data_1NTZ
# 
_entry.id   1NTZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NTZ         
RCSB  RCSB018201   
WWPDB D_1000018201 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NTM 'The native protein without bound inhibitors' unspecified 
PDB 1NTK 'The same protein bound with antimycin A'     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NTZ 
_pdbx_database_status.recvd_initial_deposition_date   2003-01-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, X.'   1 
'Wen, X.'   2 
'Esser, L.' 3 
'Quinn, B.' 4 
'Yu, L.'    5 
'Yu, C.-A.' 6 
'Xia, D.'   7 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                9067 
_citation.page_last                 9080 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12885240 
_citation.pdbx_database_id_DOI      10.1021/bi0341814 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gao, X.'   1 
primary 'Wen, X.'   2 
primary 'Esser, L.' 3 
primary 'Quinn, B.' 4 
primary 'Yu, L.'    5 
primary 'Yu, C.-A.' 6 
primary 'Xia, D.'   7 
# 
_cell.entry_id           1NTZ 
_cell.length_a           153.828 
_cell.length_b           153.828 
_cell.length_c           596.671 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NTZ 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial'   49266.254 1   1.10.2.2 ? ? ? 
2  polymer     nat 'Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial'   46575.469 1   1.10.2.2 ? ? ? 
3  polymer     nat 'Cytochrome b'                                                             42620.340 1   ?        ? ? ? 
4  polymer     nat 'cytochrome c1'                                                            27323.277 1   ?        ? ? ? 
5  polymer     nat 'UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, mitochondrial'      21640.580 1   1.10.2.2 ? ? ? 
6  polymer     nat 'Ubiquinol-cytochrome C reductase complex 14 kDa protein'                  13371.190 1   1.10.2.2 ? ? ? 
7  polymer     nat 'Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C' 9606.027  1   1.10.2.2 ? ? ? 
8  polymer     nat 'Ubiquinol-cytochrome C reductase complex 11 kDa protein'                  9189.116  1   1.10.2.2 ? ? ? 
9  polymer     nat 'Ubiquinol-cytochrome C reductase 8 kDa protein'                           5824.802  1   1.10.2.2 ? ? ? 
10 polymer     nat 'Ubiquinol-cytochrome C reductase complex 7.2 kDa protein'                 7209.311  1   1.10.2.2 ? ? ? 
11 polymer     nat 'Ubiquinol-cytochrome C reductase complex 6.4 kDa protein'                 6568.655  1   1.10.2.2 ? ? ? 
12 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                                          616.487   3   ?        ? ? ? 
13 non-polymer syn UBIQUINONE-2                                                               318.407   2   ?        ? ? ? 
14 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                                               175.820   1   ?        ? ? ? 
15 water       nat water                                                                      18.015    207 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2  'Complex III subunit II'                                                                       
5  'Rieske iron-sulfur protein, RISP'                                                             
6  'Complex III subunit VI'                                                                       
7  'Ubiquinol-cytochrome C reductase complex 9.5 kDa protein, Complex III subunit VII'            
8  'Mitochondrial hinge protein; Cytochrome C1, nonheme 11 kDa protein; Complex III subunit VIII' 
9  'Complex III subunit IX'                                                                       
10 'Cytochrome C1, nonheme 7 kDa protein; Complex III subunit X'                                  
11 'Complex III subunit XI'                                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
A ? 
2  'polypeptide(L)' no no 
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
B ? 
3  'polypeptide(L)' no no 
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
C ? 
4  'polypeptide(L)' no no 
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
D ? 
5  'polypeptide(L)' no no 
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
E ? 
6  'polypeptide(L)' no no 
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
F ? 
7  'polypeptide(L)' no no 
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
G ? 
8  'polypeptide(L)' no no GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK 
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK H ? 
9  'polypeptide(L)' no no MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRG 
MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRG I ? 
10 'polypeptide(L)' no no VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK 
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK J ? 
11 'polypeptide(L)' no no MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD 
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD K ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   THR n 
1  2   ALA n 
1  3   THR n 
1  4   TYR n 
1  5   ALA n 
1  6   GLN n 
1  7   ALA n 
1  8   LEU n 
1  9   GLN n 
1  10  SER n 
1  11  VAL n 
1  12  PRO n 
1  13  GLU n 
1  14  THR n 
1  15  GLN n 
1  16  VAL n 
1  17  SER n 
1  18  GLN n 
1  19  LEU n 
1  20  ASP n 
1  21  ASN n 
1  22  GLY n 
1  23  LEU n 
1  24  ARG n 
1  25  VAL n 
1  26  ALA n 
1  27  SER n 
1  28  GLU n 
1  29  GLN n 
1  30  SER n 
1  31  SER n 
1  32  GLN n 
1  33  PRO n 
1  34  THR n 
1  35  CYS n 
1  36  THR n 
1  37  VAL n 
1  38  GLY n 
1  39  VAL n 
1  40  TRP n 
1  41  ILE n 
1  42  ASP n 
1  43  ALA n 
1  44  GLY n 
1  45  SER n 
1  46  ARG n 
1  47  TYR n 
1  48  GLU n 
1  49  SER n 
1  50  GLU n 
1  51  LYS n 
1  52  ASN n 
1  53  ASN n 
1  54  GLY n 
1  55  ALA n 
1  56  GLY n 
1  57  TYR n 
1  58  PHE n 
1  59  VAL n 
1  60  GLU n 
1  61  HIS n 
1  62  LEU n 
1  63  ALA n 
1  64  PHE n 
1  65  LYS n 
1  66  GLY n 
1  67  THR n 
1  68  LYS n 
1  69  ASN n 
1  70  ARG n 
1  71  PRO n 
1  72  GLY n 
1  73  ASN n 
1  74  ALA n 
1  75  LEU n 
1  76  GLU n 
1  77  LYS n 
1  78  GLU n 
1  79  VAL n 
1  80  GLU n 
1  81  SER n 
1  82  MET n 
1  83  GLY n 
1  84  ALA n 
1  85  HIS n 
1  86  LEU n 
1  87  ASN n 
1  88  ALA n 
1  89  TYR n 
1  90  SER n 
1  91  THR n 
1  92  ARG n 
1  93  GLU n 
1  94  HIS n 
1  95  THR n 
1  96  ALA n 
1  97  TYR n 
1  98  TYR n 
1  99  ILE n 
1  100 LYS n 
1  101 ALA n 
1  102 LEU n 
1  103 SER n 
1  104 LYS n 
1  105 ASP n 
1  106 LEU n 
1  107 PRO n 
1  108 LYS n 
1  109 ALA n 
1  110 VAL n 
1  111 GLU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 ASP n 
1  116 ILE n 
1  117 VAL n 
1  118 GLN n 
1  119 ASN n 
1  120 CYS n 
1  121 SER n 
1  122 LEU n 
1  123 GLU n 
1  124 ASP n 
1  125 SER n 
1  126 GLN n 
1  127 ILE n 
1  128 GLU n 
1  129 LYS n 
1  130 GLU n 
1  131 ARG n 
1  132 ASP n 
1  133 VAL n 
1  134 ILE n 
1  135 LEU n 
1  136 GLN n 
1  137 GLU n 
1  138 LEU n 
1  139 GLN n 
1  140 GLU n 
1  141 ASN n 
1  142 ASP n 
1  143 THR n 
1  144 SER n 
1  145 MET n 
1  146 ARG n 
1  147 ASP n 
1  148 VAL n 
1  149 VAL n 
1  150 PHE n 
1  151 ASN n 
1  152 TYR n 
1  153 LEU n 
1  154 HIS n 
1  155 ALA n 
1  156 THR n 
1  157 ALA n 
1  158 PHE n 
1  159 GLN n 
1  160 GLY n 
1  161 THR n 
1  162 PRO n 
1  163 LEU n 
1  164 ALA n 
1  165 GLN n 
1  166 SER n 
1  167 VAL n 
1  168 GLU n 
1  169 GLY n 
1  170 PRO n 
1  171 SER n 
1  172 GLU n 
1  173 ASN n 
1  174 VAL n 
1  175 ARG n 
1  176 LYS n 
1  177 LEU n 
1  178 SER n 
1  179 ARG n 
1  180 ALA n 
1  181 ASP n 
1  182 LEU n 
1  183 THR n 
1  184 GLU n 
1  185 TYR n 
1  186 LEU n 
1  187 SER n 
1  188 ARG n 
1  189 HIS n 
1  190 TYR n 
1  191 LYS n 
1  192 ALA n 
1  193 PRO n 
1  194 ARG n 
1  195 MET n 
1  196 VAL n 
1  197 LEU n 
1  198 ALA n 
1  199 ALA n 
1  200 ALA n 
1  201 GLY n 
1  202 GLY n 
1  203 LEU n 
1  204 GLU n 
1  205 HIS n 
1  206 ARG n 
1  207 GLN n 
1  208 LEU n 
1  209 LEU n 
1  210 ASP n 
1  211 LEU n 
1  212 ALA n 
1  213 GLN n 
1  214 LYS n 
1  215 HIS n 
1  216 PHE n 
1  217 SER n 
1  218 GLY n 
1  219 LEU n 
1  220 SER n 
1  221 GLY n 
1  222 THR n 
1  223 TYR n 
1  224 ASP n 
1  225 GLU n 
1  226 ASP n 
1  227 ALA n 
1  228 VAL n 
1  229 PRO n 
1  230 THR n 
1  231 LEU n 
1  232 SER n 
1  233 PRO n 
1  234 CYS n 
1  235 ARG n 
1  236 PHE n 
1  237 THR n 
1  238 GLY n 
1  239 SER n 
1  240 GLN n 
1  241 ILE n 
1  242 CYS n 
1  243 HIS n 
1  244 ARG n 
1  245 GLU n 
1  246 ASP n 
1  247 GLY n 
1  248 LEU n 
1  249 PRO n 
1  250 LEU n 
1  251 ALA n 
1  252 HIS n 
1  253 VAL n 
1  254 ALA n 
1  255 ILE n 
1  256 ALA n 
1  257 VAL n 
1  258 GLU n 
1  259 GLY n 
1  260 PRO n 
1  261 GLY n 
1  262 TRP n 
1  263 ALA n 
1  264 HIS n 
1  265 PRO n 
1  266 ASP n 
1  267 ASN n 
1  268 VAL n 
1  269 ALA n 
1  270 LEU n 
1  271 GLN n 
1  272 VAL n 
1  273 ALA n 
1  274 ASN n 
1  275 ALA n 
1  276 ILE n 
1  277 ILE n 
1  278 GLY n 
1  279 HIS n 
1  280 TYR n 
1  281 ASP n 
1  282 CYS n 
1  283 THR n 
1  284 TYR n 
1  285 GLY n 
1  286 GLY n 
1  287 GLY n 
1  288 ALA n 
1  289 HIS n 
1  290 LEU n 
1  291 SER n 
1  292 SER n 
1  293 PRO n 
1  294 LEU n 
1  295 ALA n 
1  296 SER n 
1  297 ILE n 
1  298 ALA n 
1  299 ALA n 
1  300 THR n 
1  301 ASN n 
1  302 LYS n 
1  303 LEU n 
1  304 CYS n 
1  305 GLN n 
1  306 SER n 
1  307 PHE n 
1  308 GLN n 
1  309 THR n 
1  310 PHE n 
1  311 ASN n 
1  312 ILE n 
1  313 CYS n 
1  314 TYR n 
1  315 ALA n 
1  316 ASP n 
1  317 THR n 
1  318 GLY n 
1  319 LEU n 
1  320 LEU n 
1  321 GLY n 
1  322 ALA n 
1  323 HIS n 
1  324 PHE n 
1  325 VAL n 
1  326 CYS n 
1  327 ASP n 
1  328 HIS n 
1  329 MET n 
1  330 SER n 
1  331 ILE n 
1  332 ASP n 
1  333 ASP n 
1  334 MET n 
1  335 MET n 
1  336 PHE n 
1  337 VAL n 
1  338 LEU n 
1  339 GLN n 
1  340 GLY n 
1  341 GLN n 
1  342 TRP n 
1  343 MET n 
1  344 ARG n 
1  345 LEU n 
1  346 CYS n 
1  347 THR n 
1  348 SER n 
1  349 ALA n 
1  350 THR n 
1  351 GLU n 
1  352 SER n 
1  353 GLU n 
1  354 VAL n 
1  355 LEU n 
1  356 ARG n 
1  357 GLY n 
1  358 LYS n 
1  359 ASN n 
1  360 LEU n 
1  361 LEU n 
1  362 ARG n 
1  363 ASN n 
1  364 ALA n 
1  365 LEU n 
1  366 VAL n 
1  367 SER n 
1  368 HIS n 
1  369 LEU n 
1  370 ASP n 
1  371 GLY n 
1  372 THR n 
1  373 THR n 
1  374 PRO n 
1  375 VAL n 
1  376 CYS n 
1  377 GLU n 
1  378 ASP n 
1  379 ILE n 
1  380 GLY n 
1  381 ARG n 
1  382 SER n 
1  383 LEU n 
1  384 LEU n 
1  385 THR n 
1  386 TYR n 
1  387 GLY n 
1  388 ARG n 
1  389 ARG n 
1  390 ILE n 
1  391 PRO n 
1  392 LEU n 
1  393 ALA n 
1  394 GLU n 
1  395 TRP n 
1  396 GLU n 
1  397 SER n 
1  398 ARG n 
1  399 ILE n 
1  400 ALA n 
1  401 GLU n 
1  402 VAL n 
1  403 ASP n 
1  404 ALA n 
1  405 ARG n 
1  406 VAL n 
1  407 VAL n 
1  408 ARG n 
1  409 GLU n 
1  410 VAL n 
1  411 CYS n 
1  412 SER n 
1  413 LYS n 
1  414 TYR n 
1  415 PHE n 
1  416 TYR n 
1  417 ASP n 
1  418 GLN n 
1  419 CYS n 
1  420 PRO n 
1  421 ALA n 
1  422 VAL n 
1  423 ALA n 
1  424 GLY n 
1  425 PHE n 
1  426 GLY n 
1  427 PRO n 
1  428 ILE n 
1  429 GLU n 
1  430 GLN n 
1  431 LEU n 
1  432 PRO n 
1  433 ASP n 
1  434 TYR n 
1  435 ASN n 
1  436 ARG n 
1  437 ILE n 
1  438 ARG n 
1  439 SER n 
1  440 GLY n 
1  441 MET n 
1  442 PHE n 
1  443 TRP n 
1  444 LEU n 
1  445 ARG n 
1  446 PHE n 
2  1   SER n 
2  2   LEU n 
2  3   LYS n 
2  4   VAL n 
2  5   ALA n 
2  6   PRO n 
2  7   LYS n 
2  8   VAL n 
2  9   LYS n 
2  10  ALA n 
2  11  THR n 
2  12  GLU n 
2  13  ALA n 
2  14  PRO n 
2  15  ALA n 
2  16  GLY n 
2  17  VAL n 
2  18  PRO n 
2  19  PRO n 
2  20  HIS n 
2  21  PRO n 
2  22  GLN n 
2  23  ASP n 
2  24  LEU n 
2  25  GLU n 
2  26  PHE n 
2  27  THR n 
2  28  ARG n 
2  29  LEU n 
2  30  PRO n 
2  31  ASN n 
2  32  GLY n 
2  33  LEU n 
2  34  VAL n 
2  35  ILE n 
2  36  ALA n 
2  37  SER n 
2  38  LEU n 
2  39  GLU n 
2  40  ASN n 
2  41  TYR n 
2  42  ALA n 
2  43  PRO n 
2  44  ALA n 
2  45  SER n 
2  46  ARG n 
2  47  ILE n 
2  48  GLY n 
2  49  LEU n 
2  50  PHE n 
2  51  ILE n 
2  52  LYS n 
2  53  ALA n 
2  54  GLY n 
2  55  SER n 
2  56  ARG n 
2  57  TYR n 
2  58  GLU n 
2  59  ASN n 
2  60  SER n 
2  61  ASN n 
2  62  ASN n 
2  63  LEU n 
2  64  GLY n 
2  65  THR n 
2  66  SER n 
2  67  HIS n 
2  68  LEU n 
2  69  LEU n 
2  70  ARG n 
2  71  LEU n 
2  72  ALA n 
2  73  SER n 
2  74  SER n 
2  75  LEU n 
2  76  THR n 
2  77  THR n 
2  78  LYS n 
2  79  GLY n 
2  80  ALA n 
2  81  SER n 
2  82  SER n 
2  83  PHE n 
2  84  LYS n 
2  85  ILE n 
2  86  THR n 
2  87  ARG n 
2  88  GLY n 
2  89  ILE n 
2  90  GLU n 
2  91  ALA n 
2  92  VAL n 
2  93  GLY n 
2  94  GLY n 
2  95  LYS n 
2  96  LEU n 
2  97  SER n 
2  98  VAL n 
2  99  THR n 
2  100 SER n 
2  101 THR n 
2  102 ARG n 
2  103 GLU n 
2  104 ASN n 
2  105 MET n 
2  106 ALA n 
2  107 TYR n 
2  108 THR n 
2  109 VAL n 
2  110 GLU n 
2  111 CYS n 
2  112 LEU n 
2  113 ARG n 
2  114 ASP n 
2  115 ASP n 
2  116 VAL n 
2  117 ASP n 
2  118 ILE n 
2  119 LEU n 
2  120 MET n 
2  121 GLU n 
2  122 PHE n 
2  123 LEU n 
2  124 LEU n 
2  125 ASN n 
2  126 VAL n 
2  127 THR n 
2  128 THR n 
2  129 ALA n 
2  130 PRO n 
2  131 GLU n 
2  132 PHE n 
2  133 ARG n 
2  134 ARG n 
2  135 TRP n 
2  136 GLU n 
2  137 VAL n 
2  138 ALA n 
2  139 ALA n 
2  140 LEU n 
2  141 GLN n 
2  142 PRO n 
2  143 GLN n 
2  144 LEU n 
2  145 ARG n 
2  146 ILE n 
2  147 ASP n 
2  148 LYS n 
2  149 ALA n 
2  150 VAL n 
2  151 ALA n 
2  152 LEU n 
2  153 GLN n 
2  154 ASN n 
2  155 PRO n 
2  156 GLN n 
2  157 ALA n 
2  158 HIS n 
2  159 VAL n 
2  160 ILE n 
2  161 GLU n 
2  162 ASN n 
2  163 LEU n 
2  164 HIS n 
2  165 ALA n 
2  166 ALA n 
2  167 ALA n 
2  168 TYR n 
2  169 ARG n 
2  170 ASN n 
2  171 ALA n 
2  172 LEU n 
2  173 ALA n 
2  174 ASN n 
2  175 SER n 
2  176 LEU n 
2  177 TYR n 
2  178 CYS n 
2  179 PRO n 
2  180 ASP n 
2  181 TYR n 
2  182 ARG n 
2  183 ILE n 
2  184 GLY n 
2  185 LYS n 
2  186 VAL n 
2  187 THR n 
2  188 PRO n 
2  189 VAL n 
2  190 GLU n 
2  191 LEU n 
2  192 HIS n 
2  193 ASP n 
2  194 TYR n 
2  195 VAL n 
2  196 GLN n 
2  197 ASN n 
2  198 HIS n 
2  199 PHE n 
2  200 THR n 
2  201 SER n 
2  202 ALA n 
2  203 ARG n 
2  204 MET n 
2  205 ALA n 
2  206 LEU n 
2  207 ILE n 
2  208 GLY n 
2  209 LEU n 
2  210 GLY n 
2  211 VAL n 
2  212 SER n 
2  213 HIS n 
2  214 PRO n 
2  215 VAL n 
2  216 LEU n 
2  217 LYS n 
2  218 GLN n 
2  219 VAL n 
2  220 ALA n 
2  221 GLU n 
2  222 GLN n 
2  223 PHE n 
2  224 LEU n 
2  225 ASN n 
2  226 ILE n 
2  227 ARG n 
2  228 GLY n 
2  229 GLY n 
2  230 LEU n 
2  231 GLY n 
2  232 LEU n 
2  233 SER n 
2  234 GLY n 
2  235 ALA n 
2  236 LYS n 
2  237 ALA n 
2  238 LYS n 
2  239 TYR n 
2  240 HIS n 
2  241 GLY n 
2  242 GLY n 
2  243 GLU n 
2  244 ILE n 
2  245 ARG n 
2  246 GLU n 
2  247 GLN n 
2  248 ASN n 
2  249 GLY n 
2  250 ASP n 
2  251 SER n 
2  252 LEU n 
2  253 VAL n 
2  254 HIS n 
2  255 ALA n 
2  256 ALA n 
2  257 LEU n 
2  258 VAL n 
2  259 ALA n 
2  260 GLU n 
2  261 SER n 
2  262 ALA n 
2  263 ALA n 
2  264 ILE n 
2  265 GLY n 
2  266 SER n 
2  267 ALA n 
2  268 GLU n 
2  269 ALA n 
2  270 ASN n 
2  271 ALA n 
2  272 PHE n 
2  273 SER n 
2  274 VAL n 
2  275 LEU n 
2  276 GLN n 
2  277 HIS n 
2  278 VAL n 
2  279 LEU n 
2  280 GLY n 
2  281 ALA n 
2  282 GLY n 
2  283 PRO n 
2  284 HIS n 
2  285 VAL n 
2  286 LYS n 
2  287 ARG n 
2  288 GLY n 
2  289 SER n 
2  290 ASN n 
2  291 ALA n 
2  292 THR n 
2  293 SER n 
2  294 SER n 
2  295 LEU n 
2  296 TYR n 
2  297 GLN n 
2  298 ALA n 
2  299 VAL n 
2  300 ALA n 
2  301 LYS n 
2  302 GLY n 
2  303 VAL n 
2  304 HIS n 
2  305 GLN n 
2  306 PRO n 
2  307 PHE n 
2  308 ASP n 
2  309 VAL n 
2  310 SER n 
2  311 ALA n 
2  312 PHE n 
2  313 ASN n 
2  314 ALA n 
2  315 SER n 
2  316 TYR n 
2  317 SER n 
2  318 ASP n 
2  319 SER n 
2  320 GLY n 
2  321 LEU n 
2  322 PHE n 
2  323 GLY n 
2  324 PHE n 
2  325 TYR n 
2  326 THR n 
2  327 ILE n 
2  328 SER n 
2  329 GLN n 
2  330 ALA n 
2  331 ALA n 
2  332 SER n 
2  333 ALA n 
2  334 GLY n 
2  335 ASP n 
2  336 VAL n 
2  337 ILE n 
2  338 LYS n 
2  339 ALA n 
2  340 ALA n 
2  341 TYR n 
2  342 ASN n 
2  343 GLN n 
2  344 VAL n 
2  345 LYS n 
2  346 THR n 
2  347 ILE n 
2  348 ALA n 
2  349 GLN n 
2  350 GLY n 
2  351 ASN n 
2  352 LEU n 
2  353 SER n 
2  354 ASN n 
2  355 PRO n 
2  356 ASP n 
2  357 VAL n 
2  358 GLN n 
2  359 ALA n 
2  360 ALA n 
2  361 LYS n 
2  362 ASN n 
2  363 LYS n 
2  364 LEU n 
2  365 LYS n 
2  366 ALA n 
2  367 GLY n 
2  368 TYR n 
2  369 LEU n 
2  370 MET n 
2  371 SER n 
2  372 VAL n 
2  373 GLU n 
2  374 SER n 
2  375 SER n 
2  376 GLU n 
2  377 GLY n 
2  378 PHE n 
2  379 LEU n 
2  380 ASP n 
2  381 GLU n 
2  382 VAL n 
2  383 GLY n 
2  384 SER n 
2  385 GLN n 
2  386 ALA n 
2  387 LEU n 
2  388 ALA n 
2  389 ALA n 
2  390 GLY n 
2  391 SER n 
2  392 TYR n 
2  393 THR n 
2  394 PRO n 
2  395 PRO n 
2  396 SER n 
2  397 THR n 
2  398 VAL n 
2  399 LEU n 
2  400 GLN n 
2  401 GLN n 
2  402 ILE n 
2  403 ASP n 
2  404 ALA n 
2  405 VAL n 
2  406 ALA n 
2  407 ASP n 
2  408 ALA n 
2  409 ASP n 
2  410 VAL n 
2  411 ILE n 
2  412 ASN n 
2  413 ALA n 
2  414 ALA n 
2  415 LYS n 
2  416 LYS n 
2  417 PHE n 
2  418 VAL n 
2  419 SER n 
2  420 GLY n 
2  421 ARG n 
2  422 LYS n 
2  423 SER n 
2  424 MET n 
2  425 ALA n 
2  426 ALA n 
2  427 SER n 
2  428 GLY n 
2  429 ASN n 
2  430 LEU n 
2  431 GLY n 
2  432 HIS n 
2  433 THR n 
2  434 PRO n 
2  435 PHE n 
2  436 ILE n 
2  437 ASP n 
2  438 GLU n 
2  439 LEU n 
3  1   MET n 
3  2   THR n 
3  3   ASN n 
3  4   ILE n 
3  5   ARG n 
3  6   LYS n 
3  7   SER n 
3  8   HIS n 
3  9   PRO n 
3  10  LEU n 
3  11  MET n 
3  12  LYS n 
3  13  ILE n 
3  14  VAL n 
3  15  ASN n 
3  16  ASN n 
3  17  ALA n 
3  18  PHE n 
3  19  ILE n 
3  20  ASP n 
3  21  LEU n 
3  22  PRO n 
3  23  ALA n 
3  24  PRO n 
3  25  SER n 
3  26  ASN n 
3  27  ILE n 
3  28  SER n 
3  29  SER n 
3  30  TRP n 
3  31  TRP n 
3  32  ASN n 
3  33  PHE n 
3  34  GLY n 
3  35  SER n 
3  36  LEU n 
3  37  LEU n 
3  38  GLY n 
3  39  ILE n 
3  40  CYS n 
3  41  LEU n 
3  42  ILE n 
3  43  LEU n 
3  44  GLN n 
3  45  ILE n 
3  46  LEU n 
3  47  THR n 
3  48  GLY n 
3  49  LEU n 
3  50  PHE n 
3  51  LEU n 
3  52  ALA n 
3  53  MET n 
3  54  HIS n 
3  55  TYR n 
3  56  THR n 
3  57  SER n 
3  58  ASP n 
3  59  THR n 
3  60  THR n 
3  61  THR n 
3  62  ALA n 
3  63  PHE n 
3  64  SER n 
3  65  SER n 
3  66  VAL n 
3  67  THR n 
3  68  HIS n 
3  69  ILE n 
3  70  CYS n 
3  71  ARG n 
3  72  ASP n 
3  73  VAL n 
3  74  ASN n 
3  75  TYR n 
3  76  GLY n 
3  77  TRP n 
3  78  ILE n 
3  79  ILE n 
3  80  ARG n 
3  81  TYR n 
3  82  MET n 
3  83  HIS n 
3  84  ALA n 
3  85  ASN n 
3  86  GLY n 
3  87  ALA n 
3  88  SER n 
3  89  MET n 
3  90  PHE n 
3  91  PHE n 
3  92  ILE n 
3  93  CYS n 
3  94  LEU n 
3  95  TYR n 
3  96  MET n 
3  97  HIS n 
3  98  VAL n 
3  99  GLY n 
3  100 ARG n 
3  101 GLY n 
3  102 LEU n 
3  103 TYR n 
3  104 TYR n 
3  105 GLY n 
3  106 SER n 
3  107 TYR n 
3  108 THR n 
3  109 PHE n 
3  110 LEU n 
3  111 GLU n 
3  112 THR n 
3  113 TRP n 
3  114 ASN n 
3  115 ILE n 
3  116 GLY n 
3  117 VAL n 
3  118 ILE n 
3  119 LEU n 
3  120 LEU n 
3  121 LEU n 
3  122 THR n 
3  123 VAL n 
3  124 MET n 
3  125 ALA n 
3  126 THR n 
3  127 ALA n 
3  128 PHE n 
3  129 MET n 
3  130 GLY n 
3  131 TYR n 
3  132 VAL n 
3  133 LEU n 
3  134 PRO n 
3  135 TRP n 
3  136 GLY n 
3  137 GLN n 
3  138 MET n 
3  139 SER n 
3  140 PHE n 
3  141 TRP n 
3  142 GLY n 
3  143 ALA n 
3  144 THR n 
3  145 VAL n 
3  146 ILE n 
3  147 THR n 
3  148 ASN n 
3  149 LEU n 
3  150 LEU n 
3  151 SER n 
3  152 ALA n 
3  153 ILE n 
3  154 PRO n 
3  155 TYR n 
3  156 ILE n 
3  157 GLY n 
3  158 THR n 
3  159 ASN n 
3  160 LEU n 
3  161 VAL n 
3  162 GLU n 
3  163 TRP n 
3  164 ILE n 
3  165 TRP n 
3  166 GLY n 
3  167 GLY n 
3  168 PHE n 
3  169 SER n 
3  170 VAL n 
3  171 ASP n 
3  172 LYS n 
3  173 ALA n 
3  174 THR n 
3  175 LEU n 
3  176 THR n 
3  177 ARG n 
3  178 PHE n 
3  179 PHE n 
3  180 ALA n 
3  181 PHE n 
3  182 HIS n 
3  183 PHE n 
3  184 ILE n 
3  185 LEU n 
3  186 PRO n 
3  187 PHE n 
3  188 ILE n 
3  189 ILE n 
3  190 MET n 
3  191 ALA n 
3  192 ILE n 
3  193 ALA n 
3  194 MET n 
3  195 VAL n 
3  196 HIS n 
3  197 LEU n 
3  198 LEU n 
3  199 PHE n 
3  200 LEU n 
3  201 HIS n 
3  202 GLU n 
3  203 THR n 
3  204 GLY n 
3  205 SER n 
3  206 ASN n 
3  207 ASN n 
3  208 PRO n 
3  209 THR n 
3  210 GLY n 
3  211 ILE n 
3  212 SER n 
3  213 SER n 
3  214 ASP n 
3  215 VAL n 
3  216 ASP n 
3  217 LYS n 
3  218 ILE n 
3  219 PRO n 
3  220 PHE n 
3  221 HIS n 
3  222 PRO n 
3  223 TYR n 
3  224 TYR n 
3  225 THR n 
3  226 ILE n 
3  227 LYS n 
3  228 ASP n 
3  229 ILE n 
3  230 LEU n 
3  231 GLY n 
3  232 ALA n 
3  233 LEU n 
3  234 LEU n 
3  235 LEU n 
3  236 ILE n 
3  237 LEU n 
3  238 ALA n 
3  239 LEU n 
3  240 MET n 
3  241 LEU n 
3  242 LEU n 
3  243 VAL n 
3  244 LEU n 
3  245 PHE n 
3  246 ALA n 
3  247 PRO n 
3  248 ASP n 
3  249 LEU n 
3  250 LEU n 
3  251 GLY n 
3  252 ASP n 
3  253 PRO n 
3  254 ASP n 
3  255 ASN n 
3  256 TYR n 
3  257 THR n 
3  258 PRO n 
3  259 ALA n 
3  260 ASN n 
3  261 PRO n 
3  262 LEU n 
3  263 ASN n 
3  264 THR n 
3  265 PRO n 
3  266 PRO n 
3  267 HIS n 
3  268 ILE n 
3  269 LYS n 
3  270 PRO n 
3  271 GLU n 
3  272 TRP n 
3  273 TYR n 
3  274 PHE n 
3  275 LEU n 
3  276 PHE n 
3  277 ALA n 
3  278 TYR n 
3  279 ALA n 
3  280 ILE n 
3  281 LEU n 
3  282 ARG n 
3  283 SER n 
3  284 ILE n 
3  285 PRO n 
3  286 ASN n 
3  287 LYS n 
3  288 LEU n 
3  289 GLY n 
3  290 GLY n 
3  291 VAL n 
3  292 LEU n 
3  293 ALA n 
3  294 LEU n 
3  295 ALA n 
3  296 PHE n 
3  297 SER n 
3  298 ILE n 
3  299 LEU n 
3  300 ILE n 
3  301 LEU n 
3  302 ALA n 
3  303 LEU n 
3  304 ILE n 
3  305 PRO n 
3  306 LEU n 
3  307 LEU n 
3  308 HIS n 
3  309 THR n 
3  310 SER n 
3  311 LYS n 
3  312 GLN n 
3  313 ARG n 
3  314 SER n 
3  315 MET n 
3  316 MET n 
3  317 PHE n 
3  318 ARG n 
3  319 PRO n 
3  320 LEU n 
3  321 SER n 
3  322 GLN n 
3  323 CYS n 
3  324 LEU n 
3  325 PHE n 
3  326 TRP n 
3  327 ALA n 
3  328 LEU n 
3  329 VAL n 
3  330 ALA n 
3  331 ASP n 
3  332 LEU n 
3  333 LEU n 
3  334 THR n 
3  335 LEU n 
3  336 THR n 
3  337 TRP n 
3  338 ILE n 
3  339 GLY n 
3  340 GLY n 
3  341 GLN n 
3  342 PRO n 
3  343 VAL n 
3  344 GLU n 
3  345 HIS n 
3  346 PRO n 
3  347 TYR n 
3  348 ILE n 
3  349 THR n 
3  350 ILE n 
3  351 GLY n 
3  352 GLN n 
3  353 LEU n 
3  354 ALA n 
3  355 SER n 
3  356 VAL n 
3  357 LEU n 
3  358 TYR n 
3  359 PHE n 
3  360 LEU n 
3  361 LEU n 
3  362 ILE n 
3  363 LEU n 
3  364 VAL n 
3  365 LEU n 
3  366 MET n 
3  367 PRO n 
3  368 THR n 
3  369 ALA n 
3  370 GLY n 
3  371 THR n 
3  372 ILE n 
3  373 GLU n 
3  374 ASN n 
3  375 LYS n 
3  376 LEU n 
3  377 LEU n 
3  378 LYS n 
3  379 TRP n 
4  1   SER n 
4  2   ASP n 
4  3   LEU n 
4  4   GLU n 
4  5   LEU n 
4  6   HIS n 
4  7   PRO n 
4  8   PRO n 
4  9   SER n 
4  10  TYR n 
4  11  PRO n 
4  12  TRP n 
4  13  SER n 
4  14  HIS n 
4  15  ARG n 
4  16  GLY n 
4  17  LEU n 
4  18  LEU n 
4  19  SER n 
4  20  SER n 
4  21  LEU n 
4  22  ASP n 
4  23  HIS n 
4  24  THR n 
4  25  SER n 
4  26  ILE n 
4  27  ARG n 
4  28  ARG n 
4  29  GLY n 
4  30  PHE n 
4  31  GLN n 
4  32  VAL n 
4  33  TYR n 
4  34  LYS n 
4  35  GLN n 
4  36  VAL n 
4  37  CYS n 
4  38  SER n 
4  39  SER n 
4  40  CYS n 
4  41  HIS n 
4  42  SER n 
4  43  MET n 
4  44  ASP n 
4  45  TYR n 
4  46  VAL n 
4  47  ALA n 
4  48  TYR n 
4  49  ARG n 
4  50  HIS n 
4  51  LEU n 
4  52  VAL n 
4  53  GLY n 
4  54  VAL n 
4  55  CYS n 
4  56  TYR n 
4  57  THR n 
4  58  GLU n 
4  59  ASP n 
4  60  GLU n 
4  61  ALA n 
4  62  LYS n 
4  63  ALA n 
4  64  LEU n 
4  65  ALA n 
4  66  GLU n 
4  67  GLU n 
4  68  VAL n 
4  69  GLU n 
4  70  VAL n 
4  71  GLN n 
4  72  ASP n 
4  73  GLY n 
4  74  PRO n 
4  75  ASN n 
4  76  GLU n 
4  77  ASP n 
4  78  GLY n 
4  79  GLU n 
4  80  MET n 
4  81  PHE n 
4  82  MET n 
4  83  ARG n 
4  84  PRO n 
4  85  GLY n 
4  86  LYS n 
4  87  LEU n 
4  88  SER n 
4  89  ASP n 
4  90  TYR n 
4  91  PHE n 
4  92  PRO n 
4  93  LYS n 
4  94  PRO n 
4  95  TYR n 
4  96  PRO n 
4  97  ASN n 
4  98  PRO n 
4  99  GLU n 
4  100 ALA n 
4  101 ALA n 
4  102 ARG n 
4  103 ALA n 
4  104 ALA n 
4  105 ASN n 
4  106 ASN n 
4  107 GLY n 
4  108 ALA n 
4  109 LEU n 
4  110 PRO n 
4  111 PRO n 
4  112 ASP n 
4  113 LEU n 
4  114 SER n 
4  115 TYR n 
4  116 ILE n 
4  117 VAL n 
4  118 ARG n 
4  119 ALA n 
4  120 ARG n 
4  121 HIS n 
4  122 GLY n 
4  123 GLY n 
4  124 GLU n 
4  125 ASP n 
4  126 TYR n 
4  127 VAL n 
4  128 PHE n 
4  129 SER n 
4  130 LEU n 
4  131 LEU n 
4  132 THR n 
4  133 GLY n 
4  134 TYR n 
4  135 CYS n 
4  136 GLU n 
4  137 PRO n 
4  138 PRO n 
4  139 THR n 
4  140 GLY n 
4  141 VAL n 
4  142 SER n 
4  143 LEU n 
4  144 ARG n 
4  145 GLU n 
4  146 GLY n 
4  147 LEU n 
4  148 TYR n 
4  149 PHE n 
4  150 ASN n 
4  151 PRO n 
4  152 TYR n 
4  153 PHE n 
4  154 PRO n 
4  155 GLY n 
4  156 GLN n 
4  157 ALA n 
4  158 ILE n 
4  159 GLY n 
4  160 MET n 
4  161 ALA n 
4  162 PRO n 
4  163 PRO n 
4  164 ILE n 
4  165 TYR n 
4  166 ASN n 
4  167 GLU n 
4  168 VAL n 
4  169 LEU n 
4  170 GLU n 
4  171 PHE n 
4  172 ASP n 
4  173 ASP n 
4  174 GLY n 
4  175 THR n 
4  176 PRO n 
4  177 ALA n 
4  178 THR n 
4  179 MET n 
4  180 SER n 
4  181 GLN n 
4  182 VAL n 
4  183 ALA n 
4  184 LYS n 
4  185 ASP n 
4  186 VAL n 
4  187 CYS n 
4  188 THR n 
4  189 PHE n 
4  190 LEU n 
4  191 ARG n 
4  192 TRP n 
4  193 ALA n 
4  194 ALA n 
4  195 GLU n 
4  196 PRO n 
4  197 GLU n 
4  198 HIS n 
4  199 ASP n 
4  200 HIS n 
4  201 ARG n 
4  202 LYS n 
4  203 ARG n 
4  204 MET n 
4  205 GLY n 
4  206 LEU n 
4  207 LYS n 
4  208 MET n 
4  209 LEU n 
4  210 LEU n 
4  211 MET n 
4  212 MET n 
4  213 GLY n 
4  214 LEU n 
4  215 LEU n 
4  216 LEU n 
4  217 PRO n 
4  218 LEU n 
4  219 VAL n 
4  220 TYR n 
4  221 ALA n 
4  222 MET n 
4  223 LYS n 
4  224 ARG n 
4  225 HIS n 
4  226 LYS n 
4  227 TRP n 
4  228 SER n 
4  229 VAL n 
4  230 LEU n 
4  231 LYS n 
4  232 SER n 
4  233 ARG n 
4  234 LYS n 
4  235 LEU n 
4  236 ALA n 
4  237 TYR n 
4  238 ARG n 
4  239 PRO n 
4  240 PRO n 
4  241 LYS n 
5  1   SER n 
5  2   HIS n 
5  3   THR n 
5  4   ASP n 
5  5   ILE n 
5  6   LYS n 
5  7   VAL n 
5  8   PRO n 
5  9   ASP n 
5  10  PHE n 
5  11  SER n 
5  12  ASP n 
5  13  TYR n 
5  14  ARG n 
5  15  ARG n 
5  16  PRO n 
5  17  GLU n 
5  18  VAL n 
5  19  LEU n 
5  20  ASP n 
5  21  SER n 
5  22  THR n 
5  23  LYS n 
5  24  SER n 
5  25  SER n 
5  26  LYS n 
5  27  GLU n 
5  28  SER n 
5  29  SER n 
5  30  GLU n 
5  31  ALA n 
5  32  ARG n 
5  33  LYS n 
5  34  GLY n 
5  35  PHE n 
5  36  SER n 
5  37  TYR n 
5  38  LEU n 
5  39  VAL n 
5  40  THR n 
5  41  ALA n 
5  42  THR n 
5  43  THR n 
5  44  THR n 
5  45  VAL n 
5  46  GLY n 
5  47  VAL n 
5  48  ALA n 
5  49  TYR n 
5  50  ALA n 
5  51  ALA n 
5  52  LYS n 
5  53  ASN n 
5  54  VAL n 
5  55  VAL n 
5  56  SER n 
5  57  GLN n 
5  58  PHE n 
5  59  VAL n 
5  60  SER n 
5  61  SER n 
5  62  MET n 
5  63  SER n 
5  64  ALA n 
5  65  SER n 
5  66  ALA n 
5  67  ASP n 
5  68  VAL n 
5  69  LEU n 
5  70  ALA n 
5  71  MET n 
5  72  SER n 
5  73  LYS n 
5  74  ILE n 
5  75  GLU n 
5  76  ILE n 
5  77  LYS n 
5  78  LEU n 
5  79  SER n 
5  80  ASP n 
5  81  ILE n 
5  82  PRO n 
5  83  GLU n 
5  84  GLY n 
5  85  LYS n 
5  86  ASN n 
5  87  MET n 
5  88  ALA n 
5  89  PHE n 
5  90  LYS n 
5  91  TRP n 
5  92  ARG n 
5  93  GLY n 
5  94  LYS n 
5  95  PRO n 
5  96  LEU n 
5  97  PHE n 
5  98  VAL n 
5  99  ARG n 
5  100 HIS n 
5  101 ARG n 
5  102 THR n 
5  103 LYS n 
5  104 LYS n 
5  105 GLU n 
5  106 ILE n 
5  107 ASP n 
5  108 GLN n 
5  109 GLU n 
5  110 ALA n 
5  111 ALA n 
5  112 VAL n 
5  113 GLU n 
5  114 VAL n 
5  115 SER n 
5  116 GLN n 
5  117 LEU n 
5  118 ARG n 
5  119 ASP n 
5  120 PRO n 
5  121 GLN n 
5  122 HIS n 
5  123 ASP n 
5  124 LEU n 
5  125 GLU n 
5  126 ARG n 
5  127 VAL n 
5  128 LYS n 
5  129 LYS n 
5  130 PRO n 
5  131 GLU n 
5  132 TRP n 
5  133 VAL n 
5  134 ILE n 
5  135 LEU n 
5  136 ILE n 
5  137 GLY n 
5  138 VAL n 
5  139 CYS n 
5  140 THR n 
5  141 HIS n 
5  142 LEU n 
5  143 GLY n 
5  144 CYS n 
5  145 VAL n 
5  146 PRO n 
5  147 ILE n 
5  148 ALA n 
5  149 ASN n 
5  150 ALA n 
5  151 GLY n 
5  152 ASP n 
5  153 PHE n 
5  154 GLY n 
5  155 GLY n 
5  156 TYR n 
5  157 TYR n 
5  158 CYS n 
5  159 PRO n 
5  160 CYS n 
5  161 HIS n 
5  162 GLY n 
5  163 SER n 
5  164 HIS n 
5  165 TYR n 
5  166 ASP n 
5  167 ALA n 
5  168 SER n 
5  169 GLY n 
5  170 ARG n 
5  171 ILE n 
5  172 ARG n 
5  173 LYS n 
5  174 GLY n 
5  175 PRO n 
5  176 ALA n 
5  177 PRO n 
5  178 LEU n 
5  179 ASN n 
5  180 LEU n 
5  181 GLU n 
5  182 VAL n 
5  183 PRO n 
5  184 SER n 
5  185 TYR n 
5  186 GLU n 
5  187 PHE n 
5  188 THR n 
5  189 SER n 
5  190 ASP n 
5  191 ASP n 
5  192 MET n 
5  193 VAL n 
5  194 ILE n 
5  195 VAL n 
5  196 GLY n 
6  1   ALA n 
6  2   GLY n 
6  3   ARG n 
6  4   PRO n 
6  5   ALA n 
6  6   VAL n 
6  7   SER n 
6  8   ALA n 
6  9   SER n 
6  10  SER n 
6  11  ARG n 
6  12  TRP n 
6  13  LEU n 
6  14  GLU n 
6  15  GLY n 
6  16  ILE n 
6  17  ARG n 
6  18  LYS n 
6  19  TRP n 
6  20  TYR n 
6  21  TYR n 
6  22  ASN n 
6  23  ALA n 
6  24  ALA n 
6  25  GLY n 
6  26  PHE n 
6  27  ASN n 
6  28  LYS n 
6  29  LEU n 
6  30  GLY n 
6  31  LEU n 
6  32  MET n 
6  33  ARG n 
6  34  ASP n 
6  35  ASP n 
6  36  THR n 
6  37  ILE n 
6  38  HIS n 
6  39  GLU n 
6  40  ASN n 
6  41  ASP n 
6  42  ASP n 
6  43  VAL n 
6  44  LYS n 
6  45  GLU n 
6  46  ALA n 
6  47  ILE n 
6  48  ARG n 
6  49  ARG n 
6  50  LEU n 
6  51  PRO n 
6  52  GLU n 
6  53  ASN n 
6  54  LEU n 
6  55  TYR n 
6  56  ASP n 
6  57  ASP n 
6  58  ARG n 
6  59  VAL n 
6  60  PHE n 
6  61  ARG n 
6  62  ILE n 
6  63  LYS n 
6  64  ARG n 
6  65  ALA n 
6  66  LEU n 
6  67  ASP n 
6  68  LEU n 
6  69  SER n 
6  70  MET n 
6  71  ARG n 
6  72  GLN n 
6  73  GLN n 
6  74  ILE n 
6  75  LEU n 
6  76  PRO n 
6  77  LYS n 
6  78  GLU n 
6  79  GLN n 
6  80  TRP n 
6  81  THR n 
6  82  LYS n 
6  83  TYR n 
6  84  GLU n 
6  85  GLU n 
6  86  ASP n 
6  87  LYS n 
6  88  SER n 
6  89  TYR n 
6  90  LEU n 
6  91  GLU n 
6  92  PRO n 
6  93  TYR n 
6  94  LEU n 
6  95  LYS n 
6  96  GLU n 
6  97  VAL n 
6  98  ILE n 
6  99  ARG n 
6  100 GLU n 
6  101 ARG n 
6  102 LYS n 
6  103 GLU n 
6  104 ARG n 
6  105 GLU n 
6  106 GLU n 
6  107 TRP n 
6  108 ALA n 
6  109 LYS n 
6  110 LYS n 
7  1   GLY n 
7  2   ARG n 
7  3   GLN n 
7  4   PHE n 
7  5   GLY n 
7  6   HIS n 
7  7   LEU n 
7  8   THR n 
7  9   ARG n 
7  10  VAL n 
7  11  ARG n 
7  12  HIS n 
7  13  VAL n 
7  14  ILE n 
7  15  THR n 
7  16  TYR n 
7  17  SER n 
7  18  LEU n 
7  19  SER n 
7  20  PRO n 
7  21  PHE n 
7  22  GLU n 
7  23  GLN n 
7  24  ARG n 
7  25  ALA n 
7  26  PHE n 
7  27  PRO n 
7  28  HIS n 
7  29  TYR n 
7  30  PHE n 
7  31  SER n 
7  32  LYS n 
7  33  GLY n 
7  34  ILE n 
7  35  PRO n 
7  36  ASN n 
7  37  VAL n 
7  38  LEU n 
7  39  ARG n 
7  40  ARG n 
7  41  THR n 
7  42  ARG n 
7  43  ALA n 
7  44  CYS n 
7  45  ILE n 
7  46  LEU n 
7  47  ARG n 
7  48  VAL n 
7  49  ALA n 
7  50  PRO n 
7  51  PRO n 
7  52  PHE n 
7  53  VAL n 
7  54  ALA n 
7  55  PHE n 
7  56  TYR n 
7  57  LEU n 
7  58  VAL n 
7  59  TYR n 
7  60  THR n 
7  61  TRP n 
7  62  GLY n 
7  63  THR n 
7  64  GLN n 
7  65  GLU n 
7  66  PHE n 
7  67  GLU n 
7  68  LYS n 
7  69  SER n 
7  70  LYS n 
7  71  ARG n 
7  72  LYS n 
7  73  ASN n 
7  74  PRO n 
7  75  ALA n 
7  76  ALA n 
7  77  TYR n 
7  78  GLU n 
7  79  ASN n 
7  80  ASP n 
7  81  ARG n 
8  1   GLY n 
8  2   ASP n 
8  3   PRO n 
8  4   LYS n 
8  5   GLU n 
8  6   GLU n 
8  7   GLU n 
8  8   GLU n 
8  9   GLU n 
8  10  GLU n 
8  11  GLU n 
8  12  GLU n 
8  13  LEU n 
8  14  VAL n 
8  15  ASP n 
8  16  PRO n 
8  17  LEU n 
8  18  THR n 
8  19  THR n 
8  20  VAL n 
8  21  ARG n 
8  22  GLU n 
8  23  GLN n 
8  24  CYS n 
8  25  GLU n 
8  26  GLN n 
8  27  LEU n 
8  28  GLU n 
8  29  LYS n 
8  30  CYS n 
8  31  VAL n 
8  32  LYS n 
8  33  ALA n 
8  34  ARG n 
8  35  GLU n 
8  36  ARG n 
8  37  LEU n 
8  38  GLU n 
8  39  LEU n 
8  40  CYS n 
8  41  ASP n 
8  42  GLU n 
8  43  ARG n 
8  44  VAL n 
8  45  SER n 
8  46  SER n 
8  47  ARG n 
8  48  SER n 
8  49  GLN n 
8  50  THR n 
8  51  GLU n 
8  52  GLU n 
8  53  ASP n 
8  54  CYS n 
8  55  THR n 
8  56  GLU n 
8  57  GLU n 
8  58  LEU n 
8  59  LEU n 
8  60  ASP n 
8  61  PHE n 
8  62  LEU n 
8  63  HIS n 
8  64  ALA n 
8  65  ARG n 
8  66  ASP n 
8  67  HIS n 
8  68  CYS n 
8  69  VAL n 
8  70  ALA n 
8  71  HIS n 
8  72  LYS n 
8  73  LEU n 
8  74  PHE n 
8  75  ASN n 
8  76  SER n 
8  77  LEU n 
8  78  LYS n 
9  1   MET n 
9  2   LEU n 
9  3   SER n 
9  4   VAL n 
9  5   ALA n 
9  6   ALA n 
9  7   ARG n 
9  8   SER n 
9  9   GLY n 
9  10  PRO n 
9  11  PHE n 
9  12  ALA n 
9  13  PRO n 
9  14  VAL n 
9  15  LEU n 
9  16  SER n 
9  17  ALA n 
9  18  THR n 
9  19  SER n 
9  20  ARG n 
9  21  GLY n 
9  22  VAL n 
9  23  ALA n 
9  24  GLY n 
9  25  ALA n 
9  26  LEU n 
9  27  ARG n 
9  28  PRO n 
9  29  LEU n 
9  30  VAL n 
9  31  GLN n 
9  32  ALA n 
9  33  ALA n 
9  34  VAL n 
9  35  PRO n 
9  36  ALA n 
9  37  THR n 
9  38  SER n 
9  39  GLU n 
9  40  SER n 
9  41  PRO n 
9  42  VAL n 
9  43  LEU n 
9  44  ASP n 
9  45  LEU n 
9  46  LYS n 
9  47  ARG n 
9  48  SER n 
9  49  VAL n 
9  50  LEU n 
9  51  CYS n 
9  52  ARG n 
9  53  GLU n 
9  54  SER n 
9  55  LEU n 
9  56  ARG n 
9  57  GLY n 
10 1   VAL n 
10 2   ALA n 
10 3   PRO n 
10 4   THR n 
10 5   LEU n 
10 6   THR n 
10 7   ALA n 
10 8   ARG n 
10 9   LEU n 
10 10  TYR n 
10 11  SER n 
10 12  LEU n 
10 13  LEU n 
10 14  PHE n 
10 15  ARG n 
10 16  ARG n 
10 17  THR n 
10 18  SER n 
10 19  THR n 
10 20  PHE n 
10 21  ALA n 
10 22  LEU n 
10 23  THR n 
10 24  ILE n 
10 25  VAL n 
10 26  VAL n 
10 27  GLY n 
10 28  ALA n 
10 29  LEU n 
10 30  PHE n 
10 31  PHE n 
10 32  GLU n 
10 33  ARG n 
10 34  ALA n 
10 35  PHE n 
10 36  ASP n 
10 37  GLN n 
10 38  GLY n 
10 39  ALA n 
10 40  ASP n 
10 41  ALA n 
10 42  ILE n 
10 43  TYR n 
10 44  GLU n 
10 45  HIS n 
10 46  ILE n 
10 47  ASN n 
10 48  GLU n 
10 49  GLY n 
10 50  LYS n 
10 51  LEU n 
10 52  TRP n 
10 53  LYS n 
10 54  HIS n 
10 55  ILE n 
10 56  LYS n 
10 57  HIS n 
10 58  LYS n 
10 59  TYR n 
10 60  GLU n 
10 61  ASN n 
10 62  LYS n 
11 1   MET n 
11 2   LEU n 
11 3   THR n 
11 4   ARG n 
11 5   PHE n 
11 6   LEU n 
11 7   GLY n 
11 8   PRO n 
11 9   ARG n 
11 10  TYR n 
11 11  ARG n 
11 12  GLN n 
11 13  LEU n 
11 14  ALA n 
11 15  ARG n 
11 16  ASN n 
11 17  TRP n 
11 18  VAL n 
11 19  PRO n 
11 20  THR n 
11 21  ALA n 
11 22  GLN n 
11 23  LEU n 
11 24  TRP n 
11 25  GLY n 
11 26  ALA n 
11 27  VAL n 
11 28  GLY n 
11 29  ALA n 
11 30  VAL n 
11 31  GLY n 
11 32  LEU n 
11 33  VAL n 
11 34  TRP n 
11 35  ALA n 
11 36  THR n 
11 37  ASP n 
11 38  TRP n 
11 39  ARG n 
11 40  LEU n 
11 41  ILE n 
11 42  LEU n 
11 43  ASP n 
11 44  TRP n 
11 45  VAL n 
11 46  PRO n 
11 47  TYR n 
11 48  ILE n 
11 49  ASN n 
11 50  GLY n 
11 51  LYS n 
11 52  PHE n 
11 53  LYS n 
11 54  LYS n 
11 55  ASP n 
11 56  ASP n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP UQCR1_BOVIN 1  
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
35 P31800 ? 
2  UNP UQCR2_BOVIN 2  
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
15 P23004 ? 
3  UNP CYB_BOVIN   3  
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
1  P00157 ? 
4  UNP CY1_BOVIN   4  
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
1  P00125 ? 
5  UNP UCRI_BOVIN  5  
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
79 P13272 ? 
6  UNP UCR6_BOVIN  6  
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
1  P00129 ? 
7  UNP UCRQ_BOVIN  7  
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
1  P13271 ? 
8  UNP UCRH_BOVIN  8  GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK 1  P00126 ? 
9  UNP UCRI_BOVIN  9  MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRG 1  P13272 ? 
10 UNP UCR10_BOVIN 10 VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK 1  P00130 ? 
11 UNP UCR11_BOVIN 11 MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD 1  P07552 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1NTZ A 1 ? 446 ? P31800 35 ? 480 ? 1 446 
2  2  1NTZ B 1 ? 439 ? P23004 15 ? 453 ? 1 439 
3  3  1NTZ C 1 ? 379 ? P00157 1  ? 379 ? 1 379 
4  4  1NTZ D 1 ? 241 ? P00125 1  ? 241 ? 1 241 
5  5  1NTZ E 1 ? 196 ? P13272 79 ? 274 ? 1 196 
6  6  1NTZ F 1 ? 110 ? P00129 1  ? 110 ? 1 110 
7  7  1NTZ G 1 ? 81  ? P13271 1  ? 81  ? 1 81  
8  8  1NTZ H 1 ? 78  ? P00126 1  ? 78  ? 1 78  
9  9  1NTZ I 1 ? 57  ? P13272 1  ? 57  ? 1 57  
10 10 1NTZ J 1 ? 62  ? P00130 1  ? 62  ? 1 62  
11 11 1NTZ K 1 ? 56  ? P07552 1  ? 56  ? 1 56  
# 
_struct_ref_seq_dif.align_id                     11 
_struct_ref_seq_dif.pdbx_pdb_id_code             1NTZ 
_struct_ref_seq_dif.mon_id                       GLN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           K 
_struct_ref_seq_dif.seq_num                      22 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P07552 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          22 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            22 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'      ?    'Fe2 S2'           175.820 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
UQ2 non-polymer         . UBIQUINONE-2                      ?    'C19 H26 O4'       318.407 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1NTZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.69 
_exptl_crystal.density_percent_sol   66.64 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    
'PEG 4000, ammonium acetate, potassium chloride, glycerol, DMG/SPC, MOPS, pH 7.2, VAPOR DIFFUSION, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                'Si(111)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1NTZ 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -1.0 
_reflns.d_resolution_high            2.6 
_reflns.d_resolution_low             40.0 
_reflns.number_all                   109744 
_reflns.number_obs                   104476 
_reflns.percent_possible_obs         95.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.602 
_reflns_shell.d_res_low              2.669 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1NTZ 
_refine.ls_number_reflns_obs                     102423 
_refine.ls_number_reflns_all                     104476 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.99 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.2473 
_refine.ls_R_factor_all                          0.2473 
_refine.ls_R_factor_R_work                       0.24655 
_refine.ls_R_factor_R_free                       0.28316 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2075 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.922 
_refine.correlation_coeff_Fo_to_Fc_free          0.903 
_refine.B_iso_mean                               39.826 
_refine.aniso_B[1][1]                            1.11 
_refine.aniso_B[2][2]                            1.11 
_refine.aniso_B[3][3]                            -2.23 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.466 
_refine.pdbx_overall_ESU_R_Free                  0.305 
_refine.overall_SU_ML                            0.288 
_refine.overall_SU_B                             14.031 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16510 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         179 
_refine_hist.number_atoms_solvent             207 
_refine_hist.number_atoms_total               16896 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        28.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.021  0.021  ? 17515 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.859  1.983  ? 23744 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   3.066  3.000  ? 2094  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   19.589 15.000 ? 2982  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.321  0.200  ? 2596  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.009  0.020  ? 13063 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.212  0.300  ? 8654  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.189  0.500  ? 1052  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.180  0.300  ? 92    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.246  0.500  ? 9     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.667  0.400  ? 10490 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.868  3.801  ? 16876 'X-RAY DIFFRACTION' ? 
r_scbond_it              6.249  3.000  ? 7025  'X-RAY DIFFRACTION' ? 
r_scangle_it             8.435  4.500  ? 6866  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.602 
_refine_ls_shell.d_res_low                        2.669 
_refine_ls_shell.number_reflns_R_work             7491 
_refine_ls_shell.R_factor_R_work                  0.326 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.35 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1NTZ 
_struct.title                     'Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone' 
_struct.pdbx_descriptor           'Cytochrome bc1 Complex (E.C.1.10.2.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NTZ 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;BC1, QCR, MEMBRANE PROTEIN, PROTON TRANSLOCATION, ELECTRON TRANSFER, PROTEASE, MPP, MITOCHONDRIAL PROCESSING PEPTIDASE, CYTOCHROME C1, CYTOCHROME B, RIESKE, IRON SULFUR PROTEIN, OXIDOREDUCTASE, UBIQUINONE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 12 ? 
N  N N 13 ? 
O  N N 13 ? 
P  N N 12 ? 
Q  N N 14 ? 
R  N N 15 ? 
S  N N 15 ? 
T  N N 15 ? 
U  N N 15 ? 
V  N N 15 ? 
W  N N 15 ? 
X  N N 15 ? 
Y  N N 15 ? 
Z  N N 15 ? 
AA N N 15 ? 
BA N N 15 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The biological assembly is a dimer generated from the monomer in the asymmetric unit by the two-fold axis: -x+1, -y+1, z.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 3   ? VAL A 11  ? THR A 3   VAL A 11  1 ? 9  
HELX_P HELX_P2  2  GLY A 54  ? PHE A 64  ? GLY A 54  PHE A 64  1 ? 11 
HELX_P HELX_P3  3  ASN A 73  ? MET A 82  ? ASN A 73  MET A 82  1 ? 10 
HELX_P HELX_P4  4  ASP A 105 ? ASN A 119 ? ASP A 105 ASN A 119 1 ? 15 
HELX_P HELX_P5  5  GLU A 123 ? SER A 144 ? GLU A 123 SER A 144 1 ? 22 
HELX_P HELX_P6  6  SER A 144 ? PHE A 158 ? SER A 144 PHE A 158 1 ? 15 
HELX_P HELX_P7  7  THR A 161 ? GLN A 165 ? THR A 161 GLN A 165 5 ? 5  
HELX_P HELX_P8  8  PRO A 170 ? LEU A 177 ? PRO A 170 LEU A 177 1 ? 8  
HELX_P HELX_P9  9  SER A 178 ? TYR A 190 ? SER A 178 TYR A 190 1 ? 13 
HELX_P HELX_P10 10 LYS A 191 ? PRO A 193 ? LYS A 191 PRO A 193 5 ? 3  
HELX_P HELX_P11 11 GLU A 204 ? SER A 217 ? GLU A 204 SER A 217 1 ? 14 
HELX_P HELX_P12 12 LEU A 219 ? TYR A 223 ? LEU A 219 TYR A 223 5 ? 5  
HELX_P HELX_P13 13 ASP A 266 ? GLY A 278 ? ASP A 266 GLY A 278 1 ? 13 
HELX_P HELX_P14 14 SER A 292 ? LYS A 302 ? SER A 292 LYS A 302 1 ? 11 
HELX_P HELX_P15 15 ASP A 327 ? MET A 329 ? ASP A 327 MET A 329 5 ? 3  
HELX_P HELX_P16 16 SER A 330 ? ALA A 349 ? SER A 330 ALA A 349 1 ? 20 
HELX_P HELX_P17 17 THR A 350 ? LEU A 369 ? THR A 350 LEU A 369 1 ? 20 
HELX_P HELX_P18 18 GLY A 371 ? TYR A 386 ? GLY A 371 TYR A 386 1 ? 16 
HELX_P HELX_P19 19 PRO A 391 ? GLU A 401 ? PRO A 391 GLU A 401 1 ? 11 
HELX_P HELX_P20 20 ASP A 403 ? PHE A 415 ? ASP A 403 PHE A 415 1 ? 13 
HELX_P HELX_P21 21 ASP A 433 ? GLY A 440 ? ASP A 433 GLY A 440 1 ? 8  
HELX_P HELX_P22 22 GLY B 54  ? GLU B 58  ? GLY B 54  GLU B 58  5 ? 5  
HELX_P HELX_P23 23 GLY B 64  ? ALA B 72  ? GLY B 64  ALA B 72  1 ? 9  
HELX_P HELX_P24 24 SER B 81  ? VAL B 92  ? SER B 81  VAL B 92  1 ? 12 
HELX_P HELX_P25 25 ASP B 115 ? ALA B 129 ? ASP B 115 ALA B 129 1 ? 15 
HELX_P HELX_P26 26 ARG B 133 ? LEU B 152 ? ARG B 133 LEU B 152 1 ? 20 
HELX_P HELX_P27 27 ASN B 154 ? TYR B 168 ? ASN B 154 TYR B 168 1 ? 15 
HELX_P HELX_P28 28 PRO B 179 ? ILE B 183 ? PRO B 179 ILE B 183 5 ? 5  
HELX_P HELX_P29 29 THR B 187 ? PHE B 199 ? THR B 187 PHE B 199 1 ? 13 
HELX_P HELX_P30 30 THR B 200 ? ALA B 202 ? THR B 200 ALA B 202 5 ? 3  
HELX_P HELX_P31 31 SER B 212 ? LEU B 224 ? SER B 212 LEU B 224 1 ? 13 
HELX_P HELX_P32 32 SER B 266 ? GLY B 280 ? SER B 266 GLY B 280 1 ? 15 
HELX_P HELX_P33 33 SER B 293 ? VAL B 303 ? SER B 293 VAL B 303 1 ? 11 
HELX_P HELX_P34 34 SER B 332 ? GLN B 349 ? SER B 332 GLN B 349 1 ? 18 
HELX_P HELX_P35 35 ASN B 354 ? VAL B 372 ? ASN B 354 VAL B 372 1 ? 19 
HELX_P HELX_P36 36 SER B 374 ? ALA B 389 ? SER B 374 ALA B 389 1 ? 16 
HELX_P HELX_P37 37 PRO B 394 ? ALA B 404 ? PRO B 394 ALA B 404 1 ? 11 
HELX_P HELX_P38 38 ALA B 406 ? GLY B 420 ? ALA B 406 GLY B 420 1 ? 15 
HELX_P HELX_P39 39 HIS C 8   ? ILE C 19  ? HIS C 8   ILE C 19  1 ? 12 
HELX_P HELX_P40 40 ASN C 32  ? MET C 53  ? ASN C 32  MET C 53  1 ? 22 
HELX_P HELX_P41 41 THR C 61  ? ASP C 72  ? THR C 61  ASP C 72  1 ? 12 
HELX_P HELX_P42 42 TYR C 75  ? TYR C 104 ? TYR C 75  TYR C 104 1 ? 30 
HELX_P HELX_P43 43 GLY C 105 ? THR C 108 ? GLY C 105 THR C 108 5 ? 4  
HELX_P HELX_P44 44 PHE C 109 ? LEU C 133 ? PHE C 109 LEU C 133 1 ? 25 
HELX_P HELX_P45 45 GLY C 136 ? ASN C 148 ? GLY C 136 ASN C 148 1 ? 13 
HELX_P HELX_P46 46 LEU C 149 ? ILE C 153 ? LEU C 149 ILE C 153 5 ? 5  
HELX_P HELX_P47 47 ILE C 156 ? GLY C 166 ? ILE C 156 GLY C 166 1 ? 11 
HELX_P HELX_P48 48 ASP C 171 ? GLU C 202 ? ASP C 171 GLU C 202 1 ? 32 
HELX_P HELX_P49 49 SER C 213 ? VAL C 215 ? SER C 213 VAL C 215 5 ? 3  
HELX_P HELX_P50 50 PRO C 222 ? ALA C 246 ? PRO C 222 ALA C 246 1 ? 25 
HELX_P HELX_P51 51 GLU C 271 ? TYR C 273 ? GLU C 271 TYR C 273 5 ? 3  
HELX_P HELX_P52 52 PHE C 274 ? SER C 283 ? PHE C 274 SER C 283 1 ? 10 
HELX_P HELX_P53 53 ASN C 286 ? ILE C 300 ? ASN C 286 ILE C 300 1 ? 15 
HELX_P HELX_P54 54 LEU C 301 ? HIS C 308 ? LEU C 301 HIS C 308 5 ? 8  
HELX_P HELX_P55 55 ARG C 318 ? GLY C 340 ? ARG C 318 GLY C 340 1 ? 23 
HELX_P HELX_P56 56 PRO C 346 ? VAL C 364 ? PRO C 346 VAL C 364 1 ? 19 
HELX_P HELX_P57 57 VAL C 364 ? LEU C 377 ? VAL C 364 LEU C 377 1 ? 14 
HELX_P HELX_P58 58 ASP D 22  ? VAL D 36  ? ASP D 22  VAL D 36  1 ? 15 
HELX_P HELX_P59 59 CYS D 37  ? CYS D 40  ? CYS D 37  CYS D 40  5 ? 4  
HELX_P HELX_P60 60 TYR D 48  ? CYS D 55  ? TYR D 48  CYS D 55  1 ? 8  
HELX_P HELX_P61 61 THR D 57  ? GLU D 67  ? THR D 57  GLU D 67  1 ? 11 
HELX_P HELX_P62 62 ASN D 97  ? ASN D 106 ? ASN D 97  ASN D 106 1 ? 10 
HELX_P HELX_P63 63 TYR D 115 ? ARG D 120 ? TYR D 115 ARG D 120 1 ? 6  
HELX_P HELX_P64 64 GLY D 123 ? GLY D 133 ? GLY D 123 GLY D 133 1 ? 11 
HELX_P HELX_P65 65 THR D 178 ? GLU D 195 ? THR D 178 GLU D 195 1 ? 18 
HELX_P HELX_P66 66 GLU D 197 ? SER D 232 ? GLU D 197 SER D 232 1 ? 36 
HELX_P HELX_P67 67 SER E 1   ? ILE E 5   ? SER E 1   ILE E 5   5 ? 5  
HELX_P HELX_P68 68 SER E 25  ? SER E 61  ? SER E 25  SER E 61  1 ? 37 
HELX_P HELX_P69 69 SER E 79  ? ILE E 81  ? SER E 79  ILE E 81  5 ? 3  
HELX_P HELX_P70 70 THR E 102 ? ALA E 111 ? THR E 102 ALA E 111 1 ? 10 
HELX_P HELX_P71 71 GLU E 113 ? LEU E 117 ? GLU E 113 LEU E 117 5 ? 5  
HELX_P HELX_P72 72 HIS E 122 ? ARG E 126 ? HIS E 122 ARG E 126 5 ? 5  
HELX_P HELX_P73 73 SER F 7   ? GLY F 25  ? SER F 7   GLY F 25  1 ? 19 
HELX_P HELX_P74 74 PHE F 26  ? GLY F 30  ? PHE F 26  GLY F 30  5 ? 5  
HELX_P HELX_P75 75 MET F 32  ? ILE F 37  ? MET F 32  ILE F 37  5 ? 6  
HELX_P HELX_P76 76 ASN F 40  ? LEU F 50  ? ASN F 40  LEU F 50  1 ? 11 
HELX_P HELX_P77 77 PRO F 51  ? ARG F 71  ? PRO F 51  ARG F 71  1 ? 21 
HELX_P HELX_P78 78 PRO F 76  ? TRP F 80  ? PRO F 76  TRP F 80  5 ? 5  
HELX_P HELX_P79 79 LEU F 90  ? ALA F 108 ? LEU F 90  ALA F 108 1 ? 19 
HELX_P HELX_P80 80 LYS G 32  ? LYS G 70  ? LYS G 32  LYS G 70  1 ? 39 
HELX_P HELX_P81 81 ASP H 15  ? LEU H 27  ? ASP H 15  LEU H 27  1 ? 13 
HELX_P HELX_P82 82 LEU H 27  ? SER H 46  ? LEU H 27  SER H 46  1 ? 20 
HELX_P HELX_P83 83 CYS H 54  ? LEU H 73  ? CYS H 54  LEU H 73  1 ? 20 
HELX_P HELX_P84 84 LEU I 29  ? ALA I 33  ? LEU I 29  ALA I 33  5 ? 5  
HELX_P HELX_P85 85 ALA J 2   ? PHE J 14  ? ALA J 2   PHE J 14  1 ? 13 
HELX_P HELX_P86 86 ARG J 16  ? ILE J 46  ? ARG J 16  ILE J 46  1 ? 31 
HELX_P HELX_P87 87 MET K 1   ? LEU K 6   ? MET K 1   LEU K 6   5 ? 6  
HELX_P HELX_P88 88 GLY K 7   ? TRP K 17  ? GLY K 7   TRP K 17  1 ? 11 
HELX_P HELX_P89 89 TRP K 17  ? ASP K 37  ? TRP K 17  ASP K 37  1 ? 21 
HELX_P HELX_P90 90 TRP K 38  ? ASP K 43  ? TRP K 38  ASP K 43  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? E CYS 144 SG  ? ? ? 1_555 E CYS 160 SG  ? ? E CYS 144 E CYS 160 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2  disulf ? ? H CYS 24  SG  ? ? ? 1_555 H CYS 68  SG  ? ? H CYS 24  H CYS 68  1_555 ? ? ? ? ? ? ? 2.024 ? 
metalc1  metalc ? ? C HIS 182 NE2 ? ? ? 1_555 L HEM .   FE  ? ? C HIS 182 C HEM 381 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc2  metalc ? ? C HIS 83  NE2 ? ? ? 1_555 L HEM .   FE  ? ? C HIS 83  C HEM 381 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc3  metalc ? ? C HIS 196 NE2 ? ? ? 1_555 M HEM .   FE  ? ? C HIS 196 C HEM 382 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc4  metalc ? ? C HIS 97  NE2 ? ? ? 1_555 M HEM .   FE  ? ? C HIS 97  C HEM 382 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc5  metalc ? ? D HIS 41  NE2 ? ? ? 1_555 P HEM .   FE  ? ? D HIS 41  D HEM 242 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc6  metalc ? ? D MET 160 SD  ? ? ? 1_555 P HEM .   FE  ? ? D MET 160 D HEM 242 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc7  metalc ? ? E CYS 158 SG  ? ? ? 1_555 Q FES .   FE1 ? ? E CYS 158 E FES 200 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc8  metalc ? ? E CYS 139 SG  ? ? ? 1_555 Q FES .   FE1 ? ? E CYS 139 E FES 200 1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc9  metalc ? ? E HIS 161 ND1 ? ? ? 1_555 Q FES .   FE2 ? ? E HIS 161 E FES 200 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc10 metalc ? ? E HIS 141 ND1 ? ? ? 1_555 Q FES .   FE2 ? ? E HIS 141 E FES 200 1_555 ? ? ? ? ? ? ? 2.811 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 8 ? 
D ? 5 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 3 ? 
I ? 3 ? 
J ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 15  ? GLN A 18  ? GLN A 15  GLN A 18  
A 2 ARG A 24  ? GLN A 29  ? ARG A 24  GLN A 29  
A 3 MET A 195 ? GLY A 201 ? MET A 195 GLY A 201 
A 4 THR A 34  ? ILE A 41  ? THR A 34  ILE A 41  
A 5 THR A 95  ? LEU A 102 ? THR A 95  LEU A 102 
A 6 HIS A 85  ? SER A 90  ? HIS A 85  SER A 90  
B 1 HIS A 279 ? ASP A 281 ? HIS A 279 ASP A 281 
B 2 SER A 306 ? CYS A 313 ? SER A 306 CYS A 313 
B 3 GLY A 318 ? CYS A 326 ? GLY A 318 CYS A 326 
B 4 ALA A 251 ? GLY A 259 ? ALA A 251 GLY A 259 
B 5 ALA A 421 ? GLY A 426 ? ALA A 421 GLY A 426 
B 6 SER A 239 ? GLU A 245 ? SER A 239 GLU A 245 
B 7 ARG G 11  ? LEU G 18  ? ARG G 11  LEU G 18  
B 8 LYS D 234 ? TYR D 237 ? LYS D 234 TYR D 237 
C 1 GLU B 25  ? ARG B 28  ? GLU B 25  ARG B 28  
C 2 VAL B 34  ? LEU B 38  ? VAL B 34  LEU B 38  
C 3 MET B 204 ? LEU B 209 ? MET B 204 LEU B 209 
C 4 ALA B 44  ? ILE B 51  ? ALA B 44  ILE B 51  
C 5 MET B 105 ? LEU B 112 ? MET B 105 LEU B 112 
C 6 LYS B 95  ? SER B 100 ? LYS B 95  SER B 100 
C 7 PRO I 13  ? SER I 16  ? PRO I 13  SER I 16  
C 8 VAL I 22  ? ALA I 23  ? VAL I 22  ALA I 23  
D 1 GLY B 242 ? GLN B 247 ? GLY B 242 GLN B 247 
D 2 LYS B 422 ? GLY B 428 ? LYS B 422 GLY B 428 
D 3 LEU B 252 ? GLU B 260 ? LEU B 252 GLU B 260 
D 4 GLY B 320 ? GLN B 329 ? GLY B 320 GLN B 329 
D 5 PHE B 307 ? SER B 315 ? PHE B 307 SER B 315 
E 1 PRO C 22  ? PRO C 24  ? PRO C 22  PRO C 24  
E 2 LYS C 217 ? PRO C 219 ? LYS C 217 PRO C 219 
F 1 MET D 43  ? ALA D 47  ? MET D 43  ALA D 47  
F 2 TYR D 90  ? PHE D 91  ? TYR D 90  PHE D 91  
G 1 TYR D 148 ? PHE D 149 ? TYR D 148 PHE D 149 
G 2 ALA D 157 ? ILE D 158 ? ALA D 157 ILE D 158 
H 1 GLU E 75  ? LYS E 77  ? GLU E 75  LYS E 77  
H 2 MET E 192 ? VAL E 195 ? MET E 192 VAL E 195 
H 3 TYR E 185 ? GLU E 186 ? TYR E 185 GLU E 186 
I 1 ASN E 86  ? TRP E 91  ? ASN E 86  TRP E 91  
I 2 LYS E 94  ? HIS E 100 ? LYS E 94  HIS E 100 
I 3 TRP E 132 ? ILE E 136 ? TRP E 132 ILE E 136 
J 1 ILE E 147 ? ALA E 148 ? ILE E 147 ALA E 148 
J 2 GLY E 154 ? CYS E 158 ? GLY E 154 CYS E 158 
J 3 SER E 163 ? ASP E 166 ? SER E 163 ASP E 166 
J 4 ILE E 171 ? LYS E 173 ? ILE E 171 LYS E 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 17  ? N SER A 17  O VAL A 25  ? O VAL A 25  
A 2 3 N ARG A 24  ? N ARG A 24  O LEU A 197 ? O LEU A 197 
A 3 4 O ALA A 198 ? O ALA A 198 N GLY A 38  ? N GLY A 38  
A 4 5 N VAL A 37  ? N VAL A 37  O ILE A 99  ? O ILE A 99  
A 5 6 O LYS A 100 ? O LYS A 100 N HIS A 85  ? N HIS A 85  
B 1 2 N TYR A 280 ? N TYR A 280 O PHE A 307 ? O PHE A 307 
B 2 3 N PHE A 310 ? N PHE A 310 O GLY A 321 ? O GLY A 321 
B 3 4 O CYS A 326 ? O CYS A 326 N ALA A 251 ? N ALA A 251 
B 4 5 N ALA A 256 ? N ALA A 256 O ALA A 421 ? O ALA A 421 
B 5 6 O GLY A 424 ? O GLY A 424 N ILE A 241 ? N ILE A 241 
B 6 7 N GLN A 240 ? N GLN A 240 O SER G 17  ? O SER G 17  
B 7 8 O TYR G 16  ? O TYR G 16  N LYS D 234 ? N LYS D 234 
C 1 2 N GLU B 25  ? N GLU B 25  O SER B 37  ? O SER B 37  
C 2 3 N VAL B 34  ? N VAL B 34  O LEU B 206 ? O LEU B 206 
C 3 4 O ILE B 207 ? O ILE B 207 N GLY B 48  ? N GLY B 48  
C 4 5 N SER B 45  ? N SER B 45  O CYS B 111 ? O CYS B 111 
C 5 6 O THR B 108 ? O THR B 108 N SER B 97  ? N SER B 97  
C 6 7 N VAL B 98  ? N VAL B 98  O LEU I 15  ? O LEU I 15  
C 7 8 N VAL I 14  ? N VAL I 14  O VAL I 22  ? O VAL I 22  
D 1 2 N GLU B 246 ? N GLU B 246 O ALA B 426 ? O ALA B 426 
D 2 3 O SER B 427 ? O SER B 427 N HIS B 254 ? N HIS B 254 
D 3 4 N VAL B 253 ? N VAL B 253 O SER B 328 ? O SER B 328 
D 4 5 O LEU B 321 ? O LEU B 321 N ALA B 314 ? N ALA B 314 
E 1 2 N ALA C 23  ? N ALA C 23  O ILE C 218 ? O ILE C 218 
F 1 2 N MET D 43  ? N MET D 43  O PHE D 91  ? O PHE D 91  
G 1 2 N TYR D 148 ? N TYR D 148 O ILE D 158 ? O ILE D 158 
H 1 2 N ILE E 76  ? N ILE E 76  O VAL E 193 ? O VAL E 193 
H 2 3 O ILE E 194 ? O ILE E 194 N GLU E 186 ? N GLU E 186 
I 1 2 N TRP E 91  ? N TRP E 91  O LYS E 94  ? O LYS E 94  
I 2 3 N PHE E 97  ? N PHE E 97  O LEU E 135 ? O LEU E 135 
J 1 2 N ILE E 147 ? N ILE E 147 O TYR E 157 ? O TYR E 157 
J 2 3 N TYR E 156 ? N TYR E 156 O TYR E 165 ? O TYR E 165 
J 3 4 N HIS E 164 ? N HIS E 164 O LYS E 173 ? O LYS E 173 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM C 381' 
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM C 382' 
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE UQ2 C 383' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE UQ2 C 384' 
AC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HEM D 242' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE FES E 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 GLN C 44  ? GLN C 44   . ? 1_555 ? 
