB3  . PRO A 1 53  ? -18.105 12.537  -4.096  1.00 0.00 ? 53  PRO A HB3  4  
ATOM 10346 H HG2  . PRO A 1 53  ? -17.147 13.319  -6.821  1.00 0.00 ? 53  PRO A HG2  4  
ATOM 10347 H HG3  . PRO A 1 53  ? -18.141 14.237  -5.677  1.00 0.00 ? 53  PRO A HG3  4  
ATOM 10348 H HD2  . PRO A 1 53  ? -15.427 14.585  -6.012  1.00 0.00 ? 53  PRO A HD2  4  
ATOM 10349 H HD3  . PRO A 1 53  ? -16.319 15.014  -4.541  1.00 0.00 ? 53  PRO A HD3  4  
ATOM 10350 N N    . GLY A 1 54  ? -14.416 11.288  -6.231  1.00 0.00 ? 54  GLY A N    4  
ATOM 10351 C CA   . GLY A 1 54  ? -13.802 10.469  -7.259  1.00 0.00 ? 54  GLY A CA   4  
ATOM 10352 C C    . GLY A 1 54  ? -12.577 9.722   -6.764  1.00 0.00 ? 54  GLY A C    4  
ATOM 10353 O O    . GLY A 1 54  ? -11.980 8.944   -7.505  1.00 0.00 ? 54  GLY A O    4  
ATOM 10354 H H    . GLY A 1 54  ? -13.978 12.114  -5.944  1.00 0.00 ? 54  GLY A H    4  
ATOM 10355 H HA2  . GLY A 1 54  ? -14.528 9.751   -7.612  1.00 0.00 ? 54  GLY A HA2  4  
ATOM 10356 H HA3  . GLY A 1 54  ? -13.513 11.104  -8.083  1.00 0.00 ? 54  GLY A HA3  4  
ATOM 10357 N N    . VAL A 1 55  ? -12.199 9.957   -5.508  1.00 0.00 ? 55  VAL A N    4  
ATOM 10358 C CA   . VAL A 1 55  ? -11.037 9.299   -4.922  1.00 0.00 ? 55  VAL A CA   4  
ATOM 10359 C C    . VAL A 1 55  ? -11.151 7.779   -5.026  1.00 0.00 ? 55  VAL A C    4  
ATOM 10360 O O    . VAL A 1 55  ? -10.244 7.113   -5.529  1.00 0.00 ? 55  VAL A O    4  
ATOM 10361 C CB   . VAL A 1 55  ? -10.860 9.695   -3.442  1.00 0.00 ? 55  VAL A CB   4  
ATOM 10362 C CG1  . VAL A 1 55  ? -9.694  8.944   -2.815  1.00 0.00 ? 55  VAL A CG1  4  
ATOM 10363 C CG2  . VAL A 1 55  ? -10.667 11.199  -3.313  1.00 0.00 ? 55  VAL A CG2  4  
ATOM 10364 H H    . VAL A 1 55  ? -12.711 10.588  -4.964  1.00 0.00 ? 55  VAL A H    4  
ATOM 10365 H HA   . VAL A 1 55  ? -10.162 9.622   -5.467  1.00 0.00 ? 55  VAL A HA   4  
ATOM 10366 H HB   . VAL A 1 55  ? -11.760 9.423   -2.908  1.00 0.00 ? 55  VAL A HB   4  
ATOM 10367 H HG11 . VAL A 1 55  ? -8.871  8.908   -3.515  1.00 0.00 ? 55  VAL A HG11 4  
ATOM 10368 H HG12 . VAL A 1 55  ? -10.003 7.939   -2.572  1.00 0.00 ? 55  VAL A HG12 4  
ATOM 10369 H HG13 . VAL A 1 55  ? -9.379  9.452   -1.916  1.00 0.00 ? 55  VAL A HG13 4  
ATOM 10370 H HG21 . VAL A 1 55  ? -9.912  11.402  -2.568  1.00 0.00 ? 55  VAL A HG21 4  
ATOM 10371 H HG22 . VAL A 1 55  ? -11.598 11.657  -3.016  1.00 0.00 ? 55  VAL A HG22 4  
ATOM 10372 H HG23 . VAL A 1 55  ? -10.353 11.604  -4.264  1.00 0.00 ? 55  VAL A HG23 4  
ATOM 10373 N N    . LEU A 1 56  ? -12.264 7.236   -4.546  1.00 0.00 ? 56  LEU A N    4  
ATOM 10374 C CA   . LEU A 1 56  ? -12.491 5.802   -4.581  1.00 0.00 ? 56  LEU A CA   4  
ATOM 10375 C C    . LEU A 1 56  ? -12.655 5.318   -6.018  1.00 0.00 ? 56  LEU A C    4  
ATOM 10376 O O    . LEU A 1 56  ? -11.981 4.388   -6.457  1.00 0.00 ? 56  LEU A O    4  
ATOM 10377 C CB   . LEU A 1 56  ? -13.746 5.474   -3.769  1.00 0.00 ? 56  LEU A CB   4  
ATOM 10378 C CG   . LEU A 1 56  ? -14.523 4.250   -4.244  1.00 0.00 ? 56  LEU A CG   4  
ATOM 10379 C CD1  . LEU A 1 56  ? -15.172 3.541   -3.070  1.00 0.00 ? 56  LEU A CD1  4  
ATOM 10380 C CD2  . LEU A 1 56  ? -15.567 4.642   -5.281  1.00 0.00 ? 56  LEU A CD2  4  
ATOM 10381 H H    . LEU A 1 56  ? -12.950 7.811   -4.157  1.00 0.00 ? 56  LEU A H    4  
ATOM 10382 H HA   . LEU A 1 56  ? -11.640 5.313   -4.135  1.00 0.00 ? 56  LEU A HA   4  
ATOM 10383 H HB2  . LEU A 1 56  ? -13.453 5.314   -2.741  1.00 0.00 ? 56  LEU A HB2  4  
ATOM 10384 H HB3  . LEU A 1 56  ? -14.407 6.327   -3.810  1.00 0.00 ? 56  LEU A HB3  4  
ATOM 10385 H HG   . LEU A 1 56  ? -13.832 3.567   -4.707  1.00 0.00 ? 56  LEU A HG   4  
ATOM 10386 H HD11 . LEU A 1 56  ? -16.136 3.160   -3.370  1.00 0.00 ? 56  LEU A HD11 4  
ATOM 10387 H HD12 . LEU A 1 56  ? -15.297 4.239   -2.255  1.00 0.00 ? 56  LEU A HD12 4  
ATOM 10388 H HD13 . LEU A 1 56  ? -14.543 2.723   -2.752  1.00 0.00 ? 56  LEU A HD13 4  
ATOM 10389 H HD21 . LEU A 1 56  ? -15.538 5.709   -5.437  1.00 0.00 ? 56  LEU A HD21 4  
ATOM 10390 H HD22 . LEU A 1 56  ? -16.548 4.355   -4.932  1.00 0.00 ? 56  LEU A HD22 4  
ATOM 10391 H HD23 . LEU A 1 56  ? -15.354 4.136   -6.212  1.00 0.00 ? 56  LEU A HD23 4  
ATOM 10392 N N    . ASP A 1 57  ? -13.555 5.964   -6.743  1.00 0.00 ? 57  ASP A N    4  
ATOM 10393 C CA   . ASP A 1 57  ? -13.816 5.613   -8.132  1.00 0.00 ? 57  ASP A CA   4  
ATOM 10394 C C    . ASP A 1 57  ? -12.548 5.745   -8.968  1.00 0.00 ? 57  ASP A C    4  
ATOM 10395 O O    . ASP A 1 57  ? -12.388 5.068   -9.984  1.00 0.00 ? 57  ASP A O    4  
ATOM 10396 C CB   . ASP A 1 57  ? -14.916 6.509   -8.703  1.00 0.00 ? 57  ASP A CB   4  
ATOM 10397 C CG   . ASP A 1 57  ? -15.785 5.786   -9.713  1.00 0.00 ? 57  ASP A CG   4  
ATOM 10398 O OD1  . ASP A 1 57  ? -16.067 4.588   -9.504  1.00 0.00 ? 57  ASP A OD1  4  
ATOM 10399 O OD2  . ASP A 1 57  ? -16.183 6.418   -10.714 1.00 0.00 ? 57  ASP A OD2  4  
ATOM 10400 H H    . ASP A 1 57  ? -14.058 6.695   -6.333  1.00 0.00 ? 57  ASP A H    4  
ATOM 10401 H HA   . ASP A 1 57  ? -14.147 4.587   -8.159  1.00 0.00 ? 57  ASP A HA   4  
ATOM 10402 H HB2  . ASP A 1 57  ? -15.546 6.850   -7.894  1.00 0.00 ? 57  ASP A HB2  4  
ATOM 10403 H HB3  . ASP A 1 57  ? -14.463 7.361   -9.187  1.00 0.00 ? 57  ASP A HB3  4  
ATOM 10404 N N    . ARG A 1 58  ? -11.647 6.618   -8.529  1.00 0.00 ? 58  ARG A N    4  
ATOM 10405 C CA   . ARG A 1 58  ? -10.392 6.841   -9.231  1.00 0.00 ? 58  ARG A CA   4  
ATOM 10406 C C    . ARG A 1 58  ? -9.523  5.589   -9.210  1.00 0.00 ? 58  ARG A C    4  
ATOM 10407 O O    . ARG A 1 58  ? -8.920  5.226   -10.219 1.00 0.00 ? 58  ARG A O    4  
ATOM 10408 C CB   . ARG A 1 58  ? -9.631  8.011   -8.601  1.00 0.00 ? 58  ARG A CB   4  
ATOM 10409 C CG   . ARG A 1 58  ? -9.863  9.337   -9.306  1.00 0.00 ? 58  ARG A CG   4  
ATOM 10410 C CD   . ARG A 1 58  ? -9.229  9.351   -10.687 1.00 0.00 ? 58  ARG A CD   4  
ATOM 10411 N NE   . ARG A 1 58  ? -9.719  10.457  -11.506 1.00 0.00 ? 58  ARG A NE   4  
ATOM 10412 C CZ   . ARG A 1 58  ? -9.277  11.708  -11.403 1.00 0.00 ? 58  ARG A CZ   4  
ATOM 10413 N NH1  . ARG A 1 58  ? -8.338  12.018  -10.517 1.00 0.00 ? 58  ARG A NH1  4  
ATOM 10414 N NH2  . ARG A 1 58  ? -9.776  12.653  -12.190 1.00 0.00 ? 58  ARG A NH2  4  
ATOM 10415 H H    . ARG A 1 58  ? -11.833 7.126   -7.712  1.00 0.00 ? 58  ARG A H    4  
ATOM 10416 H HA   . ARG A 1 58  ? -10.625 7.088   -10.255 1.00 0.00 ? 58  ARG A HA   4  
ATOM 10417 H HB2  . ARG A 1 58  ? -9.940  8.114   -7.572  1.00 0.00 ? 58  ARG A HB2  4  
ATOM 10418 H HB3  . ARG A 1 58  ? -8.573  7.795   -8.629  1.00 0.00 ? 58  ARG A HB3  4  
ATOM 10419 H HG2  . ARG A 1 58  ? -10.926 9.499   -9.408  1.00 0.00 ? 58  ARG A HG2  4  
ATOM 10420 H HG3  . ARG A 1 58  ? -9.431  10.130  -8.712  1.00 0.00 ? 58  ARG A HG3  4  
ATOM 10421 H HD2  . ARG A 1 58  ? -8.159  9.444   -10.576 1.00 0.00 ? 58  ARG A HD2  4  
ATOM 10422 H HD3  . ARG A 1 58  ? -9.458  8.419   -11.183 1.00 0.00 ? 58  ARG A HD3  4  
ATOM 10423 H HE   . ARG A 1 58  ? -10.413 10.256  -12.168 1.00 0.00 ? 58  ARG A HE   4  
ATOM 10424 H HH11 . ARG A 1 58  ? -7.958  11.312  -9.922  1.00 0.00 ? 58  ARG A HH11 4  
ATOM 10425 H HH12 . ARG A 1 58  ? -8.011  12.960  -10.446 1.00 0.00 ? 58  ARG A HH12 4  
ATOM 10426 H HH22 . ARG A 1 58  ? -9.444  13.593  -12.113 1.00 0.00 ? 58  ARG A HH22 4  
ATOM 10427 N N    . MET A 1 59  ? -9.451  4.936   -8.054  1.00 0.00 ? 59  MET A N    4  
ATOM 10428 C CA   . MET A 1 59  ? -8.642  3.734   -7.912  1.00 0.00 ? 59  MET A CA   4  
ATOM 10429 C C    . MET A 1 59  ? -9.113  2.629   -8.850  1.00 0.00 ? 59  MET A C    4  
ATOM 10430 O O    . MET A 1 59  ? -8.321  2.051   -9.593  1.00 0.00 ? 59  MET A O    4  
ATOM 10431 C CB   . MET A 1 59  ? -8.675  3.251   -6.448  1.00 0.00 ? 59  MET A CB   4  
ATOM 10432 C CG   . MET A 1 59  ? -9.438  1.945   -6.203  1.00 0.00 ? 59  MET A CG   4  
ATOM 10433 S SD   . MET A 1 59  ? -10.837 2.147   -5.092  1.00 0.00 ? 59  MET A SD   4  
ATOM 10434 C CE   . MET A 1 59  ? -9.973  2.688   -3.631  1.00 0.00 ? 59  MET A CE   4  
ATOM 10435 H H    . MET A 1 59  ? -9.946  5.272   -7.275  1.00 0.00 ? 59  MET A H    4  
ATOM 10436 H HA   . MET A 1 59  ? -7.626  3.992   -8.167  1.00 0.00 ? 59  MET A HA   4  
ATOM 10437 H HB2  . MET A 1 59  ? -7.659  3.106   -6.114  1.00 0.00 ? 59  MET A HB2  4  
ATOM 10438 H HB3  . MET A 1 59  ? -9.129  4.022   -5.844  1.00 0.00 ? 59  MET A HB3  4  
ATOM 10439 H HG2  . MET A 1 59  ? -9.798  1.557   -7.135  1.00 0.00 ? 59  MET A HG2  4  
ATOM 10440 H HG3  . MET A 1 59  ? -8.762  1.234   -5.769  1.00 0.00 ? 59  MET A HG3  4  
ATOM 10441 H HE1  . MET A 1 59  ? -9.000  3.057   -3.918  1.00 0.00 ? 59  MET A HE1  4  
ATOM 10442 H HE2  . MET A 1 59  ? -9.860  1.859   -2.950  1.00 0.00 ? 59  MET A HE2  4  
ATOM 10443 H HE3  . MET A 1 59  ? -10.532 3.477   -3.156  1.00 0.00 ? 59  MET A HE3  4  
ATOM 10444 N N    . MET A 1 60  ? -10.401 2.316   -8.779  1.00 0.00 ? 60  MET A N    4  
ATOM 10445 C CA   . MET A 1 60  ? -10.972 1.253   -9.583  1.00 0.00 ? 60  MET A CA   4  
ATOM 10446 C C    . MET A 1 60  ? -11.106 1.653   -11.048 1.00 0.00 ? 60  MET A C    4  
ATOM 10447 O O    . MET A 1 60  ? -10.983 0.810   -11.936 1.00 0.00 ? 60  MET A O    4  
ATOM 10448 C CB   . MET A 1 60  ? -12.315 0.828   -8.995  1.00 0.00 ? 60  MET A CB   4  
ATOM 10449 C CG   . MET A 1 60  ? -12.171 0.008   -7.715  1.00 0.00 ? 60  MET A CG   4  
ATOM 10450 S SD   . MET A 1 60  ? -12.687 -1.703  -7.932  1.00 0.00 ? 60  MET A SD   4  
ATOM 10451 C CE   . MET A 1 60  ? -11.846 -2.105  -9.460  1.00 0.00 ? 60  MET A CE   4  
ATOM 10452 H H    . MET A 1 60  ? -10.975 2.795   -8.142  1.00 0.00 ? 60  MET A H    4  
ATOM 10453 H HA   . MET A 1 60  ? -10.296 0.413   -9.526  1.00 0.00 ? 60  MET A HA   4  
ATOM 10454 H HB2  . MET A 1 60  ? -12.895 1.712   -8.771  1.00 0.00 ? 60  MET A HB2  4  
ATOM 10455 H HB3  . MET A 1 60  ? -12.845 0.234   -9.724  1.00 0.00 ? 60  MET A HB3  4  
ATOM 10456 H HG2  . MET A 1 60  ? -11.130 0.014   -7.408  1.00 0.00 ? 60  MET A HG2  4  
ATOM 10457 H HG3  . MET A 1 60  ? -12.776 0.459   -6.942  1.00 0.00 ? 60  MET A HG3  4  
ATOM 10458 H HE1  . MET A 1 60  ? -12.573 -2.360  -10.216 1.00 0.00 ? 60  MET A HE1  4  
ATOM 10459 H HE2  . MET A 1 60  ? -11.184 -2.942  -9.297  1.00 0.00 ? 60  MET A HE2  4  
ATOM 10460 H HE3  . MET A 1 60  ? -11.270 -1.250  -9.787  1.00 0.00 ? 60  MET A HE3  4  
ATOM 10461 N N    . LYS A 1 61  ? -11.337 2.935   -11.308 1.00 0.00 ? 61  LYS A N    4  
ATOM 10462 C CA   . LYS A 1 61  ? -11.453 3.405   -12.683 1.00 0.00 ? 61  LYS A CA   4  
ATOM 10463 C C    . LYS A 1 61  ? -10.060 3.537   -13.296 1.00 0.00 ? 61  LYS A C    4  
ATOM 10464 O O    . LYS A 1 61  ? -9.784  2.984   -14.361 1.00 0.00 ? 61  LYS A O    4  
ATOM 10465 C CB   . LYS A 1 61  ? -12.229 4.731   -12.754 1.00 0.00 ? 61  LYS A CB   4  
ATOM 10466 C CG   . LYS A 1 61  ? -11.424 5.963   -12.373 1.00 0.00 ? 61  LYS A CG   4  
ATOM 10467 C CD   . LYS A 1 61  ? -10.663 6.525   -13.565 1.00 0.00 ? 61  LYS A CD   4  
ATOM 10468 C CE   . LYS A 1 61  ? -10.913 8.015   -13.735 1.00 0.00 ? 61  LYS A CE   4  
ATOM 10469 N NZ   . LYS A 1 61  ? -11.015 8.402   -15.169 1.00 0.00 ? 61  LYS A NZ   4  
ATOM 10470 H H    . LYS A 1 61  ? -11.413 3.574   -10.569 1.00 0.00 ? 61  LYS A H    4  
ATOM 10471 H HA   . LYS A 1 61  ? -11.996 2.652   -13.235 1.00 0.00 ? 61  LYS A HA   4  
ATOM 10472 H HB2  . LYS A 1 61  ? -12.586 4.866   -13.764 1.00 0.00 ? 61  LYS A HB2  4  
ATOM 10473 H HB3  . LYS A 1 61  ? -13.079 4.667   -12.091 1.00 0.00 ? 61  LYS A HB3  4  
ATOM 10474 H HG2  . LYS A 1 61  ? -12.100 6.720   -12.003 1.00 0.00 ? 61  LYS A HG2  4  
ATOM 10475 H HG3  . LYS A 1 61  ? -10.722 5.700   -11.599 1.00 0.00 ? 61  LYS A HG3  4  
ATOM 10476 H HD2  . LYS A 1 61  ? -9.607  6.364   -13.415 1.00 0.00 ? 61  LYS A HD2  4  
ATOM 10477 H HD3  . LYS A 1 61  ? -10.984 6.012   -14.460 1.00 0.00 ? 61  LYS A HD3  4  
ATOM 10478 H HE2  . LYS A 1 61  ? -11.836 8.271   -13.236 1.00 0.00 ? 61  LYS A HE2  4  
ATOM 10479 H HE3  . LYS A 1 61  ? -10.098 8.557   -13.280 1.00 0.00 ? 61  LYS A HE3  4  
ATOM 10480 H HZ1  . LYS A 1 61  ? -12.013 8.444   -15.458 1.00 0.00 ? 61  LYS A HZ1  4  
ATOM 10481 H HZ2  . LYS A 1 61  ? -10.522 7.706   -15.763 1.00 0.00 ? 61  LYS A HZ2  4  
ATOM 10482 H HZ3  . LYS A 1 61  ? -10.582 9.336   -15.318 1.00 0.00 ? 61  LYS A HZ3  4  
ATOM 10483 N N    . LYS A 1 62  ? -9.173  4.243   -12.595 1.00 0.00 ? 62  LYS A N    4  
ATOM 10484 C CA   . LYS A 1 62  ? -7.795  4.413   -13.042 1.00 0.00 ? 62  LYS A CA   4  
ATOM 10485 C C    . LYS A 1 62  ? -6.948  3.194   -12.670 1.00 0.00 ? 62  LYS A C    4  
ATOM 10486 O O    . LYS A 1 62  ? -5.734  3.187   -12.875 1.00 0.00 ? 62  LYS A O    4  
ATOM 10487 C CB   . LYS A 1 62  ? -7.185  5.675   -12.426 1.00 0.00 ? 62  LYS A CB   4  
ATOM 10488 C CG   . LYS A 1 62  ? -5.810  6.016   -12.977 1.00 0.00 ? 62  LYS A CG   4  
ATOM 10489 C CD   . LYS A 1 62  ? -4.719  5.767   -11.947 1.00 0.00 ? 62  LYS A CD   4  
ATOM 10490 C CE   . LYS A 1 62  ? -3.335  5.979   -12.539 1.00 0.00 ? 62  LYS A CE   4  
ATOM 10491 N NZ   . LYS A 1 62  ? -2.992  4.935   -13.544 1.00 0.00 ? 62  LYS A NZ   4  
ATOM 10492 H H    . LYS A 1 62  ? -9.444  4.631   -11.739 1.00 0.00 ? 62  LYS A H    4  
ATOM 10493 H HA   . LYS A 1 62  ? -7.805  4.517   -14.117 1.00 0.00 ? 62  LYS A HA   4  
ATOM 10494 H HB2  . LYS A 1 62  ? -7.842  6.510   -12.616 1.00 0.00 ? 62  LYS A HB2  4  
ATOM 10495 H HB3  . LYS A 1 62  ? -7.096  5.533   -11.359 1.00 0.00 ? 62  LYS A HB3  4  
ATOM 10496 H HG2  . LYS A 1 62  ? -5.618  5.403   -13.845 1.00 0.00 ? 62  LYS A HG2  4  
ATOM 10497 H HG3  . LYS A 1 62  ? -5.794  7.059   -13.259 1.00 0.00 ? 62  LYS A HG3  4  
ATOM 10498 H HD2  . LYS A 1 62  ? -4.854  6.448   -11.122 1.00 0.00 ? 62  LYS A HD2  4  
ATOM 10499 H HD3  . LYS A 1 62  ? -4.798  4.748   -11.594 1.00 0.00 ? 62  LYS A HD3  4  
ATOM 10500 H HE2  . LYS A 1 62  ? -3.305  6.948   -13.015 1.00 0.00 ? 62  LYS A HE2  4  
ATOM 10501 H HE3  . LYS A 1 62  ? -2.608  5.950   -11.740 1.00 0.00 ? 62  LYS A HE3  4  
ATOM 10502 H HZ1  . LYS A 1 62  ? -2.512  5.368   -14.359 1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 10503 H HZ2  . LYS A 1 62  ? -3.856  4.462   -13.878 1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 10504 H HZ3  . LYS A 1 62  ? -2.361  4.225   -13.122 1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 10505 N N    . LEU A 1 63  ? -7.592  2.172   -12.100 1.00 0.00 ? 63  LEU A N    4  
ATOM 10506 C CA   . LEU A 1 63  ? -6.902  0.958   -11.672 1.00 0.00 ? 63  LEU A CA   4  
ATOM 10507 C C    . LEU A 1 63  ? -5.912  0.469   -12.713 1.00 0.00 ? 63  LEU A C    4  
ATOM 10508 O O    . LEU A 1 63  ? -4.888  -0.125  -12.374 1.00 0.00 ? 63  LEU A O    4  
ATOM 10509 C CB   . LEU A 1 63  ? -7.919  -0.140  -11.316 1.00 0.00 ? 63  LEU A CB   4  
ATOM 10510 C CG   . LEU A 1 63  ? -8.438  -0.992  -12.481 1.00 0.00 ? 63  LEU A CG   4  
ATOM 10511 C CD1  . LEU A 1 63  ? -9.461  -2.004  -11.982 1.00 0.00 ? 63  LEU A CD1  4  
ATOM 10512 C CD2  . LEU A 1 63  ? -9.039  -0.117  -13.573 1.00 0.00 ? 63  LEU A CD2  4  
ATOM 10513 H H    . LEU A 1 63  ? -8.555  2.244   -11.945 1.00 0.00 ? 63  LEU A H    4  
ATOM 10514 H HA   . LEU A 1 63  ? -6.346  1.204   -10.794 1.00 0.00 ? 63  LEU A HA   4  
ATOM 10515 H HB2  . LEU A 1 63  ? -7.460  -0.801  -10.597 1.00 0.00 ? 63  LEU A HB2  4  
ATOM 10516 H HB3  . LEU A 1 63  ? -8.769  0.332   -10.845 1.00 0.00 ? 63  LEU A HB3  4  
ATOM 10517 H HG   . LEU A 1 63  ? -7.616  -1.541  -12.907 1.00 0.00 ? 63  LEU A HG   4  
ATOM 10518 H HD11 . LEU A 1 63  ? -10.333 -1.982  -12.620 1.00 0.00 ? 63  LEU A HD11 4  
ATOM 10519 H HD12 . LEU A 1 63  ? -9.751  -1.758  -10.970 1.00 0.00 ? 63  LEU A HD12 4  
ATOM 10520 H HD13 . LEU A 1 63  ? -9.028  -2.993  -12.001 1.00 0.00 ? 63  LEU A HD13 4  
ATOM 10521 H HD21 . LEU A 1 63  ? -10.012 -0.499  -13.848 1.00 0.00 ? 63  LEU A HD21 4  
ATOM 10522 H HD22 . LEU A 1 63  ? -8.393  -0.127  -14.438 1.00 0.00 ? 63  LEU A HD22 4  
ATOM 10523 H HD23 . LEU A 1 63  ? -9.142  0.894   -13.212 1.00 0.00 ? 63  LEU A HD23 4  
ATOM 10524 N N    . ASP A 1 64  ? -6.213  0.739   -13.973 1.00 0.00 ? 64  ASP A N    4  
ATOM 10525 C CA   . ASP A 1 64  ? -5.352  0.347   -15.081 1.00 0.00 ? 64  ASP A CA   4  
ATOM 10526 C C    . ASP A 1 64  ? -4.609  -0.961  -14.803 1.00 0.00 ? 64  ASP A C    4  
ATOM 10527 O O    . ASP A 1 64  ? -3.445  -1.116  -15.174 1.00 0.00 ? 64  ASP A O    4  
ATOM 10528 C CB   . ASP A 1 64  ? -4.351  1.460   -15.395 1.00 0.00 ? 64  ASP A CB   4  
ATOM 10529 C CG   . ASP A 1 64  ? -3.569  1.195   -16.665 1.00 0.00 ? 64  ASP A CG   4  
ATOM 10530 O OD1  . ASP A 1 64  ? -4.174  1.248   -17.757 1.00 0.00 ? 64  ASP A OD1  4  
ATOM 10531 O OD2  . ASP A 1 64  ? -2.351  0.935   -16.570 1.00 0.00 ? 64  ASP A OD2  4  
ATOM 10532 H H    . ASP A 1 64  ? -7.037  1.229   -14.167 1.00 0.00 ? 64  ASP A H    4  
ATOM 10533 H HA   . ASP A 1 64  ? -5.988  0.206   -15.926 1.00 0.00 ? 64  ASP A HA   4  
ATOM 10534 H HB2  . ASP A 1 64  ? -4.884  2.393   -15.509 1.00 0.00 ? 64  ASP A HB2  4  
ATOM 10535 H HB3  . ASP A 1 64  ? -3.653  1.549   -14.575 1.00 0.00 ? 64  ASP A HB3  4  
ATOM 10536 N N    . LEU A 1 65  ? -5.289  -1.894  -14.146 1.00 0.00 ? 65  LEU A N    4  
ATOM 10537 C CA   . LEU A 1 65  ? -4.695  -3.184  -13.815 1.00 0.00 ? 65  LEU A CA   4  
ATOM 10538 C C    . LEU A 1 65  ? -5.773  -4.230  -13.525 1.00 0.00 ? 65  LEU A C    4  
ATOM 10539 O O    . LEU A 1 65  ? -5.526  -5.215  -12.830 1.00 0.00 ? 65  LEU A O    4  
ATOM 10540 C CB   . LEU A 1 65  ? -3.742  -3.030  -12.618 1.00 0.00 ? 65  LEU A CB   4  
ATOM 10541 C CG   . LEU A 1 65  ? -4.352  -3.256  -11.228 1.00 0.00 ? 65  LEU A CG   4  
ATOM 10542 C CD1  . LEU A 1 65  ? -3.327  -2.955  -10.144 1.00 0.00 ? 65  LEU A CD1  4  
ATOM 10543 C CD2  . LEU A 1 65  ? -5.601  -2.404  -11.032 1.00 0.00 ? 65  LEU A CD2  4  
ATOM 10544 H H    . LEU A 1 65  ? -6.208  -1.710  -13.876 1.00 0.00 ? 65  LEU A H    4  
ATOM 10545 H HA   . LEU A 1 65  ? -4.125  -3.510  -14.670 1.00 0.00 ? 65  LEU A HA   4  
ATOM 10546 H HB2  . LEU A 1 65  ? -2.931  -3.733  -12.745 1.00 0.00 ? 65  LEU A HB2  4  
ATOM 10547 H HB3  . LEU A 1 65  ? -3.331  -2.033  -12.645 1.00 0.00 ? 65  LEU A HB3  4  
ATOM 10548 H HG   . LEU A 1 65  ? -4.636  -4.293  -11.135 1.00 0.00 ? 65  LEU A HG   4  
ATOM 10549 H HD11 . LEU A 1 65  ? -3.340  -3.744  -9.407  1.00 0.00 ? 65  LEU A HD11 4  
ATOM 10550 H HD12 . LEU A 1 65  ? -3.570  -2.016  -9.669  1.00 0.00 ? 65  LEU A HD12 4  
ATOM 10551 H HD13 . LEU A 1 65  ? -2.344  -2.891  -10.585 1.00 0.00 ? 65  LEU A HD13 4  
ATOM 10552 H HD21 . LEU A 1 65  ? -6.104  -2.278  -11.977 1.00 0.00 ? 65  LEU A HD21 4  
ATOM 10553 H HD22 . LEU A 1 65  ? -5.321  -1.437  -10.641 1.00 0.00 ? 65  LEU A HD22 4  
ATOM 10554 H HD23 . LEU A 1 65  ? -6.267  -2.892  -10.332 1.00 0.00 ? 65  LEU A HD23 4  
ATOM 10555 N N    . ASN A 1 66  ? -6.967  -4.014  -14.071 1.00 0.00 ? 66  ASN A N    4  
ATOM 10556 C CA   . ASN A 1 66  ? -8.076  -4.939  -13.874 1.00 0.00 ? 66  ASN A CA   4  
ATOM 10557 C C    . ASN A 1 66  ? -7.735  -6.320  -14.423 1.00 0.00 ? 66  ASN A C    4  
ATOM 10558 O O    . ASN A 1 66  ? -6.605  -6.571  -14.843 1.00 0.00 ? 66  ASN A O    4  
ATOM 10559 C CB   . ASN A 1 66  ? -9.339  -4.405  -14.554 1.00 0.00 ? 66  ASN A CB   4  
ATOM 10560 C CG   . ASN A 1 66  ? -9.169  -4.254  -16.053 1.00 0.00 ? 66  ASN A CG   4  
ATOM 10561 O OD1  . ASN A 1 66  ? -8.158  -4.671  -16.620 1.00 0.00 ? 66  ASN A OD1  4  
ATOM 10562 N ND2  . ASN A 1 66  ? -10.158 -3.654  -16.704 1.00 0.00 ? 66  ASN A ND2  4  
ATOM 10563 H H    . ASN A 1 66  ? -7.105  -3.216  -14.622 1.00 0.00 ? 66  ASN A H    4  
ATOM 10564 H HA   . ASN A 1 66  ? -8.257  -5.020  -12.813 1.00 0.00 ? 66  ASN A HA   4  
ATOM 10565 H HB2  . ASN A 1 66  ? -10.155 -5.087  -14.371 1.00 0.00 ? 66  ASN A HB2  4  
ATOM 10566 H HB3  . ASN A 1 66  ? -9.583  -3.438  -14.139 1.00 0.00 ? 66  ASN A HB3  4  
ATOM 10567 H HD21 . ASN A 1 66  ? -10.935 -3.347  -16.184 1.00 0.00 ? 66  ASN A HD21 4  
ATOM 10568 H HD22 . ASN A 1 66  ? -10.073 -3.544  -17.678 1.00 0.00 ? 66  ASN A HD22 4  
ATOM 10569 N N    . SER A 1 67  ? -8.717  -7.213  -14.414 1.00 0.00 ? 67  SER A N    4  
ATOM 10570 C CA   . SER A 1 67  ? -8.521  -8.570  -14.911 1.00 0.00 ? 67  SER A CA   4  
ATOM 10571 C C    . SER A 1 67  ? -9.824  -9.360  -14.855 1.00 0.00 ? 67  SER A C    4  
ATOM 10572 O O    . SER A 1 67  ? -10.537 -9.331  -13.853 1.00 0.00 ? 67  SER A O    4  
ATOM 10573 C CB   . SER A 1 67  ? -7.444  -9.284  -14.093 1.00 0.00 ? 67  SER A CB   4  
ATOM 10574 O OG   . SER A 1 67  ? -6.153  -9.028  -14.615 1.00 0.00 ? 67  SER A OG   4  
ATOM 10575 H H    . SER A 1 67  ? -9.596  -6.955  -14.066 1.00 0.00 ? 67  SER A H    4  
ATOM 10576 H HA   . SER A 1 67  ? -8.197  -8.504  -15.938 1.00 0.00 ? 67  SER A HA   4  
ATOM 10577 H HB2  . SER A 1 67  ? -7.481  -8.936  -13.070 1.00 0.00 ? 67  SER A HB2  4  
ATOM 10578 H HB3  . SER A 1 67  ? -7.624  -10.349 -14.116 1.00 0.00 ? 67  SER A HB3  4  
ATOM 10579 H HG   . SER A 1 67  ? -5.906  -8.119  -14.429 1.00 0.00 ? 67  SER A HG   4  
ATOM 10580 N N    . ASP A 1 68  ? -10.127 -10.068 -15.938 1.00 0.00 ? 68  ASP A N    4  
ATOM 10581 C CA   . ASP A 1 68  ? -11.344 -10.870 -16.011 1.00 0.00 ? 68  ASP A CA   4  
ATOM 10582 C C    . ASP A 1 68  ? -11.411 -11.865 -14.857 1.00 0.00 ? 68  ASP A C    4  
ATOM 10583 O O    . ASP A 1 68  ? -12.492 -12.321 -14.479 1.00 0.00 ? 68  ASP A O    4  
ATOM 10584 C CB   . ASP A 1 68  ? -11.409 -11.614 -17.346 1.00 0.00 ? 68  ASP A CB   4  
ATOM 10585 C CG   . ASP A 1 68  ? -12.825 -12.010 -17.718 1.00 0.00 ? 68  ASP A CG   4  
ATOM 10586 O OD1  . ASP A 1 68  ? -13.744 -11.187 -17.522 1.00 0.00 ? 68  ASP A OD1  4  
ATOM 10587 O OD2  . ASP A 1 68  ? -13.016 -13.144 -18.206 1.00 0.00 ? 68  ASP A OD2  4  
ATOM 10588 H H    . ASP A 1 68  ? -9.518  -10.053 -16.706 1.00 0.00 ? 68  ASP A H    4  
ATOM 10589 H HA   . ASP A 1 68  ? -12.187 -10.199 -15.942 1.00 0.00 ? 68  ASP A HA   4  
ATOM 10590 H HB2  . ASP A 1 68  ? -11.018 -10.979 -18.125 1.00 0.00 ? 68  ASP A HB2  4  
ATOM 10591 H HB3  . ASP A 1 68  ? -10.809 -12.510 -17.281 1.00 0.00 ? 68  ASP A HB3  4  
ATOM 10592 N N    . GLY A 1 69  ? -10.251 -12.200 -14.299 1.00 0.00 ? 69  GLY A N    4  
ATOM 10593 C CA   . GLY A 1 69  ? -10.202 -13.138 -13.194 1.00 0.00 ? 69  GLY A CA   4  
ATOM 10594 C C    . GLY A 1 69  ? -10.744 -12.549 -11.906 1.00 0.00 ? 69  GLY A C    4  
ATOM 10595 O O    . GLY A 1 69  ? -11.939 -12.639 -11.629 1.00 0.00 ? 69  GLY A O    4  
ATOM 10596 H H    . GLY A 1 69  ? -9.421  -11.807 -14.640 1.00 0.00 ? 69  GLY A H    4  
ATOM 10597 H HA2  . GLY A 1 69  ? -10.787 -14.009 -13.450 1.00 0.00 ? 69  GLY A HA2  4  
ATOM 10598 H HA3  . GLY A 1 69  ? -9.178  -13.439 -13.037 1.00 0.00 ? 69  GLY A HA3  4  
ATOM 10599 N N    . GLN A 1 70  ? -9.860  -11.947 -11.114 1.00 0.00 ? 70  GLN A N    4  
ATOM 10600 C CA   . GLN A 1 70  ? -10.255 -11.346 -9.848  1.00 0.00 ? 70  GLN A CA   4  
ATOM 10601 C C    . GLN A 1 70  ? -9.368  -10.150 -9.509  1.00 0.00 ? 70  GLN A C    4  
ATOM 10602 O O    . GLN A 1 70  ? -8.584  -9.696  -10.342 1.00 0.00 ? 70  GLN A O    4  
ATOM 10603 C CB   . GLN A 1 70  ? -10.184 -12.390 -8.730  1.00 0.00 ? 70  GLN A CB   4  
ATOM 10604 C CG   . GLN A 1 70  ? -11.460 -13.199 -8.573  1.00 0.00 ? 70  GLN A CG   4  
ATOM 10605 C CD   . GLN A 1 70  ? -12.507 -12.472 -7.755  1.00 0.00 ? 70  GLN A CD   4  
ATOM 10606 O OE1  . GLN A 1 70  ? -12.905 -12.931 -6.685  1.00 0.00 ? 70  GLN A OE1  4  
ATOM 10607 N NE2  . GLN A 1 70  ? -12.964 -11.331 -8.260  1.00 0.00 ? 70  GLN A NE2  4  
ATOM 10608 H H    . GLN A 1 70  ? -8.923  -11.909 -11.387 1.00 0.00 ? 70  GLN A H    4  
ATOM 10609 H HA   . GLN A 1 70  ? -11.269 -11.006 -9.949  1.00 0.00 ? 70  GLN A HA   4  
ATOM 10610 H HB2  . GLN A 1 70  ? -9.374  -13.073 -8.943  1.00 0.00 ? 70  GLN A HB2  4  
ATOM 10611 H HB3  . GLN A 1 70  ? -9.983  -11.890 -7.795  1.00 0.00 ? 70  GLN A HB3  4  
ATOM 10612 H HG2  . GLN A 1 70  ? -11.867 -13.402 -9.552  1.00 0.00 ? 70  GLN A HG2  4  
ATOM 10613 H HG3  . GLN A 1 70  ? -11.224 -14.131 -8.082  1.00 0.00 ? 70  GLN A HG3  4  
ATOM 10614 H HE21 . GLN A 1 70  ? -12.609 -11.031 -9.123  1.00 0.00 ? 70  GLN A HE21 4  
ATOM 10615 H HE22 . GLN A 1 70  ? -13.625 -10.829 -7.743  1.00 0.00 ? 70  GLN A HE22 4  
ATOM 10616 N N    . LEU A 1 71  ? -9.498  -9.643  -8.282  1.00 0.00 ? 71  LEU A N    4  
ATOM 10617 C CA   . LEU A 1 71  ? -8.707  -8.504  -7.836  1.00 0.00 ? 71  LEU A CA   4  
ATOM 10618 C C    . LEU A 1 71  ? -7.208  -8.864  -7.875  1.00 0.00 ? 71  LEU A C    4  
ATOM 10619 O O    . LEU A 1 71  ? -6.736  -9.364  -8.893  1.00 0.00 ? 71  LEU A O    4  
ATOM 10620 C CB   . LEU A 1 71  ? -9.181  -8.067  -6.435  1.00 0.00 ? 71  LEU A CB   4  
ATOM 10621 C CG   . LEU A 1 71  ? -9.968  -6.747  -6.351  1.00 0.00 ? 71  LEU A CG   4  
ATOM 10622 C CD1  . LEU A 1 71  ? -9.083  -5.625  -5.825  1.00 0.00 ? 71  LEU A CD1  4  
ATOM 10623 C CD2  . LEU A 1 71  ? -10.577 -6.366  -7.696  1.00 0.00 ? 71  LEU A CD2  4  
ATOM 10624 H H    . LEU A 1 71  ? -10.140 -10.045 -7.663  1.00 0.00 ? 71  LEU A H    4  
ATOM 10625 H HA   . LEU A 1 71  ? -8.880  -7.704  -8.534  1.00 0.00 ? 71  LEU A HA   4  
ATOM 10626 H HB2  . LEU A 1 71  ? -9.812  -8.846  -6.044  1.00 0.00 ? 71  LEU A HB2  4  
ATOM 10627 H HB3  . LEU A 1 71  ? -8.328  -7.979  -5.798  1.00 0.00 ? 71  LEU A HB3  4  
ATOM 10628 H HG   . LEU A 1 71  ? -10.778 -6.873  -5.648  1.00 0.00 ? 71  LEU A HG   4  
ATOM 10629 H HD11 . LEU A 1 71  ? -9.404  -5.348  -4.829  1.00 0.00 ? 71  LEU A HD11 4  
ATOM 10630 H HD12 . LEU A 1 71  ? -9.160  -4.769  -6.478  1.00 0.00 ? 71  LEU A HD12 4  
ATOM 10631 H HD13 . LEU A 1 71  ? -8.056  -5.963  -5.789  1.00 0.00 ? 71  LEU A HD13 4  
ATOM 10632 H HD21 . LEU A 1 71  ? -11.243 -5.531  -7.563  1.00 0.00 ? 71  LEU A HD21 4  
ATOM 10633 H HD22 . LEU A 1 71  ? -11.128 -7.207  -8.092  1.00 0.00 ? 71  LEU A HD22 4  
ATOM 10634 H HD23 . LEU A 1 71  ? -9.792  -6.093  -8.384  1.00 0.00 ? 71  LEU A HD23 4  
ATOM 10635 N N    . ASP A 1 72  ? -6.455  -8.630  -6.788  1.00 0.00 ? 72  ASP A N    4  
ATOM 10636 C CA   . ASP A 1 72  ? -5.023  -8.960  -6.766  1.00 0.00 ? 72  ASP A CA   4  
ATOM 10637 C C    . ASP A 1 72  ? -4.325  -8.314  -5.571  1.00 0.00 ? 72  ASP A C    4  
ATOM 10638 O O    . ASP A 1 72  ? -4.822  -7.353  -4.988  1.00 0.00 ? 72  ASP A O    4  
ATOM 10639 C CB   . ASP A 1 72  ? -4.333  -8.528  -8.070  1.00 0.00 ? 72  ASP A CB   4  
ATOM 10640 C CG   . ASP A 1 72  ? -2.826  -8.699  -8.023  1.00 0.00 ? 72  ASP A CG   4  
ATOM 10641 O OD1  . ASP A 1 72  ? -2.133  -7.748  -7.605  1.00 0.00 ? 72  ASP A OD1  4  
ATOM 10642 O OD2  . ASP A 1 72  ? -2.340  -9.785  -8.404  1.00 0.00 ? 72  ASP A OD2  4  
ATOM 10643 H H    . ASP A 1 72  ? -6.862  -8.242  -5.986  1.00 0.00 ? 72  ASP A H    4  
ATOM 10644 H HA   . ASP A 1 72  ? -4.940  -10.032 -6.671  1.00 0.00 ? 72  ASP A HA   4  
ATOM 10645 H HB2  . ASP A 1 72  ? -4.712  -9.127  -8.883  1.00 0.00 ? 72  ASP A HB2  4  
ATOM 10646 H HB3  . ASP A 1 72  ? -4.553  -7.491  -8.259  1.00 0.00 ? 72  ASP A HB3  4  
ATOM 10647 N N    . PHE A 1 73  ? -3.169  -8.867  -5.215  1.00 0.00 ? 73  PHE A N    4  
ATOM 10648 C CA   . PHE A 1 73  ? -2.387  -8.380  -4.084  1.00 0.00 ? 73  PHE A CA   4  
ATOM 10649 C C    . PHE A 1 73  ? -2.160  -6.866  -4.121  1.00 0.00 ? 73  PHE A C    4  