2  AC1 18 ILE C 45  ? ILE C 45   . ? 1_555 ? 
3  AC1 18 GLY C 48  ? GLY C 48   . ? 1_555 ? 
4  AC1 18 LEU C 51  ? LEU C 51   . ? 1_555 ? 
5  AC1 18 ARG C 80  ? ARG C 80   . ? 1_555 ? 
6  AC1 18 HIS C 83  ? HIS C 83   . ? 1_555 ? 
7  AC1 18 ALA C 84  ? ALA C 84   . ? 1_555 ? 
8  AC1 18 ALA C 87  ? ALA C 87   . ? 1_555 ? 
9  AC1 18 PHE C 90  ? PHE C 90   . ? 1_555 ? 
10 AC1 18 THR C 126 ? THR C 126  . ? 1_555 ? 
11 AC1 18 GLY C 130 ? GLY C 130  . ? 1_555 ? 
12 AC1 18 TYR C 131 ? TYR C 131  . ? 1_555 ? 
13 AC1 18 LEU C 133 ? LEU C 133  . ? 1_555 ? 
14 AC1 18 PRO C 134 ? PRO C 134  . ? 1_555 ? 
15 AC1 18 PHE C 179 ? PHE C 179  . ? 1_555 ? 
16 AC1 18 HIS C 182 ? HIS C 182  . ? 1_555 ? 
17 AC1 18 PHE C 183 ? PHE C 183  . ? 1_555 ? 
18 AC1 18 PRO C 186 ? PRO C 186  . ? 1_555 ? 
19 AC2 18 TRP C 31  ? TRP C 31   . ? 1_555 ? 
20 AC2 18 GLY C 34  ? GLY C 34   . ? 1_555 ? 
21 AC2 18 LEU C 37  ? LEU C 37   . ? 1_555 ? 
22 AC2 18 HIS C 97  ? HIS C 97   . ? 1_555 ? 
23 AC2 18 VAL C 98  ? VAL C 98   . ? 1_555 ? 
24 AC2 18 ARG C 100 ? ARG C 100  . ? 1_555 ? 
25 AC2 18 SER C 106 ? SER C 106  . ? 1_555 ? 
26 AC2 18 TRP C 113 ? TRP C 113  . ? 1_555 ? 
27 AC2 18 GLY C 116 ? GLY C 116  . ? 1_555 ? 
28 AC2 18 VAL C 117 ? VAL C 117  . ? 1_555 ? 
29 AC2 18 LEU C 119 ? LEU C 119  . ? 1_555 ? 
30 AC2 18 HIS C 196 ? HIS C 196  . ? 1_555 ? 
31 AC2 18 LEU C 197 ? LEU C 197  . ? 1_555 ? 
32 AC2 18 LEU C 200 ? LEU C 200  . ? 1_555 ? 
33 AC2 18 SER C 205 ? SER C 205  . ? 1_555 ? 
34 AC2 18 ASN C 206 ? ASN C 206  . ? 1_555 ? 
35 AC2 18 UQ2 O .   ? UQ2 C 384  . ? 1_555 ? 
36 AC2 18 HOH T .   ? HOH C 1012 . ? 1_555 ? 
37 AC3 11 LEU C 121 ? LEU C 121  . ? 1_555 ? 
38 AC3 11 MET C 124 ? MET C 124  . ? 1_555 ? 
39 AC3 11 GLY C 142 ? GLY C 142  . ? 1_555 ? 
40 AC3 11 VAL C 145 ? VAL C 145  . ? 1_555 ? 
41 AC3 11 ILE C 146 ? ILE C 146  . ? 1_555 ? 
42 AC3 11 LYS C 269 ? LYS C 269  . ? 1_555 ? 
43 AC3 11 PRO C 270 ? PRO C 270  . ? 1_555 ? 
44 AC3 11 PHE C 274 ? PHE C 274  . ? 1_555 ? 
45 AC3 11 TYR C 278 ? TYR C 278  . ? 1_555 ? 
46 AC3 11 LEU C 281 ? LEU C 281  . ? 1_555 ? 
47 AC3 11 HOH T .   ? HOH C 1069 . ? 1_555 ? 
48 AC4 12 PHE C 18  ? PHE C 18   . ? 1_555 ? 
49 AC4 12 ALA C 23  ? ALA C 23   . ? 1_555 ? 
50 AC4 12 ILE C 27  ? ILE C 27   . ? 1_555 ? 
51 AC4 12 TRP C 31  ? TRP C 31   . ? 1_555 ? 
52 AC4 12 LEU C 197 ? LEU C 197  . ? 1_555 ? 
53 AC4 12 LEU C 200 ? LEU C 200  . ? 1_555 ? 
54 AC4 12 SER C 205 ? SER C 205  . ? 1_555 ? 
55 AC4 12 PHE C 220 ? PHE C 220  . ? 1_555 ? 
56 AC4 12 ASP C 228 ? ASP C 228  . ? 1_555 ? 
57 AC4 12 HEM M .   ? HEM C 382  . ? 1_555 ? 
58 AC4 12 HOH T .   ? HOH C 1003 . ? 1_555 ? 
59 AC4 12 HOH T .   ? HOH C 1010 . ? 1_555 ? 
60 AC5 13 CYS D 37  ? CYS D 37   . ? 1_555 ? 
61 AC5 13 CYS D 40  ? CYS D 40   . ? 1_555 ? 
62 AC5 13 HIS D 41  ? HIS D 41   . ? 1_555 ? 
63 AC5 13 ASN D 105 ? ASN D 105  . ? 1_555 ? 
64 AC5 13 LEU D 109 ? LEU D 109  . ? 1_555 ? 
65 AC5 13 PRO D 110 ? PRO D 110  . ? 1_555 ? 
66 AC5 13 PRO D 111 ? PRO D 111  . ? 1_555 ? 
67 AC5 13 ARG D 120 ? ARG D 120  . ? 1_555 ? 
68 AC5 13 TYR D 126 ? TYR D 126  . ? 1_555 ? 
69 AC5 13 LEU D 131 ? LEU D 131  . ? 1_555 ? 
70 AC5 13 PHE D 153 ? PHE D 153  . ? 1_555 ? 
71 AC5 13 GLY D 159 ? GLY D 159  . ? 1_555 ? 
72 AC5 13 MET D 160 ? MET D 160  . ? 1_555 ? 
73 AC6 7  CYS E 139 ? CYS E 139  . ? 1_555 ? 
74 AC6 7  HIS E 141 ? HIS E 141  . ? 1_555 ? 
75 AC6 7  LEU E 142 ? LEU E 142  . ? 1_555 ? 
76 AC6 7  CYS E 144 ? CYS E 144  . ? 1_555 ? 
77 AC6 7  CYS E 158 ? CYS E 158  . ? 1_555 ? 
78 AC6 7  HIS E 161 ? HIS E 161  . ? 1_555 ? 
79 AC6 7  SER E 163 ? SER E 163  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1NTZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NTZ 
_atom_sites.fract_transf_matrix[1][1]   0.006501 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006501 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001676 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . THR A  1  1   ? 50.765 125.522 95.853  1.00 43.22  ? 1    THR A N   1 
ATOM   2     C  CA  . THR A  1  1   ? 50.681 124.024 95.929  1.00 43.37  ? 1    THR A CA  1 
ATOM   3     C  C   . THR A  1  1   ? 49.697 123.623 97.055  1.00 42.80  ? 1    THR A C   1 
ATOM   4     O  O   . THR A  1  1   ? 49.756 124.164 98.170  1.00 43.23  ? 1    THR A O   1 
ATOM   5     C  CB  . THR A  1  1   ? 52.131 123.390 96.172  1.00 43.77  ? 1    THR A CB  1 
ATOM   6     O  OG1 . THR A  1  1   ? 53.054 123.873 95.180  1.00 48.12  ? 1    THR A OG1 1 
ATOM   7     C  CG2 . THR A  1  1   ? 52.122 121.880 95.921  1.00 46.77  ? 1    THR A CG2 1 
ATOM   8     N  N   . ALA A  1  2   ? 48.786 122.700 96.744  1.00 41.62  ? 2    ALA A N   1 
ATOM   9     C  CA  . ALA A  1  2   ? 47.777 122.223 97.705  1.00 40.08  ? 2    ALA A CA  1 
ATOM   10    C  C   . ALA A  1  2   ? 48.383 121.487 98.888  1.00 38.68  ? 2    ALA A C   1 
ATOM   11    O  O   . ALA A  1  2   ? 49.442 120.885 98.772  1.00 38.99  ? 2    ALA A O   1 
ATOM   12    C  CB  . ALA A  1  2   ? 46.786 121.322 97.000  1.00 39.83  ? 2    ALA A CB  1 
ATOM   13    N  N   . THR A  1  3   ? 47.717 121.546 100.035 1.00 37.15  ? 3    THR A N   1 
ATOM   14    C  CA  . THR A  1  3   ? 48.197 120.806 101.203 1.00 35.93  ? 3    THR A CA  1 
ATOM   15    C  C   . THR A  1  3   ? 47.615 119.392 101.172 1.00 34.36  ? 3    THR A C   1 
ATOM   16    O  O   . THR A  1  3   ? 46.726 119.102 100.361 1.00 33.56  ? 3    THR A O   1 
ATOM   17    C  CB  . THR A  1  3   ? 47.748 121.467 102.498 1.00 36.13  ? 3    THR A CB  1 
ATOM   18    O  OG1 . THR A  1  3   ? 46.399 121.060 102.797 1.00 40.53  ? 3    THR A OG1 1 
ATOM   19    C  CG2 . THR A  1  3   ? 47.685 122.995 102.360 1.00 36.94  ? 3    THR A CG2 1 
ATOM   20    N  N   . TYR A  1  4   ? 48.124 118.522 102.060 1.00 33.78  ? 4    TYR A N   1 
ATOM   21    C  CA  . TYR A  1  4   ? 47.607 117.144 102.211 1.00 33.52  ? 4    TYR A CA  1 
ATOM   22    C  C   . TYR A  1  4   ? 46.139 117.209 102.570 1.00 33.69  ? 4    TYR A C   1 
ATOM   23    O  O   . TYR A  1  4   ? 45.295 116.592 101.918 1.00 33.29  ? 4    TYR A O   1 
ATOM   24    C  CB  . TYR A  1  4   ? 48.350 116.409 103.329 1.00 33.26  ? 4    TYR A CB  1 
ATOM   25    C  CG  . TYR A  1  4   ? 47.572 115.270 103.942 1.00 30.21  ? 4    TYR A CG  1 
ATOM   26    C  CD1 . TYR A  1  4   ? 47.387 114.062 103.247 1.00 27.26  ? 4    TYR A CD1 1 
ATOM   27    C  CD2 . TYR A  1  4   ? 47.037 115.382 105.229 1.00 31.40  ? 4    TYR A CD2 1 
ATOM   28    C  CE1 . TYR A  1  4   ? 46.686 113.018 103.813 1.00 27.35  ? 4    TYR A CE1 1 
ATOM   29    C  CE2 . TYR A  1  4   ? 46.320 114.341 105.806 1.00 27.67  ? 4    TYR A CE2 1 
ATOM   30    C  CZ  . TYR A  1  4   ? 46.148 113.165 105.102 1.00 29.02  ? 4    TYR A CZ  1 
ATOM   31    O  OH  . TYR A  1  4   ? 45.430 112.141 105.674 1.00 24.87  ? 4    TYR A OH  1 
ATOM   32    N  N   . ALA A  1  5   ? 45.853 117.987 103.611 1.00 34.33  ? 5    ALA A N   1 
ATOM   33    C  CA  . ALA A  1  5   ? 44.514 118.194 104.092 1.00 34.65  ? 5    ALA A CA  1 
ATOM   34    C  C   . ALA A  1  5   ? 43.580 118.635 102.966 1.00 34.65  ? 5    ALA A C   1 
ATOM   35    O  O   . ALA A  1  5   ? 42.508 118.079 102.804 1.00 35.02  ? 5    ALA A O   1 
ATOM   36    C  CB  . ALA A  1  5   ? 44.527 119.215 105.200 1.00 34.94  ? 5    ALA A CB  1 
ATOM   37    N  N   . GLN A  1  6   ? 44.015 119.603 102.168 1.00 34.38  ? 6    GLN A N   1 
ATOM   38    C  CA  . GLN A  1  6   ? 43.211 120.085 101.064 1.00 34.86  ? 6    GLN A CA  1 
ATOM   39    C  C   . GLN A  1  6   ? 42.970 119.021 100.009 1.00 35.56  ? 6    GLN A C   1 
ATOM   40    O  O   . GLN A  1  6   ? 41.902 118.976 99.404  1.00 35.55  ? 6    GLN A O   1 
ATOM   41    C  CB  . GLN A  1  6   ? 43.873 121.280 100.391 1.00 34.95  ? 6    GLN A CB  1 
ATOM   42    C  CG  . GLN A  1  6   ? 43.819 122.579 101.161 1.00 43.78  ? 6    GLN A CG  1 
ATOM   43    C  CD  . GLN A  1  6   ? 44.387 123.729 100.343 1.00 48.23  ? 6    GLN A CD  1 
ATOM   44    O  OE1 . GLN A  1  6   ? 45.525 123.664 99.887  1.00 51.16  ? 6    GLN A OE1 1 
ATOM   45    N  NE2 . GLN A  1  6   ? 43.579 124.749 100.111 1.00 44.06  ? 6    GLN A NE2 1 
ATOM   46    N  N   . ALA A  1  7   ? 43.966 118.159 99.787  1.00 36.17  ? 7    ALA A N   1 
ATOM   47    C  CA  . ALA A  1  7   ? 43.869 117.131 98.753  1.00 36.39  ? 7    ALA A CA  1 
ATOM   48    C  C   . ALA A  1  7   ? 42.805 116.088 99.047  1.00 37.04  ? 7    ALA A C   1 
ATOM   49    O  O   . ALA A  1  7   ? 42.176 115.529 98.110  1.00 37.15  ? 7    ALA A O   1 
ATOM   50    C  CB  . ALA A  1  7   ? 45.211 116.488 98.507  1.00 36.35  ? 7    ALA A CB  1 
ATOM   51    N  N   . LEU A  1  8   ? 42.577 115.840 100.339 1.00 37.23  ? 8    LEU A N   1 
ATOM   52    C  CA  . LEU A  1  8   ? 41.556 114.899 100.775 1.00 37.21  ? 8    LEU A CA  1 
ATOM   53    C  C   . LEU A  1  8   ? 40.178 115.387 100.371 1.00 38.06  ? 8    LEU A C   1 
ATOM   54    O  O   . LEU A  1  8   ? 39.295 114.582 100.055 1.00 38.01  ? 8    LEU A O   1 
ATOM   55    C  CB  . LEU A  1  8   ? 41.598 114.727 102.278 1.00 36.65  ? 8    LEU A CB  1 
ATOM   56    C  CG  . LEU A  1  8   ? 42.810 114.010 102.802 1.00 33.25  ? 8    LEU A CG  1 
ATOM   57    C  CD1 . LEU A  1  8   ? 42.673 113.791 104.255 1.00 32.36  ? 8    LEU A CD1 1 
ATOM   58    C  CD2 . LEU A  1  8   ? 42.949 112.695 102.100 1.00 34.70  ? 8    LEU A CD2 1 
ATOM   59    N  N   . GLN A  1  9   ? 39.983 116.712 100.386 1.00 38.80  ? 9    GLN A N   1 
ATOM   60    C  CA  . GLN A  1  9   ? 38.698 117.267 99.999  1.00 39.75  ? 9    GLN A CA  1 
ATOM   61    C  C   . GLN A  1  9   ? 38.433 117.199 98.508  1.00 40.43  ? 9    GLN A C   1 
ATOM   62    O  O   . GLN A  1  9   ? 37.276 117.082 98.088  1.00 40.21  ? 9    GLN A O   1 
ATOM   63    C  CB  . GLN A  1  9   ? 38.495 118.666 100.545 1.00 39.98  ? 9    GLN A CB  1 
ATOM   64    C  CG  . GLN A  1  9   ? 37.934 118.675 101.947 1.00 49.63  ? 9    GLN A CG  1 
ATOM   65    C  CD  . GLN A  1  9   ? 37.824 120.068 102.511 1.00 62.64  ? 9    GLN A CD  1 
ATOM   66    O  OE1 . GLN A  1  9   ? 38.584 120.437 103.413 1.00 66.74  ? 9    GLN A OE1 1 
ATOM   67    N  NE2 . GLN A  1  9   ? 36.883 120.864 101.978 1.00 66.53  ? 9    GLN A NE2 1 
ATOM   68    N  N   . SER A  1  10  ? 39.515 117.178 97.716  1.00 41.39  ? 10   SER A N   1 
ATOM   69    C  CA  . SER A  1  10  ? 39.425 117.139 96.241  1.00 41.75  ? 10   SER A CA  1 
ATOM   70    C  C   . SER A  1  10  ? 38.939 115.788 95.674  1.00 41.62  ? 10   SER A C   1 
ATOM   71    O  O   . SER A  1  10  ? 38.490 115.735 94.533  1.00 42.08  ? 10   SER A O   1 
ATOM   72    C  CB  . SER A  1  10  ? 40.767 117.502 95.601  1.00 41.85  ? 10   SER A CB  1 
ATOM   73    O  OG  . SER A  1  10  ? 41.557 116.319 95.427  1.00 53.52  ? 10   SER A OG  1 
ATOM   74    N  N   . VAL A  1  11  ? 39.052 114.711 96.457  1.00 41.02  ? 11   VAL A N   1 
ATOM   75    C  CA  . VAL A  1  11  ? 38.601 113.381 96.011  1.00 40.83  ? 11   VAL A CA  1 
ATOM   76    C  C   . VAL A  1  11  ? 37.110 113.360 95.800  1.00 40.84  ? 11   VAL A C   1 
ATOM   77    O  O   . VAL A  1  11  ? 36.365 113.497 96.753  1.00 40.50  ? 11   VAL A O   1 
ATOM   78    C  CB  . VAL A  1  11  ? 38.896 112.302 97.057  1.00 40.97  ? 11   VAL A CB  1 
ATOM   79    C  CG1 . VAL A  1  11  ? 38.559 110.912 96.489  1.00 33.50  ? 11   VAL A CG1 1 
ATOM   80    C  CG2 . VAL A  1  11  ? 40.356 112.363 97.515  1.00 39.39  ? 11   VAL A CG2 1 
ATOM   81    N  N   . PRO A  1  12  ? 36.679 113.107 94.561  1.00 41.65  ? 12   PRO A N   1 
ATOM   82    C  CA  . PRO A  1  12  ? 35.245 113.101 94.200  1.00 42.05  ? 12   PRO A CA  1 
ATOM   83    C  C   . PRO A  1  12  ? 34.422 112.188 95.076  1.00 42.24  ? 12   PRO A C   1 
ATOM   84    O  O   . PRO A  1  12  ? 34.817 111.053 95.345  1.00 42.64  ? 12   PRO A O   1 
ATOM   85    C  CB  . PRO A  1  12  ? 35.238 112.562 92.757  1.00 41.97  ? 12   PRO A CB  1 
ATOM   86    C  CG  . PRO A  1  12  ? 36.573 112.853 92.236  1.00 46.06  ? 12   PRO A CG  1 
ATOM   87    C  CD  . PRO A  1  12  ? 37.530 112.746 93.418  1.00 42.08  ? 12   PRO A CD  1 
ATOM   88    N  N   . GLU A  1  13  ? 33.296 112.699 95.533  1.00 41.94  ? 13   GLU A N   1 
ATOM   89    C  CA  . GLU A  1  13  ? 32.400 111.961 96.391  1.00 41.65  ? 13   GLU A CA  1 
ATOM   90    C  C   . GLU A  1  13  ? 31.887 110.749 95.648  1.00 41.05  ? 13   GLU A C   1 
ATOM   91    O  O   . GLU A  1  13  ? 31.524 110.838 94.470  1.00 41.11  ? 13   GLU A O   1 
ATOM   92    C  CB  . GLU A  1  13  ? 31.246 112.868 96.797  1.00 41.75  ? 13   GLU A CB  1 
ATOM   93    C  CG  . GLU A  1  13  ? 30.203 112.246 97.680  1.00 45.28  ? 13   GLU A CG  1 
ATOM   94    C  CD  . GLU A  1  13  ? 28.964 113.137 97.785  1.00 54.49  ? 13   GLU A CD  1 
ATOM   95    O  OE1 . GLU A  1  13  ? 28.309 113.380 96.740  1.00 52.51  ? 13   GLU A OE1 1 
ATOM   96    O  OE2 . GLU A  1  13  ? 28.657 113.621 98.900  1.00 57.54  ? 13   GLU A OE2 1 
ATOM   97    N  N   . THR A  1  14  ? 31.949 109.600 96.309  1.00 40.28  ? 14   THR A N   1 
ATOM   98    C  CA  . THR A  1  14  ? 31.464 108.361 95.735  1.00 39.26  ? 14   THR A CA  1 
ATOM   99    C  C   . THR A  1  14  ? 29.948 108.414 95.632  1.00 38.17  ? 14   THR A C   1 
ATOM   100   O  O   . THR A  1  14  ? 29.254 108.592 96.627  1.00 37.42  ? 14   THR A O   1 
ATOM   101   C  CB  . THR A  1  14  ? 31.878 107.199 96.600  1.00 39.29  ? 14   THR A CB  1 
ATOM   102   O  OG1 . THR A  1  14  ? 33.304 107.131 96.650  1.00 46.77  ? 14   THR A OG1 1 
ATOM   103   C  CG2 . THR A  1  14  ? 31.478 105.879 95.965  1.00 36.11  ? 14   THR A CG2 1 
ATOM   104   N  N   . GLN A  1  15  ? 29.448 108.260 94.419  1.00 38.11  ? 15   GLN A N   1 
ATOM   105   C  CA  . GLN A  1  15  ? 28.029 108.318 94.177  1.00 38.27  ? 15   GLN A CA  1 
ATOM   106   C  C   . GLN A  1  15  ? 27.302 106.992 94.397  1.00 38.31  ? 15   GLN A C   1 
ATOM   107   O  O   . GLN A  1  15  ? 27.648 105.978 93.809  1.00 37.68  ? 15   GLN A O   1 
ATOM   108   C  CB  . GLN A  1  15  ? 27.754 108.885 92.806  1.00 38.24  ? 15   GLN A CB  1 
ATOM   109   C  CG  . GLN A  1  15  ? 28.408 110.224 92.599  1.00 42.01  ? 15   GLN A CG  1 
ATOM   110   C  CD  . GLN A  1  15  ? 27.417 111.259 92.168  1.00 48.33  ? 15   GLN A CD  1 
ATOM   111   O  OE1 . GLN A  1  15  ? 27.287 111.552 90.970  1.00 54.59  ? 15   GLN A OE1 1 
ATOM   112   N  NE2 . GLN A  1  15  ? 26.677 111.802 93.131  1.00 39.25  ? 15   GLN A NE2 1 
ATOM   113   N  N   . VAL A  1  16  ? 26.297 107.029 95.278  1.00 38.85  ? 16   VAL A N   1 
ATOM   114   C  CA  . VAL A  1  16  ? 25.522 105.856 95.646  1.00 39.15  ? 16   VAL A CA  1 
ATOM   115   C  C   . VAL A  1  16  ? 24.085 105.990 95.179  1.00 40.13  ? 16   VAL A C   1 
ATOM   116   O  O   . VAL A  1  16  ? 23.443 107.040 95.354  1.00 40.29  ? 16   VAL A O   1 
ATOM   117   C  CB  . VAL A  1  16  ? 25.512 105.656 97.167  1.00 38.89  ? 16   VAL A CB  1 
ATOM   118   C  CG1 . VAL A  1  16  ? 25.126 104.229 97.508  1.00 37.51  ? 16   VAL A CG1 1 
ATOM   119   C  CG2 . VAL A  1  16  ? 26.878 106.000 97.770  1.00 34.85  ? 16   VAL A CG2 1 
ATOM   120   N  N   . SER A  1  17  ? 23.568 104.917 94.610  1.00 40.92  ? 17   SER A N   1 
ATOM   121   C  CA  . SER A  1  17  ? 22.213 104.902 94.107  1.00 41.57  ? 17   SER A CA  1 
ATOM   122   C  C   . SER A  1  17  ? 21.599 103.478 94.234  1.00 42.45  ? 17   SER A C   1 
ATOM   123   O  O   . SER A  1  17  ? 22.300 102.490 94.061  1.00 42.71  ? 17   SER A O   1 
ATOM   124   C  CB  . SER A  1  17  ? 22.214 105.398 92.664  1.00 41.33  ? 17   SER A CB  1 
ATOM   125   O  OG  . SER A  1  17  ? 21.144 104.874 91.937  1.00 49.00  ? 17   SER A OG  1 
ATOM   126   N  N   . GLN A  1  18  ? 20.302 103.387 94.579  1.00 43.10  ? 18   GLN A N   1 
ATOM   127   C  CA  . GLN A  1  18  ? 19.626 102.069 94.747  1.00 43.55  ? 18   GLN A CA  1 
ATOM   128   C  C   . GLN A  1  18  ? 18.605 101.705 93.649  1.00 43.68  ? 18   GLN A C   1 
ATOM   129   O  O   . GLN A  1  18  ? 17.817 102.545 93.198  1.00 43.76  ? 18   GLN A O   1 
ATOM   130   C  CB  . GLN A  1  18  ? 18.964 101.962 96.126  1.00 43.74  ? 18   GLN A CB  1 
ATOM   131   C  CG  . GLN A  1  18  ? 18.818 100.533 96.634  1.00 50.54  ? 18   GLN A CG  1 
ATOM   132   C  CD  . GLN A  1  18  ? 18.866 100.450 98.138  1.00 55.66  ? 18   GLN A CD  1 
ATOM   133   O  OE1 . GLN A  1  18  ? 19.133 99.386  98.701  1.00 56.74  ? 18   GLN A OE1 1 
ATOM   134   N  NE2 . GLN A  1  18  ? 18.619 101.574 98.799  1.00 60.61  ? 18   GLN A NE2 1 
ATOM   135   N  N   . LEU A  1  19  ? 18.621 100.434 93.257  1.00 43.76  ? 19   LEU A N   1 
ATOM   136   C  CA  . LEU A  1  19  ? 17.719 99.887  92.234  1.00 43.70  ? 19   LEU A CA  1 
ATOM   137   C  C   . LEU A  1  19  ? 16.459 99.398  92.944  1.00 43.52  ? 19   LEU A C   1 
ATOM   138   O  O   . LEU A  1  19  ? 16.452 99.290  94.168  1.00 43.62  ? 19   LEU A O   1 
ATOM   139   C  CB  . LEU A  1  19  ? 18.403 98.672  91.595  1.00 43.79  ? 19   LEU A CB  1 
ATOM   140   C  CG  . LEU A  1  19  ? 18.478 98.525  90.086  1.00 43.28  ? 19   LEU A CG  1 
ATOM   141   C  CD1 . LEU A  1  19  ? 19.210 99.706  89.494  1.00 36.24  ? 19   LEU A CD1 1 
ATOM   142   C  CD2 . LEU A  1  19  ? 19.202 97.244  89.757  1.00 41.81  ? 19   LEU A CD2 1 
ATOM   143   N  N   . ASP A  1  20  ? 15.388 99.117  92.188  1.00 43.36  ? 20   ASP A N   1 
ATOM   144   C  CA  . ASP A  1  20  ? 14.148 98.541  92.782  1.00 43.18  ? 20   ASP A CA  1 
ATOM   145   C  C   . ASP A  1  20  ? 14.415 97.034  92.839  1.00 43.01  ? 20   ASP A C   1 
ATOM   146   O  O   . ASP A  1  20  ? 13.966 96.279  92.003  1.00 43.01  ? 20   ASP A O   1 
ATOM   147   C  CB  . ASP A  1  20  ? 12.927 98.846  91.905  1.00 43.29  ? 20   ASP A CB  1 
ATOM   148   C  CG  . ASP A  1  20  ? 12.675 100.347 91.749  1.00 48.89  ? 20   ASP A CG  1 
ATOM   149   O  OD1 . ASP A  1  20  ? 12.833 101.082 92.747  1.00 52.86  ? 20   ASP A OD1 1 
ATOM   150   O  OD2 . ASP A  1  20  ? 12.319 100.879 90.671  1.00 49.32  ? 20   ASP A OD2 1 
ATOM   151   N  N   . ASN A  1  21  ? 15.184 96.636  93.837  1.00 43.00  ? 21   ASN A N   1 
ATOM   152   C  CA  . ASN A  1  21  ? 15.696 95.289  93.970  1.00 42.70  ? 21   ASN A CA  1 
ATOM   153   C  C   . ASN A  1  21  ? 16.273 95.188  95.343  1.00 41.94  ? 21   ASN A C   1 
ATOM   154   O  O   . ASN A  1  21  ? 15.869 94.383  96.167  1.00 42.02  ? 21   ASN A O   1 
ATOM   155   C  CB  . ASN A  1  21  ? 16.924 95.146  93.038  1.00 43.08  ? 21   ASN A CB  1 
ATOM   156   C  CG  . ASN A  1  21  ? 16.598 94.562  91.712  1.00 52.22  ? 21   ASN A CG  1 
ATOM   157   O  OD1 . ASN A  1  21  ? 16.585 93.343  91.547  1.00 56.24  ? 21   ASN A OD1 1 
ATOM   158   N  ND2 . ASN A  1  21  ? 16.405 95.419  90.723  1.00 56.00  ? 21   ASN A ND2 1 
ATOM   159   N  N   . GLY A  1  22  ? 17.265 96.033  95.559  1.00 41.23  ? 22   GLY A N   1 
ATOM   160   C  CA  . GLY A  1  22  ? 18.040 96.064  96.772  1.00 40.35  ? 22   GLY A CA  1 
ATOM   161   C  C   . GLY A  1  22  ? 19.481 96.156  96.299  1.00 39.27  ? 22   GLY A C   1 
ATOM   162   O  O   . GLY A  1  22  ? 20.423 96.313  97.097  1.00 39.72  ? 22   GLY A O   1 
ATOM   163   N  N   . LEU A  1  23  ? 19.652 96.048  94.981  1.00 37.62  ? 23   LEU A N   1 
ATOM   164   C  CA  . LEU A  1  23  ? 20.965 96.153  94.376  1.00 36.28  ? 23   LEU A CA  1 
ATOM   165   C  C   . LEU A  1  23  ? 21.436 97.603  94.497  1.00 34.95  ? 23   LEU A C   1 
ATOM   166   O  O   . LEU A  1  23  ? 20.819 98.523  93.939  1.00 34.64  ? 23   LEU A O   1 
ATOM   167   C  CB  . LEU A  1  23  ? 20.913 95.766  92.875  1.00 36.07  ? 23   LEU A CB  1 
ATOM   168   C  CG  . LEU A  1  23  ? 22.085 95.002  92.181  1.00 27.57  ? 23   LEU A CG  1 
ATOM   169   C  CD1 . LEU A  1  23  ? 22.524 95.721  90.930  1.00 18.80  ? 23   LEU A CD1 1 
ATOM   170   C  CD2 . LEU A  1  23  ? 23.261 94.820  93.059  1.00 28.28  ? 23   LEU A CD2 1 
ATOM   171   N  N   . ARG A  1  24  ? 22.480 97.815  95.271  1.00 33.84  ? 24   ARG A N   1 
ATOM   172   C  CA  . ARG A  1  24  ? 23.049 99.140  95.369  1.00 33.24  ? 24   ARG A CA  1 
ATOM   173   C  C   . ARG A  1  24  ? 24.065 99.317  94.237  1.00 32.92  ? 24   ARG A C   1 
ATOM   174   O  O   . ARG A  1  24  ? 24.816 98.398  93.923  1.00 33.31  ? 24   ARG A O   1 
ATOM   175   C  CB  . ARG A  1  24  ? 23.698 99.368  96.738  1.00 32.85  ? 24   ARG A CB  1 
ATOM   176   C  CG  . ARG A  1  24  ? 22.736 99.916  97.782  1.00 32.67  ? 24   ARG A CG  1 
ATOM   177   C  CD  . ARG A  1  24  ? 23.162 99.663  99.200  1.00 35.49  ? 24   ARG A CD  1 
ATOM   178   N  NE  . ARG A  1  24  ? 23.146 98.235  99.503  1.00 36.11  ? 24   ARG A NE  1 
ATOM   179   C  CZ  . ARG A  1  24  ? 23.912 97.654  100.410 1.00 32.34  ? 24   ARG A CZ  1 
ATOM   180   N  NH1 . ARG A  1  24  ? 24.786 98.375  101.108 1.00 27.76  ? 24   ARG A NH1 1 
ATOM   181   N  NH2 . ARG A  1  24  ? 23.805 96.347  100.625 1.00 30.68  ? 24   ARG A NH2 1 
ATOM   182   N  N   . VAL A  1  25  ? 24.039 100.463 93.579  1.00 31.93  ? 25   VAL A N   1 
ATOM   183   C  CA  . VAL A  1  25  ? 24.990 100.720 92.529  1.00 31.21  ? 25   VAL A CA  1 
ATOM   184   C  C   . VAL A  1  25  ? 25.813 101.957 92.844  1.00 30.58  ? 25   VAL A C   1 
ATOM   185   O  O   . VAL A  1  25  ? 25.304 103.078 92.894  1.00 30.14  ? 25   VAL A O   1 
ATOM   186   C  CB  . VAL A  1  25  ? 24.334 100.722 91.110  1.00 31.29  ? 25   VAL A CB  1 
ATOM   187   C  CG1 . VAL A  1  25  ? 22.980 101.254 91.159  1.00 34.40  ? 25   VAL A CG1 1 
ATOM   188   C  CG2 . VAL A  1  25  ? 25.190 101.464 90.075  1.00 28.40  ? 25   VAL A CG2 1 
ATOM   189   N  N   . ALA A  1  26  ? 27.085 101.739 93.122  1.00 30.52  ? 26   ALA A N   1 
ATOM   190   C  CA  . ALA A  1  26  ? 27.953 102.841 93.484  1.00 30.39  ? 26   ALA A CA  1 
ATOM   191   C  C   . ALA A  1  26  ? 29.216 102.988 92.621  1.00 30.22  ? 26   ALA A C   1 
ATOM   192   O  O   . ALA A  1  26  ? 29.774 102.000 92.121  1.00 29.55  ? 26   ALA A O   1 
ATOM   193   C  CB  . ALA A  1  26  ? 28.279 102.808 94.972  1.00 30.06  ? 26   ALA A CB  1 
ATOM   194   N  N   . SER A  1  27  ? 29.650 104.240 92.459  1.00 30.90  ? 27   SER A N   1 
ATOM   195   C  CA  . SER A  1  27  ? 30.805 104.580 91.619  1.00 31.39  ? 27   SER A CA  1 
ATOM   196   C  C   . SER A  1  27  ? 31.557 105.791 92.077  1.00 31.41  ? 27   SER A C   1 
ATOM   197   O  O   . SER A  1  27  ? 30.985 106.724 92.644  1.00 31.12  ? 27   SER A O   1 
ATOM   198   C  CB  . SER A  1  27  ? 30.334 104.891 90.200  1.00 31.74  ? 27   SER A CB  1 
ATOM   199   O  OG  . SER A  1  27  ? 29.609 106.121 90.169  1.00 30.08  ? 27   SER A OG  1 
ATOM   200   N  N   . GLU A  1  28  ? 32.845 105.797 91.768  1.00 31.92  ? 28   GLU A N   1 
ATOM   201   C  CA  . GLU A  1  28  ? 33.709 106.950 92.013  1.00 32.03  ? 28   GLU A CA  1 
ATOM   202   C  C   . GLU A  1  28  ? 34.333 107.311 90.671  1.00 32.24  ? 28   GLU A C   1 
ATOM   203   O  O   . GLU A  1  28  ? 35.218 106.612 90.180  1.00 31.78  ? 28   GLU A O   1 
ATOM   204   C  CB  . GLU A  1  28  ? 34.809 106.633 93.013  1.00 31.91  ? 28   GLU A CB  1 
ATOM   205   C  CG  . GLU A  1  28  ? 35.626 107.859 93.363  1.00 30.74  ? 28   GLU A CG  1 
ATOM   206   C  CD  . GLU A  1  28  ? 37.019 107.523 93.792  1.00 38.37  ? 28   GLU A CD  1 
ATOM   207   O  OE1 . GLU A  1  28  ? 37.934 107.546 92.922  1.00 47.53  ? 28   GLU A OE1 1 
ATOM   208   O  OE2 . GLU A  1  28  ? 37.216 107.261 94.996  1.00 36.57  ? 28   GLU A OE2 1 
ATOM   209   N  N   . GLN A  1  29  ? 33.857 108.388 90.068  1.00 33.16  ? 29   GLN A N   1 
ATOM   210   C  CA  . GLN A  1  29  ? 34.354 108.788 88.773  1.00 33.85  ? 29   GLN A CA  1 
ATOM   211   C  C   . GLN A  1  29  ? 35.688 109.489 88.850  1.00 35.16  ? 29   GLN A C   1 
ATOM   212   O  O   . GLN A  1  29  ? 35.867 110.383 89.645  1.00 35.47  ? 29   GLN A O   1 
ATOM   213   C  CB  . GLN A  1  29  ? 33.360 109.676 88.076  1.00 33.45  ? 29   GLN A CB  1 
ATOM   214   C  CG  . GLN A  1  29  ? 33.893 110.240 86.795  1.00 32.33  ? 29   GLN A CG  1 
ATOM   215   C  CD  . GLN A  1  29  ? 32.913 111.115 86.085  1.00 32.22  ? 29   GLN A CD  1 
ATOM   216   O  OE1 . GLN A  1  29  ? 31.833 111.382 86.591  1.00 33.84  ? 29   GLN A OE1 1 
ATOM   217   N  NE2 . GLN A  1  29  ? 33.271 111.550 84.901  1.00 39.56  ? 29   GLN A NE2 1 
ATOM   218   N  N   . SER A  1  30  ? 36.640 109.042 88.039  1.00 36.13  ? 30   SER A N   1 
ATOM   219   C  CA  . SER A  1  30  ? 37.939 109.693 87.946  1.00 36.66  ? 30   SER A CA  1 
ATOM   220   C  C   . SER A  1  30  ? 38.109 110.071 86.498  1.00 37.35  ? 30   SER A C   1 
ATOM   221   O  O   . SER A  1  30  ? 37.139 110.114 85.751  1.00 37.51  ? 30   SER A O   1 
ATOM   222   C  CB  . SER A  1  30  ? 39.037 108.752 88.337  1.00 36.60  ? 30   SER A CB  1 
ATOM   223   O  OG  . SER A  1  30  ? 39.281 107.843 87.290  1.00 42.87  ? 30   SER A OG  1 
ATOM   224   N  N   . SER A  1  31  ? 39.339 110.299 86.075  1.00 37.90  ? 31   SER A N   1 
ATOM   225   C  CA  . SER A  1  31  ? 39.571 110.707 84.691  1.00 38.53  ? 31   SER A CA  1 
ATOM   226   C  C   . SER A  1  31  ? 40.272 109.622 83.845  1.00 38.44  ? 31   SER A C   1 
ATOM   227   O  O   . SER A  1  31  ? 40.477 109.783 82.643  1.00 38.35  ? 31   SER A O   1 
ATOM   228   C  CB  . SER A  1  31  ? 40.374 112.003 84.666  1.00 39.03  ? 31   SER A CB  1 
ATOM   229   O  OG  . SER A  1  31  ? 40.143 112.691 83.470  1.00 51.31  ? 31   SER A OG  1 
ATOM   230   N  N   . GLN A  1  32  ? 40.614 108.522 84.494  1.00 38.32  ? 32   GLN A N   1 
ATOM   231   C  CA  . GLN A  1  32  ? 41.321 107.410 83.870  1.00 38.06  ? 32   GLN A CA  1 
ATOM   232   C  C   . GLN A  1  32  ? 40.576 106.766 82.664  1.00 37.48  ? 32   GLN A C   1 
ATOM   233   O  O   . GLN A  1  32  ? 39.362 106.748 82.632  1.00 37.50  ? 32   GLN A O   1 
ATOM   234   C  CB  . GLN A  1  32  ? 41.689 106.362 84.969  1.00 37.98  ? 32   GLN A CB  1 
ATOM   235   C  CG  . GLN A  1  32  ? 43.129 106.526 85.538  1.00 49.40  ? 32   GLN A CG  1 
ATOM   236   C  CD  . GLN A  1  32  ? 43.189 106.505 87.074  1.00 62.63  ? 32   GLN A CD  1 
ATOM   237   O  OE1 . GLN A  1  32  ? 43.294 107.558 87.710  1.00 74.01  ? 32   GLN A OE1 1 
ATOM   238   N  NE2 . GLN A  1  32  ? 43.140 105.319 87.660  1.00 68.26  ? 32   GLN A NE2 1 
ATOM   239   N  N   . PRO A  1  33  ? 41.329 106.294 81.656  1.00 37.02  ? 33   PRO A N   1 
ATOM   240   C  CA  . PRO A  1  33  ? 40.730 105.634 80.476  1.00 36.62  ? 33   PRO A CA  1 
ATOM   241   C  C   . PRO A  1  33  ? 40.449 104.171 80.758  1.00 36.45  ? 33   PRO A C   1 
ATOM   242   O  O   . PRO A  1  33  ? 39.929 103.479 79.903  1.00 36.19  ? 33   PRO A O   1 
ATOM   243   C  CB  . PRO A  1  33  ? 41.839 105.728 79.403  1.00 36.03  ? 33   PRO A CB  1 
ATOM   244   C  CG  . PRO A  1  33  ? 42.919 106.527 80.017  1.00 40.93  ? 33   PRO A CG  1 
ATOM   245   C  CD  . PRO A  1  33  ? 42.789 106.414 81.528  1.00 36.85  ? 33   PRO A CD  1 
ATOM   246   N  N   . THR A  1  34  ? 40.839 103.711 81.940  1.00 36.65  ? 34   THR A N   1 
ATOM   247   C  CA  . THR A  1  34  ? 40.621 102.338 82.358  1.00 36.75  ? 34   THR A CA  1 
ATOM   248   C  C   . THR A  1  34  ? 39.661 102.349 83.531  1.00 36.34  ? 34   THR A C   1 
ATOM   249   O  O   . THR A  1  34  ? 39.394 103.405 84.107  1.00 36.49  ? 34   THR A O   1 
ATOM   250   C  CB  . THR A  1  34  ? 41.941 101.695 82.769  1.00 36.83  ? 34   THR A CB  1 
ATOM   251   O  OG1 . THR A  1  34  ? 42.873 101.787 81.689  1.00 41.13  ? 34   THR A OG1 1 
ATOM   252   C  CG2 . THR A  1  34  ? 41.766 100.235 82.883  1.00 54.37  ? 34   THR A CG2 1 
ATOM   253   N  N   . CYS A  1  35  ? 39.108 101.193 83.860  1.00 35.91  ? 35   CYS A N   1 
ATOM   254   C  CA  . CYS A  1  35  ? 38.172 101.101 84.960  1.00 35.59  ? 35   CYS A CA  1 
ATOM   255   C  C   . CYS A  1  35  ? 38.095 99.718  85.541  1.00 34.99  ? 35   CYS A C   1 
ATOM   256   O  O   . CYS A  1  35  ? 38.732 98.769  85.048  1.00 35.13  ? 35   CYS A O   1 
ATOM   257   C  CB  . CYS A  1  35  ? 36.796 101.499 84.500  1.00 35.67  ? 35   CYS A CB  1 
ATOM   258   S  SG  . CYS A  1  35  ? 35.991 100.210 83.564  1.00 38.43  ? 35   CYS A SG  1 
ATOM   259   N  N   . THR A  1  36  ? 37.315 99.597  86.597  1.00 34.39  ? 36   THR A N   1 
ATOM   260   C  CA  . THR A  1  36  ? 37.112 98.322  87.238  1.00 34.39  ? 36   THR A CA  1 
ATOM   261   C  C   . THR A  1  36  ? 35.681 98.241  87.697  1.00 34.81  ? 36   THR A C   1 
ATOM   262   O  O   . THR A  1  36  ? 35.209 99.124  88.398  1.00 35.10  ? 36   THR A O   1 
ATOM   263   C  CB  . THR A  1  36  ? 38.065 98.147  88.408  1.00 34.30  ? 36   THR A CB  1 
ATOM   264   O  OG1 . THR A  1  36  ? 39.408 98.081  87.916  1.00 37.87  ? 36   THR A OG1 1 
ATOM   265   C  CG2 . THR A  1  36  ? 37.863 96.787  89.082  1.00 26.43  ? 36   THR A CG2 1 
ATOM   266   N  N   . VAL A  1  37  ? 34.969 97.215  87.224  1.00 34.78  ? 37   VAL A N   1 
ATOM   267   C  CA  . VAL A  1  37  ? 33.580 96.993  87.596  1.00 34.65  ? 37   VAL A CA  1 
ATOM   268   C  C   . VAL A  1  37  ? 33.483 95.683  88.281  1.00 34.33  ? 37   VAL A C   1 
ATOM   269   O  O   . VAL A  1  37  ? 34.101 94.712  87.865  1.00 33.36  ? 37   VAL A O   1 
ATOM   270   C  CB  . VAL A  1  37  ? 32.694 96.771  86.394  1.00 34.88  ? 37   VAL A CB  1 
ATOM   271   C  CG1 . VAL A  1  37  ? 31.376 97.503  86.571  1.00 27.02  ? 37   VAL A CG1 1 
ATOM   272   C  CG2 . VAL A  1  37  ? 33.390 97.112  85.126  1.00 35.67  ? 37   VAL A CG2 1 
ATOM   273   N  N   . GLY A  1  38  ? 32.600 95.599  89.248  1.00 34.79  ? 38   GLY A N   1 
ATOM   274   C  CA  . GLY A  1  38  ? 32.429 94.359  89.925  1.00 34.93  ? 38   GLY A CA  1 
ATOM   275   C  C   . GLY A  1  38  ? 31.234 94.281  90.790  1.00 35.16  ? 38   GLY A C   1 
ATOM   276   O  O   . GLY A  1  38  ? 30.555 95.281  91.045  1.00 35.12  ? 38   GLY A O   1 
ATOM   277   N  N   . VAL A  1  39  ? 30.976 93.062  91.257  1.00 35.26  ? 39   VAL A N   1 
ATOM   278   C  CA  . VAL A  1  39  ? 29.849 92.768  92.126  1.00 34.65  ? 39   VAL A CA  1 
ATOM   279   C  C   . VAL A  1  39  ? 30.336 92.229  93.456  1.00 34.20  ? 39   VAL A C   1 
ATOM   280   O  O   . VAL A  1  39  ? 31.021 91.213  93.515  1.00 34.13  ? 39   VAL A O   1 
ATOM   281   C  CB  . VAL A  1  39  ? 28.978 91.712  91.515  1.00 34.56  ? 39   VAL A CB  1 
ATOM   282   C  CG1 . VAL A  1  39  ? 27.902 91.330  92.450  1.00 39.16  ? 39   VAL A CG1 1 
ATOM   283   C  CG2 . VAL A  1  39  ? 28.407 92.190  90.203  1.00 40.05  ? 39   VAL A CG2 1 
ATOM   284   N  N   . TRP A  1  40  ? 30.044 92.944  94.518  1.00 34.02  ? 40   TRP A N   1 
ATOM   285   C  CA  . TRP A  1  40  ? 30.394 92.472  95.824  1.00 33.98  ? 40   TRP A CA  1 
ATOM   286   C  C   . TRP A  1  40  ? 29.136 91.849  96.443  1.00 34.41  ? 40   TRP A C   1 
ATOM   287   O  O   . TRP A  1  40  ? 28.028 92.417  96.339  1.00 34.32  ? 40   TRP A O   1 
ATOM   288   C  CB  . TRP A  1  40  ? 31.002 93.593  96.675  1.00 33.61  ? 40   TRP A CB  1 
ATOM   289   C  CG  . TRP A  1  40  ? 32.495 93.668  96.490  1.00 35.96  ? 40   TRP A CG  1 
ATOM   290   C  CD1 . TRP A  1  40  ? 33.453 93.277  97.382  1.00 37.08  ? 40   TRP A CD1 1 
ATOM   291   C  CD2 . TRP A  1  40  ? 33.203 94.092  95.308  1.00 33.83  ? 40   TRP A CD2 1 
ATOM   292   N  NE1 . TRP A  1  40  ? 34.707 93.455  96.837  1.00 40.34  ? 40   TRP A NE1 1 
ATOM   293   C  CE2 . TRP A  1  40  ? 34.578 93.942  95.564  1.00 34.49  ? 40   TRP A CE2 1 
ATOM   294   C  CE3 . TRP A  1  40  ? 32.809 94.592  94.055  1.00 36.85  ? 40   TRP A CE3 1 
ATOM   295   C  CZ2 . TRP A  1  40  ? 35.542 94.241  94.627  1.00 40.13  ? 40   TRP A CZ2 1 
ATOM   296   C  CZ3 . TRP A  1  40  ? 33.773 94.917  93.136  1.00 40.30  ? 40   TRP A CZ3 1 
ATOM   297   C  CH2 . TRP A  1  40  ? 35.124 94.749  93.422  1.00 44.73  ? 40   TRP A CH2 1 
ATOM   298   N  N   . ILE A  1  41  ? 29.293 90.658  97.028  1.00 34.50  ? 41   ILE A N   1 
ATOM   299   C  CA  . ILE A  1  41  ? 28.163 89.925  97.599  1.00 35.26  ? 41   ILE A CA  1 
ATOM   300   C  C   . ILE A  1  41  ? 28.360 89.571  99.065  1.00 35.82  ? 41   ILE A C   1 
ATOM   301   O  O   . ILE A  1  41  ? 29.442 89.108  99.456  1.00 36.50  ? 41   ILE A O   1 
ATOM   302   C  CB  . ILE A  1  41  ? 27.943 88.625  96.797  1.00 35.43  ? 41   ILE A CB  1 
ATOM   303   C  CG1 . ILE A  1  41  ? 27.724 88.937  95.316  1.00 41.06  ? 41   ILE A CG1 1 
ATOM   304   C  CG2 . ILE A  1  41  ? 26.764 87.848  97.329  1.00 34.15  ? 41   ILE A CG2 1 
ATOM   305   C  CD1 . ILE A  1  41  ? 27.858 87.752  94.437  1.00 39.39  ? 41   ILE A CD1 1 
ATOM   306   N  N   . ASP A  1  42  ? 27.317 89.780  99.881  1.00 35.51  ? 42   ASP A N   1 
ATOM   307   C  CA  . ASP A  1  42  ? 27.354 89.407  101.299 1.00 35.68  ? 42   ASP A CA  1 
ATOM   308   C  C   . ASP A  1  42  ? 27.253 87.890  101.477 1.00 35.86  ? 42   ASP A C   1 
ATOM   309   O  O   . ASP A  1  42  ? 26.440 87.411  102.248 1.00 35.73  ? 42   ASP A O   1 
ATOM   310   C  CB  . ASP A  1  42  ? 26.247 90.126  102.124 1.00 35.66  ? 42   ASP A CB  1 
ATOM   311   C  CG  . ASP A  1  42  ? 26.820 91.185  103.128 1.00 47.17  ? 42   ASP A CG  1 
ATOM   312   O  OD1 . ASP A  1  42  ? 26.072 91.604  104.026 1.00 55.15  ? 42   ASP A OD1 1 
ATOM   313   O  OD2 . ASP A  1  42  ? 27.991 91.637  103.110 1.00 50.03  ? 42   ASP A OD2 1 
ATOM   314   N  N   . ALA A  1  43  ? 28.103 87.153  100.759 1.00 36.45  ? 43   ALA A N   1 
ATOM   315   C  CA  . ALA A  1  43  ? 28.158 85.690  100.843 1.00 37.25  ? 43   ALA A CA  1 
ATOM   316   C  C   . ALA A  1  43  ? 29.591 85.260  101.086 1.00 37.80  ? 43   ALA A C   1 
ATOM   317   O  O   . ALA A  1  43  ? 30.504 85.705  100.397 1.00 37.53  ? 43   ALA A O   1 
ATOM   318   C  CB  . ALA A  1  43  ? 27.630 85.041  99.556  1.00 37.13  ? 43   ALA A CB  1 
ATOM   319   N  N   . GLY A  1  44  ? 29.779 84.379  102.061 1.00 38.13  ? 44   GLY A N   1 
ATOM   320   C  CA  . GLY A  1  44  ? 31.098 83.900  102.395 1.00 38.20  ? 44   GLY A CA  1 
ATOM   321   C  C   . GLY A  1  44  ? 31.030 82.461  102.808 1.00 38.20  ? 44   GLY A C   1 
ATOM   322   O  O   . GLY A  1  44  ? 30.464 81.648  102.103 1.00 39.19  ? 44   GLY A O   1 
ATOM   323   N  N   . SER A  1  45  ? 31.624 82.140  103.948 1.00 37.17  ? 45   SER A N   1 
ATOM   324   C  CA  . SER A  1  45  ? 31.631 80.783  104.449 1.00 36.08  ? 45   SER A CA  1 
ATOM   325   C  C   . SER A  1  45  ? 31.146 80.819  105.869 1.00 34.80  ? 45   SER A C   1 
ATOM   326   O  O   . SER A  1  45  ? 30.863 79.798  106.453 1.00 34.54  ? 45   SER A O   1 
ATOM   327   C  CB  . SER A  1  45  ? 33.046 80.172  104.384 1.00 36.40  ? 45   SER A CB  1 
ATOM   328   O  OG  . SER A  1  45  ? 33.902 80.723  105.389 1.00 45.56  ? 45   SER A OG  1 
ATOM   329   N  N   . ARG A  1  46  ? 31.073 82.016  106.432 1.00 33.89  ? 46   ARG A N   1 
ATOM   330   C  CA  . ARG A  1  46  ? 30.543 82.187  107.768 1.00 33.43  ? 46   ARG A CA  1 
ATOM   331   C  C   . ARG A  1  46  ? 29.016 81.955  107.690 1.00 33.44  ? 46   ARG A C   1 
ATOM   332   O  O   . ARG A  1  46  ? 28.327 81.827  108.711 1.00 33.42  ? 46   ARG A O   1 
ATOM   333   C  CB  . ARG A  1  46  ? 30.833 83.595  108.266 1.00 33.08  ? 46   ARG A CB  1 
ATOM   334   C  CG  . ARG A  1  46  ? 30.417 83.857  109.657 1.00 26.77  ? 46   ARG A CG  1 
ATOM   335   C  CD  . ARG A  1  46  ? 30.247 85.281  109.952 1.00 23.78  ? 46   ARG A CD  1 
ATOM   336   N  NE  . ARG A  1  46  ? 29.748 85.507  111.294 1.00 31.23  ? 46   ARG A NE  1 
ATOM   337   C  CZ  . ARG A  1  46  ? 30.074 86.542  112.010 1.00 31.61  ? 46   ARG A CZ  1 
ATOM   338   N  NH1 . ARG A  1  46  ? 30.913 87.411  111.512 1.00 38.20  ? 46   ARG A NH1 1 
ATOM   339   N  NH2 . ARG A  1  46  ? 29.574 86.714  113.229 1.00 36.34  ? 46   ARG A NH2 1 
ATOM   340   N  N   . TYR A  1  47  ? 28.515 81.897  106.454 1.00 33.34  ? 47   TYR A N   1 
ATOM   341   C  CA  . TYR A  1  47  ? 27.109 81.649  106.166 1.00 32.92  ? 47   TYR A CA  1 
ATOM   342   C  C   . TYR A  1  47  ? 26.842 80.203  105.949 1.00 33.46  ? 47   TYR A C   1 
ATOM   343   O  O   . TYR A  1  47  ? 25.689 79.815  105.797 1.00 33.84  ? 47   TYR A O   1 
ATOM   344   C  CB  . TYR A  1  47  ? 26.668 82.391  104.901 1.00 32.28  ? 47   TYR A CB  1 
ATOM   345   C  CG  . TYR A  1  47  ? 26.584 83.863  105.070 1.00 29.11  ? 47   TYR A CG  1 
ATOM   346   C  CD1 . TYR A  1  47  ? 25.432 84.444  105.521 1.00 23.89  ? 47   TYR A CD1 1 
ATOM   347   C  CD2 . TYR A  1  47  ? 27.687 84.687  104.787 1.00 26.28  ? 47   TYR A CD2 1 
ATOM   348   C  CE1 . TYR A  1  47  ? 25.350 85.768  105.689 1.00 32.51  ? 47   TYR A CE1 1 
ATOM   349   C  CE2 . TYR A  1  47  ? 27.616 86.019  104.945 1.00 19.27  ? 47   TYR A CE2 1 
ATOM   350   C  CZ  . TYR A  1  47  ? 26.443 86.571  105.387 1.00 30.28  ? 47   TYR A CZ  1 
ATOM   351   O  OH  . TYR A  1  47  ? 26.335 87.917  105.560 1.00 30.28  ? 47   TYR A OH  1 
ATOM   352   N  N   . GLU A  1  48  ? 27.874 79.379  105.889 1.00 33.94  ? 48   GLU A N   1 
ATOM   353   C  CA  . GLU A  1  48  ? 27.604 77.987  105.642 1.00 35.47  ? 48   GLU A CA  1 
ATOM   354   C  C   . GLU A  1  48  ? 27.429 77.032  106.792 1.00 36.86  ? 48   GLU A C   1 
ATOM   355   O  O   . GLU A  1  48  ? 27.858 77.309  107.919 1.00 36.77  ? 48   GLU A O   1 
ATOM   356   C  CB  . GLU A  1  48  ? 28.290 77.420  104.425 1.00 35.46  ? 48   GLU A CB  1 
ATOM   357   C  CG  . GLU A  1  48  ? 29.777 77.409  104.465 1.00 47.64  ? 48   GLU A CG  1 
ATOM   358   C  CD  . GLU A  1  48  ? 30.358 77.703  103.110 1.00 49.41  ? 48   GLU A CD  1 
ATOM   359   O  OE1 . GLU A  1  48  ? 31.515 77.327  102.842 1.00 47.80  ? 48   GLU A OE1 1 
ATOM   360   O  OE2 . GLU A  1  48  ? 29.652 78.350  102.307 1.00 51.11  ? 48   GLU A OE2 1 
ATOM   361   N  N   . SER A  1  49  ? 26.760 75.917  106.507 1.00 38.28  ? 49   SER A N   1 
ATOM   362   C  CA  . SER A  1  49  ? 26.399 74.948  107.537 1.00 40.20  ? 49   SER A CA  1 
ATOM   363   C  C   . SER A  1  49  ? 27.549 74.197  108.189 1.00 42.12  ? 49   SER A C   1 
ATOM   364   O  O   . SER A  1  49  ? 27.965 74.536  109.303 1.00 43.37  ? 49   SER A O   1 
ATOM   365   C  CB  . SER A  1  49  ? 25.334 73.976  107.025 1.00 39.96  ? 49   SER A CB  1 
ATOM   366   O  OG  . SER A  1  49  ? 24.191 74.681  106.580 1.00 38.63  ? 49   SER A OG  1 
ATOM   367   N  N   . GLU A  1  50  ? 28.026 73.163  107.501 1.00 42.06  ? 50   GLU A N   1 
ATOM   368   C  CA  . GLU A  1  50  ? 29.105 72.286  107.956 1.00 41.53  ? 50   GLU A CA  1 
ATOM   369   C  C   . GLU A  1  50  ? 29.148 71.292  106.863 1.00 41.46  ? 50   GLU A C   1 
ATOM   370   O  O   . GLU A  1  50  ? 30.193 71.030  106.304 1.00 41.77  ? 50   GLU A O   1 
ATOM   371   C  CB  . GLU A  1  50  ? 28.796 71.605  109.295 1.00 41.33  ? 50   GLU A CB  1 
ATOM   372   C  CG  . GLU A  1  50  ? 29.975 70.781  109.830 1.00 49.43  ? 50   GLU A CG  1 
ATOM   373   C  CD  . GLU A  1  50  ? 30.017 70.668  111.363 1.00 48.84  ? 50   GLU A CD  1 
ATOM   374   O  OE1 . GLU A  1  50  ? 28.970 70.428  111.995 1.00 48.53  ? 50   GLU A OE1 1 
ATOM   375   O  OE2 . GLU A  1  50  ? 31.109 70.813  111.931 1.00 47.32  ? 50   GLU A OE2 1 
ATOM   376   N  N   . LYS A  1  51  ? 28.005 70.674  106.602 1.00 41.39  ? 51   LYS A N   1 
ATOM   377   C  CA  . LYS A  1  51  ? 27.848 69.863  105.410 1.00 41.58  ? 51   LYS A CA  1 
ATOM   378   C  C   . LYS A  1  51  ? 27.319 71.031  104.580 1.00 41.12  ? 51   LYS A C   1 
ATOM   379   O  O   . LYS A  1  51  ? 26.325 71.661  104.989 1.00 42.17  ? 51   LYS A O   1 
ATOM   380   C  CB  . LYS A  1  51  ? 26.755 68.752  105.605 1.00 42.02  ? 51   LYS A CB  1 
ATOM   381   C  CG  . LYS A  1  51  ? 25.414 68.987  104.831 1.00 48.13  ? 51   LYS A CG  1 
ATOM   382   C  CD  . LYS A  1  51  ? 24.626 67.697  104.576 1.00 54.28  ? 51   LYS A CD  1 
ATOM   383   C  CE  . LYS A  1  51  ? 23.394 67.974  103.682 1.00 54.65  ? 51   LYS A CE  1 
ATOM   384   N  NZ  . LYS A  1  51  ? 22.409 66.842  103.709 1.00 60.31  ? 51   LYS A NZ  1 
ATOM   385   N  N   . ASN A  1  52  ? 28.040 71.404  103.518 1.00 39.20  ? 52   ASN A N   1 
ATOM   386   C  CA  . ASN A  1  52  ? 27.734 72.602  102.706 1.00 37.92  ? 52   ASN A CA  1 
ATOM   387   C  C   . ASN A  1  52  ? 29.057 73.352  102.539 1.00 37.21  ? 52   ASN A C   1 
ATOM   388   O  O   . ASN A  1  52  ? 29.403 73.787  101.451 1.00 37.26  ? 52   ASN A O   1 
ATOM   389   C  CB  . ASN A  1  52  ? 26.755 73.537  103.438 1.00 37.97  ? 52   ASN A CB  1 
ATOM   390   C  CG  . ASN A  1  52  ? 26.151 74.597  102.537 1.00 37.10  ? 52   ASN A CG  1 
ATOM   391   O  OD1 . ASN A  1  52  ? 26.758 75.579  102.262 1.00 50.08  ? 52   ASN A OD1 1 
ATOM   392   N  ND2 . ASN A  1  52  ? 24.932 74.398  102.134 1.00 45.26  ? 52   ASN A ND2 1 
ATOM   393   N  N   . ASN A  1  53  ? 29.782 73.492  103.644 1.00 36.23  ? 53   ASN A N   1 
ATOM   394   C  CA  . ASN A  1  53  ? 31.079 74.184  103.671 1.00 34.95  ? 53   ASN A CA  1 
ATOM   395   C  C   . ASN A  1  53  ? 31.929 73.912  102.428 1.00 33.93  ? 53   ASN A C   1 
ATOM   396   O  O   . ASN A  1  53  ? 32.219 72.772  102.105 1.00 33.50  ? 53   ASN A O   1 
ATOM   397   C  CB  . ASN A  1  53  ? 31.847 73.815  104.968 1.00 34.88  ? 53   ASN A CB  1 
ATOM   398   C  CG  . ASN A  1  53  ? 32.994 74.803  105.309 1.00 36.09  ? 53   ASN A CG  1 
ATOM   399   O  OD1 . ASN A  1  53  ? 33.663 74.631  106.305 1.00 42.25  ? 53   ASN A OD1 1 
ATOM   400   N  ND2 . ASN A  1  53  ? 33.206 75.816  104.476 1.00 33.25  ? 53   ASN A ND2 1 
ATOM   401   N  N   . GLY A  1  54  ? 32.303 74.992  101.735 1.00 33.45  ? 54   GLY A N   1 
ATOM   402   C  CA  . GLY A  1  54  ? 33.099 74.918  100.528 1.00 32.49  ? 54   GLY A CA  1 
ATOM   403   C  C   . GLY A  1  54  ? 32.278 75.302  99.332  1.00 32.05  ? 54   GLY A C   1 
ATOM   404   O  O   . GLY A  1  54  ? 32.808 75.443  98.238  1.00 32.08  ? 54   GLY A O   1 
ATOM   405   N  N   . ALA A  1  55  ? 30.982 75.511  99.572  1.00 32.20  ? 55   ALA A N   1 
ATOM   406   C  CA  . ALA A  1  55  ? 29.979 75.834  98.550  1.00 32.61  ? 55   ALA A CA  1 
ATOM   407   C  C   . ALA A  1  55  ? 30.293 77.012  97.635  1.00 32.91  ? 55   ALA A C   1 
ATOM   408   O  O   . ALA A  1  55  ? 30.158 76.907  96.416  1.00 33.33  ? 55   ALA A O   1 
ATOM   409   C  CB  . ALA A  1  55  ? 28.646 76.045  99.201  1.00 32.81  ? 55   ALA A CB  1 
ATOM   410   N  N   . GLY A  1  56  ? 30.672 78.134  98.224  1.00 32.54  ? 56   GLY A N   1 
ATOM   411   C  CA  . GLY A  1  56  ? 30.964 79.333  97.465  1.00 32.65  ? 56   GLY A CA  1 
ATOM   412   C  C   . GLY A  1  56  ? 32.283 79.217  96.783  1.00 33.06  ? 56   GLY A C   1 
ATOM   413   O  O   . GLY A  1  56  ? 32.460 79.685  95.628  1.00 33.51  ? 56   GLY A O   1 
ATOM   414   N  N   . TYR A  1  57  ? 33.234 78.591  97.471  1.00 32.63  ? 57   TYR A N   1 
ATOM   415   C  CA  . TYR A  1  57  ? 34.544 78.381  96.880  1.00 31.87  ? 57   TYR A CA  1 
ATOM   416   C  C   . TYR A  1  57  ? 34.334 77.545  95.628  1.00 31.88  ? 57   TYR A C   1 
ATOM   417   O  O   . TYR A  1  57  ? 34.937 77.814  94.587  1.00 32.19  ? 57   TYR A O   1 
ATOM   418   C  CB  . TYR A  1  57  ? 35.487 77.683  97.851  1.00 31.30  ? 57   TYR A CB  1 
ATOM   419   C  CG  . TYR A  1  57  ? 36.912 77.667  97.376  1.00 28.62  ? 57   TYR A CG  1 
ATOM   420   C  CD1 . TYR A  1  57  ? 37.616 78.868  97.159  1.00 31.09  ? 57   TYR A CD1 1 
ATOM   421   C  CD2 . TYR A  1  57  ? 37.559 76.470  97.115  1.00 27.53  ? 57   TYR A CD2 1 
ATOM   422   C  CE1 . TYR A  1  57  ? 38.930 78.857  96.703  1.00 25.62  ? 57   TYR A CE1 1 
ATOM   423   C  CE2 . TYR A  1  57  ? 38.866 76.442  96.670  1.00 29.07  ? 57   TYR A CE2 1 
ATOM   424   C  CZ  . TYR A  1  57  ? 39.549 77.636  96.464  1.00 34.46  ? 57   TYR A CZ  1 
ATOM   425   O  OH  . TYR A  1  57  ? 40.835 77.597  96.016  1.00 40.51  ? 57   TYR A OH  1 
ATOM   426   N  N   . PHE A  1  58  ? 33.403 76.583  95.718  1.00 31.29  ? 58   PHE A N   1 
ATOM   427   C  CA  . PHE A  1  58  ? 33.066 75.731  94.606  1.00 30.76  ? 58   PHE A CA  1 
ATOM   428   C  C   . PHE A  1  58  ? 32.393 76.565  93.490  1.00 30.68  ? 58   PHE A C   1 
ATOM   429   O  O   . PHE A  1  58  ? 32.735 76.425  92.314  1.00 30.82  ? 58   PHE A O   1 
ATOM   430   C  CB  . PHE A  1  58  ? 32.155 74.602  95.077  1.00 30.74  ? 58   PHE A CB  1 
ATOM   431   C  CG  . PHE A  1  58  ? 32.372 73.277  94.353  1.00 25.86  ? 58   PHE A CG  1 
ATOM   432   C  CD1 . PHE A  1  58  ? 32.811 72.150  95.055  1.00 24.78  ? 58   PHE A CD1 1 
ATOM   433   C  CD2 . PHE A  1  58  ? 32.074 73.146  93.007  1.00 13.43  ? 58   PHE A CD2 1 
ATOM   434   C  CE1 . PHE A  1  58  ? 32.986 70.919  94.406  1.00 21.32  ? 58   PHE A CE1 1 
ATOM   435   C  CE2 . PHE A  1  58  ? 32.258 71.946  92.365  1.00 24.43  ? 58   PHE A CE2 1 
ATOM   436   C  CZ  . PHE A  1  58  ? 32.719 70.815  93.078  1.00 22.20  ? 58   PHE A CZ  1 
ATOM   437   N  N   . VAL A  1  59  ? 31.472 77.455  93.860  1.00 30.61  ? 59   VAL A N   1 
ATOM   438   C  CA  . VAL A  1  59  ? 30.812 78.309  92.850  1.00 30.74  ? 59   VAL A CA  1 
ATOM   439   C  C   . VAL A  1  59  ? 31.819 79.192  92.140  1.00 31.27  ? 59   VAL A C   1 
ATOM   440   O  O   . VAL A  1  59  ? 31.748 79.356  90.943  1.00 31.27  ? 59   VAL A O   1 
ATOM   441   C  CB  . VAL A  1  59  ? 29.679 79.190  93.442  1.00 30.62  ? 59   VAL A CB  1 
ATOM   442   C  CG1 . VAL A  1  59  ? 29.223 80.249  92.412  1.00 25.40  ? 59   VAL A CG1 1 
ATOM   443   C  CG2 . VAL A  1  59  ? 28.505 78.334  93.877  1.00 23.94  ? 59   VAL A CG2 1 
ATOM   444   N  N   . GLU A  1  60  ? 32.790 79.718  92.890  1.00 31.89  ? 60   GLU A N   1 
ATOM   445   C  CA  . GLU A  1  60  ? 33.847 80.553  92.307  1.00 32.49  ? 60   GLU A CA  1 
ATOM   446   C  C   . GLU A  1  60  ? 34.545 79.831  91.177  1.00 32.23  ? 60   GLU A C   1 
ATOM   447   O  O   . GLU A  1  60  ? 34.844 80.415  90.162  1.00 32.78  ? 60   GLU A O   1 
ATOM   448   C  CB  . GLU A  1  60  ? 34.890 80.940  93.359  1.00 32.89  ? 60   GLU A CB  1 
ATOM   449   C  CG  . GLU A  1  60  ? 35.847 82.005  92.899  1.00 32.94  ? 60   GLU A CG  1 
ATOM   450   C  CD  . GLU A  1  60  ? 37.210 81.879  93.533  1.00 44.42  ? 60   GLU A CD  1 
ATOM   451   O  OE1 . GLU A  1  60  ? 37.430 82.433  94.645  1.00 41.47  ? 60   GLU A OE1 1 
ATOM   452   O  OE2 . GLU A  1  60  ? 38.078 81.236  92.900  1.00 49.23  ? 60   GLU A OE2 1 
ATOM   453   N  N   . HIS A  1  61  ? 34.805 78.558  91.362  1.00 31.69  ? 61   HIS A N   1 
ATOM   454   C  CA  . HIS A  1  61  ? 35.431 77.778  90.325  1.00 31.88  ? 61   HIS A CA  1 
ATOM   455   C  C   . HIS A  1  61  ? 34.557 77.631  89.087  1.00 32.25  ? 61   HIS A C   1 
ATOM   456   O  O   . HIS A  1  61  ? 35.060 77.664  87.974  1.00 33.26  ? 61   HIS A O   1 
ATOM   457   C  CB  . HIS A  1  61  ? 35.759 76.411  90.837  1.00 32.30  ? 61   HIS A CB  1 
ATOM   458   C  CG  . HIS A  1  61  ? 37.023 76.351  91.602  1.00 31.07  ? 61   HIS A CG  1 
ATOM   459   N  ND1 . HIS A  1  61  ? 38.098 75.603  91.187  1.00 26.24  ? 61   HIS A ND1 1 
ATOM   460   C  CD2 . HIS A  1  61  ? 37.392 76.941  92.760  1.00 24.88  ? 61   HIS A CD2 1 
ATOM   461   C  CE1 . HIS A  1  61  ? 39.087 75.756  92.042  1.00 32.97  ? 61   HIS A CE1 1 
ATOM   462   N  NE2 . HIS A  1  61  ? 38.677 76.545  93.018  1.00 36.06  ? 61   HIS A NE2 1 
ATOM   463   N  N   . LEU A  1  62  ? 33.249 77.466  89.280  1.00 31.16  ? 62   LEU A N   1 
ATOM   464   C  CA  . LEU A  1  62  ? 32.332 77.297  88.161  1.00 29.90  ? 62   LEU A CA  1 
ATOM   465   C  C   . LEU A  1  62  ? 31.911 78.605  87.513  1.00 30.02  ? 62   LEU A C   1 
ATOM   466   O  O   . LEU A  1  62  ? 31.562 78.638  86.347  1.00 29.85  ? 62   LEU A O   1 
ATOM   467   C  CB  . LEU A  1  62  ? 31.110 76.557  88.624  1.00 29.18  ? 62   LEU A CB  1 
ATOM   468   C  CG  . LEU A  1  62  ? 31.414 75.141  89.056  1.00 26.93  ? 62   LEU A CG  1 
ATOM   469   C  CD1 . LEU A  1  62  ? 30.395 74.588  90.021  1.00 19.57  ? 62   LEU A CD1 1 
ATOM   470   C  CD2 . LEU A  1  62  ? 31.549 74.274  87.856  1.00 20.87  ? 62   LEU A CD2 1 
ATOM   471   N  N   . ALA A  1  63  ? 31.992 79.684  88.266  1.00 30.71  ? 63   ALA A N   1 
ATOM   472   C  CA  . ALA A  1  63  ? 31.520 80.997  87.817  1.00 31.88  ? 63   ALA A CA  1 
ATOM   473   C  C   . ALA A  1  63  ? 31.951 81.481  86.434  1.00 33.00  ? 63   ALA A C   1 
ATOM   474   O  O   . ALA A  1  63  ? 31.166 82.076  85.708  1.00 33.41  ? 63   ALA A O   1 
ATOM   475   C  CB  . ALA A  1  63  ? 31.829 82.023  88.837  1.00 31.95  ? 63   ALA A CB  1 
ATOM   476   N  N   . PHE A  1  64  ? 33.189 81.225  86.067  1.00 33.75  ? 64   PHE A N   1 
ATOM   477   C  CA  . PHE A  1  64  ? 33.681 81.704  84.789  1.00 34.55  ? 64   PHE A CA  1 
ATOM   478   C  C   . PHE A  1  64  ? 33.788 80.602  83.746  1.00 35.64  ? 64   PHE A C   1 
ATOM   479   O  O   . PHE A  1  64  ? 34.495 80.772  82.744  1.00 36.26  ? 64   PHE A O   1 
ATOM   480   C  CB  . PHE A  1  64  ? 35.052 82.345  84.969  1.00 34.53  ? 64   PHE A CB  1 
ATOM   481   C  CG  . PHE A  1  64  ? 35.083 83.476  86.001  1.00 35.83  ? 64   PHE A CG  1 
ATOM   482   C  CD1 . PHE A  1  64  ? 36.256 83.804  86.638  1.00 36.32  ? 64   PHE A CD1 1 
ATOM   483   C  CD2 . PHE A  1  64  ? 33.949 84.216  86.290  1.00 27.27  ? 64   PHE A CD2 1 
ATOM   484   C  CE1 . PHE A  1  64  ? 36.292 84.818  87.540  1.00 38.51  ? 64   PHE A CE1 1 
ATOM   485   C  CE2 . PHE A  1  64  ? 33.987 85.209  87.171  1.00 27.54  ? 64   PHE A CE2 1 
ATOM   486   C  CZ  . PHE A  1  64  ? 35.162 85.523  87.809  1.00 34.94  ? 64   PHE A CZ  1 
ATOM   487   N  N   . LYS A  1  65  ? 33.095 79.473  83.970  1.00 35.47  ? 65   LYS A N   1 
ATOM   488   C  CA  . LYS A  1  65  ? 33.195 78.341  83.061  1.00 35.58  ? 65   LYS A CA  1 
ATOM   489   C  C   . LYS A  1  65  ? 31.981 78.122  82.168  1.00 35.74  ? 65   LYS A C   1 
ATOM   490   O  O   . LYS A  1  65  ? 31.841 77.040  81.560  1.00 35.80  ? 65   LYS A O   1 
ATOM   491   C  CB  . LYS A  1  65  ? 33.470 77.065  83.832  1.00 35.66  ? 65   LYS A CB  1 
ATOM   492   C  CG  . LYS A  1  65  ? 34.581 77.173  84.811  1.00 38.05  ? 65   LYS A CG  1 
ATOM   493   C  CD  . LYS A  1  65  ? 35.963 76.812  84.244  1.00 24.66  ? 65   LYS A CD  1 
ATOM   494   C  CE  . LYS A  1  65  ? 36.959 76.826  85.397  1.00 17.72  ? 65   LYS A CE  1 
ATOM   495   N  NZ  . LYS A  1  65  ? 38.345 76.876  84.981  1.00 27.23  ? 65   LYS A NZ  1 
ATOM   496   N  N   . GLY A  1  66  ? 31.086 79.102  82.116  1.00 35.38  ? 66   GLY A N   1 
ATOM   497   C  CA  . GLY A  1  66  ? 29.927 78.996  81.261  1.00 35.17  ? 66   GLY A CA  1 
ATOM   498   C  C   . GLY A  1  66  ? 28.623 79.485  81.845  1.00 35.32  ? 66   GLY A C   1 
ATOM   499   O  O   . GLY A  1  66  ? 28.284 79.199  82.988  1.00 34.93  ? 66   GLY A O   1 
ATOM   500   N  N   . THR A  1  67  ? 27.909 80.269  81.051  1.00 36.21  ? 67   THR A N   1 
ATOM   501   C  CA  . THR A  1  67  ? 26.587 80.782  81.417  1.00 37.44  ? 67   THR A CA  1 
ATOM   502   C  C   . THR A  1  67  ? 25.584 80.180  80.392  1.00 38.61  ? 67   THR A C   1 
ATOM   503   O  O   . THR A  1  67  ? 25.974 79.393  79.525  1.00 38.73  ? 67   THR A O   1 
ATOM   504   C  CB  . THR A  1  67  ? 26.566 82.353  81.349  1.00 37.20  ? 67   THR A CB  1 
ATOM   505   O  OG1 . THR A  1  67  ? 26.258 82.794  80.016  1.00 31.01  ? 67   THR A OG1 1 
ATOM   506   C  CG2 . THR A  1  67  ? 27.946 82.911  81.582  1.00 41.64  ? 67   THR A CG2 1 
ATOM   507   N  N   . LYS A  1  68  ? 24.312 80.521  80.498  1.00 39.58  ? 68   LYS A N   1 
ATOM   508   C  CA  . LYS A  1  68  ? 23.338 79.964  79.558  1.00 40.66  ? 68   LYS A CA  1 
ATOM   509   C  C   . LYS A  1  68  ? 23.362 80.704  78.224  1.00 41.24  ? 68   LYS A C   1 
ATOM   510   O  O   . LYS A  1  68  ? 23.094 80.124  77.176  1.00 41.34  ? 68   LYS A O   1 
ATOM   511   C  CB  . LYS A  1  68  ? 21.928 79.908  80.171  1.00 40.97  ? 68   LYS A CB  1 
ATOM   512   C  CG  . LYS A  1  68  ? 21.805 78.914  81.351  1.00 48.55  ? 68   LYS A CG  1 
ATOM   513   C  CD  . LYS A  1  68  ? 20.748 79.370  82.376  1.00 52.14  ? 68   LYS A CD  1 
ATOM   514   C  CE  . LYS A  1  68  ? 20.830 78.554  83.667  1.00 49.99  ? 68   LYS A CE  1 
ATOM   515   N  NZ  . LYS A  1  68  ? 19.988 79.134  84.743  1.00 50.01  ? 68   LYS A NZ  1 
ATOM   516   N  N   . ASN A  1  69  ? 23.725 81.972  78.260  1.00 41.75  ? 69   ASN A N   1 
ATOM   517   C  CA  . ASN A  1  69  ? 23.819 82.754  77.037  1.00 42.22  ? 69   ASN A CA  1 
ATOM   518   C  C   . ASN A  1  69  ? 25.234 82.631  76.454  1.00 42.63  ? 69   ASN A C   1 
ATOM   519   O  O   . ASN A  1  69  ? 25.455 82.816  75.257  1.00 42.60  ? 69   ASN A O   1 
ATOM   520   C  CB  . ASN A  1  69  ? 23.470 84.208  77.314  1.00 42.11  ? 69   ASN A CB  1 
ATOM   521   C  CG  . ASN A  1  69  ? 22.333 84.346  78.284  1.00 40.24  ? 69   ASN A CG  1 
ATOM   522   O  OD1 . ASN A  1  69  ? 22.515 84.171  79.486  1.00 39.92  ? 69   ASN A OD1 1 
ATOM   523   N  ND2 . ASN A  1  69  ? 21.139 84.636  77.771  1.00 39.28  ? 69   ASN A ND2 1 
ATOM   524   N  N   . ARG A  1  70  ? 26.187 82.326  77.319  1.00 42.91  ? 70   ARG A N   1 
ATOM   525   C  CA  . ARG A  1  70  ? 27.560 82.133  76.904  1.00 43.29  ? 70   ARG A CA  1 
ATOM   526   C  C   . ARG A  1  70  ? 28.033 80.821  77.495  1.00 43.94  ? 70   ARG A C   1 
ATOM   527   O  O   . ARG A  1  70  ? 28.345 80.757  78.675  1.00 44.18  ? 70   ARG A O   1 
ATOM   528   C  CB  . ARG A  1  70  ? 28.428 83.268  77.415  1.00 43.02  ? 70   ARG A CB  1 
ATOM   529   C  CG  . ARG A  1  70  ? 28.149 84.568  76.759  1.00 41.95  ? 70   ARG A CG  1 
ATOM   530   C  CD  . ARG A  1  70  ? 28.634 85.770  77.527  1.00 37.71  ? 70   ARG A CD  1 
ATOM   531   N  NE  . ARG A  1  70  ? 28.191 87.011  76.902  1.00 34.26  ? 70   ARG A NE  1 
ATOM   532   C  CZ  . ARG A  1  70  ? 27.054 87.631  77.199  1.00 32.16  ? 70   ARG A CZ  1 
ATOM   533   N  NH1 . ARG A  1  70  ? 26.245 87.123  78.118  1.00 32.92  ? 70   ARG A NH1 1 
ATOM   534   N  NH2 . ARG A  1  70  ? 26.723 88.762  76.575  1.00 20.85  ? 70   ARG A NH2 1 
ATOM   535   N  N   . PRO A  1  71  ? 28.077 79.773  76.678  1.00 44.14  ? 71   PRO A N   1 
ATOM   536   C  CA  . PRO A  1  71  ? 28.478 78.436  77.143  1.00 44.33  ? 71   PRO A CA  1 
ATOM   537   C  C   . PRO A  1  71  ? 29.948 78.242  77.538  1.00 44.51  ? 71   PRO A C   1 
ATOM   538   O  O   . PRO A  1  71  ? 30.655 79.203  77.861  1.00 45.36  ? 71   PRO A O   1 
ATOM   539   C  CB  . PRO A  1  71  ? 28.094 77.527  75.978  1.00 44.50  ? 71   PRO A CB  1 
ATOM   540   C  CG  . PRO A  1  71  ? 27.132 78.376  75.141  1.00 47.36  ? 71   PRO A CG  1 
ATOM   541   C  CD  . PRO A  1  71  ? 27.651 79.770  75.269  1.00 44.10  ? 71   PRO A CD  1 
ATOM   542   N  N   . GLY A  1  72  ? 30.359 76.977  77.578  1.00 43.92  ? 72   GLY A N   1 
ATOM   543   C  CA  . GLY A  1  72  ? 31.703 76.540  77.963  1.00 43.12  ? 72   GLY A CA  1 
ATOM   544   C  C   . GLY A  1  72  ? 32.859 77.529  78.136  1.00 42.59  ? 72   GLY A C   1 
ATOM   545   O  O   . GLY A  1  72  ? 33.354 77.729  79.248  1.00 43.23  ? 72   GLY A O   1 
ATOM   546   N  N   . ASN A  1  73  ? 33.285 78.154  77.048  1.00 41.18  ? 73   ASN A N   1 
ATOM   547   C  CA  . ASN A  1  73  ? 34.436 79.021  77.102  1.00 39.90  ? 73   ASN A CA  1 
ATOM   548   C  C   . ASN A  1  73  ? 34.223 80.346  76.417  1.00 39.48  ? 73   ASN A C   1 
ATOM   549   O  O   . ASN A  1  73  ? 35.128 81.189  76.371  1.00 39.69  ? 73   ASN A O   1 
ATOM   550   C  CB  . ASN A  1  73  ? 35.648 78.301  76.498  1.00 39.50  ? 73   ASN A CB  1 
ATOM   551   C  CG  . ASN A  1  73  ? 35.725 78.448  74.994  1.00 31.95  ? 73   ASN A CG  1 
ATOM   552   O  OD1 . ASN A  1  73  ? 34.757 78.287  74.298  1.00 28.65  ? 73   ASN A OD1 1 
ATOM   553   N  ND2 . ASN A  1  73  ? 36.883 78.785  74.509  1.00 42.89  ? 73   ASN A ND2 1 
ATOM   554   N  N   . ALA A  1  74  ? 33.016 80.546  75.921  1.00 38.89  ? 74   ALA A N   1 
ATOM   555   C  CA  . ALA A  1  74  ? 32.660 81.750  75.196  1.00 38.80  ? 74   ALA A CA  1 
ATOM   556   C  C   . ALA A  1  74  ? 32.920 83.045  75.951  1.00 38.97  ? 74   ALA A C   1 
ATOM   557   O  O   . ALA A  1  74  ? 33.313 84.053  75.336  1.00 39.33  ? 74   ALA A O   1 
ATOM   558   C  CB  . ALA A  1  74  ? 31.222 81.690  74.743  1.00 38.65  ? 74   ALA A CB  1 
ATOM   559   N  N   . LEU A  1  75  ? 32.680 83.025  77.269  1.00 38.33  ? 75   LEU A N   1 
ATOM   560   C  CA  . LEU A  1  75  ? 32.877 84.197  78.113  1.00 37.76  ? 75   LEU A CA  1 
ATOM   561   C  C   . LEU A  1  75  ? 34.322 84.617  78.111  1.00 37.64  ? 75   LEU A C   1 
ATOM   562   O  O   . LEU A  1  75  ? 34.628 85.806  77.926  1.00 37.60  ? 75   LEU A O   1 
ATOM   563   C  CB  . LEU A  1  75  ? 32.432 83.907  79.544  1.00 37.74  ? 75   LEU A CB  1 
ATOM   564   C  CG  . LEU A  1  75  ? 32.924 84.865  80.635  1.00 29.07  ? 75   LEU A CG  1 
ATOM   565   C  CD1 . LEU A  1  75  ? 32.316 86.229  80.471  1.00 34.97  ? 75   LEU A CD1 1 
ATOM   566   C  CD2 . LEU A  1  75  ? 32.576 84.313  81.960  1.00 35.02  ? 75   LEU A CD2 1 
ATOM   567   N  N   . GLU A  1  76  ? 35.215 83.643  78.315  1.00 37.50  ? 76   GLU A N   1 
ATOM   568   C  CA  . GLU A  1  76  ? 36.639 83.910  78.336  1.00 37.35  ? 76   GLU A CA  1 
ATOM   569   C  C   . GLU A  1  76  ? 36.997 84.598  77.072  1.00 36.83  ? 76   GLU A C   1 
ATOM   570   O  O   . GLU A  1  76  ? 37.608 85.669  77.100  1.00 37.32  ? 76   GLU A O   1 
ATOM   571   C  CB  . GLU A  1  76  ? 37.452 82.617  78.459  1.00 37.86  ? 76   GLU A CB  1 
ATOM   572   C  CG  . GLU A  1  76  ? 37.334 81.938  79.808  1.00 47.92  ? 76   GLU A CG  1 
ATOM   573   C  CD  . GLU A  1  76  ? 38.112 80.637  79.897  1.00 49.01  ? 76   GLU A CD  1 
ATOM   574   O  OE1 . GLU A  1  76  ? 38.876 80.307  78.948  1.00 46.56  ? 76   GLU A OE1 1 
ATOM   575   O  OE2 . GLU A  1  76  ? 37.952 79.943  80.926  1.00 49.55  ? 76   GLU A OE2 1 
ATOM   576   N  N   . LYS A  1  77  ? 36.555 84.026  75.950  1.00 35.55  ? 77   LYS A N   1 
ATOM   577   C  CA  . LYS A  1  77  ? 36.816 84.609  74.651  1.00 34.84  ? 77   LYS A CA  1 
ATOM   578   C  C   . LYS A  1  77  ? 36.400 86.070  74.533  1.00 34.52  ? 77   LYS A C   1 
ATOM   579   O  O   . LYS A  1  77  ? 37.098 86.834  73.923  1.00 35.08  ? 77   LYS A O   1 
ATOM   580   C  CB  . LYS A  1  77  ? 36.229 83.767  73.515  1.00 34.70  ? 77   LYS A CB  1 
ATOM   581   C  CG  . LYS A  1  77  ? 37.132 82.653  73.073  1.00 28.27  ? 77   LYS A CG  1 
ATOM   582   C  CD  . LYS A  1  77  ? 36.568 81.853  71.880  1.00 35.09  ? 77   LYS A CD  1 
ATOM   583   C  CE  . LYS A  1  77  ? 37.483 80.636  71.578  1.00 35.18  ? 77   LYS A CE  1 
ATOM   584   N  NZ  . LYS A  1  77  ? 36.894 79.608  70.688  1.00 36.19  ? 77   LYS A NZ  1 
ATOM   585   N  N   . GLU A  1  78  ? 35.288 86.465  75.151  1.00 33.90  ? 78   GLU A N   1 
ATOM   586   C  CA  . GLU A  1  78  ? 34.865 87.872  75.088  1.00 34.09  ? 78   GLU A CA  1 
ATOM   587   C  C   . GLU A  1  78  ? 35.744 88.794  75.933  1.00 34.11  ? 78   GLU A C   1 
ATOM   588   O  O   . GLU A  1  78  ? 36.201 89.838  75.443  1.00 34.29  ? 78   GLU A O   1 
ATOM   589   C  CB  . GLU A  1  78  ? 33.401 88.049  75.468  1.00 34.30  ? 78   GLU A CB  1 
ATOM   590   C  CG  . GLU A  1  78  ? 32.427 87.504  74.436  1.00 41.66  ? 78   GLU A CG  1 
ATOM   591   C  CD  . GLU A  1  78  ? 31.028 88.071  74.583  1.00 46.80  ? 78   GLU A CD  1 
ATOM   592   O  OE1 . GLU A  1  78  ? 30.894 89.284  74.902  1.00 46.35  ? 78   GLU A OE1 1 
ATOM   593   O  OE2 . GLU A  1  78  ? 30.058 87.308  74.354  1.00 53.69  ? 78   GLU A OE2 1 
ATOM   594   N  N   . VAL A  1  79  ? 35.977 88.404  77.195  1.00 33.52  ? 79   VAL A N   1 
ATOM   595   C  CA  . VAL A  1  79  ? 36.812 89.178  78.125  1.00 33.22  ? 79   VAL A CA  1 
ATOM   596   C  C   . VAL A  1  79  ? 38.264 89.386  77.584  1.00 33.11  ? 79   VAL A C   1 
ATOM   597   O  O   . VAL A  1  79  ? 38.772 90.519  77.518  1.00 32.98  ? 79   VAL A O   1 
ATOM   598   C  CB  . VAL A  1  79  ? 36.890 88.474  79.486  1.00 33.30  ? 79   VAL A CB  1 
ATOM   599   C  CG1 . VAL A  1  79  ? 37.864 89.182  80.407  1.00 31.94  ? 79   VAL A CG1 1 
ATOM   600   C  CG2 . VAL A  1  79  ? 35.515 88.371  80.129  1.00 29.02  ? 79   VAL A CG2 1 
ATOM   601   N  N   . GLU A  1  80  ? 38.892 88.283  77.185  1.00 32.96  ? 80   GLU A N   1 
ATOM   602   C  CA  . GLU A  1  80  ? 40.218 88.297  76.640  1.00 32.51  ? 80   GLU A CA  1 
ATOM   603   C  C   . GLU A  1  80  ? 40.293 89.148  75.370  1.00 32.95  ? 80   GLU A C   1 
ATOM   604   O  O   . GLU A  1  80  ? 41.192 89.967  75.240  1.00 33.58  ? 80   GLU A O   1 
ATOM   605   C  CB  . GLU A  1  80  ? 40.699 86.863  76.362  1.00 32.18  ? 80   GLU A CB  1 
ATOM   606   C  CG  . GLU A  1  80  ? 40.843 86.005  77.620  1.00 41.12  ? 80   GLU A CG  1 
ATOM   607   C  CD  . GLU A  1  80  ? 41.283 84.555  77.343  1.00 48.50  ? 80   GLU A CD  1 
ATOM   608   O  OE1 . GLU A  1  80  ? 41.517 83.809  78.328  1.00 48.97  ? 80   GLU A OE1 1 
ATOM   609   O  OE2 . GLU A  1  80  ? 41.384 84.157  76.157  1.00 47.05  ? 80   GLU A OE2 1 
ATOM   610   N  N   . SER A  1  81  ? 39.319 88.998  74.460  1.00 32.61  ? 81   SER A N   1 
ATOM   611   C  CA  . SER A  1  81  ? 39.334 89.764  73.177  1.00 32.31  ? 81   SER A CA  1 
ATOM   612   C  C   . SER A  1  81  ? 39.222 91.266  73.290  1.00 31.58  ? 81   SER A C   1 