ATOM 10650 O O    . PHE A 1 73  ? -2.535  -6.162  -3.181  1.00 0.00 ? 73  PHE A O    4  
ATOM 10651 C CB   . PHE A 1 73  ? -1.047  -9.116  -4.012  1.00 0.00 ? 73  PHE A CB   4  
ATOM 10652 C CG   . PHE A 1 73  ? -0.086  -8.747  -5.104  1.00 0.00 ? 73  PHE A CG   4  
ATOM 10653 C CD1  . PHE A 1 73  ? -0.226  -9.273  -6.378  1.00 0.00 ? 73  PHE A CD1  4  
ATOM 10654 C CD2  . PHE A 1 73  ? 0.957   -7.871  -4.854  1.00 0.00 ? 73  PHE A CD2  4  
ATOM 10655 C CE1  . PHE A 1 73  ? 0.658   -8.932  -7.384  1.00 0.00 ? 73  PHE A CE1  4  
ATOM 10656 C CE2  . PHE A 1 73  ? 1.844   -7.526  -5.856  1.00 0.00 ? 73  PHE A CE2  4  
ATOM 10657 C CZ   . PHE A 1 73  ? 1.694   -8.057  -7.123  1.00 0.00 ? 73  PHE A CZ   4  
ATOM 10658 H H    . PHE A 1 73  ? -2.837  -9.636  -5.723  1.00 0.00 ? 73  PHE A H    4  
ATOM 10659 H HA   . PHE A 1 73  ? -2.943  -8.612  -3.190  1.00 0.00 ? 73  PHE A HA   4  
ATOM 10660 H HB2  . PHE A 1 73  ? -0.578  -8.888  -3.069  1.00 0.00 ? 73  PHE A HB2  4  
ATOM 10661 H HB3  . PHE A 1 73  ? -1.226  -10.180 -4.070  1.00 0.00 ? 73  PHE A HB3  4  
ATOM 10662 H HD1  . PHE A 1 73  ? -1.036  -9.957  -6.583  1.00 0.00 ? 73  PHE A HD1  4  
ATOM 10663 H HD2  . PHE A 1 73  ? 1.077   -7.457  -3.862  1.00 0.00 ? 73  PHE A HD2  4  
ATOM 10664 H HE1  . PHE A 1 73  ? 0.537   -9.349  -8.373  1.00 0.00 ? 73  PHE A HE1  4  
ATOM 10665 H HE2  . PHE A 1 73  ? 2.653   -6.841  -5.649  1.00 0.00 ? 73  PHE A HE2  4  
ATOM 10666 H HZ   . PHE A 1 73  ? 2.385   -7.788  -7.907  1.00 0.00 ? 73  PHE A HZ   4  
ATOM 10667 N N    . GLN A 1 74  ? -1.539  -6.356  -5.185  1.00 0.00 ? 74  GLN A N    4  
ATOM 10668 C CA   . GLN A 1 74  ? -1.278  -4.924  -5.272  1.00 0.00 ? 74  GLN A CA   4  
ATOM 10669 C C    . GLN A 1 74  ? -2.532  -4.158  -5.641  1.00 0.00 ? 74  GLN A C    4  
ATOM 10670 O O    . GLN A 1 74  ? -2.680  -3.004  -5.254  1.00 0.00 ? 74  GLN A O    4  
ATOM 10671 C CB   . GLN A 1 74  ? -0.166  -4.598  -6.270  1.00 0.00 ? 74  GLN A CB   4  
ATOM 10672 C CG   . GLN A 1 74  ? 0.147   -3.104  -6.359  1.00 0.00 ? 74  GLN A CG   4  
ATOM 10673 C CD   . GLN A 1 74  ? 0.218   -2.429  -4.993  1.00 0.00 ? 74  GLN A CD   4  
ATOM 10674 O OE1  . GLN A 1 74  ? 0.789   -2.979  -4.052  1.00 0.00 ? 74  GLN A OE1  4  
ATOM 10675 N NE2  . GLN A 1 74  ? -0.362  -1.231  -4.877  1.00 0.00 ? 74  GLN A NE2  4  
ATOM 10676 H H    . GLN A 1 74  ? -1.249  -6.945  -5.910  1.00 0.00 ? 74  GLN A H    4  
ATOM 10677 H HA   . GLN A 1 74  ? -0.963  -4.598  -4.291  1.00 0.00 ? 74  GLN A HA   4  
ATOM 10678 H HB2  . GLN A 1 74  ? 0.734   -5.118  -5.974  1.00 0.00 ? 74  GLN A HB2  4  
ATOM 10679 H HB3  . GLN A 1 74  ? -0.464  -4.941  -7.250  1.00 0.00 ? 74  GLN A HB3  4  
ATOM 10680 H HG2  . GLN A 1 74  ? 1.098   -2.978  -6.853  1.00 0.00 ? 74  GLN A HG2  4  
ATOM 10681 H HG3  . GLN A 1 74  ? -0.626  -2.623  -6.941  1.00 0.00 ? 74  GLN A HG3  4  
ATOM 10682 H HE21 . GLN A 1 74  ? -0.801  -0.845  -5.666  1.00 0.00 ? 74  GLN A HE21 4  
ATOM 10683 H HE22 . GLN A 1 74  ? -0.326  -0.781  -4.002  1.00 0.00 ? 74  GLN A HE22 4  
ATOM 10684 N N    . GLU A 1 75  ? -3.440  -4.790  -6.383  1.00 0.00 ? 75  GLU A N    4  
ATOM 10685 C CA   . GLU A 1 75  ? -4.676  -4.118  -6.768  1.00 0.00 ? 75  GLU A CA   4  
ATOM 10686 C C    . GLU A 1 75  ? -5.257  -3.397  -5.568  1.00 0.00 ? 75  GLU A C    4  
ATOM 10687 O O    . GLU A 1 75  ? -5.587  -2.222  -5.643  1.00 0.00 ? 75  GLU A O    4  
ATOM 10688 C CB   . GLU A 1 75  ? -5.702  -5.103  -7.329  1.00 0.00 ? 75  GLU A CB   4  
ATOM 10689 C CG   . GLU A 1 75  ? -6.020  -4.866  -8.795  1.00 0.00 ? 75  GLU A CG   4  
ATOM 10690 C CD   . GLU A 1 75  ? -6.126  -6.152  -9.593  1.00 0.00 ? 75  GLU A CD   4  
ATOM 10691 O OE1  . GLU A 1 75  ? -7.225  -6.744  -9.622  1.00 0.00 ? 75  GLU A OE1  4  
ATOM 10692 O OE2  . GLU A 1 75  ? -5.111  -6.562  -10.193 1.00 0.00 ? 75  GLU A OE2  4  
ATOM 10693 H H    . GLU A 1 75  ? -3.281  -5.714  -6.667  1.00 0.00 ? 75  GLU A H    4  
ATOM 10694 H HA   . GLU A 1 75  ? -4.436  -3.387  -7.527  1.00 0.00 ? 75  GLU A HA   4  
ATOM 10695 H HB2  . GLU A 1 75  ? -5.327  -6.107  -7.216  1.00 0.00 ? 75  GLU A HB2  4  
ATOM 10696 H HB3  . GLU A 1 75  ? -6.621  -5.002  -6.767  1.00 0.00 ? 75  GLU A HB3  4  
ATOM 10697 H HG2  . GLU A 1 75  ? -6.960  -4.339  -8.864  1.00 0.00 ? 75  GLU A HG2  4  
ATOM 10698 H HG3  . GLU A 1 75  ? -5.238  -4.259  -9.221  1.00 0.00 ? 75  GLU A HG3  4  
ATOM 10699 N N    . PHE A 1 76  ? -5.359  -4.099  -4.450  1.00 0.00 ? 76  PHE A N    4  
ATOM 10700 C CA   . PHE A 1 76  ? -5.889  -3.485  -3.248  1.00 0.00 ? 76  PHE A CA   4  
ATOM 10701 C C    . PHE A 1 76  ? -4.968  -2.372  -2.763  1.00 0.00 ? 76  PHE A C    4  
ATOM 10702 O O    . PHE A 1 76  ? -5.400  -1.233  -2.584  1.00 0.00 ? 76  PHE A O    4  
ATOM 10703 C CB   . PHE A 1 76  ? -6.071  -4.494  -2.111  1.00 0.00 ? 76  PHE A CB   4  
ATOM 10704 C CG   . PHE A 1 76  ? -6.107  -5.946  -2.498  1.00 0.00 ? 76  PHE A CG   4  
ATOM 10705 C CD1  . PHE A 1 76  ? -7.117  -6.445  -3.296  1.00 0.00 ? 76  PHE A CD1  4  
ATOM 10706 C CD2  . PHE A 1 76  ? -5.141  -6.817  -2.020  1.00 0.00 ? 76  PHE A CD2  4  
ATOM 10707 C CE1  . PHE A 1 76  ? -7.163  -7.788  -3.616  1.00 0.00 ? 76  PHE A CE1  4  
ATOM 10708 C CE2  . PHE A 1 76  ? -5.179  -8.160  -2.341  1.00 0.00 ? 76  PHE A CE2  4  
ATOM 10709 C CZ   . PHE A 1 76  ? -6.193  -8.647  -3.138  1.00 0.00 ? 76  PHE A CZ   4  
ATOM 10710 H H    . PHE A 1 76  ? -5.063  -5.032  -4.434  1.00 0.00 ? 76  PHE A H    4  
ATOM 10711 H HA   . PHE A 1 76  ? -6.849  -3.051  -3.503  1.00 0.00 ? 76  PHE A HA   4  
ATOM 10712 H HB2  . PHE A 1 76  ? -5.248  -4.377  -1.419  1.00 0.00 ? 76  PHE A HB2  4  
ATOM 10713 H HB3  . PHE A 1 76  ? -6.997  -4.270  -1.602  1.00 0.00 ? 76  PHE A HB3  4  
ATOM 10714 H HD1  . PHE A 1 76  ? -7.875  -5.776  -3.674  1.00 0.00 ? 76  PHE A HD1  4  
ATOM 10715 H HD2  . PHE A 1 76  ? -4.347  -6.437  -1.395  1.00 0.00 ? 76  PHE A HD2  4  
ATOM 10716 H HE1  . PHE A 1 76  ? -7.956  -8.169  -4.237  1.00 0.00 ? 76  PHE A HE1  4  
ATOM 10717 H HE2  . PHE A 1 76  ? -4.420  -8.828  -1.963  1.00 0.00 ? 76  PHE A HE2  4  
ATOM 10718 H HZ   . PHE A 1 76  ? -6.228  -9.697  -3.388  1.00 0.00 ? 76  PHE A HZ   4  
ATOM 10719 N N    . LEU A 1 77  ? -3.695  -2.704  -2.554  1.00 0.00 ? 77  LEU A N    4  
ATOM 10720 C CA   . LEU A 1 77  ? -2.722  -1.722  -2.093  1.00 0.00 ? 77  LEU A CA   4  
ATOM 10721 C C    . LEU A 1 77  ? -2.725  -0.513  -3.016  1.00 0.00 ? 77  LEU A C    4  
ATOM 10722 O O    . LEU A 1 77  ? -2.555  0.623   -2.578  1.00 0.00 ? 77  LEU A O    4  
ATOM 10723 C CB   . LEU A 1 77  ? -1.332  -2.348  -2.010  1.00 0.00 ? 77  LEU A CB   4  
ATOM 10724 C CG   . LEU A 1 77  ? -0.980  -2.905  -0.632  1.00 0.00 ? 77  LEU A CG   4  
ATOM 10725 C CD1  . LEU A 1 77  ? 0.145   -3.921  -0.723  1.00 0.00 ? 77  LEU A CD1  4  
ATOM 10726 C CD2  . LEU A 1 77  ? -0.617  -1.770  0.308   1.00 0.00 ? 77  LEU A CD2  4  
ATOM 10727 H H    . LEU A 1 77  ? -3.405  -3.627  -2.713  1.00 0.00 ? 77  LEU A H    4  
ATOM 10728 H HA   . LEU A 1 77  ? -3.023  -1.402  -1.106  1.00 0.00 ? 77  LEU A HA   4  
ATOM 10729 H HB2  . LEU A 1 77  ? -1.274  -3.151  -2.731  1.00 0.00 ? 77  LEU A HB2  4  
ATOM 10730 H HB3  . LEU A 1 77  ? -0.601  -1.597  -2.269  1.00 0.00 ? 77  LEU A HB3  4  
ATOM 10731 H HG   . LEU A 1 77  ? -1.844  -3.407  -0.228  1.00 0.00 ? 77  LEU A HG   4  
ATOM 10732 H HD11 . LEU A 1 77  ? -0.276  -4.916  -0.690  1.00 0.00 ? 77  LEU A HD11 4  
ATOM 10733 H HD12 . LEU A 1 77  ? 0.826   -3.786  0.109   1.00 0.00 ? 77  LEU A HD12 4  
ATOM 10734 H HD13 . LEU A 1 77  ? 0.678   -3.785  -1.651  1.00 0.00 ? 77  LEU A HD13 4  
ATOM 10735 H HD21 . LEU A 1 77  ? 0.158   -1.169  -0.140  1.00 0.00 ? 77  LEU A HD21 4  
ATOM 10736 H HD22 . LEU A 1 77  ? -0.265  -2.175  1.246   1.00 0.00 ? 77  LEU A HD22 4  
ATOM 10737 H HD23 . LEU A 1 77  ? -1.492  -1.160  0.482   1.00 0.00 ? 77  LEU A HD23 4  
ATOM 10738 N N    . ASN A 1 78  ? -2.962  -0.773  -4.294  1.00 0.00 ? 78  ASN A N    4  
ATOM 10739 C CA   . ASN A 1 78  ? -3.041  0.282   -5.290  1.00 0.00 ? 78  ASN A CA   4  
ATOM 10740 C C    . ASN A 1 78  ? -4.383  0.989   -5.149  1.00 0.00 ? 78  ASN A C    4  
ATOM 10741 O O    . ASN A 1 78  ? -4.498  2.187   -5.407  1.00 0.00 ? 78  ASN A O    4  
ATOM 10742 C CB   . ASN A 1 78  ? -2.878  -0.299  -6.707  1.00 0.00 ? 78  ASN A CB   4  
ATOM 10743 C CG   . ASN A 1 78  ? -3.807  0.333   -7.729  1.00 0.00 ? 78  ASN A CG   4  
ATOM 10744 O OD1  . ASN A 1 78  ? -3.730  1.532   -7.998  1.00 0.00 ? 78  ASN A OD1  4  
ATOM 10745 N ND2  . ASN A 1 78  ? -4.689  -0.475  -8.304  1.00 0.00 ? 78  ASN A ND2  4  
ATOM 10746 H H    . ASN A 1 78  ? -3.118  -1.698  -4.566  1.00 0.00 ? 78  ASN A H    4  
ATOM 10747 H HA   . ASN A 1 78  ? -2.247  0.988   -5.097  1.00 0.00 ? 78  ASN A HA   4  
ATOM 10748 H HB2  . ASN A 1 78  ? -1.862  -0.141  -7.036  1.00 0.00 ? 78  ASN A HB2  4  
ATOM 10749 H HB3  . ASN A 1 78  ? -3.078  -1.360  -6.677  1.00 0.00 ? 78  ASN A HB3  4  
ATOM 10750 H HD21 . ASN A 1 78  ? -4.692  -1.422  -8.039  1.00 0.00 ? 78  ASN A HD21 4  
ATOM 10751 H HD22 . ASN A 1 78  ? -5.305  -0.091  -8.970  1.00 0.00 ? 78  ASN A HD22 4  
ATOM 10752 N N    . LEU A 1 79  ? -5.396  0.231   -4.733  1.00 0.00 ? 79  LEU A N    4  
ATOM 10753 C CA   . LEU A 1 79  ? -6.726  0.783   -4.555  1.00 0.00 ? 79  LEU A CA   4  
ATOM 10754 C C    . LEU A 1 79  ? -6.743  1.717   -3.351  1.00 0.00 ? 79  LEU A C    4  
ATOM 10755 O O    . LEU A 1 79  ? -7.043  2.897   -3.486  1.00 0.00 ? 79  LEU A O    4  
ATOM 10756 C CB   . LEU A 1 79  ? -7.768  -0.334  -4.404  1.00 0.00 ? 79  LEU A CB   4  
ATOM 10757 C CG   . LEU A 1 79  ? -8.058  -1.149  -5.683  1.00 0.00 ? 79  LEU A CG   4  
ATOM 10758 C CD1  . LEU A 1 79  ? -9.523  -1.115  -6.058  1.00 0.00 ? 79  LEU A CD1  4  
ATOM 10759 C CD2  . LEU A 1 79  ? -7.217  -0.678  -6.855  1.00 0.00 ? 79  LEU A CD2  4  
ATOM 10760 H H    . LEU A 1 79  ? -5.243  -0.717  -4.544  1.00 0.00 ? 79  LEU A H    4  
ATOM 10761 H HA   . LEU A 1 79  ? -6.958  1.351   -5.440  1.00 0.00 ? 79  LEU A HA   4  
ATOM 10762 H HB2  . LEU A 1 79  ? -7.422  -1.016  -3.640  1.00 0.00 ? 79  LEU A HB2  4  
ATOM 10763 H HB3  . LEU A 1 79  ? -8.694  0.111   -4.071  1.00 0.00 ? 79  LEU A HB3  4  
ATOM 10764 H HG   . LEU A 1 79  ? -7.813  -2.166  -5.500  1.00 0.00 ? 79  LEU A HG   4  
ATOM 10765 H HD11 . LEU A 1 79  ? -10.015 -0.312  -5.537  1.00 0.00 ? 79  LEU A HD11 4  
ATOM 10766 H HD12 . LEU A 1 79  ? -9.981  -2.056  -5.793  1.00 0.00 ? 79  LEU A HD12 4  
ATOM 10767 H HD13 . LEU A 1 79  ? -9.609  -0.964  -7.127  1.00 0.00 ? 79  LEU A HD13 4  
ATOM 10768 H HD21 . LEU A 1 79  ? -7.618  0.250   -7.235  1.00 0.00 ? 79  LEU A HD21 4  
ATOM 10769 H HD22 . LEU A 1 79  ? -7.238  -1.430  -7.631  1.00 0.00 ? 79  LEU A HD22 4  
ATOM 10770 H HD23 . LEU A 1 79  ? -6.204  -0.529  -6.532  1.00 0.00 ? 79  LEU A HD23 4  
ATOM 10771 N N    . ILE A 1 80  ? -6.378  1.194   -2.179  1.00 0.00 ? 80  ILE A N    4  
ATOM 10772 C CA   . ILE A 1 80  ? -6.328  2.013   -0.974  1.00 0.00 ? 80  ILE A CA   4  
ATOM 10773 C C    . ILE A 1 80  ? -5.131  2.952   -1.019  1.00 0.00 ? 80  ILE A C    4  
ATOM 10774 O O    . ILE A 1 80  ? -5.243  4.130   -0.681  1.00 0.00 ? 80  ILE A O    4  
ATOM 10775 C CB   . ILE A 1 80  ? -6.288  1.180   0.325   1.00 0.00 ? 80  ILE A CB   4  
ATOM 10776 C CG1  . ILE A 1 80  ? -6.634  2.067   1.522   1.00 0.00 ? 80  ILE A CG1  4  
ATOM 10777 C CG2  . ILE A 1 80  ? -4.929  0.547   0.530   1.00 0.00 ? 80  ILE A CG2  4  
ATOM 10778 C CD1  . ILE A 1 80  ? -5.475  2.923   1.998   1.00 0.00 ? 80  ILE A CD1  4  
ATOM 10779 H H    . ILE A 1 80  ? -6.121  0.257   -2.133  1.00 0.00 ? 80  ILE A H    4  
ATOM 10780 H HA   . ILE A 1 80  ? -7.219  2.606   -0.950  1.00 0.00 ? 80  ILE A HA   4  
ATOM 10781 H HB   . ILE A 1 80  ? -7.021  0.392   0.248   1.00 0.00 ? 80  ILE A HB   4  
ATOM 10782 H HG12 . ILE A 1 80  ? -7.443  2.728   1.249   1.00 0.00 ? 80  ILE A HG12 4  
ATOM 10783 H HG13 . ILE A 1 80  ? -6.947  1.442   2.346   1.00 0.00 ? 80  ILE A HG13 4  
ATOM 10784 H HG21 . ILE A 1 80  ? -4.188  1.331   0.614   1.00 0.00 ? 80  ILE A HG21 4  
ATOM 10785 H HG22 . ILE A 1 80  ? -4.696  -0.084  -0.310  1.00 0.00 ? 80  ILE A HG22 4  
ATOM 10786 H HG23 . ILE A 1 80  ? -4.942  -0.038  1.443   1.00 0.00 ? 80  ILE A HG23 4  
ATOM 10787 H HD11 . ILE A 1 80  ? -4.649  2.847   1.302   1.00 0.00 ? 80  ILE A HD11 4  
ATOM 10788 H HD12 . ILE A 1 80  ? -5.152  2.578   2.969   1.00 0.00 ? 80  ILE A HD12 4  
ATOM 10789 H HD13 . ILE A 1 80  ? -5.793  3.952   2.067   1.00 0.00 ? 80  ILE A HD13 4  
ATOM 10790 N N    . GLY A 1 81  ? -3.984  2.430   -1.455  1.00 0.00 ? 81  GLY A N    4  
ATOM 10791 C CA   . GLY A 1 81  ? -2.796  3.257   -1.552  1.00 0.00 ? 81  GLY A CA   4  
ATOM 10792 C C    . GLY A 1 81  ? -3.078  4.506   -2.352  1.00 0.00 ? 81  GLY A C    4  
ATOM 10793 O O    . GLY A 1 81  ? -2.808  5.619   -1.901  1.00 0.00 ? 81  GLY A O    4  
ATOM 10794 H H    . GLY A 1 81  ? -3.952  1.489   -1.725  1.00 0.00 ? 81  GLY A H    4  
ATOM 10795 H HA2  . GLY A 1 81  ? -2.476  3.535   -0.558  1.00 0.00 ? 81  GLY A HA2  4  
ATOM 10796 H HA3  . GLY A 1 81  ? -2.010  2.698   -2.036  1.00 0.00 ? 81  GLY A HA3  4  
ATOM 10797 N N    . GLY A 1 82  ? -3.660  4.321   -3.535  1.00 0.00 ? 82  GLY A N    4  
ATOM 10798 C CA   . GLY A 1 82  ? -4.011  5.458   -4.368  1.00 0.00 ? 82  GLY A CA   4  
ATOM 10799 C C    . GLY A 1 82  ? -4.844  6.478   -3.608  1.00 0.00 ? 82  GLY A C    4  
ATOM 10800 O O    . GLY A 1 82  ? -4.686  7.684   -3.798  1.00 0.00 ? 82  GLY A O    4  
ATOM 10801 H H    . GLY A 1 82  ? -3.867  3.403   -3.834  1.00 0.00 ? 82  GLY A H    4  
ATOM 10802 H HA2  . GLY A 1 82  ? -3.104  5.937   -4.713  1.00 0.00 ? 82  GLY A HA2  4  
ATOM 10803 H HA3  . GLY A 1 82  ? -4.573  5.111   -5.221  1.00 0.00 ? 82  GLY A HA3  4  
ATOM 10804 N N    . LEU A 1 83  ? -5.728  5.996   -2.732  1.00 0.00 ? 83  LEU A N    4  
ATOM 10805 C CA   . LEU A 1 83  ? -6.566  6.886   -1.933  1.00 0.00 ? 83  LEU A CA   4  
ATOM 10806 C C    . LEU A 1 83  ? -5.710  7.731   -1.007  1.00 0.00 ? 83  LEU A C    4  
ATOM 10807 O O    . LEU A 1 83  ? -5.903  8.941   -0.906  1.00 0.00 ? 83  LEU A O    4  
ATOM 10808 C CB   . LEU A 1 83  ? -7.576  6.091   -1.113  1.00 0.00 ? 83  LEU A CB   4  
ATOM 10809 C CG   . LEU A 1 83  ? -8.185  4.898   -1.837  1.00 0.00 ? 83  LEU A CG   4  
ATOM 10810 C CD1  . LEU A 1 83  ? -9.324  4.309   -1.024  1.00 0.00 ? 83  LEU A CD1  4  
ATOM 10811 C CD2  . LEU A 1 83  ? -8.658  5.302   -3.227  1.00 0.00 ? 83  LEU A CD2  4  
ATOM 10812 H H    . LEU A 1 83  ? -5.811  5.024   -2.615  1.00 0.00 ? 83  LEU A H    4  
ATOM 10813 H HA   . LEU A 1 83  ? -7.096  7.539   -2.610  1.00 0.00 ? 83  LEU A HA   4  
ATOM 10814 H HB2  . LEU A 1 83  ? -7.083  5.732   -0.220  1.00 0.00 ? 83  LEU A HB2  4  
ATOM 10815 H HB3  . LEU A 1 83  ? -8.376  6.754   -0.822  1.00 0.00 ? 83  LEU A HB3  4  
ATOM 10816 H HG   . LEU A 1 83  ? -7.432  4.138   -1.948  1.00 0.00 ? 83  LEU A HG   4  
ATOM 10817 H HD11 . LEU A 1 83  ? -10.246 4.807   -1.280  1.00 0.00 ? 83  LEU A HD11 4  
ATOM 10818 H HD12 . LEU A 1 83  ? -9.118  4.444   0.028   1.00 0.00 ? 83  LEU A HD12 4  
ATOM 10819 H HD13 . LEU A 1 83  ? -9.411  3.254   -1.240  1.00 0.00 ? 83  LEU A HD13 4  
ATOM 10820 H HD21 . LEU A 1 83  ? -8.453  6.348   -3.391  1.00 0.00 ? 83  LEU A HD21 4  
ATOM 10821 H HD22 . LEU A 1 83  ? -9.719  5.129   -3.313  1.00 0.00 ? 83  LEU A HD22 4  
ATOM 10822 H HD23 . LEU A 1 83  ? -8.135  4.714   -3.966  1.00 0.00 ? 83  LEU A HD23 4  
ATOM 10823 N N    . ALA A 1 84  ? -4.754  7.095   -0.337  1.00 0.00 ? 84  ALA A N    4  
ATOM 10824 C CA   . ALA A 1 84  ? -3.867  7.818   0.569   1.00 0.00 ? 84  ALA A CA   4  
ATOM 10825 C C    . ALA A 1 84  ? -3.190  8.969   -0.158  1.00 0.00 ? 84  ALA A C    4  
ATOM 10826 O O    . ALA A 1 84  ? -2.897  10.011  0.427   1.00 0.00 ? 84  ALA A O    4  
ATOM 10827 C CB   . ALA A 1 84  ? -2.808  6.889   1.130   1.00 0.00 ? 84  ALA A CB   4  
ATOM 10828 H H    . ALA A 1 84  ? -4.640  6.120   -0.457  1.00 0.00 ? 84  ALA A H    4  
ATOM 10829 H HA   . ALA A 1 84  ? -4.455  8.206   1.388   1.00 0.00 ? 84  ALA A HA   4  
ATOM 10830 H HB1  . ALA A 1 84  ? -1.934  6.917   0.490   1.00 0.00 ? 84  ALA A HB1  4  
ATOM 10831 H HB2  . ALA A 1 84  ? -3.196  5.881   1.169   1.00 0.00 ? 84  ALA A HB2  4  
ATOM 10832 H HB3  . ALA A 1 84  ? -2.538  7.213   2.123   1.00 0.00 ? 84  ALA A HB3  4  
ATOM 10833 N N    . VAL A 1 85  ? -2.948  8.767   -1.442  1.00 0.00 ? 85  VAL A N    4  
ATOM 10834 C CA   . VAL A 1 85  ? -2.305  9.779   -2.267  1.00 0.00 ? 85  VAL A CA   4  
ATOM 10835 C C    . VAL A 1 85  ? -3.318  10.772  -2.815  1.00 0.00 ? 85  VAL A C    4  
ATOM 10836 O O    . VAL A 1 85  ? -2.958  11.862  -3.259  1.00 0.00 ? 85  VAL A O    4  
ATOM 10837 C CB   . VAL A 1 85  ? -1.491  9.169   -3.434  1.00 0.00 ? 85  VAL A CB   4  
ATOM 10838 C CG1  . VAL A 1 85  ? -0.040  9.581   -3.305  1.00 0.00 ? 85  VAL A CG1  4  
ATOM 10839 C CG2  . VAL A 1 85  ? -1.598  7.649   -3.476  1.00 0.00 ? 85  VAL A CG2  4  
ATOM 10840 H H    . VAL A 1 85  ? -3.213  7.917   -1.844  1.00 0.00 ? 85  VAL A H    4  
ATOM 10841 H HA   . VAL A 1 85  ? -1.625  10.320  -1.635  1.00 0.00 ? 85  VAL A HA   4  
ATOM 10842 H HB   . VAL A 1 85  ? -1.876  9.561   -4.365  1.00 0.00 ? 85  VAL A HB   4  
ATOM 10843 H HG11 . VAL A 1 85  ? 0.016   10.564  -2.864  1.00 0.00 ? 85  VAL A HG11 4  
ATOM 10844 H HG12 . VAL A 1 85  ? 0.419   9.596   -4.280  1.00 0.00 ? 85  VAL A HG12 4  
ATOM 10845 H HG13 . VAL A 1 85  ? 0.471   8.873   -2.669  1.00 0.00 ? 85  VAL A HG13 4  
ATOM 10846 H HG21 . VAL A 1 85  ? -1.005  7.224   -2.679  1.00 0.00 ? 85  VAL A HG21 4  
ATOM 10847 H HG22 . VAL A 1 85  ? -1.233  7.289   -4.425  1.00 0.00 ? 85  VAL A HG22 4  
ATOM 10848 H HG23 . VAL A 1 85  ? -2.624  7.355   -3.356  1.00 0.00 ? 85  VAL A HG23 4  
ATOM 10849 N N    . ALA A 1 86  ? -4.581  10.386  -2.783  1.00 0.00 ? 86  ALA A N    4  
ATOM 10850 C CA   . ALA A 1 86  ? -5.650  11.231  -3.276  1.00 0.00 ? 86  ALA A CA   4  
ATOM 10851 C C    . ALA A 1 86  ? -6.588  11.655  -2.150  1.00 0.00 ? 86  ALA A C    4  
ATOM 10852 O O    . ALA A 1 86  ? -7.685  12.155  -2.397  1.00 0.00 ? 86  ALA A O    4  
ATOM 10853 C CB   . ALA A 1 86  ? -6.410  10.482  -4.344  1.00 0.00 ? 86  ALA A CB   4  
ATOM 10854 H H    . ALA A 1 86  ? -4.802  9.505   -2.421  1.00 0.00 ? 86  ALA A H    4  
ATOM 10855 H HA   . ALA A 1 86  ? -5.210  12.110  -3.725  1.00 0.00 ? 86  ALA A HA   4  
ATOM 10856 H HB1  . ALA A 1 86  ? -5.782  9.692   -4.729  1.00 0.00 ? 86  ALA A HB1  4  
ATOM 10857 H HB2  . ALA A 1 86  ? -6.676  11.158  -5.141  1.00 0.00 ? 86  ALA A HB2  4  
ATOM 10858 H HB3  . ALA A 1 86  ? -7.303  10.056  -3.914  1.00 0.00 ? 86  ALA A HB3  4  
ATOM 10859 N N    . CYS A 1 87  ? -6.150  11.446  -0.913  1.00 0.00 ? 87  CYS A N    4  
ATOM 10860 C CA   . CYS A 1 87  ? -6.950  11.799  0.251   1.00 0.00 ? 87  CYS A CA   4  
ATOM 10861 C C    . CYS A 1 87  ? -6.061  12.062  1.463   1.00 0.00 ? 87  CYS A C    4  
ATOM 10862 O O    . CYS A 1 87  ? -6.287  13.013  2.211   1.00 0.00 ? 87  CYS A O    4  
ATOM 10863 C CB   . CYS A 1 87  ? -7.946  10.682  0.567   1.00 0.00 ? 87  CYS A CB   4  
ATOM 10864 S SG   . CYS A 1 87  ? -9.485  11.258  1.320   1.00 0.00 ? 87  CYS A SG   4  
ATOM 10865 H H    . CYS A 1 87  ? -5.270  11.040  -0.781  1.00 0.00 ? 87  CYS A H    4  
ATOM 10866 H HA   . CYS A 1 87  ? -7.495  12.700  0.018   1.00 0.00 ? 87  CYS A HA   4  
ATOM 10867 H HB2  . CYS A 1 87  ? -8.202  10.169  -0.348  1.00 0.00 ? 87  CYS A HB2  4  
ATOM 10868 H HB3  . CYS A 1 87  ? -7.487  9.983   1.249   1.00 0.00 ? 87  CYS A HB3  4  
ATOM 10869 H HG   . CYS A 1 87  ? -9.561  10.854  2.187   1.00 0.00 ? 87  CYS A HG   4  
ATOM 10870 N N    . HIS A 1 88  ? -5.047  11.220  1.653   1.00 0.00 ? 88  HIS A N    4  
ATOM 10871 C CA   . HIS A 1 88  ? -4.133  11.384  2.780   1.00 0.00 ? 88  HIS A CA   4  
ATOM 10872 C C    . HIS A 1 88  ? -2.987  12.320  2.413   1.00 0.00 ? 88  HIS A C    4  
ATOM 10873 O O    . HIS A 1 88  ? -2.586  12.404  1.253   1.00 0.00 ? 88  HIS A O    4  
ATOM 10874 C CB   . HIS A 1 88  ? -3.581  10.030  3.234   1.00 0.00 ? 88  HIS A CB   4  
ATOM 10875 C CG   . HIS A 1 88  ? -2.943  10.073  4.589   1.00 0.00 ? 88  HIS A CG   4  
ATOM 10876 N ND1  . HIS A 1 88  ? -3.666  10.054  5.763   1.00 0.00 ? 88  HIS A ND1  4  
ATOM 10877 C CD2  . HIS A 1 88  ? -1.640  10.138  4.952   1.00 0.00 ? 88  HIS A CD2  4  
ATOM 10878 C CE1  . HIS A 1 88  ? -2.836  10.106  6.790   1.00 0.00 ? 88  HIS A CE1  4  
ATOM 10879 N NE2  . HIS A 1 88  ? -1.602  10.156  6.325   1.00 0.00 ? 88  HIS A NE2  4  
ATOM 10880 H H    . HIS A 1 88  ? -4.909  10.477  1.022   1.00 0.00 ? 88  HIS A H    4  
ATOM 10881 H HA   . HIS A 1 88  ? -4.692  11.824  3.592   1.00 0.00 ? 88  HIS A HA   4  
ATOM 10882 H HB2  . HIS A 1 88  ? -4.387  9.313   3.269   1.00 0.00 ? 88  HIS A HB2  4  
ATOM 10883 H HB3  . HIS A 1 88  ? -2.837  9.694   2.528   1.00 0.00 ? 88  HIS A HB3  4  
ATOM 10884 H HD1  . HIS A 1 88  ? -4.642  10.008  5.833   1.00 0.00 ? 88  HIS A HD1  4  
ATOM 10885 H HD2  . HIS A 1 88  ? -0.789  10.168  4.287   1.00 0.00 ? 88  HIS A HD2  4  
ATOM 10886 H HE1  . HIS A 1 88  ? -3.119  10.105  7.832   1.00 0.00 ? 88  HIS A HE1  4  
ATOM 10887 H HE2  . HIS A 1 88  ? -0.790  10.107  6.872   1.00 0.00 ? 88  HIS A HE2  4  
ATOM 10888 N N    . GLU A 1 89  ? -2.466  13.027  3.411   1.00 0.00 ? 89  GLU A N    4  
ATOM 10889 C CA   . GLU A 1 89  ? -1.367  13.965  3.197   1.00 0.00 ? 89  GLU A CA   4  
ATOM 10890 C C    . GLU A 1 89  ? -0.202  13.295  2.474   1.00 0.00 ? 89  GLU A C    4  
ATOM 10891 O O    . GLU A 1 89  ? 0.481   12.440  3.038   1.00 0.00 ? 89  GLU A O    4  
ATOM 10892 C CB   . GLU A 1 89  ? -0.892  14.538  4.533   1.00 0.00 ? 89  GLU A CB   4  
ATOM 10893 C CG   . GLU A 1 89  ? -0.466  15.996  4.452   1.00 0.00 ? 89  GLU A CG   4  
ATOM 10894 C CD   . GLU A 1 89  ? -1.116  16.855  5.518   1.00 0.00 ? 89  GLU A CD   4  
ATOM 10895 O OE1  . GLU A 1 89  ? -0.574  16.920  6.641   1.00 0.00 ? 89  GLU A OE1  4  
ATOM 10896 O OE2  . GLU A 1 89  ? -2.168  17.464  5.230   1.00 0.00 ? 89  GLU A OE2  4  
ATOM 10897 H H    . GLU A 1 89  ? -2.831  12.919  4.314   1.00 0.00 ? 89  GLU A H    4  
ATOM 10898 H HA   . GLU A 1 89  ? -1.739  14.772  2.583   1.00 0.00 ? 89  GLU A HA   4  
ATOM 10899 H HB2  . GLU A 1 89  ? -1.695  14.459  5.252   1.00 0.00 ? 89  GLU A HB2  4  
ATOM 10900 H HB3  . GLU A 1 89  ? -0.050  13.958  4.882   1.00 0.00 ? 89  GLU A HB3  4  
ATOM 10901 H HG2  . GLU A 1 89  ? 0.607   16.051  4.573   1.00 0.00 ? 89  GLU A HG2  4  
ATOM 10902 H HG3  . GLU A 1 89  ? -0.738  16.383  3.482   1.00 0.00 ? 89  GLU A HG3  4  
ATOM 10903 N N    . SER A 1 90  ? 0.016   13.691  1.224   1.00 0.00 ? 90  SER A N    4  
ATOM 10904 C CA   . SER A 1 90  ? 1.098   13.132  0.421   1.00 0.00 ? 90  SER A CA   4  
ATOM 10905 C C    . SER A 1 90  ? 1.139   13.779  -0.960  1.00 0.00 ? 90  SER A C    4  
ATOM 10906 O O    . SER A 1 90  ? 2.118   14.433  -1.321  1.00 0.00 ? 90  SER A O    4  
ATOM 10907 C CB   . SER A 1 90  ? 0.930   11.617  0.283   1.00 0.00 ? 90  SER A CB   4  
ATOM 10908 O OG   . SER A 1 90  ? 1.637   10.930  1.302   1.00 0.00 ? 90  SER A OG   4  
ATOM 10909 H H    . SER A 1 90  ? -0.564  14.377  0.832   1.00 0.00 ? 90  SER A H    4  
ATOM 10910 H HA   . SER A 1 90  ? 2.028   13.337  0.930   1.00 0.00 ? 90  SER A HA   4  
ATOM 10911 H HB2  . SER A 1 90  ? -0.117  11.364  0.355   1.00 0.00 ? 90  SER A HB2  4  
ATOM 10912 H HB3  . SER A 1 90  ? 1.311   11.301  -0.678  1.00 0.00 ? 90  SER A HB3  4  
ATOM 10913 H HG   . SER A 1 90  ? 1.146   10.986  2.125   1.00 0.00 ? 90  SER A HG   4  
ATOM 10914 N N    . PHE A 1 91  ? 0.070   13.593  -1.727  1.00 0.00 ? 91  PHE A N    4  
ATOM 10915 C CA   . PHE A 1 91  ? -0.018  14.159  -3.069  1.00 0.00 ? 91  PHE A CA   4  
ATOM 10916 C C    . PHE A 1 91  ? -1.132  15.195  -3.157  1.00 0.00 ? 91  PHE A C    4  
ATOM 10917 O O    . PHE A 1 91  ? -1.033  16.165  -3.908  1.00 0.00 ? 91  PHE A O    4  
ATOM 10918 C CB   . PHE A 1 91  ? -0.269  13.056  -4.097  1.00 0.00 ? 91  PHE A CB   4  
ATOM 10919 C CG   . PHE A 1 91  ? 0.970   12.624  -4.829  1.00 0.00 ? 91  PHE A CG   4  
ATOM 10920 C CD1  . PHE A 1 91  ? 2.137   12.344  -4.137  1.00 0.00 ? 91  PHE A CD1  4  
ATOM 10921 C CD2  . PHE A 1 91  ? 0.967   12.500  -6.209  1.00 0.00 ? 91  PHE A CD2  4  
ATOM 10922 C CE1  . PHE A 1 91  ? 3.279   11.949  -4.808  1.00 0.00 ? 91  PHE A CE1  4  
ATOM 10923 C CE2  . PHE A 1 91  ? 2.106   12.105  -6.886  1.00 0.00 ? 91  PHE A CE2  4  
ATOM 10924 C CZ   . PHE A 1 91  ? 3.263   11.829  -6.185  1.00 0.00 ? 91  PHE A CZ   4  
ATOM 10925 H H    . PHE A 1 91  ? -0.678  13.062  -1.383  1.00 0.00 ? 91  PHE A H    4  
ATOM 10926 H HA   . PHE A 1 91  ? 0.924   14.638  -3.291  1.00 0.00 ? 91  PHE A HA   4  
ATOM 10927 H HB2  . PHE A 1 91  ? -0.677  12.193  -3.595  1.00 0.00 ? 91  PHE A HB2  4  
ATOM 10928 H HB3  . PHE A 1 91  ? -0.982  13.411  -4.828  1.00 0.00 ? 91  PHE A HB3  4  
ATOM 10929 H HD1  . PHE A 1 91  ? 2.151   12.437  -3.061  1.00 0.00 ? 91  PHE A HD1  4  
ATOM 10930 H HD2  . PHE A 1 91  ? 0.063   12.715  -6.759  1.00 0.00 ? 91  PHE A HD2  4  
ATOM 10931 H HE1  . PHE A 1 91  ? 4.183   11.734  -4.257  1.00 0.00 ? 91  PHE A HE1  4  
ATOM 10932 H HE2  . PHE A 1 91  ? 2.091   12.011  -7.962  1.00 0.00 ? 91  PHE A HE2  4  
ATOM 10933 H HZ   . PHE A 1 91  ? 4.154   11.520  -6.711  1.00 0.00 ? 91  PHE A HZ   4  
ATOM 10934 N N    . VAL A 1 92  ? -2.197  14.974  -2.392  1.00 0.00 ? 92  VAL A N    4  
ATOM 10935 C CA   . VAL A 1 92  ? -3.340  15.881  -2.387  1.00 0.00 ? 92  VAL A CA   4  
ATOM 10936 C C    . VAL A 1 92  ? -2.898  17.342  -2.332  1.00 0.00 ? 92  VAL A C    4  
ATOM 10937 O O    . VAL A 1 92  ? -1.963  17.691  -1.613  1.00 0.00 ? 92  VAL A O    4  
ATOM 10938 C CB   . VAL A 1 92  ? -4.280  15.595  -1.199  1.00 0.00 ? 92  VAL A CB   4  
ATOM 10939 C CG1  . VAL A 1 92  ? -5.555  16.415  -1.318  1.00 0.00 ? 92  VAL A CG1  4  
ATOM 10940 C CG2  . VAL A 1 92  ? -4.596  14.107  -1.111  1.00 0.00 ? 92  VAL A CG2  4  
ATOM 10941 H H    . VAL A 1 92  ? -2.218  14.179  -1.822  1.00 0.00 ? 92  VAL A H    4  
ATOM 10942 H HA   . VAL A 1 92  ? -3.890  15.716  -3.302  1.00 0.00 ? 92  VAL A HA   4  
ATOM 10943 H HB   . VAL A 1 92  ? -3.775  15.887  -0.291  1.00 0.00 ? 92  VAL A HB   4  
ATOM 10944 H HG11 . VAL A 1 92  ? -5.997  16.255  -2.291  1.00 0.00 ? 92  VAL A HG11 4  
ATOM 10945 H HG12 . VAL A 1 92  ? -5.324  17.462  -1.195  1.00 0.00 ? 92  VAL A HG12 4  
ATOM 10946 H HG13 . VAL A 1 92  ? -6.253  16.107  -0.552  1.00 0.00 ? 92  VAL A HG13 4  
ATOM 10947 H HG21 . VAL A 1 92  ? -5.660  13.972  -0.980  1.00 0.00 ? 92  VAL A HG21 4  
ATOM 10948 H HG22 . VAL A 1 92  ? -4.073  13.676  -0.271  1.00 0.00 ? 92  VAL A HG22 4  
ATOM 10949 H HG23 . VAL A 1 92  ? -4.282  13.617  -2.021  1.00 0.00 ? 92  VAL A HG23 4  
ATOM 10950 N N    . LYS A 1 93  ? -3.575  18.187  -3.103  1.00 0.00 ? 93  LYS A N    4  
ATOM 10951 C CA   . LYS A 1 93  ? -3.252  19.610  -3.150  1.00 0.00 ? 93  LYS A CA   4  
ATOM 10952 C C    . LYS A 1 93  ? -1.845  19.830  -3.695  1.00 0.00 ? 93  LYS A C    4  
ATOM 10953 O O    . LYS A 1 93  ? -1.106  20.686  -3.209  1.00 0.00 ? 93  LYS A O    4  
ATOM 10954 C CB   . LYS A 1 93  ? -3.380  20.233  -1.757  1.00 0.00 ? 93  LYS A CB   4  
ATOM 10955 C CG   . LYS A 1 93  ? -4.780  20.732  -1.440  1.00 0.00 ? 93  LYS A CG   4  