ATOM   613   O  O   . SER A  1  81  ? 39.562 91.985  72.348  1.00 31.49  ? 81   SER A O   1 
ATOM   614   C  CB  . SER A  1  81  ? 38.319 89.231  72.149  1.00 32.26  ? 81   SER A CB  1 
ATOM   615   O  OG  . SER A  1  81  ? 38.686 87.935  71.714  1.00 29.40  ? 81   SER A OG  1 
ATOM   616   N  N   . MET A  1  82  ? 38.709 91.753  74.409  1.00 31.07  ? 82   MET A N   1 
ATOM   617   C  CA  . MET A  1  82  ? 38.660 93.186  74.587  1.00 31.10  ? 82   MET A CA  1 
ATOM   618   C  C   . MET A  1  82  ? 39.826 93.620  75.482  1.00 31.32  ? 82   MET A C   1 
ATOM   619   O  O   . MET A  1  82  ? 39.988 94.796  75.789  1.00 31.82  ? 82   MET A O   1 
ATOM   620   C  CB  . MET A  1  82  ? 37.313 93.669  75.100  1.00 30.85  ? 82   MET A CB  1 
ATOM   621   C  CG  . MET A  1  82  ? 36.836 93.001  76.355  1.00 34.94  ? 82   MET A CG  1 
ATOM   622   S  SD  . MET A  1  82  ? 35.157 93.510  76.757  1.00 35.97  ? 82   MET A SD  1 
ATOM   623   C  CE  . MET A  1  82  ? 34.792 92.415  77.973  1.00 40.05  ? 82   MET A CE  1 
ATOM   624   N  N   . GLY A  1  83  ? 40.656 92.651  75.858  1.00 30.72  ? 83   GLY A N   1 
ATOM   625   C  CA  . GLY A  1  83  ? 41.817 92.915  76.657  1.00 30.45  ? 83   GLY A CA  1 
ATOM   626   C  C   . GLY A  1  83  ? 41.521 93.072  78.122  1.00 30.46  ? 83   GLY A C   1 
ATOM   627   O  O   . GLY A  1  83  ? 42.384 93.491  78.903  1.00 31.38  ? 83   GLY A O   1 
ATOM   628   N  N   . ALA A  1  84  ? 40.329 92.700  78.524  1.00 29.47  ? 84   ALA A N   1 
ATOM   629   C  CA  . ALA A  1  84  ? 39.957 92.854  79.899  1.00 28.97  ? 84   ALA A CA  1 
ATOM   630   C  C   . ALA A  1  84  ? 40.501 91.723  80.801  1.00 28.72  ? 84   ALA A C   1 
ATOM   631   O  O   . ALA A  1  84  ? 41.052 90.751  80.319  1.00 28.86  ? 84   ALA A O   1 
ATOM   632   C  CB  . ALA A  1  84  ? 38.506 92.958  80.006  1.00 29.13  ? 84   ALA A CB  1 
ATOM   633   N  N   . HIS A  1  85  ? 40.373 91.898  82.111  1.00 28.34  ? 85   HIS A N   1 
ATOM   634   C  CA  . HIS A  1  85  ? 40.818 90.914  83.081  1.00 28.10  ? 85   HIS A CA  1 
ATOM   635   C  C   . HIS A  1  85  ? 39.661 90.617  83.987  1.00 28.04  ? 85   HIS A C   1 
ATOM   636   O  O   . HIS A  1  85  ? 38.991 91.533  84.443  1.00 29.01  ? 85   HIS A O   1 
ATOM   637   C  CB  . HIS A  1  85  ? 41.986 91.459  83.896  1.00 28.43  ? 85   HIS A CB  1 
ATOM   638   C  CG  . HIS A  1  85  ? 43.281 91.394  83.176  1.00 37.68  ? 85   HIS A CG  1 
ATOM   639   N  ND1 . HIS A  1  85  ? 43.664 92.343  82.252  1.00 34.37  ? 85   HIS A ND1 1 
ATOM   640   C  CD2 . HIS A  1  85  ? 44.243 90.440  83.159  1.00 39.74  ? 85   HIS A CD2 1 
ATOM   641   C  CE1 . HIS A  1  85  ? 44.823 91.993  81.721  1.00 36.99  ? 85   HIS A CE1 1 
ATOM   642   N  NE2 . HIS A  1  85  ? 45.189 90.835  82.244  1.00 35.63  ? 85   HIS A NE2 1 
ATOM   643   N  N   . LEU A  1  86  ? 39.406 89.340  84.231  1.00 26.82  ? 86   LEU A N   1 
ATOM   644   C  CA  . LEU A  1  86  ? 38.300 88.931  85.053  1.00 26.48  ? 86   LEU A CA  1 
ATOM   645   C  C   . LEU A  1  86  ? 38.831 88.174  86.223  1.00 27.20  ? 86   LEU A C   1 
ATOM   646   O  O   . LEU A  1  86  ? 39.561 87.206  86.061  1.00 27.94  ? 86   LEU A O   1 
ATOM   647   C  CB  . LEU A  1  86  ? 37.395 88.037  84.237  1.00 26.55  ? 86   LEU A CB  1 
ATOM   648   C  CG  . LEU A  1  86  ? 36.210 87.332  84.884  1.00 22.30  ? 86   LEU A CG  1 
ATOM   649   C  CD1 . LEU A  1  86  ? 35.145 88.323  85.361  1.00 19.58  ? 86   LEU A CD1 1 
ATOM   650   C  CD2 . LEU A  1  86  ? 35.618 86.356  83.889  1.00 23.78  ? 86   LEU A CD2 1 
ATOM   651   N  N   . ASN A  1  87  ? 38.482 88.598  87.412  1.00 27.71  ? 87   ASN A N   1 
ATOM   652   C  CA  . ASN A  1  87  ? 38.985 87.948  88.592  1.00 28.86  ? 87   ASN A CA  1 
ATOM   653   C  C   . ASN A  1  87  ? 37.907 87.788  89.638  1.00 29.20  ? 87   ASN A C   1 
ATOM   654   O  O   . ASN A  1  87  ? 36.777 88.270  89.460  1.00 29.12  ? 87   ASN A O   1 
ATOM   655   C  CB  . ASN A  1  87  ? 40.167 88.730  89.149  1.00 29.88  ? 87   ASN A CB  1 
ATOM   656   C  CG  . ASN A  1  87  ? 41.107 87.859  89.990  1.00 47.70  ? 87   ASN A CG  1 
ATOM   657   O  OD1 . ASN A  1  87  ? 41.172 87.991  91.206  1.00 47.85  ? 87   ASN A OD1 1 
ATOM   658   N  ND2 . ASN A  1  87  ? 41.833 86.963  89.328  1.00 59.02  ? 87   ASN A ND2 1 
ATOM   659   N  N   . ALA A  1  88  ? 38.239 87.110  90.730  1.00 29.72  ? 88   ALA A N   1 
ATOM   660   C  CA  . ALA A  1  88  ? 37.266 86.872  91.780  1.00 30.76  ? 88   ALA A CA  1 
ATOM   661   C  C   . ALA A  1  88  ? 37.893 86.411  93.074  1.00 31.54  ? 88   ALA A C   1 
ATOM   662   O  O   . ALA A  1  88  ? 38.945 85.768  93.074  1.00 31.80  ? 88   ALA A O   1 
ATOM   663   C  CB  . ALA A  1  88  ? 36.221 85.817  91.307  1.00 31.25  ? 88   ALA A CB  1 
ATOM   664   N  N   . TYR A  1  89  ? 37.245 86.715  94.187  1.00 31.94  ? 89   TYR A N   1 
ATOM   665   C  CA  . TYR A  1  89  ? 37.737 86.213  95.467  1.00 32.21  ? 89   TYR A CA  1 
ATOM   666   C  C   . TYR A  1  89  ? 36.623 85.894  96.423  1.00 32.50  ? 89   TYR A C   1 
ATOM   667   O  O   . TYR A  1  89  ? 35.469 86.183  96.149  1.00 32.66  ? 89   TYR A O   1 
ATOM   668   C  CB  . TYR A  1  89  ? 38.806 87.121  96.097  1.00 31.83  ? 89   TYR A CB  1 
ATOM   669   C  CG  . TYR A  1  89  ? 38.335 88.474  96.547  1.00 34.47  ? 89   TYR A CG  1 
ATOM   670   C  CD1 . TYR A  1  89  ? 38.475 89.588  95.724  1.00 40.96  ? 89   TYR A CD1 1 
ATOM   671   C  CD2 . TYR A  1  89  ? 37.813 88.658  97.813  1.00 41.15  ? 89   TYR A CD2 1 
ATOM   672   C  CE1 . TYR A  1  89  ? 38.075 90.857  96.142  1.00 41.72  ? 89   TYR A CE1 1 
ATOM   673   C  CE2 . TYR A  1  89  ? 37.407 89.912  98.247  1.00 45.52  ? 89   TYR A CE2 1 
ATOM   674   C  CZ  . TYR A  1  89  ? 37.544 91.012  97.406  1.00 46.49  ? 89   TYR A CZ  1 
ATOM   675   O  OH  . TYR A  1  89  ? 37.146 92.252  97.844  1.00 40.42  ? 89   TYR A OH  1 
ATOM   676   N  N   . SER A  1  90  ? 36.972 85.246  97.523  1.00 32.94  ? 90   SER A N   1 
ATOM   677   C  CA  . SER A  1  90  ? 36.006 84.881  98.549  1.00 33.75  ? 90   SER A CA  1 
ATOM   678   C  C   . SER A  1  90  ? 36.650 84.678  99.872  1.00 34.08  ? 90   SER A C   1 
ATOM   679   O  O   . SER A  1  90  ? 37.624 83.956  99.995  1.00 34.26  ? 90   SER A O   1 
ATOM   680   C  CB  . SER A  1  90  ? 35.137 83.654  98.166  1.00 34.23  ? 90   SER A CB  1 
ATOM   681   O  OG  . SER A  1  90  ? 35.739 82.847  97.159  1.00 44.56  ? 90   SER A OG  1 
ATOM   682   N  N   . THR A  1  91  ? 36.119 85.358  100.876 1.00 34.22  ? 91   THR A N   1 
ATOM   683   C  CA  . THR A  1  91  ? 36.621 85.239  102.216 1.00 34.13  ? 91   THR A CA  1 
ATOM   684   C  C   . THR A  1  91  ? 35.566 84.533  103.033 1.00 33.95  ? 91   THR A C   1 
ATOM   685   O  O   . THR A  1  91  ? 34.649 83.934  102.492 1.00 34.06  ? 91   THR A O   1 
ATOM   686   C  CB  . THR A  1  91  ? 36.889 86.622  102.809 1.00 34.49  ? 91   THR A CB  1 
ATOM   687   O  OG1 . THR A  1  91  ? 35.642 87.316  103.028 1.00 39.45  ? 91   THR A OG1 1 
ATOM   688   C  CG2 . THR A  1  91  ? 37.642 87.502  101.807 1.00 29.49  ? 91   THR A CG2 1 
ATOM   689   N  N   . ARG A  1  92  ? 35.684 84.628  104.342 1.00 33.85  ? 92   ARG A N   1 
ATOM   690   C  CA  . ARG A  1  92  ? 34.729 84.024  105.232 1.00 33.23  ? 92   ARG A CA  1 
ATOM   691   C  C   . ARG A  1  92  ? 33.440 84.814  105.234 1.00 33.88  ? 92   ARG A C   1 
ATOM   692   O  O   . ARG A  1  92  ? 32.374 84.280  105.598 1.00 33.94  ? 92   ARG A O   1 
ATOM   693   C  CB  . ARG A  1  92  ? 35.293 83.987  106.642 1.00 32.35  ? 92   ARG A CB  1 
ATOM   694   C  CG  . ARG A  1  92  ? 36.438 83.064  106.776 1.00 24.40  ? 92   ARG A CG  1 
ATOM   695   C  CD  . ARG A  1  92  ? 36.951 82.926  108.160 1.00 27.46  ? 92   ARG A CD  1 
ATOM   696   N  NE  . ARG A  1  92  ? 37.760 81.716  108.311 1.00 22.54  ? 92   ARG A NE  1 
ATOM   697   C  CZ  . ARG A  1  92  ? 39.019 81.631  107.960 1.00 20.81  ? 92   ARG A CZ  1 
ATOM   698   N  NH1 . ARG A  1  92  ? 39.636 82.686  107.444 1.00 29.27  ? 92   ARG A NH1 1 
ATOM   699   N  NH2 . ARG A  1  92  ? 39.683 80.508  108.133 1.00 19.63  ? 92   ARG A NH2 1 
ATOM   700   N  N   . GLU A  1  93  ? 33.502 86.061  104.755 1.00 33.94  ? 93   GLU A N   1 
ATOM   701   C  CA  . GLU A  1  93  ? 32.345 86.932  104.840 1.00 34.01  ? 93   GLU A CA  1 
ATOM   702   C  C   . GLU A  1  93  ? 31.930 87.621  103.525 1.00 33.91  ? 93   GLU A C   1 
ATOM   703   O  O   . GLU A  1  93  ? 30.851 88.197  103.438 1.00 34.48  ? 93   GLU A O   1 
ATOM   704   C  CB  . GLU A  1  93  ? 32.618 87.990  105.940 1.00 33.79  ? 93   GLU A CB  1 
ATOM   705   C  CG  . GLU A  1  93  ? 31.418 88.385  106.764 1.00 39.81  ? 93   GLU A CG  1 
ATOM   706   C  CD  . GLU A  1  93  ? 31.782 89.183  108.022 1.00 47.09  ? 93   GLU A CD  1 
ATOM   707   O  OE1 . GLU A  1  93  ? 31.823 88.582  109.116 1.00 42.84  ? 93   GLU A OE1 1 
ATOM   708   O  OE2 . GLU A  1  93  ? 31.986 90.418  107.923 1.00 51.75  ? 93   GLU A OE2 1 
ATOM   709   N  N   . HIS A  1  94  ? 32.771 87.557  102.513 1.00 33.36  ? 94   HIS A N   1 
ATOM   710   C  CA  . HIS A  1  94  ? 32.500 88.277  101.269 1.00 32.96  ? 94   HIS A CA  1 
ATOM   711   C  C   . HIS A  1  94  ? 32.913 87.516  100.012 1.00 31.92  ? 94   HIS A C   1 
ATOM   712   O  O   . HIS A  1  94  ? 33.890 86.785  100.017 1.00 32.02  ? 94   HIS A O   1 
ATOM   713   C  CB  . HIS A  1  94  ? 33.263 89.617  101.275 1.00 33.59  ? 94   HIS A CB  1 
ATOM   714   C  CG  . HIS A  1  94  ? 32.875 90.535  102.391 1.00 40.17  ? 94   HIS A CG  1 
ATOM   715   N  ND1 . HIS A  1  94  ? 31.561 90.853  102.672 1.00 40.12  ? 94   HIS A ND1 1 
ATOM   716   C  CD2 . HIS A  1  94  ? 33.625 91.198  103.300 1.00 42.44  ? 94   HIS A CD2 1 
ATOM   717   C  CE1 . HIS A  1  94  ? 31.518 91.672  103.709 1.00 34.74  ? 94   HIS A CE1 1 
ATOM   718   N  NE2 . HIS A  1  94  ? 32.755 91.895  104.112 1.00 38.54  ? 94   HIS A NE2 1 
ATOM   719   N  N   . THR A  1  95  ? 32.153 87.697  98.938  1.00 30.65  ? 95   THR A N   1 
ATOM   720   C  CA  . THR A  1  95  ? 32.495 87.100  97.659  1.00 30.14  ? 95   THR A CA  1 
ATOM   721   C  C   . THR A  1  95  ? 32.513 88.222  96.636  1.00 29.77  ? 95   THR A C   1 
ATOM   722   O  O   . THR A  1  95  ? 31.682 89.128  96.692  1.00 30.11  ? 95   THR A O   1 
ATOM   723   C  CB  . THR A  1  95  ? 31.464 86.020  97.253  1.00 30.17  ? 95   THR A CB  1 
ATOM   724   O  OG1 . THR A  1  95  ? 31.530 84.915  98.176  1.00 31.10  ? 95   THR A OG1 1 
ATOM   725   C  CG2 . THR A  1  95  ? 31.850 85.386  95.922  1.00 29.85  ? 95   THR A CG2 1 
ATOM   726   N  N   . ALA A  1  96  ? 33.471 88.200  95.727  1.00 29.15  ? 96   ALA A N   1 
ATOM   727   C  CA  . ALA A  1  96  ? 33.549 89.247  94.723  1.00 28.69  ? 96   ALA A CA  1 
ATOM   728   C  C   . ALA A  1  96  ? 33.900 88.715  93.375  1.00 28.65  ? 96   ALA A C   1 
ATOM   729   O  O   . ALA A  1  96  ? 34.618 87.721  93.254  1.00 28.44  ? 96   ALA A O   1 
ATOM   730   C  CB  . ALA A  1  96  ? 34.555 90.325  95.146  1.00 28.28  ? 96   ALA A CB  1 
ATOM   731   N  N   . TYR A  1  97  ? 33.343 89.350  92.360  1.00 28.88  ? 97   TYR A N   1 
ATOM   732   C  CA  . TYR A  1  97  ? 33.641 89.038  90.960  1.00 29.30  ? 97   TYR A CA  1 
ATOM   733   C  C   . TYR A  1  97  ? 33.824 90.396  90.289  1.00 29.20  ? 97   TYR A C   1 
ATOM   734   O  O   . TYR A  1  97  ? 32.893 91.212  90.265  1.00 29.33  ? 97   TYR A O   1 
ATOM   735   C  CB  . TYR A  1  97  ? 32.449 88.324  90.298  1.00 29.81  ? 97   TYR A CB  1 
ATOM   736   C  CG  . TYR A  1  97  ? 32.051 87.010  90.926  1.00 30.77  ? 97   TYR A CG  1 
ATOM   737   C  CD1 . TYR A  1  97  ? 30.976 86.940  91.817  1.00 27.69  ? 97   TYR A CD1 1 
ATOM   738   C  CD2 . TYR A  1  97  ? 32.711 85.823  90.589  1.00 19.65  ? 97   TYR A CD2 1 
ATOM   739   C  CE1 . TYR A  1  97  ? 30.581 85.732  92.361  1.00 30.10  ? 97   TYR A CE1 1 
ATOM   740   C  CE2 . TYR A  1  97  ? 32.331 84.614  91.146  1.00 24.65  ? 97   TYR A CE2 1 
ATOM   741   C  CZ  . TYR A  1  97  ? 31.263 84.573  92.020  1.00 28.43  ? 97   TYR A CZ  1 
ATOM   742   O  OH  . TYR A  1  97  ? 30.888 83.389  92.580  1.00 38.38  ? 97   TYR A OH  1 
ATOM   743   N  N   . TYR A  1  98  ? 35.007 90.662  89.765  1.00 29.05  ? 98   TYR A N   1 
ATOM   744   C  CA  . TYR A  1  98  ? 35.255 91.968  89.140  1.00 28.62  ? 98   TYR A CA  1 
ATOM   745   C  C   . TYR A  1  98  ? 36.001 91.906  87.819  1.00 28.12  ? 98   TYR A C   1 
ATOM   746   O  O   . TYR A  1  98  ? 36.828 91.016  87.591  1.00 27.43  ? 98   TYR A O   1 
ATOM   747   C  CB  . TYR A  1  98  ? 35.947 92.943  90.116  1.00 28.66  ? 98   TYR A CB  1 
ATOM   748   C  CG  . TYR A  1  98  ? 37.283 92.444  90.619  1.00 34.41  ? 98   TYR A CG  1 
ATOM   749   C  CD1 . TYR A  1  98  ? 38.444 92.646  89.888  1.00 36.34  ? 98   TYR A CD1 1 
ATOM   750   C  CD2 . TYR A  1  98  ? 37.377 91.751  91.812  1.00 37.89  ? 98   TYR A CD2 1 
ATOM   751   C  CE1 . TYR A  1  98  ? 39.647 92.176  90.334  1.00 37.36  ? 98   TYR A CE1 1 
ATOM   752   C  CE2 . TYR A  1  98  ? 38.574 91.276  92.263  1.00 38.49  ? 98   TYR A CE2 1 
ATOM   753   C  CZ  . TYR A  1  98  ? 39.703 91.489  91.522  1.00 39.72  ? 98   TYR A CZ  1 
ATOM   754   O  OH  . TYR A  1  98  ? 40.882 91.000  91.961  1.00 41.30  ? 98   TYR A OH  1 
ATOM   755   N  N   . ILE A  1  99  ? 35.677 92.858  86.938  1.00 28.18  ? 99   ILE A N   1 
ATOM   756   C  CA  . ILE A  1  99  ? 36.313 92.972  85.645  1.00 27.92  ? 99   ILE A CA  1 
ATOM   757   C  C   . ILE A  1  99  ? 37.144 94.244  85.604  1.00 27.95  ? 99   ILE A C   1 
ATOM   758   O  O   . ILE A  1  99  ? 36.725 95.304  86.032  1.00 27.39  ? 99   ILE A O   1 
ATOM   759   C  CB  . ILE A  1  99  ? 35.277 92.968  84.512  1.00 28.13  ? 99   ILE A CB  1 
ATOM   760   C  CG1 . ILE A  1  99  ? 34.390 91.726  84.612  1.00 35.31  ? 99   ILE A CG1 1 
ATOM   761   C  CG2 . ILE A  1  99  ? 35.972 93.009  83.127  1.00 32.87  ? 99   ILE A CG2 1 
ATOM   762   C  CD1 . ILE A  1  99  ? 33.463 91.521  83.442  1.00 27.80  ? 99   ILE A CD1 1 
ATOM   763   N  N   . LYS A  1  100 ? 38.334 94.125  85.106  1.00 29.04  ? 100  LYS A N   1 
ATOM   764   C  CA  . LYS A  1  100 ? 39.198 95.247  85.008  1.00 30.34  ? 100  LYS A CA  1 
ATOM   765   C  C   . LYS A  1  100 ? 39.305 95.465  83.516  1.00 30.99  ? 100  LYS A C   1 
ATOM   766   O  O   . LYS A  1  100 ? 39.754 94.594  82.793  1.00 31.48  ? 100  LYS A O   1 
ATOM   767   C  CB  . LYS A  1  100 ? 40.514 94.877  85.692  1.00 30.66  ? 100  LYS A CB  1 
ATOM   768   C  CG  . LYS A  1  100 ? 41.707 95.533  85.238  1.00 46.53  ? 100  LYS A CG  1 
ATOM   769   C  CD  . LYS A  1  100 ? 42.913 94.867  85.908  1.00 47.25  ? 100  LYS A CD  1 
ATOM   770   C  CE  . LYS A  1  100 ? 43.325 95.597  87.117  1.00 42.20  ? 100  LYS A CE  1 
ATOM   771   N  NZ  . LYS A  1  100 ? 43.232 97.100  86.888  1.00 48.01  ? 100  LYS A NZ  1 
ATOM   772   N  N   . ALA A  1  101 ? 38.758 96.576  83.039  1.00 31.04  ? 101  ALA A N   1 
ATOM   773   C  CA  . ALA A  1  101 ? 38.738 96.828  81.598  1.00 31.45  ? 101  ALA A CA  1 
ATOM   774   C  C   . ALA A  1  101 ? 38.795 98.283  81.189  1.00 31.75  ? 101  ALA A C   1 
ATOM   775   O  O   . ALA A  1  101 ? 38.674 99.198  82.015  1.00 31.98  ? 101  ALA A O   1 
ATOM   776   C  CB  . ALA A  1  101 ? 37.519 96.195  80.979  1.00 31.56  ? 101  ALA A CB  1 
ATOM   777   N  N   . LEU A  1  102 ? 38.942 98.474  79.882  1.00 31.50  ? 102  LEU A N   1 
ATOM   778   C  CA  . LEU A  1  102 ? 38.955 99.785  79.246  1.00 30.98  ? 102  LEU A CA  1 
ATOM   779   C  C   . LEU A  1  102 ? 37.592 100.466 79.537  1.00 32.11  ? 102  LEU A C   1 
ATOM   780   O  O   . LEU A  1  102 ? 36.566 99.796  79.647  1.00 32.30  ? 102  LEU A O   1 
ATOM   781   C  CB  . LEU A  1  102 ? 39.105 99.562  77.747  1.00 29.84  ? 102  LEU A CB  1 
ATOM   782   C  CG  . LEU A  1  102 ? 40.204 100.230 76.940  1.00 18.79  ? 102  LEU A CG  1 
ATOM   783   C  CD1 . LEU A  1  102 ? 41.513 100.257 77.663  1.00 23.53  ? 102  LEU A CD1 1 
ATOM   784   C  CD2 . LEU A  1  102 ? 40.355 99.524  75.648  1.00 23.75  ? 102  LEU A CD2 1 
ATOM   785   N  N   . SER A  1  103 ? 37.588 101.782 79.672  1.00 33.14  ? 103  SER A N   1 
ATOM   786   C  CA  . SER A  1  103 ? 36.345 102.513 79.969  1.00 33.93  ? 103  SER A CA  1 
ATOM   787   C  C   . SER A  1  103 ? 35.201 102.371 78.951  1.00 34.18  ? 103  SER A C   1 
ATOM   788   O  O   . SER A  1  103 ? 34.028 102.289 79.357  1.00 34.48  ? 103  SER A O   1 
ATOM   789   C  CB  . SER A  1  103 ? 36.615 103.986 80.275  1.00 34.46  ? 103  SER A CB  1 
ATOM   790   O  OG  . SER A  1  103 ? 36.913 104.182 81.657  1.00 48.15  ? 103  SER A OG  1 
ATOM   791   N  N   . LYS A  1  104 ? 35.521 102.360 77.643  1.00 34.08  ? 104  LYS A N   1 
ATOM   792   C  CA  . LYS A  1  104 ? 34.467 102.196 76.615  1.00 34.14  ? 104  LYS A CA  1 
ATOM   793   C  C   . LYS A  1  104 ? 33.723 100.882 76.860  1.00 33.95  ? 104  LYS A C   1 
ATOM   794   O  O   . LYS A  1  104 ? 32.537 100.813 76.715  1.00 34.37  ? 104  LYS A O   1 
ATOM   795   C  CB  . LYS A  1  104 ? 35.028 102.089 75.186  1.00 34.46  ? 104  LYS A CB  1 
ATOM   796   C  CG  . LYS A  1  104 ? 36.429 102.537 74.921  1.00 44.14  ? 104  LYS A CG  1 
ATOM   797   C  CD  . LYS A  1  104 ? 36.840 101.998 73.526  1.00 47.61  ? 104  LYS A CD  1 
ATOM   798   C  CE  . LYS A  1  104 ? 38.134 102.598 73.015  1.00 57.83  ? 104  LYS A CE  1 
ATOM   799   N  NZ  . LYS A  1  104 ? 38.441 102.099 71.642  1.00 61.44  ? 104  LYS A NZ  1 
ATOM   800   N  N   . ASP A  1  105 ? 34.463 99.858  77.265  1.00 33.15  ? 105  ASP A N   1 
ATOM   801   C  CA  . ASP A  1  105 ? 33.936 98.541  77.453  1.00 32.66  ? 105  ASP A CA  1 
ATOM   802   C  C   . ASP A  1  105 ? 33.021 98.330  78.657  1.00 32.32  ? 105  ASP A C   1 
ATOM   803   O  O   . ASP A  1  105 ? 32.563 97.212  78.903  1.00 31.65  ? 105  ASP A O   1 
ATOM   804   C  CB  . ASP A  1  105 ? 35.082 97.543  77.467  1.00 32.86  ? 105  ASP A CB  1 
ATOM   805   C  CG  . ASP A  1  105 ? 35.839 97.526  76.172  1.00 34.23  ? 105  ASP A CG  1 
ATOM   806   O  OD1 . ASP A  1  105 ? 35.325 98.077  75.191  1.00 44.41  ? 105  ASP A OD1 1 
ATOM   807   O  OD2 . ASP A  1  105 ? 36.957 96.996  76.029  1.00 45.31  ? 105  ASP A OD2 1 
ATOM   808   N  N   . LEU A  1  106 ? 32.759 99.398  79.401  1.00 32.74  ? 106  LEU A N   1 
ATOM   809   C  CA  . LEU A  1  106 ? 31.869 99.331  80.550  1.00 33.03  ? 106  LEU A CA  1 
ATOM   810   C  C   . LEU A  1  106 ? 30.476 98.606  80.284  1.00 33.80  ? 106  LEU A C   1 
ATOM   811   O  O   . LEU A  1  106 ? 30.062 97.755  81.112  1.00 33.86  ? 106  LEU A O   1 
ATOM   812   C  CB  . LEU A  1  106 ? 31.692 100.706 81.196  1.00 32.53  ? 106  LEU A CB  1 
ATOM   813   C  CG  . LEU A  1  106 ? 30.820 100.720 82.444  1.00 31.66  ? 106  LEU A CG  1 
ATOM   814   C  CD1 . LEU A  1  106 ? 31.523 100.007 83.612  1.00 31.01  ? 106  LEU A CD1 1 
ATOM   815   C  CD2 . LEU A  1  106 ? 30.422 102.138 82.820  1.00 27.56  ? 106  LEU A CD2 1 
ATOM   816   N  N   . PRO A  1  107 ? 29.778 98.915  79.152  1.00 33.89  ? 107  PRO A N   1 
ATOM   817   C  CA  . PRO A  1  107 ? 28.520 98.233  78.823  1.00 33.91  ? 107  PRO A CA  1 
ATOM   818   C  C   . PRO A  1  107 ? 28.670 96.721  78.819  1.00 34.11  ? 107  PRO A C   1 
ATOM   819   O  O   . PRO A  1  107 ? 27.887 96.022  79.476  1.00 34.53  ? 107  PRO A O   1 
ATOM   820   C  CB  . PRO A  1  107 ? 28.241 98.702  77.397  1.00 33.86  ? 107  PRO A CB  1 
ATOM   821   C  CG  . PRO A  1  107 ? 28.865 100.010 77.310  1.00 33.10  ? 107  PRO A CG  1 
ATOM   822   C  CD  . PRO A  1  107 ? 30.074 99.960  78.156  1.00 33.66  ? 107  PRO A CD  1 
ATOM   823   N  N   . LYS A  1  108 ? 29.677 96.225  78.099  1.00 33.51  ? 108  LYS A N   1 
ATOM   824   C  CA  . LYS A  1  108 ? 29.918 94.795  78.000  1.00 32.49  ? 108  LYS A CA  1 
ATOM   825   C  C   . LYS A  1  108 ? 30.326 94.207  79.323  1.00 31.48  ? 108  LYS A C   1 
ATOM   826   O  O   . LYS A  1  108 ? 29.857 93.157  79.689  1.00 31.58  ? 108  LYS A O   1 
ATOM   827   C  CB  . LYS A  1  108 ? 30.988 94.501  76.957  1.00 32.64  ? 108  LYS A CB  1 
ATOM   828   C  CG  . LYS A  1  108 ? 31.147 93.023  76.633  1.00 40.21  ? 108  LYS A CG  1 
ATOM   829   C  CD  . LYS A  1  108 ? 29.922 92.474  75.895  1.00 40.09  ? 108  LYS A CD  1 
ATOM   830   C  CE  . LYS A  1  108 ? 29.836 93.004  74.472  1.00 33.54  ? 108  LYS A CE  1 
ATOM   831   N  NZ  . LYS A  1  108 ? 28.526 92.639  73.847  1.00 38.86  ? 108  LYS A NZ  1 
ATOM   832   N  N   . ALA A  1  109 ? 31.170 94.917  80.057  1.00 30.80  ? 109  ALA A N   1 
ATOM   833   C  CA  . ALA A  1  109 ? 31.667 94.425  81.345  1.00 30.51  ? 109  ALA A CA  1 
ATOM   834   C  C   . ALA A  1  109 ? 30.559 94.205  82.377  1.00 30.43  ? 109  ALA A C   1 
ATOM   835   O  O   . ALA A  1  109 ? 30.577 93.227  83.118  1.00 30.61  ? 109  ALA A O   1 
ATOM   836   C  CB  . ALA A  1  109 ? 32.740 95.345  81.895  1.00 30.43  ? 109  ALA A CB  1 
ATOM   837   N  N   . VAL A  1  110 ? 29.593 95.114  82.412  1.00 30.04  ? 110  VAL A N   1 
ATOM   838   C  CA  . VAL A  1  110 ? 28.484 94.981  83.330  1.00 29.32  ? 110  VAL A CA  1 
ATOM   839   C  C   . VAL A  1  110 ? 27.600 93.830  82.852  1.00 28.85  ? 110  VAL A C   1 
ATOM   840   O  O   . VAL A  1  110 ? 27.195 92.964  83.652  1.00 28.82  ? 110  VAL A O   1 
ATOM   841   C  CB  . VAL A  1  110 ? 27.666 96.306  83.438  1.00 28.91  ? 110  VAL A CB  1 
ATOM   842   C  CG1 . VAL A  1  110 ? 26.382 96.094  84.206  1.00 24.68  ? 110  VAL A CG1 1 
ATOM   843   C  CG2 . VAL A  1  110 ? 28.477 97.355  84.091  1.00 27.76  ? 110  VAL A CG2 1 
ATOM   844   N  N   . GLU A  1  111 ? 27.372 93.784  81.540  1.00 28.52  ? 111  GLU A N   1 
ATOM   845   C  CA  . GLU A  1  111 ? 26.557 92.739  80.935  1.00 28.67  ? 111  GLU A CA  1 
ATOM   846   C  C   . GLU A  1  111 ? 27.117 91.346  81.242  1.00 28.83  ? 111  GLU A C   1 
ATOM   847   O  O   . GLU A  1  111 ? 26.358 90.423  81.539  1.00 29.22  ? 111  GLU A O   1 
ATOM   848   C  CB  . GLU A  1  111 ? 26.417 92.944  79.411  1.00 28.62  ? 111  GLU A CB  1 
ATOM   849   C  CG  . GLU A  1  111 ? 25.470 91.958  78.725  1.00 30.95  ? 111  GLU A CG  1 
ATOM   850   C  CD  . GLU A  1  111 ? 25.557 92.005  77.207  1.00 33.25  ? 111  GLU A CD  1 
ATOM   851   O  OE1 . GLU A  1  111 ? 26.211 92.921  76.678  1.00 36.02  ? 111  GLU A OE1 1 
ATOM   852   O  OE2 . GLU A  1  111 ? 24.969 91.117  76.539  1.00 32.84  ? 111  GLU A OE2 1 
ATOM   853   N  N   . LEU A  1  112 ? 28.443 91.205  81.220  1.00 28.41  ? 112  LEU A N   1 
ATOM   854   C  CA  . LEU A  1  112 ? 29.050 89.913  81.505  1.00 28.35  ? 112  LEU A CA  1 
ATOM   855   C  C   . LEU A  1  112 ? 28.908 89.571  82.956  1.00 28.36  ? 112  LEU A C   1 
ATOM   856   O  O   . LEU A  1  112 ? 28.558 88.453  83.302  1.00 27.74  ? 112  LEU A O   1 
ATOM   857   C  CB  . LEU A  1  112 ? 30.507 89.908  81.127  1.00 28.32  ? 112  LEU A CB  1 
ATOM   858   C  CG  . LEU A  1  112 ? 30.813 90.071  79.661  1.00 19.01  ? 112  LEU A CG  1 
ATOM   859   C  CD1 . LEU A  1  112 ? 32.272 90.070  79.497  1.00 16.63  ? 112  LEU A CD1 1 
ATOM   860   C  CD2 . LEU A  1  112 ? 30.196 88.978  78.877  1.00 19.69  ? 112  LEU A CD2 1 
ATOM   861   N  N   . LEU A  1  113 ? 29.190 90.550  83.806  1.00 29.05  ? 113  LEU A N   1 
ATOM   862   C  CA  . LEU A  1  113 ? 29.062 90.385  85.259  1.00 29.76  ? 113  LEU A CA  1 
ATOM   863   C  C   . LEU A  1  113 ? 27.665 89.913  85.619  1.00 30.30  ? 113  LEU A C   1 
ATOM   864   O  O   . LEU A  1  113 ? 27.496 89.035  86.451  1.00 30.20  ? 113  LEU A O   1 
ATOM   865   C  CB  . LEU A  1  113 ? 29.335 91.712  85.961  1.00 29.59  ? 113  LEU A CB  1 
ATOM   866   C  CG  . LEU A  1  113 ? 30.602 91.928  86.780  1.00 27.52  ? 113  LEU A CG  1 
ATOM   867   C  CD1 . LEU A  1  113 ? 31.573 90.824  86.691  1.00 17.63  ? 113  LEU A CD1 1 
ATOM   868   C  CD2 . LEU A  1  113 ? 31.225 93.278  86.477  1.00 20.75  ? 113  LEU A CD2 1 
ATOM   869   N  N   . ALA A  1  114 ? 26.667 90.499  84.975  1.00 30.96  ? 114  ALA A N   1 
ATOM   870   C  CA  . ALA A  1  114 ? 25.294 90.131  85.232  1.00 31.83  ? 114  ALA A CA  1 
ATOM   871   C  C   . ALA A  1  114 ? 25.054 88.678  84.891  1.00 32.56  ? 114  ALA A C   1 
ATOM   872   O  O   . ALA A  1  114 ? 24.528 87.925  85.693  1.00 32.58  ? 114  ALA A O   1 
ATOM   873   C  CB  . ALA A  1  114 ? 24.373 90.999  84.443  1.00 31.85  ? 114  ALA A CB  1 
ATOM   874   N  N   . ASP A  1  115 ? 25.484 88.291  83.700  1.00 33.22  ? 115  ASP A N   1 
ATOM   875   C  CA  . ASP A  1  115 ? 25.301 86.950  83.203  1.00 33.67  ? 115  ASP A CA  1 
ATOM   876   C  C   . ASP A  1  115 ? 25.938 85.924  84.126  1.00 34.43  ? 115  ASP A C   1 
ATOM   877   O  O   . ASP A  1  115 ? 25.331 84.885  84.434  1.00 34.53  ? 115  ASP A O   1 
ATOM   878   C  CB  . ASP A  1  115 ? 25.880 86.843  81.798  1.00 33.57  ? 115  ASP A CB  1 
ATOM   879   C  CG  . ASP A  1  115 ? 25.292 85.697  81.010  1.00 40.03  ? 115  ASP A CG  1 
ATOM   880   O  OD1 . ASP A  1  115 ? 24.366 85.013  81.519  1.00 44.35  ? 115  ASP A OD1 1 
ATOM   881   O  OD2 . ASP A  1  115 ? 25.692 85.393  79.869  1.00 43.33  ? 115  ASP A OD2 1 
ATOM   882   N  N   . ILE A  1  116 ? 27.141 86.234  84.598  1.00 35.07  ? 116  ILE A N   1 
ATOM   883   C  CA  . ILE A  1  116 ? 27.880 85.354  85.495  1.00 35.72  ? 116  ILE A CA  1 
ATOM   884   C  C   . ILE A  1  116 ? 27.187 85.228  86.841  1.00 36.46  ? 116  ILE A C   1 
ATOM   885   O  O   . ILE A  1  116 ? 26.966 84.125  87.329  1.00 36.52  ? 116  ILE A O   1 
ATOM   886   C  CB  . ILE A  1  116 ? 29.333 85.914  85.717  1.00 35.92  ? 116  ILE A CB  1 
ATOM   887   C  CG1 . ILE A  1  116 ? 30.103 85.955  84.408  1.00 35.44  ? 116  ILE A CG1 1 
ATOM   888   C  CG2 . ILE A  1  116 ? 30.111 85.089  86.778  1.00 28.32  ? 116  ILE A CG2 1 
ATOM   889   C  CD1 . ILE A  1  116 ? 31.290 86.898  84.445  1.00 38.62  ? 116  ILE A CD1 1 
ATOM   890   N  N   . VAL A  1  117 ? 26.791 86.358  87.407  1.00 37.24  ? 117  VAL A N   1 
ATOM   891   C  CA  . VAL A  1  117 ? 26.207 86.376  88.751  1.00 38.37  ? 117  VAL A CA  1 
ATOM   892   C  C   . VAL A  1  117 ? 24.746 85.877  88.885  1.00 39.48  ? 117  VAL A C   1 
ATOM   893   O  O   . VAL A  1  117 ? 24.250 85.682  90.006  1.00 39.64  ? 117  VAL A O   1 
ATOM   894   C  CB  . VAL A  1  117 ? 26.379 87.768  89.399  1.00 38.35  ? 117  VAL A CB  1 
ATOM   895   C  CG1 . VAL A  1  117 ? 25.235 88.661  89.067  1.00 41.59  ? 117  VAL A CG1 1 
ATOM   896   C  CG2 . VAL A  1  117 ? 26.555 87.659  90.864  1.00 41.81  ? 117  VAL A CG2 1 
ATOM   897   N  N   . GLN A  1  118 ? 24.083 85.628  87.747  1.00 40.40  ? 118  GLN A N   1 
ATOM   898   C  CA  . GLN A  1  118 ? 22.658 85.187  87.740  1.00 41.16  ? 118  GLN A CA  1 
ATOM   899   C  C   . GLN A  1  118 ? 22.438 83.913  86.919  1.00 41.75  ? 118  GLN A C   1 
ATOM   900   O  O   . GLN A  1  118 ? 21.983 82.909  87.431  1.00 41.87  ? 118  GLN A O   1 
ATOM   901   C  CB  . GLN A  1  118 ? 21.748 86.283  87.140  1.00 41.02  ? 118  GLN A CB  1 
ATOM   902   C  CG  . GLN A  1  118 ? 21.766 87.619  87.849  1.00 40.46  ? 118  GLN A CG  1 
ATOM   903   C  CD  . GLN A  1  118 ? 21.027 88.701  87.060  1.00 39.35  ? 118  GLN A CD  1 
ATOM   904   O  OE1 . GLN A  1  118 ? 19.808 88.812  87.150  1.00 45.21  ? 118  GLN A OE1 1 
ATOM   905   N  NE2 . GLN A  1  118 ? 21.769 89.489  86.279  1.00 35.86  ? 118  GLN A NE2 1 
ATOM   906   N  N   . ASN A  1  119 ? 22.765 83.984  85.635  1.00 42.16  ? 119  ASN A N   1 
ATOM   907   C  CA  . ASN A  1  119 ? 22.547 82.877  84.717  1.00 42.43  ? 119  ASN A CA  1 
ATOM   908   C  C   . ASN A  1  119 ? 23.713 81.862  84.609  1.00 42.48  ? 119  ASN A C   1 
ATOM   909   O  O   . ASN A  1  119 ? 24.045 81.393  83.526  1.00 42.44  ? 119  ASN A O   1 
ATOM   910   C  CB  . ASN A  1  119 ? 22.156 83.415  83.342  1.00 42.68  ? 119  ASN A CB  1 
ATOM   911   C  CG  . ASN A  1  119 ? 20.840 84.195  83.367  1.00 54.45  ? 119  ASN A CG  1 
ATOM   912   O  OD1 . ASN A  1  119 ? 20.439 84.773  82.370  1.00 65.10  ? 119  ASN A OD1 1 
ATOM   913   N  ND2 . ASN A  1  119 ? 20.158 84.182  84.504  1.00 60.74  ? 119  ASN A ND2 1 
ATOM   914   N  N   . CYS A  1  120 ? 24.270 81.490  85.748  1.00 42.68  ? 120  CYS A N   1 
ATOM   915   C  CA  . CYS A  1  120 ? 25.376 80.550  85.806  1.00 43.18  ? 120  CYS A CA  1 
ATOM   916   C  C   . CYS A  1  120 ? 24.997 79.098  85.424  1.00 43.50  ? 120  CYS A C   1 
ATOM   917   O  O   . CYS A  1  120 ? 24.049 78.530  85.972  1.00 43.32  ? 120  CYS A O   1 
ATOM   918   C  CB  . CYS A  1  120 ? 25.976 80.577  87.205  1.00 43.38  ? 120  CYS A CB  1 
ATOM   919   S  SG  . CYS A  1  120 ? 27.454 79.584  87.376  1.00 59.93  ? 120  CYS A SG  1 
ATOM   920   N  N   . SER A  1  121 ? 25.780 78.504  84.512  1.00 44.13  ? 121  SER A N   1 
ATOM   921   C  CA  . SER A  1  121 ? 25.554 77.113  84.020  1.00 44.57  ? 121  SER A CA  1 
ATOM   922   C  C   . SER A  1  121 ? 26.373 76.078  84.752  1.00 45.54  ? 121  SER A C   1 
ATOM   923   O  O   . SER A  1  121 ? 27.359 75.582  84.183  1.00 46.53  ? 121  SER A O   1 
ATOM   924   C  CB  . SER A  1  121 ? 25.972 76.989  82.534  1.00 44.20  ? 121  SER A CB  1 
ATOM   925   O  OG  . SER A  1  121 ? 25.088 77.638  81.678  1.00 49.90  ? 121  SER A OG  1 
ATOM   926   N  N   . LEU A  1  122 ? 25.989 75.701  85.973  1.00 45.16  ? 122  LEU A N   1 
ATOM   927   C  CA  . LEU A  1  122 ? 26.756 74.683  86.710  1.00 44.75  ? 122  LEU A CA  1 
ATOM   928   C  C   . LEU A  1  122 ? 26.537 73.331  86.067  1.00 44.48  ? 122  LEU A C   1 
ATOM   929   O  O   . LEU A  1  122 ? 25.811 72.500  86.602  1.00 44.59  ? 122  LEU A O   1 
ATOM   930   C  CB  . LEU A  1  122 ? 26.290 74.611  88.150  1.00 45.13  ? 122  LEU A CB  1 
ATOM   931   C  CG  . LEU A  1  122 ? 26.072 75.930  88.893  1.00 56.70  ? 122  LEU A CG  1 
ATOM   932   C  CD1 . LEU A  1  122 ? 25.305 75.699  90.200  1.00 58.48  ? 122  LEU A CD1 1 
ATOM   933   C  CD2 . LEU A  1  122 ? 27.377 76.598  89.168  1.00 57.39  ? 122  LEU A CD2 1 
ATOM   934   N  N   . GLU A  1  123 ? 27.154 73.119  84.907  1.00 44.16  ? 123  GLU A N   1 
ATOM   935   C  CA  . GLU A  1  123 ? 27.000 71.881  84.161  1.00 43.87  ? 123  GLU A CA  1 
ATOM   936   C  C   . GLU A  1  123 ? 27.727 70.732  84.798  1.00 43.83  ? 123  GLU A C   1 
ATOM   937   O  O   . GLU A  1  123 ? 28.908 70.820  85.059  1.00 43.65  ? 123  GLU A O   1 
ATOM   938   C  CB  . GLU A  1  123 ? 27.427 72.062  82.714  1.00 43.78  ? 123  GLU A CB  1 
ATOM   939   C  CG  . GLU A  1  123 ? 26.636 73.146  82.016  1.00 53.48  ? 123  GLU A CG  1 
ATOM   940   C  CD  . GLU A  1  123 ? 26.363 72.844  80.566  1.00 57.15  ? 123  GLU A CD  1 
ATOM   941   O  OE1 . GLU A  1  123 ? 26.299 71.652  80.205  1.00 58.46  ? 123  GLU A OE1 1 
ATOM   942   O  OE2 . GLU A  1  123 ? 26.185 73.806  79.793  1.00 63.25  ? 123  GLU A OE2 1 
ATOM   943   N  N   . ASP A  1  124 ? 26.994 69.640  85.032  1.00 43.98  ? 124  ASP A N   1 
ATOM   944   C  CA  . ASP A  1  124 ? 27.523 68.433  85.683  1.00 43.90  ? 124  ASP A CA  1 
ATOM   945   C  C   . ASP A  1  124 ? 28.971 67.996  85.380  1.00 43.55  ? 124  ASP A C   1 
ATOM   946   O  O   . ASP A  1  124 ? 29.744 67.715  86.307  1.00 43.66  ? 124  ASP A O   1 
ATOM   947   C  CB  . ASP A  1  124 ? 26.541 67.288  85.575  1.00 44.05  ? 124  ASP A CB  1 
ATOM   948   C  CG  . ASP A  1  124 ? 25.317 67.512  86.425  1.00 51.23  ? 124  ASP A CG  1 
ATOM   949   O  OD1 . ASP A  1  124 ? 24.199 67.602  85.868  1.00 51.34  ? 124  ASP A OD1 1 
ATOM   950   O  OD2 . ASP A  1  124 ? 25.385 67.651  87.667  1.00 56.68  ? 124  ASP A OD2 1 
ATOM   951   N  N   . SER A  1  125 ? 29.332 67.979  84.096  1.00 42.98  ? 125  SER A N   1 
ATOM   952   C  CA  . SER A  1  125 ? 30.683 67.602  83.651  1.00 42.40  ? 125  SER A CA  1 
ATOM   953   C  C   . SER A  1  125 ? 31.760 68.585  84.195  1.00 41.80  ? 125  SER A C   1 
ATOM   954   O  O   . SER A  1  125 ? 32.892 68.192  84.539  1.00 41.51  ? 125  SER A O   1 
ATOM   955   C  CB  . SER A  1  125 ? 30.722 67.569  82.120  1.00 42.29  ? 125  SER A CB  1 
ATOM   956   O  OG  . SER A  1  125 ? 30.067 68.710  81.581  1.00 39.58  ? 125  SER A OG  1 
ATOM   957   N  N   . GLN A  1  126 ? 31.385 69.847  84.276  1.00 41.28  ? 126  GLN A N   1 
ATOM   958   C  CA  . GLN A  1  126 ? 32.264 70.868  84.780  1.00 40.71  ? 126  GLN A CA  1 
ATOM   959   C  C   . GLN A  1  126 ? 32.366 70.839  86.298  1.00 40.29  ? 126  GLN A C   1 
ATOM   960   O  O   . GLN A  1  126 ? 33.457 71.018  86.848  1.00 40.07  ? 126  GLN A O   1 
ATOM   961   C  CB  . GLN A  1  126 ? 31.807 72.240  84.311  1.00 40.49  ? 126  GLN A CB  1 
ATOM   962   C  CG  . GLN A  1  126 ? 32.560 72.729  83.167  1.00 43.97  ? 126  GLN A CG  1 
ATOM   963   C  CD  . GLN A  1  126 ? 33.913 73.200  83.580  1.00 41.34  ? 126  GLN A CD  1 
ATOM   964   O  OE1 . GLN A  1  126 ? 34.876 73.056  82.843  1.00 42.04  ? 126  GLN A OE1 1 
ATOM   965   N  NE2 . GLN A  1  126 ? 33.995 73.776  84.766  1.00 44.63  ? 126  GLN A NE2 1 
ATOM   966   N  N   . ILE A  1  127 ? 31.241 70.613  86.986  1.00 39.70  ? 127  ILE A N   1 
ATOM   967   C  CA  . ILE A  1  127 ? 31.298 70.573  88.429  1.00 39.41  ? 127  ILE A CA  1 
ATOM   968   C  C   . ILE A  1  127 ? 32.110 69.357  88.868  1.00 39.49  ? 127  ILE A C   1 
ATOM   969   O  O   . ILE A  1  127 ? 32.841 69.397  89.884  1.00 39.96  ? 127  ILE A O   1 
ATOM   970   C  CB  . ILE A  1  127 ? 29.853 70.790  89.126  1.00 39.21  ? 127  ILE A CB  1 
ATOM   971   C  CG1 . ILE A  1  127 ? 29.804 70.296  90.570  1.00 38.11  ? 127  ILE A CG1 1 
ATOM   972   C  CG2 . ILE A  1  127 ? 28.794 70.214  88.363  1.00 38.36  ? 127  ILE A CG2 1 
ATOM   973   C  CD1 . ILE A  1  127 ? 29.331 68.942  90.741  1.00 36.67  ? 127  ILE A CD1 1 
ATOM   974   N  N   . GLU A  1  128 ? 32.130 68.353  88.002  1.00 38.85  ? 128  GLU A N   1 
ATOM   975   C  CA  . GLU A  1  128 ? 32.879 67.164  88.261  1.00 38.46  ? 128  GLU A CA  1 
ATOM   976   C  C   . GLU A  1  128 ? 34.364 67.385  87.986  1.00 37.87  ? 128  GLU A C   1 
ATOM   977   O  O   . GLU A  1  128 ? 35.204 66.792  88.646  1.00 38.49  ? 128  GLU A O   1 
ATOM   978   C  CB  . GLU A  1  128 ? 32.329 65.987  87.451  1.00 38.87  ? 128  GLU A CB  1 
ATOM   979   C  CG  . GLU A  1  128 ? 32.471 64.649  88.143  1.00 49.66  ? 128  GLU A CG  1 
ATOM   980   C  CD  . GLU A  1  128 ? 31.595 64.530  89.389  1.00 53.17  ? 128  GLU A CD  1 
ATOM   981   O  OE1 . GLU A  1  128 ? 30.598 65.277  89.510  1.00 47.38  ? 128  GLU A OE1 1 
ATOM   982   O  OE2 . GLU A  1  128 ? 31.888 63.663  90.236  1.00 56.67  ? 128  GLU A OE2 1 
ATOM   983   N  N   . LYS A  1  129 ? 34.696 68.251  87.029  1.00 36.67  ? 129  LYS A N   1 
ATOM   984   C  CA  . LYS A  1  129 ? 36.122 68.549  86.753  1.00 35.50  ? 129  LYS A CA  1 
ATOM   985   C  C   . LYS A  1  129 ? 36.694 69.431  87.864  1.00 34.69  ? 129  LYS A C   1 
ATOM   986   O  O   . LYS A  1  129 ? 37.886 69.366  88.195  1.00 34.24  ? 129  LYS A O   1 
ATOM   987   C  CB  . LYS A  1  129 ? 36.294 69.271  85.415  1.00 35.28  ? 129  LYS A CB  1 
ATOM   988   C  CG  . LYS A  1  129 ? 36.395 68.381  84.215  1.00 45.45  ? 129  LYS A CG  1 
ATOM   989   C  CD  . LYS A  1  129 ? 36.785 69.182  82.967  1.00 51.32  ? 129  LYS A CD  1 
ATOM   990   C  CE  . LYS A  1  129 ? 36.680 68.326  81.707  1.00 59.55  ? 129  LYS A CE  1 
ATOM   991   N  NZ  . LYS A  1  129 ? 36.908 69.112  80.462  1.00 60.58  ? 129  LYS A NZ  1 
ATOM   992   N  N   . GLU A  1  130 ? 35.832 70.242  88.442  1.00 34.39  ? 130  GLU A N   1 
ATOM   993   C  CA  . GLU A  1  130 ? 36.246 71.154  89.441  1.00 34.63  ? 130  GLU A CA  1 
ATOM   994   C  C   . GLU A  1  130 ? 36.528 70.550  90.765  1.00 35.41  ? 130  GLU A C   1 
ATOM   995   O  O   . GLU A  1  130 ? 37.218 71.165  91.580  1.00 35.88  ? 130  GLU A O   1 
ATOM   996   C  CB  . GLU A  1  130 ? 35.270 72.307  89.570  1.00 34.62  ? 130  GLU A CB  1 
ATOM   997   C  CG  . GLU A  1  130 ? 35.118 73.125  88.317  1.00 37.37  ? 130  GLU A CG  1 
ATOM   998   C  CD  . GLU A  1  130 ? 36.373 73.816  87.930  1.00 39.92  ? 130  GLU A CD  1 
ATOM   999   O  OE1 . GLU A  1  130 ? 36.373 75.032  87.918  1.00 58.04  ? 130  GLU A OE1 1 
ATOM   1000  O  OE2 . GLU A  1  130 ? 37.354 73.158  87.632  1.00 40.44  ? 130  GLU A OE2 1 
ATOM   1001  N  N   . ARG A  1  131 ? 35.994 69.361  91.033  1.00 35.33  ? 131  ARG A N   1 
ATOM   1002  C  CA  . ARG A  1  131 ? 36.306 68.757  92.298  1.00 34.89  ? 131  ARG A CA  1 
ATOM   1003  C  C   . ARG A  1  131 ? 37.794 68.322  92.368  1.00 34.45  ? 131  ARG A C   1 
ATOM   1004  O  O   . ARG A  1  131 ? 38.454 68.547  93.369  1.00 33.95  ? 131  ARG A O   1 
ATOM   1005  C  CB  . ARG A  1  131 ? 35.246 67.713  92.777  1.00 34.82  ? 131  ARG A CB  1 
ATOM   1006  C  CG  . ARG A  1  131 ? 35.169 66.387  92.063  1.00 40.44  ? 131  ARG A CG  1 
ATOM   1007  C  CD  . ARG A  1  131 ? 33.748 65.639  92.230  1.00 39.46  ? 131  ARG A CD  1 
ATOM   1008  N  NE  . ARG A  1  131 ? 33.030 66.080  93.435  1.00 39.13  ? 131  ARG A NE  1 
ATOM   1009  C  CZ  . ARG A  1  131 ? 31.726 66.410  93.480  1.00 35.80  ? 131  ARG A CZ  1 
ATOM   1010  N  NH1 . ARG A  1  131 ? 30.977 66.324  92.406  1.00 32.39  ? 131  ARG A NH1 1 
ATOM   1011  N  NH2 . ARG A  1  131 ? 31.179 66.817  94.617  1.00 37.13  ? 131  ARG A NH2 1 
ATOM   1012  N  N   . ASP A  1  132 ? 38.333 67.854  91.238  1.00 34.77  ? 132  ASP A N   1 
ATOM   1013  C  CA  . ASP A  1  132 ? 39.742 67.456  91.149  1.00 35.34  ? 132  ASP A CA  1 
ATOM   1014  C  C   . ASP A  1  132 ? 40.639 68.659  91.261  1.00 35.70  ? 132  ASP A C   1 
ATOM   1015  O  O   . ASP A  1  132 ? 41.721 68.583  91.865  1.00 36.43  ? 132  ASP A O   1 
ATOM   1016  C  CB  . ASP A  1  132 ? 40.027 66.796  89.824  1.00 35.83  ? 132  ASP A CB  1 
ATOM   1017  C  CG  . ASP A  1  132 ? 39.515 65.408  89.756  1.00 45.33  ? 132  ASP A CG  1 
ATOM   1018  O  OD1 . ASP A  1  132 ? 39.299 64.795  90.845  1.00 47.25  ? 132  ASP A OD1 1 
ATOM   1019  O  OD2 . ASP A  1  132 ? 39.305 64.828  88.659  1.00 43.54  ? 132  ASP A OD2 1 
ATOM   1020  N  N   . VAL A  1  133 ? 40.202 69.769  90.648  1.00 34.94  ? 133  VAL A N   1 
ATOM   1021  C  CA  . VAL A  1  133 ? 40.938 71.033  90.683  1.00 33.71  ? 133  VAL A CA  1 
ATOM   1022  C  C   . VAL A  1  133 ? 41.014 71.566  92.096  1.00 33.51  ? 133  VAL A C   1 
ATOM   1023  O  O   . VAL A  1  133 ? 42.097 71.836  92.577  1.00 33.56  ? 133  VAL A O   1 
ATOM   1024  C  CB  . VAL A  1  133 ? 40.321 72.087  89.724  1.00 33.02  ? 133  VAL A CB  1 
ATOM   1025  C  CG1 . VAL A  1  133 ? 40.944 73.455  89.940  1.00 20.63  ? 133  VAL A CG1 1 
ATOM   1026  C  CG2 . VAL A  1  133 ? 40.515 71.660  88.301  1.00 14.24  ? 133  VAL A CG2 1 
ATOM   1027  N  N   . ILE A  1  134 ? 39.866 71.654  92.782  1.00 33.35  ? 134  ILE A N   1 
ATOM   1028  C  CA  . ILE A  1  134 ? 39.833 72.155  94.168  1.00 33.52  ? 134  ILE A CA  1 
ATOM   1029  C  C   . ILE A  1  134 ? 40.648 71.267  95.132  1.00 33.59  ? 134  ILE A C   1 
ATOM   1030  O  O   . ILE A  1  134 ? 41.419 71.786  95.949  1.00 33.33  ? 134  ILE A O   1 
ATOM   1031  C  CB  . ILE A  1  134 ? 38.387 72.325  94.679  1.00 33.67  ? 134  ILE A CB  1 
ATOM   1032  C  CG1 . ILE A  1  134 ? 37.632 73.345  93.849  1.00 32.85  ? 134  ILE A CG1 1 
ATOM   1033  C  CG2 . ILE A  1  134 ? 38.377 72.795  96.093  1.00 35.19  ? 134  ILE A CG2 1 
ATOM   1034  C  CD1 . ILE A  1  134 ? 36.171 73.480  94.252  1.00 33.71  ? 134  ILE A CD1 1 
ATOM   1035  N  N   . LEU A  1  135 ? 40.498 69.935  95.031  1.00 33.32  ? 135  LEU A N   1 
ATOM   1036  C  CA  . LEU A  1  135 ? 41.296 69.031  95.897  1.00 33.32  ? 135  LEU A CA  1 
ATOM   1037  C  C   . LEU A  1  135 ? 42.797 69.261  95.714  1.00 34.04  ? 135  LEU A C   1 
ATOM   1038  O  O   . LEU A  1  135 ? 43.574 69.173  96.679  1.00 33.99  ? 135  LEU A O   1 
ATOM   1039  C  CB  . LEU A  1  135 ? 40.987 67.573  95.629  1.00 32.82  ? 135  LEU A CB  1 
ATOM   1040  C  CG  . LEU A  1  135 ? 39.595 67.102  96.036  1.00 27.81  ? 135  LEU A CG  1 
ATOM   1041  C  CD1 . LEU A  1  135 ? 39.181 65.863  95.250  1.00 13.91  ? 135  LEU A CD1 1 
ATOM   1042  C  CD2 . LEU A  1  135 ? 39.461 66.909  97.509  1.00 19.08  ? 135  LEU A CD2 1 
ATOM   1043  N  N   . GLN A  1  136 ? 43.207 69.531  94.468  1.00 34.40  ? 136  GLN A N   1 
ATOM   1044  C  CA  . GLN A  1  136 ? 44.604 69.809  94.189  1.00 34.19  ? 136  GLN A CA  1 
ATOM   1045  C  C   . GLN A  1  136 ? 45.004 71.083  94.872  1.00 33.44  ? 136  GLN A C   1 
ATOM   1046  O  O   . GLN A  1  136 ? 46.085 71.163  95.440  1.00 33.82  ? 136  GLN A O   1 
ATOM   1047  C  CB  . GLN A  1  136 ? 44.889 69.880  92.688  1.00 34.38  ? 136  GLN A CB  1 
ATOM   1048  C  CG  . GLN A  1  136 ? 45.135 68.526  92.052  1.00 54.32  ? 136  GLN A CG  1 
ATOM   1049  C  CD  . GLN A  1  136 ? 46.241 67.735  92.760  1.00 65.75  ? 136  GLN A CD  1 
ATOM   1050  O  OE1 . GLN A  1  136 ? 46.025 66.596  93.184  1.00 70.87  ? 136  GLN A OE1 1 
ATOM   1051  N  NE2 . GLN A  1  136 ? 47.422 68.337  92.881  1.00 73.60  ? 136  GLN A NE2 1 
ATOM   1052  N  N   . GLU A  1  137 ? 44.101 72.060  94.869  1.00 32.38  ? 137  GLU A N   1 
ATOM   1053  C  CA  . GLU A  1  137 ? 44.343 73.345  95.534  1.00 31.62  ? 137  GLU A CA  1 
ATOM   1054  C  C   . GLU A  1  137 ? 44.454 73.195  97.052  1.00 32.21  ? 137  GLU A C   1 
ATOM   1055  O  O   . GLU A  1  137 ? 45.253 73.872  97.694  1.00 32.55  ? 137  GLU A O   1 
ATOM   1056  C  CB  . GLU A  1  137 ? 43.293 74.365  95.137  1.00 30.66  ? 137  GLU A CB  1 
ATOM   1057  C  CG  . GLU A  1  137 ? 43.423 74.717  93.660  1.00 31.96  ? 137  GLU A CG  1 
ATOM   1058  C  CD  . GLU A  1  137 ? 42.321 75.599  93.142  1.00 39.91  ? 137  GLU A CD  1 
ATOM   1059  O  OE1 . GLU A  1  137 ? 42.345 75.910  91.929  1.00 44.05  ? 137  GLU A OE1 1 
ATOM   1060  O  OE2 . GLU A  1  137 ? 41.446 76.011  93.940  1.00 40.93  ? 137  GLU A OE2 1 
ATOM   1061  N  N   . LEU A  1  138 ? 43.722 72.247  97.608  1.00 32.40  ? 138  LEU A N   1 
ATOM   1062  C  CA  . LEU A  1  138 ? 43.819 71.999  98.999  1.00 33.01  ? 138  LEU A CA  1 
ATOM   1063  C  C   . LEU A  1  138 ? 45.194 71.444  99.267  1.00 34.80  ? 138  LEU A C   1 
ATOM   1064  O  O   . LEU A  1  138 ? 45.815 71.770  100.295 1.00 35.26  ? 138  LEU A O   1 
ATOM   1065  C  CB  . LEU A  1  138 ? 42.765 70.986  99.454  1.00 32.07  ? 138  LEU A CB  1 
ATOM   1066  C  CG  . LEU A  1  138 ? 41.323 71.433  99.313  1.00 29.72  ? 138  LEU A CG  1 
ATOM   1067  C  CD1 . LEU A  1  138 ? 40.345 70.375  99.859  1.00 29.17  ? 138  LEU A CD1 1 
ATOM   1068  C  CD2 . LEU A  1  138 ? 41.107 72.738  99.992  1.00 27.52  ? 138  LEU A CD2 1 
ATOM   1069  N  N   . GLN A  1  139 ? 45.700 70.624  98.338  1.00 35.82  ? 139  GLN A N   1 
ATOM   1070  C  CA  . GLN A  1  139 ? 47.001 69.991  98.540  1.00 37.16  ? 139  GLN A CA  1 
ATOM   1071  C  C   . GLN A  1  139 ? 48.084 71.041  98.461  1.00 37.15  ? 139  GLN A C   1 
ATOM   1072  O  O   . GLN A  1  139 ? 49.073 71.004  99.196  1.00 36.84  ? 139  GLN A O   1 
ATOM   1073  C  CB  . GLN A  1  139 ? 47.231 68.861  97.539  1.00 37.87  ? 139  GLN A CB  1 
ATOM   1074  C  CG  . GLN A  1  139 ? 48.145 67.744  98.049  1.00 55.06  ? 139  GLN A CG  1 
ATOM   1075  C  CD  . GLN A  1  139 ? 48.073 66.459  97.185  1.00 68.90  ? 139  GLN A CD  1 
ATOM   1076  O  OE1 . GLN A  1  139 ? 47.715 66.512  96.002  1.00 73.72  ? 139  GLN A OE1 1 
ATOM   1077  N  NE2 . GLN A  1  139 ? 48.408 65.314  97.788  1.00 76.15  ? 139  GLN A NE2 1 
ATOM   1078  N  N   . GLU A  1  140 ? 47.861 72.000  97.589  1.00 37.24  ? 140  GLU A N   1 
ATOM   1079  C  CA  . GLU A  1  140 ? 48.750 73.098  97.440  1.00 37.31  ? 140  GLU A CA  1 
ATOM   1080  C  C   . GLU A  1  140 ? 48.731 73.997  98.667  1.00 37.00  ? 140  GLU A C   1 
ATOM   1081  O  O   . GLU A  1  140 ? 49.804 74.312  99.221  1.00 37.42  ? 140  GLU A O   1 
ATOM   1082  C  CB  . GLU A  1  140 ? 48.368 73.907  96.239  1.00 37.30  ? 140  GLU A CB  1 
ATOM   1083  C  CG  . GLU A  1  140 ? 48.835 73.302  94.967  1.00 37.61  ? 140  GLU A CG  1 
ATOM   1084  C  CD  . GLU A  1  140 ? 48.267 74.007  93.770  1.00 47.15  ? 140  GLU A CD  1 
ATOM   1085  O  OE1 . GLU A  1  140 ? 47.727 75.137  93.916  1.00 53.41  ? 140  GLU A OE1 1 
ATOM   1086  O  OE2 . GLU A  1  140 ? 48.353 73.436  92.693  1.00 50.73  ? 140  GLU A OE2 1 
ATOM   1087  N  N   . ASN A  1  141 ? 47.525 74.420  99.093  1.00 35.38  ? 141  ASN A N   1 
ATOM   1088  C  CA  . ASN A  1  141 ? 47.422 75.290  100.260 1.00 34.40  ? 141  ASN A CA  1 
ATOM   1089  C  C   . ASN A  1  141 ? 48.128 74.663  101.522 1.00 33.97  ? 141  ASN A C   1 
ATOM   1090  O  O   . ASN A  1  141 ? 48.695 75.373  102.328 1.00 34.82  ? 141  ASN A O   1 
ATOM   1091  C  CB  . ASN A  1  141 ? 45.960 75.694  100.592 1.00 34.35  ? 141  ASN A CB  1 
ATOM   1092  C  CG  . ASN A  1  141 ? 45.170 76.307  99.370  1.00 32.88  ? 141  ASN A CG  1 
ATOM   1093  O  OD1 . ASN A  1  141 ? 43.910 76.301  99.363  1.00 34.00  ? 141  ASN A OD1 1 
ATOM   1094  N  ND2 . ASN A  1  141 ? 45.879 76.805  98.376  1.00 25.73  ? 141  ASN A ND2 1 
ATOM   1095  N  N   . ASP A  1  142 ? 48.156 73.342  101.623 1.00 32.94  ? 142  ASP A N   1 
ATOM   1096  C  CA  . ASP A  1  142 ? 48.834 72.675  102.737 1.00 32.32  ? 142  ASP A CA  1 
ATOM   1097  C  C   . ASP A  1  142 ? 50.313 72.991  102.836 1.00 32.46  ? 142  ASP A C   1 
ATOM   1098  O  O   . ASP A  1  142 ? 50.877 72.962  103.935 1.00 32.93  ? 142  ASP A O   1 
ATOM   1099  C  CB  . ASP A  1  142 ? 48.674 71.180  102.653 1.00 31.98  ? 142  ASP A CB  1 
ATOM   1100  C  CG  . ASP A  1  142 ? 47.337 70.723  103.107 1.00 34.25  ? 142  ASP A CG  1 
ATOM   1101  O  OD1 . ASP A  1  142 ? 47.073 69.503  103.003 1.00 45.35  ? 142  ASP A OD1 1 
ATOM   1102  O  OD2 . ASP A  1  142 ? 46.473 71.488  103.595 1.00 39.03  ? 142  ASP A OD2 1 
ATOM   1103  N  N   . THR A  1  143 ? 50.954 73.273  101.703 1.00 31.92  ? 143  THR A N   1 
ATOM   1104  C  CA  . THR A  1  143 ? 52.366 73.607  101.719 1.00 32.14  ? 143  THR A CA  1 
ATOM   1105  C  C   . THR A  1  143 ? 52.645 75.045  102.159 1.00 32.02  ? 143  THR A C   1 
ATOM   1106  O  O   . THR A  1  143 ? 53.762 75.383  102.513 1.00 32.18  ? 143  THR A O   1 
ATOM   1107  C  CB  . THR A  1  143 ? 53.020 73.334  100.388 1.00 32.57  ? 143  THR A CB  1 
ATOM   1108  O  OG1 . THR A  1  143 ? 52.371 74.102  99.360  1.00 43.99  ? 143  THR A OG1 1 
ATOM   1109  C  CG2 . THR A  1  143 ? 52.798 71.862  99.980  1.00 16.05  ? 143  THR A CG2 1 
ATOM   1110  N  N   . SER A  1  144 ? 51.637 75.887  102.135 1.00 31.52  ? 144  SER A N   1 
ATOM   1111  C  CA  . SER A  1  144 ? 51.819 77.226  102.602 1.00 31.20  ? 144  SER A CA  1 
ATOM   1112  C  C   . SER A  1  144 ? 51.641 77.321  104.138 1.00 31.23  ? 144  SER A C   1 
ATOM   1113  O  O   . SER A  1  144 ? 50.522 77.523  104.621 1.00 32.15  ? 144  SER A O   1 
ATOM   1114  C  CB  . SER A  1  144 ? 50.826 78.139  101.943 1.00 31.49  ? 144  SER A CB  1 
ATOM   1115  O  OG  . SER A  1  144 ? 50.610 79.298  102.734 1.00 33.77  ? 144  SER A OG  1 
ATOM   1116  N  N   . MET A  1  145 ? 52.725 77.227  104.895 1.00 30.15  ? 145  MET A N   1 
ATOM   1117  C  CA  . MET A  1  145 ? 52.618 77.285  106.354 1.00 30.17  ? 145  MET A CA  1 
ATOM   1118  C  C   . MET A  1  145 ? 51.784 78.432  106.882 1.00 31.18  ? 145  MET A C   1 
ATOM   1119  O  O   . MET A  1  145 ? 51.022 78.266  107.795 1.00 31.40  ? 145  MET A O   1 
ATOM   1120  C  CB  . MET A  1  145 ? 53.989 77.254  107.041 1.00 29.48  ? 145  MET A CB  1 
ATOM   1121  C  CG  . MET A  1  145 ? 54.713 75.940  106.885 1.00 24.75  ? 145  MET A CG  1 
ATOM   1122  S  SD  . MET A  1  145 ? 56.209 75.789  107.863 1.00 33.26  ? 145  MET A SD  1 
ATOM   1123  C  CE  . MET A  1  145 ? 55.581 75.819  109.525 1.00 25.31  ? 145  MET A CE  1 
ATOM   1124  N  N   . ARG A  1  146 ? 51.904 79.578  106.255 1.00 32.12  ? 146  ARG A N   1 
ATOM   1125  C  CA  . ARG A  1  146 ? 51.190 80.766  106.656 1.00 32.85  ? 146  ARG A CA  1 
ATOM   1126  C  C   . ARG A  1  146 ? 49.672 80.628  106.484 1.00 33.26  ? 146  ARG A C   1 
ATOM   1127  O  O   . ARG A  1  146 ? 48.904 80.953  107.407 1.00 33.72  ? 146  ARG A O   1 
ATOM   1128  C  CB  . ARG A  1  146 ? 51.703 81.948  105.868 1.00 33.24  ? 146  ARG A CB  1 
ATOM   1129  C  CG  . ARG A  1  146 ? 50.988 83.145  106.087 1.00 45.76  ? 146  ARG A CG  1 
ATOM   1130  C  CD  . ARG A  1  146 ? 50.649 83.884  104.834 1.00 61.41  ? 146  ARG A CD  1 
ATOM   1131  N  NE  . ARG A  1  146 ? 49.654 84.876  105.168 1.00 71.18  ? 146  ARG A NE  1 
ATOM   1132  C  CZ  . ARG A  1  146 ? 49.949 86.060  105.634 1.00 64.18  ? 146  ARG A CZ  1 
ATOM   1133  N  NH1 . ARG A  1  146 ? 51.231 86.416  105.729 1.00 53.20  ? 146  ARG A NH1 1 
ATOM   1134  N  NH2 . ARG A  1  146 ? 48.971 86.912  105.970 1.00 60.72  ? 146  ARG A NH2 1 
ATOM   1135  N  N   . ASP A  1  147 ? 49.232 80.117  105.338 1.00 33.07  ? 147  ASP A N   1 
ATOM   1136  C  CA  . ASP A  1  147 ? 47.792 79.937  105.120 1.00 33.40  ? 147  ASP A CA  1 
ATOM   1137  C  C   . ASP A  1  147 ? 47.223 78.939  106.134 1.00 33.80  ? 147  ASP A C   1 
ATOM   1138  O  O   . ASP A  1  147 ? 46.132 79.136  106.680 1.00 34.19  ? 147  ASP A O   1 
ATOM   1139  C  CB  . ASP A  1  147 ? 47.513 79.469  103.707 1.00 33.84  ? 147  ASP A CB  1 
ATOM   1140  C  CG  . ASP A  1  147 ? 47.676 80.573  102.680 1.00 37.24  ? 147  ASP A CG  1 
ATOM   1141  O  OD1 . ASP A  1  147 ? 48.527 81.445  102.870 1.00 55.42  ? 147  ASP A OD1 1 
ATOM   1142  O  OD2 . ASP A  1  147 ? 47.012 80.630  101.636 1.00 47.78  ? 147  ASP A OD2 1 
ATOM   1143  N  N   . VAL A  1  148 ? 47.979 77.875  106.385 1.00 33.51  ? 148  VAL A N   1 
ATOM   1144  C  CA  . VAL A  1  148 ? 47.603 76.872  107.350 1.00 32.84  ? 148  VAL A CA  1 
ATOM   1145  C  C   . VAL A  1  148 ? 47.410 77.483  108.740 1.00 33.08  ? 148  VAL A C   1 
ATOM   1146  O  O   . VAL A  1  148 ? 46.342 77.301  109.338 1.00 34.29  ? 148  VAL A O   1 
ATOM   1147  C  CB  . VAL A  1  148 ? 48.656 75.797  107.421 1.00 32.65  ? 148  VAL A CB  1 
ATOM   1148  C  CG1 . VAL A  1  148 ? 48.443 74.893  108.598 1.00 28.49  ? 148  VAL A CG1 1 
ATOM   1149  C  CG2 . VAL A  1  148 ? 48.695 75.039  106.160 1.00 29.07  ? 148  VAL A CG2 1 
ATOM   1150  N  N   . VAL A  1  149 ? 48.392 78.262  109.232 1.00 31.42  ? 149  VAL A N   1 
ATOM   1151  C  CA  . VAL A  1  149 ? 48.277 78.840  110.592 1.00 31.22  ? 149  VAL A CA  1 
ATOM   1152  C  C   . VAL A  1  149 ? 47.089 79.793  110.786 1.00 31.25  ? 149  VAL A C   1 
ATOM   1153  O  O   . VAL A  1  149 ? 46.503 79.864  111.874 1.00 31.18  ? 149  VAL A O   1 
ATOM   1154  C  CB  . VAL A  1  149 ? 49.555 79.571  111.063 1.00 31.36  ? 149  VAL A CB  1 
ATOM   1155  C  CG1 . VAL A  1  149 ? 49.683 79.465  112.542 1.00 28.06  ? 149  VAL A CG1 1 
ATOM   1156  C  CG2 . VAL A  1  149 ? 50.691 78.983  110.499 1.00 43.60  ? 149  VAL A CG2 1 
ATOM   1157  N  N   . PHE A  1  150 ? 46.748 80.547  109.764 1.00 31.35  ? 150  PHE A N   1 
ATOM   1158  C  CA  . PHE A  1  150 ? 45.611 81.433  109.894 1.00 31.68  ? 150  PHE A CA  1 
ATOM   1159  C  C   . PHE A  1  150 ? 44.290 80.649  109.864 1.00 32.02  ? 150  PHE A C   1 
ATOM   1160  O  O   . PHE A  1  150 ? 43.297 81.076  110.474 1.00 32.76  ? 150  PHE A O   1 
ATOM   1161  C  CB  . PHE A  1  150 ? 45.651 82.546  108.880 1.00 31.70  ? 150  PHE A CB  1 
ATOM   1162  C  CG  . PHE A  1  150 ? 46.555 83.669  109.271 1.00 35.77  ? 150  PHE A CG  1 
ATOM   1163  C  CD1 . PHE A  1  150 ? 47.919 83.561  109.119 1.00 36.04  ? 150  PHE A CD1 1 
ATOM   1164  C  CD2 . PHE A  1  150 ? 46.038 84.827  109.843 1.00 42.55  ? 150  PHE A CD2 1 
ATOM   1165  C  CE1 . PHE A  1  150 ? 48.771 84.615  109.493 1.00 35.00  ? 150  PHE A CE1 1 
ATOM   1166  C  CE2 . PHE A  1  150 ? 46.880 85.869  110.222 1.00 42.70  ? 150  PHE A CE2 1 
ATOM   1167  C  CZ  . PHE A  1  150 ? 48.247 85.753  110.041 1.00 36.16  ? 150  PHE A CZ  1 
ATOM   1168  N  N   . ASN A  1  151 ? 44.285 79.489  109.184 1.00 30.98  ? 151  ASN A N   1 
ATOM   1169  C  CA  . ASN A  1  151 ? 43.118 78.649  109.210 1.00 30.51  ? 151  ASN A CA  1 
ATOM   1170  C  C   . ASN A  1  151 ? 43.031 77.988  110.564 1.00 30.93  ? 151  ASN A C   1 
ATOM   1171  O  O   . ASN A  1  151 ? 41.942 77.859  111.116 1.00 31.56  ? 151  ASN A O   1 
ATOM   1172  C  CB  . ASN A  1  151 ? 43.105 77.625  108.085 1.00 29.96  ? 151  ASN A CB  1 
ATOM   1173  C  CG  . ASN A  1  151 ? 42.640 78.221  106.774 1.00 25.94  ? 151  ASN A CG  1 
ATOM   1174  O  OD1 . ASN A  1  151 ? 41.795 79.138  106.752 1.00 26.75  ? 151  ASN A OD1 1 
ATOM   1175  N  ND2 . ASN A  1  151 ? 43.213 77.748  105.670 1.00 14.35  ? 151  ASN A ND2 1 
ATOM   1176  N  N   . TYR A  1  152 ? 44.190 77.615  111.125 1.00 30.62  ? 152  TYR A N   1 
ATOM   1177  C  CA  . TYR A  1  152 ? 44.245 77.020  112.481 1.00 30.49  ? 152  TYR A CA  1 
ATOM   1178  C  C   . TYR A  1  152 ? 43.761 78.024  113.520 1.00 30.44  ? 152  TYR A C   1 
ATOM   1179  O  O   . TYR A  1  152 ? 42.906 77.708  114.335 1.00 30.47  ? 152  TYR A O   1 
ATOM   1180  C  CB  . TYR A  1  152 ? 45.669 76.574  112.849 1.00 30.38  ? 152  TYR A CB  1 
ATOM   1181  C  CG  . TYR A  1  152 ? 46.095 75.245  112.276 1.00 29.84  ? 152  TYR A CG  1 
ATOM   1182  C  CD1 . TYR A  1  152 ? 47.361 74.763  112.506 1.00 28.47  ? 152  TYR A CD1 1 
ATOM   1183  C  CD2 . TYR A  1  152 ? 45.214 74.457  111.518 1.00 29.30  ? 152  TYR A CD2 1 
ATOM   1184  C  CE1 . TYR A  1  152 ? 47.771 73.541  111.995 1.00 31.45  ? 152  TYR A CE1 1 
ATOM   1185  C  CE2 . TYR A  1  152 ? 45.619 73.242  110.996 1.00 27.73  ? 152  TYR A CE2 1 
ATOM   1186  C  CZ  . TYR A  1  152 ? 46.906 72.785  111.247 1.00 29.55  ? 152  TYR A CZ  1 
ATOM   1187  O  OH  . TYR A  1  152 ? 47.346 71.580  110.741 1.00 27.28  ? 152  TYR A OH  1 
ATOM   1188  N  N   . LEU A  1  153 ? 44.300 79.235  113.465 1.00 30.67  ? 153  LEU A N   1 
ATOM   1189  C  CA  . LEU A  1  153 ? 43.910 80.303  114.381 1.00 31.38  ? 153  LEU A CA  1 
ATOM   1190  C  C   . LEU A  1  153 ? 42.403 80.568  114.340 1.00 31.50  ? 153  LEU A C   1 
ATOM   1191  O  O   . LEU A  1  153 ? 41.783 80.740  115.370 1.00 31.43  ? 153  LEU A O   1 
ATOM   1192  C  CB  . LEU A  1  153 ? 44.684 81.575  114.054 1.00 32.03  ? 153  LEU A CB  1 
ATOM   1193  C  CG  . LEU A  1  153 ? 44.391 82.849  114.828 1.00 36.70  ? 153  LEU A CG  1 
ATOM   1194  C  CD1 . LEU A  1  153 ? 45.116 82.850  116.128 1.00 33.35  ? 153  LEU A CD1 1 
ATOM   1195  C  CD2 . LEU A  1  153 ? 44.827 84.011  113.992 1.00 38.09  ? 153  LEU A CD2 1 
ATOM   1196  N  N   . HIS A  1  154 ? 41.816 80.536  113.151 1.00 31.76  ? 154  HIS A N   1 
ATOM   1197  C  CA  . HIS A  1  154 ? 40.380 80.732  113.028 1.00 32.29  ? 154  HIS A CA  1 
ATOM   1198  C  C   . HIS A  1  154 ? 39.672 79.573  113.633 1.00 33.08  ? 154  HIS A C   1 
ATOM   1199  O  O   . HIS A  1  154 ? 38.723 79.738  114.393 1.00 33.94  ? 154  HIS A O   1 
ATOM   1200  C  CB  . HIS A  1  154 ? 39.977 80.824  111.580 1.00 32.54  ? 154  HIS A CB  1 
ATOM   1201  C  CG  . HIS A  1  154 ? 40.068 82.200  111.025 1.00 38.61  ? 154  HIS A CG  1 
ATOM   1202  N  ND1 . HIS A  1  154 ? 41.235 82.711  110.497 1.00 31.89  ? 154  HIS A ND1 1 
ATOM   1203  C  CD2 . HIS A  1  154 ? 39.153 83.193  110.949 1.00 37.22  ? 154  HIS A CD2 1 
ATOM   1204  C  CE1 . HIS A  1  154 ? 41.034 83.955  110.118 1.00 29.31  ? 154  HIS A CE1 1 
ATOM   1205  N  NE2 . HIS A  1  154 ? 39.775 84.270  110.372 1.00 41.61  ? 154  HIS A NE2 1 
ATOM   1206  N  N   . ALA A  1  155 ? 40.142 78.383  113.318 1.00 32.55  ? 155  ALA A N   1 
ATOM   1207  C  CA  . ALA A  1  155 ? 39.528 77.185  113.832 1.00 31.68  ? 155  ALA A CA  1 
ATOM   1208  C  C   . ALA A  1  155 ? 39.572 77.084  115.391 1.00 31.53  ? 155  ALA A C   1 
ATOM   1209  O  O   . ALA A  1  155 ? 38.671 76.524  115.998 1.00 32.12  ? 155  ALA A O   1 
ATOM   1210  C  CB  . ALA A  1  155 ? 40.136 75.950  113.180 1.00 31.03  ? 155  ALA A CB  1 
ATOM   1211  N  N   . THR A  1  156 ? 40.585 77.649  116.033 1.00 30.50  ? 156  THR A N   1 
ATOM   1212  C  CA  . THR A  1  156 ? 40.624 77.538  117.477 1.00 29.96  ? 156  THR A CA  1 
ATOM   1213  C  C   . THR A  1  156 ? 39.933 78.703  118.139 1.00 29.74  ? 156  THR A C   1 
ATOM   1214  O  O   . THR A  1  156 ? 39.147 78.513  119.047 1.00 28.65  ? 156  THR A O   1 
ATOM   1215  C  CB  . THR A  1  156 ? 42.081 77.288  118.027 1.00 29.98  ? 156  THR A CB  1 
ATOM   1216  O  OG1 . THR A  1  156 ? 42.043 77.137  119.449 1.00 26.01  ? 156  THR A OG1 1 
ATOM   1217  C  CG2 . THR A  1  156 ? 42.980 78.505  117.827 1.00 24.36  ? 156  THR A CG2 1 
ATOM   1218  N  N   . ALA A  1  157 ? 40.190 79.919  117.625 1.00 30.54  ? 157  ALA A N   1 
ATOM   1219  C  CA  . ALA A  1  157 ? 39.584 81.129  118.147 1.00 30.64  ? 157  ALA A CA  1 
ATOM   1220  C  C   . ALA A  1  157 ? 38.069 81.066  118.058 1.00 31.26  ? 157  ALA A C   1 
ATOM   1221  O  O   . ALA A  1  157 ? 37.375 81.443  118.991 1.00 30.89  ? 157  ALA A O   1 
ATOM   1222  C  CB  . ALA A  1  157 ? 40.077 82.302  117.407 1.00 30.64  ? 157  ALA A CB  1 
ATOM   1223  N  N   . PHE A  1  158 ? 37.560 80.568  116.932 1.00 32.41  ? 158  PHE A N   1 
ATOM   1224  C  CA  . PHE A  1  158 ? 36.107 80.478  116.714 1.00 33.28  ? 158  PHE A CA  1 
ATOM   1225  C  C   . PHE A  1  158 ? 35.521 79.063  116.787 1.00 34.06  ? 158  PHE A C   1 
ATOM   1226  O  O   . PHE A  1  158 ? 34.527 78.777  116.135 1.00 34.65  ? 158  PHE A O   1 
ATOM   1227  C  CB  . PHE A  1  158 ? 35.738 81.119  115.396 1.00 33.61  ? 158  PHE A CB  1 
ATOM   1228  C  CG  . PHE A  1  158 ? 36.187 82.552  115.269 1.00 33.76  ? 158  PHE A CG  1 
ATOM   1229  C  CD1 . PHE A  1  158 ? 35.662 83.529  116.091 1.00 27.35  ? 158  PHE A CD1 1 
ATOM   1230  C  CD2 . PHE A  1  158 ? 37.114 82.912  114.323 1.00 35.00  ? 158  PHE A CD2 1 
ATOM   1231  C  CE1 . PHE A  1  158 ? 36.060 84.823  115.981 1.00 31.84  ? 158  PHE A CE1 1 
ATOM   1232  C  CE2 . PHE A  1  158 ? 37.516 84.231  114.197 1.00 35.24  ? 158  PHE A CE2 1 
ATOM   1233  C  CZ  . PHE A  1  158 ? 36.991 85.178  115.021 1.00 32.51  ? 158  PHE A CZ  1 
ATOM   1234  N  N   . GLN A  1  159 ? 36.127 78.223  117.624 1.00 34.24  ? 159  GLN A N   1 
ATOM   1235  C  CA  . GLN A  1  159 ? 35.734 76.829  117.892 1.00 34.38  ? 159  GLN A CA  1 
ATOM   1236  C  C   . GLN A  1  159 ? 34.466 76.136  117.358 1.00 35.47  ? 159  GLN A C   1 
ATOM   1237  O  O   . GLN A  1  159 ? 34.558 75.202  116.523 1.00 36.63  ? 159  GLN A O   1 
ATOM   1238  C  CB  . GLN A  1  159 ? 35.991 76.468  119.326 1.00 33.81  ? 159  GLN A CB  1 
ATOM   1239  C  CG  . GLN A  1  159 ? 37.386 75.978  119.507 1.00 29.23  ? 159  GLN A CG  1 
ATOM   1240  C  CD  . GLN A  1  159 ? 37.780 75.858  120.933 1.00 28.51  ? 159  GLN A CD  1 
ATOM   1241  O  OE1 . GLN A  1  159 ? 36.973 75.477  121.762 1.00 28.61  ? 159  GLN A OE1 1 
ATOM   1242  N  NE2 . GLN A  1  159 ? 39.048 76.142  121.231 1.00 25.72  ? 159  GLN A NE2 1 
ATOM   1243  N  N   . GLY A  1  160 ? 33.307 76.508  117.850 1.00 34.78  ? 160  GLY A N   1 
ATOM   1244  C  CA  . GLY A  1  160 ? 32.099 75.845  117.375 1.00 34.04  ? 160  GLY A CA  1 
ATOM   1245  C  C   . GLY A  1  160 ? 31.211 76.756  116.564 1.00 33.79  ? 160  GLY A C   1 
ATOM   1246  O  O   . GLY A  1  160 ? 30.041 76.519  116.416 1.00 33.37  ? 160  GLY A O   1 
ATOM   1247  N  N   . THR A  1  161 ? 31.778 77.829  116.049 1.00 34.23  ? 161  THR A N   1 
ATOM   1248  C  CA  . THR A  1  161 ? 30.991 78.779  115.299 1.00 34.44  ? 161  THR A CA  1 
ATOM   1249  C  C   . THR A  1  161 ? 31.269 78.603  113.824 1.00 34.62  ? 161  THR A C   1 
ATOM   1250  O  O   . THR A  1  161 ? 32.202 77.895  113.454 1.00 34.56  ? 161  THR A O   1 
ATOM   1251  C  CB  . THR A  1  161 ? 31.319 80.188  115.763 1.00 34.72  ? 161  THR A CB  1 
ATOM   1252  O  OG1 . THR A  1  161 ? 32.537 80.654  115.133 1.00 35.84  ? 161  THR A OG1 1 
ATOM   1253  C  CG2 . THR A  1  161 ? 31.631 80.182  117.237 1.00 40.91  ? 161  THR A CG2 1 
ATOM   1254  N  N   . PRO A  1  162 ? 30.453 79.215  112.965 1.00 34.76  ? 162  PRO A N   1 
ATOM   1255  C  CA  . PRO A  1  162 ? 30.656 79.091  111.531 1.00 34.96  ? 162  PRO A CA  1 
ATOM   1256  C  C   . PRO A  1  162 ? 31.911 79.765  111.079 1.00 35.22  ? 162  PRO A C   1 
ATOM   1257  O  O   . PRO A  1  162 ? 32.384 79.484  109.997 1.00 36.08  ? 162  PRO A O   1 
ATOM   1258  C  CB  . PRO A  1  162 ? 29.446 79.818  110.951 1.00 35.08  ? 162  PRO A CB  1 
ATOM   1259  C  CG  . PRO A  1  162 ? 28.445 79.807  112.036 1.00 27.71  ? 162  PRO A CG  1 
ATOM   1260  C  CD  . PRO A  1  162 ? 29.242 79.997  113.268 1.00 34.64  ? 162  PRO A CD  1 
ATOM   1261  N  N   . LEU A  1  163 ? 32.480 80.599  111.936 1.00 34.70  ? 163  LEU A N   1 
ATOM   1262  C  CA  . LEU A  1  163 ? 33.673 81.375  111.624 1.00 33.87  ? 163  LEU A CA  1 
ATOM   1263  C  C   . LEU A  1  163 ? 34.925 80.541  111.767 1.00 33.58  ? 163  LEU A C   1 
ATOM   1264  O  O   . LEU A  1  163 ? 36.012 80.964  111.340 1.00 34.52  ? 163  LEU A O   1 
ATOM   1265  C  CB  . LEU A  1  163 ? 33.744 82.556  112.573 1.00 33.76  ? 163  LEU A CB  1 