ATOM 10956 C CD   . LYS A 1 93  ? -5.058  22.071  -2.103  1.00 0.00 ? 93  LYS A CD   4  
ATOM 10957 C CE   . LYS A 1 93  ? -5.639  21.894  -3.497  1.00 0.00 ? 93  LYS A CE   4  
ATOM 10958 N NZ   . LYS A 1 93  ? -6.768  22.831  -3.753  1.00 0.00 ? 93  LYS A NZ   4  
ATOM 10959 H H    . LYS A 1 93  ? -4.307  17.846  -3.658  1.00 0.00 ? 93  LYS A H    4  
ATOM 10960 H HA   . LYS A 1 93  ? -3.959  20.087  -3.813  1.00 0.00 ? 93  LYS A HA   4  
ATOM 10961 H HB2  . LYS A 1 93  ? -3.108  19.494  -1.018  1.00 0.00 ? 93  LYS A HB2  4  
ATOM 10962 H HB3  . LYS A 1 93  ? -2.698  21.068  -1.686  1.00 0.00 ? 93  LYS A HB3  4  
ATOM 10963 H HG2  . LYS A 1 93  ? -5.498  20.009  -1.796  1.00 0.00 ? 93  LYS A HG2  4  
ATOM 10964 H HG3  . LYS A 1 93  ? -4.877  20.843  -0.370  1.00 0.00 ? 93  LYS A HG3  4  
ATOM 10965 H HD2  . LYS A 1 93  ? -5.764  22.622  -1.498  1.00 0.00 ? 93  LYS A HD2  4  
ATOM 10966 H HD3  . LYS A 1 93  ? -4.134  22.625  -2.176  1.00 0.00 ? 93  LYS A HD3  4  
ATOM 10967 H HE2  . LYS A 1 93  ? -4.860  22.076  -4.224  1.00 0.00 ? 93  LYS A HE2  4  
ATOM 10968 H HE3  . LYS A 1 93  ? -5.995  20.879  -3.599  1.00 0.00 ? 93  LYS A HE3  4  
ATOM 10969 H HZ1  . LYS A 1 93  ? -7.249  22.578  -4.639  1.00 0.00 ? 93  LYS A HZ1  4  
ATOM 10970 H HZ2  . LYS A 1 93  ? -6.413  23.805  -3.830  1.00 0.00 ? 93  LYS A HZ2  4  
ATOM 10971 H HZ3  . LYS A 1 93  ? -7.454  22.786  -2.973  1.00 0.00 ? 93  LYS A HZ3  4  
ATOM 10972 N N    . ALA A 1 94  ? -1.480  19.050  -4.708  1.00 0.00 ? 94  ALA A N    4  
ATOM 10973 C CA   . ALA A 1 94  ? -0.161  19.159  -5.321  1.00 0.00 ? 94  ALA A CA   4  
ATOM 10974 C C    . ALA A 1 94  ? -0.093  18.382  -6.633  1.00 0.00 ? 94  ALA A C    4  
ATOM 10975 O O    . ALA A 1 94  ? 0.494   18.849  -7.609  1.00 0.00 ? 94  ALA A O    4  
ATOM 10976 C CB   . ALA A 1 94  ? 0.908   18.666  -4.359  1.00 0.00 ? 94  ALA A CB   4  
ATOM 10977 H H    . ALA A 1 94  ? -2.113  18.387  -5.051  1.00 0.00 ? 94  ALA A H    4  
ATOM 10978 H HA   . ALA A 1 94  ? 0.026   20.204  -5.523  1.00 0.00 ? 94  ALA A HA   4  
ATOM 10979 H HB1  . ALA A 1 94  ? 1.170   17.647  -4.603  1.00 0.00 ? 94  ALA A HB1  4  
ATOM 10980 H HB2  . ALA A 1 94  ? 0.530   18.708  -3.348  1.00 0.00 ? 94  ALA A HB2  4  
ATOM 10981 H HB3  . ALA A 1 94  ? 1.784   19.293  -4.442  1.00 0.00 ? 94  ALA A HB3  4  
ATOM 10982 N N    . ALA A 1 95  ? -0.689  17.194  -6.649  1.00 0.00 ? 95  ALA A N    4  
ATOM 10983 C CA   . ALA A 1 95  ? -0.686  16.354  -7.842  1.00 0.00 ? 95  ALA A CA   4  
ATOM 10984 C C    . ALA A 1 95  ? -1.724  16.824  -8.860  1.00 0.00 ? 95  ALA A C    4  
ATOM 10985 O O    . ALA A 1 95  ? -1.400  17.053  -10.025 1.00 0.00 ? 95  ALA A O    4  
ATOM 10986 C CB   . ALA A 1 95  ? -0.933  14.900  -7.465  1.00 0.00 ? 95  ALA A CB   4  
ATOM 10987 H H    . ALA A 1 95  ? -1.137  16.872  -5.839  1.00 0.00 ? 95  ALA A H    4  
ATOM 10988 H HA   . ALA A 1 95  ? 0.294   16.420  -8.290  1.00 0.00 ? 95  ALA A HA   4  
ATOM 10989 H HB1  . ALA A 1 95  ? -0.206  14.272  -7.959  1.00 0.00 ? 95  ALA A HB1  4  
ATOM 10990 H HB2  . ALA A 1 95  ? -1.927  14.611  -7.774  1.00 0.00 ? 95  ALA A HB2  4  
ATOM 10991 H HB3  . ALA A 1 95  ? -0.841  14.786  -6.395  1.00 0.00 ? 95  ALA A HB3  4  
ATOM 10992 N N    . PRO A 1 96  ? -2.992  16.974  -8.434  1.00 0.00 ? 96  PRO A N    4  
ATOM 10993 C CA   . PRO A 1 96  ? -4.076  17.419  -9.316  1.00 0.00 ? 96  PRO A CA   4  
ATOM 10994 C C    . PRO A 1 96  ? -3.744  18.711  -10.063 1.00 0.00 ? 96  PRO A C    4  
ATOM 10995 O O    . PRO A 1 96  ? -3.945  18.797  -11.275 1.00 0.00 ? 96  PRO A O    4  
ATOM 10996 C CB   . PRO A 1 96  ? -5.245  17.633  -8.352  1.00 0.00 ? 96  PRO A CB   4  
ATOM 10997 C CG   . PRO A 1 96  ? -4.963  16.707  -7.225  1.00 0.00 ? 96  PRO A CG   4  
ATOM 10998 C CD   . PRO A 1 96  ? -3.472  16.725  -7.062  1.00 0.00 ? 96  PRO A CD   4  
ATOM 10999 H HA   . PRO A 1 96  ? -4.337  16.653  -10.032 1.00 0.00 ? 96  PRO A HA   4  
ATOM 11000 H HB2  . PRO A 1 96  ? -5.260  18.660  -8.024  1.00 0.00 ? 96  PRO A HB2  4  
ATOM 11001 H HB3  . PRO A 1 96  ? -6.174  17.388  -8.844  1.00 0.00 ? 96  PRO A HB3  4  
ATOM 11002 H HG2  . PRO A 1 96  ? -5.446  17.062  -6.326  1.00 0.00 ? 96  PRO A HG2  4  
ATOM 11003 H HG3  . PRO A 1 96  ? -5.304  15.712  -7.469  1.00 0.00 ? 96  PRO A HG3  4  
ATOM 11004 H HD2  . PRO A 1 96  ? -3.179  17.525  -6.401  1.00 0.00 ? 96  PRO A HD2  4  
ATOM 11005 H HD3  . PRO A 1 96  ? -3.119  15.775  -6.693  1.00 0.00 ? 96  PRO A HD3  4  
ATOM 11006 N N    . PRO A 1 97  ? -3.235  19.742  -9.359  1.00 0.00 ? 97  PRO A N    4  
ATOM 11007 C CA   . PRO A 1 97  ? -2.889  21.021  -9.989  1.00 0.00 ? 97  PRO A CA   4  
ATOM 11008 C C    . PRO A 1 97  ? -1.677  20.910  -10.909 1.00 0.00 ? 97  PRO A C    4  
ATOM 11009 O O    . PRO A 1 97  ? -1.490  21.732  -11.806 1.00 0.00 ? 97  PRO A O    4  
ATOM 11010 C CB   . PRO A 1 97  ? -2.581  21.935  -8.801  1.00 0.00 ? 97  PRO A CB   4  
ATOM 11011 C CG   . PRO A 1 97  ? -2.167  21.013  -7.709  1.00 0.00 ? 97  PRO A CG   4  
ATOM 11012 C CD   . PRO A 1 97  ? -2.957  19.748  -7.908  1.00 0.00 ? 97  PRO A CD   4  
ATOM 11013 H HA   . PRO A 1 97  ? -3.723  21.422  -10.546 1.00 0.00 ? 97  PRO A HA   4  
ATOM 11014 H HB2  . PRO A 1 97  ? -1.786  22.617  -9.067  1.00 0.00 ? 97  PRO A HB2  4  
ATOM 11015 H HB3  . PRO A 1 97  ? -3.465  22.492  -8.533  1.00 0.00 ? 97  PRO A HB3  4  
ATOM 11016 H HG2  . PRO A 1 97  ? -1.109  20.809  -7.782  1.00 0.00 ? 97  PRO A HG2  4  
ATOM 11017 H HG3  . PRO A 1 97  ? -2.400  21.452  -6.750  1.00 0.00 ? 97  PRO A HG3  4  
ATOM 11018 H HD2  . PRO A 1 97  ? -2.367  18.893  -7.622  1.00 0.00 ? 97  PRO A HD2  4  
ATOM 11019 H HD3  . PRO A 1 97  ? -3.874  19.784  -7.339  1.00 0.00 ? 97  PRO A HD3  4  
ATOM 11020 N N    . GLN A 1 98  ? -0.854  19.890  -10.682 1.00 0.00 ? 98  GLN A N    4  
ATOM 11021 C CA   . GLN A 1 98  ? 0.338   19.676  -11.494 1.00 0.00 ? 98  GLN A CA   4  
ATOM 11022 C C    . GLN A 1 98  ? -0.032  19.122  -12.867 1.00 0.00 ? 98  GLN A C    4  
ATOM 11023 O O    . GLN A 1 98  ? -0.588  18.029  -12.977 1.00 0.00 ? 98  GLN A O    4  
ATOM 11024 C CB   . GLN A 1 98  ? 1.300   18.720  -10.784 1.00 0.00 ? 98  GLN A CB   4  
ATOM 11025 C CG   . GLN A 1 98  ? 2.726   19.240  -10.703 1.00 0.00 ? 98  GLN A CG   4  
ATOM 11026 C CD   . GLN A 1 98  ? 3.757   18.138  -10.845 1.00 0.00 ? 98  GLN A CD   4  
ATOM 11027 O OE1  . GLN A 1 98  ? 3.590   17.213  -11.639 1.00 0.00 ? 98  GLN A OE1  4  
ATOM 11028 N NE2  . GLN A 1 98  ? 4.833   18.232  -10.072 1.00 0.00 ? 98  GLN A NE2  4  
ATOM 11029 H H    . GLN A 1 98  ? -1.054  19.266  -9.953  1.00 0.00 ? 98  GLN A H    4  
ATOM 11030 H HA   . GLN A 1 98  ? 0.825   20.631  -11.624 1.00 0.00 ? 98  GLN A HA   4  
ATOM 11031 H HB2  . GLN A 1 98  ? 0.944   18.551  -9.779  1.00 0.00 ? 98  GLN A HB2  4  
ATOM 11032 H HB3  . GLN A 1 98  ? 1.313   17.778  -11.313 1.00 0.00 ? 98  GLN A HB3  4  
ATOM 11033 H HG2  . GLN A 1 98  ? 2.878   19.958  -11.495 1.00 0.00 ? 98  GLN A HG2  4  
ATOM 11034 H HG3  . GLN A 1 98  ? 2.865   19.724  -9.749  1.00 0.00 ? 98  GLN A HG3  4  
ATOM 11035 H HE21 . GLN A 1 98  ? 4.898   19.001  -9.460  1.00 0.00 ? 98  GLN A HE21 4  
ATOM 11036 H HE22 . GLN A 1 98  ? 5.519   17.530  -10.144 1.00 0.00 ? 98  GLN A HE22 4  
ATOM 11037 N N    . LYS A 1 99  ? 0.281   19.883  -13.912 1.00 0.00 ? 99  LYS A N    4  
ATOM 11038 C CA   . LYS A 1 99  ? -0.019  19.467  -15.277 1.00 0.00 ? 99  LYS A CA   4  
ATOM 11039 C C    . LYS A 1 99  ? 0.527   20.473  -16.285 1.00 0.00 ? 99  LYS A C    4  
ATOM 11040 O O    . LYS A 1 99  ? 1.214   20.102  -17.238 1.00 0.00 ? 99  LYS A O    4  
ATOM 11041 C CB   . LYS A 1 99  ? -1.529  19.307  -15.464 1.00 0.00 ? 99  LYS A CB   4  
ATOM 11042 C CG   . LYS A 1 99  ? -2.329  20.518  -15.011 1.00 0.00 ? 99  LYS A CG   4  
ATOM 11043 C CD   . LYS A 1 99  ? -3.722  20.122  -14.547 1.00 0.00 ? 99  LYS A CD   4  
ATOM 11044 C CE   . LYS A 1 99  ? -4.628  19.794  -15.722 1.00 0.00 ? 99  LYS A CE   4  
ATOM 11045 N NZ   . LYS A 1 99  ? -4.580  18.348  -16.074 1.00 0.00 ? 99  LYS A NZ   4  
ATOM 11046 H H    . LYS A 1 99  ? 0.724   20.744  -13.760 1.00 0.00 ? 99  LYS A H    4  
ATOM 11047 H HA   . LYS A 1 99  ? 0.458   18.512  -15.444 1.00 0.00 ? 99  LYS A HA   4  
ATOM 11048 H HB2  . LYS A 1 99  ? -1.734  19.138  -16.510 1.00 0.00 ? 99  LYS A HB2  4  
ATOM 11049 H HB3  . LYS A 1 99  ? -1.862  18.451  -14.898 1.00 0.00 ? 99  LYS A HB3  4  
ATOM 11050 H HG2  . LYS A 1 99  ? -1.810  20.995  -14.193 1.00 0.00 ? 99  LYS A HG2  4  
ATOM 11051 H HG3  . LYS A 1 99  ? -2.416  21.209  -15.836 1.00 0.00 ? 99  LYS A HG3  4  
ATOM 11052 H HD2  . LYS A 1 99  ? -3.645  19.254  -13.910 1.00 0.00 ? 99  LYS A HD2  4  
ATOM 11053 H HD3  . LYS A 1 99  ? -4.152  20.943  -13.991 1.00 0.00 ? 99  LYS A HD3  4  
ATOM 11054 H HE2  . LYS A 1 99  ? -5.642  20.058  -15.464 1.00 0.00 ? 99  LYS A HE2  4  
ATOM 11055 H HE3  . LYS A 1 99  ? -4.312  20.375  -16.577 1.00 0.00 ? 99  LYS A HE3  4  
ATOM 11056 H HZ1  . LYS A 1 99  ? -3.610  18.074  -16.329 1.00 0.00 ? 99  LYS A HZ1  4  
ATOM 11057 H HZ2  . LYS A 1 99  ? -5.206  18.155  -16.882 1.00 0.00 ? 99  LYS A HZ2  4  
ATOM 11058 H HZ3  . LYS A 1 99  ? -4.891  17.773  -15.265 1.00 0.00 ? 99  LYS A HZ3  4  
ATOM 11059 N N    . ARG A 1 100 ? 0.220   21.747  -16.068 1.00 0.00 ? 100 ARG A N    4  
ATOM 11060 C CA   . ARG A 1 100 ? 0.680   22.807  -16.957 1.00 0.00 ? 100 ARG A CA   4  
ATOM 11061 C C    . ARG A 1 100 ? 0.272   24.178  -16.427 1.00 0.00 ? 100 ARG A C    4  
ATOM 11062 O O    . ARG A 1 100 ? 1.100   25.079  -16.304 1.00 0.00 ? 100 ARG A O    4  
ATOM 11063 C CB   . ARG A 1 100 ? 0.117   22.603  -18.366 1.00 0.00 ? 100 ARG A CB   4  
ATOM 11064 C CG   . ARG A 1 100 ? 0.780   23.479  -19.417 1.00 0.00 ? 100 ARG A CG   4  
ATOM 11065 C CD   . ARG A 1 100 ? -0.073  23.588  -20.672 1.00 0.00 ? 100 ARG A CD   4  
ATOM 11066 N NE   . ARG A 1 100 ? 0.468   22.793  -21.773 1.00 0.00 ? 100 ARG A NE   4  
ATOM 11067 C CZ   . ARG A 1 100 ? 0.248   21.489  -21.925 1.00 0.00 ? 100 ARG A CZ   4  
ATOM 11068 N NH1  . ARG A 1 100 ? -0.496  20.826  -21.049 1.00 0.00 ? 100 ARG A NH1  4  
ATOM 11069 N NH2  . ARG A 1 100 ? 0.776   20.845  -22.957 1.00 0.00 ? 100 ARG A NH2  4  
ATOM 11070 H H    . ARG A 1 100 ? -0.331  21.981  -15.292 1.00 0.00 ? 100 ARG A H    4  
ATOM 11071 H HA   . ARG A 1 100 ? 1.758   22.759  -17.000 1.00 0.00 ? 100 ARG A HA   4  
ATOM 11072 H HB2  . ARG A 1 100 ? 0.255   21.571  -18.650 1.00 0.00 ? 100 ARG A HB2  4  
ATOM 11073 H HB3  . ARG A 1 100 ? -0.939  22.827  -18.355 1.00 0.00 ? 100 ARG A HB3  4  
ATOM 11074 H HG2  . ARG A 1 100 ? 0.926   24.468  -19.008 1.00 0.00 ? 100 ARG A HG2  4  
ATOM 11075 H HG3  . ARG A 1 100 ? 1.736   23.051  -19.678 1.00 0.00 ? 100 ARG A HG3  4  
ATOM 11076 H HD2  . ARG A 1 100 ? -1.070  23.244  -20.447 1.00 0.00 ? 100 ARG A HD2  4  
ATOM 11077 H HD3  . ARG A 1 100 ? -0.112  24.625  -20.975 1.00 0.00 ? 100 ARG A HD3  4  
ATOM 11078 H HE   . ARG A 1 100 ? 1.024   23.256  -22.434 1.00 0.00 ? 100 ARG A HE   4  
ATOM 11079 H HH11 . ARG A 1 100 ? -0.895  21.304  -20.267 1.00 0.00 ? 100 ARG A HH11 4  
ATOM 11080 H HH12 . ARG A 1 100 ? -0.657  19.847  -21.171 1.00 0.00 ? 100 ARG A HH12 4  
ATOM 11081 H HH22 . ARG A 1 100 ? 0.611   19.865  -23.073 1.00 0.00 ? 100 ARG A HH22 4  
ATOM 11082 N N    . PHE A 1 101 ? -1.012  24.326  -16.114 1.00 0.00 ? 101 PHE A N    4  
ATOM 11083 C CA   . PHE A 1 101 ? -1.532  25.587  -15.596 1.00 0.00 ? 101 PHE A CA   4  
ATOM 11084 C C    . PHE A 1 101 ? -2.060  25.414  -14.175 1.00 0.00 ? 101 PHE A C    4  
ATOM 11085 O O    . PHE A 1 101 ? -2.083  26.413  -13.428 1.00 0.00 ? 101 PHE A O    4  
ATOM 11086 C CB   . PHE A 1 101 ? -2.642  26.117  -16.505 1.00 0.00 ? 101 PHE A CB   4  
ATOM 11087 C CG   . PHE A 1 101 ? -2.653  27.614  -16.626 1.00 0.00 ? 101 PHE A CG   4  
ATOM 11088 C CD1  . PHE A 1 101 ? -1.481  28.311  -16.871 1.00 0.00 ? 101 PHE A CD1  4  
ATOM 11089 C CD2  . PHE A 1 101 ? -3.836  28.325  -16.497 1.00 0.00 ? 101 PHE A CD2  4  
ATOM 11090 C CE1  . PHE A 1 101 ? -1.488  29.688  -16.985 1.00 0.00 ? 101 PHE A CE1  4  
ATOM 11091 C CE2  . PHE A 1 101 ? -3.849  29.702  -16.609 1.00 0.00 ? 101 PHE A CE2  4  
ATOM 11092 C CZ   . PHE A 1 101 ? -2.673  30.384  -16.854 1.00 0.00 ? 101 PHE A CZ   4  
ATOM 11093 O OXT  . PHE A 1 101 ? -2.448  24.280  -13.823 1.00 0.00 ? 101 PHE A OXT  4  
ATOM 11094 H H    . PHE A 1 101 ? -1.624  23.570  -16.234 1.00 0.00 ? 101 PHE A H    4  
ATOM 11095 H HA   . PHE A 1 101 ? -0.720  26.299  -15.580 1.00 0.00 ? 101 PHE A HA   4  
ATOM 11096 H HB2  . PHE A 1 101 ? -2.515  25.704  -17.494 1.00 0.00 ? 101 PHE A HB2  4  
ATOM 11097 H HB3  . PHE A 1 101 ? -3.599  25.807  -16.110 1.00 0.00 ? 101 PHE A HB3  4  
ATOM 11098 H HD1  . PHE A 1 101 ? -0.553  27.768  -16.974 1.00 0.00 ? 101 PHE A HD1  4  
ATOM 11099 H HD2  . PHE A 1 101 ? -4.756  27.792  -16.307 1.00 0.00 ? 101 PHE A HD2  4  
ATOM 11100 H HE1  . PHE A 1 101 ? -0.567  30.219  -17.175 1.00 0.00 ? 101 PHE A HE1  4  
ATOM 11101 H HE2  . PHE A 1 101 ? -4.777  30.244  -16.506 1.00 0.00 ? 101 PHE A HE2  4  
ATOM 11102 H HZ   . PHE A 1 101 ? -2.681  31.461  -16.941 1.00 0.00 ? 101 PHE A HZ   4  
ATOM 11103 N N    . SER B 1 1   ? -14.946 7.345   18.155  1.00 0.00 ? 1   SER B N    4  
ATOM 11104 C CA   . SER B 1 1   ? -16.094 7.013   17.271  1.00 0.00 ? 1   SER B CA   4  
ATOM 11105 C C    . SER B 1 1   ? -16.171 7.971   16.087  1.00 0.00 ? 1   SER B C    4  
ATOM 11106 O O    . SER B 1 1   ? -16.876 8.979   16.136  1.00 0.00 ? 1   SER B O    4  
ATOM 11107 C CB   . SER B 1 1   ? -17.381 7.085   18.094  1.00 0.00 ? 1   SER B CB   4  
ATOM 11108 O OG   . SER B 1 1   ? -17.762 5.801   18.558  1.00 0.00 ? 1   SER B OG   4  