ATOM   1266  C  CG  . LEU A  1  163 ? 34.224 83.897  112.104 1.00 34.71  ? 163  LEU A CG  1 
ATOM   1267  C  CD1 . LEU A  1  163 ? 33.716 84.200  110.760 1.00 34.11  ? 163  LEU A CD1 1 
ATOM   1268  C  CD2 . LEU A  1  163 ? 33.782 84.947  113.070 1.00 34.97  ? 163  LEU A CD2 1 
ATOM   1269  N  N   . ALA A  1  164 ? 34.795 79.355  112.374 1.00 32.09  ? 164  ALA A N   1 
ATOM   1270  C  CA  . ALA A  1  164 ? 35.937 78.458  112.546 1.00 30.95  ? 164  ALA A CA  1 
ATOM   1271  C  C   . ALA A  1  164 ? 36.237 77.759  111.254 1.00 31.12  ? 164  ALA A C   1 
ATOM   1272  O  O   . ALA A  1  164 ? 37.257 77.106  111.116 1.00 31.37  ? 164  ALA A O   1 
ATOM   1273  C  CB  . ALA A  1  164 ? 35.668 77.454  113.591 1.00 30.05  ? 164  ALA A CB  1 
ATOM   1274  N  N   . GLN A  1  165 ? 35.344 77.881  110.308 1.00 31.16  ? 165  GLN A N   1 
ATOM   1275  C  CA  . GLN A  1  165 ? 35.517 77.206  109.069 1.00 31.93  ? 165  GLN A CA  1 
ATOM   1276  C  C   . GLN A  1  165 ? 36.404 77.991  108.111 1.00 32.62  ? 165  GLN A C   1 
ATOM   1277  O  O   . GLN A  1  165 ? 36.486 79.240  108.162 1.00 33.15  ? 165  GLN A O   1 
ATOM   1278  C  CB  . GLN A  1  165 ? 34.155 76.914  108.417 1.00 31.93  ? 165  GLN A CB  1 
ATOM   1279  C  CG  . GLN A  1  165 ? 33.143 76.209  109.326 1.00 29.46  ? 165  GLN A CG  1 
ATOM   1280  C  CD  . GLN A  1  165 ? 31.745 76.128  108.695 1.00 35.73  ? 165  GLN A CD  1 
ATOM   1281  O  OE1 . GLN A  1  165 ? 31.223 77.133  108.208 1.00 35.34  ? 165  GLN A OE1 1 
ATOM   1282  N  NE2 . GLN A  1  165 ? 31.147 74.931  108.701 1.00 25.48  ? 165  GLN A NE2 1 
ATOM   1283  N  N   . SER A  1  166 ? 37.072 77.240  107.251 1.00 32.07  ? 166  SER A N   1 
ATOM   1284  C  CA  . SER A  1  166 ? 37.903 77.775  106.225 1.00 31.62  ? 166  SER A CA  1 
ATOM   1285  C  C   . SER A  1  166 ? 36.979 78.073  105.036 1.00 31.27  ? 166  SER A C   1 
ATOM   1286  O  O   . SER A  1  166 ? 35.854 77.584  104.975 1.00 31.19  ? 166  SER A O   1 
ATOM   1287  C  CB  . SER A  1  166 ? 38.900 76.699  105.797 1.00 31.39  ? 166  SER A CB  1 
ATOM   1288  O  OG  . SER A  1  166 ? 38.204 75.666  105.100 1.00 32.33  ? 166  SER A OG  1 
ATOM   1289  N  N   . VAL A  1  167 ? 37.473 78.830  104.076 1.00 31.08  ? 167  VAL A N   1 
ATOM   1290  C  CA  . VAL A  1  167 ? 36.674 79.172  102.910 1.00 30.83  ? 167  VAL A CA  1 
ATOM   1291  C  C   . VAL A  1  167 ? 36.430 77.957  101.964 1.00 31.60  ? 167  VAL A C   1 
ATOM   1292  O  O   . VAL A  1  167 ? 35.315 77.726  101.491 1.00 31.64  ? 167  VAL A O   1 
ATOM   1293  C  CB  . VAL A  1  167 ? 37.344 80.330  102.118 1.00 29.74  ? 167  VAL A CB  1 
ATOM   1294  C  CG1 . VAL A  1  167 ? 36.606 80.614  100.845 1.00 23.38  ? 167  VAL A CG1 1 
ATOM   1295  C  CG2 . VAL A  1  167 ? 37.384 81.547  102.941 1.00 21.49  ? 167  VAL A CG2 1 
ATOM   1296  N  N   . GLU A  1  168 ? 37.470 77.173  101.761 1.00 32.30  ? 168  GLU A N   1 
ATOM   1297  C  CA  . GLU A  1  168 ? 37.470 76.081  100.808 1.00 33.01  ? 168  GLU A CA  1 
ATOM   1298  C  C   . GLU A  1  168 ? 36.757 74.813  101.242 1.00 33.42  ? 168  GLU A C   1 
ATOM   1299  O  O   . GLU A  1  168 ? 36.408 73.986  100.403 1.00 33.80  ? 168  GLU A O   1 
ATOM   1300  C  CB  . GLU A  1  168 ? 38.911 75.773  100.380 1.00 33.44  ? 168  GLU A CB  1 
ATOM   1301  C  CG  . GLU A  1  168 ? 39.763 77.018  100.085 1.00 46.03  ? 168  GLU A CG  1 
ATOM   1302  C  CD  . GLU A  1  168 ? 40.566 77.530  101.288 1.00 54.19  ? 168  GLU A CD  1 
ATOM   1303  O  OE1 . GLU A  1  168 ? 41.767 77.752  101.116 1.00 67.00  ? 168  GLU A OE1 1 
ATOM   1304  O  OE2 . GLU A  1  168 ? 39.996 77.732  102.394 1.00 52.08  ? 168  GLU A OE2 1 
ATOM   1305  N  N   . GLY A  1  169 ? 36.568 74.645  102.547 1.00 33.45  ? 169  GLY A N   1 
ATOM   1306  C  CA  . GLY A  1  169 ? 35.865 73.485  103.090 1.00 33.52  ? 169  GLY A CA  1 
ATOM   1307  C  C   . GLY A  1  169 ? 36.772 72.293  103.285 1.00 33.74  ? 169  GLY A C   1 
ATOM   1308  O  O   . GLY A  1  169 ? 37.893 72.312  102.834 1.00 34.70  ? 169  GLY A O   1 
ATOM   1309  N  N   . PRO A  1  170 ? 36.279 71.257  103.941 1.00 33.39  ? 170  PRO A N   1 
ATOM   1310  C  CA  . PRO A  1  170 ? 37.056 70.025  104.158 1.00 33.28  ? 170  PRO A CA  1 
ATOM   1311  C  C   . PRO A  1  170 ? 37.018 69.203  102.902 1.00 33.19  ? 170  PRO A C   1 
ATOM   1312  O  O   . PRO A  1  170 ? 36.071 69.308  102.144 1.00 33.10  ? 170  PRO A O   1 
ATOM   1313  C  CB  . PRO A  1  170 ? 36.242 69.260  105.228 1.00 33.63  ? 170  PRO A CB  1 
ATOM   1314  C  CG  . PRO A  1  170 ? 35.018 70.104  105.529 1.00 38.43  ? 170  PRO A CG  1 
ATOM   1315  C  CD  . PRO A  1  170 ? 34.907 71.157  104.456 1.00 34.05  ? 170  PRO A CD  1 
ATOM   1316  N  N   . SER A  1  171 ? 37.997 68.350  102.702 1.00 33.34  ? 171  SER A N   1 
ATOM   1317  C  CA  . SER A  1  171 ? 38.025 67.538  101.509 1.00 33.16  ? 171  SER A CA  1 
ATOM   1318  C  C   . SER A  1  171 ? 36.767 66.690  101.322 1.00 33.59  ? 171  SER A C   1 
ATOM   1319  O  O   . SER A  1  171 ? 36.238 66.619  100.205 1.00 33.68  ? 171  SER A O   1 
ATOM   1320  C  CB  . SER A  1  171 ? 39.283 66.703  101.441 1.00 32.99  ? 171  SER A CB  1 
ATOM   1321  O  OG  . SER A  1  171 ? 39.724 66.349  102.730 1.00 37.93  ? 171  SER A OG  1 
ATOM   1322  N  N   . GLU A  1  172 ? 36.229 66.114  102.409 1.00 33.46  ? 172  GLU A N   1 
ATOM   1323  C  CA  . GLU A  1  172 ? 35.012 65.289  102.273 1.00 33.37  ? 172  GLU A CA  1 
ATOM   1324  C  C   . GLU A  1  172 ? 33.854 66.057  101.621 1.00 32.75  ? 172  GLU A C   1 
ATOM   1325  O  O   . GLU A  1  172 ? 33.092 65.489  100.835 1.00 32.71  ? 172  GLU A O   1 
ATOM   1326  C  CB  . GLU A  1  172 ? 34.593 64.648  103.596 1.00 33.72  ? 172  GLU A CB  1 
ATOM   1327  C  CG  . GLU A  1  172 ? 33.425 63.650  103.505 1.00 53.36  ? 172  GLU A CG  1 
ATOM   1328  C  CD  . GLU A  1  172 ? 33.816 62.242  102.990 1.00 64.77  ? 172  GLU A CD  1 
ATOM   1329  O  OE1 . GLU A  1  172 ? 34.366 62.120  101.869 1.00 63.20  ? 172  GLU A OE1 1 
ATOM   1330  O  OE2 . GLU A  1  172 ? 33.519 61.245  103.700 1.00 70.17  ? 172  GLU A OE2 1 
ATOM   1331  N  N   . ASN A  1  173 ? 33.764 67.358  101.893 1.00 32.20  ? 173  ASN A N   1 
ATOM   1332  C  CA  . ASN A  1  173 ? 32.728 68.184  101.275 1.00 32.05  ? 173  ASN A CA  1 
ATOM   1333  C  C   . ASN A  1  173 ? 32.988 68.469  99.805  1.00 32.18  ? 173  ASN A C   1 
ATOM   1334  O  O   . ASN A  1  173 ? 32.054 68.610  99.020  1.00 33.03  ? 173  ASN A O   1 
ATOM   1335  C  CB  . ASN A  1  173 ? 32.568 69.508  101.987 1.00 31.80  ? 173  ASN A CB  1 
ATOM   1336  C  CG  . ASN A  1  173 ? 31.757 69.404  103.247 1.00 33.75  ? 173  ASN A CG  1 
ATOM   1337  O  OD1 . ASN A  1  173 ? 31.473 70.415  103.885 1.00 30.51  ? 173  ASN A OD1 1 
ATOM   1338  N  ND2 . ASN A  1  173 ? 31.376 68.175  103.627 1.00 30.38  ? 173  ASN A ND2 1 
ATOM   1339  N  N   . VAL A  1  174 ? 34.250 68.549  99.431  1.00 31.27  ? 174  VAL A N   1 
ATOM   1340  C  CA  . VAL A  1  174 ? 34.605 68.858  98.064  1.00 30.46  ? 174  VAL A CA  1 
ATOM   1341  C  C   . VAL A  1  174 ? 34.228 67.702  97.148  1.00 30.46  ? 174  VAL A C   1 
ATOM   1342  O  O   . VAL A  1  174 ? 33.715 67.886  96.039  1.00 30.63  ? 174  VAL A O   1 
ATOM   1343  C  CB  . VAL A  1  174 ? 36.103 69.189  97.958  1.00 30.05  ? 174  VAL A CB  1 
ATOM   1344  C  CG1 . VAL A  1  174 ? 36.549 69.232  96.535  1.00 17.77  ? 174  VAL A CG1 1 
ATOM   1345  C  CG2 . VAL A  1  174 ? 36.400 70.526  98.673  1.00 24.50  ? 174  VAL A CG2 1 
ATOM   1346  N  N   . ARG A  1  175 ? 34.388 66.511  97.644  1.00 30.34  ? 175  ARG A N   1 
ATOM   1347  C  CA  . ARG A  1  175 ? 34.089 65.401  96.846  1.00 30.44  ? 175  ARG A CA  1 
ATOM   1348  C  C   . ARG A  1  175 ? 32.647 65.004  96.880  1.00 30.61  ? 175  ARG A C   1 
ATOM   1349  O  O   . ARG A  1  175 ? 32.223 64.209  96.040  1.00 30.36  ? 175  ARG A O   1 
ATOM   1350  C  CB  . ARG A  1  175 ? 34.960 64.254  97.206  1.00 30.51  ? 175  ARG A CB  1 
ATOM   1351  C  CG  . ARG A  1  175 ? 35.002 63.996  98.609  1.00 33.36  ? 175  ARG A CG  1 
ATOM   1352  C  CD  . ARG A  1  175 ? 35.723 62.747  98.947  1.00 42.51  ? 175  ARG A CD  1 
ATOM   1353  N  NE  . ARG A  1  175 ? 36.822 62.523  98.044  1.00 36.03  ? 175  ARG A NE  1 
ATOM   1354  C  CZ  . ARG A  1  175 ? 38.077 62.597  98.391  1.00 42.31  ? 175  ARG A CZ  1 
ATOM   1355  N  NH1 . ARG A  1  175 ? 38.409 62.890  99.670  1.00 39.46  ? 175  ARG A NH1 1 
ATOM   1356  N  NH2 . ARG A  1  175 ? 39.022 62.392  97.465  1.00 43.83  ? 175  ARG A NH2 1 
ATOM   1357  N  N   . LYS A  1  176 ? 31.864 65.566  97.819  1.00 30.89  ? 176  LYS A N   1 
ATOM   1358  C  CA  . LYS A  1  176 ? 30.431 65.198  97.903  1.00 31.06  ? 176  LYS A CA  1 
ATOM   1359  C  C   . LYS A  1  176 ? 29.412 66.279  97.540  1.00 30.55  ? 176  LYS A C   1 
ATOM   1360  O  O   . LYS A  1  176 ? 28.282 65.962  97.269  1.00 30.09  ? 176  LYS A O   1 
ATOM   1361  C  CB  . LYS A  1  176 ? 30.057 64.524  99.253  1.00 31.43  ? 176  LYS A CB  1 
ATOM   1362  C  CG  . LYS A  1  176 ? 29.839 65.528  100.409 1.00 50.23  ? 176  LYS A CG  1 
ATOM   1363  C  CD  . LYS A  1  176 ? 28.733 65.072  101.389 1.00 52.35  ? 176  LYS A CD  1 
ATOM   1364  C  CE  . LYS A  1  176 ? 28.448 66.153  102.466 1.00 53.92  ? 176  LYS A CE  1 
ATOM   1365  N  NZ  . LYS A  1  176 ? 29.323 66.005  103.664 1.00 50.04  ? 176  LYS A NZ  1 
ATOM   1366  N  N   . LEU A  1  177 ? 29.809 67.551  97.563  1.00 30.94  ? 177  LEU A N   1 
ATOM   1367  C  CA  . LEU A  1  177 ? 28.881 68.638  97.220  1.00 31.00  ? 177  LEU A CA  1 
ATOM   1368  C  C   . LEU A  1  177 ? 28.201 68.369  95.865  1.00 31.29  ? 177  LEU A C   1 
ATOM   1369  O  O   . LEU A  1  177 ? 28.869 68.056  94.869  1.00 31.16  ? 177  LEU A O   1 
ATOM   1370  C  CB  . LEU A  1  177 ? 29.603 69.982  97.176  1.00 30.80  ? 177  LEU A CB  1 
ATOM   1371  C  CG  . LEU A  1  177 ? 29.844 70.772  98.465  1.00 34.19  ? 177  LEU A CG  1 
ATOM   1372  C  CD1 . LEU A  1  177 ? 30.878 71.881  98.222  1.00 38.67  ? 177  LEU A CD1 1 
ATOM   1373  C  CD2 . LEU A  1  177 ? 28.573 71.354  99.020  1.00 34.56  ? 177  LEU A CD2 1 
ATOM   1374  N  N   . SER A  1  178 ? 26.880 68.472  95.840  1.00 31.70  ? 178  SER A N   1 
ATOM   1375  C  CA  . SER A  1  178 ? 26.119 68.219  94.621  1.00 32.59  ? 178  SER A CA  1 
ATOM   1376  C  C   . SER A  1  178 ? 25.752 69.508  93.897  1.00 33.35  ? 178  SER A C   1 
ATOM   1377  O  O   . SER A  1  178 ? 25.948 70.604  94.428  1.00 33.05  ? 178  SER A O   1 
ATOM   1378  C  CB  . SER A  1  178 ? 24.835 67.484  94.972  1.00 32.41  ? 178  SER A CB  1 
ATOM   1379  O  OG  . SER A  1  178 ? 24.113 68.244  95.920  1.00 26.75  ? 178  SER A OG  1 
ATOM   1380  N  N   . ARG A  1  179 ? 25.206 69.367  92.679  1.00 34.44  ? 179  ARG A N   1 
ATOM   1381  C  CA  . ARG A  1  179 ? 24.741 70.521  91.927  1.00 35.42  ? 179  ARG A CA  1 
ATOM   1382  C  C   . ARG A  1  179 ? 23.572 71.163  92.706  1.00 36.68  ? 179  ARG A C   1 
ATOM   1383  O  O   . ARG A  1  179 ? 23.467 72.402  92.791  1.00 37.01  ? 179  ARG A O   1 
ATOM   1384  C  CB  . ARG A  1  179 ? 24.298 70.152  90.503  1.00 34.99  ? 179  ARG A CB  1 
ATOM   1385  C  CG  . ARG A  1  179 ? 23.924 71.387  89.705  1.00 35.97  ? 179  ARG A CG  1 
ATOM   1386  C  CD  . ARG A  1  179 ? 23.213 71.167  88.408  1.00 42.16  ? 179  ARG A CD  1 
ATOM   1387  N  NE  . ARG A  1  179 ? 22.526 72.396  87.993  1.00 47.44  ? 179  ARG A NE  1 
ATOM   1388  C  CZ  . ARG A  1  179 ? 22.482 72.846  86.754  1.00 50.95  ? 179  ARG A CZ  1 
ATOM   1389  N  NH1 . ARG A  1  179 ? 23.064 72.167  85.789  1.00 58.93  ? 179  ARG A NH1 1 
ATOM   1390  N  NH2 . ARG A  1  179 ? 21.844 73.970  86.476  1.00 53.69  ? 179  ARG A NH2 1 
ATOM   1391  N  N   . ALA A  1  180 ? 22.738 70.310  93.316  1.00 37.09  ? 180  ALA A N   1 
ATOM   1392  C  CA  . ALA A  1  180 ? 21.615 70.768  94.133  1.00 37.36  ? 180  ALA A CA  1 
ATOM   1393  C  C   . ALA A  1  180 ? 22.114 71.659  95.279  1.00 37.59  ? 180  ALA A C   1 
ATOM   1394  O  O   . ALA A  1  180 ? 21.530 72.716  95.554  1.00 37.62  ? 180  ALA A O   1 
ATOM   1395  C  CB  . ALA A  1  180 ? 20.830 69.572  94.690  1.00 37.06  ? 180  ALA A CB  1 
ATOM   1396  N  N   . ASP A  1  181 ? 23.197 71.230  95.928  1.00 37.67  ? 181  ASP A N   1 
ATOM   1397  C  CA  . ASP A  1  181 ? 23.788 71.986  97.027  1.00 38.26  ? 181  ASP A CA  1 
ATOM   1398  C  C   . ASP A  1  181 ? 24.193 73.376  96.584  1.00 39.07  ? 181  ASP A C   1 
ATOM   1399  O  O   . ASP A  1  181 ? 23.927 74.377  97.268  1.00 39.12  ? 181  ASP A O   1 
ATOM   1400  C  CB  . ASP A  1  181 ? 25.033 71.279  97.538  1.00 38.15  ? 181  ASP A CB  1 
ATOM   1401  C  CG  . ASP A  1  181 ? 24.726 70.225  98.553  1.00 37.79  ? 181  ASP A CG  1 
ATOM   1402  O  OD1 . ASP A  1  181 ? 23.736 70.394  99.300  1.00 34.98  ? 181  ASP A OD1 1 
ATOM   1403  O  OD2 . ASP A  1  181 ? 25.441 69.208  98.702  1.00 35.44  ? 181  ASP A OD2 1 
ATOM   1404  N  N   . LEU A  1  182 ? 24.844 73.433  95.434  1.00 39.82  ? 182  LEU A N   1 
ATOM   1405  C  CA  . LEU A  1  182 ? 25.333 74.678  94.895  1.00 40.19  ? 182  LEU A CA  1 
ATOM   1406  C  C   . LEU A  1  182 ? 24.202 75.603  94.492  1.00 40.47  ? 182  LEU A C   1 
ATOM   1407  O  O   . LEU A  1  182 ? 24.179 76.760  94.887  1.00 40.62  ? 182  LEU A O   1 
ATOM   1408  C  CB  . LEU A  1  182 ? 26.293 74.405  93.736  1.00 40.23  ? 182  LEU A CB  1 
ATOM   1409  C  CG  . LEU A  1  182 ? 27.510 73.563  94.184  1.00 40.77  ? 182  LEU A CG  1 
ATOM   1410  C  CD1 . LEU A  1  182 ? 28.406 73.173  93.047  1.00 34.39  ? 182  LEU A CD1 1 
ATOM   1411  C  CD2 . LEU A  1  182 ? 28.301 74.249  95.287  1.00 40.71  ? 182  LEU A CD2 1 
ATOM   1412  N  N   . THR A  1  183 ? 23.239 75.068  93.751  1.00 40.73  ? 183  THR A N   1 
ATOM   1413  C  CA  . THR A  1  183 ? 22.062 75.832  93.298  1.00 40.91  ? 183  THR A CA  1 
ATOM   1414  C  C   . THR A  1  183 ? 21.282 76.439  94.472  1.00 40.73  ? 183  THR A C   1 
ATOM   1415  O  O   . THR A  1  183 ? 20.854 77.602  94.417  1.00 40.51  ? 183  THR A O   1 
ATOM   1416  C  CB  . THR A  1  183 ? 21.143 74.925  92.463  1.00 41.14  ? 183  THR A CB  1 
ATOM   1417  O  OG1 . THR A  1  183 ? 21.847 74.491  91.294  1.00 44.93  ? 183  THR A OG1 1 
ATOM   1418  C  CG2 . THR A  1  183 ? 19.950 75.718  91.885  1.00 46.73  ? 183  THR A CG2 1 
ATOM   1419  N  N   . GLU A  1  184 ? 21.131 75.657  95.539  1.00 40.79  ? 184  GLU A N   1 
ATOM   1420  C  CA  . GLU A  1  184 ? 20.449 76.116  96.732  1.00 40.65  ? 184  GLU A CA  1 
ATOM   1421  C  C   . GLU A  1  184 ? 21.214 77.274  97.404  1.00 40.14  ? 184  GLU A C   1 
ATOM   1422  O  O   . GLU A  1  184 ? 20.623 78.296  97.728  1.00 40.19  ? 184  GLU A O   1 
ATOM   1423  C  CB  . GLU A  1  184 ? 20.235 74.965  97.714  1.00 40.86  ? 184  GLU A CB  1 
ATOM   1424  C  CG  . GLU A  1  184 ? 19.453 75.373  98.952  1.00 56.34  ? 184  GLU A CG  1 
ATOM   1425  C  CD  . GLU A  1  184 ? 19.244 74.227  99.926  1.00 67.64  ? 184  GLU A CD  1 
ATOM   1426  O  OE1 . GLU A  1  184 ? 19.159 73.054  99.474  1.00 72.78  ? 184  GLU A OE1 1 
ATOM   1427  O  OE2 . GLU A  1  184 ? 19.150 74.499  101.150 1.00 71.52  ? 184  GLU A OE2 1 
ATOM   1428  N  N   . TYR A  1  185 ? 22.525 77.109  97.592  1.00 39.81  ? 185  TYR A N   1 
ATOM   1429  C  CA  . TYR A  1  185 ? 23.373 78.176  98.185  1.00 39.65  ? 185  TYR A CA  1 
ATOM   1430  C  C   . TYR A  1  185 ? 23.301 79.473  97.341  1.00 39.20  ? 185  TYR A C   1 
ATOM   1431  O  O   . TYR A  1  185 ? 23.274 80.572  97.881  1.00 38.90  ? 185  TYR A O   1 
ATOM   1432  C  CB  . TYR A  1  185 ? 24.828 77.693  98.321  1.00 39.58  ? 185  TYR A CB  1 
ATOM   1433  C  CG  . TYR A  1  185 ? 25.864 78.772  98.676  1.00 40.79  ? 185  TYR A CG  1 
ATOM   1434  C  CD1 . TYR A  1  185 ? 26.505 79.517  97.675  1.00 40.31  ? 185  TYR A CD1 1 
ATOM   1435  C  CD2 . TYR A  1  185 ? 26.259 78.978  99.993  1.00 41.19  ? 185  TYR A CD2 1 
ATOM   1436  C  CE1 . TYR A  1  185 ? 27.462 80.480  97.986  1.00 43.73  ? 185  TYR A CE1 1 
ATOM   1437  C  CE2 . TYR A  1  185 ? 27.223 79.950  100.319 1.00 43.39  ? 185  TYR A CE2 1 
ATOM   1438  C  CZ  . TYR A  1  185 ? 27.824 80.687  99.308  1.00 46.84  ? 185  TYR A CZ  1 
ATOM   1439  O  OH  . TYR A  1  185 ? 28.797 81.623  99.610  1.00 46.29  ? 185  TYR A OH  1 
ATOM   1440  N  N   . LEU A  1  186 ? 23.272 79.315  96.021  1.00 39.08  ? 186  LEU A N   1 
ATOM   1441  C  CA  . LEU A  1  186 ? 23.141 80.442  95.117  1.00 39.08  ? 186  LEU A CA  1 
ATOM   1442  C  C   . LEU A  1  186 ? 21.811 81.136  95.334  1.00 39.01  ? 186  LEU A C   1 
ATOM   1443  O  O   . LEU A  1  186 ? 21.762 82.363  95.441  1.00 38.98  ? 186  LEU A O   1 
ATOM   1444  C  CB  . LEU A  1  186 ? 23.242 79.980  93.660  1.00 39.11  ? 186  LEU A CB  1 
ATOM   1445  C  CG  . LEU A  1  186 ? 24.648 79.684  93.142  1.00 41.36  ? 186  LEU A CG  1 
ATOM   1446  C  CD1 . LEU A  1  186 ? 24.588 79.340  91.655  1.00 37.88  ? 186  LEU A CD1 1 
ATOM   1447  C  CD2 . LEU A  1  186 ? 25.630 80.893  93.424  1.00 22.50  ? 186  LEU A CD2 1 
ATOM   1448  N  N   . SER A  1  187 ? 20.733 80.343  95.403  1.00 38.93  ? 187  SER A N   1 
ATOM   1449  C  CA  . SER A  1  187 ? 19.383 80.875  95.613  1.00 39.26  ? 187  SER A CA  1 
ATOM   1450  C  C   . SER A  1  187 ? 19.295 81.670  96.898  1.00 39.35  ? 187  SER A C   1 
ATOM   1451  O  O   . SER A  1  187 ? 18.751 82.773  96.922  1.00 39.49  ? 187  SER A O   1 
ATOM   1452  C  CB  . SER A  1  187 ? 18.347 79.744  95.676  1.00 39.50  ? 187  SER A CB  1 
ATOM   1453  O  OG  . SER A  1  187 ? 18.257 79.041  94.452  1.00 52.39  ? 187  SER A OG  1 
ATOM   1454  N  N   . ARG A  1  188 ? 19.847 81.113  97.964  1.00 39.24  ? 188  ARG A N   1 
ATOM   1455  C  CA  . ARG A  1  188 ? 19.800 81.752  99.273  1.00 39.18  ? 188  ARG A CA  1 
ATOM   1456  C  C   . ARG A  1  188 ? 20.592 83.049  99.398  1.00 38.55  ? 188  ARG A C   1 
ATOM   1457  O  O   . ARG A  1  188 ? 20.122 84.001  100.006 1.00 38.41  ? 188  ARG A O   1 
ATOM   1458  C  CB  . ARG A  1  188 ? 20.265 80.773  100.367 1.00 39.54  ? 188  ARG A CB  1 
ATOM   1459  C  CG  . ARG A  1  188 ? 19.282 79.678  100.679 1.00 52.40  ? 188  ARG A CG  1 
ATOM   1460  C  CD  . ARG A  1  188 ? 17.941 80.180  101.237 1.00 56.32  ? 188  ARG A CD  1 
ATOM   1461  N  NE  . ARG A  1  188 ? 17.216 79.126  101.923 1.00 60.14  ? 188  ARG A NE  1 
ATOM   1462  C  CZ  . ARG A  1  188 ? 17.591 78.604  103.087 1.00 65.31  ? 188  ARG A CZ  1 
ATOM   1463  N  NH1 . ARG A  1  188 ? 18.690 79.049  103.705 1.00 69.38  ? 188  ARG A NH1 1 
ATOM   1464  N  NH2 . ARG A  1  188 ? 16.873 77.643  103.643 1.00 65.18  ? 188  ARG A NH2 1 
ATOM   1465  N  N   . HIS A  1  189 ? 21.780 83.090  98.797  1.00 37.95  ? 189  HIS A N   1 
ATOM   1466  C  CA  . HIS A  1  189 ? 22.663 84.232  98.972  1.00 37.26  ? 189  HIS A CA  1 
ATOM   1467  C  C   . HIS A  1  189 ? 22.822 85.212  97.843  1.00 37.06  ? 189  HIS A C   1 
ATOM   1468  O  O   . HIS A  1  189 ? 22.954 86.402  98.088  1.00 37.10  ? 189  HIS A O   1 
ATOM   1469  C  CB  . HIS A  1  189 ? 24.018 83.763  99.432  1.00 37.04  ? 189  HIS A CB  1 
ATOM   1470  C  CG  . HIS A  1  189 ? 23.957 82.825  100.578 1.00 30.38  ? 189  HIS A CG  1 
ATOM   1471  N  ND1 . HIS A  1  189 ? 23.758 83.248  101.870 1.00 35.64  ? 189  HIS A ND1 1 
ATOM   1472  C  CD2 . HIS A  1  189 ? 24.024 81.478  100.629 1.00 33.28  ? 189  HIS A CD2 1 
ATOM   1473  C  CE1 . HIS A  1  189 ? 23.727 82.199  102.674 1.00 35.68  ? 189  HIS A CE1 1 
ATOM   1474  N  NE2 . HIS A  1  189 ? 23.886 81.113  101.942 1.00 36.51  ? 189  HIS A NE2 1 
ATOM   1475  N  N   . TYR A  1  190 ? 22.840 84.735  96.603  1.00 37.04  ? 190  TYR A N   1 
ATOM   1476  C  CA  . TYR A  1  190 ? 23.036 85.638  95.457  1.00 36.87  ? 190  TYR A CA  1 
ATOM   1477  C  C   . TYR A  1  190 ? 21.771 86.376  95.087  1.00 37.06  ? 190  TYR A C   1 
ATOM   1478  O  O   . TYR A  1  190 ? 21.256 86.204  94.005  1.00 37.38  ? 190  TYR A O   1 
ATOM   1479  C  CB  . TYR A  1  190 ? 23.590 84.894  94.234  1.00 36.65  ? 190  TYR A CB  1 
ATOM   1480  C  CG  . TYR A  1  190 ? 25.079 84.551  94.306  1.00 40.36  ? 190  TYR A CG  1 
ATOM   1481  C  CD1 . TYR A  1  190 ? 25.901 84.744  93.218  1.00 38.53  ? 190  TYR A CD1 1 
ATOM   1482  C  CD2 . TYR A  1  190 ? 25.640 84.010  95.452  1.00 38.58  ? 190  TYR A CD2 1 
ATOM   1483  C  CE1 . TYR A  1  190 ? 27.242 84.424  93.273  1.00 34.88  ? 190  TYR A CE1 1 
ATOM   1484  C  CE2 . TYR A  1  190 ? 26.974 83.701  95.512  1.00 38.48  ? 190  TYR A CE2 1 
ATOM   1485  C  CZ  . TYR A  1  190 ? 27.769 83.913  94.420  1.00 35.51  ? 190  TYR A CZ  1 
ATOM   1486  O  OH  . TYR A  1  190 ? 29.109 83.600  94.476  1.00 40.74  ? 190  TYR A OH  1 
ATOM   1487  N  N   . LYS A  1  191 ? 21.257 87.180  96.009  1.00 37.16  ? 191  LYS A N   1 
ATOM   1488  C  CA  . LYS A  1  191 ? 20.067 87.972  95.751  1.00 37.37  ? 191  LYS A CA  1 
ATOM   1489  C  C   . LYS A  1  191 ? 20.246 89.455  96.099  1.00 36.94  ? 191  LYS A C   1 
ATOM   1490  O  O   . LYS A  1  191 ? 20.778 89.809  97.167  1.00 36.91  ? 191  LYS A O   1 
ATOM   1491  C  CB  . LYS A  1  191 ? 18.811 87.358  96.385  1.00 38.00  ? 191  LYS A CB  1 
ATOM   1492  C  CG  . LYS A  1  191 ? 18.917 86.959  97.865  1.00 48.06  ? 191  LYS A CG  1 
ATOM   1493  C  CD  . LYS A  1  191 ? 17.867 85.861  98.173  1.00 58.35  ? 191  LYS A CD  1 
ATOM   1494  C  CE  . LYS A  1  191 ? 17.380 85.866  99.628  1.00 63.56  ? 191  LYS A CE  1 
ATOM   1495  N  NZ  . LYS A  1  191 ? 16.289 84.840  99.821  1.00 64.36  ? 191  LYS A NZ  1 
ATOM   1496  N  N   . ALA A  1  192 ? 19.800 90.296  95.165  1.00 36.39  ? 192  ALA A N   1 
ATOM   1497  C  CA  . ALA A  1  192 ? 19.910 91.762  95.204  1.00 35.61  ? 192  ALA A CA  1 
ATOM   1498  C  C   . ALA A  1  192 ? 20.284 92.593  96.449  1.00 35.16  ? 192  ALA A C   1 
ATOM   1499  O  O   . ALA A  1  192 ? 21.281 93.293  96.406  1.00 35.35  ? 192  ALA A O   1 
ATOM   1500  C  CB  . ALA A  1  192 ? 18.833 92.433  94.363  1.00 35.51  ? 192  ALA A CB  1 
ATOM   1501  N  N   . PRO A  1  193 ? 19.505 92.546  97.548  1.00 34.72  ? 193  PRO A N   1 
ATOM   1502  C  CA  . PRO A  1  193 ? 19.837 93.353  98.747  1.00 34.13  ? 193  PRO A CA  1 
ATOM   1503  C  C   . PRO A  1  193 ? 21.166 92.975  99.401  1.00 33.54  ? 193  PRO A C   1 
ATOM   1504  O  O   . PRO A  1  193 ? 21.618 93.641  100.332 1.00 33.18  ? 193  PRO A O   1 
ATOM   1505  C  CB  . PRO A  1  193 ? 18.691 93.039  99.704  1.00 33.79  ? 193  PRO A CB  1 
ATOM   1506  C  CG  . PRO A  1  193 ? 17.602 92.574  98.838  1.00 37.57  ? 193  PRO A CG  1 
ATOM   1507  C  CD  . PRO A  1  193 ? 18.258 91.795  97.747  1.00 34.69  ? 193  PRO A CD  1 
ATOM   1508  N  N   . ARG A  1  194 ? 21.780 91.916  98.902  1.00 33.31  ? 194  ARG A N   1 
ATOM   1509  C  CA  . ARG A  1  194 ? 23.016 91.429  99.456  1.00 33.34  ? 194  ARG A CA  1 
ATOM   1510  C  C   . ARG A  1  194 ? 24.167 91.623  98.476  1.00 32.75  ? 194  ARG A C   1 
ATOM   1511  O  O   . ARG A  1  194 ? 25.288 91.204  98.722  1.00 32.86  ? 194  ARG A O   1 
ATOM   1512  C  CB  . ARG A  1  194 ? 22.841 89.965  99.883  1.00 33.92  ? 194  ARG A CB  1 
ATOM   1513  C  CG  . ARG A  1  194 ? 21.529 89.761  100.738 1.00 42.27  ? 194  ARG A CG  1 
ATOM   1514  C  CD  . ARG A  1  194 ? 21.269 88.362  101.225 1.00 47.38  ? 194  ARG A CD  1 
ATOM   1515  N  NE  . ARG A  1  194 ? 22.130 88.001  102.340 1.00 47.37  ? 194  ARG A NE  1 
ATOM   1516  C  CZ  . ARG A  1  194 ? 23.221 87.280  102.216 1.00 48.57  ? 194  ARG A CZ  1 
ATOM   1517  N  NH1 . ARG A  1  194 ? 23.609 86.844  101.020 1.00 45.43  ? 194  ARG A NH1 1 
ATOM   1518  N  NH2 . ARG A  1  194 ? 23.939 87.004  103.275 1.00 51.11  ? 194  ARG A NH2 1 
ATOM   1519  N  N   . MET A  1  195 ? 23.875 92.266  97.355  1.00 32.07  ? 195  MET A N   1 
ATOM   1520  C  CA  . MET A  1  195 ? 24.903 92.579  96.392  1.00 31.22  ? 195  MET A CA  1 
ATOM   1521  C  C   . MET A  1  195 ? 25.008 94.055  96.057  1.00 30.34  ? 195  MET A C   1 
ATOM   1522  O  O   . MET A  1  195 ? 24.035 94.828  96.235  1.00 30.05  ? 195  MET A O   1 
ATOM   1523  C  CB  . MET A  1  195 ? 24.892 91.680  95.142  1.00 31.19  ? 195  MET A CB  1 
ATOM   1524  C  CG  . MET A  1  195 ? 23.677 90.880  94.911  1.00 35.64  ? 195  MET A CG  1 
ATOM   1525  S  SD  . MET A  1  195 ? 23.988 89.658  93.622  1.00 43.26  ? 195  MET A SD  1 
ATOM   1526  C  CE  . MET A  1  195 ? 24.275 90.697  92.256  1.00 45.23  ? 195  MET A CE  1 
ATOM   1527  N  N   . VAL A  1  196 ? 26.213 94.454  95.631  1.00 29.24  ? 196  VAL A N   1 
ATOM   1528  C  CA  . VAL A  1  196 ? 26.525 95.840  95.286  1.00 28.20  ? 196  VAL A CA  1 
ATOM   1529  C  C   . VAL A  1  196 ? 27.349 95.888  93.993  1.00 27.80  ? 196  VAL A C   1 
ATOM   1530  O  O   . VAL A  1  196 ? 28.424 95.296  93.911  1.00 28.12  ? 196  VAL A O   1 
ATOM   1531  C  CB  . VAL A  1  196 ? 27.363 96.509  96.411  1.00 27.89  ? 196  VAL A CB  1 
ATOM   1532  C  CG1 . VAL A  1  196 ? 27.986 97.827  95.947  1.00 27.89  ? 196  VAL A CG1 1 
ATOM   1533  C  CG2 . VAL A  1  196 ? 26.537 96.714  97.645  1.00 25.52  ? 196  VAL A CG2 1 
ATOM   1534  N  N   . LEU A  1  197 ? 26.826 96.542  92.973  1.00 27.22  ? 197  LEU A N   1 
ATOM   1535  C  CA  . LEU A  1  197 ? 27.568 96.699  91.750  1.00 27.40  ? 197  LEU A CA  1 
ATOM   1536  C  C   . LEU A  1  197 ? 28.486 97.908  91.970  1.00 28.24  ? 197  LEU A C   1 
ATOM   1537  O  O   . LEU A  1  197 ? 28.021 99.025  92.265  1.00 28.76  ? 197  LEU A O   1 
ATOM   1538  C  CB  . LEU A  1  197 ? 26.639 96.935  90.586  1.00 26.97  ? 197  LEU A CB  1 
ATOM   1539  C  CG  . LEU A  1  197 ? 27.308 97.246  89.254  1.00 25.18  ? 197  LEU A CG  1 
ATOM   1540  C  CD1 . LEU A  1  197 ? 28.154 96.099  88.808  1.00 24.44  ? 197  LEU A CD1 1 
ATOM   1541  C  CD2 . LEU A  1  197 ? 26.258 97.576  88.199  1.00 17.01  ? 197  LEU A CD2 1 
ATOM   1542  N  N   . ALA A  1  198 ? 29.783 97.684  91.896  1.00 28.18  ? 198  ALA A N   1 
ATOM   1543  C  CA  . ALA A  1  198 ? 30.715 98.757  92.146  1.00 28.38  ? 198  ALA A CA  1 
ATOM   1544  C  C   . ALA A  1  198 ? 31.556 99.039  90.942  1.00 28.54  ? 198  ALA A C   1 
ATOM   1545  O  O   . ALA A  1  198 ? 31.876 98.123  90.178  1.00 28.99  ? 198  ALA A O   1 
ATOM   1546  C  CB  . ALA A  1  198 ? 31.599 98.415  93.335  1.00 28.38  ? 198  ALA A CB  1 
ATOM   1547  N  N   . ALA A  1  199 ? 31.905 100.304 90.744  1.00 28.57  ? 199  ALA A N   1 
ATOM   1548  C  CA  . ALA A  1  199 ? 32.799 100.676 89.634  1.00 29.31  ? 199  ALA A CA  1 
ATOM   1549  C  C   . ALA A  1  199 ? 33.717 101.846 89.992  1.00 30.14  ? 199  ALA A C   1 
ATOM   1550  O  O   . ALA A  1  199 ? 33.452 102.579 90.970  1.00 30.28  ? 199  ALA A O   1 
ATOM   1551  C  CB  . ALA A  1  199 ? 32.015 100.971 88.371  1.00 29.05  ? 199  ALA A CB  1 
ATOM   1552  N  N   . ALA A  1  200 ? 34.811 102.011 89.234  1.00 30.61  ? 200  ALA A N   1 
ATOM   1553  C  CA  . ALA A  1  200 ? 35.749 103.161 89.451  1.00 30.96  ? 200  ALA A CA  1 
ATOM   1554  C  C   . ALA A  1  200 ? 36.552 103.464 88.219  1.00 31.34  ? 200  ALA A C   1 
ATOM   1555  O  O   . ALA A  1  200 ? 37.122 102.563 87.621  1.00 31.27  ? 200  ALA A O   1 
ATOM   1556  C  CB  . ALA A  1  200 ? 36.692 102.913 90.645  1.00 30.72  ? 200  ALA A CB  1 
ATOM   1557  N  N   . GLY A  1  201 ? 36.601 104.751 87.852  1.00 31.79  ? 201  GLY A N   1 
ATOM   1558  C  CA  . GLY A  1  201 ? 37.334 105.216 86.681  1.00 32.20  ? 201  GLY A CA  1 
ATOM   1559  C  C   . GLY A  1  201 ? 36.571 106.218 85.789  1.00 32.94  ? 201  GLY A C   1 
ATOM   1560  O  O   . GLY A  1  201 ? 35.770 107.059 86.265  1.00 32.48  ? 201  GLY A O   1 
ATOM   1561  N  N   . GLY A  1  202 ? 36.826 106.135 84.486  1.00 33.77  ? 202  GLY A N   1 
ATOM   1562  C  CA  . GLY A  1  202 ? 36.173 107.009 83.541  1.00 34.20  ? 202  GLY A CA  1 
ATOM   1563  C  C   . GLY A  1  202 ? 34.779 106.540 83.217  1.00 34.71  ? 202  GLY A C   1 
ATOM   1564  O  O   . GLY A  1  202 ? 34.546 105.938 82.175  1.00 34.90  ? 202  GLY A O   1 
ATOM   1565  N  N   . LEU A  1  203 ? 33.851 106.774 84.138  1.00 35.14  ? 203  LEU A N   1 
ATOM   1566  C  CA  . LEU A  1  203 ? 32.440 106.411 83.923  1.00 35.64  ? 203  LEU A CA  1 
ATOM   1567  C  C   . LEU A  1  203 ? 31.618 107.489 84.560  1.00 35.78  ? 203  LEU A C   1 
ATOM   1568  O  O   . LEU A  1  203 ? 32.025 108.052 85.543  1.00 35.66  ? 203  LEU A O   1 
ATOM   1569  C  CB  . LEU A  1  203 ? 32.088 105.124 84.682  1.00 35.48  ? 203  LEU A CB  1 
ATOM   1570  C  CG  . LEU A  1  203 ? 33.220 104.458 85.429  1.00 40.21  ? 203  LEU A CG  1 
ATOM   1571  C  CD1 . LEU A  1  203 ? 32.899 104.271 86.890  1.00 41.08  ? 203  LEU A CD1 1 
ATOM   1572  C  CD2 . LEU A  1  203 ? 33.614 103.187 84.769  1.00 48.43  ? 203  LEU A CD2 1 
ATOM   1573  N  N   . GLU A  1  204 ? 30.462 107.781 84.009  1.00 36.29  ? 204  GLU A N   1 
ATOM   1574  C  CA  . GLU A  1  204 ? 29.554 108.695 84.690  1.00 37.09  ? 204  GLU A CA  1 
ATOM   1575  C  C   . GLU A  1  204 ? 28.569 107.797 85.453  1.00 37.41  ? 204  GLU A C   1 
ATOM   1576  O  O   . GLU A  1  204 ? 28.173 106.741 84.948  1.00 37.17  ? 204  GLU A O   1 
ATOM   1577  C  CB  . GLU A  1  204 ? 28.828 109.586 83.709  1.00 37.22  ? 204  GLU A CB  1 
ATOM   1578  C  CG  . GLU A  1  204 ? 29.674 110.718 83.183  1.00 45.57  ? 204  GLU A CG  1 
ATOM   1579  C  CD  . GLU A  1  204 ? 28.949 111.513 82.126  1.00 55.74  ? 204  GLU A CD  1 
ATOM   1580  O  OE1 . GLU A  1  204 ? 29.159 112.742 82.051  1.00 58.77  ? 204  GLU A OE1 1 
ATOM   1581  O  OE2 . GLU A  1  204 ? 28.153 110.906 81.371  1.00 58.11  ? 204  GLU A OE2 1 
ATOM   1582  N  N   . HIS A  1  205 ? 28.212 108.184 86.675  1.00 37.73  ? 205  HIS A N   1 
ATOM   1583  C  CA  . HIS A  1  205 ? 27.304 107.366 87.502  1.00 37.75  ? 205  HIS A CA  1 
ATOM   1584  C  C   . HIS A  1  205 ? 25.966 106.912 86.815  1.00 37.65  ? 205  HIS A C   1 
ATOM   1585  O  O   . HIS A  1  205 ? 25.471 105.813 87.083  1.00 37.61  ? 205  HIS A O   1 
ATOM   1586  C  CB  . HIS A  1  205 ? 27.027 108.042 88.828  1.00 37.68  ? 205  HIS A CB  1 
ATOM   1587  C  CG  . HIS A  1  205 ? 26.252 107.200 89.772  1.00 40.52  ? 205  HIS A CG  1 
ATOM   1588  N  ND1 . HIS A  1  205 ? 26.852 106.348 90.671  1.00 44.17  ? 205  HIS A ND1 1 
ATOM   1589  C  CD2 . HIS A  1  205 ? 24.919 107.047 89.940  1.00 41.64  ? 205  HIS A CD2 1 
ATOM   1590  C  CE1 . HIS A  1  205 ? 25.920 105.718 91.363  1.00 43.89  ? 205  HIS A CE1 1 
ATOM   1591  N  NE2 . HIS A  1  205 ? 24.740 106.122 90.936  1.00 42.57  ? 205  HIS A NE2 1 
ATOM   1592  N  N   . ARG A  1  206 ? 25.419 107.759 85.933  1.00 37.49  ? 206  ARG A N   1 
ATOM   1593  C  CA  . ARG A  1  206 ? 24.181 107.445 85.192  1.00 37.42  ? 206  ARG A CA  1 
ATOM   1594  C  C   . ARG A  1  206 ? 24.351 106.205 84.298  1.00 36.78  ? 206  ARG A C   1 
ATOM   1595  O  O   . ARG A  1  206 ? 23.453 105.361 84.226  1.00 36.58  ? 206  ARG A O   1 
ATOM   1596  C  CB  . ARG A  1  206 ? 23.715 108.658 84.368  1.00 37.80  ? 206  ARG A CB  1 
ATOM   1597  C  CG  . ARG A  1  206 ? 23.231 109.839 85.225  1.00 46.29  ? 206  ARG A CG  1 
ATOM   1598  C  CD  . ARG A  1  206 ? 23.019 111.142 84.442  1.00 58.85  ? 206  ARG A CD  1 
ATOM   1599  N  NE  . ARG A  1  206 ? 22.467 112.224 85.281  1.00 66.07  ? 206  ARG A NE  1 
ATOM   1600  C  CZ  . ARG A  1  206 ? 22.151 113.452 84.832  1.00 67.09  ? 206  ARG A CZ  1 
ATOM   1601  N  NH1 . ARG A  1  206 ? 22.328 113.765 83.552  1.00 68.98  ? 206  ARG A NH1 1 
ATOM   1602  N  NH2 . ARG A  1  206 ? 21.659 114.363 85.665  1.00 63.92  ? 206  ARG A NH2 1 
ATOM   1603  N  N   . GLN A  1  207 ? 25.513 106.107 83.637  1.00 36.34  ? 207  GLN A N   1 
ATOM   1604  C  CA  . GLN A  1  207 ? 25.863 104.944 82.797  1.00 35.77  ? 207  GLN A CA  1 
ATOM   1605  C  C   . GLN A  1  207 ? 25.705 103.698 83.638  1.00 34.80  ? 207  GLN A C   1 
ATOM   1606  O  O   . GLN A  1  207 ? 24.997 102.777 83.251  1.00 34.69  ? 207  GLN A O   1 
ATOM   1607  C  CB  . GLN A  1  207 ? 27.329 105.022 82.349  1.00 36.10  ? 207  GLN A CB  1 
ATOM   1608  C  CG  . GLN A  1  207 ? 27.706 106.262 81.596  1.00 51.42  ? 207  GLN A CG  1 
ATOM   1609  C  CD  . GLN A  1  207 ? 27.544 106.103 80.091  1.00 58.49  ? 207  GLN A CD  1 
ATOM   1610  O  OE1 . GLN A  1  207 ? 27.727 104.984 79.548  1.00 60.85  ? 207  GLN A OE1 1 
ATOM   1611  N  NE2 . GLN A  1  207 ? 27.214 107.215 79.397  1.00 45.73  ? 207  GLN A NE2 1 
ATOM   1612  N  N   . LEU A  1  208 ? 26.380 103.693 84.802  1.00 33.96  ? 208  LEU A N   1 
ATOM   1613  C  CA  . LEU A  1  208 ? 26.313 102.597 85.747  1.00 33.39  ? 208  LEU A CA  1 
ATOM   1614  C  C   . LEU A  1  208 ? 24.896 102.272 86.152  1.00 33.79  ? 208  LEU A C   1 
ATOM   1615  O  O   . LEU A  1  208 ? 24.547 101.098 86.280  1.00 33.94  ? 208  LEU A O   1 
ATOM   1616  C  CB  . LEU A  1  208 ? 27.120 102.894 86.990  1.00 32.77  ? 208  LEU A CB  1 
ATOM   1617  C  CG  . LEU A  1  208 ? 28.323 102.006 87.257  1.00 34.66  ? 208  LEU A CG  1 
ATOM   1618  C  CD1 . LEU A  1  208 ? 28.534 101.989 88.748  1.00 35.62  ? 208  LEU A CD1 1 
ATOM   1619  C  CD2 . LEU A  1  208 ? 28.148 100.516 86.698  1.00 20.27  ? 208  LEU A CD2 1 
ATOM   1620  N  N   . LEU A  1  209 ? 24.087 103.311 86.392  1.00 33.76  ? 209  LEU A N   1 
ATOM   1621  C  CA  . LEU A  1  209 ? 22.697 103.112 86.757  1.00 33.89  ? 209  LEU A CA  1 
ATOM   1622  C  C   . LEU A  1  209 ? 21.940 102.460 85.637  1.00 34.20  ? 209  LEU A C   1 
ATOM   1623  O  O   . LEU A  1  209 ? 21.262 101.453 85.852  1.00 34.49  ? 209  LEU A O   1 
ATOM   1624  C  CB  . LEU A  1  209 ? 22.016 104.425 87.133  1.00 34.02  ? 209  LEU A CB  1 
ATOM   1625  C  CG  . LEU A  1  209 ? 21.467 104.519 88.561  1.00 33.20  ? 209  LEU A CG  1 
ATOM   1626  C  CD1 . LEU A  1  209 ? 20.424 105.658 88.668  1.00 24.03  ? 209  LEU A CD1 1 
ATOM   1627  C  CD2 . LEU A  1  209 ? 20.834 103.183 88.948  1.00 32.09  ? 209  LEU A CD2 1 
ATOM   1628  N  N   . ASP A  1  210 ? 22.051 103.036 84.437  1.00 34.10  ? 210  ASP A N   1 
ATOM   1629  C  CA  . ASP A  1  210 ? 21.376 102.502 83.271  1.00 33.74  ? 210  ASP A CA  1 
ATOM   1630  C  C   . ASP A  1  210 ? 21.711 101.049 83.136  1.00 33.11  ? 210  ASP A C   1 
ATOM   1631  O  O   . ASP A  1  210 ? 20.824 100.203 83.101  1.00 33.17  ? 210  ASP A O   1 
ATOM   1632  C  CB  . ASP A  1  210 ? 21.763 103.269 82.005  1.00 33.95  ? 210  ASP A CB  1 
ATOM   1633  C  CG  . ASP A  1  210 ? 21.109 104.642 81.938  1.00 43.19  ? 210  ASP A CG  1 
ATOM   1634  O  OD1 . ASP A  1  210 ? 21.428 105.427 81.006  1.00 46.74  ? 210  ASP A OD1 1 
ATOM   1635  O  OD2 . ASP A  1  210 ? 20.262 105.025 82.778  1.00 43.19  ? 210  ASP A OD2 1 
ATOM   1636  N  N   . LEU A  1  211 ? 22.994 100.745 83.166  1.00 32.55  ? 211  LEU A N   1 
ATOM   1637  C  CA  . LEU A  1  211 ? 23.436 99.367  83.045  1.00 32.30  ? 211  LEU A CA  1 
ATOM   1638  C  C   . LEU A  1  211 ? 22.897 98.449  84.165  1.00 31.99  ? 211  LEU A C   1 
ATOM   1639  O  O   . LEU A  1  211 ? 22.506 97.314  83.904  1.00 31.77  ? 211  LEU A O   1 
ATOM   1640  C  CB  . LEU A  1  211 ? 24.947 99.304  82.928  1.00 32.21  ? 211  LEU A CB  1 
ATOM   1641  C  CG  . LEU A  1  211 ? 25.488 99.902  81.622  1.00 29.17  ? 211  LEU A CG  1 
ATOM   1642  C  CD1 . LEU A  1  211 ? 26.977 100.101 81.691  1.00 32.78  ? 211  LEU A CD1 1 
ATOM   1643  C  CD2 . LEU A  1  211 ? 25.106 99.052  80.427  1.00 26.35  ? 211  LEU A CD2 1 
ATOM   1644  N  N   . ALA A  1  212 ? 22.814 98.978  85.382  1.00 31.95  ? 212  ALA A N   1 
ATOM   1645  C  CA  . ALA A  1  212 ? 22.301 98.214  86.500  1.00 32.09  ? 212  ALA A CA  1 
ATOM   1646  C  C   . ALA A  1  212 ? 20.831 97.870  86.315  1.00 32.95  ? 212  ALA A C   1 
ATOM   1647  O  O   . ALA A  1  212 ? 20.415 96.765  86.621  1.00 32.88  ? 212  ALA A O   1 
ATOM   1648  C  CB  . ALA A  1  212 ? 22.522 98.936  87.782  1.00 31.73  ? 212  ALA A CB  1 
ATOM   1649  N  N   . GLN A  1  213 ? 20.047 98.812  85.802  1.00 33.97  ? 213  GLN A N   1 
ATOM   1650  C  CA  . GLN A  1  213 ? 18.626 98.537  85.545  1.00 35.18  ? 213  GLN A CA  1 
ATOM   1651  C  C   . GLN A  1  213 ? 18.484 97.637  84.334  1.00 35.64  ? 213  GLN A C   1 
ATOM   1652  O  O   . GLN A  1  213 ? 17.645 96.762  84.303  1.00 35.82  ? 213  GLN A O   1 
ATOM   1653  C  CB  . GLN A  1  213 ? 17.796 99.841  85.309  1.00 35.70  ? 213  GLN A CB  1 
ATOM   1654  C  CG  . GLN A  1  213 ? 17.110 100.479 86.571  1.00 44.36  ? 213  GLN A CG  1 
ATOM   1655  C  CD  . GLN A  1  213 ? 16.012 99.582  87.219  1.00 52.07  ? 213  GLN A CD  1 
ATOM   1656  O  OE1 . GLN A  1  213 ? 15.671 98.504  86.696  1.00 50.66  ? 213  GLN A OE1 1 
ATOM   1657  N  NE2 . GLN A  1  213 ? 15.468 100.039 88.358  1.00 54.85  ? 213  GLN A NE2 1 
ATOM   1658  N  N   . LYS A  1  214 ? 19.319 97.864  83.337  1.00 35.85  ? 214  LYS A N   1 
ATOM   1659  C  CA  . LYS A  1  214 ? 19.259 97.093  82.130  1.00 36.03  ? 214  LYS A CA  1 
ATOM   1660  C  C   . LYS A  1  214 ? 19.570 95.623  82.345  1.00 36.66  ? 214  LYS A C   1 
ATOM   1661  O  O   . LYS A  1  214 ? 18.804 94.777  81.948  1.00 36.32  ? 214  LYS A O   1 
ATOM   1662  C  CB  . LYS A  1  214 ? 20.182 97.692  81.077  1.00 35.86  ? 214  LYS A CB  1 
ATOM   1663  C  CG  . LYS A  1  214 ? 20.173 96.966  79.764  1.00 39.41  ? 214  LYS A CG  1 
ATOM   1664  C  CD  . LYS A  1  214 ? 20.820 97.805  78.655  1.00 41.89  ? 214  LYS A CD  1 
ATOM   1665  C  CE  . LYS A  1  214 ? 20.782 97.055  77.309  1.00 46.30  ? 214  LYS A CE  1 
ATOM   1666  N  NZ  . LYS A  1  214 ? 20.998 97.953  76.126  1.00 44.67  ? 214  LYS A NZ  1 
ATOM   1667  N  N   . HIS A  1  215 ? 20.648 95.326  83.058  1.00 38.04  ? 215  HIS A N   1 
ATOM   1668  C  CA  . HIS A  1  215 ? 21.070 93.926  83.218  1.00 39.48  ? 215  HIS A CA  1 
ATOM   1669  C  C   . HIS A  1  215 ? 20.888 93.239  84.571  1.00 40.83  ? 215  HIS A C   1 
ATOM   1670  O  O   . HIS A  1  215 ? 21.157 92.047  84.688  1.00 40.39  ? 215  HIS A O   1 
ATOM   1671  C  CB  . HIS A  1  215 ? 22.498 93.748  82.763  1.00 39.38  ? 215  HIS A CB  1 
ATOM   1672  C  CG  . HIS A  1  215 ? 22.741 94.171  81.359  1.00 38.65  ? 215  HIS A CG  1 
ATOM   1673  N  ND1 . HIS A  1  215 ? 23.334 95.372  81.038  1.00 36.50  ? 215  HIS A ND1 1 
ATOM   1674  C  CD2 . HIS A  1  215 ? 22.506 93.540  80.187  1.00 41.45  ? 215  HIS A CD2 1 
ATOM   1675  C  CE1 . HIS A  1  215 ? 23.449 95.466  79.726  1.00 40.31  ? 215  HIS A CE1 1 
ATOM   1676  N  NE2 . HIS A  1  215 ? 22.950 94.369  79.186  1.00 41.96  ? 215  HIS A NE2 1 
ATOM   1677  N  N   . PHE A  1  216 ? 20.469 93.973  85.594  1.00 42.72  ? 216  PHE A N   1 
ATOM   1678  C  CA  . PHE A  1  216 ? 20.281 93.349  86.913  1.00 44.57  ? 216  PHE A CA  1 
ATOM   1679  C  C   . PHE A  1  216 ? 18.829 93.330  87.353  1.00 46.47  ? 216  PHE A C   1 
ATOM   1680  O  O   . PHE A  1  216 ? 18.489 92.745  88.380  1.00 46.59  ? 216  PHE A O   1 
ATOM   1681  C  CB  . PHE A  1  216 ? 21.183 93.980  87.980  1.00 44.31  ? 216  PHE A CB  1 
ATOM   1682  C  CG  . PHE A  1  216 ? 22.636 93.616  87.837  1.00 38.71  ? 216  PHE A CG  1 
ATOM   1683  C  CD1 . PHE A  1  216 ? 23.474 94.346  87.010  1.00 37.83  ? 216  PHE A CD1 1 
ATOM   1684  C  CD2 . PHE A  1  216 ? 23.168 92.539  88.532  1.00 36.02  ? 216  PHE A CD2 1 
ATOM   1685  C  CE1 . PHE A  1  216 ? 24.823 93.997  86.872  1.00 35.15  ? 216  PHE A CE1 1 
ATOM   1686  C  CE2 . PHE A  1  216 ? 24.501 92.200  88.404  1.00 31.55  ? 216  PHE A CE2 1 
ATOM   1687  C  CZ  . PHE A  1  216 ? 25.329 92.939  87.573  1.00 31.95  ? 216  PHE A CZ  1 
ATOM   1688  N  N   . SER A  1  217 ? 17.980 93.992  86.579  1.00 48.31  ? 217  SER A N   1 
ATOM   1689  C  CA  . SER A  1  217 ? 16.562 93.999  86.850  1.00 50.17  ? 217  SER A CA  1 
ATOM   1690  C  C   . SER A  1  217 ? 16.113 92.598  86.584  1.00 52.14  ? 217  SER A C   1 
ATOM   1691  O  O   . SER A  1  217 ? 16.233 92.110  85.465  1.00 52.41  ? 217  SER A O   1 
ATOM   1692  C  CB  . SER A  1  217 ? 15.857 94.937  85.898  1.00 49.99  ? 217  SER A CB  1 
ATOM   1693  O  OG  . SER A  1  217 ? 14.490 95.009  86.184  1.00 57.27  ? 217  SER A OG  1 
ATOM   1694  N  N   . GLY A  1  218 ? 15.655 91.919  87.619  1.00 53.81  ? 218  GLY A N   1 
ATOM   1695  C  CA  . GLY A  1  218 ? 15.243 90.542  87.470  1.00 55.56  ? 218  GLY A CA  1 
ATOM   1696  C  C   . GLY A  1  218 ? 15.689 89.689  88.634  1.00 57.27  ? 218  GLY A C   1 
ATOM   1697  O  O   . GLY A  1  218 ? 15.658 88.464  88.564  1.00 57.27  ? 218  GLY A O   1 
ATOM   1698  N  N   . LEU A  1  219 ? 16.161 90.344  89.689  1.00 58.92  ? 219  LEU A N   1 
ATOM   1699  C  CA  . LEU A  1  219 ? 16.540 89.652  90.902  1.00 60.56  ? 219  LEU A CA  1 
ATOM   1700  C  C   . LEU A  1  219 ? 15.452 89.897  91.928  1.00 62.44  ? 219  LEU A C   1 
ATOM   1701  O  O   . LEU A  1  219 ? 14.283 90.045  91.557  1.00 62.68  ? 219  LEU A O   1 
ATOM   1702  C  CB  . LEU A  1  219 ? 17.873 90.148  91.411  1.00 60.52  ? 219  LEU A CB  1 
ATOM   1703  C  CG  . LEU A  1  219 ? 19.092 89.530  90.735  1.00 62.87  ? 219  LEU A CG  1 
ATOM   1704  C  CD1 . LEU A  1  219 ? 20.361 90.149  91.296  1.00 61.06  ? 219  LEU A CD1 1 
ATOM   1705  C  CD2 . LEU A  1  219 ? 19.099 88.003  90.915  1.00 60.62  ? 219  LEU A CD2 1 
ATOM   1706  N  N   . SER A  1  220 ? 15.844 90.008  93.203  1.00 64.09  ? 220  SER A N   1 
ATOM   1707  C  CA  . SER A  1  220 ? 14.914 90.214  94.358  1.00 65.88  ? 220  SER A CA  1 
ATOM   1708  C  C   . SER A  1  220 ? 13.470 90.808  94.245  1.00 67.87  ? 220  SER A C   1 
ATOM   1709  O  O   . SER A  1  220 ? 12.669 90.608  95.165  1.00 67.99  ? 220  SER A O   1 
ATOM   1710  C  CB  . SER A  1  220 ? 15.625 90.752  95.586  1.00 65.80  ? 220  SER A CB  1 
ATOM   1711  O  OG  . SER A  1  220 ? 14.759 90.748  96.718  1.00 57.95  ? 220  SER A OG  1 
ATOM   1712  N  N   . GLY A  1  221 ? 13.168 91.548  93.161  1.00 69.62  ? 221  GLY A N   1 
ATOM   1713  C  CA  . GLY A  1  221 ? 11.827 92.101  92.922  1.00 71.17  ? 221  GLY A CA  1 
ATOM   1714  C  C   . GLY A  1  221 ? 10.734 91.115  93.322  1.00 72.72  ? 221  GLY A C   1 
ATOM   1715  O  O   . GLY A  1  221 ? 10.104 91.280  94.370  1.00 72.93  ? 221  GLY A O   1 
ATOM   1716  N  N   . THR A  1  222 ? 10.509 90.088  92.497  1.00 73.96  ? 222  THR A N   1 
ATOM   1717  C  CA  . THR A  1  222 ? 9.543  89.019  92.845  1.00 74.97  ? 222  THR A CA  1 
ATOM   1718  C  C   . THR A  1  222 ? 10.381 87.872  93.475  1.00 76.12  ? 222  THR A C   1 
ATOM   1719  O  O   . THR A  1  222 ? 10.677 86.861  92.818  1.00 76.23  ? 222  THR A O   1 
ATOM   1720  C  CB  . THR A  1  222 ? 8.774  88.512  91.577  1.00 74.76  ? 222  THR A CB  1 
ATOM   1721  O  OG1 . THR A  1  222 ? 8.256  89.628  90.845  1.00 69.50  ? 222  THR A OG1 1 
ATOM   1722  C  CG2 . THR A  1  222 ? 7.512  87.734  91.978  1.00 71.40  ? 222  THR A CG2 1 
ATOM   1723  N  N   . TYR A  1  223 ? 10.766 88.057  94.744  1.00 77.02  ? 223  TYR A N   1 
ATOM   1724  C  CA  . TYR A  1  223 ? 11.646 87.111  95.445  1.00 77.87  ? 223  TYR A CA  1 
ATOM   1725  C  C   . TYR A  1  223 ? 11.506 87.290  96.984  1.00 78.30  ? 223  TYR A C   1 
ATOM   1726  O  O   . TYR A  1  223 ? 10.392 87.242  97.517  1.00 78.42  ? 223  TYR A O   1 
ATOM   1727  C  CB  . TYR A  1  223 ? 13.093 87.392  95.008  1.00 78.17  ? 223  TYR A CB  1 
ATOM   1728  C  CG  . TYR A  1  223 ? 14.139 86.291  95.142  1.00 85.34  ? 223  TYR A CG  1 
ATOM   1729  C  CD1 . TYR A  1  223 ? 15.250 86.288  94.300  1.00 87.96  ? 223  TYR A CD1 1 
ATOM   1730  C  CD2 . TYR A  1  223 ? 14.064 85.309  96.141  1.00 84.93  ? 223  TYR A CD2 1 
ATOM   1731  C  CE1 . TYR A  1  223 ? 16.223 85.338  94.414  1.00 89.14  ? 223  TYR A CE1 1 
ATOM   1732  C  CE2 . TYR A  1  223 ? 15.042 84.355  96.266  1.00 86.94  ? 223  TYR A CE2 1 
ATOM   1733  C  CZ  . TYR A  1  223 ? 16.120 84.372  95.392  1.00 88.86  ? 223  TYR A CZ  1 
ATOM   1734  O  OH  . TYR A  1  223 ? 17.097 83.431  95.490  1.00 90.71  ? 223  TYR A OH  1 
ATOM   1735  N  N   . ASP A  1  224 ? 12.640 87.570  97.653  1.00 78.54  ? 224  ASP A N   1 
ATOM   1736  C  CA  . ASP A  1  224 ? 12.755 87.679  99.125  1.00 78.91  ? 224  ASP A CA  1 
ATOM   1737  C  C   . ASP A  1  224 ? 11.795 86.878  100.046 1.00 79.16  ? 224  ASP A C   1 
ATOM   1738  O  O   . ASP A  1  224 ? 11.755 85.640  99.970  1.00 79.32  ? 224  ASP A O   1 
ATOM   1739  C  CB  . ASP A  1  224 ? 13.114 89.106  99.634  1.00 79.11  ? 224  ASP A CB  1 
ATOM   1740  C  CG  . ASP A  1  224 ? 11.997 90.139  99.404  1.00 83.92  ? 224  ASP A CG  1 
ATOM   1741  O  OD1 . ASP A  1  224 ? 11.123 89.918  98.550  1.00 85.73  ? 224  ASP A OD1 1 
ATOM   1742  O  OD2 . ASP A  1  224 ? 11.924 91.206  100.055 1.00 84.96  ? 224  ASP A OD2 1 
ATOM   1743  N  N   . GLU A  1  225 ? 11.039 87.584  100.898 1.00 79.08  ? 225  GLU A N   1 
ATOM   1744  C  CA  . GLU A  1  225 ? 10.090 86.962  101.847 1.00 78.84  ? 225  GLU A CA  1 
ATOM   1745  C  C   . GLU A  1  225 ? 10.737 85.932  102.769 1.00 78.70  ? 225  GLU A C   1 
ATOM   1746  O  O   . GLU A  1  225 ? 11.900 86.082  103.138 1.00 78.75  ? 225  GLU A O   1 
ATOM   1747  C  CB  . GLU A  1  225 ? 8.840  86.422  101.137 1.00 78.70  ? 225  GLU A CB  1 
ATOM   1748  C  CG  . GLU A  1  225 ? 7.883  87.522  100.713 1.00 72.05  ? 225  GLU A CG  1 
ATOM   1749  C  CD  . GLU A  1  225 ? 7.369  87.328  99.312  1.00 68.55  ? 225  GLU A CD  1 
ATOM   1750  O  OE1 . GLU A  1  225 ? 7.270  86.166  98.880  1.00 69.98  ? 225  GLU A OE1 1 
ATOM   1751  O  OE2 . GLU A  1  225 ? 7.086  88.339  98.634  1.00 61.71  ? 225  GLU A OE2 1 
ATOM   1752  N  N   . ASP A  1  226 ? 10.008 84.878  103.122 1.00 78.47  ? 226  ASP A N   1 
ATOM   1753  C  CA  . ASP A  1  226 ? 10.556 83.905  104.052 1.00 78.11  ? 226  ASP A CA  1 
ATOM   1754  C  C   . ASP A  1  226 ? 11.683 83.001  103.522 1.00 77.82  ? 226  ASP A C   1 
ATOM   1755  O  O   . ASP A  1  226 ? 11.638 82.549  102.371 1.00 77.86  ? 226  ASP A O   1 
ATOM   1756  C  CB  . ASP A  1  226 ? 9.475  83.131  104.776 1.00 78.02  ? 226  ASP A CB  1 
ATOM   1757  C  CG  . ASP A  1  226 ? 9.725  83.075  106.250 1.00 77.26  ? 226  ASP A CG  1 
ATOM   1758  O  OD1 . ASP A  1  226 ? 10.645 82.347  106.665 1.00 78.80  ? 226  ASP A OD1 1 
ATOM   1759  O  OD2 . ASP A  1  226 ? 9.112  83.789  107.068 1.00 76.37  ? 226  ASP A OD2 1 
ATOM   1760  N  N   . ALA A  1  227 ? 12.702 82.814  104.389 1.00 77.36  ? 227  ALA A N   1 
ATOM   1761  C  CA  . ALA A  1  227 ? 13.939 82.015  104.167 1.00 76.77  ? 227  ALA A CA  1 
ATOM   1762  C  C   . ALA A  1  227 ? 15.199 82.877  104.105 1.00 76.45  ? 227  ALA A C   1 
ATOM   1763  O  O   . ALA A  1  227 ? 16.236 82.424  103.606 1.00 76.49  ? 227  ALA A O   1 
ATOM   1764  C  CB  . ALA A  1  227 ? 13.849 81.084  102.942 1.00 76.64  ? 227  ALA A CB  1 
ATOM   1765  N  N   . VAL A  1  228 ? 15.107 84.125  104.595 1.00 76.08  ? 228  VAL A N   1 
ATOM   1766  C  CA  . VAL A  1  228 ? 16.280 85.047  104.619 1.00 75.83  ? 228  VAL A CA  1 
ATOM   1767  C  C   . VAL A  1  228 ? 16.764 85.288  106.068 1.00 75.18  ? 228  VAL A C   1 
ATOM   1768  O  O   . VAL A  1  228 ? 16.268 86.201  106.743 1.00 75.39  ? 228  VAL A O   1 
ATOM   1769  C  CB  . VAL A  1  228 ? 15.965 86.469  103.985 1.00 75.91  ? 228  VAL A CB  1 
ATOM   1770  C  CG1 . VAL A  1  228 ? 17.283 87.250  103.729 1.00 75.24  ? 228  VAL A CG1 1 
ATOM   1771  C  CG2 . VAL A  1  228 ? 15.166 86.341  102.699 1.00 75.15  ? 228  VAL A CG2 1 
ATOM   1772  N  N   . PRO A  1  229 ? 17.724 84.481  106.547 1.00 73.97  ? 229  PRO A N   1 
ATOM   1773  C  CA  . PRO A  1  229 ? 18.228 84.638  107.915 1.00 71.99  ? 229  PRO A CA  1 
ATOM   1774  C  C   . PRO A  1  229 ? 19.335 85.685  108.004 1.00 69.54  ? 229  PRO A C   1 
ATOM   1775  O  O   . PRO A  1  229 ? 19.900 86.105  106.973 1.00 69.26  ? 229  PRO A O   1 
ATOM   1776  C  CB  . PRO A  1  229 ? 18.809 83.235  108.242 1.00 72.24  ? 229  PRO A CB  1 
ATOM   1777  C  CG  . PRO A  1  229 ? 18.481 82.360  107.008 1.00 76.27  ? 229  PRO A CG  1 
ATOM   1778  C  CD  . PRO A  1  229 ? 18.363 83.342  105.860 1.00 74.28  ? 229  PRO A CD  1 
ATOM   1779  N  N   . THR A  1  230 ? 19.633 86.100  109.235 1.00 67.23  ? 230  THR A N   1 
ATOM   1780  C  CA  . THR A  1  230 ? 20.691 87.061  109.498 1.00 64.89  ? 230  THR A CA  1 
ATOM   1781  C  C   . THR A  1  230 ? 21.942 86.263  109.905 1.00 62.28  ? 230  THR A C   1 
ATOM   1782  O  O   . THR A  1  230 ? 22.014 85.049  109.699 1.00 62.33  ? 230  THR A O   1 
ATOM   1783  C  CB  . THR A  1  230 ? 20.273 88.029  110.665 1.00 65.07  ? 230  THR A CB  1 
ATOM   1784  O  OG1 . THR A  1  230 ? 18.846 88.163  110.705 1.00 66.69  ? 230  THR A OG1 1 
ATOM   1785  C  CG2 . THR A  1  230 ? 20.773 89.489  110.397 1.00 65.05  ? 230  THR A CG2 1 
ATOM   1786  N  N   . LEU A  1  231 ? 22.925 86.945  110.465 1.00 59.39  ? 231  LEU A N   1 
ATOM   1787  C  CA  . LEU A  1  231 ? 24.113 86.276  110.924 1.00 56.49  ? 231  LEU A CA  1 
ATOM   1788  C  C   . LEU A  1  231 ? 24.120 86.211  112.417 1.00 54.22  ? 231  LEU A C   1 
ATOM   1789  O  O   . LEU A  1  231 ? 23.927 87.216  113.090 1.00 54.31  ? 231  LEU A O   1 
ATOM   1790  C  CB  . LEU A  1  231 ? 25.356 87.009  110.465 1.00 56.04  ? 231  LEU A CB  1 
ATOM   1791  C  CG  . LEU A  1  231 ? 25.951 86.602  109.142 1.00 45.32  ? 231  LEU A CG  1 
ATOM   1792  C  CD1 . LEU A  1  231 ? 27.138 87.489  108.847 1.00 52.41  ? 231  LEU A CD1 1 
ATOM   1793  C  CD2 . LEU A  1  231 ? 26.364 85.137  109.155 1.00 37.74  ? 231  LEU A CD2 1 
ATOM   1794  N  N   . SER A  1  232 ? 24.363 85.030  112.941 1.00 52.01  ? 232  SER A N   1 
ATOM   1795  C  CA  . SER A  1  232 ? 24.451 84.846  114.374 1.00 50.21  ? 232  SER A CA  1 
ATOM   1796  C  C   . SER A  1  232 ? 25.864 85.207  114.831 1.00 48.62  ? 232  SER A C   1 
ATOM   1797  O  O   . SER A  1  232 ? 26.829 84.974  114.099 1.00 48.98  ? 232  SER A O   1 
ATOM   1798  C  CB  . SER A  1  232 ? 24.173 83.383  114.715 1.00 50.10  ? 232  SER A CB  1 
ATOM   1799  O  OG  . SER A  1  232 ? 25.101 82.537  114.043 1.00 49.89  ? 232  SER A OG  1 
ATOM   1800  N  N   . PRO A  1  233 ? 25.999 85.792  116.020 1.00 46.80  ? 233  PRO A N   1 
ATOM   1801  C  CA  . PRO A  1  233 ? 27.329 86.115  116.556 1.00 45.41  ? 233  PRO A CA  1 
ATOM   1802  C  C   . PRO A  1  233 ? 28.187 84.859  116.722 1.00 43.95  ? 233  PRO A C   1 
ATOM   1803  O  O   . PRO A  1  233 ? 27.662 83.734  116.828 1.00 44.28  ? 233  PRO A O   1 
ATOM   1804  C  CB  . PRO A  1  233 ? 27.016 86.730  117.918 1.00 45.43  ? 233  PRO A CB  1 
ATOM   1805  C  CG  . PRO A  1  233 ? 25.611 87.218  117.796 1.00 44.79  ? 233  PRO A CG  1 
ATOM   1806  C  CD  . PRO A  1  233 ? 24.917 86.259  116.904 1.00 46.47  ? 233  PRO A CD  1 
ATOM   1807  N  N   . CYS A  1  234 ? 29.491 85.043  116.713 1.00 42.17  ? 234  CYS A N   1 
ATOM   1808  C  CA  . CYS A  1  234 ? 30.410 83.932  116.837 1.00 40.42  ? 234  CYS A CA  1 
ATOM   1809  C  C   . CYS A  1  234 ? 31.247 84.056  118.081 1.00 38.44  ? 234  CYS A C   1 
ATOM   1810  O  O   . CYS A  1  234 ? 32.056 84.956  118.199 1.00 37.55  ? 234  CYS A O   1 
ATOM   1811  C  CB  . CYS A  1  234 ? 31.323 83.866  115.622 1.00 40.58  ? 234  CYS A CB  1 
ATOM   1812  S  SG  . CYS A  1  234 ? 30.512 83.429  114.069 1.00 43.21  ? 234  CYS A SG  1 
ATOM   1813  N  N   . ARG A  1  235 ? 31.028 83.152  119.020 1.00 37.47  ? 235  ARG A N   1 
ATOM   1814  C  CA  . ARG A  1  235 ? 31.793 83.149  120.243 1.00 36.57  ? 235  ARG A CA  1 
ATOM   1815  C  C   . ARG A  1  235 ? 33.284 83.030  119.967 1.00 35.81  ? 235  ARG A C   1 
ATOM   1816  O  O   . ARG A  1  235 ? 33.706 82.154  119.184 1.00 35.63  ? 235  ARG A O   1 
ATOM   1817  C  CB  . ARG A  1  235 ? 31.375 81.980  121.156 1.00 36.21  ? 235  ARG A CB  1 
ATOM   1818  C  CG  . ARG A  1  235 ? 32.366 81.781  122.321 1.00 34.81  ? 235  ARG A CG  1 
ATOM   1819  C  CD  . ARG A  1  235 ? 32.317 80.467  123.026 1.00 27.95  ? 235  ARG A CD  1 
ATOM   1820  N  NE  . ARG A  1  235 ? 31.702 79.453  122.211 1.00 30.52  ? 235  ARG A NE  1 
ATOM   1821  C  CZ  . ARG A  1  235 ? 31.027 78.451  122.692 1.00 40.79  ? 235  ARG A CZ  1 
ATOM   1822  N  NH1 . ARG A  1  235 ? 30.905 78.298  124.012 1.00 49.18  ? 235  ARG A NH1 1 
ATOM   1823  N  NH2 . ARG A  1  235 ? 30.485 77.581  121.877 1.00 46.33  ? 235  ARG A NH2 1 
ATOM   1824  N  N   . PHE A  1  236 ? 34.073 83.962  120.536 1.00 35.23  ? 236  PHE A N   1 
ATOM   1825  C  CA  . PHE A  1  236 ? 35.536 83.862  120.479 1.00 34.63  ? 236  PHE A CA  1 
ATOM   1826  C  C   . PHE A  1  236 ? 35.905 83.012  121.668 1.00 34.35  ? 236  PHE A C   1 
ATOM   1827  O  O   . PHE A  1  236 ? 35.366 83.204  122.772 1.00 34.07  ? 236  PHE A O   1 
ATOM   1828  C  CB  . PHE A  1  236 ? 36.196 85.219  120.640 1.00 34.71  ? 236  PHE A CB  1 
ATOM   1829  C  CG  . PHE A  1  236 ? 37.725 85.166  120.699 1.00 36.00  ? 236  PHE A CG  1 
ATOM   1830  C  CD1 . PHE A  1  236 ? 38.481 85.314  119.546 1.00 44.07  ? 236  PHE A CD1 1 
ATOM   1831  C  CD2 . PHE A  1  236 ? 38.389 85.002  121.901 1.00 37.37  ? 236  PHE A CD2 1 
ATOM   1832  C  CE1 . PHE A  1  236 ? 39.895 85.303  119.594 1.00 49.59  ? 236  PHE A CE1 1 
ATOM   1833  C  CE2 . PHE A  1  236 ? 39.798 84.968  121.947 1.00 47.78  ? 236  PHE A CE2 1 
ATOM   1834  C  CZ  . PHE A  1  236 ? 40.540 85.126  120.789 1.00 41.94  ? 236  PHE A CZ  1 
ATOM   1835  N  N   . THR A  1  237 ? 36.832 82.092  121.479 1.00 34.67  ? 237  THR A N   1 
ATOM   1836  C  CA  . THR A  1  237 ? 37.205 81.237  122.571 1.00 35.72  ? 237  THR A CA  1 
ATOM   1837  C  C   . THR A  1  237 ? 38.503 81.587  123.251 1.00 36.90  ? 237  THR A C   1 
ATOM   1838  O  O   . THR A  1  237 ? 38.487 82.104  124.360 1.00 38.19  ? 237  THR A O   1 
ATOM   1839  C  CB  . THR A  1  237 ? 37.097 79.750  122.222 1.00 36.08  ? 237  THR A CB  1 
ATOM   1840  O  OG1 . THR A  1  237 ? 35.718 79.421  121.888 1.00 34.97  ? 237  THR A OG1 1 
ATOM   1841  C  CG2 . THR A  1  237 ? 37.378 78.905  123.437 1.00 5.81   ? 237  THR A CG2 1 
ATOM   1842  N  N   . GLY A  1  238 ? 39.633 81.379  122.632 1.00 36.13  ? 238  GLY A N   1 
ATOM   1843  C  CA  . GLY A  1  238 ? 40.838 81.734  123.380 1.00 36.23  ? 238  GLY A CA  1 
ATOM   1844  C  C   . GLY A  1  238 ? 41.423 80.471  123.871 1.00 36.54  ? 238  GLY A C   1 
ATOM   1845  O  O   . GLY A  1  238 ? 41.052 79.949  124.913 1.00 36.76  ? 238  GLY A O   1 
ATOM   1846  N  N   . SER A  1  239 ? 42.346 79.958  123.083 1.00 36.41  ? 239  SER A N   1 
ATOM   1847  C  CA  . SER A  1  239 ? 42.884 78.670  123.304 1.00 35.60  ? 239  SER A CA  1 
ATOM   1848  C  C   . SER A  1  239 ? 44.136 78.518  122.486 1.00 35.31  ? 239  SER A C   1 
ATOM   1849  O  O   . SER A  1  239 ? 44.782 79.518  122.107 1.00 35.92  ? 239  SER A O   1 
ATOM   1850  C  CB  . SER A  1  239 ? 41.874 77.703  122.804 1.00 35.14  ? 239  SER A CB  1 
ATOM   1851  O  OG  . SER A  1  239 ? 41.332 78.221  121.608 1.00 27.46  ? 239  SER A OG  1 
ATOM   1852  N  N   . GLN A  1  240 ? 44.447 77.279  122.138 1.00 34.22  ? 240  GLN A N   1 
ATOM   1853  C  CA  . GLN A  1  240 ? 45.666 76.996  121.434 1.00 33.56  ? 240  GLN A CA  1 
ATOM   1854  C  C   . GLN A  1  240 ? 45.602 75.728  120.579 1.00 33.34  ? 240  GLN A C   1 
ATOM   1855  O  O   . GLN A  1  240 ? 45.018 74.681  120.983 1.00 33.26  ? 240  GLN A O   1 
ATOM   1856  C  CB  . GLN A  1  240 ? 46.834 76.907  122.460 1.00 33.15  ? 240  GLN A CB  1 
ATOM   1857  C  CG  . GLN A  1  240 ? 48.207 76.701  121.894 1.00 34.36  ? 240  GLN A CG  1 
ATOM   1858  C  CD  . GLN A  1  240 ? 49.322 77.033  122.936 1.00 54.42  ? 240  GLN A CD  1 
ATOM   1859  O  OE1 . GLN A  1  240 ? 49.210 77.993  123.664 1.00 60.96  ? 240  GLN A OE1 1 
ATOM   1860  N  NE2 . GLN A  1  240 ? 50.379 76.244  122.961 1.00 57.42  ? 240  GLN A NE2 1 
ATOM   1861  N  N   . ILE A  1  241 ? 46.170 75.820  119.389 1.00 32.75  ? 241  ILE A N   1 
ATOM   1862  C  CA  . ILE A  1  241 ? 46.309 74.663  118.555 1.00 32.32  ? 241  ILE A CA  1 
ATOM   1863  C  C   . ILE A  1  241 ? 47.774 74.609  118.146 1.00 32.09  ? 241  ILE A C   1 
ATOM   1864  O  O   . ILE A  1  241 ? 48.335 75.596  117.658 1.00 32.17  ? 241  ILE A O   1 
ATOM   1865  C  CB  . ILE A  1  241 ? 45.379 74.721  117.384 1.00 32.12  ? 241  ILE A CB  1 
ATOM   1866  C  CG1 . ILE A  1  241 ? 45.615 73.545  116.475 1.00 33.69  ? 241  ILE A CG1 1 
ATOM   1867  C  CG2 . ILE A  1  241 ? 45.546 75.987  116.651 1.00 30.69  ? 241  ILE A CG2 1 
ATOM   1868  C  CD1 . ILE A  1  241 ? 44.695 73.515  115.325 1.00 36.12  ? 241  ILE A CD1 1 
ATOM   1869  N  N   . CYS A  1  242 ? 48.420 73.510  118.476 1.00 31.67  ? 242  CYS A N   1 
ATOM   1870  C  CA  . CYS A  1  242 ? 49.823 73.332  118.162 1.00 31.68  ? 242  CYS A CA  1 
ATOM   1871  C  C   . CYS A  1  242 ? 49.994 72.145  117.251 1.00 32.20  ? 242  CYS A C   1 
ATOM   1872  O  O   . CYS A  1  242 ? 49.626 71.013  117.612 1.00 33.31  ? 242  CYS A O   1 
ATOM   1873  C  CB  . CYS A  1  242 ? 50.608 73.085  119.428 1.00 31.32  ? 242  CYS A CB  1 
ATOM   1874  S  SG  . CYS A  1  242 ? 50.649 74.491  120.537 1.00 38.33  ? 242  CYS A SG  1 
ATOM   1875  N  N   . HIS A  1  243 ? 50.533 72.378  116.076 1.00 31.34  ? 243  HIS A N   1 
ATOM   1876  C  CA  . HIS A  1  243 ? 50.773 71.308  115.149 1.00 31.33  ? 243  HIS A CA  1 
ATOM   1877  C  C   . HIS A  1  243 ? 52.258 71.136  115.056 1.00 32.46  ? 243  HIS A C   1 
ATOM   1878  O  O   . HIS A  1  243 ? 52.911 71.766  114.251 1.00 33.48  ? 243  HIS A O   1 
ATOM   1879  C  CB  . HIS A  1  243 ? 50.136 71.630  113.803 1.00 30.59  ? 243  HIS A CB  1 
ATOM   1880  C  CG  . HIS A  1  243 ? 50.225 70.527  112.789 1.00 37.97  ? 243  HIS A CG  1 
ATOM   1881  N  ND1 . HIS A  1  243 ? 49.410 70.484  111.668 1.00 44.21  ? 243  HIS A ND1 1 
ATOM   1882  C  CD2 . HIS A  1  243 ? 51.066 69.470  112.677 1.00 38.69  ? 243  HIS A CD2 1 
ATOM   1883  C  CE1 . HIS A  1  243 ? 49.738 69.446  110.919 1.00 29.63  ? 243  HIS A CE1 1 
ATOM   1884  N  NE2 . HIS A  1  243 ? 50.742 68.814  111.503 1.00 42.95  ? 243  HIS A NE2 1 
ATOM   1885  N  N   . ARG A  1  244 ? 52.791 70.302  115.930 1.00 33.08  ? 244  ARG A N   1 
ATOM   1886  C  CA  . ARG A  1  244 ? 54.213 70.003  115.985 1.00 33.71  ? 244  ARG A CA  1 
ATOM   1887  C  C   . ARG A  1  244 ? 54.653 69.246  114.740 1.00 34.94  ? 244  ARG A C   1 
ATOM   1888  O  O   . ARG A  1  244 ? 54.046 68.246  114.377 1.00 36.70  ? 244  ARG A O   1 
ATOM   1889  C  CB  . ARG A  1  244 ? 54.488 69.131  117.212 1.00 33.07  ? 244  ARG A CB  1 
ATOM   1890  C  CG  . ARG A  1  244 ? 55.917 68.797  117.415 1.00 37.75  ? 244  ARG A CG  1 
ATOM   1891  C  CD  . ARG A  1  244 ? 56.803 69.955  118.009 1.00 29.05  ? 244  ARG A CD  1 
ATOM   1892  N  NE  . ARG A  1  244 ? 57.925 69.369  118.767 1.00 26.38  ? 244  ARG A NE  1 
ATOM   1893  C  CZ  . ARG A  1  244 ? 57.874 68.995  120.069 1.00 34.10  ? 244  ARG A CZ  1 
ATOM   1894  N  NH1 . ARG A  1  244 ? 56.763 69.193  120.827 1.00 39.14  ? 244  ARG A NH1 1 
ATOM   1895  N  NH2 . ARG A  1  244 ? 58.949 68.443  120.616 1.00 32.88  ? 244  ARG A NH2 1 
ATOM   1896  N  N   . GLU A  1  245 ? 55.689 69.732  114.076 1.00 34.17  ? 245  GLU A N   1 
ATOM   1897  C  CA  . GLU A  1  245 ? 56.228 69.074  112.880 1.00 33.49  ? 245  GLU A CA  1 
ATOM   1898  C  C   . GLU A  1  245 ? 57.683 69.521  112.704 1.00 33.77  ? 245  GLU A C   1 
ATOM   1899  O  O   . GLU A  1  245 ? 57.950 70.467  111.999 1.00 34.09  ? 245  GLU A O   1 
ATOM   1900  C  CB  . GLU A  1  245 ? 55.425 69.454  111.633 1.00 32.81  ? 245  GLU A CB  1 
ATOM   1901  C  CG  . GLU A  1  245 ? 55.319 68.374  110.579 1.00 29.15  ? 245  GLU A CG  1 
ATOM   1902  C  CD  . GLU A  1  245 ? 56.670 67.867  110.034 1.00 42.35  ? 245  GLU A CD  1 
ATOM   1903  O  OE1 . GLU A  1  245 ? 57.537 67.436  110.828 1.00 37.88  ? 245  GLU A OE1 1 
ATOM   1904  O  OE2 . GLU A  1  245 ? 56.838 67.835  108.789 1.00 40.98  ? 245  GLU A OE2 1 
ATOM   1905  N  N   . ASP A  1  246 ? 58.606 68.769  113.282 1.00 33.59  ? 246  ASP A N   1 
ATOM   1906  C  CA  . ASP A  1  246 ? 59.995 69.089  113.250 1.00 34.03  ? 246  ASP A CA  1 
ATOM   1907  C  C   . ASP A  1  246 ? 60.655 68.960  111.900 1.00 36.05  ? 246  ASP A C   1 
ATOM   1908  O  O   . ASP A  1  246 ? 61.817 69.380  111.722 1.00 37.25  ? 246  ASP A O   1 
ATOM   1909  C  CB  . ASP A  1  246 ? 60.728 68.298  114.276 1.00 33.27  ? 246  ASP A CB  1 
ATOM   1910  C  CG  . ASP A  1  246 ? 60.367 68.720  115.671 1.00 36.76  ? 246  ASP A CG  1 
ATOM   1911  O  OD1 . ASP A  1  246 ? 59.592 69.691  115.797 1.00 33.01  ? 246  ASP A OD1 1 
ATOM   1912  O  OD2 . ASP A  1  246 ? 60.809 68.157  116.701 1.00 28.28  ? 246  ASP A OD2 1 
ATOM   1913  N  N   . GLY A  1  247 ? 59.916 68.440  110.932 1.00 35.98  ? 247  GLY A N   1 
ATOM   1914  C  CA  . GLY A  1  247 ? 60.424 68.313  109.601 1.00 36.12  ? 247  GLY A CA  1 
ATOM   1915  C  C   . GLY A  1  247 ? 60.474 69.633  108.879 1.00 36.54  ? 247  GLY A C   1 
ATOM   1916  O  O   . GLY A  1  247 ? 61.313 69.821  108.051 1.00 37.88  ? 247  GLY A O   1 
ATOM   1917  N  N   . LEU A  1  248 ? 59.542 70.531  109.163 1.00 35.79  ? 248  LEU A N   1 
ATOM   1918  C  CA  . LEU A  1  248 ? 59.560 71.869  108.551 1.00 34.78  ? 248  LEU A CA  1 
ATOM   1919  C  C   . LEU A  1  248 ? 60.691 72.664  109.222 1.00 34.83  ? 248  LEU A C   1 
ATOM   1920  O  O   . LEU A  1  248 ? 60.966 72.446  110.394 1.00 35.40  ? 248  LEU A O   1 
ATOM   1921  C  CB  . LEU A  1  248 ? 58.194 72.543  108.733 1.00 34.32  ? 248  LEU A CB  1 
ATOM   1922  C  CG  . LEU A  1  248 ? 57.033 71.634  108.234 1.00 36.21  ? 248  LEU A CG  1 
ATOM   1923  C  CD1 . LEU A  1  248 ? 55.709 72.226  108.439 1.00 26.11  ? 248  LEU A CD1 1 
ATOM   1924  C  CD2 . LEU A  1  248 ? 57.185 71.222  106.778 1.00 32.64  ? 248  LEU A CD2 1 
ATOM   1925  N  N   . PRO A  1  249 ? 61.395 73.524  108.470 1.00 34.29  ? 249  PRO A N   1 
ATOM   1926  C  CA  . PRO A  1  249 ? 62.561 74.281  109.010 1.00 32.78  ? 249  PRO A CA  1 
ATOM   1927  C  C   . PRO A  1  249 ? 62.327 75.591  109.759 1.00 32.28  ? 249  PRO A C   1 
ATOM   1928  O  O   . PRO A  1  249 ? 63.250 76.092  110.409 1.00 32.13  ? 249  PRO A O   1 
ATOM   1929  C  CB  . PRO A  1  249 ? 63.385 74.530  107.773 1.00 32.20  ? 249  PRO A CB  1 
ATOM   1930  C  CG  . PRO A  1  249 ? 62.331 74.771  106.692 1.00 32.34  ? 249  PRO A CG  1 
ATOM   1931  C  CD  . PRO A  1  249 ? 61.176 73.810  107.025 1.00 34.38  ? 249  PRO A CD  1 
ATOM   1932  N  N   . LEU A  1  250 ? 61.158 76.178  109.657 1.00 32.08  ? 250  LEU A N   1 
ATOM   1933  C  CA  . LEU A  1  250 ? 60.906 77.416  110.412 1.00 32.10  ? 250  LEU A CA  1 
ATOM   1934  C  C   . LEU A  1  250 ? 59.529 77.324  111.054 1.00 32.15  ? 250  LEU A C   1 
ATOM   1935  O  O   . LEU A  1  250 ? 58.613 76.751  110.481 1.00 33.24  ? 250  LEU A O   1 
ATOM   1936  C  CB  . LEU A  1  250 ? 60.978 78.643  109.514 1.00 32.45  ? 250  LEU A CB  1 
ATOM   1937  C  CG  . LEU A  1  250 ? 62.288 79.005  108.819 1.00 36.01  ? 250  LEU A CG  1 
ATOM   1938  C  CD1 . LEU A  1  250 ? 62.008 80.021  107.774 1.00 38.93  ? 250  LEU A CD1 1 
ATOM   1939  C  CD2 . LEU A  1  250 ? 63.277 79.527  109.793 1.00 25.27  ? 250  LEU A CD2 1 
ATOM   1940  N  N   . ALA A  1  251 ? 59.391 77.851  112.255 1.00 30.90  ? 251  ALA A N   1 
ATOM   1941  C  CA  . ALA A  1  251 ? 58.122 77.788  112.943 1.00 29.87  ? 251  ALA A CA  1 
ATOM   1942  C  C   . ALA A  1  251 ? 57.248 78.949  112.580 1.00 28.86  ? 251  ALA A C   1 
ATOM   1943  O  O   . ALA A  1  251 ? 57.750 80.075  112.370 1.00 29.70  ? 251  ALA A O   1 
ATOM   1944  C  CB  . ALA A  1  251 ? 58.347 77.747  114.448 1.00 29.76  ? 251  ALA A CB  1 
ATOM   1945  N  N   . HIS A  1  252 ? 55.958 78.686  112.462 1.00 26.96  ? 252  HIS A N   1 
ATOM   1946  C  CA  . HIS A  1  252 ? 54.992 79.720  112.206 1.00 27.65  ? 252  HIS A CA  1 
ATOM   1947  C  C   . HIS A  1  252 ? 54.075 79.797  113.428 1.00 29.64  ? 252  HIS A C   1 
ATOM   1948  O  O   . HIS A  1  252 ? 53.577 78.732  113.950 1.00 29.74  ? 252  HIS A O   1 
ATOM   1949  C  CB  . HIS A  1  252 ? 54.148 79.391  111.011 1.00 27.17  ? 252  HIS A CB  1 
ATOM   1950  C  CG  . HIS A  1  252 ? 54.643 79.962  109.725 1.00 27.82  ? 252  HIS A CG  1 
ATOM   1951  N  ND1 . HIS A  1  252 ? 55.753 79.468  109.066 1.00 28.37  ? 252  HIS A ND1 1 
ATOM   1952  C  CD2 . HIS A  1  252 ? 54.109 80.904  108.908 1.00 24.23  ? 252  HIS A CD2 1 
ATOM   1953  C  CE1 . HIS A  1  252 ? 55.910 80.124  107.931 1.00 23.61  ? 252  HIS A CE1 1 
ATOM   1954  N  NE2 . HIS A  1  252 ? 54.907 80.974  107.796 1.00 29.96  ? 252  HIS A NE2 1 
ATOM   1955  N  N   . VAL A  1  253 ? 53.853 81.025  113.911 1.00 30.14  ? 253  VAL A N   1 
ATOM   1956  C  CA  . VAL A  1  253 ? 53.030 81.244  115.090 1.00 30.77  ? 253  VAL A CA  1 
ATOM   1957  C  C   . VAL A  1  253 ? 52.112 82.444  114.819 1.00 31.82  ? 253  VAL A C   1 
ATOM   1958  O  O   . VAL A  1  253 ? 52.544 83.438  114.253 1.00 32.30  ? 253  VAL A O   1 
ATOM   1959  C  CB  . VAL A  1  253 ? 53.919 81.571  116.370 1.00 30.73  ? 253  VAL A CB  1 
ATOM   1960  C  CG1 . VAL A  1  253 ? 53.089 81.748  117.533 1.00 25.51  ? 253  VAL A CG1 1 
ATOM   1961  C  CG2 . VAL A  1  253 ? 54.951 80.486  116.632 1.00 28.88  ? 253  VAL A CG2 1 
ATOM   1962  N  N   . ALA A  1  254 ? 50.848 82.331  115.217 1.00 32.15  ? 254  ALA A N   1 
ATOM   1963  C  CA  . ALA A  1  254 ? 49.885 83.391  115.053 1.00 32.10  ? 254  ALA A CA  1 
ATOM   1964  C  C   . ALA A  1  254 ? 49.102 83.489  116.351 1.00 33.09  ? 254  ALA A C   1 
ATOM   1965  O  O   . ALA A  1  254 ? 48.504 82.494  116.804 1.00 33.39  ? 254  ALA A O   1 
ATOM   1966  C  CB  . ALA A  1  254 ? 48.991 83.086  113.930 1.00 31.74  ? 254  ALA A CB  1 
ATOM   1967  N  N   . ILE A  1  255 ? 49.126 84.676  116.968 1.00 33.51  ? 255  ILE A N   1 
ATOM   1968  C  CA  . ILE A  1  255 ? 48.464 84.911  118.260 1.00 33.88  ? 255  ILE A CA  1 
ATOM   1969  C  C   . ILE A  1  255 ? 47.540 86.152  118.194 1.00 34.72  ? 255  ILE A C   1 
ATOM   1970  O  O   . ILE A  1  255 ? 47.910 87.204  117.623 1.00 34.02  ? 255  ILE A O   1 
ATOM   1971  C  CB  . ILE A  1  255 ? 49.535 85.092  119.327 1.00 33.61  ? 255  ILE A CB  1 
ATOM   1972  C  CG1 . ILE A  1  255 ? 48.953 85.677  120.611 1.00 36.75  ? 255  ILE A CG1 1 
ATOM   1973  C  CG2 . ILE A  1  255 ? 50.603 85.987  118.809 1.00 24.48  ? 255  ILE A CG2 1 
ATOM   1974  C  CD1 . ILE A  1  255 ? 49.634 85.189  121.872 1.00 21.48  ? 255  ILE A CD1 1 
ATOM   1975  N  N   . ALA A  1  256 ? 46.341 86.036  118.760 1.00 35.41  ? 256  ALA A N   1 
ATOM   1976  C  CA  . ALA A  1  256 ? 45.422 87.146  118.694 1.00 36.12  ? 256  ALA A CA  1 
ATOM   1977  C  C   . ALA A  1  256 ? 44.370 87.179  119.770 1.00 36.93  ? 256  ALA A C   1 
ATOM   1978  O  O   . ALA A  1  256 ? 43.923 86.124  120.282 1.00 36.89  ? 256  ALA A O   1 
ATOM   1979  C  CB  . ALA A  1  256 ? 44.749 87.202  117.297 1.00 36.30  ? 256  ALA A CB  1 
ATOM   1980  N  N   . VAL A  1  257 ? 43.970 88.395  120.135 1.00 37.29  ? 257  VAL A N   1 
ATOM   1981  C  CA  . VAL A  1  257 ? 42.867 88.570  121.075 1.00 37.86  ? 257  VAL A CA  1 
ATOM   1982  C  C   . VAL A  1  257 ? 41.652 88.842  120.217 1.00 38.46  ? 257  VAL A C   1 
ATOM   1983  O  O   . VAL A  1  257 ? 41.767 88.982  118.996 1.00 38.14  ? 257  VAL A O   1 
ATOM   1984  C  CB  . VAL A  1  257 ? 43.076 89.783  122.021 1.00 37.91  ? 257  VAL A CB  1 
ATOM   1985  C  CG1 . VAL A  1  257 ? 44.214 89.510  123.021 1.00 30.79  ? 257  VAL A CG1 1 
ATOM   1986  C  CG2 . VAL A  1  257 ? 43.309 91.099  121.200 1.00 35.10  ? 257  VAL A CG2 1 
ATOM   1987  N  N   . GLU A  1  258 ? 40.490 88.928  120.837 1.00 39.52  ? 258  GLU A N   1 
ATOM   1988  C  CA  . GLU A  1  258 ? 39.286 89.186  120.082 1.00 39.99  ? 258  GLU A CA  1 
ATOM   1989  C  C   . GLU A  1  258 ? 39.187 90.624  119.807 1.00 40.32  ? 258  GLU A C   1 
ATOM   1990  O  O   . GLU A  1  258 ? 39.313 91.420  120.713 1.00 41.45  ? 258  GLU A O   1 
ATOM   1991  C  CB  . GLU A  1  258 ? 38.072 88.758  120.855 1.00 39.95  ? 258  GLU A CB  1 
ATOM   1992  C  CG  . GLU A  1  258 ? 36.749 89.123  120.191 1.00 37.90  ? 258  GLU A CG  1 
ATOM   1993  C  CD  . GLU A  1  258 ? 35.553 88.522  120.932 1.00 39.71  ? 258  GLU A CD  1 
ATOM   1994  O  OE1 . GLU A  1  258 ? 34.481 88.371  120.315 1.00 40.13  ? 258  GLU A OE1 1 
ATOM   1995  O  OE2 . GLU A  1  258 ? 35.707 88.162  122.130 1.00 34.80  ? 258  GLU A OE2 1 
ATOM   1996  N  N   . GLY A  1  259 ? 39.024 90.982  118.543 1.00 39.74  ? 259  GLY A N   1 
ATOM   1997  C  CA  . GLY A  1  259 ? 38.837 92.367  118.191 1.00 39.91  ? 259  GLY A CA  1 
ATOM   1998  C  C   . GLY A  1  259 ? 37.363 92.612  118.027 1.00 40.31  ? 259  GLY A C   1 
ATOM   1999  O  O   . GLY A  1  259 ? 36.590 91.664  117.990 1.00 40.84  ? 259  GLY A O   1 
ATOM   2000  N  N   . PRO A  1  260 ? 36.958 93.860  117.889 1.00 40.49  ? 260  PRO A N   1 
ATOM   2001  C  CA  . PRO A  1  260 ? 35.546 94.162  117.680 1.00 40.99  ? 260  PRO A CA  1 
ATOM   2002  C  C   . PRO A  1  260 ? 35.342 94.113  116.184 1.00 41.92  ? 260  PRO A C   1 
ATOM   2003  O  O   . PRO A  1  260 ? 36.336 94.148  115.407 1.00 43.01  ? 260  PRO A O   1 
ATOM   2004  C  CB  . PRO A  1  260 ? 35.426 95.604  118.124 1.00 40.93  ? 260  PRO A CB  1 
ATOM   2005  C  CG  . PRO A  1  260 ? 36.834 96.177  118.023 1.00 44.45  ? 260  PRO A CG  1 
ATOM   2006  C  CD  . PRO A  1  260 ? 37.807 95.056  117.766 1.00 40.53  ? 260  PRO A CD  1 
ATOM   2007  N  N   . GLY A  1  261 ? 34.111 94.119  115.740 1.00 41.40  ? 261  GLY A N   1 
ATOM   2008  C  CA  . GLY A  1  261 ? 33.879 94.045  114.305 1.00 40.74  ? 261  GLY A CA  1 
ATOM   2009  C  C   . GLY A  1  261 ? 34.177 95.269  113.429 1.00 39.61  ? 261  GLY A C   1 
ATOM   2010  O  O   . GLY A  1  261 ? 34.738 96.246  113.872 1.00 38.90  ? 261  GLY A O   1 
ATOM   2011  N  N   . TRP A  1  262 ? 33.775 95.163  112.167 1.00 39.84  ? 262  TRP A N   1 
ATOM   2012  C  CA  . TRP A  1  262 ? 33.921 96.212  111.177 1.00 40.37  ? 262  TRP A CA  1 
ATOM   2013  C  C   . TRP A  1  262 ? 33.424 97.542  111.690 1.00 39.65  ? 262  TRP A C   1 
ATOM   2014  O  O   . TRP A  1  262 ? 34.147 98.518  111.698 1.00 39.36  ? 262  TRP A O   1 
ATOM   2015  C  CB  . TRP A  1  262 ? 33.095 95.869  109.906 1.00 41.34  ? 262  TRP A CB  1 
ATOM   2016  C  CG  . TRP A  1  262 ? 33.623 94.723  109.105 1.00 56.62  ? 262  TRP A CG  1 
ATOM   2017  C  CD1 . TRP A  1  262 ? 33.188 93.437  109.138 1.00 55.50  ? 262  TRP A CD1 1 
ATOM   2018  C  CD2 . TRP A  1  262 ? 34.662 94.771  108.112 1.00 65.76  ? 262  TRP A CD2 1 
ATOM   2019  N  NE1 . TRP A  1  262 ? 33.909 92.666  108.255 1.00 65.41  ? 262  TRP A NE1 1 
ATOM   2020  C  CE2 . TRP A  1  262 ? 34.823 93.462  107.611 1.00 69.25  ? 262  TRP A CE2 1 
ATOM   2021  C  CE3 . TRP A  1  262 ? 35.495 95.793  107.606 1.00 69.58  ? 262  TRP A CE3 1 
ATOM   2022  C  CZ2 . TRP A  1  262 ? 35.779 93.139  106.625 1.00 71.79  ? 262  TRP A CZ2 1 
ATOM   2023  C  CZ3 . TRP A  1  262 ? 36.445 95.470  106.630 1.00 68.86  ? 262  TRP A CZ3 1 
ATOM   2024  C  CH2 . TRP A  1  262 ? 36.577 94.156  106.154 1.00 69.64  ? 262  TRP A CH2 1 
ATOM   2025  N  N   . ALA A  1  263 ? 32.182 97.549  112.127 1.00 39.52  ? 263  ALA A N   1 
ATOM   2026  C  CA  . ALA A  1  263 ? 31.497 98.758  112.582 1.00 39.54  ? 263  ALA A CA  1 
ATOM   2027  C  C   . ALA A  1  263 ? 32.174 99.652  113.649 1.00 39.10  ? 263  ALA A C   1 
ATOM   2028  O  O   . ALA A  1  263 ? 32.128 100.885 113.549 1.00 38.94  ? 263  ALA A O   1 
ATOM   2029  C  CB  . ALA A  1  263 ? 30.043 98.405  113.023 1.00 39.65  ? 263  ALA A CB  1 
ATOM   2030  N  N   . HIS A  1  264 ? 32.801 99.019  114.636 1.00 38.91  ? 264  HIS A N   1 
ATOM   2031  C  CA  . HIS A  1  264 ? 33.384 99.709  115.802 1.00 38.97  ? 264  HIS A CA  1 
ATOM   2032  C  C   . HIS A  1  264 ? 34.374 100.819 115.484 1.00 38.94  ? 264  HIS A C   1 
ATOM   2033  O  O   . HIS A  1  264 ? 35.305 100.626 114.699 1.00 38.67  ? 264  HIS A O   1 
ATOM   2034  C  CB  . HIS A  1  264 ? 34.014 98.689  116.733 1.00 39.14  ? 264  HIS A CB  1 
ATOM   2035  C  CG  . HIS A  1  264 ? 33.785 98.965  118.185 1.00 39.40  ? 264  HIS A CG  1 
ATOM   2036  N  ND1 . HIS A  1  264 ? 34.431 99.970  118.862 1.00 42.05  ? 264  HIS A ND1 1 
ATOM   2037  C  CD2 . HIS A  1  264 ? 32.997 98.347  119.095 1.00 47.02  ? 264  HIS A CD2 1 
ATOM   2038  C  CE1 . HIS A  1  264 ? 34.048 99.968  120.126 1.00 43.09  ? 264  HIS A CE1 1 
ATOM   2039  N  NE2 . HIS A  1  264 ? 33.176 98.993  120.293 1.00 50.63  ? 264  HIS A NE2 1 
ATOM   2040  N  N   . PRO A  1  265 ? 34.147 101.996 116.080 1.00 39.24  ? 265  PRO A N   1 
ATOM   2041  C  CA  . PRO A  1  265 ? 34.998 103.174 115.862 1.00 39.12  ? 265  PRO A CA  1 
ATOM   2042  C  C   . PRO A  1  265 ? 36.414 102.965 116.280 1.00 39.35  ? 265  PRO A C   1 
ATOM   2043  O  O   . PRO A  1  265 ? 37.325 103.584 115.696 1.00 39.64  ? 265  PRO A O   1 
ATOM   2044  C  CB  . PRO A  1  265 ? 34.374 104.227 116.770 1.00 38.67  ? 265  PRO A CB  1 
ATOM   2045  C  CG  . PRO A  1  265 ? 32.983 103.809 116.921 1.00 37.81  ? 265  PRO A CG  1 
ATOM   2046  C  CD  . PRO A  1  265 ? 33.006 102.306 116.955 1.00 39.59  ? 265  PRO A CD  1 
ATOM   2047  N  N   . ASP A  1  266 ? 36.630 102.086 117.249 1.00 39.30  ? 266  ASP A N   1 
ATOM   2048  C  CA  . ASP A  1  266 ? 37.960 101.895 117.731 1.00 39.88  ? 266  ASP A CA  1 
ATOM   2049  C  C   . ASP A  1  266 ? 38.966 101.035 116.949 1.00 39.84  ? 266  ASP A C   1 
ATOM   2050  O  O   . ASP A  1  266 ? 40.061 100.729 117.451 1.00 40.32  ? 266  ASP A O   1 
ATOM   2051  C  CB  . ASP A  1  266 ? 38.093 101.888 119.285 1.00 40.48  ? 266  ASP A CB  1 
ATOM   2052  C  CG  . ASP A  1  266 ? 37.375 100.752 119.931 1.00 47.15  ? 266  ASP A CG  1 
ATOM   2053  O  OD1 . ASP A  1  266 ? 36.928 100.905 121.098 1.00 37.48  ? 266  ASP A OD1 1 
ATOM   2054  O  OD2 . ASP A  1  266 ? 37.223 99.654  119.364 1.00 54.64  ? 266  ASP A OD2 1 
ATOM   2055  N  N   . ASN A  1  267 ? 38.626 100.735 115.682 1.00 38.93  ? 267  ASN A N   1 
ATOM   2056  C  CA  . ASN A  1  267 ? 39.517 99.991  114.793 1.00 37.70  ? 267  ASN A CA  1 
ATOM   2057  C  C   . ASN A  1  267 ? 40.626 100.910 114.346 1.00 37.16  ? 267  ASN A C   1 
ATOM   2058  O  O   . ASN A  1  267 ? 41.696 100.460 113.953 1.00 37.53  ? 267  ASN A O   1 
ATOM   2059  C  CB  . ASN A  1  267 ? 38.765 99.475  113.562 1.00 37.20  ? 267  ASN A CB  1 
ATOM   2060  C  CG  . ASN A  1  267 ? 38.162 98.090  113.778 1.00 33.51  ? 267  ASN A CG  1 
ATOM   2061  O  OD1 . ASN A  1  267 ? 38.878 97.129  114.084 1.00 38.41  ? 267  ASN A OD1 1 
ATOM   2062  N  ND2 . ASN A  1  267 ? 36.849 97.977  113.601 1.00 24.48  ? 267  ASN A ND2 1 
ATOM   2063  N  N   . VAL A  1  268 ? 40.358 102.208 114.386 1.00 36.07  ? 268  VAL A N   1 
ATOM   2064  C  CA  . VAL A  1  268 ? 41.344 103.199 113.999 1.00 34.98  ? 268  VAL A CA  1 
ATOM   2065  C  C   . VAL A  1  268 ? 42.499 103.236 115.023 1.00 34.97  ? 268  VAL A C   1 
ATOM   2066  O  O   . VAL A  1  268 ? 43.645 103.073 114.650 1.00 35.54  ? 268  VAL A O   1 
ATOM   2067  C  CB  . VAL A  1  268 ? 40.710 104.585 113.812 1.00 34.60  ? 268  VAL A CB  1 
ATOM   2068  C  CG1 . VAL A  1  268 ? 41.755 105.593 113.398 1.00 31.34  ? 268  VAL A CG1 1 
ATOM   2069  C  CG2 . VAL A  1  268 ? 39.566 104.521 112.769 1.00 18.63  ? 268  VAL A CG2 1 
ATOM   2070  N  N   . ALA A  1  269 ? 42.188 103.373 116.315 1.00 34.48  ? 269  ALA A N   1 
ATOM   2071  C  CA  . ALA A  1  269 ? 43.237 103.388 117.352 1.00 33.98  ? 269  ALA A CA  1 
ATOM   2072  C  C   . ALA A  1  269 ? 44.047 102.074 117.380 1.00 34.50  ? 269  ALA A C   1 
ATOM   2073  O  O   . ALA A  1  269 ? 45.279 102.084 117.657 1.00 34.72  ? 269  ALA A O   1 
ATOM   2074  C  CB  . ALA A  1  269 ? 42.659 103.674 118.689 1.00 33.48  ? 269  ALA A CB  1 
ATOM   2075  N  N   . LEU A  1  270 ? 43.376 100.951 117.059 1.00 34.16  ? 270  LEU A N   1 
ATOM   2076  C  CA  . LEU A  1  270 ? 44.033 99.665  117.031 1.00 33.70  ? 270  LEU A CA  1 
ATOM   2077  C  C   . LEU A  1  270 ? 45.001 99.623  115.886 1.00 34.32  ? 270  LEU A C   1 
ATOM   2078  O  O   . LEU A  1  270 ? 46.113 99.092  116.022 1.00 34.49  ? 270  LEU A O   1 
ATOM   2079  C  CB  . LEU A  1  270 ? 43.028 98.546  116.892 1.00 33.47  ? 270  LEU A CB  1 
ATOM   2080  C  CG  . LEU A  1  270 ? 42.208 98.222  118.127 1.00 32.24  ? 270  LEU A CG  1 
ATOM   2081  C  CD1 . LEU A  1  270 ? 41.235 97.146  117.817 1.00 33.31  ? 270  LEU A CD1 1 
ATOM   2082  C  CD2 . LEU A  1  270 ? 43.105 97.856  119.318 1.00 32.67  ? 270  LEU A CD2 1 
ATOM   2083  N  N   . GLN A  1  271 ? 44.594 100.185 114.746 1.00 34.81  ? 271  GLN A N   1 
ATOM   2084  C  CA  . GLN A  1  271 ? 45.465 100.216 113.586 1.00 35.79  ? 271  GLN A CA  1 
ATOM   2085  C  C   . GLN A  1  271 ? 46.679 101.118 113.795 1.00 36.10  ? 271  GLN A C   1 
ATOM   2086  O  O   . GLN A  1  271 ? 47.734 100.866 113.223 1.00 36.49  ? 271  GLN A O   1 
ATOM   2087  C  CB  . GLN A  1  271 ? 44.720 100.598 112.300 1.00 36.26  ? 271  GLN A CB  1 
ATOM   2088  C  CG  . GLN A  1  271 ? 43.804 99.499  111.723 1.00 54.91  ? 271  GLN A CG  1 
ATOM   2089  C  CD  . GLN A  1  271 ? 44.550 98.237  111.208 1.00 63.24  ? 271  GLN A CD  1 
ATOM   2090  O  OE1 . GLN A  1  271 ? 43.915 97.323  110.690 1.00 69.62  ? 271  GLN A OE1 1 
ATOM   2091  N  NE2 . GLN A  1  271 ? 45.875 98.203  111.351 1.00 67.38  ? 271  GLN A NE2 1 
ATOM   2092  N  N   . VAL A  1  272 ? 46.521 102.166 114.610 1.00 35.79  ? 272  VAL A N   1 
ATOM   2093  C  CA  . VAL A  1  272 ? 47.630 103.049 114.934 1.00 35.87  ? 272  VAL A CA  1 
ATOM   2094  C  C   . VAL A  1  272 ? 48.656 102.270 115.802 1.00 36.11  ? 272  VAL A C   1 
ATOM   2095  O  O   . VAL A  1  272 ? 49.863 102.273 115.519 1.00 36.44  ? 272  VAL A O   1 
ATOM   2096  C  CB  . VAL A  1  272 ? 47.141 104.344 115.691 1.00 35.50  ? 272  VAL A CB  1 
ATOM   2097  C  CG1 . VAL A  1  272 ? 48.335 105.190 116.187 1.00 25.44  ? 272  VAL A CG1 1 
ATOM   2098  C  CG2 . VAL A  1  272 ? 46.291 105.144 114.798 1.00 30.81  ? 272  VAL A CG2 1 
ATOM   2099  N  N   . ALA A  1  273 ? 48.155 101.570 116.812 1.00 35.85  ? 273  ALA A N   1 
ATOM   2100  C  CA  . ALA A  1  273 ? 49.008 100.813 117.707 1.00 35.91  ? 273  ALA A CA  1 
ATOM   2101  C  C   . ALA A  1  273 ? 49.733 99.681  116.961 1.00 35.81  ? 273  ALA A C   1 
ATOM   2102  O  O   . ALA A  1  273 ? 50.904 99.414  117.206 1.00 36.01  ? 273  ALA A O   1 
ATOM   2103  C  CB  . ALA A  1  273 ? 48.194 100.269 118.832 1.00 36.01  ? 273  ALA A CB  1 
ATOM   2104  N  N   . ASN A  1  274 ? 49.011 99.030  116.057 1.00 35.46  ? 274  ASN A N   1 
ATOM   2105  C  CA  . ASN A  1  274 ? 49.561 97.971  115.235 1.00 34.79  ? 274  ASN A CA  1 
ATOM   2106  C  C   . ASN A  1  274 ? 50.648 98.542  114.370 1.00 34.08  ? 274  ASN A C   1 
ATOM   2107  O  O   . ASN A  1  274 ? 51.697 97.945  114.234 1.00 34.46  ? 274  ASN A O   1 
ATOM   2108  C  CB  . ASN A  1  274 ? 48.462 97.346  114.342 1.00 34.61  ? 274  ASN A CB  1 
ATOM   2109  C  CG  . ASN A  1  274 ? 47.815 96.120  114.966 1.00 34.57  ? 274  ASN A CG  1 
ATOM   2110  O  OD1 . ASN A  1  274 ? 46.976 95.488  114.356 1.00 44.59  ? 274  ASN A OD1 1 
ATOM   2111  N  ND2 . ASN A  1  274 ? 48.210 95.784  116.182 1.00 28.74  ? 274  ASN A ND2 1 
ATOM   2112  N  N   . ALA A  1  275 ? 50.392 99.708  113.782 1.00 33.28  ? 275  ALA A N   1 
ATOM   2113  C  CA  . ALA A  1  275 ? 51.387 100.370 112.949 1.00 33.05  ? 275  ALA A CA  1 
ATOM   2114  C  C   . ALA A  1  275 ? 52.684 100.658 113.748 1.00 33.23  ? 275  ALA A C   1 
ATOM   2115  O  O   . ALA A  1  275 ? 53.774 100.411 113.260 1.00 33.85  ? 275  ALA A O   1 
ATOM   2116  C  CB  . ALA A  1  275 ? 50.832 101.641 112.331 1.00 32.57  ? 275  ALA A CB  1 
ATOM   2117  N  N   . ILE A  1  276 ? 52.547 101.148 114.971 1.00 33.06  ? 276  ILE A N   1 
ATOM   2118  C  CA  . ILE A  1  276 ? 53.707 101.395 115.816 1.00 33.65  ? 276  ILE A CA  1 
ATOM   2119  C  C   . ILE A  1  276 ? 54.555 100.105 115.933 1.00 34.94  ? 276  ILE A C   1 
ATOM   2120  O  O   . ILE A  1  276 ? 55.799 100.166 115.845 1.00 35.17  ? 276  ILE A O   1 
ATOM   2121  C  CB  . ILE A  1  276 ? 53.271 101.886 117.230 1.00 33.24  ? 276  ILE A CB  1 
ATOM   2122  C  CG1 . ILE A  1  276 ? 52.499 103.182 117.146 1.00 22.61  ? 276  ILE A CG1 1 
ATOM   2123  C  CG2 . ILE A  1  276 ? 54.436 102.087 118.102 1.00 27.86  ? 276  ILE A CG2 1 
ATOM   2124  C  CD1 . ILE A  1  276 ? 51.898 103.601 118.478 1.00 20.95  ? 276  ILE A CD1 1 
ATOM   2125  N  N   . ILE A  1  277 ? 53.890 98.941  116.112 1.00 35.24  ? 277  ILE A N   1 
ATOM   2126  C  CA  . ILE A  1  277 ? 54.608 97.691  116.192 1.00 36.19  ? 277  ILE A CA  1 
ATOM   2127  C  C   . ILE A  1  277 ? 55.095 97.316  114.815 1.00 37.41  ? 277  ILE A C   1 
ATOM   2128  O  O   . ILE A  1  277 ? 56.218 96.816  114.650 1.00 38.00  ? 277  ILE A O   1 
ATOM   2129  C  CB  . ILE A  1  277 ? 53.745 96.604  116.778 1.00 36.91  ? 277  ILE A CB  1 
ATOM   2130  C  CG1 . ILE A  1  277 ? 53.329 96.983  118.201 1.00 37.27  ? 277  ILE A CG1 1 
ATOM   2131  C  CG2 . ILE A  1  277 ? 54.510 95.262  116.809 1.00 33.92  ? 277  ILE A CG2 1 
ATOM   2132  C  CD1 . ILE A  1  277 ? 52.767 95.861  118.961 1.00 27.04  ? 277  ILE A CD1 1 
ATOM   2133  N  N   . GLY A  1  278 ? 54.255 97.580  113.816 1.00 37.90  ? 278  GLY A N   1 
ATOM   2134  C  CA  . GLY A  1  278 ? 54.593 97.366  112.410 1.00 38.43  ? 278  GLY A CA  1 
ATOM   2135  C  C   . GLY A  1  278 ? 54.830 95.972  111.887 1.00 39.02  ? 278  GLY A C   1 
ATOM   2136  O  O   . GLY A  1  278 ? 54.114 95.037  112.192 1.00 39.00  ? 278  GLY A O   1 
ATOM   2137  N  N   . HIS A  1  279 ? 55.833 95.856  111.034 1.00 39.85  ? 279  HIS A N   1 
ATOM   2138  C  CA  . HIS A  1  279 ? 56.189 94.583  110.442 1.00 40.35  ? 279  HIS A CA  1 
ATOM   2139  C  C   . HIS A  1  279 ? 57.668 94.481  110.148 1.00 39.83  ? 279  HIS A C   1 
ATOM   2140  O  O   . HIS A  1  279 ? 58.385 95.485  110.158 1.00 41.59  ? 279  HIS A O   1 
ATOM   2141  C  CB  . HIS A  1  279 ? 55.351 94.292  109.186 1.00 41.46  ? 279  HIS A CB  1 
ATOM   2142  C  CG  . HIS A  1  279 ? 55.059 95.495  108.340 1.00 64.55  ? 279  HIS A CG  1 
ATOM   2143  N  ND1 . HIS A  1  279 ? 55.807 95.824  107.229 1.00 70.29  ? 279  HIS A ND1 1 
ATOM   2144  C  CD2 . HIS A  1  279 ? 54.046 96.396  108.389 1.00 68.18  ? 279  HIS A CD2 1 
ATOM   2145  C  CE1 . HIS A  1  279 ? 55.290 96.895  106.652 1.00 67.89  ? 279  HIS A CE1 1 
ATOM   2146  N  NE2 . HIS A  1  279 ? 54.222 97.262  107.337 1.00 66.70  ? 279  HIS A NE2 1 
ATOM   2147  N  N   . TYR A  1  280 ? 58.146 93.279  109.938 1.00 37.72  ? 280  TYR A N   1 
ATOM   2148  C  CA  . TYR A  1  280 ? 59.524 93.093  109.625 1.00 37.00  ? 280  TYR A CA  1 
ATOM   2149  C  C   . TYR A  1  280 ? 59.681 91.935  108.732 1.00 37.92  ? 280  TYR A C   1 
ATOM   2150  O  O   . TYR A  1  280 ? 58.843 90.994  108.732 1.00 39.68  ? 280  TYR A O   1 
ATOM   2151  C  CB  . TYR A  1  280 ? 60.362 92.889  110.884 1.00 36.23  ? 280  TYR A CB  1 
ATOM   2152  C  CG  . TYR A  1  280 ? 61.832 92.609  110.625 1.00 22.25  ? 280  TYR A CG  1 
ATOM   2153  C  CD1 . TYR A  1  280 ? 62.686 93.613  110.186 1.00 19.46  ? 280  TYR A CD1 1 
ATOM   2154  C  CD2 . TYR A  1  280 ? 62.359 91.330  110.796 1.00 22.12  ? 280  TYR A CD2 1 
ATOM   2155  C  CE1 . TYR A  1  280 ? 64.043 93.353  109.938 1.00 21.65  ? 280  TYR A CE1 1 
ATOM   2156  C  CE2 . TYR A  1  280 ? 63.691 91.050  110.511 1.00 24.50  ? 280  TYR A CE2 1 
ATOM   2157  C  CZ  . TYR A  1  280 ? 64.531 92.064  110.110 1.00 32.02  ? 280  TYR A CZ  1 
ATOM   2158  O  OH  . TYR A  1  280 ? 65.860 91.782  109.868 1.00 40.47  ? 280  TYR A OH  1 
ATOM   2159  N  N   . ASP A  1  281 ? 60.785 91.940  108.016 1.00 36.77  ? 281  ASP A N   1 
ATOM   2160  C  CA  . ASP A  1  281 ? 61.121 90.905  107.128 1.00 36.25  ? 281  ASP A CA  1 
ATOM   2161  C  C   . ASP A  1  281 ? 62.618 90.968  106.953 1.00 35.25  ? 281  ASP A C   1 
ATOM   2162  O  O   . ASP A  1  281 ? 63.183 92.060  106.880 1.00 35.79  ? 281  ASP A O   1 
ATOM   2163  C  CB  . ASP A  1  281 ? 60.491 91.255  105.835 1.00 37.42  ? 281  ASP A CB  1 
ATOM   2164  C  CG  . ASP A  1  281 ? 60.698 90.299  104.874 1.00 36.16  ? 281  ASP A CG  1 
ATOM   2165  O  OD1 . ASP A  1  281 ? 59.973 89.334  104.967 1.00 47.39  ? 281  ASP A OD1 1 
ATOM   2166  O  OD2 . ASP A  1  281 ? 61.605 90.376  104.001 1.00 31.39  ? 281  ASP A OD2 1 
ATOM   2167  N  N   . CYS A  1  282 ? 63.256 89.832  106.758 1.00 33.60  ? 282  CYS A N   1 
ATOM   2168  C  CA  . CYS A  1  282 ? 64.709 89.812  106.597 1.00 32.36  ? 282  CYS A CA  1 
ATOM   2169  C  C   . CYS A  1  282 ? 65.259 90.568  105.403 1.00 31.52  ? 282  CYS A C   1 
ATOM   2170  O  O   . CYS A  1  282 ? 66.461 90.713  105.290 1.00 31.37  ? 282  CYS A O   1 
ATOM   2171  C  CB  . CYS A  1  282 ? 65.235 88.402  106.566 1.00 32.37  ? 282  CYS A CB  1 
ATOM   2172  S  SG  . CYS A  1  282 ? 64.682 87.502  105.073 1.00 38.86  ? 282  CYS A SG  1 
ATOM   2173  N  N   . THR A  1  283 ? 64.409 91.021  104.486 1.00 31.24  ? 283  THR A N   1 
ATOM   2174  C  CA  . THR A  1  283 ? 64.933 91.823  103.352 1.00 30.84  ? 283  THR A CA  1 
ATOM   2175  C  C   . THR A  1  283 ? 64.755 93.296  103.547 1.00 31.03  ? 283  THR A C   1 
ATOM   2176  O  O   . THR A  1  283 ? 64.975 94.061  102.618 1.00 31.84  ? 283  THR A O   1 
ATOM   2177  C  CB  . THR A  1  283 ? 64.316 91.442  102.021 1.00 30.87  ? 283  THR A CB  1 
ATOM   2178  O  OG1 . THR A  1  283 ? 62.908 91.688  102.058 1.00 26.28  ? 283  THR A OG1 1 
ATOM   2179  C  CG2 . THR A  1  283 ? 64.454 89.927  101.727 1.00 33.65  ? 283  THR A CG2 1 
ATOM   2180  N  N   . TYR A  1  284 ? 64.314 93.729  104.733 1.00 31.05  ? 284  TYR A N   1 
ATOM   2181  C  CA  . TYR A  1  284 ? 64.190 95.184  104.968 1.00 30.57  ? 284  TYR A CA  1 
ATOM   2182  C  C   . TYR A  1  284 ? 65.577 95.730  105.166 1.00 31.53  ? 284  TYR A C   1 
ATOM   2183  O  O   . TYR A  1  284 ? 66.420 95.093  105.828 1.00 31.98  ? 284  TYR A O   1 
ATOM   2184  C  CB  . TYR A  1  284 ? 63.414 95.524  106.233 1.00 29.49  ? 284  TYR A CB  1 
ATOM   2185  C  CG  . TYR A  1  284 ? 61.927 95.371  106.181 1.00 26.78  ? 284  TYR A CG  1 
ATOM   2186  C  CD1 . TYR A  1  284 ? 61.306 94.620  105.173 1.00 32.21  ? 284  TYR A CD1 1 
ATOM   2187  C  CD2 . TYR A  1  284 ? 61.121 95.909  107.200 1.00 21.58  ? 284  TYR A CD2 1 
ATOM   2188  C  CE1 . TYR A  1  284 ? 59.916 94.458  105.130 1.00 19.58  ? 284  TYR A CE1 1 
ATOM   2189  C  CE2 . TYR A  1  284 ? 59.703 95.712  107.201 1.00 21.13  ? 284  TYR A CE2 1 
ATOM   2190  C  CZ  . TYR A  1  284 ? 59.120 94.963  106.167 1.00 19.94  ? 284  TYR A CZ  1 
ATOM   2191  O  OH  . TYR A  1  284 ? 57.746 94.803  106.101 1.00 29.54  ? 284  TYR A OH  1 
ATOM   2192  N  N   . GLY A  1  285 ? 65.829 96.895  104.585 1.00 31.85  ? 285  GLY A N   1 
ATOM   2193  C  CA  . GLY A  1  285 ? 67.065 97.606  104.817 1.00 32.27  ? 285  GLY A CA  1 
ATOM   2194  C  C   . GLY A  1  285 ? 66.773 98.306  106.115 1.00 33.55  ? 285  GLY A C   1 
ATOM   2195  O  O   . GLY A  1  285 ? 65.585 98.485  106.481 1.00 33.53  ? 285  GLY A O   1 
ATOM   2196  N  N   . GLY A  1  286 ? 67.792 98.714  106.834 1.00 34.93  ? 286  GLY A N   1 
ATOM   2197  C  CA  . GLY A  1  286 ? 67.538 99.305  108.136 1.00 36.75  ? 286  GLY A CA  1 
ATOM   2198  C  C   . GLY A  1  286 ? 67.223 98.147  109.095 1.00 38.34  ? 286  GLY A C   1 
ATOM   2199  O  O   . GLY A  1  286 ? 66.168 97.453  109.011 1.00 38.99  ? 286  GLY A O   1 
ATOM   2200  N  N   . GLY A  1  287 ? 68.160 97.852  109.956 1.00 38.23  ? 287  GLY A N   1 
ATOM   2201  C  CA  . GLY A  1  287 ? 67.937 96.768  110.876 1.00 36.71  ? 287  GLY A CA  1 
ATOM   2202  C  C   . GLY A  1  287 ? 67.784 97.370  112.213 1.00 34.92  ? 287  GLY A C   1 
ATOM   2203  O  O   . GLY A  1  287 ? 66.678 97.699  112.632 1.00 34.24  ? 287  GLY A O   1 
ATOM   2204  N  N   . ALA A  1  288 ? 68.941 97.645  112.811 1.00 33.70  ? 288  ALA A N   1 
ATOM   2205  C  CA  . ALA A  1  288 ? 69.057 98.222  114.112 1.00 32.49  ? 288  ALA A CA  1 
ATOM   2206  C  C   . ALA A  1  288 ? 68.334 99.550  114.291 1.00 32.38  ? 288  ALA A C   1 
ATOM   2207  O  O   . ALA A  1  288 ? 67.834 99.853  115.391 1.00 33.47  ? 288  ALA A O   1 
ATOM   2208  C  CB  . ALA A  1  288 ? 70.518 98.381  114.435 1.00 31.85  ? 288  ALA A CB  1 
ATOM   2209  N  N   . HIS A  1  289 ? 68.228 100.334 113.228 1.00 31.09  ? 289  HIS A N   1 
ATOM   2210  C  CA  . HIS A  1  289 ? 67.662 101.680 113.377 1.00 29.86  ? 289  HIS A CA  1 
ATOM   2211  C  C   . HIS A  1  289 ? 66.191 101.813 113.207 1.00 28.86  ? 289  HIS A C   1 
ATOM   2212  O  O   . HIS A  1  289 ? 65.663 102.906 113.378 1.00 28.43  ? 289  HIS A O   1 
ATOM   2213  C  CB  . HIS A  1  289 ? 68.390 102.692 112.519 1.00 29.06  ? 289  HIS A CB  1 
ATOM   2214  C  CG  . HIS A  1  289 ? 69.872 102.640 112.667 1.00 32.45  ? 289  HIS A CG  1 
ATOM   2215  N  ND1 . HIS A  1  289 ? 70.728 102.604 111.585 1.00 33.22  ? 289  HIS A ND1 1 
ATOM   2216  C  CD2 . HIS A  1  289 ? 70.658 102.615 113.769 1.00 33.56  ? 289  HIS A CD2 1 
ATOM   2217  C  CE1 . HIS A  1  289 ? 71.979 102.570 112.015 1.00 30.38  ? 289  HIS A CE1 1 
ATOM   2218  N  NE2 . HIS A  1  289 ? 71.964 102.579 113.337 1.00 26.75  ? 289  HIS A NE2 1 
ATOM   2219  N  N   . LEU A  1  290 ? 65.508 100.710 112.909 1.00 28.15  ? 290  LEU A N   1 
ATOM   2220  C  CA  . LEU A  1  290 ? 64.052 100.758 112.736 1.00 28.45  ? 290  LEU A CA  1 
ATOM   2221  C  C   . LEU A  1  290 ? 63.364 101.314 114.016 1.00 29.52  ? 290  LEU A C   1 
ATOM   2222  O  O   . LEU A  1  290 ? 63.797 101.020 115.145 1.00 29.45  ? 290  LEU A O   1 
ATOM   2223  C  CB  . LEU A  1  290 ? 63.505 99.371  112.379 1.00 28.23  ? 290  LEU A CB  1 
ATOM   2224  C  CG  . LEU A  1  290 ? 63.848 98.800  110.994 1.00 31.45  ? 290  LEU A CG  1 
ATOM   2225  C  CD1 . LEU A  1  290 ? 63.437 97.373  110.882 1.00 32.32  ? 290  LEU A CD1 1 
ATOM   2226  C  CD2 . LEU A  1  290 ? 63.198 99.598  109.911 1.00 27.95  ? 290  LEU A CD2 1 
ATOM   2227  N  N   . SER A  1  291 ? 62.346 102.154 113.826 1.00 30.40  ? 291  SER A N   1 
ATOM   2228  C  CA  . SER A  1  291 ? 61.641 102.776 114.934 1.00 31.78  ? 291  SER A CA  1 
ATOM   2229  C  C   . SER A  1  291 ? 61.033 101.747 115.870 1.00 32.57  ? 291  SER A C   1 
ATOM   2230  O  O   . SER A  1  291 ? 61.355 101.726 117.063 1.00 33.14  ? 291  SER A O   1 
ATOM   2231  C  CB  . SER A  1  291 ? 60.539 103.688 114.429 1.00 32.06  ? 291  SER A CB  1 
ATOM   2232  O  OG  . SER A  1  291 ? 61.018 104.614 113.481 1.00 41.91  ? 291  SER A OG  1 
ATOM   2233  N  N   . SER A  1  292 ? 60.182 100.887 115.324 1.00 32.03  ? 292  SER A N   1 
ATOM   2234  C  CA  . SER A  1  292 ? 59.530 99.864  116.101 1.00 31.67  ? 292  SER A CA  1 
ATOM   2235  C  C   . SER A  1  292 ? 60.538 99.070  116.835 1.00 31.56  ? 292  SER A C   1 
ATOM   2236  O  O   . SER A  1  292 ? 61.448 98.539  116.233 1.00 31.84  ? 292  SER A O   1 
ATOM   2237  C  CB  . SER A  1  292 ? 58.716 98.918  115.189 1.00 31.66  ? 292  SER A CB  1 
ATOM   2238  O  OG  . SER A  1  292 ? 58.470 97.649  115.825 1.00 27.44  ? 292  SER A OG  1 
ATOM   2239  N  N   . PRO A  1  293 ? 60.427 99.060  118.157 1.00 31.52  ? 293  PRO A N   1 
ATOM   2240  C  CA  . PRO A  1  293 ? 61.335 98.279  119.015 1.00 31.91  ? 293  PRO A CA  1 
ATOM   2241  C  C   . PRO A  1  293 ? 61.308 96.759  118.706 1.00 32.29  ? 293  PRO A C   1 
ATOM   2242  O  O   . PRO A  1  293 ? 62.371 96.128  118.761 1.00 32.60  ? 293  PRO A O   1 
ATOM   2243  C  CB  . PRO A  1  293 ? 60.824 98.551  120.435 1.00 31.50  ? 293  PRO A CB  1 
ATOM   2244  C  CG  . PRO A  1  293 ? 59.979 99.847  120.316 1.00 23.08  ? 293  PRO A CG  1 
ATOM   2245  C  CD  . PRO A  1  293 ? 59.446 99.849  118.929 1.00 31.37  ? 293  PRO A CD  1 
ATOM   2246  N  N   . LEU A  1  294 ? 60.143 96.200  118.365 1.00 31.97  ? 294  LEU A N   1 
ATOM   2247  C  CA  . LEU A  1  294 ? 60.078 94.771  118.052 1.00 31.41  ? 294  LEU A CA  1 
ATOM   2248  C  C   . LEU A  1  294 ? 60.935 94.536  116.837 1.00 32.08  ? 294  LEU A C   1 
ATOM   2249  O  O   . LEU A  1  294 ? 61.863 93.776  116.883 1.00 32.86  ? 294  LEU A O   1 
ATOM   2250  C  CB  . LEU A  1  294 ? 58.645 94.315  117.798 1.00 30.57  ? 294  LEU A CB  1 
ATOM   2251  C  CG  . LEU A  1  294 ? 58.421 92.879  117.294 1.00 29.22  ? 294  LEU A CG  1 
ATOM   2252  C  CD1 . LEU A  1  294 ? 59.185 91.862  118.047 1.00 25.01  ? 294  LEU A CD1 1 
ATOM   2253  C  CD2 . LEU A  1  294 ? 56.950 92.507  117.295 1.00 30.96  ? 294  LEU A CD2 1 
ATOM   2254  N  N   . ALA A  1  295 ? 60.667 95.278  115.788 1.00 32.30  ? 295  ALA A N   1 
ATOM   2255  C  CA  . ALA A  1  295 ? 61.412 95.183  114.550 1.00 32.62  ? 295  ALA A CA  1 
ATOM   2256  C  C   . ALA A  1  295 ? 62.910 95.335  114.768 1.00 33.84  ? 295  ALA A C   1 
ATOM   2257  O  O   . ALA A  1  295 ? 63.715 94.525  114.293 1.00 34.34  ? 295  ALA A O   1 
ATOM   2258  C  CB  . ALA A  1  295 ? 60.924 96.230  113.597 1.00 31.84  ? 295  ALA A CB  1 
ATOM   2259  N  N   . SER A  1  296 ? 63.279 96.354  115.508 1.00 34.33  ? 296  SER A N   1 
ATOM   2260  C  CA  . SER A  1  296 ? 64.681 96.612  115.785 1.00 34.97  ? 296  SER A CA  1 
ATOM   2261  C  C   . SER A  1  296 ? 65.385 95.461  116.581 1.00 35.49  ? 296  SER A C   1 
ATOM   2262  O  O   . SER A  1  296 ? 66.466 94.995  116.195 1.00 34.58  ? 296  SER A O   1 
ATOM   2263  C  CB  . SER A  1  296 ? 64.828 97.928  116.523 1.00 34.27  ? 296  SER A CB  1 
ATOM   2264  O  OG  . SER A  1  296 ? 66.086 97.990  117.114 1.00 27.94  ? 296  SER A OG  1 
ATOM   2265  N  N   . ILE A  1  297 ? 64.757 95.019  117.669 1.00 36.64  ? 297  ILE A N   1 
ATOM   2266  C  CA  . ILE A  1  297 ? 65.329 93.953  118.476 1.00 38.55  ? 297  ILE A CA  1 
ATOM   2267  C  C   . ILE A  1  297 ? 65.338 92.639  117.682 1.00 40.24  ? 297  ILE A C   1 
ATOM   2268  O  O   . ILE A  1  297 ? 66.294 91.826  117.809 1.00 40.84  ? 297  ILE A O   1 
ATOM   2269  C  CB  . ILE A  1  297 ? 64.586 93.806  119.846 1.00 39.00  ? 297  ILE A CB  1 
ATOM   2270  C  CG1 . ILE A  1  297 ? 64.788 95.094  120.710 1.00 51.05  ? 297  ILE A CG1 1 
ATOM   2271  C  CG2 . ILE A  1  297 ? 65.126 92.623  120.628 1.00 36.56  ? 297  ILE A CG2 1 
ATOM   2272  C  CD1 . ILE A  1  297 ? 63.909 95.163  122.059 1.00 49.49  ? 297  ILE A CD1 1 
ATOM   2273  N  N   . ALA A  1  298 ? 64.338 92.461  116.805 1.00 40.59  ? 298  ALA A N   1 
ATOM   2274  C  CA  . ALA A  1  298 ? 64.272 91.270  115.983 1.00 41.70  ? 298  ALA A CA  1 
ATOM   2275  C  C   . ALA A  1  298 ? 65.382 91.246  114.947 1.00 43.51  ? 298  ALA A C   1 
ATOM   2276  O  O   . ALA A  1  298 ? 65.952 90.188  114.667 1.00 44.56  ? 298  ALA A O   1 
ATOM   2277  C  CB  . ALA A  1  298 ? 62.963 91.149  115.328 1.00 41.47  ? 298  ALA A CB  1 
ATOM   2278  N  N   . ALA A  1  299 ? 65.694 92.397  114.380 1.00 43.85  ? 299  ALA A N   1 
ATOM   2279  C  CA  . ALA A  1  299 ? 66.725 92.465  113.383 1.00 44.59  ? 299  ALA A CA  1 
ATOM   2280  C  C   . ALA A  1  299 ? 68.115 92.269  113.953 1.00 45.14  ? 299  ALA A C   1 
ATOM   2281  O  O   . ALA A  1  299 ? 68.905 91.495  113.397 1.00 45.86  ? 299  ALA A O   1 
ATOM   2282  C  CB  . ALA A  1  299 ? 66.658 93.795  112.629 1.00 44.75  ? 299  ALA A CB  1 
ATOM   2283  N  N   . THR A  1  300 ? 68.427 92.960  115.051 1.00 44.91  ? 300  THR A N   1 
ATOM   2284  C  CA  . THR A  1  300 ? 69.785 92.888  115.613 1.00 45.16  ? 300  THR A CA  1 
ATOM   2285  C  C   . THR A  1  300 ? 70.060 91.582  116.223 1.00 45.62  ? 300  THR A C   1 
ATOM   2286  O  O   . THR A  1  300 ? 71.115 91.004  116.017 1.00 45.82  ? 300  THR A O   1 
ATOM   2287  C  CB  . THR A  1  300 ? 70.037 93.979  116.639 1.00 44.82  ? 300  THR A CB  1 
ATOM   2288  O  OG1 . THR A  1  300 ? 69.004 93.963  117.598 1.00 52.59  ? 300  THR A OG1 1 
ATOM   2289  C  CG2 . THR A  1  300 ? 69.871 95.269  116.046 1.00 33.14  ? 300  THR A CG2 1 
ATOM   2290  N  N   . ASN A  1  301 ? 69.116 91.097  117.002 1.00 45.69  ? 301  ASN A N   1 
ATOM   2291  C  CA  . ASN A  1  301 ? 69.303 89.832  117.628 1.00 45.61  ? 301  ASN A CA  1 
ATOM   2292  C  C   . ASN A  1  301 ? 68.935 88.645  116.725 1.00 45.37  ? 301  ASN A C   1 
ATOM   2293  O  O   . ASN A  1  301 ? 69.174 87.500  117.096 1.00 45.58  ? 301  ASN A O   1 
ATOM   2294  C  CB  . ASN A  1  301 ? 68.596 89.769  118.972 1.00 45.65  ? 301  ASN A CB  1 
ATOM   2295  C  CG  . ASN A  1  301 ? 69.374 90.435  120.062 1.00 45.98  ? 301  ASN A CG  1 
ATOM   2296  O  OD1 . ASN A  1  301 ? 70.366 89.888  120.566 1.00 49.92  ? 301  ASN A OD1 1 
ATOM   2297  N  ND2 . ASN A  1  301 ? 68.936 91.610  120.454 1.00 52.51  ? 301  ASN A ND2 1 
ATOM   2298  N  N   . LYS A  1  302 ? 68.387 88.944  115.535 1.00 44.81  ? 302  LYS A N   1 
ATOM   2299  C  CA  . LYS A  1  302 ? 68.013 87.927  114.531 1.00 44.74  ? 302  LYS A CA  1 
ATOM   2300  C  C   . LYS A  1  302 ? 67.043 86.964  115.092 1.00 43.96  ? 302  LYS A C   1 
ATOM   2301  O  O   . LYS A  1  302 ? 67.236 85.766  114.974 1.00 43.92  ? 302  LYS A O   1 
ATOM   2302  C  CB  . LYS A  1  302 ? 69.241 87.181  113.991 1.00 45.14  ? 302  LYS A CB  1 
ATOM   2303  C  CG  . LYS A  1  302 ? 70.231 88.081  113.316 1.00 59.83  ? 302  LYS A CG  1 
ATOM   2304  C  CD  . LYS A  1  302 ? 71.519 87.367  113.047 1.00 68.77  ? 302  LYS A CD  1 
ATOM   2305  C  CE  . LYS A  1  302 ? 72.479 88.265  112.283 1.00 76.43  ? 302  LYS A CE  1 
ATOM   2306  N  NZ  . LYS A  1  302 ? 73.800 87.599  112.115 1.00 82.60  ? 302  LYS A NZ  1 
ATOM   2307  N  N   . LEU A  1  303 ? 65.967 87.493  115.690 1.00 43.03  ? 303  LEU A N   1 
ATOM   2308  C  CA  . LEU A  1  303 ? 64.939 86.664  116.338 1.00 41.96  ? 303  LEU A CA  1 
ATOM   2309  C  C   . LEU A  1  303 ? 63.851 86.159  115.452 1.00 41.26  ? 303  LEU A C   1 
ATOM   2310  O  O   . LEU A  1  303 ? 62.883 85.573  115.961 1.00 42.38  ? 303  LEU A O   1 
ATOM   2311  C  CB  . LEU A  1  303 ? 64.252 87.445  117.450 1.00 41.59  ? 303  LEU A CB  1 
ATOM   2312  C  CG  . LEU A  1  303 ? 65.117 88.056  118.526 1.00 41.71  ? 303  LEU A CG  1 
ATOM   2313  C  CD1 . LEU A  1  303 ? 64.221 88.745  119.568 1.00 44.52  ? 303  LEU A CD1 1 
ATOM   2314  C  CD2 . LEU A  1  303 ? 65.972 87.012  119.156 1.00 40.23  ? 303  LEU A CD2 1 
ATOM   2315  N  N   . CYS A  1  304 ? 63.924 86.456  114.160 1.00 39.43  ? 304  CYS A N   1 
ATOM   2316  C  CA  . CYS A  1  304 ? 62.885 86.024  113.223 1.00 38.56  ? 304  CYS A CA  1 
ATOM   2317  C  C   . CYS A  1  304 ? 63.241 86.249  111.780 1.00 38.56  ? 304  CYS A C   1 
ATOM   2318  O  O   . CYS A  1  304 ? 64.269 86.827  111.454 1.00 39.55  ? 304  CYS A O   1 
ATOM   2319  C  CB  . CYS A  1  304 ? 61.492 86.619  113.543 1.00 37.83  ? 304  CYS A CB  1 
ATOM   2320  S  SG  . CYS A  1  304 ? 61.218 88.349  113.136 1.00 34.01  ? 304  CYS A SG  1 
ATOM   2321  N  N   . GLN A  1  305 ? 62.404 85.749  110.914 1.00 37.21  ? 305  GLN A N   1 
ATOM   2322  C  CA  . GLN A  1  305 ? 62.603 85.913  109.510 1.00 35.84  ? 305  GLN A CA  1 
ATOM   2323  C  C   . GLN A  1  305 ? 61.598 86.960  109.046 1.00 34.32  ? 305  GLN A C   1 
ATOM   2324  O  O   . GLN A  1  305 ? 61.864 87.705  108.152 1.00 35.06  ? 305  GLN A O   1 
ATOM   2325  C  CB  . GLN A  1  305 ? 62.354 84.586  108.784 1.00 35.55  ? 305  GLN A CB  1 
ATOM   2326  C  CG  . GLN A  1  305 ? 63.158 84.426  107.547 1.00 45.64  ? 305  GLN A CG  1 
ATOM   2327  C  CD  . GLN A  1  305 ? 64.640 84.361  107.861 1.00 55.88  ? 305  GLN A CD  1 
ATOM   2328  O  OE1 . GLN A  1  305 ? 65.485 85.013  107.183 1.00 52.27  ? 305  GLN A OE1 1 
ATOM   2329  N  NE2 . GLN A  1  305 ? 64.981 83.600  108.900 1.00 56.98  ? 305  GLN A NE2 1 
ATOM   2330  N  N   . SER A  1  306 ? 60.449 86.982  109.677 1.00 32.60  ? 306  SER A N   1 
ATOM   2331  C  CA  . SER A  1  306 ? 59.443 87.942  109.393 1.00 32.55  ? 306  SER A CA  1 
ATOM   2332  C  C   . SER A  1  306 ? 58.430 87.987  110.535 1.00 32.74  ? 306  SER A C   1 
ATOM   2333  O  O   . SER A  1  306 ? 58.361 87.058  111.376 1.00 32.84  ? 306  SER A O   1 
ATOM   2334  C  CB  . SER A  1  306 ? 58.708 87.592  108.102 1.00 32.79  ? 306  SER A CB  1 
ATOM   2335  O  OG  . SER A  1  306 ? 57.860 86.463  108.271 1.00 34.41  ? 306  SER A OG  1 
ATOM   2336  N  N   . PHE A  1  307 ? 57.707 89.096  110.614 1.00 32.20  ? 307  PHE A N   1 
ATOM   2337  C  CA  . PHE A  1  307 ? 56.583 89.229  111.544 1.00 31.80  ? 307  PHE A CA  1 
ATOM   2338  C  C   . PHE A  1  307 ? 55.625 90.300  111.010 1.00 31.39  ? 307  PHE A C   1 
ATOM   2339  O  O   . PHE A  1  307 ? 56.024 91.172  110.250 1.00 30.87  ? 307  PHE A O   1 
ATOM   2340  C  CB  . PHE A  1  307 ? 57.015 89.498  113.002 1.00 31.92  ? 307  PHE A CB  1 
ATOM   2341  C  CG  . PHE A  1  307 ? 57.370 90.909  113.286 1.00 40.36  ? 307  PHE A CG  1 
ATOM   2342  C  CD1 . PHE A  1  307 ? 58.670 91.247  113.576 1.00 42.63  ? 307  PHE A CD1 1 
ATOM   2343  C  CD2 . PHE A  1  307 ? 56.383 91.908  113.357 1.00 44.50  ? 307  PHE A CD2 1 
ATOM   2344  C  CE1 . PHE A  1  307 ? 59.007 92.555  113.868 1.00 43.97  ? 307  PHE A CE1 1 
ATOM   2345  C  CE2 . PHE A  1  307 ? 56.722 93.229  113.636 1.00 41.96  ? 307  PHE A CE2 1 
ATOM   2346  C  CZ  . PHE A  1  307 ? 58.023 93.553  113.886 1.00 41.85  ? 307  PHE A CZ  1 
ATOM   2347  N  N   . GLN A  1  308 ? 54.358 90.173  111.324 1.00 31.50  ? 308  GLN A N   1 
ATOM   2348  C  CA  . GLN A  1  308 ? 53.403 91.156  110.893 1.00 31.99  ? 308  GLN A CA  1 
ATOM   2349  C  C   . GLN A  1  308 ? 52.311 91.255  111.861 1.00 32.32  ? 308  GLN A C   1 
ATOM   2350  O  O   . GLN A  1  308 ? 51.851 90.232  112.364 1.00 33.13  ? 308  GLN A O   1 
ATOM   2351  C  CB  . GLN A  1  308 ? 52.826 90.830  109.513 1.00 31.63  ? 308  GLN A CB  1 
ATOM   2352  C  CG  . GLN A  1  308 ? 52.723 89.402  109.212 1.00 50.66  ? 308  GLN A CG  1 
ATOM   2353  C  CD  . GLN A  1  308 ? 51.433 89.070  108.499 1.00 60.39  ? 308  GLN A CD  1 
ATOM   2354  O  OE1 . GLN A  1  308 ? 50.545 89.887  108.428 1.00 67.94  ? 308  GLN A OE1 1 
ATOM   2355  N  NE2 . GLN A  1  308 ? 51.318 87.866  108.029 1.00 49.33  ? 308  GLN A NE2 1 
ATOM   2356  N  N   . THR A  1  309 ? 51.912 92.484  112.190 1.00 32.06  ? 309  THR A N   1 
ATOM   2357  C  CA  . THR A  1  309 ? 50.747 92.665  113.047 1.00 32.76  ? 309  THR A CA  1 
ATOM   2358  C  C   . THR A  1  309 ? 49.527 92.634  112.139 1.00 32.83  ? 309  THR A C   1 
ATOM   2359  O  O   . THR A  1  309 ? 49.639 92.882  110.962 1.00 33.63  ? 309  THR A O   1 
ATOM   2360  C  CB  . THR A  1  309 ? 50.776 93.997  113.720 1.00 33.02  ? 309  THR A CB  1 
ATOM   2361  O  OG1 . THR A  1  309 ? 50.851 95.010  112.724 1.00 32.27  ? 309  THR A OG1 1 
ATOM   2362  C  CG2 . THR A  1  309 ? 52.009 94.165  114.508 1.00 25.47  ? 309  THR A CG2 1 
ATOM   2363  N  N   . PHE A  1  310 ? 48.363 92.353  112.691 1.00 32.13  ? 310  PHE A N   1 
ATOM   2364  C  CA  . PHE A  1  310 ? 47.137 92.350  111.894 1.00 31.17  ? 310  PHE A CA  1 
ATOM   2365  C  C   . PHE A  1  310 ? 45.953 92.707  112.744 1.00 31.26  ? 310  PHE A C   1 
ATOM   2366  O  O   . PHE A  1  310 ? 46.017 92.642  113.986 1.00 30.88  ? 310  PHE A O   1 
ATOM   2367  C  CB  . PHE A  1  310 ? 46.897 91.004  111.209 1.00 29.95  ? 310  PHE A CB  1 
ATOM   2368  C  CG  . PHE A  1  310 ? 46.855 89.843  112.150 1.00 34.78  ? 310  PHE A CG  1 
ATOM   2369  C  CD1 . PHE A  1  310 ? 45.721 89.579  112.916 1.00 34.66  ? 310  PHE A CD1 1 
ATOM   2370  C  CD2 . PHE A  1  310 ? 47.921 88.980  112.244 1.00 39.07  ? 310  PHE A CD2 1 
ATOM   2371  C  CE1 . PHE A  1  310 ? 45.684 88.546  113.744 1.00 30.67  ? 310  PHE A CE1 1 
ATOM   2372  C  CE2 . PHE A  1  310 ? 47.871 87.910  113.092 1.00 37.37  ? 310  PHE A CE2 1 
ATOM   2373  C  CZ  . PHE A  1  310 ? 46.777 87.699  113.847 1.00 33.52  ? 310  PHE A CZ  1 
ATOM   2374  N  N   . ASN A  1  311 ? 44.883 93.106  112.065 1.00 31.75  ? 311  ASN A N   1 
ATOM   2375  C  CA  . ASN A  1  311 ? 43.622 93.428  112.668 1.00 32.78  ? 311  ASN A CA  1 
ATOM   2376  C  C   . ASN A  1  311 ? 42.552 92.960  111.697 1.00 34.21  ? 311  ASN A C   1 
ATOM   2377  O  O   . ASN A  1  311 ? 42.144 93.703  110.805 1.00 34.84  ? 311  ASN A O   1 
ATOM   2378  C  CB  . ASN A  1  311 ? 43.493 94.919  112.888 1.00 32.73  ? 311  ASN A CB  1 
ATOM   2379  C  CG  . ASN A  1  311 ? 42.138 95.306  113.523 1.00 41.18  ? 311  ASN A CG  1 
ATOM   2380  O  OD1 . ASN A  1  311 ? 41.675 94.664  114.470 1.00 41.08  ? 311  ASN A OD1 1 
ATOM   2381  N  ND2 . ASN A  1  311 ? 41.512 96.355  112.995 1.00 37.20  ? 311  ASN A ND2 1 
ATOM   2382  N  N   . ILE A  1  312 ? 42.168 91.703  111.808 1.00 34.45  ? 312  ILE A N   1 
ATOM   2383  C  CA  . ILE A  1  312 ? 41.188 91.139  110.924 1.00 35.43  ? 312  ILE A CA  1 
ATOM   2384  C  C   . ILE A  1  312 ? 39.797 91.462  111.443 1.00 36.51  ? 312  ILE A C   1 
ATOM   2385  O  O   . ILE A  1  312 ? 39.559 91.381  112.636 1.00 37.16  ? 312  ILE A O   1 
ATOM   2386  C  CB  . ILE A  1  312 ? 41.421 89.617  110.819 1.00 35.88  ? 312  ILE A CB  1 
ATOM   2387  C  CG1 . ILE A  1  312 ? 42.831 89.352  110.247 1.00 35.20  ? 312  ILE A CG1 1 
ATOM   2388  C  CG2 . ILE A  1  312 ? 40.359 88.941  109.956 1.00 30.99  ? 312  ILE A CG2 1 
ATOM   2389  C  CD1 . ILE A  1  312 ? 43.152 87.904  110.108 1.00 32.97  ? 312  ILE A CD1 1 
ATOM   2390  N  N   . CYS A  1  313 ? 38.898 91.882  110.538 1.00 36.71  ? 313  CYS A N   1 
ATOM   2391  C  CA  . CYS A  1  313 ? 37.512 92.264  110.890 1.00 36.17  ? 313  CYS A CA  1 
ATOM   2392  C  C   . CYS A  1  313 ? 36.446 91.373  110.325 1.00 35.07  ? 313  CYS A C   1 
ATOM   2393  O  O   . CYS A  1  313 ? 36.474 91.038  109.145 1.00 34.87  ? 313  CYS A O   1 
ATOM   2394  C  CB  . CYS A  1  313 ? 37.206 93.645  110.357 1.00 36.27  ? 313  CYS A CB  1 
ATOM   2395  S  SG  . CYS A  1  313 ? 38.095 94.922  111.141 1.00 48.97  ? 313  CYS A SG  1 
ATOM   2396  N  N   . TYR A  1  314 ? 35.464 91.052  111.163 1.00 34.32  ? 314  TYR A N   1 
ATOM   2397  C  CA  . TYR A  1  314 ? 34.272 90.291  110.749 1.00 33.55  ? 314  TYR A CA  1 
ATOM   2398  C  C   . TYR A  1  314 ? 33.075 91.030  111.347 1.00 33.89  ? 314  TYR A C   1 
ATOM   2399  O  O   . TYR A  1  314 ? 33.263 92.031  111.993 1.00 33.11  ? 314  TYR A O   1 
ATOM   2400  C  CB  . TYR A  1  314 ? 34.335 88.872  111.246 1.00 32.52  ? 314  TYR A CB  1 
ATOM   2401  C  CG  . TYR A  1  314 ? 35.439 88.081  110.625 1.00 25.61  ? 314  TYR A CG  1 
ATOM   2402  C  CD1 . TYR A  1  314 ? 36.449 87.528  111.406 1.00 27.23  ? 314  TYR A CD1 1 
ATOM   2403  C  CD2 . TYR A  1  314 ? 35.483 87.878  109.254 1.00 25.98  ? 314  TYR A CD2 1 
ATOM   2404  C  CE1 . TYR A  1  314 ? 37.473 86.795  110.843 1.00 30.98  ? 314  TYR A CE1 1 
ATOM   2405  C  CE2 . TYR A  1  314 ? 36.514 87.135  108.661 1.00 19.69  ? 314  TYR A CE2 1 
ATOM   2406  C  CZ  . TYR A  1  314 ? 37.501 86.589  109.461 1.00 31.89  ? 314  TYR A CZ  1 
ATOM   2407  O  OH  . TYR A  1  314 ? 38.522 85.839  108.893 1.00 24.24  ? 314  TYR A OH  1 
ATOM   2408  N  N   . ALA A  1  315 ? 31.858 90.545  111.104 1.00 35.14  ? 315  ALA A N   1 
ATOM   2409  C  CA  . ALA A  1  315 ? 30.626 91.187  111.622 1.00 36.23  ? 315  ALA A CA  1 
ATOM   2410  C  C   . ALA A  1  315 ? 30.752 91.865  112.983 1.00 37.50  ? 315  ALA A C   1 
ATOM   2411  O  O   . ALA A  1  315 ? 30.873 93.100  113.064 1.00 38.93  ? 315  ALA A O   1 
ATOM   2412  C  CB  . ALA A  1  315 ? 29.500 90.241  111.633 1.00 36.41  ? 315  ALA A CB  1 
ATOM   2413  N  N   . ASP A  1  316 ? 30.731 91.106  114.060 1.00 36.72  ? 316  ASP A N   1 
ATOM   2414  C  CA  . ASP A  1  316 ? 30.846 91.778  115.359 1.00 36.15  ? 316  ASP A CA  1 
ATOM   2415  C  C   . ASP A  1  316 ? 32.014 91.323  116.153 1.00 35.08  ? 316  ASP A C   1 
ATOM   2416  O  O   . ASP A  1  316 ? 32.061 91.469  117.372 1.00 35.19  ? 316  ASP A O   1 
ATOM   2417  C  CB  . ASP A  1  316 ? 29.548 91.683  116.158 1.00 36.45  ? 316  ASP A CB  1 
ATOM   2418  C  CG  . ASP A  1  316 ? 28.470 92.553  115.590 1.00 46.48  ? 316  ASP A CG  1 
ATOM   2419  O  OD1 . ASP A  1  316 ? 27.673 92.039  114.752 1.00 47.99  ? 316  ASP A OD1 1 
ATOM   2420  O  OD2 . ASP A  1  316 ? 28.352 93.777  115.896 1.00 43.20  ? 316  ASP A OD2 1 
ATOM   2421  N  N   . THR A  1  317 ? 32.980 90.784  115.464 1.00 34.05  ? 317  THR A N   1 
ATOM   2422  C  CA  . THR A  1  317 ? 34.135 90.303  116.116 1.00 33.33  ? 317  THR A CA  1 
ATOM   2423  C  C   . THR A  1  317 ? 35.370 90.435  115.174 1.00 33.15  ? 317  THR A C   1 
ATOM   2424  O  O   . THR A  1  317 ? 35.283 91.031  114.086 1.00 32.28  ? 317  THR A O   1 
ATOM   2425  C  CB  . THR A  1  317 ? 33.877 88.857  116.596 1.00 32.80  ? 317  THR A CB  1 
ATOM   2426  O  OG1 . THR A  1  317 ? 34.908 88.439  117.478 1.00 38.27  ? 317  THR A OG1 1 
ATOM   2427  C  CG2 . THR A  1  317 ? 33.931 87.882  115.468 1.00 28.91  ? 317  THR A CG2 1 
ATOM   2428  N  N   . GLY A  1  318 ? 36.512 89.946  115.632 1.00 33.59  ? 318  GLY A N   1 
ATOM   2429  C  CA  . GLY A  1  318 ? 37.709 89.980  114.837 1.00 34.23  ? 318  GLY A CA  1 
ATOM   2430  C  C   . GLY A  1  318 ? 38.902 89.401  115.568 1.00 34.75  ? 318  GLY A C   1 
ATOM   2431  O  O   . GLY A  1  318 ? 38.810 89.053  116.747 1.00 35.02  ? 318  GLY A O   1 
ATOM   2432  N  N   . LEU A  1  319 ? 40.014 89.268  114.851 1.00 34.49  ? 319  LEU A N   1 
ATOM   2433  C  CA  . LEU A  1  319 ? 41.262 88.785  115.428 1.00 34.00  ? 319  LEU A CA  1 
ATOM   2434  C  C   . LEU A  1  319 ? 42.286 89.923  115.394 1.00 34.30  ? 319  LEU A C   1 
ATOM   2435  O  O   . LEU A  1  319 ? 42.555 90.531  114.331 1.00 34.93  ? 319  LEU A O   1 
ATOM   2436  C  CB  . LEU A  1  319 ? 41.788 87.565  114.662 1.00 33.59  ? 319  LEU A CB  1 
ATOM   2437  C  CG  . LEU A  1  319 ? 40.909 86.309  114.699 1.00 33.65  ? 319  LEU A CG  1 
ATOM   2438  C  CD1 . LEU A  1  319 ? 41.354 85.272  113.656 1.00 32.58  ? 319  LEU A CD1 1 
ATOM   2439  C  CD2 . LEU A  1  319 ? 40.902 85.720  116.061 1.00 32.54  ? 319  LEU A CD2 1 
ATOM   2440  N  N   . LEU A  1  320 ? 42.848 90.234  116.542 1.00 33.55  ? 320  LEU A N   1 
ATOM   2441  C  CA  . LEU A  1  320 ? 43.800 91.298  116.603 1.00 32.78  ? 320  LEU A CA  1 
ATOM   2442  C  C   . LEU A  1  320 ? 45.055 90.770  117.170 1.00 32.26  ? 320  LEU A C   1 
ATOM   2443  O  O   . LEU A  1  320 ? 45.073 90.322  118.275 1.00 32.20  ? 320  LEU A O   1 
ATOM   2444  C  CB  . LEU A  1  320 ? 43.269 92.428  117.485 1.00 32.70  ? 320  LEU A CB  1 
ATOM   2445  C  CG  . LEU A  1  320 ? 44.233 93.580  117.842 1.00 30.48  ? 320  LEU A CG  1 
ATOM   2446  C  CD1 . LEU A  1  320 ? 44.550 94.447  116.645 1.00 32.32  ? 320  LEU A CD1 1 
ATOM   2447  C  CD2 . LEU A  1  320 ? 43.617 94.415  118.905 1.00 32.89  ? 320  LEU A CD2 1 
ATOM   2448  N  N   . GLY A  1  321 ? 46.123 90.824  116.410 1.00 32.18  ? 321  GLY A N   1 
ATOM   2449  C  CA  . GLY A  1  321 ? 47.376 90.341  116.912 1.00 32.29  ? 321  GLY A CA  1 
ATOM   2450  C  C   . GLY A  1  321 ? 48.501 90.331  115.921 1.00 32.16  ? 321  GLY A C   1 
ATOM   2451  O  O   . GLY A  1  321 ? 48.584 91.183  115.077 1.00 32.53  ? 321  GLY A O   1 
ATOM   2452  N  N   . ALA A  1  322 ? 49.371 89.347  116.037 1.00 31.77  ? 322  ALA A N   1 
ATOM   2453  C  CA  . ALA A  1  322 ? 50.514 89.280  115.184 1.00 31.83  ? 322  ALA A CA  1 
ATOM   2454  C  C   . ALA A  1  322 ? 50.841 87.854  114.762 1.00 31.88  ? 322  ALA A C   1 
ATOM   2455  O  O   . ALA A  1  322 ? 50.329 86.922  115.295 1.00 31.36  ? 322  ALA A O   1 
ATOM   2456  C  CB  . ALA A  1  322 ? 51.741 89.963  115.868 1.00 31.74  ? 322  ALA A CB  1 
ATOM   2457  N  N   . HIS A  1  323 ? 51.657 87.729  113.730 1.00 32.76  ? 323  HIS A N   1 
ATOM   2458  C  CA  . HIS A  1  323 ? 52.076 86.433  113.205 1.00 32.87  ? 323  HIS A CA  1 
ATOM   2459  C  C   . HIS A  1  323 ? 53.534 86.545  112.932 1.00 32.53  ? 323  HIS A C   1 
ATOM   2460  O  O   . HIS A  1  323 ? 54.011 87.619  112.575 1.00 32.68  ? 323  HIS A O   1 
ATOM   2461  C  CB  . HIS A  1  323 ? 51.301 86.125  111.914 1.00 33.21  ? 323  HIS A CB  1 
ATOM   2462  C  CG  . HIS A  1  323 ? 52.070 85.329  110.897 1.00 35.95  ? 323  HIS A CG  1 
ATOM   2463  N  ND1 . HIS A  1  323 ? 52.225 83.958  110.980 1.00 34.74  ? 323  HIS A ND1 1 
ATOM   2464  C  CD2 . HIS A  1  323 ? 52.635 85.697  109.719 1.00 24.47  ? 323  HIS A CD2 1 
ATOM   2465  C  CE1 . HIS A  1  323 ? 52.892 83.523  109.923 1.00 23.20  ? 323  HIS A CE1 1 
ATOM   2466  N  NE2 . HIS A  1  323 ? 53.176 84.560  109.154 1.00 32.83  ? 323  HIS A NE2 1 
ATOM   2467  N  N   . PHE A  1  324 ? 54.280 85.482  113.193 1.00 31.91  ? 324  PHE A N   1 
ATOM   2468  C  CA  . PHE A  1  324 ? 55.723 85.505  112.909 1.00 30.54  ? 324  PHE A CA  1 
ATOM   2469  C  C   . PHE A  1  324 ? 56.268 84.199  112.429 1.00 29.66  ? 324  PHE A C   1 
ATOM   2470  O  O   . PHE A  1  324 ? 55.599 83.150  112.544 1.00 29.78  ? 324  PHE A O   1 
ATOM   2471  C  CB  . PHE A  1  324 ? 56.526 86.077  114.043 1.00 30.07  ? 324  PHE A CB  1 
ATOM   2472  C  CG  . PHE A  1  324 ? 56.448 85.313  115.284 1.00 26.95  ? 324  PHE A CG  1 
ATOM   2473  C  CD1 . PHE A  1  324 ? 57.258 84.176  115.479 1.00 22.46  ? 324  PHE A CD1 1 
ATOM   2474  C  CD2 . PHE A  1  324 ? 55.653 85.762  116.326 1.00 20.88  ? 324  PHE A CD2 1 
ATOM   2475  C  CE1 . PHE A  1  324 ? 57.218 83.472  116.667 1.00 20.75  ? 324  PHE A CE1 1 
ATOM   2476  C  CE2 . PHE A  1  324 ? 55.608 85.064  117.509 1.00 27.10  ? 324  PHE A CE2 1 
ATOM   2477  C  CZ  . PHE A  1  324 ? 56.394 83.900  117.675 1.00 27.39  ? 324  PHE A CZ  1 
ATOM   2478  N  N   . VAL A  1  325 ? 57.469 84.249  111.866 1.00 29.02  ? 325  VAL A N   1 
ATOM   2479  C  CA  . VAL A  1  325 ? 58.132 83.072  111.285 1.00 29.05  ? 325  VAL A CA  1 
ATOM   2480  C  C   . VAL A  1  325 ? 59.550 83.056  111.776 1.00 29.61  ? 325  VAL A C   1 
ATOM   2481  O  O   . VAL A  1  325 ? 60.264 84.014  111.577 1.00 30.25  ? 325  VAL A O   1 
ATOM   2482  C  CB  . VAL A  1  325 ? 58.157 83.228  109.754 1.00 29.67  ? 325  VAL A CB  1 
ATOM   2483  C  CG1 . VAL A  1  325 ? 58.980 82.093  109.049 1.00 24.46  ? 325  VAL A CG1 1 
ATOM   2484  C  CG2 . VAL A  1  325 ? 56.723 83.355  109.201 1.00 26.61  ? 325  VAL A CG2 1 
ATOM   2485  N  N   . CYS A  1  326 ? 59.976 81.986  112.427 1.00 29.94  ? 326  CYS A N   1 
ATOM   2486  C  CA  . CYS A  1  326 ? 61.336 81.958  112.977 1.00 30.27  ? 326  CYS A CA  1 
ATOM   2487  C  C   . CYS A  1  326 ? 61.926 80.567  113.224 1.00 31.46  ? 326  CYS A C   1 
ATOM   2488  O  O   . CYS A  1  326 ? 61.243 79.571  113.190 1.00 31.90  ? 326  CYS A O   1 
ATOM   2489  C  CB  . CYS A  1  326 ? 61.365 82.721  114.295 1.00 30.14  ? 326  CYS A CB  1 
ATOM   2490  S  SG  . CYS A  1  326 ? 60.382 81.917  115.567 1.00 29.60  ? 326  CYS A SG  1 
ATOM   2491  N  N   . ASP A  1  327 ? 63.195 80.557  113.562 1.00 32.50  ? 327  ASP A N   1 
ATOM   2492  C  CA  . ASP A  1  327 ? 63.956 79.377  113.822 1.00 33.68  ? 327  ASP A CA  1 
ATOM   2493  C  C   . ASP A  1  327 ? 63.429 78.795  115.101 1.00 36.27  ? 327  ASP A C   1 
ATOM   2494  O  O   . ASP A  1  327 ? 62.973 79.546  115.983 1.00 38.47  ? 327  ASP A O   1 
ATOM   2495  C  CB  . ASP A  1  327 ? 65.420 79.810  114.027 1.00 33.48  ? 327  ASP A CB  1 
ATOM   2496  C  CG  . ASP A  1  327 ? 66.303 78.717  114.609 1.00 45.56  ? 327  ASP A CG  1 
ATOM   2497  O  OD1 . ASP A  1  327 ? 66.514 78.724  115.843 1.00 51.83  ? 327  ASP A OD1 1 
ATOM   2498  O  OD2 . ASP A  1  327 ? 66.864 77.833  113.916 1.00 40.29  ? 327  ASP A OD2 1 
ATOM   2499  N  N   . HIS A  1  328 ? 63.502 77.465  115.223 1.00 35.44  ? 328  HIS A N   1 
ATOM   2500  C  CA  . HIS A  1  328 ? 63.097 76.775  116.408 1.00 34.89  ? 328  HIS A CA  1 
ATOM   2501  C  C   . HIS A  1  328 ? 63.572 77.340  117.760 1.00 34.63  ? 328  HIS A C   1 
ATOM   2502  O  O   . HIS A  1  328 ? 62.820 77.330  118.707 1.00 35.65  ? 328  HIS A O   1 
ATOM   2503  C  CB  . HIS A  1  328 ? 63.368 75.248  116.296 1.00 34.98  ? 328  HIS A CB  1 
ATOM   2504  C  CG  . HIS A  1  328 ? 64.814 74.854  116.395 1.00 30.70  ? 328  HIS A CG  1 
ATOM   2505  N  ND1 . HIS A  1  328 ? 65.325 74.182  117.486 1.00 36.24  ? 328  HIS A ND1 1 
ATOM   2506  C  CD2 . HIS A  1  328 ? 65.833 74.962  115.516 1.00 38.04  ? 328  HIS A CD2 1 
ATOM   2507  C  CE1 . HIS A  1  328 ? 66.600 73.910  117.281 1.00 31.92  ? 328  HIS A CE1 1 
ATOM   2508  N  NE2 . HIS A  1  328 ? 66.938 74.385  116.100 1.00 25.61  ? 328  HIS A NE2 1 
ATOM   2509  N  N   . MET A  1  329 ? 64.795 77.854  117.846 1.00 33.12  ? 329  MET A N   1 
ATOM   2510  C  CA  . MET A  1  329 ? 65.262 78.421  119.120 1.00 31.12  ? 329  MET A CA  1 
ATOM   2511  C  C   . MET A  1  329 ? 64.941 79.850  119.323 1.00 31.47  ? 329  MET A C   1 
ATOM   2512  O  O   . MET A  1  329 ? 65.539 80.473  120.169 1.00 32.21  ? 329  MET A O   1 
ATOM   2513  C  CB  . MET A  1  329 ? 66.753 78.271  119.295 1.00 29.62  ? 329  MET A CB  1 
ATOM   2514  C  CG  . MET A  1  329 ? 67.228 76.866  119.221 1.00 41.18  ? 329  MET A CG  1 
ATOM   2515  S  SD  . MET A  1  329 ? 66.359 75.806  120.349 1.00 48.20  ? 329  MET A SD  1 
ATOM   2516  C  CE  . MET A  1  329 ? 66.859 76.583  121.939 1.00 35.38  ? 329  MET A CE  1 
ATOM   2517  N  N   . SER A  1  330 ? 63.999 80.411  118.584 1.00 31.07  ? 330  SER A N   1 
ATOM   2518  C  CA  . SER A  1  330 ? 63.730 81.824  118.771 1.00 30.34  ? 330  SER A CA  1 
ATOM   2519  C  C   . SER A  1  330 ? 62.308 82.165  119.055 1.00 30.31  ? 330  SER A C   1 
ATOM   2520  O  O   . SER A  1  330 ? 61.986 83.304  119.229 1.00 29.89  ? 330  SER A O   1 
ATOM   2521  C  CB  . SER A  1  330 ? 64.267 82.631  117.612 1.00 30.65  ? 330  SER A CB  1 
ATOM   2522  O  OG  . SER A  1  330 ? 65.696 82.560  117.571 1.00 42.13  ? 330  SER A OG  1 
ATOM   2523  N  N   . ILE A  1  331 ? 61.464 81.146  119.155 1.00 31.23  ? 331  ILE A N   1 
ATOM   2524  C  CA  . ILE A  1  331 ? 60.051 81.329  119.402 1.00 31.92  ? 331  ILE A CA  1 
ATOM   2525  C  C   . ILE A  1  331 ? 59.805 81.984  120.719 1.00 33.23  ? 331  ILE A C   1 
ATOM   2526  O  O   . ILE A  1  331 ? 58.981 82.900  120.813 1.00 34.05  ? 331  ILE A O   1 
ATOM   2527  C  CB  . ILE A  1  331 ? 59.336 79.977  119.376 1.00 31.96  ? 331  ILE A CB  1 
ATOM   2528  C  CG1 . ILE A  1  331 ? 59.661 79.221  118.108 1.00 27.31  ? 331  ILE A CG1 1 
ATOM   2529  C  CG2 . ILE A  1  331 ? 57.835 80.157  119.470 1.00 19.89  ? 331  ILE A CG2 1 
ATOM   2530  C  CD1 . ILE A  1  331 ? 58.910 77.931  118.029 1.00 34.10  ? 331  ILE A CD1 1 
ATOM   2531  N  N   . ASP A  1  332 ? 60.471 81.492  121.767 1.00 33.69  ? 332  ASP A N   1 
ATOM   2532  C  CA  . ASP A  1  332 ? 60.321 82.099  123.096 1.00 34.12  ? 332  ASP A CA  1 
ATOM   2533  C  C   . ASP A  1  332 ? 60.712 83.604  123.103 1.00 34.13  ? 332  ASP A C   1 
ATOM   2534  O  O   . ASP A  1  332 ? 59.880 84.450  123.428 1.00 33.88  ? 332  ASP A O   1 
ATOM   2535  C  CB  . ASP A  1  332 ? 61.097 81.312  124.186 1.00 34.34  ? 332  ASP A CB  1 
ATOM   2536  C  CG  . ASP A  1  332 ? 60.635 81.672  125.621 1.00 40.87  ? 332  ASP A CG  1 
ATOM   2537  O  OD1 . ASP A  1  332 ? 60.952 82.765  126.108 1.00 50.72  ? 332  ASP A OD1 1 
ATOM   2538  O  OD2 . ASP A  1  332 ? 59.923 80.927  126.315 1.00 51.80  ? 332  ASP A OD2 1 
ATOM   2539  N  N   . ASP A  1  333 ? 61.946 83.937  122.705 1.00 34.66  ? 333  ASP A N   1 
ATOM   2540  C  CA  . ASP A  1  333 ? 62.351 85.373  122.708 1.00 35.55  ? 333  ASP A CA  1 
ATOM   2541  C  C   . ASP A  1  333 ? 61.376 86.216  121.890 1.00 36.31  ? 333  ASP A C   1 
ATOM   2542  O  O   . ASP A  1  333 ? 60.979 87.295  122.319 1.00 36.96  ? 333  ASP A O   1 
ATOM   2543  C  CB  . ASP A  1  333 ? 63.799 85.597  122.206 1.00 35.40  ? 333  ASP A CB  1 
ATOM   2544  C  CG  . ASP A  1  333 ? 64.835 84.908  123.075 1.00 48.77  ? 333  ASP A CG  1 
ATOM   2545  O  OD1 . ASP A  1  333 ? 65.148 83.737  122.816 1.00 72.58  ? 333  ASP A OD1 1 
ATOM   2546  O  OD2 . ASP A  1  333 ? 65.361 85.432  124.053 1.00 61.70  ? 333  ASP A OD2 1 
ATOM   2547  N  N   . MET A  1  334 ? 60.955 85.693  120.739 1.00 35.93  ? 334  MET A N   1 
ATOM   2548  C  CA  . MET A  1  334 ? 60.056 86.405  119.865 1.00 36.03  ? 334  MET A CA  1 
ATOM   2549  C  C   . MET A  1  334 ? 58.725 86.754  120.563 1.00 37.16  ? 334  MET A C   1 
ATOM   2550  O  O   . MET A  1  334 ? 58.263 87.932  120.510 1.00 38.28  ? 334  MET A O   1 
ATOM   2551  C  CB  . MET A  1  334 ? 59.822 85.600  118.630 1.00 35.71  ? 334  MET A CB  1 
ATOM   2552  C  CG  . MET A  1  334 ? 59.309 86.367  117.490 1.00 47.75  ? 334  MET A CG  1 
ATOM   2553  S  SD  . MET A  1  334 ? 60.354 87.720  116.925 1.00 41.18  ? 334  MET A SD  1 
ATOM   2554  C  CE  . MET A  1  334 ? 59.131 88.667  116.184 1.00 43.38  ? 334  MET A CE  1 
ATOM   2555  N  N   . MET A  1  335 ? 58.141 85.766  121.265 1.00 36.25  ? 335  MET A N   1 
ATOM   2556  C  CA  . MET A  1  335 ? 56.889 85.966  122.003 1.00 34.81  ? 335  MET A CA  1 
ATOM   2557  C  C   . MET A  1  335 ? 57.061 87.012  123.108 1.00 34.36  ? 335  MET A C   1 
ATOM   2558  O  O   . MET A  1  335 ? 56.234 87.922  123.263 1.00 34.94  ? 335  MET A O   1 
ATOM   2559  C  CB  . MET A  1  335 ? 56.448 84.696  122.647 1.00 34.11  ? 335  MET A CB  1 
ATOM   2560  C  CG  . MET A  1  335 ? 55.030 84.783  123.103 1.00 38.74  ? 335  MET A CG  1 
ATOM   2561  S  SD  . MET A  1  335 ? 53.860 84.441  121.726 1.00 50.59  ? 335  MET A SD  1 
ATOM   2562  C  CE  . MET A  1  335 ? 52.972 85.721  121.830 1.00 42.08  ? 335  MET A CE  1 
ATOM   2563  N  N   . PHE A  1  336 ? 58.141 86.875  123.867 1.00 32.59  ? 336  PHE A N   1 
ATOM   2564  C  CA  . PHE A  1  336 ? 58.438 87.784  124.936 1.00 31.23  ? 336  PHE A CA  1 
ATOM   2565  C  C   . PHE A  1  336 ? 58.461 89.237  124.460 1.00 31.57  ? 336  PHE A C   1 
ATOM   2566  O  O   . PHE A  1  336 ? 57.893 90.122  125.102 1.00 32.09  ? 336  PHE A O   1 
ATOM   2567  C  CB  . PHE A  1  336 ? 59.787 87.449  125.557 1.00 30.38  ? 336  PHE A CB  1 
ATOM   2568  C  CG  . PHE A  1  336 ? 60.218 88.422  126.558 1.00 29.63  ? 336  PHE A CG  1 
ATOM   2569  C  CD1 . PHE A  1  336 ? 59.521 88.543  127.773 1.00 24.50  ? 336  PHE A CD1 1 
ATOM   2570  C  CD2 . PHE A  1  336 ? 61.259 89.316  126.284 1.00 31.86  ? 336  PHE A CD2 1 
ATOM   2571  C  CE1 . PHE A  1  336 ? 59.893 89.493  128.724 1.00 24.28  ? 336  PHE A CE1 1 
ATOM   2572  C  CE2 . PHE A  1  336 ? 61.627 90.259  127.226 1.00 35.74  ? 336  PHE A CE2 1 