ATOM 11109 H H1   . SER B 1 1   ? -15.218 8.165   18.732  1.00 0.00 ? 1   SER B H1   4  
ATOM 11110 H H2   . SER B 1 1   ? -14.131 7.567   17.547  1.00 0.00 ? 1   SER B H2   4  
ATOM 11111 H H3   . SER B 1 1   ? -14.756 6.515   18.751  1.00 0.00 ? 1   SER B H3   4  
ATOM 11112 H HA   . SER B 1 1   ? -15.963 6.006   16.901  1.00 0.00 ? 1   SER B HA   4  
ATOM 11113 H HB2  . SER B 1 1   ? -17.225 7.730   18.946  1.00 0.00 ? 1   SER B HB2  4  
ATOM 11114 H HB3  . SER B 1 1   ? -18.176 7.485   17.482  1.00 0.00 ? 1   SER B HB3  4  
ATOM 11115 H HG   . SER B 1 1   ? -16.990 5.336   18.884  1.00 0.00 ? 1   SER B HG   4  
ATOM 11116 N N    . ARG B 1 2   ? -15.444 7.648   15.021  1.00 0.00 ? 2   ARG B N    4  
ATOM 11117 C CA   . ARG B 1 2   ? -15.431 8.481   13.823  1.00 0.00 ? 2   ARG B CA   4  
ATOM 11118 C C    . ARG B 1 2   ? -14.514 7.890   12.753  1.00 0.00 ? 2   ARG B C    4  
ATOM 11119 O O    . ARG B 1 2   ? -14.919 7.721   11.604  1.00 0.00 ? 2   ARG B O    4  
ATOM 11120 C CB   . ARG B 1 2   ? -14.986 9.906   14.165  1.00 0.00 ? 2   ARG B CB   4  
ATOM 11121 C CG   . ARG B 1 2   ? -15.822 10.983  13.493  1.00 0.00 ? 2   ARG B CG   4  
ATOM 11122 C CD   . ARG B 1 2   ? -15.518 11.079  12.007  1.00 0.00 ? 2   ARG B CD   4  
ATOM 11123 N NE   . ARG B 1 2   ? -14.127 11.446  11.755  1.00 0.00 ? 2   ARG B NE   4  
ATOM 11124 C CZ   . ARG B 1 2   ? -13.635 11.704  10.545  1.00 0.00 ? 2   ARG B CZ   4  
ATOM 11125 N NH1  . ARG B 1 2   ? -14.417 11.637  9.476   1.00 0.00 ? 2   ARG B NH1  4  
ATOM 11126 N NH2  . ARG B 1 2   ? -12.357 12.031  10.405  1.00 0.00 ? 2   ARG B NH2  4  
ATOM 11127 H H    . ARG B 1 2   ? -14.904 6.832   15.042  1.00 0.00 ? 2   ARG B H    4  
ATOM 11128 H HA   . ARG B 1 2   ? -16.438 8.513   13.434  1.00 0.00 ? 2   ARG B HA   4  
ATOM 11129 H HB2  . ARG B 1 2   ? -15.053 10.043  15.234  1.00 0.00 ? 2   ARG B HB2  4  
ATOM 11130 H HB3  . ARG B 1 2   ? -13.959 10.034  13.858  1.00 0.00 ? 2   ARG B HB3  4  
ATOM 11131 H HG2  . ARG B 1 2   ? -16.868 10.746  13.622  1.00 0.00 ? 2   ARG B HG2  4  
ATOM 11132 H HG3  . ARG B 1 2   ? -15.607 11.934  13.958  1.00 0.00 ? 2   ARG B HG3  4  
ATOM 11133 H HD2  . ARG B 1 2   ? -15.715 10.121  11.549  1.00 0.00 ? 2   ARG B HD2  4  
ATOM 11134 H HD3  . ARG B 1 2   ? -16.163 11.825  11.568  1.00 0.00 ? 2   ARG B HD3  4  
ATOM 11135 H HE   . ARG B 1 2   ? -13.527 11.504  12.528  1.00 0.00 ? 2   ARG B HE   4  
ATOM 11136 H HH11 . ARG B 1 2   ? -15.382 11.392  9.574   1.00 0.00 ? 2   ARG B HH11 4  
ATOM 11137 H HH12 . ARG B 1 2   ? -14.042 11.832  8.569   1.00 0.00 ? 2   ARG B HH12 4  
ATOM 11138 H HH22 . ARG B 1 2   ? -11.988 12.225  9.496   1.00 0.00 ? 2   ARG B HH22 4  
ATOM 11139 N N    . PRO B 1 3   ? -13.258 7.567   13.116  1.00 0.00 ? 3   PRO B N    4  
ATOM 11140 C CA   . PRO B 1 3   ? -12.279 6.995   12.186  1.00 0.00 ? 3   PRO B CA   4  
ATOM 11141 C C    . PRO B 1 3   ? -12.656 5.571   11.763  1.00 0.00 ? 3   PRO B C    4  
ATOM 11142 O O    . PRO B 1 3   ? -13.802 5.314   11.397  1.00 0.00 ? 3   PRO B O    4  
ATOM 11143 C CB   . PRO B 1 3   ? -10.969 7.025   13.004  1.00 0.00 ? 3   PRO B CB   4  
ATOM 11144 C CG   . PRO B 1 3   ? -11.241 7.970   14.116  1.00 0.00 ? 3   PRO B CG   4  
ATOM 11145 C CD   . PRO B 1 3   ? -12.673 7.727   14.450  1.00 0.00 ? 3   PRO B CD   4  
ATOM 11146 H HA   . PRO B 1 3   ? -12.169 7.611   11.304  1.00 0.00 ? 3   PRO B HA   4  
ATOM 11147 H HB2  . PRO B 1 3   ? -10.756 6.038   13.383  1.00 0.00 ? 3   PRO B HB2  4  
ATOM 11148 H HB3  . PRO B 1 3   ? -10.156 7.366   12.383  1.00 0.00 ? 3   PRO B HB3  4  
ATOM 11149 H HG2  . PRO B 1 3   ? -10.606 7.746   14.962  1.00 0.00 ? 3   PRO B HG2  4  
ATOM 11150 H HG3  . PRO B 1 3   ? -11.096 8.988   13.787  1.00 0.00 ? 3   PRO B HG3  4  
ATOM 11151 H HD2  . PRO B 1 3   ? -12.770 6.818   15.025  1.00 0.00 ? 3   PRO B HD2  4  
ATOM 11152 H HD3  . PRO B 1 3   ? -13.100 8.569   14.971  1.00 0.00 ? 3   PRO B HD3  4  
ATOM 11153 N N    . THR B 1 4   ? -11.694 4.649   11.810  1.00 0.00 ? 4   THR B N    4  
ATOM 11154 C CA   . THR B 1 4   ? -11.939 3.261   11.426  1.00 0.00 ? 4   THR B CA   4  
ATOM 11155 C C    . THR B 1 4   ? -10.655 2.453   11.461  1.00 0.00 ? 4   THR B C    4  
ATOM 11156 O O    . THR B 1 4   ? -9.561  2.978   11.260  1.00 0.00 ? 4   THR B O    4  
ATOM 11157 C CB   . THR B 1 4   ? -12.576 3.188   10.033  1.00 0.00 ? 4   THR B CB   4  
ATOM 11158 O OG1  . THR B 1 4   ? -12.486 1.875   9.507   1.00 0.00 ? 4   THR B OG1  4  
ATOM 11159 C CG2  . THR B 1 4   ? -11.946 4.130   9.029   1.00 0.00 ? 4   THR B CG2  4  
ATOM 11160 H H    . THR B 1 4   ? -10.800 4.907   12.107  1.00 0.00 ? 4   THR B H    4  
ATOM 11161 H HA   . THR B 1 4   ? -12.621 2.829   12.142  1.00 0.00 ? 4   THR B HA   4  
ATOM 11162 H HB   . THR B 1 4   ? -13.622 3.447   10.116  1.00 0.00 ? 4   THR B HB   4  
ATOM 11163 H HG1  . THR B 1 4   ? -11.596 1.717   9.188   1.00 0.00 ? 4   THR B HG1  4  
ATOM 11164 H HG21 . THR B 1 4   ? -11.032 3.695   8.650   1.00 0.00 ? 4   THR B HG21 4  
ATOM 11165 H HG22 . THR B 1 4   ? -11.723 5.073   9.509   1.00 0.00 ? 4   THR B HG22 4  
ATOM 11166 H HG23 . THR B 1 4   ? -12.631 4.297   8.211   1.00 0.00 ? 4   THR B HG23 4  
ATOM 11167 N N    . GLU B 1 5   ? -10.808 1.166   11.731  1.00 0.00 ? 5   GLU B N    4  
ATOM 11168 C CA   . GLU B 1 5   ? -9.685  0.244   11.813  1.00 0.00 ? 5   GLU B CA   4  
ATOM 11169 C C    . GLU B 1 5   ? -8.708  0.452   10.658  1.00 0.00 ? 5   GLU B C    4  
ATOM 11170 O O    . GLU B 1 5   ? -7.501  0.575   10.870  1.00 0.00 ? 5   GLU B O    4  
ATOM 11171 C CB   . GLU B 1 5   ? -10.221 -1.181  11.811  1.00 0.00 ? 5   GLU B CB   4  
ATOM 11172 C CG   . GLU B 1 5   ? -9.529  -2.098  12.806  1.00 0.00 ? 5   GLU B CG   4  
ATOM 11173 C CD   . GLU B 1 5   ? -8.450  -2.947  12.162  1.00 0.00 ? 5   GLU B CD   4  
ATOM 11174 O OE1  . GLU B 1 5   ? -7.894  -2.518  11.130  1.00 0.00 ? 5   GLU B OE1  4  
ATOM 11175 O OE2  . GLU B 1 5   ? -8.162  -4.041  12.692  1.00 0.00 ? 5   GLU B OE2  4  
ATOM 11176 H H    . GLU B 1 5   ? -11.713 0.821   11.886  1.00 0.00 ? 5   GLU B H    4  
ATOM 11177 H HA   . GLU B 1 5   ? -9.172  0.426   12.744  1.00 0.00 ? 5   GLU B HA   4  
ATOM 11178 H HB2  . GLU B 1 5   ? -11.276 -1.144  12.054  1.00 0.00 ? 5   GLU B HB2  4  
ATOM 11179 H HB3  . GLU B 1 5   ? -10.105 -1.597  10.822  1.00 0.00 ? 5   GLU B HB3  4  
ATOM 11180 H HG2  . GLU B 1 5   ? -9.077  -1.494  13.579  1.00 0.00 ? 5   GLU B HG2  4  
ATOM 11181 H HG3  . GLU B 1 5   ? -10.267 -2.752  13.247  1.00 0.00 ? 5   GLU B HG3  4  
ATOM 11182 N N    . THR B 1 6   ? -9.236  0.503   9.440   1.00 0.00 ? 6   THR B N    4  
ATOM 11183 C CA   . THR B 1 6   ? -8.406  0.712   8.261   1.00 0.00 ? 6   THR B CA   4  
ATOM 11184 C C    . THR B 1 6   ? -7.748  2.085   8.311   1.00 0.00 ? 6   THR B C    4  
ATOM 11185 O O    . THR B 1 6   ? -6.628  2.263   7.834   1.00 0.00 ? 6   THR B O    4  
ATOM 11186 C CB   . THR B 1 6   ? -9.242  0.581   6.990   1.00 0.00 ? 6   THR B CB   4  
ATOM 11187 O OG1  . THR B 1 6   ? -10.140 -0.510  7.090   1.00 0.00 ? 6   THR B OG1  4  
ATOM 11188 C CG2  . THR B 1 6   ? -8.403  0.373   5.751   1.00 0.00 ? 6   THR B CG2  4  
ATOM 11189 H H    . THR B 1 6   ? -10.203 0.407   9.331   1.00 0.00 ? 6   THR B H    4  
ATOM 11190 H HA   . THR B 1 6   ? -7.634  -0.044  8.254   1.00 0.00 ? 6   THR B HA   4  
ATOM 11191 H HB   . THR B 1 6   ? -9.817  1.485   6.853   1.00 0.00 ? 6   THR B HB   4  
ATOM 11192 H HG1  . THR B 1 6   ? -9.671  -1.283  7.412   1.00 0.00 ? 6   THR B HG1  4  
ATOM 11193 H HG21 . THR B 1 6   ? -7.392  0.129   6.041   1.00 0.00 ? 6   THR B HG21 4  
ATOM 11194 H HG22 . THR B 1 6   ? -8.398  1.279   5.164   1.00 0.00 ? 6   THR B HG22 4  
ATOM 11195 H HG23 . THR B 1 6   ? -8.816  -0.434  5.167   1.00 0.00 ? 6   THR B HG23 4  
ATOM 11196 N N    . GLU B 1 7   ? -8.448  3.053   8.904   1.00 0.00 ? 7   GLU B N    4  
ATOM 11197 C CA   . GLU B 1 7   ? -7.929  4.414   9.022   1.00 0.00 ? 7   GLU B CA   4  
ATOM 11198 C C    . GLU B 1 7   ? -6.538  4.399   9.639   1.00 0.00 ? 7   GLU B C    4  
ATOM 11199 O O    . GLU B 1 7   ? -5.646  5.130   9.207   1.00 0.00 ? 7   GLU B O    4  
ATOM 11200 C CB   . GLU B 1 7   ? -8.867  5.272   9.877   1.00 0.00 ? 7   GLU B CB   4  
ATOM 11201 C CG   . GLU B 1 7   ? -9.145  6.643   9.283   1.00 0.00 ? 7   GLU B CG   4  
ATOM 11202 C CD   . GLU B 1 7   ? -8.519  7.766   10.087  1.00 0.00 ? 7   GLU B CD   4  
ATOM 11203 O OE1  . GLU B 1 7   ? -7.454  7.536   10.698  1.00 0.00 ? 7   GLU B OE1  4  
ATOM 11204 O OE2  . GLU B 1 7   ? -9.093  8.875   10.106  1.00 0.00 ? 7   GLU B OE2  4  
ATOM 11205 H H    . GLU B 1 7   ? -9.332  2.844   9.271   1.00 0.00 ? 7   GLU B H    4  
ATOM 11206 H HA   . GLU B 1 7   ? -7.871  4.837   8.033   1.00 0.00 ? 7   GLU B HA   4  
ATOM 11207 H HB2  . GLU B 1 7   ? -9.806  4.755   9.989   1.00 0.00 ? 7   GLU B HB2  4  
ATOM 11208 H HB3  . GLU B 1 7   ? -8.424  5.409   10.853  1.00 0.00 ? 7   GLU B HB3  4  
ATOM 11209 H HG2  . GLU B 1 7   ? -8.749  6.675   8.280   1.00 0.00 ? 7   GLU B HG2  4  
ATOM 11210 H HG3  . GLU B 1 7   ? -10.215 6.796   9.252   1.00 0.00 ? 7   GLU B HG3  4  
ATOM 11211 N N    . ARG B 1 8   ? -6.356  3.548   10.640  1.00 0.00 ? 8   ARG B N    4  
ATOM 11212 C CA   . ARG B 1 8   ? -5.069  3.422   11.306  1.00 0.00 ? 8   ARG B CA   4  
ATOM 11213 C C    . ARG B 1 8   ? -4.084  2.659   10.423  1.00 0.00 ? 8   ARG B C    4  
ATOM 11214 O O    . ARG B 1 8   ? -2.873  2.844   10.528  1.00 0.00 ? 8   ARG B O    4  
ATOM 11215 C CB   . ARG B 1 8   ? -5.234  2.710   12.651  1.00 0.00 ? 8   ARG B CB   4  
ATOM 11216 C CG   . ARG B 1 8   ? -4.745  3.528   13.835  1.00 0.00 ? 8   ARG B CG   4  
ATOM 11217 C CD   . ARG B 1 8   ? -5.825  4.469   14.346  1.00 0.00 ? 8   ARG B CD   4  
ATOM 11218 N NE   . ARG B 1 8   ? -5.263  5.705   14.885  1.00 0.00 ? 8   ARG B NE   4  
ATOM 11219 C CZ   . ARG B 1 8   ? -5.921  6.526   15.699  1.00 0.00 ? 8   ARG B CZ   4  
ATOM 11220 N NH1  . ARG B 1 8   ? -7.166  6.247   16.069  1.00 0.00 ? 8   ARG B NH1  4  
ATOM 11221 N NH2  . ARG B 1 8   ? -5.336  7.628   16.144  1.00 0.00 ? 8   ARG B NH2  4  
ATOM 11222 H H    . ARG B 1 8   ? -7.104  2.986   10.933  1.00 0.00 ? 8   ARG B H    4  
ATOM 11223 H HA   . ARG B 1 8   ? -4.685  4.417   11.479  1.00 0.00 ? 8   ARG B HA   4  
ATOM 11224 H HB2  . ARG B 1 8   ? -6.280  2.489   12.801  1.00 0.00 ? 8   ARG B HB2  4  
ATOM 11225 H HB3  . ARG B 1 8   ? -4.680  1.783   12.628  1.00 0.00 ? 8   ARG B HB3  4  
ATOM 11226 H HG2  . ARG B 1 8   ? -4.461  2.857   14.630  1.00 0.00 ? 8   ARG B HG2  4  
ATOM 11227 H HG3  . ARG B 1 8   ? -3.889  4.110   13.528  1.00 0.00 ? 8   ARG B HG3  4  
ATOM 11228 H HD2  . ARG B 1 8   ? -6.488  4.713   13.528  1.00 0.00 ? 8   ARG B HD2  4  
ATOM 11229 H HD3  . ARG B 1 8   ? -6.382  3.967   15.123  1.00 0.00 ? 8   ARG B HD3  4  
ATOM 11230 H HE   . ARG B 1 8   ? -4.346  5.935   14.628  1.00 0.00 ? 8   ARG B HE   4  
ATOM 11231 H HH11 . ARG B 1 8   ? -7.614  5.417   15.737  1.00 0.00 ? 8   ARG B HH11 4  
ATOM 11232 H HH12 . ARG B 1 8   ? -7.655  6.868   16.681  1.00 0.00 ? 8   ARG B HH12 4  
ATOM 11233 H HH22 . ARG B 1 8   ? -5.831  8.246   16.756  1.00 0.00 ? 8   ARG B HH22 4  
ATOM 11234 N N    . CYS B 1 9   ? -4.617  1.801   9.555   1.00 0.00 ? 9   CYS B N    4  
ATOM 11235 C CA   . CYS B 1 9   ? -3.794  1.001   8.652   1.00 0.00 ? 9   CYS B CA   4  
ATOM 11236 C C    . CYS B 1 9   ? -3.108  1.870   7.603   1.00 0.00 ? 9   CYS B C    4  
ATOM 11237 O O    . CYS B 1 9   ? -1.889  1.817   7.443   1.00 0.00 ? 9   CYS B O    4  
ATOM 11238 C CB   . CYS B 1 9   ? -4.648  -0.066  7.963   1.00 0.00 ? 9   CYS B CB   4  
ATOM 11239 S SG   . CYS B 1 9   ? -5.406  -1.251  9.100   1.00 0.00 ? 9   CYS B SG   4  
ATOM 11240 H H    . CYS B 1 9   ? -5.591  1.698   9.523   1.00 0.00 ? 9   CYS B H    4  
ATOM 11241 H HA   . CYS B 1 9   ? -3.036  0.511   9.241   1.00 0.00 ? 9   CYS B HA   4  
ATOM 11242 H HB2  . CYS B 1 9   ? -5.442  0.418   7.417   1.00 0.00 ? 9   CYS B HB2  4  
ATOM 11243 H HB3  . CYS B 1 9   ? -4.029  -0.621  7.273   1.00 0.00 ? 9   CYS B HB3  4  
ATOM 11244 H HG   . CYS B 1 9   ? -5.340  -0.894  9.988   1.00 0.00 ? 9   CYS B HG   4  
ATOM 11245 N N    . ILE B 1 10  ? -3.893  2.666   6.883   1.00 0.00 ? 10  ILE B N    4  
ATOM 11246 C CA   . ILE B 1 10  ? -3.353  3.538   5.847   1.00 0.00 ? 10  ILE B CA   4  
ATOM 11247 C C    . ILE B 1 10  ? -2.188  4.369   6.373   1.00 0.00 ? 10  ILE B C    4  
ATOM 11248 O O    . ILE B 1 10  ? -1.090  4.337   5.821   1.00 0.00 ? 10  ILE B O    4  
ATOM 11249 C CB   . ILE B 1 10  ? -4.432  4.495   5.295   1.00 0.00 ? 10  ILE B CB   4  
ATOM 11250 C CG1  . ILE B 1 10  ? -5.734  3.743   5.013   1.00 0.00 ? 10  ILE B CG1  4  
ATOM 11251 C CG2  . ILE B 1 10  ? -3.935  5.185   4.033   1.00 0.00 ? 10  ILE B CG2  4  
ATOM 11252 C CD1  . ILE B 1 10  ? -6.847  4.091   5.969   1.00 0.00 ? 10  ILE B CD1  4  
ATOM 11253 H H    . ILE B 1 10  ? -4.858  2.665   7.049   1.00 0.00 ? 10  ILE B H    4  
ATOM 11254 H HA   . ILE B 1 10  ? -3.000  2.917   5.035   1.00 0.00 ? 10  ILE B HA   4  
ATOM 11255 H HB   . ILE B 1 10  ? -4.618  5.255   6.039   1.00 0.00 ? 10  ILE B HB   4  
ATOM 11256 H HG12 . ILE B 1 10  ? -6.074  3.984   4.019   1.00 0.00 ? 10  ILE B HG12 4  
ATOM 11257 H HG13 . ILE B 1 10  ? -5.554  2.680   5.083   1.00 0.00 ? 10  ILE B HG13 4  
ATOM 11258 H HG21 . ILE B 1 10  ? -3.842  6.244   4.216   1.00 0.00 ? 10  ILE B HG21 4  
ATOM 11259 H HG22 . ILE B 1 10  ? -4.639  5.018   3.231   1.00 0.00 ? 10  ILE B HG22 4  
ATOM 11260 H HG23 . ILE B 1 10  ? -2.972  4.781   3.757   1.00 0.00 ? 10  ILE B HG23 4  
ATOM 11261 H HD11 . ILE B 1 10  ? -7.378  4.958   5.604   1.00 0.00 ? 10  ILE B HD11 4  
ATOM 11262 H HD12 . ILE B 1 10  ? -6.429  4.306   6.941   1.00 0.00 ? 10  ILE B HD12 4  
ATOM 11263 H HD13 . ILE B 1 10  ? -7.529  3.257   6.046   1.00 0.00 ? 10  ILE B HD13 4  
ATOM 11264 N N    . GLU B 1 11  ? -2.439  5.120   7.438   1.00 0.00 ? 11  GLU B N    4  
ATOM 11265 C CA   . GLU B 1 11  ? -1.419  5.975   8.036   1.00 0.00 ? 11  GLU B CA   4  
ATOM 11266 C C    . GLU B 1 11  ? -0.151  5.195   8.376   1.00 0.00 ? 11  GLU B C    4  
ATOM 11267 O O    . GLU B 1 11  ? 0.941   5.761   8.412   1.00 0.00 ? 11  GLU B O    4  
ATOM 11268 C CB   . GLU B 1 11  ? -1.968  6.657   9.292   1.00 0.00 ? 11  GLU B CB   4  
ATOM 11269 C CG   . GLU B 1 11  ? -2.158  8.156   9.130   1.00 0.00 ? 11  GLU B CG   4  
ATOM 11270 C CD   . GLU B 1 11  ? -1.994  8.910   10.436  1.00 0.00 ? 11  GLU B CD   4  
ATOM 11271 O OE1  . GLU B 1 11  ? -2.271  8.318   11.501  1.00 0.00 ? 11  GLU B OE1  4  
ATOM 11272 O OE2  . GLU B 1 11  ? -1.589  10.089  10.394  1.00 0.00 ? 11  GLU B OE2  4  
ATOM 11273 H H    . GLU B 1 11  ? -3.338  5.108   7.829   1.00 0.00 ? 11  GLU B H    4  
ATOM 11274 H HA   . GLU B 1 11  ? -1.167  6.736   7.314   1.00 0.00 ? 11  GLU B HA   4  
ATOM 11275 H HB2  . GLU B 1 11  ? -2.924  6.219   9.537   1.00 0.00 ? 11  GLU B HB2  4  
ATOM 11276 H HB3  . GLU B 1 11  ? -1.285  6.489   10.111  1.00 0.00 ? 11  GLU B HB3  4  
ATOM 11277 H HG2  . GLU B 1 11  ? -1.428  8.526   8.425   1.00 0.00 ? 11  GLU B HG2  4  
ATOM 11278 H HG3  . GLU B 1 11  ? -3.151  8.341   8.747   1.00 0.00 ? 11  GLU B HG3  4  
ATOM 11279 N N    . SER B 1 12  ? -0.297  3.902   8.641   1.00 0.00 ? 12  SER B N    4  
ATOM 11280 C CA   . SER B 1 12  ? 0.848   3.070   8.994   1.00 0.00 ? 12  SER B CA   4  
ATOM 11281 C C    . SER B 1 12  ? 1.874   3.008   7.865   1.00 0.00 ? 12  SER B C    4  
ATOM 11282 O O    . SER B 1 12  ? 3.049   3.304   8.075   1.00 0.00 ? 12  SER B O    4  
ATOM 11283 C CB   . SER B 1 12  ? 0.392   1.653   9.350   1.00 0.00 ? 12  SER B CB   4  
ATOM 11284 O OG   . SER B 1 12  ? -0.974  1.631   9.718   1.00 0.00 ? 12  SER B OG   4  
ATOM 11285 H H    . SER B 1 12  ? -1.191  3.503   8.610   1.00 0.00 ? 12  SER B H    4  
ATOM 11286 H HA   . SER B 1 12  ? 1.317   3.510   9.861   1.00 0.00 ? 12  SER B HA   4  
ATOM 11287 H HB2  . SER B 1 12  ? 0.531   1.006   8.497   1.00 0.00 ? 12  SER B HB2  4  
ATOM 11288 H HB3  . SER B 1 12  ? 0.980   1.287   10.179  1.00 0.00 ? 12  SER B HB3  4  
ATOM 11289 H HG   . SER B 1 12  ? -1.069  1.949   10.619  1.00 0.00 ? 12  SER B HG   4  
ATOM 11290 N N    . LEU B 1 13  ? 1.436   2.601   6.676   1.00 0.00 ? 13  LEU B N    4  
ATOM 11291 C CA   . LEU B 1 13  ? 2.330   2.477   5.534   1.00 0.00 ? 13  LEU B CA   4  
ATOM 11292 C C    . LEU B 1 13  ? 2.805   3.829   5.003   1.00 0.00 ? 13  LEU B C    4  
ATOM 11293 O O    . LEU B 1 13  ? 3.989   4.028   4.779   1.00 0.00 ? 13  LEU B O    4  
ATOM 11294 C CB   . LEU B 1 13  ? 1.631   1.699   4.428   1.00 0.00 ? 13  LEU B CB   4  
ATOM 11295 C CG   . LEU B 1 13  ? 1.920   0.203   4.426   1.00 0.00 ? 13  LEU B CG   4  
ATOM 11296 C CD1  . LEU B 1 13  ? 3.392   -0.052  4.169   1.00 0.00 ? 13  LEU B CD1  4  
ATOM 11297 C CD2  . LEU B 1 13  ? 1.516   -0.436  5.738   1.00 0.00 ? 13  LEU B CD2  4  
ATOM 11298 H H    . LEU B 1 13  ? 0.493   2.354   6.565   1.00 0.00 ? 13  LEU B H    4  
ATOM 11299 H HA   . LEU B 1 13  ? 3.192   1.913   5.856   1.00 0.00 ? 13  LEU B HA   4  
ATOM 11300 H HB2  . LEU B 1 13  ? 0.565   1.840   4.533   1.00 0.00 ? 13  LEU B HB2  4  
ATOM 11301 H HB3  . LEU B 1 13  ? 1.940   2.104   3.476   1.00 0.00 ? 13  LEU B HB3  4  
ATOM 11302 H HG   . LEU B 1 13  ? 1.350   -0.259  3.642   1.00 0.00 ? 13  LEU B HG   4  
ATOM 11303 H HD11 . LEU B 1 13  ? 3.814   0.788   3.638   1.00 0.00 ? 13  LEU B HD11 4  
ATOM 11304 H HD12 . LEU B 1 13  ? 3.503   -0.949  3.578   1.00 0.00 ? 13  LEU B HD12 4  
ATOM 11305 H HD13 . LEU B 1 13  ? 3.906   -0.177  5.114   1.00 0.00 ? 13  LEU B HD13 4  
ATOM 11306 H HD21 . LEU B 1 13  ? 1.506   0.311   6.516   1.00 0.00 ? 13  LEU B HD21 4  
ATOM 11307 H HD22 . LEU B 1 13  ? 2.233   -1.206  5.987   1.00 0.00 ? 13  LEU B HD22 4  
ATOM 11308 H HD23 . LEU B 1 13  ? 0.536   -0.873  5.640   1.00 0.00 ? 13  LEU B HD23 4  
ATOM 11309 N N    . ILE B 1 14  ? 1.886   4.754   4.792   1.00 0.00 ? 14  ILE B N    4  
ATOM 11310 C CA   . ILE B 1 14  ? 2.241   6.069   4.279   1.00 0.00 ? 14  ILE B CA   4  
ATOM 11311 C C    . ILE B 1 14  ? 3.377   6.692   5.049   1.00 0.00 ? 14  ILE B C    4  
ATOM 11312 O O    . ILE B 1 14  ? 4.109   7.523   4.532   1.00 0.00 ? 14  ILE B O    4  
ATOM 11313 C CB   . ILE B 1 14  ? 1.090   7.065   4.411   1.00 0.00 ? 14  ILE B CB   4  
ATOM 11314 C CG1  . ILE B 1 14  ? -0.240  6.476   3.989   1.00 0.00 ? 14  ILE B CG1  4  
ATOM 11315 C CG2  . ILE B 1 14  ? 1.395   8.306   3.615   1.00 0.00 ? 14  ILE B CG2  4  
ATOM 11316 C CD1  . ILE B 1 14  ? -1.380  7.099   4.743   1.00 0.00 ? 14  ILE B CD1  4  
ATOM 11317 H H    . ILE B 1 14  ? 0.955   4.555   4.981   1.00 0.00 ? 14  ILE B H    4  
ATOM 11318 H HA   . ILE B 1 14  ? 2.504   5.988   3.242   1.00 0.00 ? 14  ILE B HA   4  
ATOM 11319 H HB   . ILE B 1 14  ? 1.025   7.354   5.450   1.00 0.00 ? 14  ILE B HB   4  
ATOM 11320 H HG12 . ILE B 1 14  ? -0.396  6.647   2.934   1.00 0.00 ? 14  ILE B HG12 4  
ATOM 11321 H HG13 . ILE B 1 14  ? -0.247  5.423   4.189   1.00 0.00 ? 14  ILE B HG13 4  
ATOM 11322 H HG21 . ILE B 1 14  ? 0.852   8.276   2.686   1.00 0.00 ? 14  ILE B HG21 4  
ATOM 11323 H HG22 . ILE B 1 14  ? 2.456   8.345   3.418   1.00 0.00 ? 14  ILE B HG22 4  
ATOM 11324 H HG23 . ILE B 1 14  ? 1.100   9.173   4.184   1.00 0.00 ? 14  ILE B HG23 4  
ATOM 11325 H HD11 . ILE B 1 14  ? -2.067  6.336   5.055   1.00 0.00 ? 14  ILE B HD11 4  
ATOM 11326 H HD12 . ILE B 1 14  ? -1.885  7.808   4.108   1.00 0.00 ? 14  ILE B HD12 4  
ATOM 11327 H HD13 . ILE B 1 14  ? -0.984  7.608   5.614   1.00 0.00 ? 14  ILE B HD13 4  
ATOM 11328 N N    . ALA B 1 15  ? 3.464   6.337   6.305   1.00 0.00 ? 15  ALA B N    4  
ATOM 11329 C CA   . ALA B 1 15  ? 4.440   6.920   7.188   1.00 0.00 ? 15  ALA B CA   4  
ATOM 11330 C C    . ALA B 1 15  ? 5.779   6.212   7.134   1.00 0.00 ? 15  ALA B C    4  
ATOM 11331 O O    . ALA B 1 15  ? 6.822   6.850   7.267   1.00 0.00 ? 15  ALA B O    4  
ATOM 11332 C CB   . ALA B 1 15  ? 3.844   6.968   8.570   1.00 0.00 ? 15  ALA B CB   4  
ATOM 11333 H H    . ALA B 1 15  ? 2.825   5.691   6.661   1.00 0.00 ? 15  ALA B H    4  
ATOM 11334 H HA   . ALA B 1 15  ? 4.589   7.942   6.867   1.00 0.00 ? 15  ALA B HA   4  
ATOM 11335 H HB1  . ALA B 1 15  ? 2.761   6.985   8.473   1.00 0.00 ? 15  ALA B HB1  4  
ATOM 11336 H HB2  . ALA B 1 15  ? 4.176   7.863   9.071   1.00 0.00 ? 15  ALA B HB2  4  
ATOM 11337 H HB3  . ALA B 1 15  ? 4.144   6.097   9.129   1.00 0.00 ? 15  ALA B HB3  4  
ATOM 11338 N N    . VAL B 1 16  ? 5.767   4.908   6.886   1.00 0.00 ? 16  VAL B N    4  
ATOM 11339 C CA   . VAL B 1 16  ? 7.007   4.174   6.757   1.00 0.00 ? 16  VAL B CA   4  
ATOM 11340 C C    . VAL B 1 16  ? 7.868   4.885   5.714   1.00 0.00 ? 16  VAL B C    4  
ATOM 11341 O O    . VAL B 1 16  ? 9.094   4.932   5.811   1.00 0.00 ? 16  VAL B O    4  
ATOM 11342 C CB   . VAL B 1 16  ? 6.753   2.727   6.300   1.00 0.00 ? 16  VAL B CB   4  
ATOM 11343 C CG1  . VAL B 1 16  ? 5.772   2.023   7.208   1.00 0.00 ? 16  VAL B CG1  4  
ATOM 11344 C CG2  . VAL B 1 16  ? 6.225   2.714   4.888   1.00 0.00 ? 16  VAL B CG2  4  
ATOM 11345 H H    . VAL B 1 16  ? 4.918   4.444   6.744   1.00 0.00 ? 16  VAL B H    4  
ATOM 11346 H HA   . VAL B 1 16  ? 7.515   4.168   7.711   1.00 0.00 ? 16  VAL B HA   4  
ATOM 11347 H HB   . VAL B 1 16  ? 7.681   2.193   6.321   1.00 0.00 ? 16  VAL B HB   4  
ATOM 11348 H HG11 . VAL B 1 16  ? 6.287   1.649   8.079   1.00 0.00 ? 16  VAL B HG11 4  
ATOM 11349 H HG12 . VAL B 1 16  ? 5.320   1.198   6.667   1.00 0.00 ? 16  VAL B HG12 4  
ATOM 11350 H HG13 . VAL B 1 16  ? 5.008   2.720   7.508   1.00 0.00 ? 16  VAL B HG13 4  
ATOM 11351 H HG21 . VAL B 1 16  ? 5.672   3.628   4.711   1.00 0.00 ? 16  VAL B HG21 4  
ATOM 11352 H HG22 . VAL B 1 16  ? 5.569   1.866   4.754   1.00 0.00 ? 16  VAL B HG22 4  
ATOM 11353 H HG23 . VAL B 1 16  ? 7.050   2.648   4.197   1.00 0.00 ? 16  VAL B HG23 4  
ATOM 11354 N N    . PHE B 1 17  ? 7.176   5.451   4.722   1.00 0.00 ? 17  PHE B N    4  
ATOM 11355 C CA   . PHE B 1 17  ? 7.817   6.193   3.641   1.00 0.00 ? 17  PHE B CA   4  
ATOM 11356 C C    . PHE B 1 17  ? 8.154   7.613   4.084   1.00 0.00 ? 17  PHE B C    4  
ATOM 11357 O O    . PHE B 1 17  ? 9.306   8.037   4.009   1.00 0.00 ? 17  PHE B O    4  
ATOM 11358 C CB   . PHE B 1 17  ? 6.911   6.250   2.406   1.00 0.00 ? 17  PHE B CB   4  
ATOM 11359 C CG   . PHE B 1 17  ? 5.983   5.076   2.268   1.00 0.00 ? 17  PHE B CG   4  
ATOM 11360 C CD1  . PHE B 1 17  ? 6.482   3.787   2.212   1.00 0.00 ? 17  PHE B CD1  4  
ATOM 11361 C CD2  . PHE B 1 17  ? 4.614   5.266   2.188   1.00 0.00 ? 17  PHE B CD2  4  
ATOM 11362 C CE1  . PHE B 1 17  ? 5.631   2.705   2.077   1.00 0.00 ? 17  PHE B CE1  4  
ATOM 11363 C CE2  . PHE B 1 17  ? 3.759   4.189   2.055   1.00 0.00 ? 17  PHE B CE2  4  
ATOM 11364 C CZ   . PHE B 1 17  ? 4.269   2.907   1.999   1.00 0.00 ? 17  PHE B CZ   4  
ATOM 11365 H H    . PHE B 1 17  ? 6.195   5.378   4.730   1.00 0.00 ? 17  PHE B H    4  
ATOM 11366 H HA   . PHE B 1 17  ? 8.732   5.681   3.384   1.00 0.00 ? 17  PHE B HA   4  
ATOM 11367 H HB2  . PHE B 1 17  ? 6.306   7.142   2.456   1.00 0.00 ? 17  PHE B HB2  4  
ATOM 11368 H HB3  . PHE B 1 17  ? 7.529   6.291   1.521   1.00 0.00 ? 17  PHE B HB3  4  
ATOM 11369 H HD1  . PHE B 1 17  ? 7.548   3.628   2.275   1.00 0.00 ? 17  PHE B HD1  4  
ATOM 11370 H HD2  . PHE B 1 17  ? 4.215   6.268   2.231   1.00 0.00 ? 17  PHE B HD2  4  
ATOM 11371 H HE1  . PHE B 1 17  ? 6.033   1.704   2.034   1.00 0.00 ? 17  PHE B HE1  4  
ATOM 11372 H HE2  . PHE B 1 17  ? 2.692   4.351   1.994   1.00 0.00 ? 17  PHE B HE2  4  
ATOM 11373 H HZ   . PHE B 1 17  ? 3.601   2.064   1.893   1.00 0.00 ? 17  PHE B HZ   4  
ATOM 11374 N N    . GLN B 1 18  ? 7.137   8.350   4.536   1.00 0.00 ? 18  GLN B N    4  
ATOM 11375 C CA   . GLN B 1 18  ? 7.330   9.735   4.974   1.00 0.00 ? 18  GLN B CA   4  
ATOM 11376 C C    . GLN B 1 18  ? 8.511   9.858   5.926   1.00 0.00 ? 18  GLN B C    4  
ATOM 11377 O O    . GLN B 1 18  ? 9.132   10.916  6.018   1.00 0.00 ? 18  GLN B O    4  
ATOM 11378 C CB   . GLN B 1 18  ? 6.076   10.268  5.666   1.00 0.00 ? 18  GLN B CB   4  
ATOM 11379 C CG   . GLN B 1 18  ? 4.802   10.027  4.889   1.00 0.00 ? 18  GLN B CG   4  
ATOM 11380 C CD   . GLN B 1 18  ? 4.541   11.095  3.853   1.00 0.00 ? 18  GLN B CD   4  
ATOM 11381 O OE1  . GLN B 1 18  ? 3.834   12.069  4.107   1.00 0.00 ? 18  GLN B OE1  4  
ATOM 11382 N NE2  . GLN B 1 18  ? 5.117   10.909  2.673   1.00 0.00 ? 18  GLN B NE2  4  
ATOM 11383 H H    . GLN B 1 18  ? 6.232   7.960   4.558   1.00 0.00 ? 18  GLN B H    4  
ATOM 11384 H HA   . GLN B 1 18  ? 7.526   10.334  4.098   1.00 0.00 ? 18  GLN B HA   4  
ATOM 11385 H HB2  . GLN B 1 18  ? 5.979   9.790   6.628   1.00 0.00 ? 18  GLN B HB2  4  
ATOM 11386 H HB3  . GLN B 1 18  ? 6.186   11.332  5.811   1.00 0.00 ? 18  GLN B HB3  4  
ATOM 11387 H HG2  . GLN B 1 18  ? 4.889   9.084   4.380   1.00 0.00 ? 18  GLN B HG2  4  
ATOM 11388 H HG3  . GLN B 1 18  ? 3.971   9.991   5.579   1.00 0.00 ? 18  GLN B HG3  4  
ATOM 11389 H HE21 . GLN B 1 18  ? 5.670   10.103  2.549   1.00 0.00 ? 18  GLN B HE21 4  
ATOM 11390 H HE22 . GLN B 1 18  ? 4.971   11.581  1.976   1.00 0.00 ? 18  GLN B HE22 4  
ATOM 11391 N N    . LYS B 1 19  ? 8.831   8.778   6.624   1.00 0.00 ? 19  LYS B N    4  
ATOM 11392 C CA   . LYS B 1 19  ? 9.953   8.797   7.545   1.00 0.00 ? 19  LYS B CA   4  
ATOM 11393 C C    . LYS B 1 19  ? 11.248  9.044   6.777   1.00 0.00 ? 19  LYS B C    4  
ATOM 11394 O O    . LYS B 1 19  ? 12.023  9.941   7.113   1.00 0.00 ? 19  LYS B O    4  
ATOM 11395 C CB   . LYS B 1 19  ? 10.035  7.470   8.304   1.00 0.00 ? 19  LYS B CB   4  
ATOM 11396 C CG   . LYS B 1 19  ? 10.713  7.578   9.661   1.00 0.00 ? 19  LYS B CG   4  
ATOM 11397 C CD   . LYS B 1 19  ? 10.067  8.647   10.528  1.00 0.00 ? 19  LYS B CD   4  
ATOM 11398 C CE   . LYS B 1 19  ? 10.943  9.886   10.634  1.00 0.00 ? 19  LYS B CE   4  
ATOM 11399 N NZ   . LYS B 1 19  ? 10.489  10.797  11.721  1.00 0.00 ? 19  LYS B NZ   4  
ATOM 11400 H H    . LYS B 1 19  ? 8.312   7.955   6.511   1.00 0.00 ? 19  LYS B H    4  
ATOM 11401 H HA   . LYS B 1 19  ? 9.799   9.602   8.248   1.00 0.00 ? 19  LYS B HA   4  
ATOM 11402 H HB2  . LYS B 1 19  ? 9.033   7.095   8.458   1.00 0.00 ? 19  LYS B HB2  4  
ATOM 11403 H HB3  . LYS B 1 19  ? 10.587  6.760   7.707   1.00 0.00 ? 19  LYS B HB3  4  
ATOM 11404 H HG2  . LYS B 1 19  ? 10.637  6.627   10.166  1.00 0.00 ? 19  LYS B HG2  4  
ATOM 11405 H HG3  . LYS B 1 19  ? 11.754  7.827   9.513   1.00 0.00 ? 19  LYS B HG3  4  
ATOM 11406 H HD2  . LYS B 1 19  ? 9.119   8.926   10.094  1.00 0.00 ? 19  LYS B HD2  4  
ATOM 11407 H HD3  . LYS B 1 19  ? 9.907   8.245   11.518  1.00 0.00 ? 19  LYS B HD3  4  
ATOM 11408 H HE2  . LYS B 1 19  ? 11.958  9.577   10.836  1.00 0.00 ? 19  LYS B HE2  4  
ATOM 11409 H HE3  . LYS B 1 19  ? 10.909  10.415  9.693   1.00 0.00 ? 19  LYS B HE3  4  
ATOM 11410 H HZ1  . LYS B 1 19  ? 10.702  11.784  11.472  1.00 0.00 ? 19  LYS B HZ1  4  
ATOM 11411 H HZ2  . LYS B 1 19  ? 10.976  10.562  12.610  1.00 0.00 ? 19  LYS B HZ2  4  
ATOM 11412 H HZ3  . LYS B 1 19  ? 9.464   10.699  11.863  1.00 0.00 ? 19  LYS B HZ3  4  
ATOM 11413 N N    . TYR B 1 20  ? 11.456  8.258   5.725   1.00 0.00 ? 20  TYR B N    4  
ATOM 11414 C CA   . TYR B 1 20  ? 12.633  8.398   4.876   1.00 0.00 ? 20  TYR B CA   4  