ATOM   2573  C  CZ  . PHE A  1  336 ? 60.932 90.335  128.472 1.00 21.68  ? 336  PHE A CZ  1 
ATOM   2574  N  N   . VAL A  1  337 ? 59.148 89.480  123.360 1.00 31.16  ? 337  VAL A N   1 
ATOM   2575  C  CA  . VAL A  1  337 ? 59.229 90.782  122.830 1.00 31.21  ? 337  VAL A CA  1 
ATOM   2576  C  C   . VAL A  1  337 ? 57.893 91.256  122.236 1.00 31.16  ? 337  VAL A C   1 
ATOM   2577  O  O   . VAL A  1  337 ? 57.460 92.399  122.479 1.00 31.53  ? 337  VAL A O   1 
ATOM   2578  C  CB  . VAL A  1  337 ? 60.370 90.897  121.889 1.00 31.29  ? 337  VAL A CB  1 
ATOM   2579  C  CG1 . VAL A  1  337 ? 60.400 92.217  121.309 1.00 31.54  ? 337  VAL A CG1 1 
ATOM   2580  C  CG2 . VAL A  1  337 ? 61.660 90.638  122.654 1.00 30.16  ? 337  VAL A CG2 1 
ATOM   2581  N  N   . LEU A  1  338 ? 57.211 90.376  121.521 1.00 30.44  ? 338  LEU A N   1 
ATOM   2582  C  CA  . LEU A  1  338 ? 55.918 90.741  120.988 1.00 30.10  ? 338  LEU A CA  1 
ATOM   2583  C  C   . LEU A  1  338 ? 54.976 91.255  122.159 1.00 30.46  ? 338  LEU A C   1 
ATOM   2584  O  O   . LEU A  1  338 ? 54.508 92.422  122.162 1.00 29.38  ? 338  LEU A O   1 
ATOM   2585  C  CB  . LEU A  1  338 ? 55.292 89.540  120.316 1.00 29.52  ? 338  LEU A CB  1 
ATOM   2586  C  CG  . LEU A  1  338 ? 53.879 89.830  119.836 1.00 30.85  ? 338  LEU A CG  1 
ATOM   2587  C  CD1 . LEU A  1  338 ? 53.885 91.023  118.855 1.00 28.57  ? 338  LEU A CD1 1 
ATOM   2588  C  CD2 . LEU A  1  338 ? 53.219 88.613  119.221 1.00 20.74  ? 338  LEU A CD2 1 
ATOM   2589  N  N   . GLN A  1  339 ? 54.769 90.377  123.155 1.00 30.98  ? 339  GLN A N   1 
ATOM   2590  C  CA  . GLN A  1  339 ? 53.920 90.647  124.302 1.00 31.04  ? 339  GLN A CA  1 
ATOM   2591  C  C   . GLN A  1  339 ? 54.360 91.841  125.078 1.00 32.14  ? 339  GLN A C   1 
ATOM   2592  O  O   . GLN A  1  339 ? 53.539 92.602  125.598 1.00 32.09  ? 339  GLN A O   1 
ATOM   2593  C  CB  . GLN A  1  339 ? 53.905 89.442  125.193 1.00 30.82  ? 339  GLN A CB  1 
ATOM   2594  C  CG  . GLN A  1  339 ? 53.158 88.291  124.570 1.00 29.61  ? 339  GLN A CG  1 
ATOM   2595  C  CD  . GLN A  1  339 ? 52.976 87.168  125.501 1.00 33.29  ? 339  GLN A CD  1 
ATOM   2596  O  OE1 . GLN A  1  339 ? 53.958 86.606  125.999 1.00 34.63  ? 339  GLN A OE1 1 
ATOM   2597  N  NE2 . GLN A  1  339 ? 51.716 86.801  125.757 1.00 24.49  ? 339  GLN A NE2 1 
ATOM   2598  N  N   . GLY A  1  340 ? 55.668 92.039  125.128 1.00 33.06  ? 340  GLY A N   1 
ATOM   2599  C  CA  . GLY A  1  340 ? 56.240 93.161  125.823 1.00 33.44  ? 340  GLY A CA  1 
ATOM   2600  C  C   . GLY A  1  340 ? 55.821 94.436  125.182 1.00 34.23  ? 340  GLY A C   1 
ATOM   2601  O  O   . GLY A  1  340 ? 55.620 95.422  125.858 1.00 35.34  ? 340  GLY A O   1 
ATOM   2602  N  N   . GLN A  1  341 ? 55.677 94.422  123.866 1.00 34.09  ? 341  GLN A N   1 
ATOM   2603  C  CA  . GLN A  1  341 ? 55.253 95.611  123.148 1.00 33.54  ? 341  GLN A CA  1 
ATOM   2604  C  C   . GLN A  1  341 ? 53.766 95.940  123.346 1.00 33.59  ? 341  GLN A C   1 
ATOM   2605  O  O   . GLN A  1  341 ? 53.406 97.108  123.516 1.00 32.84  ? 341  GLN A O   1 
ATOM   2606  C  CB  . GLN A  1  341 ? 55.626 95.514  121.687 1.00 32.99  ? 341  GLN A CB  1 
ATOM   2607  C  CG  . GLN A  1  341 ? 57.071 95.673  121.483 1.00 27.77  ? 341  GLN A CG  1 
ATOM   2608  C  CD  . GLN A  1  341 ? 57.576 96.980  122.048 1.00 32.69  ? 341  GLN A CD  1 
ATOM   2609  O  OE1 . GLN A  1  341 ? 58.385 96.989  122.963 1.00 35.58  ? 341  GLN A OE1 1 
ATOM   2610  N  NE2 . GLN A  1  341 ? 57.078 98.090  121.518 1.00 34.00  ? 341  GLN A NE2 1 
ATOM   2611  N  N   . TRP A  1  342 ? 52.913 94.912  123.335 1.00 34.36  ? 342  TRP A N   1 
ATOM   2612  C  CA  . TRP A  1  342 ? 51.488 95.118  123.582 1.00 35.24  ? 342  TRP A CA  1 
ATOM   2613  C  C   . TRP A  1  342 ? 51.259 95.764  124.966 1.00 35.50  ? 342  TRP A C   1 
ATOM   2614  O  O   . TRP A  1  342 ? 50.480 96.728  125.092 1.00 36.65  ? 342  TRP A O   1 
ATOM   2615  C  CB  . TRP A  1  342 ? 50.710 93.802  123.540 1.00 35.79  ? 342  TRP A CB  1 
ATOM   2616  C  CG  . TRP A  1  342 ? 50.473 93.245  122.197 1.00 37.25  ? 342  TRP A CG  1 
ATOM   2617  C  CD1 . TRP A  1  342 ? 50.417 93.923  121.025 1.00 39.24  ? 342  TRP A CD1 1 
ATOM   2618  C  CD2 . TRP A  1  342 ? 50.236 91.882  121.884 1.00 42.13  ? 342  TRP A CD2 1 
ATOM   2619  N  NE1 . TRP A  1  342 ? 50.187 93.057  119.983 1.00 34.44  ? 342  TRP A NE1 1 
ATOM   2620  C  CE2 . TRP A  1  342 ? 50.087 91.791  120.482 1.00 34.60  ? 342  TRP A CE2 1 
ATOM   2621  C  CE3 . TRP A  1  342 ? 50.155 90.694  122.653 1.00 40.11  ? 342  TRP A CE3 1 
ATOM   2622  C  CZ2 . TRP A  1  342 ? 49.838 90.592  119.836 1.00 35.67  ? 342  TRP A CZ2 1 
ATOM   2623  C  CZ3 . TRP A  1  342 ? 49.906 89.495  122.004 1.00 30.98  ? 342  TRP A CZ3 1 
ATOM   2624  C  CH2 . TRP A  1  342 ? 49.745 89.449  120.616 1.00 41.69  ? 342  TRP A CH2 1 
ATOM   2625  N  N   . MET A  1  343 ? 51.942 95.264  125.995 1.00 34.04  ? 343  MET A N   1 
ATOM   2626  C  CA  . MET A  1  343 ? 51.730 95.810  127.328 1.00 32.93  ? 343  MET A CA  1 
ATOM   2627  C  C   . MET A  1  343 ? 52.253 97.204  127.451 1.00 33.11  ? 343  MET A C   1 
ATOM   2628  O  O   . MET A  1  343 ? 51.622 98.057  128.085 1.00 33.36  ? 343  MET A O   1 
ATOM   2629  C  CB  . MET A  1  343 ? 52.341 94.941  128.389 1.00 32.15  ? 343  MET A CB  1 
ATOM   2630  C  CG  . MET A  1  343 ? 51.951 93.491  128.337 1.00 36.33  ? 343  MET A CG  1 
ATOM   2631  S  SD  . MET A  1  343 ? 50.340 93.086  128.911 1.00 29.69  ? 343  MET A SD  1 
ATOM   2632  C  CE  . MET A  1  343 ? 49.220 93.515  127.535 1.00 20.93  ? 343  MET A CE  1 
ATOM   2633  N  N   . ARG A  1  344 ? 53.419 97.445  126.857 1.00 32.75  ? 344  ARG A N   1 
ATOM   2634  C  CA  . ARG A  1  344 ? 54.011 98.750  126.885 1.00 32.41  ? 344  ARG A CA  1 
ATOM   2635  C  C   . ARG A  1  344 ? 53.023 99.740  126.341 1.00 31.86  ? 344  ARG A C   1 
ATOM   2636  O  O   . ARG A  1  344 ? 52.772 100.767 126.940 1.00 31.73  ? 344  ARG A O   1 
ATOM   2637  C  CB  . ARG A  1  344 ? 55.271 98.786  126.034 1.00 32.75  ? 344  ARG A CB  1 
ATOM   2638  C  CG  . ARG A  1  344 ? 56.091 100.023 126.269 1.00 24.42  ? 344  ARG A CG  1 
ATOM   2639  C  CD  . ARG A  1  344 ? 57.243 100.151 125.422 1.00 19.68  ? 344  ARG A CD  1 
ATOM   2640  N  NE  . ARG A  1  344 ? 56.905 100.160 124.000 1.00 37.97  ? 344  ARG A NE  1 
ATOM   2641  C  CZ  . ARG A  1  344 ? 56.370 101.192 123.340 1.00 35.46  ? 344  ARG A CZ  1 
ATOM   2642  N  NH1 . ARG A  1  344 ? 56.051 102.309 123.975 1.00 30.69  ? 344  ARG A NH1 1 
ATOM   2643  N  NH2 . ARG A  1  344 ? 56.137 101.089 122.028 1.00 28.24  ? 344  ARG A NH2 1 
ATOM   2644  N  N   . LEU A  1  345 ? 52.419 99.391  125.225 1.00 31.94  ? 345  LEU A N   1 
ATOM   2645  C  CA  . LEU A  1  345 ? 51.454 100.249 124.615 1.00 32.47  ? 345  LEU A CA  1 
ATOM   2646  C  C   . LEU A  1  345 ? 50.198 100.356 125.458 1.00 33.29  ? 345  LEU A C   1 
ATOM   2647  O  O   . LEU A  1  345 ? 49.592 101.427 125.518 1.00 33.57  ? 345  LEU A O   1 
ATOM   2648  C  CB  . LEU A  1  345 ? 51.117 99.801  123.188 1.00 32.23  ? 345  LEU A CB  1 
ATOM   2649  C  CG  . LEU A  1  345 ? 52.162 100.142 122.103 1.00 29.74  ? 345  LEU A CG  1 
ATOM   2650  C  CD1 . LEU A  1  345 ? 51.619 99.790  120.699 1.00 26.89  ? 345  LEU A CD1 1 
ATOM   2651  C  CD2 . LEU A  1  345 ? 52.590 101.626 122.161 1.00 19.09  ? 345  LEU A CD2 1 
ATOM   2652  N  N   . CYS A  1  346 ? 49.805 99.252  126.106 1.00 33.04  ? 346  CYS A N   1 
ATOM   2653  C  CA  . CYS A  1  346 ? 48.635 99.272  126.970 1.00 33.32  ? 346  CYS A CA  1 
ATOM   2654  C  C   . CYS A  1  346 ? 48.806 100.248 128.127 1.00 32.95  ? 346  CYS A C   1 
ATOM   2655  O  O   . CYS A  1  346 ? 47.867 100.923 128.516 1.00 32.17  ? 346  CYS A O   1 
ATOM   2656  C  CB  . CYS A  1  346 ? 48.356 97.885  127.557 1.00 33.90  ? 346  CYS A CB  1 
ATOM   2657  S  SG  . CYS A  1  346 ? 47.439 96.780  126.499 1.00 40.77  ? 346  CYS A SG  1 
ATOM   2658  N  N   . THR A  1  347 ? 50.012 100.321 128.670 1.00 33.44  ? 347  THR A N   1 
ATOM   2659  C  CA  . THR A  1  347 ? 50.238 101.154 129.817 1.00 34.11  ? 347  THR A CA  1 
ATOM   2660  C  C   . THR A  1  347 ? 51.002 102.391 129.554 1.00 34.92  ? 347  THR A C   1 
ATOM   2661  O  O   . THR A  1  347 ? 50.571 103.456 129.939 1.00 35.72  ? 347  THR A O   1 
ATOM   2662  C  CB  . THR A  1  347 ? 50.966 100.392 130.873 1.00 34.13  ? 347  THR A CB  1 
ATOM   2663  O  OG1 . THR A  1  347 ? 52.189 99.902  130.321 1.00 42.81  ? 347  THR A OG1 1 
ATOM   2664  C  CG2 . THR A  1  347 ? 50.209 99.139  131.251 1.00 34.27  ? 347  THR A CG2 1 
ATOM   2665  N  N   . SER A  1  348 ? 52.141 102.278 128.884 1.00 34.64  ? 348  SER A N   1 
ATOM   2666  C  CA  . SER A  1  348 ? 53.027 103.444 128.751 1.00 34.50  ? 348  SER A CA  1 
ATOM   2667  C  C   . SER A  1  348 ? 53.249 104.100 127.375 1.00 33.99  ? 348  SER A C   1 
ATOM   2668  O  O   . SER A  1  348 ? 54.278 104.782 127.164 1.00 34.45  ? 348  SER A O   1 
ATOM   2669  C  CB  . SER A  1  348 ? 54.366 103.123 129.409 1.00 34.75  ? 348  SER A CB  1 
ATOM   2670  O  OG  . SER A  1  348 ? 54.751 101.780 129.111 1.00 41.92  ? 348  SER A OG  1 
ATOM   2671  N  N   . ALA A  1  349 ? 52.301 103.930 126.468 1.00 33.43  ? 349  ALA A N   1 
ATOM   2672  C  CA  . ALA A  1  349 ? 52.401 104.504 125.118 1.00 33.33  ? 349  ALA A CA  1 
ATOM   2673  C  C   . ALA A  1  349 ? 52.730 105.993 125.169 1.00 33.58  ? 349  ALA A C   1 
ATOM   2674  O  O   . ALA A  1  349 ? 52.117 106.730 125.921 1.00 33.50  ? 349  ALA A O   1 
ATOM   2675  C  CB  . ALA A  1  349 ? 51.100 104.288 124.354 1.00 33.10  ? 349  ALA A CB  1 
ATOM   2676  N  N   . THR A  1  350 ? 53.731 106.421 124.396 1.00 34.13  ? 350  THR A N   1 
ATOM   2677  C  CA  . THR A  1  350 ? 54.110 107.839 124.361 1.00 34.78  ? 350  THR A CA  1 
ATOM   2678  C  C   . THR A  1  350 ? 53.642 108.521 123.109 1.00 35.31  ? 350  THR A C   1 
ATOM   2679  O  O   . THR A  1  350 ? 53.326 107.867 122.121 1.00 35.73  ? 350  THR A O   1 
ATOM   2680  C  CB  . THR A  1  350 ? 55.610 108.048 124.592 1.00 34.86  ? 350  THR A CB  1 
ATOM   2681  O  OG1 . THR A  1  350 ? 56.366 106.917 124.083 1.00 34.72  ? 350  THR A OG1 1 
ATOM   2682  C  CG2 . THR A  1  350 ? 55.894 108.042 126.062 1.00 26.92  ? 350  THR A CG2 1 
ATOM   2683  N  N   . GLU A  1  351 ? 53.630 109.845 123.147 1.00 35.35  ? 351  GLU A N   1 
ATOM   2684  C  CA  . GLU A  1  351 ? 53.108 110.679 122.048 1.00 35.48  ? 351  GLU A CA  1 
ATOM   2685  C  C   . GLU A  1  351 ? 53.800 110.646 120.683 1.00 35.49  ? 351  GLU A C   1 
ATOM   2686  O  O   . GLU A  1  351 ? 53.129 110.661 119.643 1.00 35.58  ? 351  GLU A O   1 
ATOM   2687  C  CB  . GLU A  1  351 ? 53.026 112.109 122.488 1.00 35.27  ? 351  GLU A CB  1 
ATOM   2688  C  CG  . GLU A  1  351 ? 51.740 112.732 122.116 1.00 43.54  ? 351  GLU A CG  1 
ATOM   2689  C  CD  . GLU A  1  351 ? 50.655 112.361 123.086 1.00 40.99  ? 351  GLU A CD  1 
ATOM   2690  O  OE1 . GLU A  1  351 ? 50.853 112.625 124.295 1.00 42.37  ? 351  GLU A OE1 1 
ATOM   2691  O  OE2 . GLU A  1  351 ? 49.612 111.803 122.646 1.00 35.14  ? 351  GLU A OE2 1 
ATOM   2692  N  N   . SER A  1  352 ? 55.125 110.710 120.683 1.00 35.32  ? 352  SER A N   1 
ATOM   2693  C  CA  . SER A  1  352 ? 55.866 110.707 119.439 1.00 35.60  ? 352  SER A CA  1 
ATOM   2694  C  C   . SER A  1  352 ? 55.539 109.458 118.585 1.00 35.69  ? 352  SER A C   1 
ATOM   2695  O  O   . SER A  1  352 ? 55.136 109.585 117.423 1.00 35.93  ? 352  SER A O   1 
ATOM   2696  C  CB  . SER A  1  352 ? 57.347 110.800 119.711 1.00 35.79  ? 352  SER A CB  1 
ATOM   2697  O  OG  . SER A  1  352 ? 58.029 111.278 118.581 1.00 47.21  ? 352  SER A OG  1 
ATOM   2698  N  N   . GLU A  1  353 ? 55.634 108.272 119.194 1.00 35.20  ? 353  GLU A N   1 
ATOM   2699  C  CA  . GLU A  1  353 ? 55.330 107.037 118.498 1.00 35.16  ? 353  GLU A CA  1 
ATOM   2700  C  C   . GLU A  1  353 ? 53.882 106.987 118.001 1.00 35.03  ? 353  GLU A C   1 
ATOM   2701  O  O   . GLU A  1  353 ? 53.604 106.390 116.975 1.00 35.11  ? 353  GLU A O   1 
ATOM   2702  C  CB  . GLU A  1  353 ? 55.696 105.781 119.353 1.00 35.72  ? 353  GLU A CB  1 
ATOM   2703  C  CG  . GLU A  1  353 ? 54.745 105.419 120.512 1.00 29.65  ? 353  GLU A CG  1 
ATOM   2704  C  CD  . GLU A  1  353 ? 55.422 104.527 121.542 1.00 36.93  ? 353  GLU A CD  1 
ATOM   2705  O  OE1 . GLU A  1  353 ? 54.880 104.375 122.659 1.00 37.67  ? 353  GLU A OE1 1 
ATOM   2706  O  OE2 . GLU A  1  353 ? 56.528 104.004 121.247 1.00 41.08  ? 353  GLU A OE2 1 
ATOM   2707  N  N   . VAL A  1  354 ? 52.973 107.658 118.692 1.00 34.96  ? 354  VAL A N   1 
ATOM   2708  C  CA  . VAL A  1  354 ? 51.593 107.656 118.248 1.00 35.06  ? 354  VAL A CA  1 
ATOM   2709  C  C   . VAL A  1  354 ? 51.442 108.490 116.961 1.00 35.05  ? 354  VAL A C   1 
ATOM   2710  O  O   . VAL A  1  354 ? 50.713 108.094 116.039 1.00 35.70  ? 354  VAL A O   1 
ATOM   2711  C  CB  . VAL A  1  354 ? 50.566 108.016 119.398 1.00 34.93  ? 354  VAL A CB  1 
ATOM   2712  C  CG1 . VAL A  1  354 ? 49.160 108.155 118.856 1.00 30.04  ? 354  VAL A CG1 1 
ATOM   2713  C  CG2 . VAL A  1  354 ? 50.570 106.907 120.464 1.00 36.02  ? 354  VAL A CG2 1 
ATOM   2714  N  N   . LEU A  1  355 ? 52.213 109.563 116.847 1.00 34.16  ? 355  LEU A N   1 
ATOM   2715  C  CA  . LEU A  1  355 ? 52.175 110.360 115.632 1.00 33.55  ? 355  LEU A CA  1 
ATOM   2716  C  C   . LEU A  1  355 ? 52.720 109.511 114.483 1.00 32.99  ? 355  LEU A C   1 
ATOM   2717  O  O   . LEU A  1  355 ? 52.123 109.484 113.405 1.00 33.54  ? 355  LEU A O   1 
ATOM   2718  C  CB  . LEU A  1  355 ? 52.949 111.667 115.786 1.00 33.91  ? 355  LEU A CB  1 
ATOM   2719  C  CG  . LEU A  1  355 ? 52.981 112.624 114.587 1.00 37.68  ? 355  LEU A CG  1 
ATOM   2720  C  CD1 . LEU A  1  355 ? 51.616 112.872 114.011 1.00 40.38  ? 355  LEU A CD1 1 
ATOM   2721  C  CD2 . LEU A  1  355 ? 53.598 113.886 114.961 1.00 26.47  ? 355  LEU A CD2 1 
ATOM   2722  N  N   . ARG A  1  356 ? 53.795 108.744 114.735 1.00 31.60  ? 356  ARG A N   1 
ATOM   2723  C  CA  . ARG A  1  356 ? 54.334 107.859 113.702 1.00 30.46  ? 356  ARG A CA  1 
ATOM   2724  C  C   . ARG A  1  356 ? 53.253 106.847 113.245 1.00 30.60  ? 356  ARG A C   1 
ATOM   2725  O  O   . ARG A  1  356 ? 53.015 106.648 112.038 1.00 29.68  ? 356  ARG A O   1 
ATOM   2726  C  CB  . ARG A  1  356 ? 55.545 107.110 114.203 1.00 29.76  ? 356  ARG A CB  1 
ATOM   2727  C  CG  . ARG A  1  356 ? 56.182 106.275 113.101 1.00 32.15  ? 356  ARG A CG  1 
ATOM   2728  C  CD  . ARG A  1  356 ? 57.437 105.569 113.474 1.00 36.70  ? 356  ARG A CD  1 
ATOM   2729  N  NE  . ARG A  1  356 ? 57.160 104.311 114.138 1.00 38.91  ? 356  ARG A NE  1 
ATOM   2730  C  CZ  . ARG A  1  356 ? 57.409 104.104 115.392 1.00 43.04  ? 356  ARG A CZ  1 
ATOM   2731  N  NH1 . ARG A  1  356 ? 57.958 105.079 116.114 1.00 45.02  ? 356  ARG A NH1 1 
ATOM   2732  N  NH2 . ARG A  1  356 ? 57.128 102.939 115.944 1.00 37.43  ? 356  ARG A NH2 1 
ATOM   2733  N  N   . GLY A  1  357 ? 52.622 106.206 114.220 1.00 31.58  ? 357  GLY A N   1 
ATOM   2734  C  CA  . GLY A  1  357 ? 51.529 105.284 113.949 1.00 32.77  ? 357  GLY A CA  1 
ATOM   2735  C  C   . GLY A  1  357 ? 50.483 105.967 113.063 1.00 33.77  ? 357  GLY A C   1 
ATOM   2736  O  O   . GLY A  1  357 ? 50.199 105.480 111.967 1.00 34.72  ? 357  GLY A O   1 
ATOM   2737  N  N   . LYS A  1  358 ? 49.988 107.146 113.486 1.00 33.34  ? 358  LYS A N   1 
ATOM   2738  C  CA  . LYS A  1  358 ? 48.990 107.878 112.692 1.00 32.92  ? 358  LYS A CA  1 
ATOM   2739  C  C   . LYS A  1  358 ? 49.507 108.156 111.282 1.00 32.25  ? 358  LYS A C   1 
ATOM   2740  O  O   . LYS A  1  358 ? 48.789 107.960 110.299 1.00 32.25  ? 358  LYS A O   1 
ATOM   2741  C  CB  . LYS A  1  358 ? 48.585 109.198 113.372 1.00 33.39  ? 358  LYS A CB  1 
ATOM   2742  C  CG  . LYS A  1  358 ? 47.967 109.036 114.761 1.00 38.52  ? 358  LYS A CG  1 
ATOM   2743  C  CD  . LYS A  1  358 ? 47.186 110.265 115.177 1.00 36.45  ? 358  LYS A CD  1 
ATOM   2744  C  CE  . LYS A  1  358 ? 48.021 111.354 115.703 1.00 39.98  ? 358  LYS A CE  1 
ATOM   2745  N  NZ  . LYS A  1  358 ? 47.136 112.356 116.386 1.00 32.73  ? 358  LYS A NZ  1 
ATOM   2746  N  N   . ASN A  1  359 ? 50.764 108.592 111.188 1.00 31.44  ? 359  ASN A N   1 
ATOM   2747  C  CA  . ASN A  1  359 ? 51.381 108.873 109.897 1.00 30.55  ? 359  ASN A CA  1 
ATOM   2748  C  C   . ASN A  1  359 ? 51.525 107.654 108.970 1.00 30.63  ? 359  ASN A C   1 
ATOM   2749  O  O   . ASN A  1  359 ? 51.245 107.748 107.746 1.00 29.73  ? 359  ASN A O   1 
ATOM   2750  C  CB  . ASN A  1  359 ? 52.684 109.574 110.083 1.00 29.80  ? 359  ASN A CB  1 
ATOM   2751  C  CG  . ASN A  1  359 ? 52.493 111.002 110.431 1.00 31.14  ? 359  ASN A CG  1 
ATOM   2752  O  OD1 . ASN A  1  359 ? 53.369 111.652 111.036 1.00 26.30  ? 359  ASN A OD1 1 
ATOM   2753  N  ND2 . ASN A  1  359 ? 51.320 111.517 110.099 1.00 28.10  ? 359  ASN A ND2 1 
ATOM   2754  N  N   . LEU A  1  360 ? 51.912 106.505 109.561 1.00 31.10  ? 360  LEU A N   1 
ATOM   2755  C  CA  . LEU A  1  360 ? 52.056 105.288 108.812 1.00 31.40  ? 360  LEU A CA  1 
ATOM   2756  C  C   . LEU A  1  360 ? 50.682 104.917 108.293 1.00 31.27  ? 360  LEU A C   1 
ATOM   2757  O  O   . LEU A  1  360 ? 50.535 104.516 107.141 1.00 32.13  ? 360  LEU A O   1 
ATOM   2758  C  CB  . LEU A  1  360 ? 52.613 104.167 109.681 1.00 31.82  ? 360  LEU A CB  1 
ATOM   2759  C  CG  . LEU A  1  360 ? 54.128 104.142 109.992 1.00 43.77  ? 360  LEU A CG  1 
ATOM   2760  C  CD1 . LEU A  1  360 ? 54.445 103.230 111.185 1.00 48.77  ? 360  LEU A CD1 1 
ATOM   2761  C  CD2 . LEU A  1  360 ? 54.905 103.709 108.814 1.00 42.13  ? 360  LEU A CD2 1 
ATOM   2762  N  N   . LEU A  1  361 ? 49.675 105.146 109.110 1.00 29.98  ? 361  LEU A N   1 
ATOM   2763  C  CA  . LEU A  1  361 ? 48.319 104.837 108.737 1.00 29.83  ? 361  LEU A CA  1 
ATOM   2764  C  C   . LEU A  1  361 ? 47.740 105.764 107.646 1.00 30.00  ? 361  LEU A C   1 
ATOM   2765  O  O   . LEU A  1  361 ? 47.030 105.310 106.772 1.00 29.94  ? 361  LEU A O   1 
ATOM   2766  C  CB  . LEU A  1  361 ? 47.445 104.807 109.970 1.00 29.87  ? 361  LEU A CB  1 
ATOM   2767  C  CG  . LEU A  1  361 ? 46.041 104.359 109.777 1.00 36.02  ? 361  LEU A CG  1 
ATOM   2768  C  CD1 . LEU A  1  361 ? 46.044 102.998 109.108 1.00 41.54  ? 361  LEU A CD1 1 
ATOM   2769  C  CD2 . LEU A  1  361 ? 45.335 104.314 111.133 1.00 42.97  ? 361  LEU A CD2 1 
ATOM   2770  N  N   . ARG A  1  362 ? 48.048 107.055 107.699 1.00 30.50  ? 362  ARG A N   1 
ATOM   2771  C  CA  . ARG A  1  362 ? 47.599 107.960 106.631 1.00 31.16  ? 362  ARG A CA  1 
ATOM   2772  C  C   . ARG A  1  362 ? 48.224 107.547 105.269 1.00 31.41  ? 362  ARG A C   1 
ATOM   2773  O  O   . ARG A  1  362 ? 47.552 107.578 104.248 1.00 31.69  ? 362  ARG A O   1 
ATOM   2774  C  CB  . ARG A  1  362 ? 47.954 109.411 106.929 1.00 31.06  ? 362  ARG A CB  1 
ATOM   2775  C  CG  . ARG A  1  362 ? 47.208 110.015 108.112 1.00 37.53  ? 362  ARG A CG  1 
ATOM   2776  C  CD  . ARG A  1  362 ? 47.941 111.231 108.709 1.00 43.41  ? 362  ARG A CD  1 
ATOM   2777  N  NE  . ARG A  1  362 ? 47.090 112.073 109.538 1.00 34.07  ? 362  ARG A NE  1 
ATOM   2778  C  CZ  . ARG A  1  362 ? 47.433 112.520 110.745 1.00 33.91  ? 362  ARG A CZ  1 
ATOM   2779  N  NH1 . ARG A  1  362 ? 48.625 112.200 111.282 1.00 15.66  ? 362  ARG A NH1 1 
ATOM   2780  N  NH2 . ARG A  1  362 ? 46.582 113.275 111.430 1.00 38.41  ? 362  ARG A NH2 1 
ATOM   2781  N  N   . ASN A  1  363 ? 49.499 107.134 105.287 1.00 31.25  ? 363  ASN A N   1 
ATOM   2782  C  CA  . ASN A  1  363 ? 50.195 106.702 104.063 1.00 30.70  ? 363  ASN A CA  1 
ATOM   2783  C  C   . ASN A  1  363 ? 49.669 105.417 103.513 1.00 30.96  ? 363  ASN A C   1 
ATOM   2784  O  O   . ASN A  1  363 ? 49.485 105.279 102.317 1.00 30.66  ? 363  ASN A O   1 
ATOM   2785  C  CB  . ASN A  1  363 ? 51.696 106.621 104.270 1.00 30.11  ? 363  ASN A CB  1 
ATOM   2786  C  CG  . ASN A  1  363 ? 52.394 107.962 104.024 1.00 37.52  ? 363  ASN A CG  1 
ATOM   2787  O  OD1 . ASN A  1  363 ? 52.783 108.286 102.880 1.00 38.72  ? 363  ASN A OD1 1 
ATOM   2788  N  ND2 . ASN A  1  363 ? 52.544 108.753 105.081 1.00 38.14  ? 363  ASN A ND2 1 
ATOM   2789  N  N   . ALA A  1  364 ? 49.382 104.478 104.406 1.00 31.52  ? 364  ALA A N   1 
ATOM   2790  C  CA  . ALA A  1  364 ? 48.837 103.174 104.024 1.00 30.84  ? 364  ALA A CA  1 
ATOM   2791  C  C   . ALA A  1  364 ? 47.489 103.347 103.349 1.00 31.50  ? 364  ALA A C   1 
ATOM   2792  O  O   . ALA A  1  364 ? 47.255 102.807 102.254 1.00 31.00  ? 364  ALA A O   1 
ATOM   2793  C  CB  . ALA A  1  364 ? 48.709 102.315 105.209 1.00 30.08  ? 364  ALA A CB  1 
ATOM   2794  N  N   . LEU A  1  365 ? 46.624 104.147 103.974 1.00 32.99  ? 365  LEU A N   1 
ATOM   2795  C  CA  . LEU A  1  365 ? 45.287 104.415 103.452 1.00 34.42  ? 365  LEU A CA  1 
ATOM   2796  C  C   . LEU A  1  365 ? 45.322 104.940 102.045 1.00 35.69  ? 365  LEU A C   1 
ATOM   2797  O  O   . LEU A  1  365 ? 44.693 104.371 101.149 1.00 37.12  ? 365  LEU A O   1 
ATOM   2798  C  CB  . LEU A  1  365 ? 44.568 105.435 104.315 1.00 34.80  ? 365  LEU A CB  1 
ATOM   2799  C  CG  . LEU A  1  365 ? 43.151 105.766 103.836 1.00 41.53  ? 365  LEU A CG  1 
ATOM   2800  C  CD1 . LEU A  1  365 ? 42.251 104.532 103.903 1.00 46.47  ? 365  LEU A CD1 1 
ATOM   2801  C  CD2 . LEU A  1  365 ? 42.573 106.869 104.641 1.00 44.17  ? 365  LEU A CD2 1 
ATOM   2802  N  N   . VAL A  1  366 ? 46.108 105.978 101.835 1.00 35.26  ? 366  VAL A N   1 
ATOM   2803  C  CA  . VAL A  1  366 ? 46.169 106.628 100.565 1.00 35.76  ? 366  VAL A CA  1 
ATOM   2804  C  C   . VAL A  1  366 ? 46.982 105.859 99.533  1.00 36.81  ? 366  VAL A C   1 
ATOM   2805  O  O   . VAL A  1  366 ? 46.648 105.857 98.334  1.00 37.34  ? 366  VAL A O   1 
ATOM   2806  C  CB  . VAL A  1  366 ? 46.699 108.093 100.733 1.00 35.98  ? 366  VAL A CB  1 
ATOM   2807  C  CG1 . VAL A  1  366 ? 47.147 108.694 99.403  1.00 42.78  ? 366  VAL A CG1 1 
ATOM   2808  C  CG2 . VAL A  1  366 ? 45.652 108.956 101.401 1.00 31.75  ? 366  VAL A CG2 1 
ATOM   2809  N  N   . SER A  1  367 ? 48.041 105.194 99.977  1.00 37.28  ? 367  SER A N   1 
ATOM   2810  C  CA  . SER A  1  367 ? 48.879 104.456 99.050  1.00 37.65  ? 367  SER A CA  1 
ATOM   2811  C  C   . SER A  1  367 ? 48.074 103.281 98.478  1.00 38.36  ? 367  SER A C   1 
ATOM   2812  O  O   . SER A  1  367 ? 48.203 102.927 97.295  1.00 38.43  ? 367  SER A O   1 
ATOM   2813  C  CB  . SER A  1  367 ? 50.154 103.972 99.746  1.00 37.58  ? 367  SER A CB  1 
ATOM   2814  O  OG  . SER A  1  367 ? 51.083 103.414 98.830  1.00 53.12  ? 367  SER A OG  1 
ATOM   2815  N  N   . HIS A  1  368 ? 47.179 102.742 99.308  1.00 38.84  ? 368  HIS A N   1 
ATOM   2816  C  CA  . HIS A  1  368 ? 46.363 101.615 98.917  1.00 38.50  ? 368  HIS A CA  1 
ATOM   2817  C  C   . HIS A  1  368 ? 45.295 102.010 97.970  1.00 37.76  ? 368  HIS A C   1 
ATOM   2818  O  O   . HIS A  1  368 ? 44.983 101.275 97.065  1.00 38.08  ? 368  HIS A O   1 
ATOM   2819  C  CB  . HIS A  1  368 ? 45.734 100.948 100.123 1.00 38.48  ? 368  HIS A CB  1 
ATOM   2820  C  CG  . HIS A  1  368 ? 44.936 99.747  99.780  1.00 36.85  ? 368  HIS A CG  1 
ATOM   2821  N  ND1 . HIS A  1  368 ? 43.561 99.749  99.767  1.00 41.38  ? 368  HIS A ND1 1 
ATOM   2822  C  CD2 . HIS A  1  368 ? 45.314 98.517  99.377  1.00 42.80  ? 368  HIS A CD2 1 
ATOM   2823  C  CE1 . HIS A  1  368 ? 43.123 98.561  99.403  1.00 38.83  ? 368  HIS A CE1 1 
ATOM   2824  N  NE2 . HIS A  1  368 ? 44.168 97.796  99.152  1.00 47.58  ? 368  HIS A NE2 1 
ATOM   2825  N  N   . LEU A  1  369 ? 44.725 103.186 98.157  1.00 36.71  ? 369  LEU A N   1 
ATOM   2826  C  CA  . LEU A  1  369 ? 43.662 103.616 97.256  1.00 35.89  ? 369  LEU A CA  1 
ATOM   2827  C  C   . LEU A  1  369 ? 44.198 104.251 95.996  1.00 35.17  ? 369  LEU A C   1 
ATOM   2828  O  O   . LEU A  1  369 ? 43.819 105.354 95.626  1.00 35.22  ? 369  LEU A O   1 
ATOM   2829  C  CB  . LEU A  1  369 ? 42.677 104.524 97.962  1.00 35.67  ? 369  LEU A CB  1 
ATOM   2830  C  CG  . LEU A  1  369 ? 41.853 103.819 99.021  1.00 30.43  ? 369  LEU A CG  1 
ATOM   2831  C  CD1 . LEU A  1  369 ? 40.997 104.760 99.694  1.00 22.86  ? 369  LEU A CD1 1 
ATOM   2832  C  CD2 . LEU A  1  369 ? 41.021 102.710 98.405  1.00 41.96  ? 369  LEU A CD2 1 
ATOM   2833  N  N   . ASP A  1  370 ? 45.043 103.518 95.312  1.00 34.81  ? 370  ASP A N   1 
ATOM   2834  C  CA  . ASP A  1  370 ? 45.672 103.998 94.131  1.00 35.24  ? 370  ASP A CA  1 
ATOM   2835  C  C   . ASP A  1  370 ? 45.432 103.040 92.955  1.00 34.56  ? 370  ASP A C   1 
ATOM   2836  O  O   . ASP A  1  370 ? 46.064 101.957 92.851  1.00 34.25  ? 370  ASP A O   1 
ATOM   2837  C  CB  . ASP A  1  370 ? 47.161 104.156 94.406  1.00 36.37  ? 370  ASP A CB  1 
ATOM   2838  C  CG  . ASP A  1  370 ? 47.893 104.801 93.266  1.00 53.45  ? 370  ASP A CG  1 
ATOM   2839  O  OD1 . ASP A  1  370 ? 49.125 104.529 93.137  1.00 64.86  ? 370  ASP A OD1 1 
ATOM   2840  O  OD2 . ASP A  1  370 ? 47.326 105.581 92.441  1.00 36.44  ? 370  ASP A OD2 1 
ATOM   2841  N  N   . GLY A  1  371 ? 44.537 103.443 92.061  1.00 33.82  ? 371  GLY A N   1 
ATOM   2842  C  CA  . GLY A  1  371 ? 44.182 102.612 90.932  1.00 33.16  ? 371  GLY A CA  1 
ATOM   2843  C  C   . GLY A  1  371 ? 42.720 102.273 90.996  1.00 32.81  ? 371  GLY A C   1 
ATOM   2844  O  O   . GLY A  1  371 ? 42.173 102.179 92.060  1.00 32.79  ? 371  GLY A O   1 
ATOM   2845  N  N   . THR A  1  372 ? 42.097 102.077 89.840  1.00 33.18  ? 372  THR A N   1 
ATOM   2846  C  CA  . THR A  1  372 ? 40.656 101.759 89.756  1.00 33.71  ? 372  THR A CA  1 
ATOM   2847  C  C   . THR A  1  372 ? 40.281 100.468 90.497  1.00 34.17  ? 372  THR A C   1 
ATOM   2848  O  O   . THR A  1  372 ? 39.208 100.350 91.036  1.00 34.59  ? 372  THR A O   1 
ATOM   2849  C  CB  . THR A  1  372 ? 40.229 101.611 88.298  1.00 33.53  ? 372  THR A CB  1 
ATOM   2850  O  OG1 . THR A  1  372 ? 41.052 100.612 87.670  1.00 38.22  ? 372  THR A OG1 1 
ATOM   2851  C  CG2 . THR A  1  372 ? 40.504 102.920 87.486  1.00 24.62  ? 372  THR A CG2 1 
ATOM   2852  N  N   . THR A  1  373 ? 41.173 99.512  90.496  1.00 34.19  ? 373  THR A N   1 
ATOM   2853  C  CA  . THR A  1  373 ? 40.904 98.258  91.127  1.00 34.09  ? 373  THR A CA  1 
ATOM   2854  C  C   . THR A  1  373 ? 40.753 98.280  92.657  1.00 34.49  ? 373  THR A C   1 
ATOM   2855  O  O   . THR A  1  373 ? 39.731 97.823  93.151  1.00 35.21  ? 373  THR A O   1 
ATOM   2856  C  CB  . THR A  1  373 ? 41.856 97.184  90.634  1.00 33.74  ? 373  THR A CB  1 
ATOM   2857  O  OG1 . THR A  1  373 ? 41.708 97.064  89.223  1.00 22.63  ? 373  THR A OG1 1 
ATOM   2858  C  CG2 . THR A  1  373 ? 41.450 95.811  91.175  1.00 27.42  ? 373  THR A CG2 1 
ATOM   2859  N  N   . PRO A  1  374 ? 41.744 98.785  93.422  1.00 33.86  ? 374  PRO A N   1 
ATOM   2860  C  CA  . PRO A  1  374 ? 41.582 98.845  94.874  1.00 33.59  ? 374  PRO A CA  1 
ATOM   2861  C  C   . PRO A  1  374 ? 40.435 99.751  95.298  1.00 34.49  ? 374  PRO A C   1 
ATOM   2862  O  O   . PRO A  1  374 ? 39.762 99.417  96.266  1.00 35.11  ? 374  PRO A O   1 
ATOM   2863  C  CB  . PRO A  1  374 ? 42.905 99.393  95.340  1.00 32.98  ? 374  PRO A CB  1 
ATOM   2864  C  CG  . PRO A  1  374 ? 43.823 99.057  94.270  1.00 20.41  ? 374  PRO A CG  1 
ATOM   2865  C  CD  . PRO A  1  374 ? 43.095 99.228  93.029  1.00 33.34  ? 374  PRO A CD  1 
ATOM   2866  N  N   . VAL A  1  375 ? 40.190 100.853 94.568  1.00 34.43  ? 375  VAL A N   1 
ATOM   2867  C  CA  . VAL A  1  375 ? 39.085 101.744 94.900  1.00 34.20  ? 375  VAL A CA  1 
ATOM   2868  C  C   . VAL A  1  375 ? 37.727 101.084 94.642  1.00 34.16  ? 375  VAL A C   1 
ATOM   2869  O  O   . VAL A  1  375 ? 36.843 101.183 95.459  1.00 34.26  ? 375  VAL A O   1 
ATOM   2870  C  CB  . VAL A  1  375 ? 39.183 103.123 94.170  1.00 34.32  ? 375  VAL A CB  1 
ATOM   2871  C  CG1 . VAL A  1  375 ? 37.935 103.956 94.412  1.00 30.85  ? 375  VAL A CG1 1 
ATOM   2872  C  CG2 . VAL A  1  375 ? 40.399 103.890 94.650  1.00 34.87  ? 375  VAL A CG2 1 
ATOM   2873  N  N   . CYS A  1  376 ? 37.591 100.369 93.527  1.00 34.15  ? 376  CYS A N   1 
ATOM   2874  C  CA  . CYS A  1  376 ? 36.332 99.692  93.212  1.00 34.71  ? 376  CYS A CA  1 
ATOM   2875  C  C   . CYS A  1  376 ? 36.032 98.691  94.298  1.00 35.51  ? 376  CYS A C   1 
ATOM   2876  O  O   . CYS A  1  376 ? 34.905 98.593  94.774  1.00 35.61  ? 376  CYS A O   1 
ATOM   2877  C  CB  . CYS A  1  376 ? 36.429 98.972  91.868  1.00 34.80  ? 376  CYS A CB  1 
ATOM   2878  S  SG  . CYS A  1  376 ? 34.917 98.131  91.302  1.00 34.03  ? 376  CYS A SG  1 
ATOM   2879  N  N   . GLU A  1  377 ? 37.072 98.003  94.738  1.00 36.04  ? 377  GLU A N   1 
ATOM   2880  C  CA  . GLU A  1  377 ? 36.951 97.010  95.764  1.00 36.77  ? 377  GLU A CA  1 
ATOM   2881  C  C   . GLU A  1  377 ? 36.555 97.636  97.041  1.00 37.55  ? 377  GLU A C   1 
ATOM   2882  O  O   . GLU A  1  377 ? 35.734 97.091  97.796  1.00 38.08  ? 377  GLU A O   1 
ATOM   2883  C  CB  . GLU A  1  377 ? 38.259 96.290  95.956  1.00 36.98  ? 377  GLU A CB  1 
ATOM   2884  C  CG  . GLU A  1  377 ? 38.166 95.198  96.978  1.00 47.64  ? 377  GLU A CG  1 
ATOM   2885  C  CD  . GLU A  1  377 ? 39.368 95.103  97.847  1.00 56.47  ? 377  GLU A CD  1 
ATOM   2886  O  OE1 . GLU A  1  377 ? 39.894 96.171  98.290  1.00 69.73  ? 377  GLU A OE1 1 
ATOM   2887  O  OE2 . GLU A  1  377 ? 39.789 93.960  98.098  1.00 55.56  ? 377  GLU A OE2 1 
ATOM   2888  N  N   . ASP A  1  378 ? 37.115 98.814  97.284  1.00 37.52  ? 378  ASP A N   1 
ATOM   2889  C  CA  . ASP A  1  378 ? 36.827 99.562  98.483  1.00 36.79  ? 378  ASP A CA  1 
ATOM   2890  C  C   . ASP A  1  378 ? 35.413 100.015 98.583  1.00 36.05  ? 378  ASP A C   1 
ATOM   2891  O  O   . ASP A  1  378 ? 34.859 100.036 99.660  1.00 36.30  ? 378  ASP A O   1 
ATOM   2892  C  CB  . ASP A  1  378 ? 37.711 100.744 98.587  1.00 36.91  ? 378  ASP A CB  1 
ATOM   2893  C  CG  . ASP A  1  378 ? 37.854 101.185 99.954  1.00 42.99  ? 378  ASP A CG  1 
ATOM   2894  O  OD1 . ASP A  1  378 ? 38.133 100.319 100.817 1.00 50.85  ? 378  ASP A OD1 1 
ATOM   2895  O  OD2 . ASP A  1  378 ? 37.660 102.354 100.300 1.00 36.30  ? 378  ASP A OD2 1 
ATOM   2896  N  N   . ILE A  1  379 ? 34.835 100.398 97.449  1.00 35.07  ? 379  ILE A N   1 
ATOM   2897  C  CA  . ILE A  1  379 ? 33.464 100.849 97.391  1.00 34.15  ? 379  ILE A CA  1 
ATOM   2898  C  C   . ILE A  1  379 ? 32.534 99.673  97.696  1.00 33.74  ? 379  ILE A C   1 
ATOM   2899  O  O   . ILE A  1  379 ? 31.680 99.753  98.577  1.00 33.56  ? 379  ILE A O   1 
ATOM   2900  C  CB  . ILE A  1  379 ? 33.177 101.397 95.995  1.00 34.13  ? 379  ILE A CB  1 
ATOM   2901  C  CG1 . ILE A  1  379 ? 33.995 102.659 95.741  1.00 28.99  ? 379  ILE A CG1 1 
ATOM   2902  C  CG2 . ILE A  1  379 ? 31.693 101.683 95.815  1.00 34.51  ? 379  ILE A CG2 1 
ATOM   2903  C  CD1 . ILE A  1  379 ? 34.023 103.076 94.302  1.00 19.07  ? 379  ILE A CD1 1 
ATOM   2904  N  N   . GLY A  1  380 ? 32.750 98.564  96.994  1.00 33.47  ? 380  GLY A N   1 
ATOM   2905  C  CA  . GLY A  1  380 ? 31.943 97.372  97.167  1.00 32.74  ? 380  GLY A CA  1 
ATOM   2906  C  C   . GLY A  1  380 ? 31.967 96.845  98.581  1.00 32.52  ? 380  GLY A C   1 
ATOM   2907  O  O   . GLY A  1  380 ? 30.927 96.618  99.171  1.00 32.62  ? 380  GLY A O   1 
ATOM   2908  N  N   . ARG A  1  381 ? 33.158 96.694  99.140  1.00 32.55  ? 381  ARG A N   1 
ATOM   2909  C  CA  . ARG A  1  381 ? 33.286 96.166  100.473 1.00 32.96  ? 381  ARG A CA  1 
ATOM   2910  C  C   . ARG A  1  381 ? 32.669 97.104  101.504 1.00 32.35  ? 381  ARG A C   1 
ATOM   2911  O  O   . ARG A  1  381 ? 31.946 96.661  102.365 1.00 32.31  ? 381  ARG A O   1 
ATOM   2912  C  CB  . ARG A  1  381 ? 34.759 95.862  100.817 1.00 33.75  ? 381  ARG A CB  1 
ATOM   2913  C  CG  . ARG A  1  381 ? 34.992 94.508  101.573 1.00 48.40  ? 381  ARG A CG  1 
ATOM   2914  C  CD  . ARG A  1  381 ? 36.299 94.432  102.430 1.00 64.73  ? 381  ARG A CD  1 
ATOM   2915  N  NE  . ARG A  1  381 ? 37.515 94.952  101.758 1.00 80.91  ? 381  ARG A NE  1 
ATOM   2916  C  CZ  . ARG A  1  381 ? 38.131 96.117  102.084 1.00 87.28  ? 381  ARG A CZ  1 
ATOM   2917  N  NH1 . ARG A  1  381 ? 37.630 96.890  103.045 1.00 90.82  ? 381  ARG A NH1 1 
ATOM   2918  N  NH2 . ARG A  1  381 ? 39.232 96.513  101.435 1.00 86.38  ? 381  ARG A NH2 1 
ATOM   2919  N  N   . SER A  1  382 ? 32.917 98.401  101.364 1.00 32.27  ? 382  SER A N   1 
ATOM   2920  C  CA  . SER A  1  382 ? 32.413 99.400  102.320 1.00 32.56  ? 382  SER A CA  1 
ATOM   2921  C  C   . SER A  1  382 ? 30.934 99.350  102.455 1.00 32.75  ? 382  SER A C   1 
ATOM   2922  O  O   . SER A  1  382 ? 30.412 99.242  103.542 1.00 32.55  ? 382  SER A O   1 
ATOM   2923  C  CB  . SER A  1  382 ? 32.803 100.785 101.898 1.00 32.56  ? 382  SER A CB  1 
ATOM   2924  O  OG  . SER A  1  382 ? 34.163 100.841 101.632 1.00 36.78  ? 382  SER A OG  1 
ATOM   2925  N  N   . LEU A  1  383 ? 30.254 99.403  101.331 1.00 33.24  ? 383  LEU A N   1 
ATOM   2926  C  CA  . LEU A  1  383 ? 28.827 99.346  101.335 1.00 33.85  ? 383  LEU A CA  1 
ATOM   2927  C  C   . LEU A  1  383 ? 28.246 98.085  101.969 1.00 34.71  ? 383  LEU A C   1 
ATOM   2928  O  O   . LEU A  1  383 ? 27.140 98.112  102.537 1.00 35.02  ? 383  LEU A O   1 
ATOM   2929  C  CB  . LEU A  1  383 ? 28.278 99.554  99.953  1.00 33.60  ? 383  LEU A CB  1 
ATOM   2930  C  CG  . LEU A  1  383 ? 28.004 101.019 99.719  1.00 28.74  ? 383  LEU A CG  1 
ATOM   2931  C  CD1 . LEU A  1  383 ? 29.085 101.623 98.852  1.00 18.20  ? 383  LEU A CD1 1 
ATOM   2932  C  CD2 . LEU A  1  383 ? 26.680 101.135 99.068  1.00 25.97  ? 383  LEU A CD2 1 
ATOM   2933  N  N   . LEU A  1  384 ? 28.976 96.992  101.889 1.00 35.21  ? 384  LEU A N   1 
ATOM   2934  C  CA  . LEU A  1  384 ? 28.510 95.766  102.487 1.00 36.09  ? 384  LEU A CA  1 
ATOM   2935  C  C   . LEU A  1  384 ? 28.667 95.805  104.009 1.00 37.28  ? 384  LEU A C   1 
ATOM   2936  O  O   . LEU A  1  384 ? 27.785 95.337  104.743 1.00 37.65  ? 384  LEU A O   1 
ATOM   2937  C  CB  . LEU A  1  384 ? 29.238 94.557  101.890 1.00 35.85  ? 384  LEU A CB  1 
ATOM   2938  C  CG  . LEU A  1  384 ? 28.751 94.148  100.499 1.00 29.76  ? 384  LEU A CG  1 
ATOM   2939  C  CD1 . LEU A  1  384 ? 29.358 92.830  100.119 1.00 27.93  ? 384  LEU A CD1 1 
ATOM   2940  C  CD2 . LEU A  1  384 ? 27.203 94.060  100.460 1.00 26.51  ? 384  LEU A CD2 1 
ATOM   2941  N  N   . THR A  1  385 ? 29.751 96.432  104.470 1.00 37.81  ? 385  THR A N   1 
ATOM   2942  C  CA  . THR A  1  385 ? 30.060 96.523  105.885 1.00 38.66  ? 385  THR A CA  1 
ATOM   2943  C  C   . THR A  1  385 ? 29.678 97.850  106.574 1.00 39.99  ? 385  THR A C   1 
ATOM   2944  O  O   . THR A  1  385 ? 29.409 97.862  107.761 1.00 40.31  ? 385  THR A O   1 
ATOM   2945  C  CB  . THR A  1  385 ? 31.543 96.312  106.095 1.00 38.78  ? 385  THR A CB  1 
ATOM   2946  O  OG1 . THR A  1  385 ? 32.273 97.422  105.518 1.00 32.22  ? 385  THR A OG1 1 
ATOM   2947  C  CG2 . THR A  1  385 ? 32.031 95.091  105.325 1.00 37.84  ? 385  THR A CG2 1 
ATOM   2948  N  N   . TYR A  1  386 ? 29.718 98.968  105.848 1.00 40.69  ? 386  TYR A N   1 
ATOM   2949  C  CA  . TYR A  1  386 ? 29.440 100.277 106.465 1.00 41.06  ? 386  TYR A CA  1 
ATOM   2950  C  C   . TYR A  1  386 ? 28.106 100.876 106.042 1.00 41.43  ? 386  TYR A C   1 
ATOM   2951  O  O   . TYR A  1  386 ? 27.580 101.771 106.707 1.00 41.67  ? 386  TYR A O   1 
ATOM   2952  C  CB  . TYR A  1  386 ? 30.565 101.289 106.137 1.00 41.10  ? 386  TYR A CB  1 
ATOM   2953  C  CG  . TYR A  1  386 ? 31.963 100.886 106.583 1.00 41.26  ? 386  TYR A CG  1 
ATOM   2954  C  CD1 . TYR A  1  386 ? 33.060 101.023 105.719 1.00 42.83  ? 386  TYR A CD1 1 
ATOM   2955  C  CD2 . TYR A  1  386 ? 32.196 100.405 107.870 1.00 43.31  ? 386  TYR A CD2 1 
ATOM   2956  C  CE1 . TYR A  1  386 ? 34.363 100.663 106.123 1.00 43.93  ? 386  TYR A CE1 1 
ATOM   2957  C  CE2 . TYR A  1  386 ? 33.489 100.039 108.289 1.00 44.77  ? 386  TYR A CE2 1 
ATOM   2958  C  CZ  . TYR A  1  386 ? 34.569 100.162 107.403 1.00 44.88  ? 386  TYR A CZ  1 
ATOM   2959  O  OH  . TYR A  1  386 ? 35.847 99.805  107.812 1.00 38.81  ? 386  TYR A OH  1 
ATOM   2960  N  N   . GLY A  1  387 ? 27.576 100.431 104.914 1.00 41.49  ? 387  GLY A N   1 
ATOM   2961  C  CA  . GLY A  1  387 ? 26.342 100.998 104.411 1.00 41.50  ? 387  GLY A CA  1 
ATOM   2962  C  C   . GLY A  1  387 ? 26.635 102.324 103.732 1.00 42.02  ? 387  GLY A C   1 
ATOM   2963  O  O   . GLY A  1  387 ? 25.779 102.870 103.041 1.00 42.56  ? 387  GLY A O   1 
ATOM   2964  N  N   . ARG A  1  388 ? 27.842 102.866 103.981 1.00 41.84  ? 388  ARG A N   1 
ATOM   2965  C  CA  . ARG A  1  388 ? 28.313 104.113 103.364 1.00 41.53  ? 388  ARG A CA  1 
ATOM   2966  C  C   . ARG A  1  388 ? 29.670 103.850 102.769 1.00 42.02  ? 388  ARG A C   1 
ATOM   2967  O  O   . ARG A  1  388 ? 30.267 102.767 102.920 1.00 42.17  ? 388  ARG A O   1 
ATOM   2968  C  CB  . ARG A  1  388 ? 28.567 105.210 104.411 1.00 41.03  ? 388  ARG A CB  1 
ATOM   2969  C  CG  . ARG A  1  388 ? 27.583 105.321 105.501 1.00 48.60  ? 388  ARG A CG  1 
ATOM   2970  C  CD  . ARG A  1  388 ? 28.215 105.468 106.897 1.00 43.39  ? 388  ARG A CD  1 
ATOM   2971  N  NE  . ARG A  1  388 ? 29.179 106.569 107.008 1.00 34.36  ? 388  ARG A NE  1 
ATOM   2972  C  CZ  . ARG A  1  388 ? 30.073 106.661 107.993 1.00 29.53  ? 388  ARG A CZ  1 
ATOM   2973  N  NH1 . ARG A  1  388 ? 30.135 105.722 108.915 1.00 36.04  ? 388  ARG A NH1 1 
ATOM   2974  N  NH2 . ARG A  1  388 ? 30.900 107.675 108.057 1.00 21.41  ? 388  ARG A NH2 1 
ATOM   2975  N  N   . ARG A  1  389 ? 30.186 104.888 102.153 1.00 41.68  ? 389  ARG A N   1 
ATOM   2976  C  CA  . ARG A  1  389 ? 31.524 104.914 101.643 1.00 40.46  ? 389  ARG A CA  1 
ATOM   2977  C  C   . ARG A  1  389 ? 32.136 105.913 102.578 1.00 39.19  ? 389  ARG A C   1 
ATOM   2978  O  O   . ARG A  1  389 ? 31.640 107.015 102.677 1.00 39.54  ? 389  ARG A O   1 
ATOM   2979  C  CB  . ARG A  1  389 ? 31.507 105.534 100.258 1.00 40.57  ? 389  ARG A CB  1 
ATOM   2980  C  CG  . ARG A  1  389 ? 32.852 105.817 99.704  1.00 42.49  ? 389  ARG A CG  1 
ATOM   2981  C  CD  . ARG A  1  389 ? 33.444 104.663 98.926  1.00 41.54  ? 389  ARG A CD  1 
ATOM   2982  N  NE  . ARG A  1  389 ? 34.599 105.088 98.147  1.00 40.19  ? 389  ARG A NE  1 
ATOM   2983  C  CZ  . ARG A  1  389 ? 35.797 104.616 98.334  1.00 29.61  ? 389  ARG A CZ  1 
ATOM   2984  N  NH1 . ARG A  1  389 ? 35.983 103.695 99.247  1.00 36.42  ? 389  ARG A NH1 1 
ATOM   2985  N  NH2 . ARG A  1  389 ? 36.798 105.032 97.609  1.00 19.28  ? 389  ARG A NH2 1 
ATOM   2986  N  N   . ILE A  1  390 ? 33.169 105.549 103.304 1.00 37.93  ? 390  ILE A N   1 
ATOM   2987  C  CA  . ILE A  1  390 ? 33.754 106.513 104.212 1.00 37.33  ? 390  ILE A CA  1 
ATOM   2988  C  C   . ILE A  1  390 ? 34.878 107.319 103.562 1.00 37.74  ? 390  ILE A C   1 
ATOM   2989  O  O   . ILE A  1  390 ? 35.949 106.798 103.299 1.00 38.22  ? 390  ILE A O   1 
ATOM   2990  C  CB  . ILE A  1  390 ? 34.159 105.856 105.490 1.00 36.95  ? 390  ILE A CB  1 
ATOM   2991  C  CG1 . ILE A  1  390 ? 32.905 105.287 106.174 1.00 37.12  ? 390  ILE A CG1 1 
ATOM   2992  C  CG2 . ILE A  1  390 ? 34.835 106.839 106.416 1.00 36.40  ? 390  ILE A CG2 1 
ATOM   2993  C  CD1 . ILE A  1  390 ? 33.172 104.642 107.530 1.00 40.43  ? 390  ILE A CD1 1 
ATOM   2994  N  N   . PRO A  1  391 ? 34.625 108.605 103.305 1.00 37.67  ? 391  PRO A N   1 
ATOM   2995  C  CA  . PRO A  1  391 ? 35.594 109.445 102.611 1.00 37.97  ? 391  PRO A CA  1 
ATOM   2996  C  C   . PRO A  1  391 ? 36.861 109.587 103.389 1.00 38.34  ? 391  PRO A C   1 
ATOM   2997  O  O   . PRO A  1  391 ? 36.853 109.573 104.624 1.00 39.07  ? 391  PRO A O   1 
ATOM   2998  C  CB  . PRO A  1  391 ? 34.887 110.803 102.531 1.00 37.74  ? 391  PRO A CB  1 
ATOM   2999  C  CG  . PRO A  1  391 ? 33.481 110.490 102.715 1.00 40.20  ? 391  PRO A CG  1 
ATOM   3000  C  CD  . PRO A  1  391 ? 33.443 109.369 103.710 1.00 37.21  ? 391  PRO A CD  1 
ATOM   3001  N  N   . LEU A  1  392 ? 37.944 109.724 102.662 1.00 37.52  ? 392  LEU A N   1 
ATOM   3002  C  CA  . LEU A  1  392 ? 39.251 109.908 103.222 1.00 36.70  ? 392  LEU A CA  1 
ATOM   3003  C  C   . LEU A  1  392 ? 39.307 111.003 104.270 1.00 35.98  ? 392  LEU A C   1 
ATOM   3004  O  O   . LEU A  1  392 ? 39.967 110.840 105.285 1.00 36.32  ? 392  LEU A O   1 
ATOM   3005  C  CB  . LEU A  1  392 ? 40.222 110.188 102.094 1.00 36.68  ? 392  LEU A CB  1 
ATOM   3006  C  CG  . LEU A  1  392 ? 40.342 108.931 101.224 1.00 49.84  ? 392  LEU A CG  1 
ATOM   3007  C  CD1 . LEU A  1  392 ? 39.749 109.077 99.815  1.00 57.58  ? 392  LEU A CD1 1 
ATOM   3008  C  CD2 . LEU A  1  392 ? 41.744 108.350 101.215 1.00 47.31  ? 392  LEU A CD2 1 
ATOM   3009  N  N   . ALA A  1  393 ? 38.577 112.097 104.058 1.00 35.03  ? 393  ALA A N   1 
ATOM   3010  C  CA  . ALA A  1  393 ? 38.590 113.194 105.021 1.00 34.81  ? 393  ALA A CA  1 
ATOM   3011  C  C   . ALA A  1  393 ? 38.100 112.742 106.398 1.00 34.53  ? 393  ALA A C   1 
ATOM   3012  O  O   . ALA A  1  393 ? 38.627 113.177 107.418 1.00 34.28  ? 393  ALA A O   1 
ATOM   3013  C  CB  . ALA A  1  393 ? 37.775 114.363 104.523 1.00 34.92  ? 393  ALA A CB  1 
ATOM   3014  N  N   . GLU A  1  394 ? 37.097 111.858 106.416 1.00 34.52  ? 394  GLU A N   1 
ATOM   3015  C  CA  . GLU A  1  394 ? 36.575 111.327 107.675 1.00 34.45  ? 394  GLU A CA  1 
ATOM   3016  C  C   . GLU A  1  394 ? 37.567 110.376 108.335 1.00 34.23  ? 394  GLU A C   1 
ATOM   3017  O  O   . GLU A  1  394 ? 37.756 110.432 109.560 1.00 34.59  ? 394  GLU A O   1 
ATOM   3018  C  CB  . GLU A  1  394 ? 35.225 110.624 107.500 1.00 34.60  ? 394  GLU A CB  1 
ATOM   3019  C  CG  . GLU A  1  394 ? 34.495 110.439 108.838 1.00 41.99  ? 394  GLU A CG  1 
ATOM   3020  C  CD  . GLU A  1  394 ? 33.464 109.330 108.821 1.00 40.98  ? 394  GLU A CD  1 
ATOM   3021  O  OE1 . GLU A  1  394 ? 33.453 108.509 109.772 1.00 46.57  ? 394  GLU A OE1 1 
ATOM   3022  O  OE2 . GLU A  1  394 ? 32.653 109.288 107.879 1.00 35.79  ? 394  GLU A OE2 1 
ATOM   3023  N  N   . TRP A  1  395 ? 38.184 109.488 107.537 1.00 33.47  ? 395  TRP A N   1 
ATOM   3024  C  CA  . TRP A  1  395 ? 39.185 108.589 108.078 1.00 33.24  ? 395  TRP A CA  1 
ATOM   3025  C  C   . TRP A  1  395 ? 40.300 109.440 108.660 1.00 33.12  ? 395  TRP A C   1 
ATOM   3026  O  O   . TRP A  1  395 ? 40.865 109.092 109.693 1.00 33.46  ? 395  TRP A O   1 
ATOM   3027  C  CB  . TRP A  1  395 ? 39.783 107.645 107.014 1.00 33.34  ? 395  TRP A CB  1 
ATOM   3028  C  CG  . TRP A  1  395 ? 38.891 106.507 106.526 1.00 35.85  ? 395  TRP A CG  1 
ATOM   3029  C  CD1 . TRP A  1  395 ? 38.611 106.209 105.238 1.00 35.10  ? 395  TRP A CD1 1 
ATOM   3030  C  CD2 . TRP A  1  395 ? 38.199 105.517 107.320 1.00 33.79  ? 395  TRP A CD2 1 
ATOM   3031  N  NE1 . TRP A  1  395 ? 37.770 105.125 105.166 1.00 28.44  ? 395  TRP A NE1 1 
ATOM   3032  C  CE2 . TRP A  1  395 ? 37.510 104.676 106.429 1.00 35.44  ? 395  TRP A CE2 1 
ATOM   3033  C  CE3 . TRP A  1  395 ? 38.093 105.260 108.690 1.00 36.95  ? 395  TRP A CE3 1 
ATOM   3034  C  CZ2 . TRP A  1  395 ? 36.713 103.590 106.866 1.00 39.69  ? 395  TRP A CZ2 1 
ATOM   3035  C  CZ3 . TRP A  1  395 ? 37.293 104.189 109.124 1.00 35.43  ? 395  TRP A CZ3 1 
ATOM   3036  C  CH2 . TRP A  1  395 ? 36.617 103.377 108.212 1.00 37.22  ? 395  TRP A CH2 1 
ATOM   3037  N  N   . GLU A  1  396 ? 40.609 110.569 108.003 1.00 32.36  ? 396  GLU A N   1 
ATOM   3038  C  CA  . GLU A  1  396 ? 41.659 111.458 108.491 1.00 31.97  ? 396  GLU A CA  1 
ATOM   3039  C  C   . GLU A  1  396 ? 41.278 112.033 109.840 1.00 31.84  ? 396  GLU A C   1 
ATOM   3040  O  O   . GLU A  1  396 ? 42.098 112.062 110.780 1.00 31.98  ? 396  GLU A O   1 
ATOM   3041  C  CB  . GLU A  1  396 ? 41.904 112.587 107.521 1.00 32.12  ? 396  GLU A CB  1 
ATOM   3042  C  CG  . GLU A  1  396 ? 42.819 113.696 108.059 1.00 33.54  ? 396  GLU A CG  1 
ATOM   3043  C  CD  . GLU A  1  396 ? 44.168 113.174 108.557 1.00 36.40  ? 396  GLU A CD  1 
ATOM   3044  O  OE1 . GLU A  1  396 ? 44.739 112.251 107.930 1.00 38.62  ? 396  GLU A OE1 1 
ATOM   3045  O  OE2 . GLU A  1  396 ? 44.659 113.692 109.572 1.00 36.06  ? 396  GLU A OE2 1 
ATOM   3046  N  N   . SER A  1  397 ? 40.032 112.476 109.940 1.00 31.15  ? 397  SER A N   1 
ATOM   3047  C  CA  . SER A  1  397 ? 39.531 113.036 111.155 1.00 30.98  ? 397  SER A CA  1 
ATOM   3048  C  C   . SER A  1  397 ? 39.631 111.997 112.271 1.00 31.70  ? 397  SER A C   1 
ATOM   3049  O  O   . SER A  1  397 ? 40.128 112.298 113.370 1.00 32.15  ? 397  SER A O   1 
ATOM   3050  C  CB  . SER A  1  397 ? 38.096 113.499 110.969 1.00 30.63  ? 397  SER A CB  1 
ATOM   3051  O  OG  . SER A  1  397 ? 37.505 113.795 112.213 1.00 34.95  ? 397  SER A OG  1 
ATOM   3052  N  N   . ARG A  1  398 ? 39.204 110.767 111.981 1.00 31.67  ? 398  ARG A N   1 
ATOM   3053  C  CA  . ARG A  1  398 ? 39.289 109.696 112.962 1.00 32.00  ? 398  ARG A CA  1 
ATOM   3054  C  C   . ARG A  1  398 ? 40.739 109.353 113.351 1.00 31.70  ? 398  ARG A C   1 
ATOM   3055  O  O   . ARG A  1  398 ? 41.032 109.058 114.524 1.00 31.68  ? 398  ARG A O   1 
ATOM   3056  C  CB  . ARG A  1  398 ? 38.530 108.468 112.495 1.00 32.34  ? 398  ARG A CB  1 
ATOM   3057  C  CG  . ARG A  1  398 ? 37.071 108.584 112.751 1.00 41.68  ? 398  ARG A CG  1 
ATOM   3058  C  CD  . ARG A  1  398 ? 36.241 107.577 112.048 1.00 46.33  ? 398  ARG A CD  1 
ATOM   3059  N  NE  . ARG A  1  398 ? 34.919 107.516 112.638 1.00 53.36  ? 398  ARG A NE  1 
ATOM   3060  C  CZ  . ARG A  1  398 ? 34.032 106.580 112.365 1.00 68.14  ? 398  ARG A CZ  1 
ATOM   3061  N  NH1 . ARG A  1  398 ? 34.317 105.609 111.490 1.00 68.85  ? 398  ARG A NH1 1 
ATOM   3062  N  NH2 . ARG A  1  398 ? 32.856 106.600 112.968 1.00 74.89  ? 398  ARG A NH2 1 
ATOM   3063  N  N   . ILE A  1  399 ? 41.641 109.414 112.388 1.00 31.37  ? 399  ILE A N   1 
ATOM   3064  C  CA  . ILE A  1  399 ? 43.029 109.173 112.689 1.00 31.48  ? 399  ILE A CA  1 
ATOM   3065  C  C   . ILE A  1  399 ? 43.570 110.333 113.552 1.00 32.57  ? 399  ILE A C   1 
ATOM   3066  O  O   . ILE A  1  399 ? 44.063 110.095 114.664 1.00 33.07  ? 399  ILE A O   1 
ATOM   3067  C  CB  . ILE A  1  399 ? 43.834 109.017 111.425 1.00 30.79  ? 399  ILE A CB  1 
ATOM   3068  C  CG1 . ILE A  1  399 ? 43.465 107.722 110.742 1.00 33.69  ? 399  ILE A CG1 1 
ATOM   3069  C  CG2 . ILE A  1  399 ? 45.266 108.951 111.755 1.00 23.26  ? 399  ILE A CG2 1 
ATOM   3070  C  CD1 . ILE A  1  399 ? 43.974 107.603 109.400 1.00 36.15  ? 399  ILE A CD1 1 
ATOM   3071  N  N   . ALA A  1  400 ? 43.359 111.582 113.083 1.00 32.49  ? 400  ALA A N   1 
ATOM   3072  C  CA  . ALA A  1  400 ? 43.829 112.804 113.777 1.00 32.33  ? 400  ALA A CA  1 
ATOM   3073  C  C   . ALA A  1  400 ? 43.507 112.845 115.250 1.00 32.33  ? 400  ALA A C   1 
ATOM   3074  O  O   . ALA A  1  400 ? 44.329 113.273 116.046 1.00 32.84  ? 400  ALA A O   1 
ATOM   3075  C  CB  . ALA A  1  400 ? 43.304 114.087 113.067 1.00 31.94  ? 400  ALA A CB  1 
ATOM   3076  N  N   . GLU A  1  401 ? 42.317 112.360 115.609 1.00 32.17  ? 401  GLU A N   1 
ATOM   3077  C  CA  . GLU A  1  401 ? 41.834 112.310 117.020 1.00 32.04  ? 401  GLU A CA  1 
ATOM   3078  C  C   . GLU A  1  401 ? 42.586 111.361 117.940 1.00 31.12  ? 401  GLU A C   1 
ATOM   3079  O  O   . GLU A  1  401 ? 42.386 111.396 119.143 1.00 31.19  ? 401  GLU A O   1 
ATOM   3080  C  CB  . GLU A  1  401 ? 40.364 111.868 117.066 1.00 32.56  ? 401  GLU A CB  1 
ATOM   3081  C  CG  . GLU A  1  401 ? 39.345 112.915 116.659 1.00 43.17  ? 401  GLU A CG  1 
ATOM   3082  C  CD  . GLU A  1  401 ? 37.918 112.399 116.809 1.00 48.45  ? 401  GLU A CD  1 
ATOM   3083  O  OE1 . GLU A  1  401 ? 37.682 111.187 116.479 1.00 37.28  ? 401  GLU A OE1 1 
ATOM   3084  O  OE2 . GLU A  1  401 ? 37.040 113.189 117.280 1.00 48.73  ? 401  GLU A OE2 1 
ATOM   3085  N  N   . VAL A  1  402 ? 43.374 110.456 117.381 1.00 30.26  ? 402  VAL A N   1 
ATOM   3086  C  CA  . VAL A  1  402 ? 44.099 109.495 118.215 1.00 29.39  ? 402  VAL A CA  1 
ATOM   3087  C  C   . VAL A  1  402 ? 45.341 110.111 118.850 1.00 28.87  ? 402  VAL A C   1 
ATOM   3088  O  O   . VAL A  1  402 ? 46.122 110.709 118.200 1.00 29.02  ? 402  VAL A O   1 
ATOM   3089  C  CB  . VAL A  1  402 ? 44.475 108.199 117.415 1.00 28.93  ? 402  VAL A CB  1 
ATOM   3090  C  CG1 . VAL A  1  402 ? 45.336 107.257 118.254 1.00 26.66  ? 402  VAL A CG1 1 
ATOM   3091  C  CG2 . VAL A  1  402 ? 43.235 107.495 116.957 1.00 17.70  ? 402  VAL A CG2 1 
ATOM   3092  N  N   . ASP A  1  403 ? 45.441 110.044 120.144 1.00 28.72  ? 403  ASP A N   1 
ATOM   3093  C  CA  . ASP A  1  403 ? 46.631 110.504 120.809 1.00 28.84  ? 403  ASP A CA  1 
ATOM   3094  C  C   . ASP A  1  403 ? 47.098 109.323 121.695 1.00 29.32  ? 403  ASP A C   1 
ATOM   3095  O  O   . ASP A  1  403 ? 46.444 108.250 121.711 1.00 29.64  ? 403  ASP A O   1 
ATOM   3096  C  CB  . ASP A  1  403 ? 46.359 111.805 121.611 1.00 28.78  ? 403  ASP A CB  1 
ATOM   3097  C  CG  . ASP A  1  403 ? 45.901 111.549 123.057 1.00 37.10  ? 403  ASP A CG  1 
ATOM   3098  O  OD1 . ASP A  1  403 ? 45.015 110.681 123.274 1.00 40.68  ? 403  ASP A OD1 1 
ATOM   3099  O  OD2 . ASP A  1  403 ? 46.384 112.178 124.045 1.00 36.82  ? 403  ASP A OD2 1 
ATOM   3100  N  N   . ALA A  1  404 ? 48.198 109.494 122.405 1.00 29.50  ? 404  ALA A N   1 
ATOM   3101  C  CA  . ALA A  1  404 ? 48.710 108.431 123.260 1.00 30.06  ? 404  ALA A CA  1 
ATOM   3102  C  C   . ALA A  1  404 ? 47.653 107.862 124.229 1.00 31.19  ? 404  ALA A C   1 
ATOM   3103  O  O   . ALA A  1  404 ? 47.471 106.631 124.318 1.00 31.19  ? 404  ALA A O   1 
ATOM   3104  C  CB  . ALA A  1  404 ? 49.954 108.896 124.014 1.00 29.65  ? 404  ALA A CB  1 
ATOM   3105  N  N   . ARG A  1  405 ? 46.920 108.753 124.904 1.00 32.07  ? 405  ARG A N   1 
ATOM   3106  C  CA  . ARG A  1  405 ? 45.911 108.327 125.869 1.00 32.70  ? 405  ARG A CA  1 
ATOM   3107  C  C   . ARG A  1  405 ? 44.919 107.351 125.265 1.00 32.74  ? 405  ARG A C   1 
ATOM   3108  O  O   . ARG A  1  405 ? 44.554 106.365 125.893 1.00 32.90  ? 405  ARG A O   1 
ATOM   3109  C  CB  . ARG A  1  405 ? 45.195 109.524 126.482 1.00 33.14  ? 405  ARG A CB  1 
ATOM   3110  C  CG  . ARG A  1  405 ? 44.405 109.193 127.732 1.00 42.65  ? 405  ARG A CG  1 
ATOM   3111  C  CD  . ARG A  1  405 ? 43.662 110.376 128.312 1.00 54.13  ? 405  ARG A CD  1 
ATOM   3112  N  NE  . ARG A  1  405 ? 42.493 109.954 129.079 1.00 67.68  ? 405  ARG A NE  1 
ATOM   3113  C  CZ  . ARG A  1  405 ? 41.364 109.496 128.532 1.00 72.14  ? 405  ARG A CZ  1 
ATOM   3114  N  NH1 . ARG A  1  405 ? 41.252 109.387 127.201 1.00 75.78  ? 405  ARG A NH1 1 
ATOM   3115  N  NH2 . ARG A  1  405 ? 40.350 109.127 129.311 1.00 68.39  ? 405  ARG A NH2 1 
ATOM   3116  N  N   . VAL A  1  406 ? 44.506 107.621 124.034 1.00 32.68  ? 406  VAL A N   1 
ATOM   3117  C  CA  . VAL A  1  406 ? 43.591 106.751 123.343 1.00 32.37  ? 406  VAL A CA  1 
ATOM   3118  C  C   . VAL A  1  406 ? 44.239 105.405 123.086 1.00 32.61  ? 406  VAL A C   1 
ATOM   3119  O  O   . VAL A  1  406 ? 43.651 104.367 123.378 1.00 31.65  ? 406  VAL A O   1 
ATOM   3120  C  CB  . VAL A  1  406 ? 43.132 107.360 122.045 1.00 32.06  ? 406  VAL A CB  1 
ATOM   3121  C  CG1 . VAL A  1  406 ? 42.268 106.399 121.305 1.00 24.30  ? 406  VAL A CG1 1 
ATOM   3122  C  CG2 . VAL A  1  406 ? 42.386 108.654 122.318 1.00 25.79  ? 406  VAL A CG2 1 
ATOM   3123  N  N   . VAL A  1  407 ? 45.484 105.419 122.604 1.00 33.74  ? 407  VAL A N   1 
ATOM   3124  C  CA  . VAL A  1  407 ? 46.168 104.158 122.331 1.00 34.65  ? 407  VAL A CA  1 
ATOM   3125  C  C   . VAL A  1  407 ? 46.214 103.259 123.592 1.00 35.89  ? 407  VAL A C   1 
ATOM   3126  O  O   . VAL A  1  407 ? 45.710 102.125 123.572 1.00 36.09  ? 407  VAL A O   1 
ATOM   3127  C  CB  . VAL A  1  407 ? 47.574 104.349 121.681 1.00 34.33  ? 407  VAL A CB  1 
ATOM   3128  C  CG1 . VAL A  1  407 ? 48.342 103.048 121.680 1.00 29.57  ? 407  VAL A CG1 1 
ATOM   3129  C  CG2 . VAL A  1  407 ? 47.433 104.861 120.266 1.00 30.85  ? 407  VAL A CG2 1 
ATOM   3130  N  N   . ARG A  1  408 ? 46.694 103.802 124.710 1.00 36.56  ? 408  ARG A N   1 
ATOM   3131  C  CA  . ARG A  1  408 ? 46.783 103.002 125.923 1.00 37.21  ? 408  ARG A CA  1 
ATOM   3132  C  C   . ARG A  1  408 ? 45.467 102.635 126.547 1.00 38.19  ? 408  ARG A C   1 
ATOM   3133  O  O   . ARG A  1  408 ? 45.391 101.727 127.334 1.00 38.57  ? 408  ARG A O   1 
ATOM   3134  C  CB  . ARG A  1  408 ? 47.791 103.541 126.931 1.00 37.05  ? 408  ARG A CB  1 
ATOM   3135  C  CG  . ARG A  1  408 ? 47.714 104.940 127.228 1.00 39.11  ? 408  ARG A CG  1 
ATOM   3136  C  CD  . ARG A  1  408 ? 48.931 105.465 128.013 1.00 31.87  ? 408  ARG A CD  1 
ATOM   3137  N  NE  . ARG A  1  408 ? 48.577 106.672 128.744 1.00 29.28  ? 408  ARG A NE  1 
ATOM   3138  C  CZ  . ARG A  1  408 ? 48.572 107.874 128.213 1.00 29.89  ? 408  ARG A CZ  1 
ATOM   3139  N  NH1 . ARG A  1  408 ? 48.982 108.038 126.996 1.00 36.37  ? 408  ARG A NH1 1 
ATOM   3140  N  NH2 . ARG A  1  408 ? 48.208 108.923 128.916 1.00 33.96  ? 408  ARG A NH2 1 
ATOM   3141  N  N   . GLU A  1  409 ? 44.411 103.277 126.116 1.00 38.72  ? 409  GLU A N   1 
ATOM   3142  C  CA  . GLU A  1  409 ? 43.105 102.959 126.632 1.00 39.30  ? 409  GLU A CA  1 
ATOM   3143  C  C   . GLU A  1  409 ? 42.490 101.894 125.729 1.00 39.22  ? 409  GLU A C   1 
ATOM   3144  O  O   . GLU A  1  409 ? 41.907 100.911 126.212 1.00 40.14  ? 409  GLU A O   1 
ATOM   3145  C  CB  . GLU A  1  409 ? 42.238 104.200 126.618 1.00 39.52  ? 409  GLU A CB  1 
ATOM   3146  C  CG  . GLU A  1  409 ? 41.546 104.487 127.898 1.00 47.51  ? 409  GLU A CG  1 
ATOM   3147  C  CD  . GLU A  1  409 ? 41.260 105.952 128.032 1.00 55.79  ? 409  GLU A CD  1 
ATOM   3148  O  OE1 . GLU A  1  409 ? 41.653 106.544 129.056 1.00 54.08  ? 409  GLU A OE1 1 
ATOM   3149  O  OE2 . GLU A  1  409 ? 40.682 106.521 127.087 1.00 59.71  ? 409  GLU A OE2 1 
ATOM   3150  N  N   . VAL A  1  410 ? 42.605 102.103 124.419 1.00 38.04  ? 410  VAL A N   1 
ATOM   3151  C  CA  . VAL A  1  410 ? 42.062 101.176 123.440 1.00 36.85  ? 410  VAL A CA  1 
ATOM   3152  C  C   . VAL A  1  410 ? 42.867 99.867  123.393 1.00 36.60  ? 410  VAL A C   1 
ATOM   3153  O  O   . VAL A  1  410 ? 42.293 98.780  123.254 1.00 36.24  ? 410  VAL A O   1 
ATOM   3154  C  CB  . VAL A  1  410 ? 41.915 101.841 122.051 1.00 36.25  ? 410  VAL A CB  1 
ATOM   3155  C  CG1 . VAL A  1  410 ? 41.538 100.860 121.007 1.00 28.09  ? 410  VAL A CG1 1 
ATOM   3156  C  CG2 . VAL A  1  410 ? 40.884 102.927 122.113 1.00 31.66  ? 410  VAL A CG2 1 
ATOM   3157  N  N   . CYS A  1  411 ? 44.185 99.943  123.573 1.00 36.83  ? 411  CYS A N   1 
ATOM   3158  C  CA  . CYS A  1  411 ? 44.958 98.694  123.571 1.00 37.06  ? 411  CYS A CA  1 
ATOM   3159  C  C   . CYS A  1  411 ? 44.621 97.907  124.851 1.00 37.46  ? 411  CYS A C   1 
ATOM   3160  O  O   . CYS A  1  411 ? 44.428 96.659  124.815 1.00 36.93  ? 411  CYS A O   1 
ATOM   3161  C  CB  . CYS A  1  411 ? 46.447 98.933  123.432 1.00 36.38  ? 411  CYS A CB  1 
ATOM   3162  S  SG  . CYS A  1  411 ? 46.896 99.569  121.821 1.00 38.21  ? 411  CYS A SG  1 
ATOM   3163  N  N   . SER A  1  412 ? 44.496 98.648  125.966 1.00 37.21  ? 412  SER A N   1 
ATOM   3164  C  CA  . SER A  1  412 ? 44.154 98.041  127.233 1.00 36.69  ? 412  SER A CA  1 
ATOM   3165  C  C   . SER A  1  412 ? 42.872 97.251  127.148 1.00 36.01  ? 412  SER A C   1 
ATOM   3166  O  O   . SER A  1  412 ? 42.853 96.083  127.469 1.00 36.20  ? 412  SER A O   1 
ATOM   3167  C  CB  . SER A  1  412 ? 44.115 99.068  128.339 1.00 36.42  ? 412  SER A CB  1 
ATOM   3168  O  OG  . SER A  1  412 ? 45.432 99.493  128.616 1.00 35.37  ? 412  SER A OG  1 
ATOM   3169  N  N   . LYS A  1  413 ? 41.836 97.875  126.629 1.00 35.34  ? 413  LYS A N   1 
ATOM   3170  C  CA  . LYS A  1  413 ? 40.561 97.234  126.462 1.00 35.63  ? 413  LYS A CA  1 
ATOM   3171  C  C   . LYS A  1  413 ? 40.638 95.859  125.722 1.00 36.00  ? 413  LYS A C   1 
ATOM   3172  O  O   . LYS A  1  413 ? 40.029 94.895  126.145 1.00 36.34  ? 413  LYS A O   1 
ATOM   3173  C  CB  . LYS A  1  413 ? 39.636 98.180  125.715 1.00 35.76  ? 413  LYS A CB  1 
ATOM   3174  C  CG  . LYS A  1  413 ? 38.240 97.645  125.440 1.00 36.05  ? 413  LYS A CG  1 
ATOM   3175  C  CD  . LYS A  1  413 ? 37.429 98.702  124.691 1.00 37.22  ? 413  LYS A CD  1 
ATOM   3176  C  CE  . LYS A  1  413 ? 36.010 98.275  124.489 1.00 42.92  ? 413  LYS A CE  1 
ATOM   3177  N  NZ  . LYS A  1  413 ? 35.248 99.322  123.779 1.00 47.78  ? 413  LYS A NZ  1 
ATOM   3178  N  N   . TYR A  1  414 ? 41.456 95.770  124.686 1.00 36.02  ? 414  TYR A N   1 
ATOM   3179  C  CA  . TYR A  1  414 ? 41.529 94.551  123.894 1.00 35.93  ? 414  TYR A CA  1 
ATOM   3180  C  C   . TYR A  1  414 ? 42.612 93.596  124.258 1.00 36.57  ? 414  TYR A C   1 
ATOM   3181  O  O   . TYR A  1  414 ? 42.434 92.381  124.128 1.00 37.35  ? 414  TYR A O   1 
ATOM   3182  C  CB  . TYR A  1  414 ? 41.564 94.870  122.393 1.00 35.39  ? 414  TYR A CB  1 
ATOM   3183  C  CG  . TYR A  1  414 ? 40.336 95.600  121.958 1.00 33.08  ? 414  TYR A CG  1 
ATOM   3184  C  CD1 . TYR A  1  414 ? 40.306 97.009  121.924 1.00 28.12  ? 414  TYR A CD1 1 
ATOM   3185  C  CD2 . TYR A  1  414 ? 39.168 94.908  121.674 1.00 27.65  ? 414  TYR A CD2 1 
ATOM   3186  C  CE1 . TYR A  1  414 ? 39.152 97.695  121.602 1.00 32.13  ? 414  TYR A CE1 1 
ATOM   3187  C  CE2 . TYR A  1  414 ? 37.999 95.585  121.338 1.00 34.62  ? 414  TYR A CE2 1 
ATOM   3188  C  CZ  . TYR A  1  414 ? 37.993 96.977  121.295 1.00 35.57  ? 414  TYR A CZ  1 
ATOM   3189  O  OH  . TYR A  1  414 ? 36.831 97.642  120.963 1.00 31.74  ? 414  TYR A OH  1 
ATOM   3190  N  N   . PHE A  1  415 ? 43.720 94.113  124.752 1.00 36.54  ? 415  PHE A N   1 
ATOM   3191  C  CA  . PHE A  1  415 ? 44.852 93.280  125.066 1.00 36.41  ? 415  PHE A CA  1 
ATOM   3192  C  C   . PHE A  1  415 ? 45.026 93.017  126.524 1.00 36.67  ? 415  PHE A C   1 
ATOM   3193  O  O   . PHE A  1  415 ? 45.162 91.874  126.923 1.00 37.53  ? 415  PHE A O   1 
ATOM   3194  C  CB  . PHE A  1  415 ? 46.125 93.903  124.560 1.00 36.52  ? 415  PHE A CB  1 
ATOM   3195  C  CG  . PHE A  1  415 ? 46.294 93.850  123.080 1.00 39.60  ? 415  PHE A CG  1 
ATOM   3196  C  CD1 . PHE A  1  415 ? 46.348 95.032  122.331 1.00 38.27  ? 415  PHE A CD1 1 
ATOM   3197  C  CD2 . PHE A  1  415 ? 46.507 92.634  122.432 1.00 34.32  ? 415  PHE A CD2 1 
ATOM   3198  C  CE1 . PHE A  1  415 ? 46.577 94.994  120.959 1.00 32.81  ? 415  PHE A CE1 1 
ATOM   3199  C  CE2 . PHE A  1  415 ? 46.747 92.594  121.065 1.00 38.04  ? 415  PHE A CE2 1 
ATOM   3200  C  CZ  . PHE A  1  415 ? 46.787 93.771  120.328 1.00 31.98  ? 415  PHE A CZ  1 
ATOM   3201  N  N   . TYR A  1  416 ? 45.064 94.069  127.335 1.00 36.14  ? 416  TYR A N   1 
ATOM   3202  C  CA  . TYR A  1  416 ? 45.322 93.879  128.764 1.00 35.55  ? 416  TYR A CA  1 
ATOM   3203  C  C   . TYR A  1  416 ? 44.505 92.805  129.478 1.00 35.74  ? 416  TYR A C   1 
ATOM   3204  O  O   . TYR A  1  416 ? 43.275 92.903  129.587 1.00 35.90  ? 416  TYR A O   1 
ATOM   3205  C  CB  . TYR A  1  416 ? 45.324 95.170  129.548 1.00 34.96  ? 416  TYR A CB  1 
ATOM   3206  C  CG  . TYR A  1  416 ? 46.256 95.091  130.739 1.00 33.41  ? 416  TYR A CG  1 
ATOM   3207  C  CD1 . TYR A  1  416 ? 47.640 95.225  130.569 1.00 30.37  ? 416  TYR A CD1 1 
ATOM   3208  C  CD2 . TYR A  1  416 ? 45.774 94.840  132.012 1.00 24.53  ? 416  TYR A CD2 1 
ATOM   3209  C  CE1 . TYR A  1  416 ? 48.505 95.133  131.633 1.00 29.08  ? 416  TYR A CE1 1 
ATOM   3210  C  CE2 . TYR A  1  416 ? 46.621 94.748  133.081 1.00 29.95  ? 416  TYR A CE2 1 
ATOM   3211  C  CZ  . TYR A  1  416 ? 47.996 94.900  132.894 1.00 36.27  ? 416  TYR A CZ  1 
ATOM   3212  O  OH  . TYR A  1  416 ? 48.865 94.798  133.968 1.00 39.57  ? 416  TYR A OH  1 
ATOM   3213  N  N   . ASP A  1  417 ? 45.216 91.741  129.873 1.00 35.46  ? 417  ASP A N   1 
ATOM   3214  C  CA  . ASP A  1  417 ? 44.678 90.635  130.644 1.00 35.09  ? 417  ASP A CA  1 
ATOM   3215  C  C   . ASP A  1  417 ? 43.533 89.964  129.943 1.00 35.62  ? 417  ASP A C   1 
ATOM   3216  O  O   . ASP A  1  417 ? 42.433 89.822  130.480 1.00 35.66  ? 417  ASP A O   1 
ATOM   3217  C  CB  . ASP A  1  417 ? 44.294 91.102  132.054 1.00 34.72  ? 417  ASP A CB  1 
ATOM   3218  C  CG  . ASP A  1  417 ? 44.256 89.974  133.052 1.00 30.93  ? 417  ASP A CG  1 
ATOM   3219  O  OD1 . ASP A  1  417 ? 44.982 88.992  132.864 1.00 43.02  ? 417  ASP A OD1 1 
ATOM   3220  O  OD2 . ASP A  1  417 ? 43.537 89.981  134.059 1.00 34.28  ? 417  ASP A OD2 1 
ATOM   3221  N  N   . GLN A  1  418 ? 43.776 89.602  128.707 1.00 36.04  ? 418  GLN A N   1 
ATOM   3222  C  CA  . GLN A  1  418 ? 42.794 88.908  127.923 1.00 36.13  ? 418  GLN A CA  1 
ATOM   3223  C  C   . GLN A  1  418 ? 43.407 87.589  127.424 1.00 36.46  ? 418  GLN A C   1 
ATOM   3224  O  O   . GLN A  1  418 ? 44.643 87.456  127.339 1.00 36.45  ? 418  GLN A O   1 
ATOM   3225  C  CB  . GLN A  1  418 ? 42.338 89.779  126.749 1.00 35.70  ? 418  GLN A CB  1 