ATOM 11415 C C    . TYR B 1 20  ? 12.428  9.540   3.893   1.00 0.00 ? 20  TYR B C    4  
ATOM 11416 O O    . TYR B 1 20  ? 13.275  10.417  3.729   1.00 0.00 ? 20  TYR B O    4  
ATOM 11417 C CB   . TYR B 1 20  ? 12.909  7.097   4.112   1.00 0.00 ? 20  TYR B CB   4  
ATOM 11418 C CG   . TYR B 1 20  ? 12.392  5.848   4.799   1.00 0.00 ? 20  TYR B CG   4  
ATOM 11419 C CD1  . TYR B 1 20  ? 12.455  5.710   6.180   1.00 0.00 ? 20  TYR B CD1  4  
ATOM 11420 C CD2  . TYR B 1 20  ? 11.840  4.807   4.063   1.00 0.00 ? 20  TYR B CD2  4  
ATOM 11421 C CE1  . TYR B 1 20  ? 11.985  4.572   6.807   1.00 0.00 ? 20  TYR B CE1  4  
ATOM 11422 C CE2  . TYR B 1 20  ? 11.367  3.665   4.682   1.00 0.00 ? 20  TYR B CE2  4  
ATOM 11423 C CZ   . TYR B 1 20  ? 11.442  3.553   6.054   1.00 0.00 ? 20  TYR B CZ   4  
ATOM 11424 O OH   . TYR B 1 20  ? 10.971  2.418   6.674   1.00 0.00 ? 20  TYR B OH   4  
ATOM 11425 H H    . TYR B 1 20  ? 10.779  7.587   5.488   1.00 0.00 ? 20  TYR B H    4  
ATOM 11426 H HA   . TYR B 1 20  ? 13.477  8.626   5.509   1.00 0.00 ? 20  TYR B HA   4  
ATOM 11427 H HB2  . TYR B 1 20  ? 12.442  7.154   3.141   1.00 0.00 ? 20  TYR B HB2  4  
ATOM 11428 H HB3  . TYR B 1 20  ? 13.976  6.985   3.983   1.00 0.00 ? 20  TYR B HB3  4  
ATOM 11429 H HD1  . TYR B 1 20  ? 12.881  6.510   6.768   1.00 0.00 ? 20  TYR B HD1  4  
ATOM 11430 H HD2  . TYR B 1 20  ? 11.783  4.897   2.988   1.00 0.00 ? 20  TYR B HD2  4  
ATOM 11431 H HE1  . TYR B 1 20  ? 12.043  4.484   7.882   1.00 0.00 ? 20  TYR B HE1  4  
ATOM 11432 H HE2  . TYR B 1 20  ? 10.942  2.868   4.091   1.00 0.00 ? 20  TYR B HE2  4  
ATOM 11433 H HH   . TYR B 1 20  ? 11.556  2.183   7.397   1.00 0.00 ? 20  TYR B HH   4  
ATOM 11434 N N    . ALA B 1 21  ? 11.283  9.478   3.230   1.00 0.00 ? 21  ALA B N    4  
ATOM 11435 C CA   . ALA B 1 21  ? 10.886  10.447  2.222   1.00 0.00 ? 21  ALA B CA   4  
ATOM 11436 C C    . ALA B 1 21  ? 10.758  11.856  2.796   1.00 0.00 ? 21  ALA B C    4  
ATOM 11437 O O    . ALA B 1 21  ? 11.341  12.804  2.270   1.00 0.00 ? 21  ALA B O    4  
ATOM 11438 C CB   . ALA B 1 21  ? 9.575   9.979   1.605   1.00 0.00 ? 21  ALA B CB   4  
ATOM 11439 H H    . ALA B 1 21  ? 10.679  8.730   3.418   1.00 0.00 ? 21  ALA B H    4  
ATOM 11440 H HA   . ALA B 1 21  ? 11.638  10.451  1.447   1.00 0.00 ? 21  ALA B HA   4  
ATOM 11441 H HB1  . ALA B 1 21  ? 9.729   9.736   0.559   1.00 0.00 ? 21  ALA B HB1  4  
ATOM 11442 H HB2  . ALA B 1 21  ? 8.831   10.756  1.695   1.00 0.00 ? 21  ALA B HB2  4  
ATOM 11443 H HB3  . ALA B 1 21  ? 9.239   9.093   2.133   1.00 0.00 ? 21  ALA B HB3  4  
ATOM 11444 N N    . GLY B 1 22  ? 9.997   11.984  3.874   1.00 0.00 ? 22  GLY B N    4  
ATOM 11445 C CA   . GLY B 1 22  ? 9.809   13.280  4.499   1.00 0.00 ? 22  GLY B CA   4  
ATOM 11446 C C    . GLY B 1 22  ? 11.033  13.734  5.269   1.00 0.00 ? 22  GLY B C    4  
ATOM 11447 O O    . GLY B 1 22  ? 11.938  14.347  4.705   1.00 0.00 ? 22  GLY B O    4  
ATOM 11448 H H    . GLY B 1 22  ? 9.559   11.194  4.248   1.00 0.00 ? 22  GLY B H    4  
ATOM 11449 H HA2  . GLY B 1 22  ? 9.589   14.009  3.732   1.00 0.00 ? 22  GLY B HA2  4  
ATOM 11450 H HA3  . GLY B 1 22  ? 8.971   13.223  5.177   1.00 0.00 ? 22  GLY B HA3  4  
ATOM 11451 N N    . LYS B 1 23  ? 11.061  13.429  6.564   1.00 0.00 ? 23  LYS B N    4  
ATOM 11452 C CA   . LYS B 1 23  ? 12.182  13.807  7.421   1.00 0.00 ? 23  LYS B CA   4  
ATOM 11453 C C    . LYS B 1 23  ? 12.241  15.319  7.611   1.00 0.00 ? 23  LYS B C    4  
ATOM 11454 O O    . LYS B 1 23  ? 12.001  15.827  8.705   1.00 0.00 ? 23  LYS B O    4  
ATOM 11455 C CB   . LYS B 1 23  ? 13.501  13.301  6.831   1.00 0.00 ? 23  LYS B CB   4  
ATOM 11456 C CG   . LYS B 1 23  ? 14.539  12.944  7.882   1.00 0.00 ? 23  LYS B CG   4  
ATOM 11457 C CD   . LYS B 1 23  ? 15.933  12.859  7.281   1.00 0.00 ? 23  LYS B CD   4  
ATOM 11458 C CE   . LYS B 1 23  ? 16.617  14.217  7.267   1.00 0.00 ? 23  LYS B CE   4  
ATOM 11459 N NZ   . LYS B 1 23  ? 17.413  14.425  6.027   1.00 0.00 ? 23  LYS B NZ   4  
ATOM 11460 H H    . LYS B 1 23  ? 10.309  12.937  6.955   1.00 0.00 ? 23  LYS B H    4  
ATOM 11461 H HA   . LYS B 1 23  ? 12.030  13.343  8.384   1.00 0.00 ? 23  LYS B HA   4  
ATOM 11462 H HB2  . LYS B 1 23  ? 13.303  12.421  6.238   1.00 0.00 ? 23  LYS B HB2  4  
ATOM 11463 H HB3  . LYS B 1 23  ? 13.916  14.068  6.194   1.00 0.00 ? 23  LYS B HB3  4  
ATOM 11464 H HG2  . LYS B 1 23  ? 14.535  13.701  8.652   1.00 0.00 ? 23  LYS B HG2  4  
ATOM 11465 H HG3  . LYS B 1 23  ? 14.285  11.987  8.315   1.00 0.00 ? 23  LYS B HG3  4  
ATOM 11466 H HD2  . LYS B 1 23  ? 16.527  12.175  7.869   1.00 0.00 ? 23  LYS B HD2  4  
ATOM 11467 H HD3  . LYS B 1 23  ? 15.856  12.493  6.268   1.00 0.00 ? 23  LYS B HD3  4  
ATOM 11468 H HE2  . LYS B 1 23  ? 15.862  14.987  7.332   1.00 0.00 ? 23  LYS B HE2  4  
ATOM 11469 H HE3  . LYS B 1 23  ? 17.273  14.284  8.123   1.00 0.00 ? 23  LYS B HE3  4  
ATOM 11470 H HZ1  . LYS B 1 23  ? 18.121  15.172  6.178   1.00 0.00 ? 23  LYS B HZ1  4  
ATOM 11471 H HZ2  . LYS B 1 23  ? 16.789  14.708  5.244   1.00 0.00 ? 23  LYS B HZ2  4  
ATOM 11472 H HZ3  . LYS B 1 23  ? 17.902  13.546  5.764   1.00 0.00 ? 23  LYS B HZ3  4  
ATOM 11473 N N    . ASP B 1 24  ? 12.561  16.035  6.537   1.00 0.00 ? 24  ASP B N    4  
ATOM 11474 C CA   . ASP B 1 24  ? 12.652  17.489  6.585   1.00 0.00 ? 24  ASP B CA   4  
ATOM 11475 C C    . ASP B 1 24  ? 12.227  18.102  5.255   1.00 0.00 ? 24  ASP B C    4  
ATOM 11476 O O    . ASP B 1 24  ? 12.654  17.658  4.190   1.00 0.00 ? 24  ASP B O    4  
ATOM 11477 C CB   . ASP B 1 24  ? 14.078  17.921  6.928   1.00 0.00 ? 24  ASP B CB   4  
ATOM 11478 C CG   . ASP B 1 24  ? 14.112  19.129  7.844   1.00 0.00 ? 24  ASP B CG   4  
ATOM 11479 O OD1  . ASP B 1 24  ? 13.722  20.226  7.394   1.00 0.00 ? 24  ASP B OD1  4  
ATOM 11480 O OD2  . ASP B 1 24  ? 14.528  18.978  9.012   1.00 0.00 ? 24  ASP B OD2  4  
ATOM 11481 H H    . ASP B 1 24  ? 12.741  15.573  5.691   1.00 0.00 ? 24  ASP B H    4  
ATOM 11482 H HA   . ASP B 1 24  ? 11.983  17.836  7.358   1.00 0.00 ? 24  ASP B HA   4  
ATOM 11483 H HB2  . ASP B 1 24  ? 14.586  17.105  7.421   1.00 0.00 ? 24  ASP B HB2  4  
ATOM 11484 H HB3  . ASP B 1 24  ? 14.602  18.168  6.017   1.00 0.00 ? 24  ASP B HB3  4  
ATOM 11485 N N    . GLY B 1 25  ? 11.382  19.126  5.324   1.00 0.00 ? 25  GLY B N    4  
ATOM 11486 C CA   . GLY B 1 25  ? 10.914  19.783  4.118   1.00 0.00 ? 25  GLY B CA   4  
ATOM 11487 C C    . GLY B 1 25  ? 9.570   19.256  3.654   1.00 0.00 ? 25  GLY B C    4  
ATOM 11488 O O    . GLY B 1 25  ? 8.797   19.977  3.023   1.00 0.00 ? 25  GLY B O    4  
ATOM 11489 H H    . GLY B 1 25  ? 11.074  19.438  6.201   1.00 0.00 ? 25  GLY B H    4  
ATOM 11490 H HA2  . GLY B 1 25  ? 10.827  20.843  4.310   1.00 0.00 ? 25  GLY B HA2  4  
ATOM 11491 H HA3  . GLY B 1 25  ? 11.639  19.629  3.333   1.00 0.00 ? 25  GLY B HA3  4  
ATOM 11492 N N    . HIS B 1 26  ? 9.291   17.995  3.968   1.00 0.00 ? 26  HIS B N    4  
ATOM 11493 C CA   . HIS B 1 26  ? 8.031   17.371  3.579   1.00 0.00 ? 26  HIS B CA   4  
ATOM 11494 C C    . HIS B 1 26  ? 7.881   17.348  2.061   1.00 0.00 ? 26  HIS B C    4  
ATOM 11495 O O    . HIS B 1 26  ? 7.242   18.224  1.476   1.00 0.00 ? 26  HIS B O    4  
ATOM 11496 C CB   . HIS B 1 26  ? 6.853   18.116  4.214   1.00 0.00 ? 26  HIS B CB   4  
ATOM 11497 C CG   . HIS B 1 26  ? 6.051   17.272  5.156   1.00 0.00 ? 26  HIS B CG   4  
ATOM 11498 N ND1  . HIS B 1 26  ? 5.171   17.800  6.076   1.00 0.00 ? 26  HIS B ND1  4  
ATOM 11499 C CD2  . HIS B 1 26  ? 5.998   15.928  5.316   1.00 0.00 ? 26  HIS B CD2  4  
ATOM 11500 C CE1  . HIS B 1 26  ? 4.613   16.819  6.763   1.00 0.00 ? 26  HIS B CE1  4  
ATOM 11501 N NE2  . HIS B 1 26  ? 5.097   15.673  6.320   1.00 0.00 ? 26  HIS B NE2  4  
ATOM 11502 H H    . HIS B 1 26  ? 9.947   17.471  4.473   1.00 0.00 ? 26  HIS B H    4  
ATOM 11503 H HA   . HIS B 1 26  ? 8.040   16.355  3.943   1.00 0.00 ? 26  HIS B HA   4  
ATOM 11504 H HB2  . HIS B 1 26  ? 7.227   18.964  4.767   1.00 0.00 ? 26  HIS B HB2  4  
ATOM 11505 H HB3  . HIS B 1 26  ? 6.191   18.465  3.434   1.00 0.00 ? 26  HIS B HB3  4  
ATOM 11506 H HD1  . HIS B 1 26  ? 4.984   18.753  6.209   1.00 0.00 ? 26  HIS B HD1  4  
ATOM 11507 H HD2  . HIS B 1 26  ? 6.560   15.193  4.756   1.00 0.00 ? 26  HIS B HD2  4  
ATOM 11508 H HE1  . HIS B 1 26  ? 3.883   16.934  7.551   1.00 0.00 ? 26  HIS B HE1  4  
ATOM 11509 H HE2  . HIS B 1 26  ? 4.785   14.785  6.593   1.00 0.00 ? 26  HIS B HE2  4  
ATOM 11510 N N    . SER B 1 27  ? 8.476   16.342  1.429   1.00 0.00 ? 27  SER B N    4  
ATOM 11511 C CA   . SER B 1 27  ? 8.411   16.204  -0.022  1.00 0.00 ? 27  SER B CA   4  
ATOM 11512 C C    . SER B 1 27  ? 7.487   15.057  -0.418  1.00 0.00 ? 27  SER B C    4  
ATOM 11513 O O    . SER B 1 27  ? 7.089   14.248  0.421   1.00 0.00 ? 27  SER B O    4  
ATOM 11514 C CB   . SER B 1 27  ? 9.810   15.971  -0.597  1.00 0.00 ? 27  SER B CB   4  
ATOM 11515 O OG   . SER B 1 27  ? 10.807  16.517  0.249   1.00 0.00 ? 27  SER B OG   4  
ATOM 11516 H H    . SER B 1 27  ? 8.972   15.676  1.950   1.00 0.00 ? 27  SER B H    4  
ATOM 11517 H HA   . SER B 1 27  ? 8.015   17.125  -0.425  1.00 0.00 ? 27  SER B HA   4  
ATOM 11518 H HB2  . SER B 1 27  ? 9.983   14.910  -0.698  1.00 0.00 ? 27  SER B HB2  4  
ATOM 11519 H HB3  . SER B 1 27  ? 9.881   16.441  -1.566  1.00 0.00 ? 27  SER B HB3  4  
ATOM 11520 H HG   . SER B 1 27  ? 11.464  15.845  0.444   1.00 0.00 ? 27  SER B HG   4  
ATOM 11521 N N    . VAL B 1 28  ? 7.150   14.991  -1.703  1.00 0.00 ? 28  VAL B N    4  
ATOM 11522 C CA   . VAL B 1 28  ? 6.273   13.943  -2.210  1.00 0.00 ? 28  VAL B CA   4  
ATOM 11523 C C    . VAL B 1 28  ? 7.074   12.807  -2.840  1.00 0.00 ? 28  VAL B C    4  
ATOM 11524 O O    . VAL B 1 28  ? 6.580   12.101  -3.719  1.00 0.00 ? 28  VAL B O    4  
ATOM 11525 C CB   . VAL B 1 28  ? 5.284   14.494  -3.253  1.00 0.00 ? 28  VAL B CB   4  
ATOM 11526 C CG1  . VAL B 1 28  ? 4.318   15.476  -2.609  1.00 0.00 ? 28  VAL B CG1  4  
ATOM 11527 C CG2  . VAL B 1 28  ? 6.032   15.148  -4.404  1.00 0.00 ? 28  VAL B CG2  4  
ATOM 11528 H H    . VAL B 1 28  ? 7.499   15.665  -2.324  1.00 0.00 ? 28  VAL B H    4  
ATOM 11529 H HA   . VAL B 1 28  ? 5.705   13.552  -1.378  1.00 0.00 ? 28  VAL B HA   4  
ATOM 11530 H HB   . VAL B 1 28  ? 4.711   13.667  -3.648  1.00 0.00 ? 28  VAL B HB   4  
ATOM 11531 H HG11 . VAL B 1 28  ? 4.260   15.281  -1.547  1.00 0.00 ? 28  VAL B HG11 4  
ATOM 11532 H HG12 . VAL B 1 28  ? 3.338   15.359  -3.049  1.00 0.00 ? 28  VAL B HG12 4  
ATOM 11533 H HG13 . VAL B 1 28  ? 4.668   16.485  -2.772  1.00 0.00 ? 28  VAL B HG13 4  
ATOM 11534 H HG21 . VAL B 1 28  ? 6.058   16.217  -4.254  1.00 0.00 ? 28  VAL B HG21 4  
ATOM 11535 H HG22 . VAL B 1 28  ? 5.529   14.927  -5.334  1.00 0.00 ? 28  VAL B HG22 4  
ATOM 11536 H HG23 . VAL B 1 28  ? 7.041   14.765  -4.441  1.00 0.00 ? 28  VAL B HG23 4  
ATOM 11537 N N    . THR B 1 29  ? 8.313   12.637  -2.388  1.00 0.00 ? 29  THR B N    4  
ATOM 11538 C CA   . THR B 1 29  ? 9.178   11.588  -2.911  1.00 0.00 ? 29  THR B CA   4  
ATOM 11539 C C    . THR B 1 29  ? 10.148  11.090  -1.841  1.00 0.00 ? 29  THR B C    4  
ATOM 11540 O O    . THR B 1 29  ? 10.105  11.531  -0.693  1.00 0.00 ? 29  THR B O    4  
ATOM 11541 C CB   . THR B 1 29  ? 9.953   12.096  -4.126  1.00 0.00 ? 29  THR B CB   4  
ATOM 11542 O OG1  . THR B 1 29  ? 10.453  13.400  -3.893  1.00 0.00 ? 29  THR B OG1  4  
ATOM 11543 C CG2  . THR B 1 29  ? 9.118   12.141  -5.387  1.00 0.00 ? 29  THR B CG2  4  
ATOM 11544 H H    . THR B 1 29  ? 8.652   13.231  -1.687  1.00 0.00 ? 29  THR B H    4  
ATOM 11545 H HA   . THR B 1 29  ? 8.551   10.765  -3.219  1.00 0.00 ? 29  THR B HA   4  
ATOM 11546 H HB   . THR B 1 29  ? 10.788  11.437  -4.306  1.00 0.00 ? 29  THR B HB   4  
ATOM 11547 H HG1  . THR B 1 29  ? 10.862  13.437  -3.025  1.00 0.00 ? 29  THR B HG1  4  
ATOM 11548 H HG21 . THR B 1 29  ? 8.876   11.133  -5.697  1.00 0.00 ? 29  THR B HG21 4  
ATOM 11549 H HG22 . THR B 1 29  ? 9.675   12.633  -6.171  1.00 0.00 ? 29  THR B HG22 4  
ATOM 11550 H HG23 . THR B 1 29  ? 8.206   12.687  -5.195  1.00 0.00 ? 29  THR B HG23 4  
ATOM 11551 N N    . LEU B 1 30  ? 11.016  10.165  -2.232  1.00 0.00 ? 30  LEU B N    4  
ATOM 11552 C CA   . LEU B 1 30  ? 12.001  9.588   -1.321  1.00 0.00 ? 30  LEU B CA   4  
ATOM 11553 C C    . LEU B 1 30  ? 13.336  9.374   -2.052  1.00 0.00 ? 30  LEU B C    4  
ATOM 11554 O O    . LEU B 1 30  ? 13.879  10.312  -2.631  1.00 0.00 ? 30  LEU B O    4  
ATOM 11555 C CB   . LEU B 1 30  ? 11.455  8.271   -0.749  1.00 0.00 ? 30  LEU B CB   4  
ATOM 11556 C CG   . LEU B 1 30  ? 11.989  7.856   0.627   1.00 0.00 ? 30  LEU B CG   4  
ATOM 11557 C CD1  . LEU B 1 30  ? 11.732  6.381   0.872   1.00 0.00 ? 30  LEU B CD1  4  
ATOM 11558 C CD2  . LEU B 1 30  ? 13.472  8.173   0.774   1.00 0.00 ? 30  LEU B CD2  4  
ATOM 11559 H H    . LEU B 1 30  ? 10.992  9.857   -3.162  1.00 0.00 ? 30  LEU B H    4  
ATOM 11560 H HA   . LEU B 1 30  ? 12.155  10.288  -0.514  1.00 0.00 ? 30  LEU B HA   4  
ATOM 11561 H HB2  . LEU B 1 30  ? 10.385  8.369   -0.667  1.00 0.00 ? 30  LEU B HB2  4  
ATOM 11562 H HB3  . LEU B 1 30  ? 11.671  7.479   -1.449  1.00 0.00 ? 30  LEU B HB3  4  
ATOM 11563 H HG   . LEU B 1 30  ? 11.456  8.401   1.383   1.00 0.00 ? 30  LEU B HG   4  
ATOM 11564 H HD11 . LEU B 1 30  ? 12.514  5.977   1.498   1.00 0.00 ? 30  LEU B HD11 4  
ATOM 11565 H HD12 . LEU B 1 30  ? 11.716  5.856   -0.072  1.00 0.00 ? 30  LEU B HD12 4  
ATOM 11566 H HD13 . LEU B 1 30  ? 10.778  6.264   1.367   1.00 0.00 ? 30  LEU B HD13 4  
ATOM 11567 H HD21 . LEU B 1 30  ? 14.051  7.461   0.206   1.00 0.00 ? 30  LEU B HD21 4  
ATOM 11568 H HD22 . LEU B 1 30