ATOM   3226  C  CG  . GLN A  1  418 ? 41.709 91.070  127.161 1.00 22.56  ? 418  GLN A CG  1 
ATOM   3227  C  CD  . GLN A  1  418 ? 40.221 90.933  127.404 1.00 27.89  ? 418  GLN A CD  1 
ATOM   3228  O  OE1 . GLN A  1  418 ? 39.564 91.885  127.816 1.00 31.33  ? 418  GLN A OE1 1 
ATOM   3229  N  NE2 . GLN A  1  418 ? 39.690 89.760  127.155 1.00 28.24  ? 418  GLN A NE2 1 
ATOM   3230  N  N   . CYS A  1  419 ? 42.549 86.607  127.148 1.00 36.07  ? 419  CYS A N   1 
ATOM   3231  C  CA  . CYS A  1  419 ? 42.999 85.330  126.657 1.00 35.66  ? 419  CYS A CA  1 
ATOM   3232  C  C   . CYS A  1  419 ? 43.188 85.379  125.134 1.00 35.07  ? 419  CYS A C   1 
ATOM   3233  O  O   . CYS A  1  419 ? 42.286 85.759  124.402 1.00 35.27  ? 419  CYS A O   1 
ATOM   3234  C  CB  . CYS A  1  419 ? 41.977 84.225  127.013 1.00 35.89  ? 419  CYS A CB  1 
ATOM   3235  S  SG  . CYS A  1  419 ? 41.741 83.937  128.794 1.00 40.99  ? 419  CYS A SG  1 
ATOM   3236  N  N   . PRO A  1  420 ? 44.378 85.040  124.673 1.00 34.34  ? 420  PRO A N   1 
ATOM   3237  C  CA  . PRO A  1  420 ? 44.659 84.964  123.241 1.00 33.91  ? 420  PRO A CA  1 
ATOM   3238  C  C   . PRO A  1  420 ? 44.265 83.613  122.624 1.00 34.02  ? 420  PRO A C   1 
ATOM   3239  O  O   . PRO A  1  420 ? 44.112 82.615  123.324 1.00 33.89  ? 420  PRO A O   1 
ATOM   3240  C  CB  . PRO A  1  420 ? 46.174 85.040  123.181 1.00 33.33  ? 420  PRO A CB  1 
ATOM   3241  C  CG  . PRO A  1  420 ? 46.650 85.093  124.582 1.00 22.48  ? 420  PRO A CG  1 
ATOM   3242  C  CD  . PRO A  1  420 ? 45.565 84.794  125.483 1.00 34.14  ? 420  PRO A CD  1 
ATOM   3243  N  N   . ALA A  1  421 ? 44.130 83.609  121.308 1.00 33.89  ? 421  ALA A N   1 
ATOM   3244  C  CA  . ALA A  1  421 ? 43.923 82.406  120.541 1.00 33.71  ? 421  ALA A CA  1 
ATOM   3245  C  C   . ALA A  1  421 ? 45.312 82.224  119.977 1.00 34.82  ? 421  ALA A C   1 
ATOM   3246  O  O   . ALA A  1  421 ? 45.865 83.177  119.416 1.00 35.94  ? 421  ALA A O   1 
ATOM   3247  C  CB  . ALA A  1  421 ? 42.978 82.668  119.442 1.00 32.97  ? 421  ALA A CB  1 
ATOM   3248  N  N   . VAL A  1  422 ? 45.922 81.049  120.164 1.00 34.56  ? 422  VAL A N   1 
ATOM   3249  C  CA  . VAL A  1  422 ? 47.307 80.835  119.693 1.00 34.37  ? 422  VAL A CA  1 
ATOM   3250  C  C   . VAL A  1  422 ? 47.329 79.716  118.715 1.00 34.70  ? 422  VAL A C   1 
ATOM   3251  O  O   . VAL A  1  422 ? 46.715 78.680  118.961 1.00 35.57  ? 422  VAL A O   1 
ATOM   3252  C  CB  . VAL A  1  422 ? 48.238 80.390  120.853 1.00 34.38  ? 422  VAL A CB  1 
ATOM   3253  C  CG1 . VAL A  1  422 ? 49.572 79.951  120.324 1.00 28.89  ? 422  VAL A CG1 1 
ATOM   3254  C  CG2 . VAL A  1  422 ? 48.381 81.481  121.933 1.00 25.95  ? 422  VAL A CG2 1 
ATOM   3255  N  N   . ALA A  1  423 ? 48.015 79.905  117.589 1.00 33.61  ? 423  ALA A N   1 
ATOM   3256  C  CA  . ALA A  1  423 ? 48.149 78.852  116.613 1.00 32.56  ? 423  ALA A CA  1 
ATOM   3257  C  C   . ALA A  1  423 ? 49.622 78.700  116.223 1.00 32.32  ? 423  ALA A C   1 
ATOM   3258  O  O   . ALA A  1  423 ? 50.270 79.673  115.844 1.00 31.95  ? 423  ALA A O   1 
ATOM   3259  C  CB  . ALA A  1  423 ? 47.352 79.145  115.465 1.00 32.36  ? 423  ALA A CB  1 
ATOM   3260  N  N   . GLY A  1  424 ? 50.146 77.485  116.359 1.00 32.18  ? 424  GLY A N   1 
ATOM   3261  C  CA  . GLY A  1  424 ? 51.539 77.188  116.044 1.00 32.52  ? 424  GLY A CA  1 
ATOM   3262  C  C   . GLY A  1  424 ? 51.673 75.998  115.084 1.00 33.15  ? 424  GLY A C   1 
ATOM   3263  O  O   . GLY A  1  424 ? 50.888 75.061  115.125 1.00 33.42  ? 424  GLY A O   1 
ATOM   3264  N  N   . PHE A  1  425 ? 52.682 76.035  114.236 1.00 33.24  ? 425  PHE A N   1 
ATOM   3265  C  CA  . PHE A  1  425 ? 52.895 74.989  113.229 1.00 32.90  ? 425  PHE A CA  1 
ATOM   3266  C  C   . PHE A  1  425 ? 54.430 74.928  112.970 1.00 33.63  ? 425  PHE A C   1 
ATOM   3267  O  O   . PHE A  1  425 ? 55.136 75.966  113.029 1.00 33.78  ? 425  PHE A O   1 
ATOM   3268  C  CB  . PHE A  1  425 ? 52.133 75.394  111.947 1.00 32.28  ? 425  PHE A CB  1 
ATOM   3269  C  CG  . PHE A  1  425 ? 52.136 74.352  110.856 1.00 30.36  ? 425  PHE A CG  1 
ATOM   3270  C  CD1 . PHE A  1  425 ? 52.026 74.733  109.526 1.00 28.30  ? 425  PHE A CD1 1 
ATOM   3271  C  CD2 . PHE A  1  425 ? 52.211 73.004  111.153 1.00 23.62  ? 425  PHE A CD2 1 
ATOM   3272  C  CE1 . PHE A  1  425 ? 52.002 73.805  108.523 1.00 30.47  ? 425  PHE A CE1 1 
ATOM   3273  C  CE2 . PHE A  1  425 ? 52.193 72.069  110.153 1.00 27.59  ? 425  PHE A CE2 1 
ATOM   3274  C  CZ  . PHE A  1  425 ? 52.078 72.469  108.822 1.00 17.79  ? 425  PHE A CZ  1 
ATOM   3275  N  N   . GLY A  1  426 ? 54.962 73.732  112.743 1.00 33.61  ? 426  GLY A N   1 
ATOM   3276  C  CA  . GLY A  1  426 ? 56.398 73.608  112.519 1.00 33.57  ? 426  GLY A CA  1 
ATOM   3277  C  C   . GLY A  1  426 ? 57.177 73.148  113.740 1.00 33.28  ? 426  GLY A C   1 
ATOM   3278  O  O   . GLY A  1  426 ? 56.686 72.370  114.534 1.00 34.49  ? 426  GLY A O   1 
ATOM   3279  N  N   . PRO A  1  427 ? 58.414 73.567  113.857 1.00 31.75  ? 427  PRO A N   1 
ATOM   3280  C  CA  . PRO A  1  427 ? 59.257 73.168  115.004 1.00 30.77  ? 427  PRO A CA  1 
ATOM   3281  C  C   . PRO A  1  427 ? 58.917 73.957  116.212 1.00 29.93  ? 427  PRO A C   1 
ATOM   3282  O  O   . PRO A  1  427 ? 59.683 74.905  116.557 1.00 30.61  ? 427  PRO A O   1 
ATOM   3283  C  CB  . PRO A  1  427 ? 60.671 73.544  114.545 1.00 29.59  ? 427  PRO A CB  1 
ATOM   3284  C  CG  . PRO A  1  427 ? 60.537 73.849  113.156 1.00 33.36  ? 427  PRO A CG  1 
ATOM   3285  C  CD  . PRO A  1  427 ? 59.156 74.345  112.873 1.00 31.53  ? 427  PRO A CD  1 
ATOM   3286  N  N   . ILE A  1  428 ? 57.850 73.582  116.888 1.00 28.34  ? 428  ILE A N   1 
ATOM   3287  C  CA  . ILE A  1  428 ? 57.350 74.394  118.001 1.00 28.49  ? 428  ILE A CA  1 
ATOM   3288  C  C   . ILE A  1  428 ? 57.615 73.948  119.452 1.00 30.42  ? 428  ILE A C   1 
ATOM   3289  O  O   . ILE A  1  428 ? 56.967 74.428  120.374 1.00 30.97  ? 428  ILE A O   1 
ATOM   3290  C  CB  . ILE A  1  428 ? 55.885 74.746  117.788 1.00 27.36  ? 428  ILE A CB  1 
ATOM   3291  C  CG1 . ILE A  1  428 ? 55.063 73.481  117.549 1.00 17.99  ? 428  ILE A CG1 1 
ATOM   3292  C  CG2 . ILE A  1  428 ? 55.708 75.636  116.554 1.00 22.67  ? 428  ILE A CG2 1 
ATOM   3293  C  CD1 . ILE A  1  428 ? 53.643 73.782  117.319 1.00 18.89  ? 428  ILE A CD1 1 
ATOM   3294  N  N   . GLU A  1  429 ? 58.592 73.066  119.654 1.00 31.29  ? 429  GLU A N   1 
ATOM   3295  C  CA  . GLU A  1  429 ? 58.924 72.601  120.995 1.00 31.33  ? 429  GLU A CA  1 
ATOM   3296  C  C   . GLU A  1  429 ? 59.106 73.814  121.913 1.00 31.34  ? 429  GLU A C   1 
ATOM   3297  O  O   . GLU A  1  429 ? 58.678 73.801  123.017 1.00 31.05  ? 429  GLU A O   1 
ATOM   3298  C  CB  . GLU A  1  429 ? 60.213 71.742  120.977 1.00 31.51  ? 429  GLU A CB  1 
ATOM   3299  C  CG  . GLU A  1  429 ? 60.538 71.024  122.303 1.00 31.91  ? 429  GLU A CG  1 
ATOM   3300  C  CD  . GLU A  1  429 ? 61.847 70.204  122.215 1.00 40.85  ? 429  GLU A CD  1 
ATOM   3301  O  OE1 . GLU A  1  429 ? 61.815 69.051  121.715 1.00 33.08  ? 429  GLU A OE1 1 
ATOM   3302  O  OE2 . GLU A  1  429 ? 62.924 70.730  122.631 1.00 28.77  ? 429  GLU A OE2 1 
ATOM   3303  N  N   . GLN A  1  430 ? 59.740 74.872  121.431 1.00 31.33  ? 430  GLN A N   1 
ATOM   3304  C  CA  . GLN A  1  430 ? 59.849 76.021  122.278 1.00 30.63  ? 430  GLN A CA  1 
ATOM   3305  C  C   . GLN A  1  430 ? 58.747 77.080  122.303 1.00 30.05  ? 430  GLN A C   1 
ATOM   3306  O  O   . GLN A  1  430 ? 58.896 78.113  122.920 1.00 29.99  ? 430  GLN A O   1 
ATOM   3307  C  CB  . GLN A  1  430 ? 61.269 76.499  122.557 1.00 30.52  ? 430  GLN A CB  1 
ATOM   3308  C  CG  . GLN A  1  430 ? 61.764 77.635  121.766 1.00 37.93  ? 430  GLN A CG  1 
ATOM   3309  C  CD  . GLN A  1  430 ? 62.843 78.362  122.511 1.00 28.43  ? 430  GLN A CD  1 
ATOM   3310  O  OE1 . GLN A  1  430 ? 63.748 78.882  121.937 1.00 28.52  ? 430  GLN A OE1 1 
ATOM   3311  N  NE2 . GLN A  1  430 ? 62.755 78.346  123.786 1.00 48.82  ? 430  GLN A NE2 1 
ATOM   3312  N  N   . LEU A  1  431 ? 57.604 76.772  121.708 1.00 29.77  ? 431  LEU A N   1 
ATOM   3313  C  CA  . LEU A  1  431 ? 56.474 77.674  121.812 1.00 29.63  ? 431  LEU A CA  1 
ATOM   3314  C  C   . LEU A  1  431 ? 56.097 77.594  123.278 1.00 30.05  ? 431  LEU A C   1 
ATOM   3315  O  O   . LEU A  1  431 ? 55.991 76.507  123.848 1.00 29.35  ? 431  LEU A O   1 
ATOM   3316  C  CB  . LEU A  1  431 ? 55.318 77.221  120.904 1.00 29.53  ? 431  LEU A CB  1 
ATOM   3317  C  CG  . LEU A  1  431 ? 54.068 78.118  120.866 1.00 37.80  ? 431  LEU A CG  1 
ATOM   3318  C  CD1 . LEU A  1  431 ? 54.378 79.477  120.316 1.00 38.67  ? 431  LEU A CD1 1 
ATOM   3319  C  CD2 . LEU A  1  431 ? 52.924 77.460  120.065 1.00 31.71  ? 431  LEU A CD2 1 
ATOM   3320  N  N   . PRO A  1  432 ? 56.045 78.741  123.929 1.00 30.89  ? 432  PRO A N   1 
ATOM   3321  C  CA  . PRO A  1  432 ? 55.742 78.794  125.363 1.00 30.64  ? 432  PRO A CA  1 
ATOM   3322  C  C   . PRO A  1  432 ? 54.424 78.188  125.643 1.00 31.23  ? 432  PRO A C   1 
ATOM   3323  O  O   . PRO A  1  432 ? 53.541 78.245  124.802 1.00 31.09  ? 432  PRO A O   1 
ATOM   3324  C  CB  . PRO A  1  432 ? 55.693 80.292  125.660 1.00 30.44  ? 432  PRO A CB  1 
ATOM   3325  C  CG  . PRO A  1  432 ? 56.536 80.915  124.528 1.00 24.54  ? 432  PRO A CG  1 
ATOM   3326  C  CD  . PRO A  1  432 ? 56.285 80.076  123.344 1.00 30.84  ? 432  PRO A CD  1 
ATOM   3327  N  N   . ASP A  1  433 ? 54.292 77.602  126.833 1.00 32.26  ? 433  ASP A N   1 
ATOM   3328  C  CA  . ASP A  1  433 ? 53.061 76.982  127.288 1.00 32.96  ? 433  ASP A CA  1 
ATOM   3329  C  C   . ASP A  1  433 ? 51.926 78.002  127.306 1.00 34.03  ? 433  ASP A C   1 
ATOM   3330  O  O   . ASP A  1  433 ? 52.173 79.200  127.509 1.00 34.78  ? 433  ASP A O   1 
ATOM   3331  C  CB  . ASP A  1  433 ? 53.289 76.450  128.686 1.00 32.75  ? 433  ASP A CB  1 
ATOM   3332  C  CG  . ASP A  1  433 ? 52.089 75.876  129.261 1.00 35.03  ? 433  ASP A CG  1 
ATOM   3333  O  OD1 . ASP A  1  433 ? 51.399 76.618  130.025 1.00 33.81  ? 433  ASP A OD1 1 
ATOM   3334  O  OD2 . ASP A  1  433 ? 51.700 74.696  128.979 1.00 39.39  ? 433  ASP A OD2 1 
ATOM   3335  N  N   . TYR A  1  434 ? 50.683 77.553  127.138 1.00 34.20  ? 434  TYR A N   1 
ATOM   3336  C  CA  . TYR A  1  434 ? 49.589 78.512  127.128 1.00 34.32  ? 434  TYR A CA  1 
ATOM   3337  C  C   . TYR A  1  434 ? 49.515 79.380  128.379 1.00 34.70  ? 434  TYR A C   1 
ATOM   3338  O  O   . TYR A  1  434 ? 49.324 80.591  128.271 1.00 35.09  ? 434  TYR A O   1 
ATOM   3339  C  CB  . TYR A  1  434 ? 48.235 77.897  126.817 1.00 34.03  ? 434  TYR A CB  1 
ATOM   3340  C  CG  . TYR A  1  434 ? 47.176 78.974  126.595 1.00 36.38  ? 434  TYR A CG  1 
ATOM   3341  C  CD1 . TYR A  1  434 ? 46.921 79.481  125.329 1.00 31.31  ? 434  TYR A CD1 1 
ATOM   3342  C  CD2 . TYR A  1  434 ? 46.480 79.509  127.650 1.00 31.00  ? 434  TYR A CD2 1 
ATOM   3343  C  CE1 . TYR A  1  434 ? 46.010 80.458  125.141 1.00 20.43  ? 434  TYR A CE1 1 
ATOM   3344  C  CE2 . TYR A  1  434 ? 45.592 80.487  127.459 1.00 25.31  ? 434  TYR A CE2 1 
ATOM   3345  C  CZ  . TYR A  1  434 ? 45.356 80.967  126.214 1.00 19.21  ? 434  TYR A CZ  1 
ATOM   3346  O  OH  . TYR A  1  434 ? 44.411 81.966  126.050 1.00 22.62  ? 434  TYR A OH  1 
ATOM   3347  N  N   . ASN A  1  435 ? 49.690 78.787  129.560 1.00 34.46  ? 435  ASN A N   1 
ATOM   3348  C  CA  . ASN A  1  435 ? 49.627 79.589  130.785 1.00 34.56  ? 435  ASN A CA  1 
ATOM   3349  C  C   . ASN A  1  435 ? 50.637 80.728  130.758 1.00 34.09  ? 435  ASN A C   1 
ATOM   3350  O  O   . ASN A  1  435 ? 50.335 81.837  131.158 1.00 33.90  ? 435  ASN A O   1 
ATOM   3351  C  CB  . ASN A  1  435 ? 49.813 78.731  132.044 1.00 34.88  ? 435  ASN A CB  1 
ATOM   3352  C  CG  . ASN A  1  435 ? 48.567 77.989  132.423 1.00 43.61  ? 435  ASN A CG  1 
ATOM   3353  O  OD1 . ASN A  1  435 ? 47.527 78.604  132.635 1.00 46.02  ? 435  ASN A OD1 1 
ATOM   3354  N  ND2 . ASN A  1  435 ? 48.652 76.630  132.503 1.00 34.90  ? 435  ASN A ND2 1 
ATOM   3355  N  N   . ARG A  1  436 ? 51.818 80.462  130.222 1.00 34.02  ? 436  ARG A N   1 
ATOM   3356  C  CA  . ARG A  1  436 ? 52.826 81.484  130.173 1.00 33.85  ? 436  ARG A CA  1 
ATOM   3357  C  C   . ARG A  1  436 ? 52.562 82.579  129.145 1.00 34.16  ? 436  ARG A C   1 
ATOM   3358  O  O   . ARG A  1  436 ? 52.757 83.792  129.425 1.00 34.09  ? 436  ARG A O   1 
ATOM   3359  C  CB  . ARG A  1  436 ? 54.232 80.919  130.290 1.00 33.02  ? 436  ARG A CB  1 
ATOM   3360  C  CG  . ARG A  1  436 ? 54.345 80.309  131.674 1.00 41.46  ? 436  ARG A CG  1 
ATOM   3361  C  CD  . ARG A  1  436 ? 55.615 79.772  132.061 1.00 43.36  ? 436  ARG A CD  1 
ATOM   3362  N  NE  . ARG A  1  436 ? 56.656 80.727  131.912 1.00 30.87  ? 436  ARG A NE  1 
ATOM   3363  C  CZ  . ARG A  1  436 ? 57.910 80.459  132.126 1.00 35.59  ? 436  ARG A CZ  1 
ATOM   3364  N  NH1 . ARG A  1  436 ? 58.267 79.263  132.562 1.00 39.42  ? 436  ARG A NH1 1 
ATOM   3365  N  NH2 . ARG A  1  436 ? 58.824 81.376  131.905 1.00 47.88  ? 436  ARG A NH2 1 
ATOM   3366  N  N   . ILE A  1  437 ? 51.958 82.189  128.030 1.00 34.05  ? 437  ILE A N   1 
ATOM   3367  C  CA  . ILE A  1  437 ? 51.541 83.171  127.058 1.00 34.06  ? 437  ILE A CA  1 
ATOM   3368  C  C   . ILE A  1  437 ? 50.408 84.025  127.723 1.00 34.55  ? 437  ILE A C   1 
ATOM   3369  O  O   . ILE A  1  437 ? 50.357 85.243  127.583 1.00 35.14  ? 437  ILE A O   1 
ATOM   3370  C  CB  . ILE A  1  437 ? 51.036 82.485  125.789 1.00 33.60  ? 437  ILE A CB  1 
ATOM   3371  C  CG1 . ILE A  1  437 ? 52.167 81.698  125.126 1.00 29.34  ? 437  ILE A CG1 1 
ATOM   3372  C  CG2 . ILE A  1  437 ? 50.546 83.481  124.844 1.00 32.71  ? 437  ILE A CG2 1 
ATOM   3373  C  CD1 . ILE A  1  437 ? 51.732 80.933  123.926 1.00 25.35  ? 437  ILE A CD1 1 
ATOM   3374  N  N   . ARG A  1  438 ? 49.574 83.380  128.517 1.00 34.24  ? 438  ARG A N   1 
ATOM   3375  C  CA  . ARG A  1  438 ? 48.483 84.070  129.162 1.00 33.77  ? 438  ARG A CA  1 
ATOM   3376  C  C   . ARG A  1  438 ? 49.016 85.016  130.256 1.00 33.64  ? 438  ARG A C   1 
ATOM   3377  O  O   . ARG A  1  438 ? 48.508 86.098  130.447 1.00 33.19  ? 438  ARG A O   1 
ATOM   3378  C  CB  . ARG A  1  438 ? 47.464 83.048  129.720 1.00 33.46  ? 438  ARG A CB  1 
ATOM   3379  C  CG  . ARG A  1  438 ? 46.265 83.668  130.438 1.00 28.32  ? 438  ARG A CG  1 
ATOM   3380  C  CD  . ARG A  1  438 ? 45.396 84.511  129.550 1.00 25.62  ? 438  ARG A CD  1 
ATOM   3381  N  NE  . ARG A  1  438 ? 45.039 85.763  130.214 1.00 38.94  ? 438  ARG A NE  1 
ATOM   3382  C  CZ  . ARG A  1  438 ? 43.972 85.922  130.971 1.00 39.47  ? 438  ARG A CZ  1 
ATOM   3383  N  NH1 . ARG A  1  438 ? 43.143 84.923  131.156 1.00 57.81  ? 438  ARG A NH1 1 
ATOM   3384  N  NH2 . ARG A  1  438 ? 43.721 87.071  131.531 1.00 27.35  ? 438  ARG A NH2 1 
ATOM   3385  N  N   . SER A  1  439 ? 50.099 84.621  130.904 1.00 33.95  ? 439  SER A N   1 
ATOM   3386  C  CA  . SER A  1  439 ? 50.668 85.427  131.961 1.00 34.05  ? 439  SER A CA  1 
ATOM   3387  C  C   . SER A  1  439 ? 51.484 86.605  131.377 1.00 34.87  ? 439  SER A C   1 
ATOM   3388  O  O   . SER A  1  439 ? 51.775 87.557  132.061 1.00 35.02  ? 439  SER A O   1 
ATOM   3389  C  CB  . SER A  1  439 ? 51.493 84.551  132.918 1.00 33.84  ? 439  SER A CB  1 
ATOM   3390  O  OG  . SER A  1  439 ? 51.090 84.746  134.299 1.00 36.15  ? 439  SER A OG  1 
ATOM   3391  N  N   . GLY A  1  440 ? 51.809 86.531  130.084 1.00 35.59  ? 440  GLY A N   1 
ATOM   3392  C  CA  . GLY A  1  440 ? 52.486 87.612  129.402 1.00 35.65  ? 440  GLY A CA  1 
ATOM   3393  C  C   . GLY A  1  440 ? 51.458 88.641  128.883 1.00 36.31  ? 440  GLY A C   1 
ATOM   3394  O  O   . GLY A  1  440 ? 51.833 89.680  128.295 1.00 37.01  ? 440  GLY A O   1 
ATOM   3395  N  N   . MET A  1  441 ? 50.162 88.362  129.090 1.00 35.83  ? 441  MET A N   1 
ATOM   3396  C  CA  . MET A  1  441 ? 49.106 89.281  128.648 1.00 35.71  ? 441  MET A CA  1 
ATOM   3397  C  C   . MET A  1  441 ? 48.761 90.340  129.700 1.00 35.78  ? 441  MET A C   1 
ATOM   3398  O  O   . MET A  1  441 ? 47.877 91.172  129.496 1.00 35.53  ? 441  MET A O   1 
ATOM   3399  C  CB  . MET A  1  441 ? 47.850 88.545  128.217 1.00 35.57  ? 441  MET A CB  1 
ATOM   3400  C  CG  . MET A  1  441 ? 47.992 87.708  126.985 1.00 38.70  ? 441  MET A CG  1 
ATOM   3401  S  SD  . MET A  1  441 ? 48.402 88.653  125.528 1.00 36.78  ? 441  MET A SD  1 
ATOM   3402  C  CE  . MET A  1  441 ? 47.048 89.751  125.415 1.00 25.82  ? 441  MET A CE  1 
ATOM   3403  N  N   . PHE A  1  442 ? 49.443 90.293  130.827 1.00 36.20  ? 442  PHE A N   1 
ATOM   3404  C  CA  . PHE A  1  442 ? 49.278 91.319  131.858 1.00 36.76  ? 442  PHE A CA  1 
ATOM   3405  C  C   . PHE A  1  442 ? 50.621 91.543  132.472 1.00 37.84  ? 442  PHE A C   1 
ATOM   3406  O  O   . PHE A  1  442 ? 51.545 90.701  132.344 1.00 37.02  ? 442  PHE A O   1 
ATOM   3407  C  CB  . PHE A  1  442 ? 48.302 90.884  132.964 1.00 36.10  ? 442  PHE A CB  1 
ATOM   3408  C  CG  . PHE A  1  442 ? 48.857 89.825  133.876 1.00 31.13  ? 442  PHE A CG  1 
ATOM   3409  C  CD1 . PHE A  1  442 ? 48.526 88.486  133.682 1.00 31.17  ? 442  PHE A CD1 1 
ATOM   3410  C  CD2 . PHE A  1  442 ? 49.738 90.152  134.912 1.00 16.40  ? 442  PHE A CD2 1 
ATOM   3411  C  CE1 . PHE A  1  442 ? 49.029 87.517  134.498 1.00 21.46  ? 442  PHE A CE1 1 
ATOM   3412  C  CE2 . PHE A  1  442 ? 50.251 89.190  135.704 1.00 25.16  ? 442  PHE A CE2 1 
ATOM   3413  C  CZ  . PHE A  1  442 ? 49.878 87.855  135.510 1.00 31.69  ? 442  PHE A CZ  1 
ATOM   3414  N  N   . TRP A  1  443 ? 50.751 92.660  133.153 1.00 39.63  ? 443  TRP A N   1 
ATOM   3415  C  CA  . TRP A  1  443 ? 51.955 92.906  133.889 1.00 41.21  ? 443  TRP A CA  1 
ATOM   3416  C  C   . TRP A  1  443 ? 51.975 93.248  135.342 1.00 41.32  ? 443  TRP A C   1 
ATOM   3417  O  O   . TRP A  1  443 ? 51.181 94.075  135.805 1.00 41.62  ? 443  TRP A O   1 
ATOM   3418  C  CB  . TRP A  1  443 ? 53.281 92.945  133.096 1.00 42.04  ? 443  TRP A CB  1 
ATOM   3419  C  CG  . TRP A  1  443 ? 53.586 94.187  132.487 1.00 49.25  ? 443  TRP A CG  1 
ATOM   3420  C  CD1 . TRP A  1  443 ? 53.217 95.422  132.924 1.00 63.46  ? 443  TRP A CD1 1 
ATOM   3421  C  CD2 . TRP A  1  443 ? 54.384 94.388  131.339 1.00 49.83  ? 443  TRP A CD2 1 
ATOM   3422  N  NE1 . TRP A  1  443 ? 53.731 96.400  132.096 1.00 65.90  ? 443  TRP A NE1 1 
ATOM   3423  C  CE2 . TRP A  1  443 ? 54.457 95.801  131.114 1.00 55.69  ? 443  TRP A CE2 1 
ATOM   3424  C  CE3 . TRP A  1  443 ? 55.053 93.539  130.471 1.00 39.44  ? 443  TRP A CE3 1 
ATOM   3425  C  CZ2 . TRP A  1  443 ? 55.162 96.365  130.053 1.00 57.32  ? 443  TRP A CZ2 1 
ATOM   3426  C  CZ3 . TRP A  1  443 ? 55.742 94.094  129.409 1.00 55.18  ? 443  TRP A CZ3 1 
ATOM   3427  C  CH2 . TRP A  1  443 ? 55.791 95.510  129.208 1.00 53.40  ? 443  TRP A CH2 1 
ATOM   3428  N  N   . LEU A  1  444 ? 52.836 92.561  136.084 1.00 41.22  ? 444  LEU A N   1 
ATOM   3429  C  CA  . LEU A  1  444 ? 52.951 92.766  137.522 1.00 41.24  ? 444  LEU A CA  1 
ATOM   3430  C  C   . LEU A  1  444 ? 53.550 94.157  137.939 1.00 41.90  ? 444  LEU A C   1 
ATOM   3431  O  O   . LEU A  1  444 ? 53.458 94.518  139.091 1.00 42.18  ? 444  LEU A O   1 
ATOM   3432  C  CB  . LEU A  1  444 ? 53.744 91.632  138.154 1.00 40.66  ? 444  LEU A CB  1 
ATOM   3433  C  CG  . LEU A  1  444 ? 53.235 90.195  138.129 1.00 37.29  ? 444  LEU A CG  1 
ATOM   3434  C  CD1 . LEU A  1  444 ? 54.372 89.206  138.395 1.00 31.31  ? 444  LEU A CD1 1 
ATOM   3435  C  CD2 . LEU A  1  444 ? 52.165 90.025  139.131 1.00 41.57  ? 444  LEU A CD2 1 
ATOM   3436  N  N   . ARG A  1  445 ? 54.189 94.876  136.994 1.00 42.11  ? 445  ARG A N   1 
ATOM   3437  C  CA  . ARG A  1  445 ? 54.751 96.229  137.230 1.00 42.77  ? 445  ARG A CA  1 
ATOM   3438  C  C   . ARG A  1  445 ? 53.581 97.128  137.456 1.00 43.42  ? 445  ARG A C   1 
ATOM   3439  O  O   . ARG A  1  445 ? 53.587 98.007  138.292 1.00 42.33  ? 445  ARG A O   1 
ATOM   3440  C  CB  . ARG A  1  445 ? 55.389 96.781  135.913 1.00 42.63  ? 445  ARG A CB  1 
ATOM   3441  C  CG  . ARG A  1  445 ? 56.717 96.295  135.541 1.00 45.30  ? 445  ARG A CG  1 
ATOM   3442  C  CD  . ARG A  1  445 ? 56.908 96.178  134.001 1.00 51.66  ? 445  ARG A CD  1 
ATOM   3443  N  NE  . ARG A  1  445 ? 58.198 95.597  133.675 1.00 60.00  ? 445  ARG A NE  1 
ATOM   3444  C  CZ  . ARG A  1  445 ? 58.647 95.417  132.459 1.00 70.48  ? 445  ARG A CZ  1 
ATOM   3445  N  NH1 . ARG A  1  445 ? 57.912 95.753  131.435 1.00 78.45  ? 445  ARG A NH1 1 
ATOM   3446  N  NH2 . ARG A  1  445 ? 59.850 94.900  132.259 1.00 81.26  ? 445  ARG A NH2 1 
ATOM   3447  N  N   . PHE A  1  446 ? 52.604 96.931  136.592 1.00 45.45  ? 446  PHE A N   1 
ATOM   3448  C  CA  . PHE A  1  446 ? 51.409 97.723  136.529 1.00 47.33  ? 446  PHE A CA  1 
ATOM   3449  C  C   . PHE A  1  446 ? 50.410 97.144  137.480 1.00 49.55  ? 446  PHE A C   1 
ATOM   3450  O  O   . PHE A  1  446 ? 49.323 97.703  137.762 1.00 50.04  ? 446  PHE A O   1 
ATOM   3451  C  CB  . PHE A  1  446 ? 50.870 97.646  135.104 1.00 46.85  ? 446  PHE A CB  1 
ATOM   3452  C  CG  . PHE A  1  446 ? 49.830 98.645  134.802 1.00 40.29  ? 446  PHE A CG  1 
ATOM   3453  C  CD1 . PHE A  1  446 ? 50.146 99.981  134.714 1.00 31.73  ? 446  PHE A CD1 1 
ATOM   3454  C  CD2 . PHE A  1  446 ? 48.510 98.247  134.588 1.00 42.42  ? 446  PHE A CD2 1 
ATOM   3455  C  CE1 . PHE A  1  446 ? 49.172 100.906 134.413 1.00 38.53  ? 446  PHE A CE1 1 
ATOM   3456  C  CE2 . PHE A  1  446 ? 47.527 99.176  134.301 1.00 42.12  ? 446  PHE A CE2 1 
ATOM   3457  C  CZ  . PHE A  1  446 ? 47.852 100.490 134.206 1.00 38.66  ? 446  PHE A CZ  1 
ATOM   3458  O  OXT . PHE A  1  446 ? 50.710 96.076  137.973 1.00 50.74  ? 446  PHE A OXT 1 
ATOM   3459  N  N   . VAL B  2  17  ? 31.710 114.333 89.897  1.00 63.05  ? 17   VAL B N   1 
ATOM   3460  C  CA  . VAL B  2  17  ? 32.388 115.456 89.186  1.00 63.15  ? 17   VAL B CA  1 
ATOM   3461  C  C   . VAL B  2  17  ? 33.876 115.528 89.565  1.00 63.29  ? 17   VAL B C   1 
ATOM   3462  O  O   . VAL B  2  17  ? 34.231 116.102 90.593  1.00 63.51  ? 17   VAL B O   1 
ATOM   3463  C  CB  . VAL B  2  17  ? 31.687 116.831 89.480  1.00 63.23  ? 17   VAL B CB  1 
ATOM   3464  C  CG1 . VAL B  2  17  ? 30.709 117.186 88.378  1.00 63.11  ? 17   VAL B CG1 1 
ATOM   3465  C  CG2 . VAL B  2  17  ? 30.986 116.822 90.871  1.00 62.85  ? 17   VAL B CG2 1 
ATOM   3466  N  N   . PRO B  2  18  ? 34.744 114.934 88.743  1.00 63.16  ? 18   PRO B N   1 
ATOM   3467  C  CA  . PRO B  2  18  ? 36.191 114.936 89.020  1.00 62.73  ? 18   PRO B CA  1 
ATOM   3468  C  C   . PRO B  2  18  ? 36.808 116.247 88.534  1.00 62.32  ? 18   PRO B C   1 
ATOM   3469  O  O   . PRO B  2  18  ? 36.289 116.832 87.564  1.00 62.48  ? 18   PRO B O   1 
ATOM   3470  C  CB  . PRO B  2  18  ? 36.717 113.765 88.164  1.00 62.65  ? 18   PRO B CB  1 
ATOM   3471  C  CG  . PRO B  2  18  ? 35.512 113.182 87.509  1.00 63.79  ? 18   PRO B CG  1 
ATOM   3472  C  CD  . PRO B  2  18  ? 34.427 114.219 87.499  1.00 63.26  ? 18   PRO B CD  1 
ATOM   3473  N  N   . PRO B  2  19  ? 37.900 116.699 89.159  1.00 61.61  ? 19   PRO B N   1 
ATOM   3474  C  CA  . PRO B  2  19  ? 38.539 117.949 88.733  1.00 60.65  ? 19   PRO B CA  1 
ATOM   3475  C  C   . PRO B  2  19  ? 39.160 117.750 87.351  1.00 59.33  ? 19   PRO B C   1 
ATOM   3476  O  O   . PRO B  2  19  ? 39.646 116.637 87.077  1.00 59.48  ? 19   PRO B O   1 
ATOM   3477  C  CB  . PRO B  2  19  ? 39.692 118.136 89.760  1.00 60.84  ? 19   PRO B CB  1 
ATOM   3478  C  CG  . PRO B  2  19  ? 39.455 117.133 90.839  1.00 64.53  ? 19   PRO B CG  1 
ATOM   3479  C  CD  . PRO B  2  19  ? 38.649 116.027 90.241  1.00 61.79  ? 19   PRO B CD  1 
ATOM   3480  N  N   . HIS B  2  20  ? 39.088 118.760 86.476  1.00 57.48  ? 20   HIS B N   1 
ATOM   3481  C  CA  . HIS B  2  20  ? 39.786 118.675 85.193  1.00 55.48  ? 20   HIS B CA  1 
ATOM   3482  C  C   . HIS B  2  20  ? 41.281 118.434 85.545  1.00 52.60  ? 20   HIS B C   1 
ATOM   3483  O  O   . HIS B  2  20  ? 41.793 119.015 86.517  1.00 52.36  ? 20   HIS B O   1 
ATOM   3484  C  CB  . HIS B  2  20  ? 39.581 119.958 84.334  1.00 56.26  ? 20   HIS B CB  1 
ATOM   3485  C  CG  . HIS B  2  20  ? 39.094 121.175 85.110  1.00 72.59  ? 20   HIS B CG  1 
ATOM   3486  N  ND1 . HIS B  2  20  ? 39.893 122.280 85.346  1.00 75.36  ? 20   HIS B ND1 1 
ATOM   3487  C  CD2 . HIS B  2  20  ? 37.867 121.492 85.605  1.00 72.56  ? 20   HIS B CD2 1 
ATOM   3488  C  CE1 . HIS B  2  20  ? 39.194 123.201 85.991  1.00 73.72  ? 20   HIS B CE1 1 
ATOM   3489  N  NE2 . HIS B  2  20  ? 37.964 122.748 86.162  1.00 73.22  ? 20   HIS B NE2 1 
ATOM   3490  N  N   . PRO B  2  21  ? 41.944 117.522 84.820  1.00 50.09  ? 21   PRO B N   1 
ATOM   3491  C  CA  . PRO B  2  21  ? 43.334 117.129 85.134  1.00 47.94  ? 21   PRO B CA  1 
ATOM   3492  C  C   . PRO B  2  21  ? 44.420 118.224 85.049  1.00 45.88  ? 21   PRO B C   1 
ATOM   3493  O  O   . PRO B  2  21  ? 44.211 119.364 85.454  1.00 46.27  ? 21   PRO B O   1 
ATOM   3494  C  CB  . PRO B  2  21  ? 43.619 116.005 84.125  1.00 47.69  ? 21   PRO B CB  1 
ATOM   3495  C  CG  . PRO B  2  21  ? 42.293 115.551 83.681  1.00 44.80  ? 21   PRO B CG  1 
ATOM   3496  C  CD  . PRO B  2  21  ? 41.413 116.770 83.670  1.00 49.92  ? 21   PRO B CD  1 
ATOM   3497  N  N   . GLN B  2  22  ? 45.601 117.823 84.612  1.00 43.12  ? 22   GLN B N   1 
ATOM   3498  C  CA  . GLN B  2  22  ? 46.746 118.710 84.451  1.00 40.20  ? 22   GLN B CA  1 
ATOM   3499  C  C   . GLN B  2  22  ? 47.613 117.993 83.467  1.00 37.51  ? 22   GLN B C   1 
ATOM   3500  O  O   . GLN B  2  22  ? 47.499 116.779 83.326  1.00 37.54  ? 22   GLN B O   1 
ATOM   3501  C  CB  . GLN B  2  22  ? 47.536 118.823 85.777  1.00 40.22  ? 22   GLN B CB  1 
ATOM   3502  C  CG  . GLN B  2  22  ? 47.019 119.851 86.804  1.00 43.99  ? 22   GLN B CG  1 
ATOM   3503  C  CD  . GLN B  2  22  ? 47.074 121.304 86.299  1.00 47.47  ? 22   GLN B CD  1 
ATOM   3504  O  OE1 . GLN B  2  22  ? 46.055 121.864 85.892  1.00 32.71  ? 22   GLN B OE1 1 
ATOM   3505  N  NE2 . GLN B  2  22  ? 48.263 121.918 86.363  1.00 51.69  ? 22   GLN B NE2 1 
ATOM   3506  N  N   . ASP B  2  23  ? 48.478 118.706 82.769  1.00 35.05  ? 23   ASP B N   1 
ATOM   3507  C  CA  . ASP B  2  23  ? 49.387 118.021 81.873  1.00 33.17  ? 23   ASP B CA  1 
ATOM   3508  C  C   . ASP B  2  23  ? 50.690 117.825 82.556  1.00 32.13  ? 23   ASP B C   1 
ATOM   3509  O  O   . ASP B  2  23  ? 51.011 118.523 83.510  1.00 32.07  ? 23   ASP B O   1 
ATOM   3510  C  CB  . ASP B  2  23  ? 49.619 118.772 80.615  1.00 32.97  ? 23   ASP B CB  1 
ATOM   3511  C  CG  . ASP B  2  23  ? 48.377 118.962 79.817  1.00 32.77  ? 23   ASP B CG  1 
ATOM   3512  O  OD1 . ASP B  2  23  ? 48.463 119.575 78.746  1.00 30.10  ? 23   ASP B OD1 1 
ATOM   3513  O  OD2 . ASP B  2  23  ? 47.266 118.548 80.172  1.00 39.82  ? 23   ASP B OD2 1 
ATOM   3514  N  N   . LEU B  2  24  ? 51.422 116.825 82.106  1.00 31.11  ? 24   LEU B N   1 
ATOM   3515  C  CA  . LEU B  2  24  ? 52.709 116.551 82.623  1.00 30.06  ? 24   LEU B CA  1 
ATOM   3516  C  C   . LEU B  2  24  ? 53.627 117.619 82.068  1.00 29.94  ? 24   LEU B C   1 
ATOM   3517  O  O   . LEU B  2  24  ? 53.503 117.995 80.921  1.00 29.82  ? 24   LEU B O   1 
ATOM   3518  C  CB  . LEU B  2  24  ? 53.162 115.178 82.136  1.00 29.61  ? 24   LEU B CB  1 
ATOM   3519  C  CG  . LEU B  2  24  ? 54.601 114.710 82.444  1.00 29.18  ? 24   LEU B CG  1 
ATOM   3520  C  CD1 . LEU B  2  24  ? 54.648 113.227 82.756  1.00 25.02  ? 24   LEU B CD1 1 
ATOM   3521  C  CD2 . LEU B  2  24  ? 55.551 115.036 81.297  1.00 30.33  ? 24   LEU B CD2 1 
ATOM   3522  N  N   . GLU B  2  25  ? 54.509 118.148 82.902  1.00 30.05  ? 25   GLU B N   1 
ATOM   3523  C  CA  . GLU B  2  25  ? 55.495 119.122 82.433  1.00 30.32  ? 25   GLU B CA  1 
ATOM   3524  C  C   . GLU B  2  25  ? 56.846 118.419 82.306  1.00 30.88  ? 25   GLU B C   1 
ATOM   3525  O  O   . GLU B  2  25  ? 57.258 117.678 83.215  1.00 31.43  ? 25   GLU B O   1 
ATOM   3526  C  CB  . GLU B  2  25  ? 55.579 120.330 83.355  1.00 30.00  ? 25   GLU B CB  1 
ATOM   3527  C  CG  . GLU B  2  25  ? 54.224 120.891 83.711  1.00 36.12  ? 25   GLU B CG  1 
ATOM   3528  C  CD  . GLU B  2  25  ? 54.144 122.387 83.571  1.00 38.69  ? 25   GLU B CD  1 
ATOM   3529  O  OE1 . GLU B  2  25  ? 53.131 122.963 84.034  1.00 45.99  ? 25   GLU B OE1 1 
ATOM   3530  O  OE2 . GLU B  2  25  ? 55.068 122.992 82.967  1.00 46.00  ? 25   GLU B OE2 1 
ATOM   3531  N  N   . PHE B  2  26  ? 57.521 118.644 81.173  1.00 30.63  ? 26   PHE B N   1 
ATOM   3532  C  CA  . PHE B  2  26  ? 58.773 117.988 80.870  1.00 30.32  ? 26   PHE B CA  1 
ATOM   3533  C  C   . PHE B  2  26  ? 59.852 118.999 80.470  1.00 30.25  ? 26   PHE B C   1 
ATOM   3534  O  O   . PHE B  2  26  ? 59.586 119.894 79.713  1.00 29.76  ? 26   PHE B O   1 
ATOM   3535  C  CB  . PHE B  2  26  ? 58.534 117.040 79.730  1.00 29.98  ? 26   PHE B CB  1 
ATOM   3536  C  CG  . PHE B  2  26  ? 59.641 116.092 79.493  1.00 21.16  ? 26   PHE B CG  1 
ATOM   3537  C  CD1 . PHE B  2  26  ? 59.581 114.822 80.011  1.00 16.65  ? 26   PHE B CD1 1 
ATOM   3538  C  CD2 . PHE B  2  26  ? 60.699 116.423 78.644  1.00 24.44  ? 26   PHE B CD2 1 
ATOM   3539  C  CE1 . PHE B  2  26  ? 60.605 113.873 79.766  1.00 20.78  ? 26   PHE B CE1 1 
ATOM   3540  C  CE2 . PHE B  2  26  ? 61.723 115.499 78.411  1.00 38.95  ? 26   PHE B CE2 1 
ATOM   3541  C  CZ  . PHE B  2  26  ? 61.651 114.191 78.984  1.00 19.60  ? 26   PHE B CZ  1 
ATOM   3542  N  N   . THR B  2  27  ? 61.105 118.765 80.908  1.00 30.14  ? 27   THR B N   1 
ATOM   3543  C  CA  . THR B  2  27  ? 62.218 119.711 80.643  1.00 28.95  ? 27   THR B CA  1 
ATOM   3544  C  C   . THR B  2  27  ? 63.588 119.040 80.591  1.00 28.71  ? 27   THR B C   1 
ATOM   3545  O  O   . THR B  2  27  ? 63.957 118.360 81.542  1.00 28.98  ? 27   THR B O   1 
ATOM   3546  C  CB  . THR B  2  27  ? 62.281 120.642 81.787  1.00 28.35  ? 27   THR B CB  1 
ATOM   3547  O  OG1 . THR B  2  27  ? 61.052 121.314 81.911  1.00 28.52  ? 27   THR B OG1 1 
ATOM   3548  C  CG2 . THR B  2  27  ? 63.288 121.726 81.556  1.00 23.24  ? 27   THR B CG2 1 
ATOM   3549  N  N   . ARG B  2  28  ? 64.332 119.214 79.487  1.00 28.06  ? 28   ARG B N   1 
ATOM   3550  C  CA  . ARG B  2  28  ? 65.704 118.740 79.419  1.00 28.14  ? 28   ARG B CA  1 
ATOM   3551  C  C   . ARG B  2  28  ? 66.585 119.918 79.799  1.00 30.01  ? 28   ARG B C   1 
ATOM   3552  O  O   . ARG B  2  28  ? 66.495 120.986 79.170  1.00 31.07  ? 28   ARG B O   1 
ATOM   3553  C  CB  . ARG B  2  28  ? 66.127 118.374 78.008  1.00 27.55  ? 28   ARG B CB  1 
ATOM   3554  C  CG  . ARG B  2  28  ? 65.248 117.487 77.230  1.00 39.65  ? 28   ARG B CG  1 
ATOM   3555  C  CD  . ARG B  2  28  ? 66.012 116.707 76.109  1.00 34.95  ? 28   ARG B CD  1 
ATOM   3556  N  NE  . ARG B  2  28  ? 66.641 115.506 76.664  1.00 32.98  ? 28   ARG B NE  1 
ATOM   3557  C  CZ  . ARG B  2  28  ? 67.914 115.164 76.491  1.00 40.54  ? 28   ARG B CZ  1 
ATOM   3558  N  NH1 . ARG B  2  28  ? 68.709 115.902 75.747  1.00 37.12  ? 28   ARG B NH1 1 
ATOM   3559  N  NH2 . ARG B  2  28  ? 68.384 114.040 77.037  1.00 54.34  ? 28   ARG B NH2 1 
ATOM   3560  N  N   . LEU B  2  29  ? 67.460 119.750 80.771  1.00 30.75  ? 29   LEU B N   1 
ATOM   3561  C  CA  . LEU B  2  29  ? 68.389 120.829 81.112  1.00 32.01  ? 29   LEU B CA  1 
ATOM   3562  C  C   . LEU B  2  29  ? 69.538 120.711 80.135  1.00 33.66  ? 29   LEU B C   1 
ATOM   3563  O  O   . LEU B  2  29  ? 69.685 119.671 79.486  1.00 34.13  ? 29   LEU B O   1 
ATOM   3564  C  CB  . LEU B  2  29  ? 68.894 120.661 82.520  1.00 31.82  ? 29   LEU B CB  1 
ATOM   3565  C  CG  . LEU B  2  29  ? 67.824 120.826 83.537  1.00 23.69  ? 29   LEU B CG  1 
ATOM   3566  C  CD1 . LEU B  2  29  ? 68.398 120.626 84.868  1.00 29.39  ? 29   LEU B CD1 1 
ATOM   3567  C  CD2 . LEU B  2  29  ? 67.283 122.193 83.405  1.00 11.39  ? 29   LEU B CD2 1 
ATOM   3568  N  N   . PRO B  2  30  ? 70.312 121.777 79.942  1.00 34.94  ? 30   PRO B N   1 
ATOM   3569  C  CA  . PRO B  2  30  ? 71.434 121.706 78.981  1.00 35.45  ? 30   PRO B CA  1 
ATOM   3570  C  C   . PRO B  2  30  ? 72.497 120.668 79.346  1.00 36.13  ? 30   PRO B C   1 
ATOM   3571  O  O   . PRO B  2  30  ? 73.160 120.159 78.450  1.00 37.03  ? 30   PRO B O   1 
ATOM   3572  C  CB  . PRO B  2  30  ? 71.971 123.155 78.939  1.00 35.16  ? 30   PRO B CB  1 
ATOM   3573  C  CG  . PRO B  2  30  ? 71.386 123.809 80.203  1.00 37.60  ? 30   PRO B CG  1 
ATOM   3574  C  CD  . PRO B  2  30  ? 70.050 123.176 80.387  1.00 35.12  ? 30   PRO B CD  1 
ATOM   3575  N  N   . ASN B  2  31  ? 72.578 120.274 80.620  1.00 35.67  ? 31   ASN B N   1 
ATOM   3576  C  CA  . ASN B  2  31  ? 73.540 119.244 81.040  1.00 34.46  ? 31   ASN B CA  1 
ATOM   3577  C  C   . ASN B  2  31  ? 73.032 117.834 80.807  1.00 34.13  ? 31   ASN B C   1 
ATOM   3578  O  O   . ASN B  2  31  ? 73.641 116.863 81.283  1.00 34.44  ? 31   ASN B O   1 
ATOM   3579  C  CB  . ASN B  2  31  ? 73.906 119.414 82.499  1.00 33.93  ? 31   ASN B CB  1 
ATOM   3580  C  CG  . ASN B  2  31  ? 72.731 119.202 83.411  1.00 38.54  ? 31   ASN B CG  1 
ATOM   3581  O  OD1 . ASN B  2  31  ? 71.669 118.731 82.971  1.00 37.62  ? 31   ASN B OD1 1 
ATOM   3582  N  ND2 . ASN B  2  31  ? 72.894 119.556 84.711  1.00 29.38  ? 31   ASN B ND2 1 
ATOM   3583  N  N   . GLY B  2  32  ? 71.851 117.718 80.201  1.00 33.26  ? 32   GLY B N   1 
ATOM   3584  C  CA  . GLY B  2  32  ? 71.295 116.406 79.846  1.00 32.36  ? 32   GLY B CA  1 
ATOM   3585  C  C   . GLY B  2  32  ? 70.261 115.803 80.789  1.00 31.54  ? 32   GLY B C   1 
ATOM   3586  O  O   . GLY B  2  32  ? 69.590 114.816 80.437  1.00 31.63  ? 32   GLY B O   1 
ATOM   3587  N  N   . LEU B  2  33  ? 70.144 116.380 81.986  1.00 30.03  ? 33   LEU B N   1 
ATOM   3588  C  CA  . LEU B  2  33  ? 69.207 115.915 82.976  1.00 28.30  ? 33   LEU B CA  1 
ATOM   3589  C  C   . LEU B  2  33  ? 67.831 116.181 82.502  1.00 27.76  ? 33   LEU B C   1 
ATOM   3590  O  O   . LEU B  2  33  ? 67.591 117.138 81.800  1.00 27.69  ? 33   LEU B O   1 
ATOM   3591  C  CB  . LEU B  2  33  ? 69.433 116.644 84.298  1.00 28.04  ? 33   LEU B CB  1 
ATOM   3592  C  CG  . LEU B  2  33  ? 68.583 116.219 85.493  1.00 33.84  ? 33   LEU B CG  1 
ATOM   3593  C  CD1 . LEU B  2  33  ? 69.182 115.103 86.184  1.00 29.45  ? 33   LEU B CD1 1 
ATOM   3594  C  CD2 . LEU B  2  33  ? 68.461 117.294 86.404  1.00 39.17  ? 33   LEU B CD2 1 
ATOM   3595  N  N   . VAL B  2  34  ? 66.925 115.305 82.852  1.00 27.98  ? 34   VAL B N   1 
ATOM   3596  C  CA  . VAL B  2  34  ? 65.551 115.449 82.488  1.00 28.66  ? 34   VAL B CA  1 
ATOM   3597  C  C   . VAL B  2  34  ? 64.713 115.586 83.762  1.00 30.06  ? 34   VAL B C   1 
ATOM   3598  O  O   . VAL B  2  34  ? 64.990 114.903 84.788  1.00 31.61  ? 34   VAL B O   1 
ATOM   3599  C  CB  . VAL B  2  34  ? 65.080 114.217 81.696  1.00 28.31  ? 34   VAL B CB  1 
ATOM   3600  C  CG1 . VAL B  2  34  ? 63.636 113.987 81.883  1.00 29.58  ? 34   VAL B CG1 1 
ATOM   3601  C  CG2 . VAL B  2  34  ? 65.410 114.371 80.234  1.00 30.19  ? 34   VAL B CG2 1 
ATOM   3602  N  N   . ILE B  2  35  ? 63.730 116.491 83.732  1.00 29.40  ? 35   ILE B N   1 
ATOM   3603  C  CA  . ILE B  2  35  ? 62.811 116.661 84.830  1.00 29.60  ? 35   ILE B CA  1 
ATOM   3604  C  C   . ILE B  2  35  ? 61.345 116.559 84.334  1.00 30.39  ? 35   ILE B C   1 
ATOM   3605  O  O   . ILE B  2  35  ? 60.926 117.263 83.401  1.00 30.01  ? 35   ILE B O   1 
ATOM   3606  C  CB  . ILE B  2  35  ? 63.035 117.994 85.496  1.00 30.06  ? 35   ILE B CB  1 
ATOM   3607  C  CG1 . ILE B  2  35  ? 64.495 118.157 85.908  1.00 31.72  ? 35   ILE B CG1 1 
ATOM   3608  C  CG2 . ILE B  2  35  ? 62.172 118.117 86.700  1.00 35.82  ? 35   ILE B CG2 1 
ATOM   3609  C  CD1 . ILE B  2  35  ? 64.921 119.551 85.889  1.00 35.87  ? 35   ILE B CD1 1 
ATOM   3610  N  N   . ALA B  2  36  ? 60.579 115.653 84.916  1.00 31.70  ? 36   ALA B N   1 
ATOM   3611  C  CA  . ALA B  2  36  ? 59.180 115.530 84.545  1.00 32.35  ? 36   ALA B CA  1 
ATOM   3612  C  C   . ALA B  2  36  ? 58.330 115.528 85.789  1.00 34.08  ? 36   ALA B C   1 
ATOM   3613  O  O   . ALA B  2  36  ? 58.676 114.903 86.774  1.00 35.24  ? 36   ALA B O   1 
ATOM   3614  C  CB  . ALA B  2  36  ? 58.965 114.321 83.768  1.00 31.98  ? 36   ALA B CB  1 
ATOM   3615  N  N   . SER B  2  37  ? 57.238 116.269 85.771  1.00 34.56  ? 37   SER B N   1 
ATOM   3616  C  CA  . SER B  2  37  ? 56.347 116.325 86.952  1.00 33.98  ? 37   SER B CA  1 
ATOM   3617  C  C   . SER B  2  37  ? 54.857 116.435 86.547  1.00 33.72  ? 37   SER B C   1 
ATOM   3618  O  O   . SER B  2  37  ? 54.527 116.974 85.472  1.00 33.57  ? 37   SER B O   1 
ATOM   3619  C  CB  . SER B  2  37  ? 56.711 117.501 87.802  1.00 33.42  ? 37   SER B CB  1 
ATOM   3620  O  OG  . SER B  2  37  ? 56.377 118.698 87.139  1.00 31.20  ? 37   SER B OG  1 
ATOM   3621  N  N   . LEU B  2  38  ? 53.979 115.876 87.372  1.00 33.38  ? 38   LEU B N   1 
ATOM   3622  C  CA  . LEU B  2  38  ? 52.528 115.944 87.132  1.00 33.24  ? 38   LEU B CA  1 
ATOM   3623  C  C   . LEU B  2  38  ? 51.916 116.356 88.444  1.00 34.64  ? 38   LEU B C   1 
ATOM   3624  O  O   . LEU B  2  38  ? 52.297 115.851 89.503  1.00 33.93  ? 38   LEU B O   1 
ATOM   3625  C  CB  . LEU B  2  38  ? 51.966 114.579 86.752  1.00 32.39  ? 38   LEU B CB  1 
ATOM   3626  C  CG  . LEU B  2  38  ? 50.681 114.390 85.899  1.00 27.91  ? 38   LEU B CG  1 
ATOM   3627  C  CD1 . LEU B  2  38  ? 50.067 112.991 86.105  1.00 27.20  ? 38   LEU B CD1 1 
ATOM   3628  C  CD2 . LEU B  2  38  ? 49.624 115.415 86.050  1.00 8.15   ? 38   LEU B CD2 1 
ATOM   3629  N  N   . GLU B  2  39  ? 51.016 117.320 88.390  1.00 36.46  ? 39   GLU B N   1 
ATOM   3630  C  CA  . GLU B  2  39  ? 50.321 117.728 89.560  1.00 37.97  ? 39   GLU B CA  1 
ATOM   3631  C  C   . GLU B  2  39  ? 48.925 117.085 89.560  1.00 39.64  ? 39   GLU B C   1 
ATOM   3632  O  O   . GLU B  2  39  ? 47.990 117.572 88.915  1.00 39.96  ? 39   GLU B O   1 
ATOM   3633  C  CB  . GLU B  2  39  ? 50.254 119.264 89.665  1.00 38.09  ? 39   GLU B CB  1 
ATOM   3634  C  CG  . GLU B  2  39  ? 49.484 119.821 90.878  1.00 42.29  ? 39   GLU B CG  1 
ATOM   3635  C  CD  . GLU B  2  39  ? 49.638 118.970 92.167  1.00 50.20  ? 39   GLU B CD  1 
ATOM   3636  O  OE1 . GLU B  2  39  ? 50.754 118.876 92.750  1.00 47.62  ? 39   GLU B OE1 1 
ATOM   3637  O  OE2 . GLU B  2  39  ? 48.631 118.403 92.605  1.00 46.72  ? 39   GLU B OE2 1 
ATOM   3638  N  N   . ASN B  2  40  ? 48.846 115.904 90.154  1.00 40.81  ? 40   ASN B N   1 
ATOM   3639  C  CA  . ASN B  2  40  ? 47.571 115.248 90.386  1.00 41.65  ? 40   ASN B CA  1 
ATOM   3640  C  C   . ASN B  2  40  ? 47.262 115.741 91.766  1.00 42.65  ? 40   ASN B C   1 
ATOM   3641  O  O   . ASN B  2  40  ? 48.138 115.775 92.596  1.00 43.54  ? 40   ASN B O   1 
ATOM   3642  C  CB  . ASN B  2  40  ? 47.681 113.690 90.336  1.00 41.21  ? 40   ASN B CB  1 
ATOM   3643  C  CG  . ASN B  2  40  ? 48.775 113.087 91.311  1.00 43.74  ? 40   ASN B CG  1 
ATOM   3644  O  OD1 . ASN B  2  40  ? 49.036 111.888 91.266  1.00 53.20  ? 40   ASN B OD1 1 
ATOM   3645  N  ND2 . ASN B  2  40  ? 49.380 113.912 92.165  1.00 34.77  ? 40   ASN B ND2 1 
ATOM   3646  N  N   . TYR B  2  41  ? 46.072 116.184 92.030  1.00 42.65  ? 41   TYR B N   1 
ATOM   3647  C  CA  . TYR B  2  41  ? 45.836 116.712 93.350  1.00 43.08  ? 41   TYR B CA  1 
ATOM   3648  C  C   . TYR B  2  41  ? 45.689 115.614 94.480  1.00 42.88  ? 41   TYR B C   1 
ATOM   3649  O  O   . TYR B  2  41  ? 44.711 115.584 95.266  1.00 43.39  ? 41   TYR B O   1 
ATOM   3650  C  CB  . TYR B  2  41  ? 44.757 117.773 93.302  1.00 43.54  ? 41   TYR B CB  1 
ATOM   3651  C  CG  . TYR B  2  41  ? 45.176 118.982 92.424  1.00 52.04  ? 41   TYR B CG  1 
ATOM   3652  C  CD1 . TYR B  2  41  ? 45.919 120.039 92.968  1.00 54.56  ? 41   TYR B CD1 1 
ATOM   3653  C  CD2 . TYR B  2  41  ? 44.852 119.041 91.059  1.00 53.22  ? 41   TYR B CD2 1 
ATOM   3654  C  CE1 . TYR B  2  41  ? 46.312 121.130 92.192  1.00 53.43  ? 41   TYR B CE1 1 
ATOM   3655  C  CE2 . TYR B  2  41  ? 45.242 120.132 90.274  1.00 55.88  ? 41   TYR B CE2 1 
ATOM   3656  C  CZ  . TYR B  2  41  ? 45.975 121.174 90.857  1.00 58.28  ? 41   TYR B CZ  1 
ATOM   3657  O  OH  . TYR B  2  41  ? 46.368 122.260 90.106  1.00 60.38  ? 41   TYR B OH  1 
ATOM   3658  N  N   . ALA B  2  42  ? 46.725 114.769 94.559  1.00 41.58  ? 42   ALA B N   1 
ATOM   3659  C  CA  . ALA B  2  42  ? 46.777 113.619 95.444  1.00 40.52  ? 42   ALA B CA  1 
ATOM   3660  C  C   . ALA B  2  42  ? 47.261 113.928 96.824  1.00 39.73  ? 42   ALA B C   1 
ATOM   3661  O  O   . ALA B  2  42  ? 48.071 114.800 97.013  1.00 40.23  ? 42   ALA B O   1 
ATOM   3662  C  CB  . ALA B  2  42  ? 47.674 112.510 94.815  1.00 40.18  ? 42   ALA B CB  1 
ATOM   3663  N  N   . PRO B  2  43  ? 46.727 113.212 97.798  1.00 38.55  ? 43   PRO B N   1 
ATOM   3664  C  CA  . PRO B  2  43  ? 47.174 113.327 99.184  1.00 37.50  ? 43   PRO B CA  1 
ATOM   3665  C  C   . PRO B  2  43  ? 48.626 112.930 99.384  1.00 36.68  ? 43   PRO B C   1 
ATOM   3666  O  O   . PRO B  2  43  ? 49.265 113.428 100.266 1.00 36.41  ? 43   PRO B O   1 
ATOM   3667  C  CB  . PRO B  2  43  ? 46.266 112.352 99.907  1.00 37.39  ? 43   PRO B CB  1 
ATOM   3668  C  CG  . PRO B  2  43  ? 45.051 112.283 99.048  1.00 40.00  ? 43   PRO B CG  1 
ATOM   3669  C  CD  . PRO B  2  43  ? 45.535 112.351 97.671  1.00 38.35  ? 43   PRO B CD  1 
ATOM   3670  N  N   . ALA B  2  44  ? 49.132 112.035 98.570  1.00 37.02  ? 44   ALA B N   1 
ATOM   3671  C  CA  . ALA B  2  44  ? 50.519 111.629 98.705  1.00 37.04  ? 44   ALA B CA  1 
ATOM   3672  C  C   . ALA B  2  44  ? 51.373 112.139 97.546  1.00 36.87  ? 44   ALA B C   1 
ATOM   3673  O  O   . ALA B  2  44  ? 50.852 112.614 96.535  1.00 36.97  ? 44   ALA B O   1 
ATOM   3674  C  CB  . ALA B  2  44  ? 50.626 110.144 98.815  1.00 36.82  ? 44   ALA B CB  1 
ATOM   3675  N  N   . SER B  2  45  ? 52.688 112.055 97.721  1.00 36.28  ? 45   SER B N   1 
ATOM   3676  C  CA  . SER B  2  45  ? 53.624 112.445 96.696  1.00 35.88  ? 45   SER B CA  1 
ATOM   3677  C  C   . SER B  2  45  ? 54.613 111.320 96.383  1.00 35.55  ? 45   SER B C   1 
ATOM   3678  O  O   . SER B  2  45  ? 54.926 110.476 97.227  1.00 34.72  ? 45   SER B O   1 
ATOM   3679  C  CB  . SER B  2  45  ? 54.385 113.705 97.089  1.00 35.91  ? 45   SER B CB  1 
ATOM   3680  O  OG  . SER B  2  45  ? 53.560 114.850 97.042  1.00 38.90  ? 45   SER B OG  1 
ATOM   3681  N  N   . ARG B  2  46  ? 55.118 111.340 95.166  1.00 36.19  ? 46   ARG B N   1 
ATOM   3682  C  CA  . ARG B  2  46  ? 56.066 110.340 94.711  1.00 36.67  ? 46   ARG B CA  1 
ATOM   3683  C  C   . ARG B  2  46  ? 57.162 110.985 93.933  1.00 35.97  ? 46   ARG B C   1 
ATOM   3684  O  O   . ARG B  2  46  ? 56.902 111.626 92.957  1.00 36.53  ? 46   ARG B O   1 
ATOM   3685  C  CB  . ARG B  2  46  ? 55.373 109.357 93.803  1.00 36.99  ? 46   ARG B CB  1 
ATOM   3686  C  CG  . ARG B  2  46  ? 55.228 108.010 94.327  1.00 46.93  ? 46   ARG B CG  1 
ATOM   3687  C  CD  . ARG B  2  46  ? 54.672 107.060 93.292  1.00 55.44  ? 46   ARG B CD  1 
ATOM   3688  N  NE  . ARG B  2  46  ? 54.711 105.655 93.696  1.00 71.08  ? 46   ARG B NE  1 
ATOM   3689  C  CZ  . ARG B  2  46  ? 53.856 105.082 94.544  1.00 71.95  ? 46   ARG B CZ  1 
ATOM   3690  N  NH1 . ARG B  2  46  ? 52.896 105.790 95.133  1.00 60.52  ? 46   ARG B NH1 1 
ATOM   3691  N  NH2 . ARG B  2  46  ? 53.971 103.790 94.807  1.00 82.26  ? 46   ARG B NH2 1 
ATOM   3692  N  N   . ILE B  2  47  ? 58.396 110.818 94.375  1.00 35.19  ? 47   ILE B N   1 
ATOM   3693  C  CA  . ILE B  2  47  ? 59.536 111.356 93.650  1.00 35.25  ? 47   ILE B CA  1 
ATOM   3694  C  C   . ILE B  2  47  ? 60.508 110.227 93.335  1.00 35.16  ? 47   ILE B C   1 
ATOM   3695  O  O   . ILE B  2  47  ? 60.898 109.434 94.239  1.00 35.40  ? 47   ILE B O   1 
ATOM   3696  C  CB  . ILE B  2  47  ? 60.295 112.386 94.464  1.00 35.76  ? 47   ILE B CB  1 
ATOM   3697  C  CG1 . ILE B  2  47  ? 59.364 113.358 95.205  1.00 43.40  ? 47   ILE B CG1 1 
ATOM   3698  C  CG2 . ILE B  2  47  ? 61.283 113.104 93.596  1.00 39.24  ? 47   ILE B CG2 1 
ATOM   3699  C  CD1 . ILE B  2  47  ? 58.657 114.212 94.344  1.00 46.53  ? 47   ILE B CD1 1 
ATOM   3700  N  N   . GLY B  2  48  ? 60.914 110.126 92.080  1.00 34.12  ? 48   GLY B N   1 
ATOM   3701  C  CA  . GLY B  2  48  ? 61.878 109.127 91.733  1.00 33.15  ? 48   GLY B CA  1 
ATOM   3702  C  C   . GLY B  2  48  ? 63.041 109.709 90.984  1.00 32.49  ? 48   GLY B C   1 
ATOM   3703  O  O   . GLY B  2  48  ? 62.860 110.561 90.166  1.00 32.74  ? 48   GLY B O   1 
ATOM   3704  N  N   . LEU B  2  49  ? 64.248 109.293 91.334  1.00 31.82  ? 49   LEU B N   1 
ATOM   3705  C  CA  . LEU B  2  49  ? 65.443 109.675 90.577  1.00 30.78  ? 49   LEU B CA  1 
ATOM   3706  C  C   . LEU B  2  49  ? 65.871 108.423 89.772  1.00 31.15  ? 49   LEU B C   1 
ATOM   3707  O  O   . LEU B  2  49  ? 66.301 107.419 90.347  1.00 32.72  ? 49   LEU B O   1 
ATOM   3708  C  CB  . LEU B  2  49  ? 66.557 110.081 91.498  1.00 29.94  ? 49   LEU B CB  1 
ATOM   3709  C  CG  . LEU B  2  49  ? 67.781 110.558 90.778  1.00 28.76  ? 49   LEU B CG  1 
ATOM   3710  C  CD1 . LEU B  2  49  ? 67.441 111.747 89.859  1.00 26.89  ? 49   LEU B CD1 1 
ATOM   3711  C  CD2 . LEU B  2  49  ? 68.784 110.976 91.791  1.00 36.02  ? 49   LEU B CD2 1 
ATOM   3712  N  N   . PHE B  2  50  ? 65.677 108.463 88.466  1.00 29.35  ? 50   PHE B N   1 
ATOM   3713  C  CA  . PHE B  2  50  ? 65.998 107.378 87.610  1.00 27.66  ? 50   PHE B CA  1 
ATOM   3714  C  C   . PHE B  2  50  ? 67.373 107.567 87.047  1.00 29.26  ? 50   PHE B C   1 
ATOM   3715  O  O   . PHE B  2  50  ? 67.728 108.647 86.568  1.00 30.29  ? 50   PHE B O   1 
ATOM   3716  C  CB  . PHE B  2  50  ? 64.993 107.314 86.525  1.00 26.61  ? 50   PHE B CB  1 
ATOM   3717  C  CG  . PHE B  2  50  ? 63.652 106.898 86.989  1.00 33.17  ? 50   PHE B CG  1 
ATOM   3718  C  CD1 . PHE B  2  50  ? 62.832 107.778 87.686  1.00 31.01  ? 50   PHE B CD1 1 
ATOM   3719  C  CD2 . PHE B  2  50  ? 63.209 105.602 86.781  1.00 31.38  ? 50   PHE B CD2 1 
ATOM   3720  C  CE1 . PHE B  2  50  ? 61.597 107.382 88.129  1.00 26.64  ? 50   PHE B CE1 1 
ATOM   3721  C  CE2 . PHE B  2  50  ? 61.990 105.200 87.244  1.00 24.38  ? 50   PHE B CE2 1 
ATOM   3722  C  CZ  . PHE B  2  50  ? 61.174 106.089 87.902  1.00 30.43  ? 50   PHE B CZ  1 
ATOM   3723  N  N   . ILE B  2  51  ? 68.190 106.546 87.138  1.00 30.29  ? 51   ILE B N   1 
ATOM   3724  C  CA  . ILE B  2  51  ? 69.572 106.662 86.687  1.00 31.60  ? 51   ILE B CA  1 
ATOM   3725  C  C   . ILE B  2  51  ? 69.954 105.515 85.825  1.00 32.25  ? 51   ILE B C   1 
ATOM   3726  O  O   . ILE B  2  51  ? 69.607 104.349 86.136  1.00 33.35  ? 51   ILE B O   1 
ATOM   3727  C  CB  . ILE B  2  51  ? 70.507 106.614 87.898  1.00 32.04  ? 51   ILE B CB  1 
ATOM   3728  C  CG1 . ILE B  2  51  ? 70.008 107.531 89.013  1.00 39.31  ? 51   ILE B CG1 1 
ATOM   3729  C  CG2 . ILE B  2  51  ? 71.951 106.909 87.481  1.00 32.92  ? 51   ILE B CG2 1 
ATOM   3730  C  CD1 . ILE B  2  51  ? 70.596 107.247 90.334  1.00 23.09  ? 51   ILE B CD1 1 
ATOM   3731  N  N   . LYS B  2  52  ? 70.714 105.804 84.770  1.00 31.03  ? 52   LYS B N   1 
ATOM   3732  C  CA  . LYS B  2  52  ? 71.234 104.772 83.900  1.00 29.95  ? 52   LYS B CA  1 
ATOM   3733  C  C   . LYS B  2  52  ? 72.434 104.163 84.593  1.00 30.20  ? 52   LYS B C   1 
ATOM   3734  O  O   . LYS B  2  52  ? 73.562 104.476 84.236  1.00 30.18  ? 52   LYS B O   1 
ATOM   3735  C  CB  . LYS B  2  52  ? 71.729 105.371 82.618  1.00 29.41  ? 52   LYS B CB  1 
ATOM   3736  C  CG  . LYS B  2  52  ? 70.699 106.006 81.763  1.00 14.51  ? 52   LYS B CG  1 
ATOM   3737  C  CD  . LYS B  2  52  ? 71.257 106.125 80.340  1.00 24.81  ? 52   LYS B CD  1 
ATOM   3738  C  CE  . LYS B  2  52  ? 70.240 106.615 79.355  1.00 36.74  ? 52   LYS B CE  1 
ATOM   3739  N  NZ  . LYS B  2  52  ? 70.925 107.135 78.097  1.00 49.93  ? 52   LYS B NZ  1 
ATOM   3740  N  N   . ALA B  2  53  ? 72.187 103.223 85.518  1.00 30.32  ? 53   ALA B N   1 
ATOM   3741  C  CA  . ALA B  2  53  ? 73.239 102.639 86.323  1.00 29.89  ? 53   ALA B CA  1 
ATOM   3742  C  C   . ALA B  2  53  ? 73.040 101.154 86.608  1.00 29.62  ? 53   ALA B C   1 
ATOM   3743  O  O   . ALA B  2  53  ? 73.711 100.597 87.461  1.00 28.86  ? 53   ALA B O   1 
ATOM   3744  C  CB  . ALA B  2  53  ? 73.340 103.378 87.606  1.00 29.78  ? 53   ALA B CB  1 
ATOM   3745  N  N   . GLY B  2  54  ? 72.107 100.531 85.896  1.00 29.60  ? 54   GLY B N   1 
ATOM   3746  C  CA  . GLY B  2  54  ? 71.841 99.108  86.030  1.00 29.09  ? 54   GLY B CA  1 
ATOM   3747  C  C   . GLY B  2  54  ? 73.082 98.235  85.850  1.00 29.49  ? 54   GLY B C   1 
ATOM   3748  O  O   . GLY B  2  54  ? 74.168 98.725  85.508  1.00 29.63  ? 54   GLY B O   1 
ATOM   3749  N  N   . SER B  2  55  ? 72.908 96.929  86.053  1.00 29.57  ? 55   SER B N   1 
ATOM   3750  C  CA  . SER B  2  55  ? 73.999 95.960  86.019  1.00 28.91  ? 55   SER B CA  1 
ATOM   3751  C  C   . SER B  2  55  ? 74.786 95.890  84.739  1.00 29.71  ? 55   SER B C   1 
ATOM   3752  O  O   . SER B  2  55  ? 75.919 95.484  84.745  1.00 29.92  ? 55   SER B O   1 
ATOM   3753  C  CB  . SER B  2  55  ? 73.476 94.599  86.384  1.00 28.37  ? 55   SER B CB  1 
ATOM   3754  O  OG  . SER B  2  55  ? 72.282 94.357  85.716  1.00 39.83  ? 55   SER B OG  1 
ATOM   3755  N  N   . ARG B  2  56  ? 74.200 96.314  83.629  1.00 30.44  ? 56   ARG B N   1 
ATOM   3756  C  CA  . ARG B  2  56  ? 74.932 96.302  82.352  1.00 30.30  ? 56   ARG B CA  1 
ATOM   3757  C  C   . ARG B  2  56  ? 76.156 97.201  82.350  1.00 30.99  ? 56   ARG B C   1 
ATOM   3758  O  O   . ARG B  2  56  ? 77.033 97.070  81.494  1.00 31.98  ? 56   ARG B O   1 
ATOM   3759  C  CB  . ARG B  2  56  ? 74.035 96.674  81.209  1.00 29.68  ? 56   ARG B CB  1 
ATOM   3760  C  CG  . ARG B  2  56  ? 73.892 98.141  81.000  1.00 25.13  ? 56   ARG B CG  1 
ATOM   3761  C  CD  . ARG B  2  56  ? 73.177 98.461  79.724  1.00 26.46  ? 56   ARG B CD  1 
ATOM   3762  N  NE  . ARG B  2  56  ? 74.063 98.287  78.567  1.00 25.00  ? 56   ARG B NE  1 
ATOM   3763  C  CZ  . ARG B  2  56  ? 73.629 98.059  77.360  1.00 26.40  ? 56   ARG B CZ  1 
ATOM   3764  N  NH1 . ARG B  2  56  ? 72.333 97.965  77.158  1.00 36.39  ? 56   ARG B NH1 1 
ATOM   3765  N  NH2 . ARG B  2  56  ? 74.476 97.936  76.335  1.00 25.80  ? 56   ARG B NH2 1 
ATOM   3766  N  N   . TYR B  2  57  ? 76.240 98.114  83.315  1.00 29.98  ? 57   TYR B N   1 
ATOM   3767  C  CA  . TYR B  2  57  ? 77.390 98.982  83.394  1.00 28.41  ? 57   TYR B CA  1 
ATOM   3768  C  C   . TYR B  2  57  ? 78.509 98.370  84.247  1.00 27.18  ? 57   TYR B C   1 
ATOM   3769  O  O   . TYR B  2  57  ? 79.585 98.951  84.395  1.00 27.64  ? 57   TYR B O   1 
ATOM   3770  C  CB  . TYR B  2  57  ? 76.958 100.365 83.868  1.00 28.48  ? 57   TYR B CB  1 
ATOM   3771  C  CG  . TYR B  2  57  ? 75.991 100.972 82.890  1.00 32.65  ? 57   TYR B CG  1 
ATOM   3772  C  CD1 . TYR B  2  57  ? 74.617 101.104 83.192  1.00 30.40  ? 57   TYR B CD1 1 
ATOM   3773  C  CD2 . TYR B  2  57  ? 76.411 101.296 81.625  1.00 21.21  ? 57   TYR B CD2 1 
ATOM   3774  C  CE1 . TYR B  2  57  ? 73.742 101.590 82.254  1.00 32.64  ? 57   TYR B CE1 1 
ATOM   3775  C  CE2 . TYR B  2  57  ? 75.533 101.787 80.676  1.00 22.64  ? 57   TYR B CE2 1 
ATOM   3776  C  CZ  . TYR B  2  57  ? 74.223 101.944 80.984  1.00 28.82  ? 57   TYR B CZ  1 
ATOM   3777  O  OH  . TYR B  2  57  ? 73.390 102.444 80.008  1.00 38.32  ? 57   TYR B OH  1 
ATOM   3778  N  N   . GLU B  2  58  ? 78.273 97.193  84.795  1.00 26.48  ? 58   GLU B N   1 
ATOM   3779  C  CA  . GLU B  2  58  ? 79.313 96.532  85.571  1.00 27.33  ? 58   GLU B CA  1 
ATOM   3780  C  C   . GLU B  2  58  ? 80.238 95.853  84.637  1.00 28.43  ? 58   GLU B C   1 
ATOM   3781  O  O   . GLU B  2  58  ? 79.939 95.706  83.477  1.00 29.45  ? 58   GLU B O   1 
ATOM   3782  C  CB  . GLU B  2  58  ? 78.732 95.495  86.476  1.00 27.59  ? 58   GLU B CB  1 
ATOM   3783  C  CG  . GLU B  2  58  ? 77.719 96.007  87.494  1.00 38.10  ? 58   GLU B CG  1 
ATOM   3784  C  CD  . GLU B  2  58  ? 77.237 94.898  88.405  1.00 38.21  ? 58   GLU B CD  1 
ATOM   3785  O  OE1 . GLU B  2  58  ? 76.510 95.196  89.395  1.00 30.81  ? 58   GLU B OE1 1 
ATOM   3786  O  OE2 . GLU B  2  58  ? 77.606 93.725  88.142  1.00 30.32  ? 58   GLU B OE2 1 
ATOM   3787  N  N   . ASN B  2  59  ? 81.402 95.488  85.094  1.00 28.63  ? 59   ASN B N   1 
ATOM   3788  C  CA  . ASN B  2  59  ? 82.276 94.687  84.227  1.00 28.47  ? 59   ASN B CA  1 
ATOM   3789  C  C   . ASN B  2  59  ? 82.885 93.519  85.021  1.00 27.61  ? 59   ASN B C   1 
ATOM   3790  O  O   . ASN B  2  59  ? 82.597 93.351  86.219  1.00 26.46  ? 59   ASN B O   1 
ATOM   3791  C  CB  . ASN B  2  59  ? 83.356 95.538  83.590  1.00 28.65  ? 59   ASN B CB  1 
ATOM   3792  C  CG  . ASN B  2  59  ? 84.365 96.011  84.586  1.00 38.33  ? 59   ASN B CG  1 
ATOM   3793  O  OD1 . ASN B  2  59  ? 84.947 95.223  85.325  1.00 44.35  ? 59   ASN B OD1 1 
ATOM   3794  N  ND2 . ASN B  2  59  ? 84.579 97.289  84.623  1.00 35.78  ? 59   ASN B ND2 1 
ATOM   3795  N  N   . SER B  2  60  ? 83.771 92.760  84.371  1.00 28.04  ? 60   SER B N   1 
ATOM   3796  C  CA  . SER B  2  60  ? 84.446 91.581  85.010  1.00 28.19  ? 60   SER B CA  1 
ATOM   3797  C  C   . SER B  2  60  ? 85.112 91.861  86.358  1.00 28.66  ? 60   SER B C   1 
ATOM   3798  O  O   . SER B  2  60  ? 85.138 91.023  87.198  1.00 29.35  ? 60   SER B O   1 
ATOM   3799  C  CB  . SER B  2  60  ? 85.460 91.014  84.094  1.00 27.45  ? 60   SER B CB  1 
ATOM   3800  O  OG  . SER B  2  60  ? 84.992 91.111  82.807  1.00 53.30  ? 60   SER B OG  1 
ATOM   3801  N  N   . ASN B  2  61  ? 85.639 93.046  86.547  1.00 28.61  ? 61   ASN B N   1 
ATOM   3802  C  CA  . ASN B  2  61  ? 86.272 93.344  87.784  1.00 28.54  ? 61   ASN B CA  1 
ATOM   3803  C  C   . ASN B  2  61  ? 85.404 93.829  88.858  1.00 29.71  ? 61   ASN B C   1 
ATOM   3804  O  O   . ASN B  2  61  ? 85.826 93.863  89.960  1.00 31.50  ? 61   ASN B O   1 
ATOM   3805  C  CB  . ASN B  2  61  ? 87.359 94.283  87.583  1.00 27.96  ? 61   ASN B CB  1 
ATOM   3806  C  CG  . ASN B  2  61  ? 88.309 93.802  86.583  1.00 34.13  ? 61   ASN B CG  1 
ATOM   3807  O  OD1 . ASN B  2  61  ? 88.589 92.595  86.487  1.00 39.42  ? 61   ASN B OD1 1 
ATOM   3808  N  ND2 . ASN B  2  61  ? 88.795 94.687  85.801  1.00 25.96  ? 61   ASN B ND2 1 
ATOM   3809  N  N   . ASN B  2  62  ? 84.164 94.167  88.583  1.00 28.99  ? 62   ASN B N   1 
ATOM   3810  C  CA  . ASN B  2  62  ? 83.350 94.647  89.649  1.00 28.72  ? 62   ASN B CA  1 
ATOM   3811  C  C   . ASN B  2  62  ? 81.954 94.138  89.721  1.00 30.69  ? 62   ASN B C   1 
ATOM   3812  O  O   . ASN B  2  62  ? 81.079 94.835  90.208  1.00 33.13  ? 62   ASN B O   1 
ATOM   3813  C  CB  . ASN B  2  62  ? 83.359 96.156  89.698  1.00 27.70  ? 62   ASN B CB  1 
ATOM   3814  C  CG  . ASN B  2  62  ? 82.502 96.812  88.572  1.00 26.77  ? 62   ASN B CG  1 
ATOM   3815  O  OD1 . ASN B  2  62  ? 82.151 96.182  87.552  1.00 33.63  ? 62   ASN B OD1 1 
ATOM   3816  N  ND2 . ASN B  2  62  ? 82.211 98.069  88.744  1.00 29.14  ? 62   ASN B ND2 1 
ATOM   3817  N  N   . LEU B  2  63  ? 81.723 92.912  89.318  1.00 30.33  ? 63   LEU B N   1 
ATOM   3818  C  CA  . LEU B  2  63  ? 80.356 92.397  89.298  1.00 29.79  ? 63   LEU B CA  1 
ATOM   3819  C  C   . LEU B  2  63  ? 79.696 92.443  90.663  1.00 29.50  ? 63   LEU B C   1 
ATOM   3820  O  O   . LEU B  2  63  ? 80.339 92.191  91.697  1.00 29.39  ? 63   LEU B O   1 
ATOM   3821  C  CB  . LEU B  2  63  ? 80.334 90.955  88.779  1.00 29.55  ? 63   LEU B CB  1 
ATOM   3822  C  CG  . LEU B  2  63  ? 80.967 90.707  87.423  1.00 32.81  ? 63   LEU B CG  1 
ATOM   3823  C  CD1 . LEU B  2  63  ? 81.081 89.241  87.235  1.00 36.24  ? 63   LEU B CD1 1 
ATOM   3824  C  CD2 . LEU B  2  63  ? 80.114 91.351  86.251  1.00 20.87  ? 63   LEU B CD2 1 
ATOM   3825  N  N   . GLY B  2  64  ? 78.422 92.766  90.679  1.00 28.88  ? 64   GLY B N   1 
ATOM   3826  C  CA  . GLY B  2  64  ? 77.701 92.799  91.923  1.00 28.43  ? 64   GLY B CA  1 
ATOM   3827  C  C   . GLY B  2  64  ? 77.751 94.166  92.612  1.00 27.70  ? 64   GLY B C   1 
ATOM   3828  O  O   . GLY B  2  64  ? 77.079 94.374  93.599  1.00 25.78  ? 64   GLY B O   1 
ATOM   3829  N  N   . THR B  2  65  ? 78.585 95.081  92.103  1.00 28.63  ? 65   THR B N   1 
ATOM   3830  C  CA  . THR B  2  65  ? 78.656 96.390  92.703  1.00 29.79  ? 65   THR B CA  1 
ATOM   3831  C  C   . THR B  2  65  ? 77.281 97.076  92.684  1.00 31.09  ? 65   THR B C   1 
ATOM   3832  O  O   . THR B  2  65  ? 76.874 97.646  93.671  1.00 32.85  ? 65   THR B O   1 
ATOM   3833  C  CB  . THR B  2  65  ? 79.689 97.273  92.041  1.00 29.96  ? 65   THR B CB  1 
ATOM   3834  O  OG1 . THR B  2  65  ? 80.981 96.612  91.980  1.00 29.48  ? 65   THR B OG1 1 
ATOM   3835  C  CG2 . THR B  2  65  ? 79.943 98.406  92.888  1.00 18.88  ? 65   THR B CG2 1 
ATOM   3836  N  N   . SER B  2  66  ? 76.524 96.956  91.597  1.00 30.90  ? 66   SER B N   1 
ATOM   3837  C  CA  . SER B  2  66  ? 75.199 97.592  91.586  1.00 31.05  ? 66   SER B CA  1 
ATOM   3838  C  C   . SER B  2  66  ? 74.196 96.892  92.459  1.00 32.01  ? 66   SER B C   1 
ATOM   3839  O  O   . SER B  2  66  ? 73.116 97.435  92.718  1.00 32.13  ? 66   SER B O   1 
ATOM   3840  C  CB  . SER B  2  66  ? 74.641 97.854  90.183  1.00 30.19  ? 66   SER B CB  1 
ATOM   3841  O  OG  . SER B  2  66  ? 74.557 96.686  89.410  1.00 31.74  ? 66   SER B OG  1 
ATOM   3842  N  N   . HIS B  2  67  ? 74.530 95.678  92.912  1.00 32.34  ? 67   HIS B N   1 
ATOM   3843  C  CA  . HIS B  2  67  ? 73.640 94.976  93.816  1.00 32.96  ? 67   HIS B CA  1 
ATOM   3844  C  C   . HIS B  2  67  ? 73.864 95.528  95.196  1.00 32.91  ? 67   HIS B C   1 
ATOM   3845  O  O   . HIS B  2  67  ? 72.979 96.077  95.771  1.00 32.95  ? 67   HIS B O   1 
ATOM   3846  C  CB  . HIS B  2  67  ? 73.847 93.463  93.789  1.00 33.71  ? 67   HIS B CB  1 
ATOM   3847  C  CG  . HIS B  2  67  ? 72.803 92.699  94.544  1.00 39.42  ? 67   HIS B CG  1 
ATOM   3848  N  ND1 . HIS B  2  67  ? 72.928 91.354  94.838  1.00 34.79  ? 67   HIS B ND1 1 
ATOM   3849  C  CD2 . HIS B  2  67  ? 71.633 93.100  95.101  1.00 33.25  ? 67   HIS B CD2 1 
ATOM   3850  C  CE1 . HIS B  2  67  ? 71.868 90.955  95.514  1.00 28.69  ? 67   HIS B CE1 1 
ATOM   3851  N  NE2 . HIS B  2  67  ? 71.073 91.999  95.699  1.00 38.37  ? 67   HIS B NE2 1 
ATOM   3852  N  N   . LEU B  2  68  ? 75.079 95.453  95.690  1.00 33.51  ? 68   LEU B N   1 
ATOM   3853  C  CA  . LEU B  2  68  ? 75.378 96.002  97.018  1.00 33.82  ? 68   LEU B CA  1 
ATOM   3854  C  C   . LEU B  2  68  ? 74.888 97.453  97.134  1.00 33.81  ? 68   LEU B C   1 
ATOM   3855  O  O   . LEU B  2  68  ? 74.336 97.843  98.145  1.00 32.51  ? 68   LEU B O   1 
ATOM   3856  C  CB  . LEU B  2  68  ? 76.860 95.938  97.302  1.00 33.38  ? 68   LEU B CB  1 
ATOM   3857  C  CG  . LEU B  2  68  ? 77.120 96.193  98.760  1.00 30.83  ? 68   LEU B CG  1 
ATOM   3858  C  CD1 . LEU B  2  68  ? 76.285 95.236  99.554  1.00 25.24  ? 68   LEU B CD1 1 
ATOM   3859  C  CD2 . LEU B  2  68  ? 78.578 96.023  99.073  1.00 24.26  ? 68   LEU B CD2 1 
ATOM   3860  N  N   . LEU B  2  69  ? 75.021 98.201  96.027  1.00 35.16  ? 69   LEU B N   1 
ATOM   3861  C  CA  . LEU B  2  69  ? 74.630 99.597  95.972  1.00 35.05  ? 69   LEU B CA  1 
ATOM   3862  C  C   . LEU B  2  69  ? 73.146 99.651  96.157  1.00 34.98  ? 69   LEU B C   1 
ATOM   3863  O  O   . LEU B  2  69  ? 72.682 100.378 96.952  1.00 35.95  ? 69   LEU B O   1 
ATOM   3864  C  CB  . LEU B  2  69  ? 75.006 100.198 94.627  1.00 35.30  ? 69   LEU B CB  1 
ATOM   3865  C  CG  . LEU B  2  69  ? 75.388 101.699 94.499  1.00 30.60  ? 69   LEU B CG  1 
ATOM   3866  C  CD1 . LEU B  2  69  ? 75.071 102.162 93.156  1.00 21.27  ? 69   LEU B CD1 1 
ATOM   3867  C  CD2 . LEU B  2  69  ? 74.775 102.557 95.460  1.00 27.63  ? 69   LEU B CD2 1 
ATOM   3868  N  N   . ARG B  2  70  ? 72.419 98.809  95.451  1.00 34.25  ? 70   ARG B N   1 
ATOM   3869  C  CA  . ARG B  2  70  ? 70.988 98.782  95.573  1.00 34.53  ? 70   ARG B CA  1 
ATOM   3870  C  C   . ARG B  2  70  ? 70.570 98.526  97.031  1.00 35.74  ? 70   ARG B C   1 
ATOM   3871  O  O   . ARG B  2  70  ? 69.621 99.132  97.528  1.00 36.56  ? 70   ARG B O   1 
ATOM   3872  C  CB  . ARG B  2  70  ? 70.385 97.729  94.602  1.00 34.09  ? 70   ARG B CB  1 
ATOM   3873  C  CG  . ARG B  2  70  ? 68.985 97.287  94.939  1.00 31.05  ? 70   ARG B CG  1 
ATOM   3874  C  CD  . ARG B  2  70  ? 68.259 96.611  93.822  1.00 27.14  ? 70   ARG B CD  1 
ATOM   3875  N  NE  . ARG B  2  70  ? 68.487 95.182  93.756  1.00 33.05  ? 70   ARG B NE  1 
ATOM   3876  C  CZ  . ARG B  2  70  ? 69.227 94.574  92.846  1.00 29.77  ? 70   ARG B CZ  1 
ATOM   3877  N  NH1 . ARG B  2  70  ? 69.901 95.279  91.957  1.00 31.15  ? 70   ARG B NH1 1 
ATOM   3878  N  NH2 . ARG B  2  70  ? 69.329 93.254  92.860  1.00 27.14  ? 70   ARG B NH2 1 
ATOM   3879  N  N   . LEU B  2  71  ? 71.331 97.682  97.735  1.00 35.86  ? 71   LEU B N   1 
ATOM   3880  C  CA  . LEU B  2  71  ? 71.043 97.354  99.131  1.00 35.70  ? 71   LEU B CA  1 
ATOM   3881  C  C   . LEU B  2  71  ? 71.578 98.422  100.088 1.00 36.78  ? 71   LEU B C   1 
ATOM   3882  O  O   . LEU B  2  71  ? 71.305 98.371  101.292 1.00 37.96  ? 71   LEU B O   1 
ATOM   3883  C  CB  . LEU B  2  71  ? 71.706 96.037  99.518  1.00 35.43  ? 71   LEU B CB  1 
ATOM   3884  C  CG  . LEU B  2  71  ? 71.411 94.681  98.809  1.00 36.49  ? 71   LEU B CG  1 
ATOM   3885  C  CD1 . LEU B  2  71  ? 71.998 93.520  99.589  1.00 30.07  ? 71   LEU B CD1 1 
ATOM   3886  C  CD2 . LEU B  2  71  ? 69.972 94.449  98.637  1.00 19.68  ? 71   LEU B CD2 1 
ATOM   3887  N  N   . ALA B  2  72  ? 72.329 99.399  99.583  1.00 35.88  ? 72   ALA B N   1 
ATOM   3888  C  CA  . ALA B  2  72  ? 72.948 100.377 100.494 1.00 34.83  ? 72   ALA B CA  1 
ATOM   3889  C  C   . ALA B  2  72  ? 72.297 101.700 100.649 1.00 33.96  ? 72   ALA B C   1 
ATOM   3890  O  O   . ALA B  2  72  ? 72.929 102.604 101.140 1.00 35.38  ? 72   ALA B O   1 
ATOM   3891  C  CB  . ALA B  2  72  ? 74.362 100.587 100.117 1.00 34.77  ? 72   ALA B CB  1 
ATOM   3892  N  N   . SER B  2  73  ? 71.034 101.820 100.309 1.00 32.15  ? 73   SER B N   1 
ATOM   3893  C  CA  . SER B  2  73  ? 70.360 103.116 100.295 1.00 31.24  ? 73   SER B CA  1 
ATOM   3894  C  C   . SER B  2  73  ? 70.185 103.779 101.600 1.00 31.51  ? 73   SER B C   1 
ATOM   3895  O  O   . SER B  2  73  ? 69.869 104.957 101.640 1.00 32.29  ? 73   SER B O   1 
ATOM   3896  C  CB  . SER B  2  73  ? 68.995 103.037 99.606  1.00 31.20  ? 73   SER B CB  1 
ATOM   3897  O  OG  . SER B  2  73  ? 68.036 102.442 100.477 1.00 43.87  ? 73   SER B OG  1 
ATOM   3898  N  N   . SER B  2  74  ? 70.291 103.046 102.693 1.00 30.98  ? 74   SER B N   1 
ATOM   3899  C  CA  . SER B  2  74  ? 70.174 103.717 103.973 1.00 29.73  ? 74   SER B CA  1 
ATOM   3900  C  C   . SER B  2  74  ? 71.423 103.815 104.827 1.00 29.05  ? 74   SER B C   1 
ATOM   3901  O  O   . SER B  2  74  ? 71.332 104.091 106.030 1.00 28.09  ? 74   SER B O   1 
ATOM   3902  C  CB  . SER B  2  74  ? 68.908 103.349 104.763 1.00 28.93  ? 74   SER B CB  1 
ATOM   3903  O  OG  . SER B  2  74  ? 69.091 102.214 105.557 1.00 29.30  ? 74   SER B OG  1 
ATOM   3904  N  N   . LEU B  2  75  ? 72.596 103.636 104.205 1.00 29.22  ? 75   LEU B N   1 
ATOM   3905  C  CA  . LEU B  2  75  ? 73.864 103.838 104.927 1.00 29.98  ? 75   LEU B CA  1 
ATOM   3906  C  C   . LEU B  2  75  ? 74.058 105.371 105.119 1.00 30.82  ? 75   LEU B C   1 
ATOM   3907  O  O   . LEU B  2  75  ? 73.371 106.168 104.486 1.00 31.35  ? 75   LEU B O   1 
ATOM   3908  C  CB  . LEU B  2  75  ? 75.031 103.269 104.167 1.00 29.95  ? 75   LEU B CB  1 
ATOM   3909  C  CG  . LEU B  2  75  ? 74.974 101.798 103.720 1.00 33.53  ? 75   LEU B CG  1 
ATOM   3910  C  CD1 . LEU B  2  75  ? 76.399 101.328 103.381 1.00 39.53  ? 75   LEU B CD1 1 
ATOM   3911  C  CD2 . LEU B  2  75  ? 74.424 100.921 104.761 1.00 15.55  ? 75   LEU B CD2 1 
ATOM   3912  N  N   . THR B  2  76  ? 74.981 105.776 105.968 1.00 31.17  ? 76   THR B N   1 
ATOM   3913  C  CA  . THR B  2  76  ? 75.131 107.162 106.217 1.00 32.49  ? 76   THR B CA  1 
ATOM   3914  C  C   . THR B  2  76  ? 75.607 108.015 105.034 1.00 32.46  ? 76   THR B C   1 
ATOM   3915  O  O   . THR B  2  76  ? 76.378 107.567 104.192 1.00 32.14  ? 76   THR B O   1 
ATOM   3916  C  CB  . THR B  2  76  ? 75.934 107.435 107.538 1.00 33.95  ? 76   THR B CB  1 
ATOM   3917  O  OG1 . THR B  2  76  ? 77.322 107.254 107.324 1.00 61.23  ? 76   THR B OG1 1 
ATOM   3918  C  CG2 . THR B  2  76  ? 75.625 106.411 108.532 1.00 31.95  ? 76   THR B CG2 1 
ATOM   3919  N  N   . THR B  2  77  ? 75.056 109.213 104.947 1.00 33.19  ? 77   THR B N   1 
ATOM   3920  C  CA  . THR B  2  77  ? 75.406 110.174 103.904 1.00 35.29  ? 77   THR B CA  1 
ATOM   3921  C  C   . THR B  2  77  ? 75.935 111.451 104.561 1.00 37.18  ? 77   THR B C   1 
ATOM   3922  O  O   . THR B  2  77  ? 75.808 111.636 105.818 1.00 38.73  ? 77   THR B O   1 
ATOM   3923  C  CB  . THR B  2  77  ? 74.169 110.584 103.132 1.00 35.51  ? 77   THR B CB  1 
ATOM   3924  O  OG1 . THR B  2  77  ? 73.292 111.297 104.010 1.00 33.40  ? 77   THR B OG1 1 
ATOM   3925  C  CG2 . THR B  2  77  ? 73.383 109.409 102.684 1.00 29.52  ? 77   THR B CG2 1 
ATOM   3926  N  N   . LYS B  2  78  ? 76.531 112.347 103.778 1.00 37.21  ? 78   LYS B N   1 
ATOM   3927  C  CA  . LYS B  2  78  ? 76.969 113.645 104.397 1.00 37.74  ? 78   LYS B CA  1 
ATOM   3928  C  C   . LYS B  2  78  ? 75.650 114.331 104.662 1.00 37.60  ? 78   LYS B C   1 
ATOM   3929  O  O   . LYS B  2  78  ? 74.722 114.217 103.891 1.00 38.76  ? 78   LYS B O   1 
ATOM   3930  C  CB  . LYS B  2  78  ? 77.806 114.444 103.437 1.00 37.60  ? 78   LYS B CB  1 
ATOM   3931  C  CG  . LYS B  2  78  ? 78.892 113.633 102.832 1.00 40.93  ? 78   LYS B CG  1 
ATOM   3932  C  CD  . LYS B  2  78  ? 79.443 114.316 101.599 1.00 45.87  ? 78   LYS B CD  1 
ATOM   3933  C  CE  . LYS B  2  78  ? 80.299 113.381 100.789 1.00 37.53  ? 78   LYS B CE  1 
ATOM   3934  N  NZ  . LYS B  2  78  ? 80.918 114.159 99.722  1.00 40.07  ? 78   LYS B NZ  1 
ATOM   3935  N  N   . GLY B  2  79  ? 75.467 114.895 105.774 1.00 36.28  ? 79   GLY B N   1 
ATOM   3936  C  CA  . GLY B  2  79  ? 74.149 115.449 105.935 1.00 36.38  ? 79   GLY B CA  1 
ATOM   3937  C  C   . GLY B  2  79  ? 73.050 114.536 106.463 1.00 35.84  ? 79   GLY B C   1 
ATOM   3938  O  O   . GLY B  2  79  ? 72.008 115.031 106.859 1.00 36.76  ? 79   GLY B O   1 
ATOM   3939  N  N   . ALA B  2  80  ? 73.261 113.230 106.486 1.00 34.68  ? 80   ALA B N   1 
ATOM   3940  C  CA  . ALA B  2  80  ? 72.241 112.337 107.054 1.00 34.03  ? 80   ALA B CA  1 
ATOM   3941  C  C   . ALA B  2  80  ? 72.789 110.971 107.426 1.00 33.59  ? 80   ALA B C   1 
ATOM   3942  O  O   . ALA B  2  80  ? 73.146 110.159 106.544 1.00 33.61  ? 80   ALA B O   1 
ATOM   3943  C  CB  . ALA B  2  80  ? 71.035 112.205 106.133 1.00 33.68  ? 80   ALA B CB  1 
ATOM   3944  N  N   . SER B  2  81  ? 72.838 110.697 108.726 1.00 32.77  ? 81   SER B N   1 
ATOM   3945  C  CA  . SER B  2  81  ? 73.315 109.413 109.187 1.00 32.78  ? 81   SER B CA  1 
ATOM   3946  C  C   . SER B  2  81  ? 72.262 108.363 108.909 1.00 33.56  ? 81   SER B C   1 
ATOM   3947  O  O   . SER B  2  81  ? 71.072 108.682 108.738 1.00 34.47  ? 81   SER B O   1 
ATOM   3948  C  CB  . SER B  2  81  ? 73.594 109.449 110.671 1.00 32.63  ? 81   SER B CB  1 
ATOM   3949  O  OG  . SER B  2  81  ? 72.379 109.491 111.398 1.00 33.89  ? 81   SER B OG  1 
ATOM   3950  N  N   . SER B  2  82  ? 72.691 107.111 108.888 1.00 33.00  ? 82   SER B N   1 
ATOM   3951  C  CA  . SER B  2  82  ? 71.804 105.986 108.672 1.00 32.44  ? 82   SER B CA  1 
ATOM   3952  C  C   . SER B  2  82  ? 70.622 106.058 109.621 1.00 32.34  ? 82   SER B C   1 
ATOM   3953  O  O   . SER B  2  82  ? 69.477 106.075 109.183 1.00 32.21  ? 82   SER B O   1 
ATOM   3954  C  CB  . SER B  2  82  ? 72.552 104.682 108.863 1.00 31.75  ? 82   SER B CB  1 
ATOM   3955  O  OG  . SER B  2  82  ? 71.703 103.598 108.621 1.00 45.99  ? 82   SER B OG  1 
ATOM   3956  N  N   . PHE B  2  83  ? 70.912 106.176 110.925 1.00 32.42  ? 83   PHE B N   1 
ATOM   3957  C  CA  . PHE B  2  83  ? 69.863 106.278 111.935 1.00 31.93  ? 83   PHE B CA  1 
ATOM   3958  C  C   . PHE B  2  83  ? 68.812 107.337 111.523 1.00 32.63  ? 83   PHE B C   1 
ATOM   3959  O  O   . PHE B  2  83  ? 67.607 107.065 111.532 1.00 32.96  ? 83   PHE B O   1 
ATOM   3960  C  CB  . PHE B  2  83  ? 70.472 106.625 113.282 1.00 31.30  ? 83   PHE B CB  1 
ATOM   3961  C  CG  . PHE B  2  83  ? 69.455 106.809 114.391 1.00 33.87  ? 83   PHE B CG  1 
ATOM   3962  C  CD1 . PHE B  2  83  ? 68.884 105.701 115.034 1.00 30.42  ? 83   PHE B CD1 1 
ATOM   3963  C  CD2 . PHE B  2  83  ? 69.094 108.067 114.812 1.00 31.81  ? 83   PHE B CD2 1 
ATOM   3964  C  CE1 . PHE B  2  83  ? 67.982 105.862 116.047 1.00 15.90  ? 83   PHE B CE1 1 
ATOM   3965  C  CE2 . PHE B  2  83  ? 68.177 108.227 115.829 1.00 27.17  ? 83   PHE B CE2 1 
ATOM   3966  C  CZ  . PHE B  2  83  ? 67.622 107.109 116.446 1.00 30.70  ? 83   PHE B CZ  1 
ATOM   3967  N  N   . LYS B  2  84  ? 69.278 108.513 111.111 1.00 32.75  ? 84   LYS B N   1 
ATOM   3968  C  CA  . LYS B  2  84  ? 68.363 109.570 110.702 1.00 32.90  ? 84   LYS B CA  1 
ATOM   3969  C  C   . LYS B  2  84  ? 67.497 109.224 109.494 1.00 33.12  ? 84   LYS B C   1 
ATOM   3970  O  O   . LYS B  2  84  ? 66.307 109.518 109.464 1.00 33.27  ? 84   LYS B O   1 
ATOM   3971  C  CB  . LYS B  2  84  ? 69.099 110.861 110.416 1.00 31.98  ? 84   LYS B CB  1 
ATOM   3972  C  CG  . LYS B  2  84  ? 68.162 112.020 110.307 1.00 21.97  ? 84   LYS B CG  1 
ATOM   3973  C  CD  . LYS B  2  84  ? 68.882 113.330 110.117 1.00 31.49  ? 84   LYS B CD  1 
ATOM   3974  C  CE  . LYS B  2  84  ? 67.902 114.452 109.985 1.00 32.46  ? 84   LYS B CE  1 
ATOM   3975  N  NZ  . LYS B  2  84  ? 68.628 115.755 109.910 1.00 47.47  ? 84   LYS B NZ  1 
ATOM   3976  N  N   . ILE B  2  85  ? 68.102 108.610 108.510 1.00 32.83  ? 85   ILE B N   1 
ATOM   3977  C  CA  . ILE B  2  85  ? 67.401 108.297 107.314 1.00 33.32  ? 85   ILE B CA  1 
ATOM   3978  C  C   . ILE B  2  85  ? 66.258 107.396 107.656 1.00 33.89  ? 85   ILE B C   1 
ATOM   3979  O  O   . ILE B  2  85  ? 65.120 107.659 107.296 1.00 34.47  ? 85   ILE B O   1 
ATOM   3980  C  CB  . ILE B  2  85  ? 68.362 107.629 106.281 1.00 33.39  ? 85   ILE B CB  1 
ATOM   3981  C  CG1 . ILE B  2  85  ? 69.396 108.660 105.773 1.00 32.73  ? 85   ILE B CG1 1 
ATOM   3982  C  CG2 . ILE B  2  85  ? 67.591 107.078 105.146 1.00 31.68  ? 85   ILE B CG2 1 
ATOM   3983  C  CD1 . ILE B  2  85  ? 70.580 108.075 105.103 1.00 24.80  ? 85   ILE B CD1 1 
ATOM   3984  N  N   . THR B  2  86  ? 66.543 106.393 108.459 1.00 33.56  ? 86   THR B N   1 
ATOM   3985  C  CA  . THR B  2  86  ? 65.557 105.435 108.838 1.00 33.06  ? 86   THR B CA  1 
ATOM   3986  C  C   . THR B  2  86  ? 64.461 106.048 109.720 1.00 33.82  ? 86   THR B C   1 
ATOM   3987  O  O   . THR B  2  86  ? 63.280 106.024 109.360 1.00 33.81  ? 86   THR B O   1 
ATOM   3988  C  CB  . THR B  2  86  ? 66.228 104.335 109.516 1.00 32.72  ? 86   THR B CB  1 
ATOM   3989  O  OG1 . THR B  2  86  ? 67.184 103.734 108.605 1.00 33.22  ? 86   THR B OG1 1 
ATOM   3990  C  CG2 . THR B  2  86  ? 65.247 103.233 109.831 1.00 20.05  ? 86   THR B CG2 1 
ATOM   3991  N  N   . ARG B  2  87  ? 64.863 106.664 110.828 1.00 34.06  ? 87   ARG B N   1 
ATOM   3992  C  CA  . ARG B  2  87  ? 63.918 107.276 111.750 1.00 33.96  ? 87   ARG B CA  1 
ATOM   3993  C  C   . ARG B  2  87  ? 63.155 108.404 111.159 1.00 34.29  ? 87   ARG B C   1 
ATOM   3994  O  O   . ARG B  2  87  ? 61.946 108.548 111.405 1.00 33.85  ? 87   ARG B O   1 
ATOM   3995  C  CB  . ARG B  2  87  ? 64.634 107.783 112.969 1.00 33.73  ? 87   ARG B CB  1 
ATOM   3996  C  CG  . ARG B  2  87  ? 65.172 106.697 113.818 1.00 35.70  ? 87   ARG B CG  1 
ATOM   3997  C  CD  . ARG B  2  87  ? 64.135 105.627 114.183 1.00 32.93  ? 87   ARG B CD  1 
ATOM   3998  N  NE  . ARG B  2  87  ? 64.666 104.698 115.158 1.00 29.27  ? 87   ARG B NE  1 
ATOM   3999  C  CZ  . ARG B  2  87  ? 64.661 104.936 116.467 1.00 29.54  ? 87   ARG B CZ  1 
ATOM   4000  N  NH1 . ARG B  2  87  ? 64.105 106.054 116.943 1.00 18.54  ? 87   ARG B NH1 1 
ATOM   4001  N  NH2 . ARG B  2  87  ? 65.178 104.062 117.296 1.00 19.88  ? 87   ARG B NH2 1 
ATOM   4002  N  N   . GLY B  2  88  ? 63.857 109.211 110.360 1.00 34.73  ? 88   GLY B N   1 
ATOM   4003  C  CA  . GLY B  2  88  ? 63.284 110.403 109.759 1.00 34.13  ? 88   GLY B CA  1 
ATOM   4004  C  C   . GLY B  2  88  ? 62.213 110.096 108.799 1.00 33.50  ? 88   GLY B C   1 
ATOM   4005  O  O   . GLY B  2  88  ? 61.184 110.700 108.849 1.00 33.70  ? 88   GLY B O   1 
ATOM   4006  N  N   . ILE B  2  89  ? 62.476 109.151 107.904 1.00 33.59  ? 89   ILE B N   1 
ATOM   4007  C  CA  . ILE B  2  89  ? 61.477 108.682 106.909 1.00 32.92  ? 89   ILE B CA  1 
ATOM   4008  C  C   . ILE B  2  89  ? 60.311 107.969 107.606 1.00 32.11  ? 89   ILE B C   1 
ATOM   4009  O  O   . ILE B  2  89  ? 59.141 108.258 107.333 1.00 32.26  ? 89   ILE B O   1 
ATOM   4010  C  CB  . ILE B  2  89  ? 62.145 107.759 105.848 1.00 32.49  ? 89   ILE B CB  1 
ATOM   4011  C  CG1 . ILE B  2  89  ? 63.055 108.589 104.972 1.00 29.29  ? 89   ILE B CG1 1 
ATOM   4012  C  CG2 . ILE B  2  89  ? 61.083 107.096 104.940 1.00 37.57  ? 89   ILE B CG2 1 
ATOM   4013  C  CD1 . ILE B  2  89  ? 63.999 107.796 104.088 1.00 22.80  ? 89   ILE B CD1 1 
ATOM   4014  N  N   . GLU B  2  90  ? 60.620 107.099 108.549 1.00 31.71  ? 90   GLU B N   1 
ATOM   4015  C  CA  . GLU B  2  90  ? 59.544 106.418 109.276 1.00 31.89  ? 90   GLU B CA  1 
ATOM   4016  C  C   . GLU B  2  90  ? 58.710 107.372 110.120 1.00 32.21  ? 90   GLU B C   1 
ATOM   4017  O  O   . GLU B  2  90  ? 57.537 107.131 110.314 1.00 32.85  ? 90   GLU B O   1 
ATOM   4018  C  CB  . GLU B  2  90  ? 60.044 105.254 110.125 1.00 31.45  ? 90   GLU B CB  1 
ATOM   4019  C  CG  . GLU B  2  90  ? 60.653 104.144 109.316 1.00 33.25  ? 90   GLU B CG  1 
ATOM   4020  C  CD  . GLU B  2  90  ? 61.020 102.940 110.160 1.00 39.78  ? 90   GLU B CD  1 
ATOM   4021  O  OE1 . GLU B  2  90  ? 61.746 103.112 111.156 1.00 41.48  ? 90   GLU B OE1 1 
ATOM   4022  O  OE2 . GLU B  2  90  ? 60.564 101.828 109.833 1.00 40.86  ? 90   GLU B OE2 1 
ATOM   4023  N  N   . ALA B  2  91  ? 59.295 108.482 110.576 1.00 31.72  ? 91   ALA B N   1 
ATOM   4024  C  CA  . ALA B  2  91  ? 58.530 109.428 111.423 1.00 30.81  ? 91   ALA B CA  1 
ATOM   4025  C  C   . ALA B  2  91  ? 57.337 110.045 110.679 1.00 30.93  ? 91   ALA B C   1 
ATOM   4026  O  O   . ALA B  2  91  ? 56.294 110.325 111.286 1.00 30.29  ? 91   ALA B O   1 
ATOM   4027  C  CB  . ALA B  2  91  ? 59.417 110.486 112.007 1.00 29.77  ? 91   ALA B CB  1 
ATOM   4028  N  N   . VAL B  2  92  ? 57.474 110.194 109.352 1.00 31.59  ? 92   VAL B N   1 
ATOM   4029  C  CA  . VAL B  2  92  ? 56.390 110.742 108.538 1.00 32.05  ? 92   VAL B CA  1 
ATOM   4030  C  C   . VAL B  2  92  ? 55.649 109.658 107.779 1.00 32.80  ? 92   VAL B C   1 
ATOM   4031  O  O   . VAL B  2  92  ? 54.696 109.938 107.016 1.00 32.55  ? 92   VAL B O   1 
ATOM   4032  C  CB  . VAL B  2  92  ? 56.869 111.859 107.596 1.00 31.95  ? 92   VAL B CB  1 
ATOM   4033  C  CG1 . VAL B  2  92  ? 57.155 113.084 108.386 1.00 16.42  ? 92   VAL B CG1 1 
ATOM   4034  C  CG2 . VAL B  2  92  ? 58.074 111.432 106.844 1.00 19.04  ? 92   VAL B CG2 1 
ATOM   4035  N  N   . GLY B  2  93  ? 56.079 108.411 108.005 1.00 33.32  ? 93   GLY B N   1 
ATOM   4036  C  CA  . GLY B  2  93  ? 55.435 107.245 107.425 1.00 33.27  ? 93   GLY B CA  1 
ATOM   4037  C  C   . GLY B  2  93  ? 55.664 107.049 105.946 1.00 33.07  ? 93   GLY B C   1 
ATOM   4038  O  O   . GLY B  2  93  ? 54.814 106.483 105.271 1.00 33.80  ? 93   GLY B O   1 
ATOM   4039  N  N   . GLY B  2  94  ? 56.810 107.493 105.446 1.00 31.94  ? 94   GLY B N   1 
ATOM   4040  C  CA  . GLY B  2  94  ? 57.095 107.378 104.038 1.00 31.75  ? 94   GLY B CA  1 
ATOM   4041  C  C   . GLY B  2  94  ? 57.923 106.158 103.650 1.00 32.46  ? 94   GLY B C   1 
ATOM   4042  O  O   . GLY B  2  94  ? 58.191 105.288 104.477 1.00 32.85  ? 94   GLY B O   1 
ATOM   4043  N  N   . LYS B  2  95  ? 58.311 106.085 102.374 1.00 32.33  ? 95   LYS B N   1 
ATOM   4044  C  CA  . LYS B  2  95  ? 59.110 104.954 101.861 1.00 31.55  ? 95   LYS B CA  1 
ATOM   4045  C  C   . LYS B  2  95  ? 60.349 105.451 101.144 1.00 29.93  ? 95   LYS B C   1 
ATOM   4046  O  O   . LYS B  2  95  ? 60.379 106.544 100.687 1.00 29.00  ? 95   LYS B O   1 
ATOM   4047  C  CB  . LYS B  2  95  ? 58.324 104.166 100.812 1.00 31.79  ? 95   LYS B CB  1 
ATOM   4048  C  CG  . LYS B  2  95  ? 57.126 103.433 101.248 1.00 43.84  ? 95   LYS B CG  1 
ATOM   4049  C  CD  . LYS B  2  95  ? 56.605 102.587 100.038 1.00 54.05  ? 95   LYS B CD  1 
ATOM   4050  C  CE  . LYS B  2  95  ? 55.316 101.802 100.365 1.00 65.87  ? 95   LYS B CE  1 
ATOM   4051  N  NZ  . LYS B  2  95  ? 54.255 102.667 100.970 1.00 65.96  ? 95   LYS B NZ  1 
ATOM   4052  N  N   . LEU B  2  96  ? 61.335 104.573 101.031 1.00 29.86  ? 96   LEU B N   1 
ATOM   4053  C  CA  . LEU B  2  96  ? 62.539 104.774 100.271 1.00 30.37  ? 96   LEU B CA  1 
ATOM   4054  C  C   . LEU B  2  96  ? 62.797 103.443 99.676  1.00 32.92  ? 96   LEU B C   1 
ATOM   4055  O  O   . LEU B  2  96  ? 63.058 102.483 100.376 1.00 33.57  ? 96   LEU B O   1 
ATOM   4056  C  CB  . LEU B  2  96  ? 63.718 105.117 101.151 1.00 29.81  ? 96   LEU B CB  1 
ATOM   4057  C  CG  . LEU B  2  96  ? 65.107 105.164 100.434 1.00 29.68  ? 96   LEU B CG  1 
ATOM   4058  C  CD1 . LEU B  2  96  ? 65.087 106.042 99.156  1.00 21.46  ? 96   LEU B CD1 1 
ATOM   4059  C  CD2 . LEU B  2  96  ? 66.225 105.668 101.400 1.00 28.61  ? 96   LEU B CD2 1 
ATOM   4060  N  N   . SER B  2  97  ? 62.704 103.342 98.377  1.00 35.13  ? 97   SER B N   1 
ATOM   4061  C  CA  . SER B  2  97  ? 62.962 102.074 97.748  1.00 36.61  ? 97   SER B CA  1 
ATOM   4062  C  C   . SER B  2  97  ? 63.811 102.226 96.543  1.00 37.97  ? 97   SER B C   1 
ATOM   4063  O  O   . SER B  2  97  ? 63.777 103.234 95.915  1.00 38.95  ? 97   SER B O   1 
ATOM   4064  C  CB  . SER B  2  97  ? 61.657 101.354 97.417  1.00 36.94  ? 97   SER B CB  1 
ATOM   4065  O  OG  . SER B  2  97  ? 60.558 102.248 97.462  1.00 58.03  ? 97   SER B OG  1 
ATOM   4066  N  N   . VAL B  2  98  ? 64.695 101.260 96.308  1.00 38.09  ? 98   VAL B N   1 
ATOM   4067  C  CA  . VAL B  2  98  ? 65.485 101.250 95.113  1.00 37.20  ? 98   VAL B CA  1 
ATOM   4068  C  C   . VAL B  2  98  ? 65.234 100.029 94.259  1.00 37.90  ? 98   VAL B C   1 
ATOM   4069  O  O   . VAL B  2  98  ? 65.247 98.843  94.730  1.00 37.63  ? 98   VAL B O   1 
ATOM   4070  C  CB  . VAL B  2  98  ? 66.947 101.579 95.321  1.00 37.27  ? 98   VAL B CB  1 
ATOM   4071  C  CG1 . VAL B  2  98  ? 67.347 101.495 96.699  1.00 37.18  ? 98   VAL B CG1 1 
ATOM   4072  C  CG2 . VAL B  2  98  ? 67.846 100.831 94.389  1.00 31.36  ? 98   VAL B CG2 1 
ATOM   4073  N  N   . THR B  2  99  ? 64.879 100.301 93.011  1.00 38.26  ? 99   THR B N   1 
ATOM   4074  C  CA  . THR B  2  99  ? 64.616 99.265  92.087  1.00 37.31  ? 99   THR B CA  1 
ATOM   4075  C  C   . THR B  2  99  ? 65.482 99.277  90.874  1.00 36.30  ? 99   THR B C   1 
ATOM   4076  O  O   . THR B  2  99  ? 65.651 100.294 90.241  1.00 36.44  ? 99   THR B O   1 
ATOM   4077  C  CB  . THR B  2  99  ? 63.142 99.135  91.791  1.00 37.63  ? 99   THR B CB  1 
ATOM   4078  O  OG1 . THR B  2  99  ? 62.943 99.031  90.399  1.00 39.03  ? 99   THR B OG1 1 
ATOM   4079  C  CG2 . THR B  2  99  ? 62.376 100.346 92.200  1.00 41.48  ? 99   THR B CG2 1 
ATOM   4080  N  N   . SER B  2  100 ? 66.030 98.112  90.552  1.00 35.27  ? 100  SER B N   1 
ATOM   4081  C  CA  . SER B  2  100 ? 66.959 97.969  89.445  1.00 34.14  ? 100  SER B CA  1 
ATOM   4082  C  C   . SER B  2  100 ? 66.563 97.031  88.331  1.00 33.86  ? 100  SER B C   1 
ATOM   4083  O  O   . SER B  2  100 ? 65.817 96.063  88.530  1.00 33.64  ? 100  SER B O   1 
ATOM   4084  C  CB  . SER B  2  100 ? 68.274 97.522  89.965  1.00 33.49  ? 100  SER B CB  1 
ATOM   4085  O  OG  . SER B  2  100 ? 68.687 98.379  91.002  1.00 38.33  ? 100  SER B OG  1 
ATOM   4086  N  N   . THR B  2  101 ? 67.061 97.344  87.140  1.00 33.27  ? 101  THR B N   1 
ATOM   4087  C  CA  . THR B  2  101 ? 66.906 96.505  85.973  1.00 33.50  ? 101  THR B CA  1 
ATOM   4088  C  C   . THR B  2  101 ? 68.295 96.474  85.366  1.00 34.17  ? 101  THR B C   1 
ATOM   4089  O  O   . THR B  2  101 ? 69.185 97.083  85.878  1.00 34.73  ? 101  THR B O   1 
ATOM   4090  C  CB  . THR B  2  101 ? 65.912 97.069  84.979  1.00 33.33  ? 101  THR B CB  1 
ATOM   4091  O  OG1 . THR B  2  101 ? 66.383 98.333  84.478  1.00 27.85  ? 101  THR B OG1 1 
ATOM   4092  C  CG2 . THR B  2  101 ? 64.606 97.380  85.650  1.00 21.15  ? 101  THR B CG2 1 
ATOM   4093  N  N   . ARG B  2  102 ? 68.479 95.757  84.278  1.00 34.40  ? 102  ARG B N   1 
ATOM   4094  C  CA  . ARG B  2  102 ? 69.804 95.654  83.674  1.00 34.35  ? 102  ARG B CA  1 
ATOM   4095  C  C   . ARG B  2  102 ? 70.273 97.008  83.146  1.00 34.82  ? 102  ARG B C   1 
ATOM   4096  O  O   . ARG B  2  102 ? 71.481 97.238  82.950  1.00 35.53  ? 102  ARG B O   1 
ATOM   4097  C  CB  . ARG B  2  102 ? 69.803 94.622  82.565  1.00 33.91  ? 102  ARG B CB  1 
ATOM   4098  C  CG  . ARG B  2  102 ? 69.635 93.251  83.039  1.00 32.74  ? 102  ARG B CG  1 
ATOM   4099  C  CD  . ARG B  2  102 ? 69.705 92.172  81.918  1.00 28.54  ? 102  ARG B CD  1 
ATOM   4100  N  NE  . ARG B  2  102 ? 70.336 90.982  82.429  1.00 35.15  ? 102  ARG B NE  1 
ATOM   4101  C  CZ  . ARG B  2  102 ? 69.784 90.163  83.313  1.00 30.84  ? 102  ARG B CZ  1 
ATOM   4102  N  NH1 . ARG B  2  102 ? 68.546 90.353  83.735  1.00 36.53  ? 102  ARG B NH1 1 
ATOM   4103  N  NH2 . ARG B  2  102 ? 70.454 89.134  83.742  1.00 37.50  ? 102  ARG B NH2 1 
ATOM   4104  N  N   . GLU B  2  103 ? 69.330 97.921  82.948  1.00 33.80  ? 103  GLU B N   1 
ATOM   4105  C  CA  . GLU B  2  103 ? 69.686 99.229  82.475  1.00 32.56  ? 103  GLU B CA  1 
ATOM   4106  C  C   . GLU B  2  103 ? 69.620 100.347 83.473  1.00 32.57  ? 103  GLU B C   1 
ATOM   4107  O  O   . GLU B  2  103 ? 70.508 101.195 83.493  1.00 33.33  ? 103  GLU B O   1 
ATOM   4108  C  CB  . GLU B  2  103 ? 68.918 99.568  81.240  1.00 32.31  ? 103  GLU B CB  1 
ATOM   4109  C  CG  . GLU B  2  103 ? 69.023 98.477  80.201  1.00 32.53  ? 103  GLU B CG  1 
ATOM   4110  C  CD  . GLU B  2  103 ? 69.105 99.004  78.813  1.00 36.64  ? 103  GLU B CD  1 
ATOM   4111  O  OE1 . GLU B  2  103 ? 68.056 99.109  78.174  1.00 39.97  ? 103  GLU B OE1 1 
ATOM   4112  O  OE2 . GLU B  2  103 ? 70.222 99.260  78.342  1.00 40.23  ? 103  GLU B OE2 1 
ATOM   4113  N  N   . ASN B  2  104 ? 68.629 100.348 84.354  1.00 32.37  ? 104  ASN B N   1 
ATOM   4114  C  CA  . ASN B  2  104 ? 68.472 101.492 85.257  1.00 32.61  ? 104  ASN B CA  1 
ATOM   4115  C  C   . ASN B  2  104 ? 68.505 101.167 86.709  1.00 33.78  ? 104  ASN B C   1 
ATOM   4116  O  O   . ASN B  2  104 ? 68.413 100.013 87.077  1.00 35.06  ? 104  ASN B O   1 
ATOM   4117  C  CB  . ASN B  2  104 ? 67.106 102.164 85.036  1.00 32.07  ? 104  ASN B CB  1 
ATOM   4118  C  CG  . ASN B  2  104 ? 66.849 102.551 83.607  1.00 35.44  ? 104  ASN B CG  1 
ATOM   4119  O  OD1 . ASN B  2  104 ? 65.703 102.564 83.176  1.00 34.96  ? 104  ASN B OD1 1 
ATOM   4120  N  ND2 . ASN B  2  104 ? 67.899 102.930 82.874  1.00 36.30  ? 104  ASN B ND2 1 
ATOM   4121  N  N   . MET B  2  105 ? 68.679 102.202 87.537  1.00 33.28  ? 105  MET B N   1 
ATOM   4122  C  CA  . MET B  2  105 ? 68.458 102.106 88.984  1.00 34.21  ? 105  MET B CA  1 
ATOM   4123  C  C   . MET B  2  105 ? 67.505 103.249 89.266  1.00 35.69  ? 105  MET B C   1 
ATOM   4124  O  O   . MET B  2  105 ? 67.684 104.363 88.746  1.00 37.06  ? 105  MET B O   1 
ATOM   4125  C  CB  . MET B  2  105 ? 69.700 102.333 89.809  1.00 34.09  ? 105  MET B CB  1 
ATOM   4126  C  CG  . MET B  2  105 ? 70.734 101.315 89.670  1.00 32.55  ? 105  MET B CG  1 
ATOM   4127  S  SD  . MET B  2  105 ? 71.711 101.245 91.139  1.00 38.64  ? 105  MET B SD  1 
ATOM   4128  C  CE  . MET B  2  105 ? 72.993 100.940 90.522  1.00 35.85  ? 105  MET B CE  1 
ATOM   4129  N  N   . ALA B  2  106 ? 66.520 103.011 90.097  1.00 35.37  ? 106  ALA B N   1 
ATOM   4130  C  CA  . ALA B  2  106 ? 65.562 104.013 90.367  1.00 35.54  ? 106  ALA B CA  1 
ATOM   4131  C  C   . ALA B  2  106 ? 65.363 104.180 91.818  1.00 36.07  ? 106  ALA B C   1 
ATOM   4132  O  O   . ALA B  2  106 ? 64.914 103.252 92.499  1.00 36.87  ? 106  ALA B O   1 
ATOM   4133  C  CB  . ALA B  2  106 ? 64.290 103.658 89.735  1.00 35.69  ? 106  ALA B CB  1 
ATOM   4134  N  N   . TYR B  2  107 ? 65.656 105.366 92.324  1.00 35.48  ? 107  TYR B N   1 
ATOM   4135  C  CA  . TYR B  2  107 ? 65.426 105.628 93.735  1.00 35.04  ? 107  TYR B CA  1 
ATOM   4136  C  C   . TYR B  2  107 ? 64.102 106.364 93.866  1.00 35.24  ? 107  TYR B C   1 
ATOM   4137  O  O   . TYR B  2  107 ? 63.976 107.507 93.373  1.00 36.46  ? 107  TYR B O   1 
ATOM   4138  C  CB  . TYR B  2  107 ? 66.536 106.473 94.298  1.00 34.50  ? 107  TYR B CB  1 
ATOM   4139  C  CG  . TYR B  2  107 ? 67.833 105.746 94.421  1.00 35.72  ? 107  TYR B CG  1 
ATOM   4140  C  CD1 . TYR B  2  107 ? 68.585 105.416 93.299  1.00 25.71  ? 107  TYR B CD1 1 
ATOM   4141  C  CD2 . TYR B  2  107 ? 68.330 105.384 95.677  1.00 27.37  ? 107  TYR B CD2 1 
ATOM   4142  C  CE1 . TYR B  2  107 ? 69.807 104.743 93.435  1.00 28.83  ? 107  TYR B CE1 1 
ATOM   4143  C  CE2 . TYR B  2  107 ? 69.538 104.780 95.809  1.00 23.09  ? 107  TYR B CE2 1 
ATOM   4144  C  CZ  . TYR B  2  107 ? 70.262 104.442 94.702  1.00 26.04  ? 107  TYR B CZ  1 
ATOM   4145  O  OH  . TYR B  2  107 ? 71.435 103.812 94.881  1.00 32.23  ? 107  TYR B OH  1 
ATOM   4146  N  N   . THR B  2  108 ? 63.098 105.700 94.448  1.00 34.09  ? 108  THR B N   1 
ATOM   4147  C  CA  . THR B  2  108 ? 61.793 106.307 94.660  1.00 34.94  ? 108  THR B CA  1 
ATOM   4148  C  C   . THR B  2  108 ? 61.551 106.545 96.117  1.00 37.39  ? 108  THR B C   1 
ATOM   4149  O  O   . THR B  2  108 ? 61.918 105.715 96.982  1.00 39.13  ? 108  THR B O   1 
ATOM   4150  C  CB  . THR B  2  108 ? 60.691 105.497 94.104  1.00 33.74  ? 108  THR B CB  1 
ATOM   4151  O  OG1 . THR B  2  108 ? 60.859 104.135 94.499  1.00 52.29  ? 108  THR B OG1 1 
ATOM   4152  C  CG2 . THR B  2  108 ? 60.799 105.449 92.659  1.00 19.99  ? 108  THR B CG2 1 
ATOM   4153  N  N   . VAL B  2  109 ? 60.884 107.638 96.411  1.00 37.00  ? 109  VAL B N   1 
ATOM   4154  C  CA  . VAL B  2  109 ? 60.679 108.019 97.763  1.00 36.47  ? 109  VAL B CA  1 
ATOM   4155  C  C   . VAL B  2  109 ? 59.181 108.413 97.863  1.00 36.66  ? 109  VAL B C   1 
ATOM   4156  O  O   . VAL B  2  109 ? 58.640 108.989 96.930  1.00 36.56  ? 109  VAL B O   1 
ATOM   4157  C  CB  . VAL B  2  109 ? 61.684 109.138 98.086  1.00 36.40  ? 109  VAL B CB  1 
ATOM   4158  C  CG1 . VAL B  2  109 ? 61.063 110.521 98.028  1.00 32.82  ? 109  VAL B CG1 1 
ATOM   4159  C  CG2 . VAL B  2  109 ? 62.378 108.884 99.330  1.00 41.40  ? 109  VAL B CG2 1 
ATOM   4160  N  N   . GLU B  2  110 ? 58.465 107.954 98.903  1.00 37.03  ? 110  GLU B N   1 
ATOM   4161  C  CA  . GLU B  2  110 ? 57.015 108.283 98.973  1.00 36.62  ? 110  GLU B CA  1 
ATOM   4162  C  C   . GLU B  2  110 ? 56.549 108.813 100.293 1.00 35.35  ? 110  GLU B C   1 
ATOM   4163  O  O   . GLU B  2  110 ? 57.088 108.448 101.296 1.00 36.16  ? 110  GLU B O   1 
ATOM   4164  C  CB  . GLU B  2  110 ? 56.142 107.153 98.424  1.00 37.04  ? 110  GLU B CB  1 
ATOM   4165  C  CG  . GLU B  2  110 ? 55.329 106.363 99.398  1.00 53.29  ? 110  GLU B CG  1 
ATOM   4166  C  CD  . GLU B  2  110 ? 54.636 105.194 98.694  1.00 63.17  ? 110  GLU B CD  1 
ATOM   4167  O  OE1 . GLU B  2  110 ? 53.572 104.707 99.191  1.00 60.95  ? 110  GLU B OE1 1 
ATOM   4168  O  OE2 . GLU B  2  110 ? 55.172 104.756 97.636  1.00 61.43  ? 110  GLU B OE2 1 
ATOM   4169  N  N   . CYS B  2  111 ? 55.597 109.743 100.271 1.00 33.58  ? 111  CYS B N   1 
ATOM   4170  C  CA  . CYS B  2  111 ? 55.096 110.388 101.488 1.00 32.95  ? 111  CYS B CA  1 
ATOM   4171  C  C   . CYS B  2  111 ? 53.944 111.303 101.147 1.00 32.79  ? 111  CYS B C   1 
ATOM   4172  O  O   . CYS B  2  111 ? 53.678 111.562 99.970  1.00 32.83  ? 111  CYS B O   1 
ATOM   4173  C  CB  . CYS B  2  111 ? 56.191 111.237 102.116 1.00 33.14  ? 111  CYS B CB  1 
ATOM   4174  S  SG  . CYS B  2  111 ? 56.725 112.649 101.065 1.00 37.71  ? 111  CYS B SG  1 
ATOM   4175  N  N   . LEU B  2  112 ? 53.273 111.826 102.178 1.00 32.47  ? 112  LEU B N   1 
ATOM   4176  C  CA  . LEU B  2  112 ? 52.166 112.771 101.983 1.00 31.85  ? 112  LEU B CA  1 
ATOM   4177  C  C   . LEU B  2  112 ? 52.749 114.107 101.504 1.00 32.20  ? 112  LEU B C   1 
ATOM   4178  O  O   . LEU B  2  112 ? 53.923 114.377 101.749 1.00 31.85  ? 112  LEU B O   1 
ATOM   4179  C  CB  . LEU B  2  112 ? 51.434 112.979 103.280 1.00 31.41  ? 112  LEU B CB  1 
ATOM   4180  C  CG  . LEU B  2  112 ? 50.938 111.765 104.093 1.00 28.22  ? 112  LEU B CG  1 
ATOM   4181  C  CD1 . LEU B  2  112 ? 50.468 112.257 105.468 1.00 27.56  ? 112  LEU B CD1 1 
ATOM   4182  C  CD2 . LEU B  2  112 ? 49.807 111.044 103.400 1.00 21.29  ? 112  LEU B CD2 1 
ATOM   4183  N  N   . ARG B  2  113 ? 51.924 114.932 100.818 1.00 32.85  ? 113  ARG B N   1 
ATOM   4184  C  CA  . ARG B  2  113 ? 52.360 116.244 100.229 1.00 33.06  ? 113  ARG B CA  1 
ATOM   4185  C  C   . ARG B  2  113 ? 53.176 117.110 101.128 1.00 33.06  ? 113  ARG B C   1 
ATOM   4186  O  O   . ARG B  2  113 ? 54.193 117.655 100.723 1.00 33.38  ? 113  ARG B O   1 
ATOM   4187  C  CB  . ARG B  2  113 ? 51.173 117.092 99.875  1.00 33.38  ? 113  ARG B CB  1 
ATOM   4188  C  CG  . ARG B  2  113 ? 50.390 116.633 98.817  1.00 44.63  ? 113  ARG B CG  1 
ATOM   4189  C  CD  . ARG B  2  113 ? 49.401 117.675 98.319  1.00 47.81  ? 113  ARG B CD  1 
ATOM   4190  N  NE  . ARG B  2  113 ? 49.029 117.325 96.963  1.00 57.40  ? 113  ARG B NE  1 
ATOM   4191  C  CZ  . ARG B  2  113 ? 49.557 117.862 95.883  1.00 50.52  ? 113  ARG B CZ  1 
ATOM   4192  N  NH1 . ARG B  2  113 ? 50.420 118.864 95.980  1.00 46.65  ? 113  ARG B NH1 1 
ATOM   4193  N  NH2 . ARG B  2  113 ? 49.187 117.426 94.708  1.00 55.02  ? 113  ARG B NH2 1 
ATOM   4194  N  N   . ASP B  2  114 ? 52.676 117.291 102.339 1.00 32.99  ? 114  ASP B N   1 
ATOM   4195  C  CA  . ASP B  2  114 ? 53.291 118.162 103.324 1.00 33.30  ? 114  ASP B CA  1 
ATOM   4196  C  C   . ASP B  2  114 ? 54.713 117.776 103.665 1.00 33.58  ? 114  ASP B C   1 
ATOM   4197  O  O   . ASP B  2  114 ? 55.466 118.592 104.124 1.00 34.77  ? 114  ASP B O   1 
ATOM   4198  C  CB  . ASP B  2  114 ? 52.448 118.203 104.616 1.00 33.29  ? 114  ASP B CB  1 
ATOM   4199  C  CG  . ASP B  2  114 ? 50.969 118.566 104.359 1.00 40.68  ? 114  ASP B CG  1 
ATOM   4200  O  OD1 . ASP B  2  114 ? 50.147 118.361 105.284 1.00 50.88  ? 114  ASP B OD1 1 
ATOM   4201  O  OD2 . ASP B  2  114 ? 50.536 119.067 103.283 1.00 33.02  ? 114  ASP B OD2 1 
ATOM   4202  N  N   . ASP B  2  115 ? 55.093 116.543 103.397 1.00 32.76  ? 115  ASP B N   1 
ATOM   4203  C  CA  . ASP B  2  115 ? 56.419 116.104 103.744 1.00 32.34  ? 115  ASP B CA  1 
ATOM   4204  C  C   . ASP B  2  115 ? 57.431 115.942 102.627 1.00 32.66  ? 115  ASP B C   1 
ATOM   4205  O  O   . ASP B  2  115 ? 58.557 115.521 102.907 1.00 33.18  ? 115  ASP B O   1 
ATOM   4206  C  CB  . ASP B  2  115 ? 56.367 114.859 104.595 1.00 31.87  ? 115  ASP B CB  1 
ATOM   4207  C  CG  . ASP B  2  115 ? 55.537 115.056 105.837 1.00 41.18  ? 115  ASP B CG  1 
ATOM   4208  O  OD1 . ASP B  2  115 ? 56.026 115.736 106.788 1.00 41.83  ? 115  ASP B OD1 1 
ATOM   4209  O  OD2 . ASP B  2  115 ? 54.362 114.608 105.948 1.00 38.33  ? 115  ASP B OD2 1 
ATOM   4210  N  N   . VAL B  2  116 ? 57.080 116.317 101.382 1.00 32.21  ? 116  VAL B N   1 
ATOM   4211  C  CA  . VAL B  2  116 ? 58.034 116.192 100.286 1.00 32.83  ? 116  VAL B CA  1 
ATOM   4212  C  C   . VAL B  2  116 ? 59.449 116.706 100.612 1.00 33.61  ? 116  VAL B C   1 
ATOM   4213  O  O   . VAL B  2  116 ? 60.426 116.012 100.397 1.00 33.63  ? 116  VAL B O   1 
ATOM   4214  C  CB  . VAL B  2  116 ? 57.540 116.833 98.975  1.00 33.01  ? 116  VAL B CB  1 
ATOM   4215  C  CG1 . VAL B  2  116 ? 56.427 116.080 98.451  1.00 41.34  ? 116  VAL B CG1 1 
ATOM   4216  C  CG2 . VAL B  2  116 ? 57.136 118.245 99.178  1.00 41.19  ? 116  VAL B CG2 1 
ATOM   4217  N  N   . ASP B  2  117 ? 59.533 117.883 101.196 1.00 34.60  ? 117  ASP B N   1 
ATOM   4218  C  CA  . ASP B  2  117 ? 60.806 118.488 101.487 1.00 35.83  ? 117  ASP B CA  1 
ATOM   4219  C  C   . ASP B  2  117 ? 61.838 117.606 102.222 1.00 36.23  ? 117  ASP B C   1 
ATOM   4220  O  O   . ASP B  2  117 ? 62.950 117.431 101.731 1.00 36.23  ? 117  ASP B O   1 
ATOM   4221  C  CB  . ASP B  2  117 ? 60.637 119.896 102.112 1.00 36.16  ? 117  ASP B CB  1 
ATOM   4222  C  CG  . ASP B  2  117 ? 59.998 120.932 101.108 1.00 47.19  ? 117  ASP B CG  1 
ATOM   4223  O  OD1 . ASP B  2  117 ? 60.198 120.810 99.865  1.00 52.85  ? 117  ASP B OD1 1 
ATOM   4224  O  OD2 . ASP B  2  117 ? 59.308 121.899 101.478 1.00 54.96  ? 117  ASP B OD2 1 
ATOM   4225  N  N   . ILE B  2  118 ? 61.472 116.997 103.344 1.00 36.62  ? 118  ILE B N   1 
ATOM   4226  C  CA  . ILE B  2  118 ? 62.466 116.187 104.007 1.00 37.02  ? 118  ILE B CA  1 
ATOM   4227  C  C   . ILE B  2  118 ? 62.852 114.917 103.206 1.00 37.01  ? 118  ILE B C   1 
ATOM   4228  O  O   . ILE B  2  118 ? 64.046 114.577 103.100 1.00 37.52  ? 118  ILE B O   1 
ATOM   4229  C  CB  . ILE B  2  118 ? 62.207 115.960 105.618 1.00 37.59  ? 118  ILE B CB  1 
ATOM   4230  C  CG1 . ILE B  2  118 ? 63.578 115.827 106.356 1.00 47.14  ? 118  ILE B CG1 1 
ATOM   4231  C  CG2 . ILE B  2  118 ? 61.354 114.726 105.898 1.00 23.58  ? 118  ILE B CG2 1 
ATOM   4232  C  CD1 . ILE B  2  118 ? 63.553 116.089 107.886 1.00 48.98  ? 118  ILE B CD1 1 
ATOM   4233  N  N   . LEU B  2  119 ? 61.869 114.304 102.549 1.00 36.04  ? 119  LEU B N   1 
ATOM   4234  C  CA  . LEU B  2  119 ? 62.119 113.125 101.744 1.00 35.42  ? 119  LEU B CA  1 
ATOM   4235  C  C   . LEU B  2  119 ? 63.009 113.417 100.557 1.00 34.94  ? 119  LEU B C   1 
ATOM   4236  O  O   . LEU B  2  119 ? 63.888 112.601 100.199 1.00 35.56  ? 119  LEU B O   1 
ATOM   4237  C  CB  . LEU B  2  119 ? 60.814 112.478 101.288 1.00 35.82  ? 119  LEU B CB  1 
ATOM   4238  C  CG  . LEU B  2  119 ? 60.069 111.569 102.298 1.00 49.27  ? 119  LEU B CG  1 
ATOM   4239  C  CD1 . LEU B  2  119 ? 59.685 110.378 101.589 1.00 51.65  ? 119  LEU B CD1 1 
ATOM   4240  C  CD2 . LEU B  2  119 ? 60.938 111.133 103.415 1.00 56.36  ? 119  LEU B CD2 1 
ATOM   4241  N  N   . MET B  2  120 ? 62.779 114.564 99.931  1.00 33.87  ? 120  MET B N   1 
ATOM   4242  C  CA  . MET B  2  120 ? 63.600 115.024 98.830  1.00 33.28  ? 120  MET B CA  1 
ATOM   4243  C  C   . MET B  2  120 ? 65.033 115.116 99.276  1.00 33.13  ? 120  MET B C   1 
ATOM   4244  O  O   . MET B  2  120 ? 65.940 114.664 98.572  1.00 33.59  ? 120  MET B O   1 
ATOM   4245  C  CB  . MET B  2  120 ? 63.165 116.412 98.406  1.00 33.52  ? 120  MET B CB  1 
ATOM   4246  C  CG  . MET B  2  120 ? 63.966 116.971 97.295  1.00 37.14  ? 120  MET B CG  1 
ATOM   4247  S  SD  . MET B  2  120 ? 63.603 116.088 95.845  1.00 54.98  ? 120  MET B SD  1 
ATOM   4248  C  CE  . MET B  2  120 ? 61.821 116.547 95.682  1.00 43.92  ? 120  MET B CE  1 
ATOM   4249  N  N   . GLU B  2  121 ? 65.244 115.698 100.458 1.00 32.52  ? 121  GLU B N   1 
ATOM   4250  C  CA  . GLU B  2  121 ? 66.576 115.851 100.999 1.00 32.45  ? 121  GLU B CA  1 
ATOM   4251  C  C   . GLU B  2  121 ? 67.312 114.517 101.254 1.00 33.17  ? 121  GLU B C   1 
ATOM   4252  O  O   . GLU B  2  121 ? 68.506 114.369 100.923 1.00 34.33  ? 121  GLU B O   1 
ATOM   4253  C  CB  . GLU B  2  121 ? 66.520 116.652 102.245 1.00 32.48  ? 121  GLU B CB  1 
ATOM   4254  C  CG  . GLU B  2  121 ? 67.772 116.573 103.076 1.00 42.94  ? 121  GLU B CG  1 
ATOM   4255  C  CD  . GLU B  2  121 ? 67.798 117.620 104.131 1.00 45.45  ? 121  GLU B CD  1 
ATOM   4256  O  OE1 . GLU B  2  121 ? 68.324 117.359 105.230 1.00 51.57  ? 121  GLU B OE1 1 
ATOM   4257  O  OE2 . GLU B  2  121 ? 67.286 118.697 103.866 1.00 44.50  ? 121  GLU B OE2 1 
ATOM   4258  N  N   . PHE B  2  122 ? 66.606 113.542 101.791 1.00 32.45  ? 122  PHE B N   1 
ATOM   4259  C  CA  . PHE B  2  122 ? 67.206 112.258 102.070 1.00 32.04  ? 122  PHE B CA  1 
ATOM   4260  C  C   . PHE B  2  122 ? 67.544 111.626 100.716 1.00 32.40  ? 122  PHE B C   1 
ATOM   4261  O  O   . PHE B  2  122 ? 68.613 111.018 100.539 1.00 31.87  ? 122  PHE B O   1 
ATOM   4262  C  CB  . PHE B  2  122 ? 66.208 111.354 102.811 1.00 31.98  ? 122  PHE B CB  1 
ATOM   4263  C  CG  . PHE B  2  122 ? 65.996 111.703 104.285 1.00 26.08  ? 122  PHE B CG  1 
ATOM   4264  C  CD1 . PHE B  2  122 ? 64.708 111.774 104.814 1.00 29.54  ? 122  PHE B CD1 1 
ATOM   4265  C  CD2 . PHE B  2  122 ? 67.063 111.829 105.154 1.00 33.01  ? 122  PHE B CD2 1 
ATOM   4266  C  CE1 . PHE B  2  122 ? 64.488 112.067 106.212 1.00 28.33  ? 122  PHE B CE1 1 
ATOM   4267  C  CE2 . PHE B  2  122 ? 66.843 112.112 106.556 1.00 30.33  ? 122  PHE B CE2 1 
ATOM   4268  C  CZ  . PHE B  2  122 ? 65.553 112.217 107.055 1.00 23.63  ? 122  PHE B CZ  1 
ATOM   4269  N  N   . LEU B  2  123 ? 66.630 111.782 99.756  1.00 33.10  ? 123  LEU B N   1 
ATOM   4270  C  CA  . LEU B  2  123 ? 66.832 111.227 98.414  1.00 33.98  ? 123  LEU B CA  1 
ATOM   4271  C  C   . LEU B  2  123 ? 68.151 111.763 97.865  1.00 35.36  ? 123  LEU B C   1 
ATOM   4272  O  O   . LEU B  2  123 ? 68.997 111.009 97.458  1.00 36.21  ? 123  LEU B O   1 
ATOM   4273  C  CB  . LEU B  2  123 ? 65.737 111.702 97.506  1.00 33.80  ? 123  LEU B CB  1 
ATOM   4274  C  CG  . LEU B  2  123 ? 65.239 110.859 96.372  1.00 33.74  ? 123  LEU B CG  1 
ATOM   4275  C  CD1 . LEU B  2  123 ? 65.015 111.762 95.254  1.00 22.52  ? 123  LEU B CD1 1 
ATOM   4276  C  CD2 . LEU B  2  123 ? 66.155 109.787 95.996  1.00 35.40  ? 123  LEU B CD2 1 
ATOM   4277  N  N   . LEU B  2  124 ? 68.315 113.092 97.891  1.00 35.28  ? 124  LEU B N   1 
ATOM   4278  C  CA  . LEU B  2  124 ? 69.518 113.724 97.368  1.00 34.32  ? 124  LEU B CA  1 
ATOM   4279  C  C   . LEU B  2  124 ? 70.733 113.279 98.080  1.00 33.74  ? 124  LEU B C   1 
ATOM   4280  O  O   . LEU B  2  124 ? 71.761 113.053 97.470  1.00 34.56  ? 124  LEU B O   1 
ATOM   4281  C  CB  . LEU B  2  124 ? 69.398 115.232 97.378  1.00 33.78  ? 124  LEU B CB  1 
ATOM   4282  C  CG  . LEU B  2  124 ? 68.369 115.751 96.384  1.00 32.36  ? 124  LEU B CG  1 
ATOM   4283  C  CD1 . LEU B  2  124 ? 68.174 117.244 96.538  1.00 35.74  ? 124  LEU B CD1 1 
ATOM   4284  C  CD2 . LEU B  2  124 ? 68.712 115.378 94.954  1.00 18.93  ? 124  LEU B CD2 1 
ATOM   4285  N  N   . ASN B  2  125 ? 70.620 113.124 99.366  1.00 32.71  ? 125  ASN B N   1 
ATOM   4286  C  CA  . ASN B  2  125 ? 71.722 112.642 100.141 1.00 32.98  ? 125  ASN B CA  1 
ATOM   4287  C  C   . ASN B  2  125 ? 72.175 111.159 99.782  1.00 33.20  ? 125  ASN B C   1 
ATOM   4288  O  O   . ASN B  2  125 ? 73.383 110.876 99.663  1.00 33.78  ? 125  ASN B O   1 
ATOM   4289  C  CB  . ASN B  2  125 ? 71.378 112.769 101.608 1.00 32.67  ? 125  ASN B CB  1 
ATOM   4290  C  CG  . ASN B  2  125 ? 71.717 114.111 102.136 1.00 42.07  ? 125  ASN B CG  1 
ATOM   4291  O  OD1 . ASN B  2  125 ? 72.861 114.518 102.055 1.00 36.30  ? 125  ASN B OD1 1 
ATOM   4292  N  ND2 . ASN B  2  125 ? 70.713 114.858 102.624 1.00 42.90  ? 125  ASN B ND2 1 
ATOM   4293  N  N   . VAL B  2  126 ? 71.196 110.268 99.586  1.00 31.95  ? 126  VAL B N   1 
ATOM   4294  C  CA  . VAL B  2  126 ? 71.448 108.889 99.256  1.00 31.59  ? 126  VAL B CA  1 
ATOM   4295  C  C   . VAL B  2  126 ? 72.091 108.725 97.889  1.00 31.07  ? 126  VAL B C   1 
ATOM   4296  O  O   . VAL B  2  126 ? 72.979 107.860 97.691  1.00 30.56  ? 126  VAL B O   1 
ATOM   4297  C  CB  . VAL B  2  126 ? 70.100 108.082 99.225  1.00 32.19  ? 126  VAL B CB  1 
ATOM   4298  C  CG1 . VAL B  2  126 ? 70.321 106.669 98.711  1.00 29.73  ? 126  VAL B CG1 1 
ATOM   4299  C  CG2 . VAL B  2  126 ? 69.462 108.051 100.576 1.00 23.35  ? 126  VAL B CG2 1 
ATOM   4300  N  N   . THR B  2  127 ? 71.657 109.568 96.952  1.00 30.81  ? 127  THR B N   1 
ATOM   4301  C  CA  . THR B  2  127 ? 72.103 109.499 95.593  1.00 31.16  ? 127  THR B CA  1 
ATOM   4302  C  C   . THR B  2  127 ? 73.275 110.354 95.264  1.00 32.93  ? 127  THR B C   1 
ATOM   4303  O  O   . THR B  2  127 ? 73.949 110.081 94.278  1.00 34.38  ? 127  THR B O   1 
ATOM   4304  C  CB  . THR B  2  127 ? 70.957 109.827 94.624  1.00 30.97  ? 127  THR B CB  1 
ATOM   4305  O  OG1 . THR B  2  127 ? 70.415 111.099 94.957  1.00 39.45  ? 127  THR B OG1 1 
ATOM   4306  C  CG2 . THR B  2  127 ? 69.717 108.856 94.831  1.00 32.53  ? 127  THR B CG2 1 
ATOM   4307  N  N   . THR B  2  128 ? 73.549 111.419 96.038  1.00 32.64  ? 128  THR B N   1 
ATOM   4308  C  CA  . THR B  2  128 ? 74.671 112.298 95.656  1.00 32.46  ? 128  THR B CA  1 
ATOM   4309  C  C   . THR B  2  128 ? 75.718 112.531 96.710  1.00 32.45  ? 128  THR B C   1 
ATOM   4310  O  O   . THR B  2  128 ? 76.760 113.096 96.432  1.00 32.24  ? 128  THR B O   1 
ATOM   4311  C  CB  . THR B  2  128 ? 74.193 113.670 95.152  1.00 32.49  ? 128  THR B CB  1 
ATOM   4312  O  OG1 . THR B  2  128 ? 73.689 114.407 96.244  1.00 31.84  ? 128  THR B OG1 1 
ATOM   4313  C  CG2 . THR B  2  128 ? 72.990 113.568 94.175  1.00 27.43  ? 128  THR B CG2 1 
ATOM   4314  N  N   . ALA B  2  129 ? 75.425 112.173 97.935  1.00 32.45  ? 129  ALA B N   1 
ATOM   4315  C  CA  . ALA B  2  129 ? 76.423 112.309 98.975  1.00 31.22  ? 129  ALA B CA  1 
ATOM   4316  C  C   . ALA B  2  129 ? 76.571 111.034 99.868  1.00 30.61  ? 129  ALA B C   1 
ATOM   4317  O  O   . ALA B  2  129 ? 76.622 111.151 101.048 1.00 30.27  ? 129  ALA B O   1 
ATOM   4318  C  CB  . ALA B  2  129 ? 76.147 113.525 99.822  1.00 30.14  ? 129  ALA B CB  1 
ATOM   4319  N  N   . PRO B  2  130 ? 76.642 109.838 99.287  1.00 30.69  ? 130  PRO B N   1 
ATOM   4320  C  CA  . PRO B  2  130 ? 76.843 108.629 100.100 1.00 30.92  ? 130  PRO B CA  1 
ATOM   4321  C  C   . PRO B  2  130 ? 78.270 108.596 100.619 1.00 31.52  ? 130  PRO B C   1 
ATOM   4322  O  O   . PRO B  2  130 ? 79.148 109.020 99.917  1.00 32.10  ? 130  PRO B O   1 
ATOM   4323  C  CB  . PRO B  2  130 ? 76.678 107.496 99.092  1.00 30.60  ? 130  PRO B CB  1 
ATOM   4324  C  CG  . PRO B  2  130 ? 76.106 108.066 97.923  1.00 27.55  ? 130  PRO B CG  1 
ATOM   4325  C  CD  . PRO B  2  130 ? 76.501 109.511 97.863  1.00 30.48  ? 130  PRO B CD  1 
ATOM   4326  N  N   . GLU B  2  131 ? 78.495 108.126 101.831 1.00 31.16  ? 131  GLU B N   1 
ATOM   4327  C  CA  . GLU B  2  131 ? 79.847 108.058 102.326 1.00 30.61  ? 131  GLU B CA  1 
ATOM   4328  C  C   . GLU B  2  131 ? 80.460 106.643 102.211 1.00 30.18  ? 131  GLU B C   1 
ATOM   4329  O  O   . GLU B  2  131 ? 81.670 106.497 102.194 1.00 30.71  ? 131  GLU B O   1 
ATOM   4330  C  CB  . GLU B  2  131 ? 79.918 108.556 103.757 1.00 30.46  ? 131  GLU B CB  1 
ATOM   4331  C  CG  . GLU B  2  131 ? 79.816 110.056 103.896 1.00 45.53  ? 131  GLU B CG  1 
ATOM   4332  C  CD  . GLU B  2  131 ? 79.790 110.507 105.350 1.00 50.19  ? 131  GLU B CD  1 
ATOM   4333  O  OE1 . GLU B  2  131 ? 80.644 110.057 106.136 1.00 48.51  ? 131  GLU B OE1 1 
ATOM   4334  O  OE2 . GLU B  2  131 ? 78.911 111.308 105.703 1.00 51.71  ? 131  GLU B OE2 1 
ATOM   4335  N  N   . PHE B  2  132 ? 79.605 105.624 102.138 1.00 29.49  ? 132  PHE B N   1 
ATOM   4336  C  CA  . PHE B  2  132 ? 80.039 104.220 102.067 1.00 29.30  ? 132  PHE B CA  1 
ATOM   4337  C  C   . PHE B  2  132 ? 81.136 103.910 103.053 1.00 29.89  ? 132  PHE B C   1 
ATOM   4338  O  O   . PHE B  2  132 ? 82.218 103.521 102.648 1.00 30.51  ? 132  PHE B O   1 
ATOM   4339  C  CB  . PHE B  2  132 ? 80.529 103.875 100.664 1.00 28.58  ? 132  PHE B CB  1 
ATOM   4340  C  CG  . PHE B  2  132 ? 79.495 104.037 99.613  1.00 22.43  ? 132  PHE B CG  1 
ATOM   4341  C  CD1 . PHE B  2  132 ? 79.735 104.829 98.494  1.00 22.30  ? 132  PHE B CD1 1 
ATOM   4342  C  CD2 . PHE B  2  132 ? 78.270 103.405 99.734  1.00 23.98  ? 132  PHE B CD2 1 
ATOM   4343  C  CE1 . PHE B  2  132 ? 78.759 104.950 97.498  1.00 27.26  ? 132  PHE B CE1 1 
ATOM   4344  C  CE2 . PHE B  2  132 ? 77.278 103.564 98.780  1.00 28.91  ? 132  PHE B CE2 1 
ATOM   4345  C  CZ  . PHE B  2  132 ? 77.513 104.308 97.664  1.00 22.21  ? 132  PHE B CZ  1 
ATOM   4346  N  N   . ARG B  2  133 ? 80.884 104.142 104.338 1.00 29.16  ? 133  ARG B N   1 
ATOM   4347  C  CA  . ARG B  2  133 ? 81.869 103.871 105.369 1.00 28.82  ? 133  ARG B CA  1 
ATOM   4348  C  C   . ARG B  2  133 ? 82.248 102.384 105.470 1.00 29.11  ? 133  ARG B C   1 
ATOM   4349  O  O   . ARG B  2  133 ? 81.367 101.494 105.568 1.00 29.78  ? 133  ARG B O   1 
ATOM   4350  C  CB  . ARG B  2  133 ? 81.323 104.324 106.720 1.00 29.26  ? 133  ARG B CB  1 
ATOM   4351  C  CG  . ARG B  2  133 ? 81.128 105.845 106.872 1.00 22.97  ? 133  ARG B CG  1 
ATOM   4352  C  CD  . ARG B  2  133 ? 80.320 106.231 108.068 1.00 12.23  ? 133  ARG B CD  1 
ATOM   4353  N  NE  . ARG B  2  133 ? 80.224 107.688 108.241 1.00 29.09  ? 133  ARG B NE  1 
ATOM   4354  C  CZ  . ARG B  2  133 ? 79.826 108.262 109.364 1.00 28.14  ? 133  ARG B CZ  1 
ATOM   4355  N  NH1 . ARG B  2  133 ? 79.494 107.511 110.432 1.00 22.43  ? 133  ARG B NH1 1 
ATOM   4356  N  NH2 . ARG B  2  133 ? 79.781 109.564 109.449 1.00 28.46  ? 133  ARG B NH2 1 
ATOM   4357  N  N   . ARG B  2  134 ? 83.545 102.131 105.458 1.00 28.55  ? 134  ARG B N   1 
ATOM   4358  C  CA  . ARG B  2  134 ? 84.138 100.796 105.579 1.00 28.80  ? 134  ARG B CA  1 
ATOM   4359  C  C   . ARG B  2  134 ? 83.348 99.818  106.440 1.00 30.47  ? 134  ARG B C   1 
ATOM   4360  O  O   . ARG B  2  134 ? 82.910 98.733  105.954 1.00 31.66  ? 134  ARG B O   1 
ATOM   4361  C  CB  . ARG B  2  134 ? 85.486 100.932 106.190 1.00 28.57  ? 134  ARG B CB  1 
ATOM   4362  C  CG  . ARG B  2  134 ? 86.573 100.147 105.588 1.00 29.95  ? 134  ARG B CG  1 
ATOM   4363  C  CD  . ARG B  2  134 ? 87.975 100.547 106.156 1.00 37.30  ? 134  ARG B CD  1 
ATOM   4364  N  NE  . ARG B  2  134 ? 87.955 100.509 107.612 1.00 46.99  ? 134  ARG B NE  1 
ATOM   4365  C  CZ  . ARG B  2  134 ? 88.330 101.508 108.377 1.00 61.71  ? 134  ARG B CZ  1 
ATOM   4366  N  NH1 . ARG B  2  134 ? 88.809 102.630 107.832 1.00 71.87  ? 134  ARG B NH1 1 
ATOM   4367  N  NH2 . ARG B  2  134 ? 88.239 101.401 109.688 1.00 65.47  ? 134  ARG B NH2 1 
ATOM   4368  N  N   . TRP B  2  135 ? 83.123 100.182 107.691 1.00 30.57  ? 135  TRP B N   1 
ATOM   4369  C  CA  . TRP B  2  135 ? 82.417 99.285  108.618 1.00 30.42  ? 135  TRP B CA  1 
ATOM   4370  C  C   . TRP B  2  135 ? 80.961 99.078  108.313 1.00 31.19  ? 135  TRP B C   1 
ATOM   4371  O  O   . TRP B  2  135 ? 80.427 97.962  108.532 1.00 32.11  ? 135  TRP B O   1 
ATOM   4372  C  CB  . TRP B  2  135 ? 82.589 99.714  110.060 1.00 29.87  ? 135  TRP B CB  1 
ATOM   4373  C  CG  . TRP B  2  135 ? 82.172 101.103 110.285 1.00 34.00  ? 135  TRP B CG  1 
ATOM   4374  C  CD1 . TRP B  2  135 ? 80.896 101.562 110.574 1.00 27.82  ? 135  TRP B CD1 1 
ATOM   4375  C  CD2 . TRP B  2  135 ? 83.001 102.247 110.228 1.00 20.43  ? 135  TRP B CD2 1 
ATOM   4376  N  NE1 . TRP B  2  135 ? 80.911 102.920 110.734 1.00 26.85  ? 135  TRP B NE1 1 
ATOM   4377  C  CE2 . TRP B  2  135 ? 82.187 103.375 110.521 1.00 21.43  ? 135  TRP B CE2 1 
ATOM   4378  C  CE3 . TRP B  2  135 ? 84.361 102.443 109.985 1.00 24.01  ? 135  TRP B CE3 1 
ATOM   4379  C  CZ2 . TRP B  2  135 ? 82.671 104.631 110.559 1.00 13.44  ? 135  TRP B CZ2 1 
ATOM   4380  C  CZ3 . TRP B  2  135 ? 84.862 103.729 110.037 1.00 25.62  ? 135  TRP B CZ3 1 
ATOM   4381  C  CH2 . TRP B  2  135 ? 84.029 104.803 110.313 1.00 21.15  ? 135  TRP B CH2 1 
ATOM   4382  N  N   . GLU B  2  136 ? 80.281 100.115 107.833 1.00 30.90  ? 136  GLU B N   1 
ATOM   4383  C  CA  . GLU B  2  136 ? 78.856 99.946  107.460 1.00 31.08  ? 136  GLU B CA  1 
ATOM   4384  C  C   . GLU B  2  136 ? 78.727 99.069  106.237 1.00 31.66  ? 136  GLU B C   1 
ATOM   4385  O  O   . GLU B  2  136 ? 77.742 98.343  106.104 1.00 31.91  ? 136  GLU B O   1 
ATOM   4386  C  CB  . GLU B  2  136 ? 78.196 101.285 107.166 1.00 31.12  ? 136  GLU B CB  1 
ATOM   4387  C  CG  . GLU B  2  136 ? 78.033 102.165 108.385 1.00 27.29  ? 136  GLU B CG  1 
ATOM   4388  C  CD  . GLU B  2  136 ? 77.267 103.411 108.101 1.00 27.69  ? 136  GLU B CD  1 
ATOM   4389  O  OE1 . GLU B  2  136 ? 77.025 104.171 109.049 1.00 38.43  ? 136  GLU B OE1 1 
ATOM   4390  O  OE2 . GLU B  2  136 ? 76.917 103.654 106.935 1.00 30.81  ? 136  GLU B OE2 1 
ATOM   4391  N  N   . VAL B  2  137 ? 79.714 99.164  105.319 1.00 31.97  ? 137  VAL B N   1 
ATOM   4392  C  CA  . VAL B  2  137 ? 79.696 98.367  104.083 1.00 32.93  ? 137  VAL B CA  1 
ATOM   4393  C  C   . VAL B  2  137 ? 80.029 96.909  104.390 1.00 33.29  ? 137  VAL B C   1 
ATOM   4394  O  O   . VAL B  2  137 ? 79.403 96.014  103.848 1.00 34.79  ? 137  VAL B O   1 
ATOM   4395  C  CB  . VAL B  2  137 ? 80.633 98.957  102.959 1.00 33.57  ? 137  VAL B CB  1 
ATOM   4396  C  CG1 . VAL B  2  137 ? 80.825 97.956  101.830 1.00 26.47  ? 137  VAL B CG1 1 
ATOM   4397  C  CG2 . VAL B  2  137 ? 80.066 100.270 102.403 1.00 22.06  ? 137  VAL B CG2 1 
ATOM   4398  N  N   . ALA B  2  138 ? 80.955 96.682  105.334 1.00 31.83  ? 138  ALA B N   1 
ATOM   4399  C  CA  . ALA B  2  138 ? 81.282 95.336  105.763 1.00 30.12  ? 138  ALA B CA  1 
ATOM   4400  C  C   . ALA B  2  138 ? 80.075 94.653  106.393 1.00 30.03  ? 138  ALA B C   1 
ATOM   4401  O  O   . ALA B  2  138 ? 79.786 93.494  106.076 1.00 30.35  ? 138  ALA B O   1 
ATOM   4402  C  CB  . ALA B  2  138 ? 82.445 95.315  106.676 1.00 28.43  ? 138  ALA B CB  1 
ATOM   4403  N  N   . ALA B  2  139 ? 79.313 95.394  107.179 1.00 29.68  ? 139  ALA B N   1 
ATOM   4404  C  CA  . ALA B  2  139 ? 78.124 94.844  107.857 1.00 29.76  ? 139  ALA B CA  1 
ATOM   4405  C  C   . ALA B  2  139 ? 76.997 94.497  106.911 1.00 31.43  ? 139  ALA B C   1 
ATOM   4406  O  O   . ALA B  2  139 ? 76.189 93.547  107.181 1.00 33.10  ? 139  ALA B O   1 
ATOM   4407  C  CB  . ALA B  2  139 ? 77.629 95.782  108.948 1.00 28.66  ? 139  ALA B CB  1 
ATOM   4408  N  N   . LEU B  2  140 ? 76.963 95.181  105.767 1.00 30.90  ? 140  LEU B N   1 
ATOM   4409  C  CA  . LEU B  2  140 ? 75.914 94.989  104.777 1.00 30.10  ? 140  LEU B CA  1 
ATOM   4410  C  C   . LEU B  2  140 ? 76.161 93.794  103.823 1.00 30.89  ? 140  LEU B C   1 
ATOM   4411  O  O   . LEU B  2  140 ? 75.208 93.242  103.270 1.00 30.96  ? 140  LEU B O   1 
ATOM   4412  C  CB  . LEU B  2  140 ? 75.791 96.246  103.961 1.00 29.83  ? 140  LEU B CB  1 
ATOM   4413  C  CG  . LEU B  2  140 ? 74.713 96.337  102.907 1.00 34.35  ? 140  LEU B CG  1 
ATOM   4414  C  CD1 . LEU B  2  140 ? 73.358 96.341  103.625 1.00 30.47  ? 140  LEU B CD1 1 
ATOM   4415  C  CD2 . LEU B  2  140 ? 74.934 97.605  102.099 1.00 32.49  ? 140  LEU B CD2 1 
ATOM   4416  N  N   . GLN B  2  141 ? 77.435 93.437  103.583 1.00 31.35  ? 141  GLN B N   1 
ATOM   4417  C  CA  . GLN B  2  141 ? 77.757 92.291  102.680 1.00 32.07  ? 141  GLN B CA  1 
ATOM   4418  C  C   . GLN B  2  141 ? 76.851 91.049  102.841 1.00 32.30  ? 141  GLN B C   1 
ATOM   4419  O  O   . GLN B  2  141 ? 76.260 90.623  101.858 1.00 32.74  ? 141  GLN B O   1 
ATOM   4420  C  CB  . GLN B  2  141 ? 79.261 91.910  102.697 1.00 32.61  ? 141  GLN B CB  1 
ATOM   4421  C  CG  . GLN B  2  141 ? 80.238 93.093  102.570 1.00 38.41  ? 141  GLN B CG  1 
ATOM   4422  C  CD  . GLN B  2  141 ? 80.704 93.367  101.098 1.00 36.35  ? 141  GLN B CD  1 
ATOM   4423  O  OE1 . GLN B  2  141 ? 80.269 92.709  100.163 1.00 37.78  ? 141  GLN B OE1 1 
ATOM   4424  N  NE2 . GLN B  2  141 ? 81.611 94.303  100.943 1.00 43.17  ? 141  GLN B NE2 1 
ATOM   4425  N  N   . PRO B  2  142 ? 76.676 90.504  104.065 1.00 32.00  ? 142  PRO B N   1 
ATOM   4426  C  CA  . PRO B  2  142 ? 75.781 89.340  104.221 1.00 31.99  ? 142  PRO B CA  1 
ATOM   4427  C  C   . PRO B  2  142 ? 74.360 89.541  103.683 1.00 32.58  ? 142  PRO B C   1 
ATOM   4428  O  O   . PRO B  2  142 ? 73.662 88.551  103.471 1.00 33.38  ? 142  PRO B O   1 
ATOM   4429  C  CB  . PRO B  2  142 ? 75.734 89.088  105.773 1.00 31.25  ? 142  PRO B CB  1 
ATOM   4430  C  CG  . PRO B  2  142 ? 76.999 89.628  106.293 1.00 31.83  ? 142  PRO B CG  1 
ATOM   4431  C  CD  . PRO B  2  142 ? 77.344 90.856  105.356 1.00 31.46  ? 142  PRO B CD  1 
ATOM   4432  N  N   . GLN B  2  143 ? 73.929 90.763  103.486 1.00 32.24  ? 143  GLN B N   1 
ATOM   4433  C  CA  . GLN B  2  143 ? 72.601 90.971  103.000 1.00 32.33  ? 143  GLN B CA  1 
ATOM   4434  C  C   . GLN B  2  143 ? 72.486 90.512  101.574 1.00 33.88  ? 143  GLN B C   1 
ATOM   4435  O  O   . GLN B  2  143 ? 71.438 90.011  101.175 1.00 35.06  ? 143  GLN B O   1 
ATOM   4436  C  CB  . GLN B  2  143 ? 72.173 92.415  103.169 1.00 32.09  ? 143  GLN B CB  1 
ATOM   4437  C  CG  . GLN B  2  143 ? 70.701 92.661  102.956 1.00 29.49  ? 143  GLN B CG  1 
ATOM   4438  C  CD  . GLN B  2  143 ? 69.814 91.938  103.974 1.00 35.02  ? 143  GLN B CD  1 
ATOM   4439  O  OE1 . GLN B  2  143 ? 68.683 91.556  103.659 1.00 39.13  ? 143  GLN B OE1 1 
ATOM   4440  N  NE2 . GLN B  2  143 ? 70.311 91.779  105.191 1.00 40.67  ? 143  GLN B NE2 1 
ATOM   4441  N  N   . LEU B  2  144 ? 73.588 90.586  100.815 1.00 34.36  ? 144  LEU B N   1 
ATOM   4442  C  CA  . LEU B  2  144 ? 73.605 90.101  99.400  1.00 34.56  ? 144  LEU B CA  1 
ATOM   4443  C  C   . LEU B  2  144 ? 73.167 88.641  99.308  1.00 34.67  ? 144  LEU B C   1 
ATOM   4444  O  O   . LEU B  2  144 ? 72.408 88.280  98.465  1.00 35.22  ? 144  LEU B O   1 
ATOM   4445  C  CB  . LEU B  2  144 ? 75.017 90.236  98.801  1.00 34.48  ? 144  LEU B CB  1 
ATOM   4446  C  CG  . LEU B  2  144 ? 75.509 91.671  98.595  1.00 24.01  ? 144  LEU B CG  1 
ATOM   4447  C  CD1 . LEU B  2  144 ? 77.037 91.817  98.650  1.00 32.35  ? 144  LEU B CD1 1 
ATOM   4448  C  CD2 . LEU B  2  144 ? 74.985 92.245  97.332  1.00 29.35  ? 144  LEU B CD2 1 
ATOM   4449  N  N   . ARG B  2  145 ? 73.668 87.828  100.214 1.00 34.71  ? 145  ARG B N   1 
ATOM   4450  C  CA  . ARG B  2  145 ? 73.368 86.428  100.267 1.00 34.65  ? 145  ARG B CA  1 
ATOM   4451  C  C   . ARG B  2  145 ? 71.894 86.191  100.704 1.00 34.07  ? 145  ARG B C   1 
ATOM   4452  O  O   . ARG B  2  145 ? 71.199 85.359  100.102 1.00 34.36  ? 145  ARG B O   1 
ATOM   4453  C  CB  . ARG B  2  145 ? 74.344 85.763  101.227 1.00 35.55  ? 145  ARG B CB  1 
ATOM   4454  C  CG  . ARG B  2  145 ? 74.465 84.248  101.112 1.00 41.99  ? 145  ARG B CG  1 
ATOM   4455  C  CD  . ARG B  2  145 ? 75.516 83.633  102.076 1.00 48.36  ? 145  ARG B CD  1 
ATOM   4456  N  NE  . ARG B  2  145 ? 76.829 84.340  102.081 1.00 40.53  ? 145  ARG B NE  1 
ATOM   4457  C  CZ  . ARG B  2  145 ? 77.263 85.096  103.096 1.00 62.64  ? 145  ARG B CZ  1 
ATOM   4458  N  NH1 . ARG B  2  145 ? 76.486 85.301  104.165 1.00 73.95  ? 145  ARG B NH1 1 
ATOM   4459  N  NH2 . ARG B  2  145 ? 78.457 85.682  103.038 1.00 72.01  ? 145  ARG B NH2 1 
ATOM   4460  N  N   . ILE B  2  146 ? 71.411 86.928  101.719 1.00 33.02  ? 146  ILE B N   1 
ATOM   4461  C  CA  . ILE B  2  146 ? 69.998 86.807  102.118 1.00 33.39  ? 146  ILE B CA  1 
ATOM   4462  C  C   . ILE B  2  146 ? 69.102 87.260  100.884 1.00 33.76  ? 146  ILE B C   1 
ATOM   4463  O  O   . ILE B  2  146 ? 68.183 86.492  100.410 1.00 34.09  ? 146  ILE B O   1 
ATOM   4464  C  CB  . ILE B  2  146 ? 69.636 87.703  103.379 1.00 34.04  ? 146  ILE B CB  1 
ATOM   4465  C  CG1 . ILE B  2  146 ? 70.534 87.422  104.623 1.00 25.73  ? 146  ILE B CG1 1 
ATOM   4466  C  CG2 . ILE B  2  146 ? 68.167 87.550  103.741 1.00 29.77  ? 146  ILE B CG2 1 
ATOM   4467  C  CD1 . ILE B  2  146 ? 70.785 85.971  104.887 1.00 49.72  ? 146  ILE B CD1 1 
ATOM   4468  N  N   . ASP B  2  147 ? 69.385 88.475  100.374 1.00 32.51  ? 147  ASP B N   1 
ATOM   4469  C  CA  . ASP B  2  147 ? 68.669 89.058  99.211  1.00 31.46  ? 147  ASP B CA  1 
ATOM   4470  C  C   . ASP B  2  147 ? 68.658 88.144  97.991  1.00 31.37  ? 147  ASP B C   1 
ATOM   4471  O  O   . ASP B  2  147 ? 67.572 87.845  97.397  1.00 32.31  ? 147  ASP B O   1 
ATOM   4472  C  CB  . ASP B  2  147 ? 69.299 90.386  98.828  1.00 31.51  ? 147  ASP B CB  1 
ATOM   4473  C  CG  . ASP B  2  147 ? 68.410 91.200  98.007  1.00 33.88  ? 147  ASP B CG  1 
ATOM   4474  O  OD1 . ASP B  2  147 ? 68.719 91.411  96.813  1.00 33.93  ? 147  ASP B OD1 1 
ATOM   4475  O  OD2 . ASP B  2  147 ? 67.342 91.662  98.453  1.00 38.28  ? 147  ASP B OD2 1 
ATOM   4476  N  N   . LYS B  2  148 ? 69.829 87.659  97.616  1.00 30.34  ? 148  LYS B N   1 
ATOM   4477  C  CA  . LYS B  2  148 ? 69.910 86.748  96.501  1.00 29.73  ? 148  LYS B CA  1 
ATOM   4478  C  C   . LYS B  2  148 ? 69.106 85.390  96.760  1.00 30.13  ? 148  LYS B C   1 
ATOM   4479  O  O   . LYS B  2  148 ? 68.414 84.866  95.822  1.00 30.91  ? 148  LYS B O   1 
ATOM   4480  C  CB  . LYS B  2  148 ? 71.336 86.448  96.174  1.00 28.75  ? 148  LYS B CB  1 
ATOM   4481  C  CG  . LYS B  2  148 ? 71.522 85.744  94.877  1.00 27.90  ? 148  LYS B CG  1 
ATOM   4482  C  CD  . LYS B  2  148 ? 72.986 85.397  94.678  1.00 29.53  ? 148  LYS B CD  1 
ATOM   4483  C  CE  . LYS B  2  148 ? 73.220 84.797  93.345  1.00 27.73  ? 148  LYS B CE  1 
ATOM   4484  N  NZ  . LYS B  2  148 ? 74.650 84.413  93.183  1.00 33.49  ? 148  LYS B NZ  1 
ATOM   4485  N  N   . ALA B  2  149 ? 69.203 84.834  97.978  1.00 28.61  ? 149  ALA B N   1 
ATOM   4486  C  CA  . ALA B  2  149 ? 68.498 83.558  98.280  1.00 27.70  ? 149  ALA B CA  1 
ATOM   4487  C  C   . ALA B  2  149 ? 67.016 83.737  98.114  1.00 29.69  ? 149  ALA B C   1 
ATOM   4488  O  O   . ALA B  2  149 ? 66.343 82.884  97.533  1.00 29.87  ? 149  ALA B O   1 
ATOM   4489  C  CB  . ALA B  2  149 ? 68.824 83.027  99.742  1.00 25.52  ? 149  ALA B CB  1 
ATOM   4490  N  N   . VAL B  2  150 ? 66.501 84.873  98.586  1.00 31.90  ? 150  VAL B N   1 
ATOM   4491  C  CA  . VAL B  2  150 ? 65.065 85.144  98.498  1.00 33.74  ? 150  VAL B CA  1 
ATOM   4492  C  C   . VAL B  2  150 ? 64.618 85.299  97.021  1.00 35.44  ? 150  VAL B C   1 
ATOM   4493  O  O   . VAL B  2  150 ? 63.623 84.773  96.634  1.00 36.54  ? 150  VAL B O   1 
ATOM   4494  C  CB  . VAL B  2  150 ? 64.653 86.400  99.362  1.00 34.23  ? 150  VAL B CB  1 
ATOM   4495  C  CG1 . VAL B  2  150 ? 63.295 86.817  99.024  1.00 21.55  ? 150  VAL B CG1 1 
ATOM   4496  C  CG2 . VAL B  2  150 ? 64.766 86.101  100.890 1.00 25.05  ? 150  VAL B CG2 1 
ATOM   4497  N  N   . ALA B  2  151 ? 65.391 85.996  96.199  1.00 35.74  ? 151  ALA B N   1 
ATOM   4498  C  CA  . ALA B  2  151 ? 65.016 86.112  94.787  1.00 35.46  ? 151  ALA B CA  1 
ATOM   4499  C  C   . ALA B  2  151 ? 65.078 84.763  94.113  1.00 35.20  ? 151  ALA B C   1 
ATOM   4500  O  O   . ALA B  2  151 ? 64.155 84.364  93.402  1.00 35.12  ? 151  ALA B O   1 
ATOM   4501  C  CB  . ALA B  2  151 ? 65.920 87.059  94.094  1.00 35.55  ? 151  ALA B CB  1 
ATOM   4502  N  N   . LEU B  2  152 ? 66.162 84.039  94.358  1.00 35.23  ? 152  LEU B N   1 
ATOM   4503  C  CA  . LEU B  2  152 ? 66.350 82.733  93.742  1.00 35.06  ? 152  LEU B CA  1 
ATOM   4504  C  C   . LEU B  2  152 ? 65.439 81.610  94.155  1.00 35.53  ? 152  LEU B C   1 
ATOM   4505  O  O   . LEU B  2  152 ? 65.625 80.492  93.705  1.00 36.58  ? 152  LEU B O   1 
ATOM   4506  C  CB  . LEU B  2  152 ? 67.795 82.279  93.744  1.00 34.82  ? 152  LEU B CB  1 
ATOM   4507  C  CG  . LEU B  2  152 ? 68.608 82.601  92.480  1.00 37.68  ? 152  LEU B CG  1 
ATOM   4508  C  CD1 . LEU B  2  152 ? 68.382 84.007  91.965  1.00 32.42  ? 152  LEU B CD1 1 
ATOM   4509  C  CD2 . LEU B  2  152 ? 70.055 82.337  92.707  1.00 37.52  ? 152  LEU B CD2 1 
ATOM   4510  N  N   . GLN B  2  153 ? 64.458 81.851  95.006  1.00 34.88  ? 153  GLN B N   1 
ATOM   4511  C  CA  . GLN B  2  153 ? 63.539 80.773  95.242  1.00 34.42  ? 153  GLN B CA  1 
ATOM   4512  C  C   . GLN B  2  153 ? 62.485 80.660  94.195  1.00 33.89  ? 153  GLN B C   1 
ATOM   4513  O  O   . GLN B  2  153 ? 61.760 79.688  94.153  1.00 34.00  ? 153  GLN B O   1 
ATOM   4514  C  CB  . GLN B  2  153 ? 63.021 80.680  96.642  1.00 34.95  ? 153  GLN B CB  1 
ATOM   4515  C  CG  . GLN B  2  153 ? 62.746 81.915  97.294  1.00 37.84  ? 153  GLN B CG  1 
ATOM   4516  C  CD  . GLN B  2  153 ? 62.855 81.760  98.804  1.00 47.48  ? 153  GLN B CD  1 
ATOM   4517  O  OE1 . GLN B  2  153 ? 63.877 81.332  99.311  1.00 55.67  ? 153  GLN B OE1 1 
ATOM   4518  N  NE2 . GLN B  2  153 ? 61.819 82.104  99.501  1.00 46.01  ? 153  GLN B NE2 1 
ATOM   4519  N  N   . ASN B  2  154 ? 62.417 81.652  93.304  1.00 33.47  ? 154  ASN B N   1 
ATOM   4520  C  CA  . ASN B  2  154 ? 61.519 81.561  92.150  1.00 32.70  ? 154  ASN B CA  1 
ATOM   4521  C  C   . ASN B  2  154 ? 62.382 81.019  91.057  1.00 31.15  ? 154  ASN B C   1 
ATOM   4522  O  O   . ASN B  2  154 ? 63.388 81.627  90.731  1.00 30.93  ? 154  ASN B O   1 
ATOM   4523  C  CB  . ASN B  2  154 ? 61.010 82.940  91.767  1.00 33.12  ? 154  ASN B CB  1 
ATOM   4524  C  CG  . ASN B  2  154 ? 60.426 83.664  92.926  1.00 43.26  ? 154  ASN B CG  1 
ATOM   4525  O  OD1 . ASN B  2  154 ? 59.311 83.353  93.362  1.00 61.98  ? 154  ASN B OD1 1 
ATOM   4526  N  ND2 . ASN B  2  154 ? 61.185 84.596  93.494  1.00 39.05  ? 154  ASN B ND2 1 
ATOM   4527  N  N   . PRO B  2  155 ? 62.056 79.836  90.547  1.00 30.10  ? 155  PRO B N   1 
ATOM   4528  C  CA  . PRO B  2  155 ? 62.842 79.208  89.477  1.00 31.02  ? 155  PRO B CA  1 
ATOM   4529  C  C   . PRO B  2  155 ? 63.087 80.158  88.290  1.00 32.21  ? 155  PRO B C   1 
ATOM   4530  O  O   . PRO B  2  155 ? 64.126 80.086  87.676  1.00 33.40  ? 155  PRO B O   1 
ATOM   4531  C  CB  . PRO B  2  155 ? 61.970 78.032  89.042  1.00 31.15  ? 155  PRO B CB  1 
ATOM   4532  C  CG  . PRO B  2  155 ? 61.111 77.748  90.209  1.00 29.88  ? 155  PRO B CG  1 
ATOM   4533  C  CD  . PRO B  2  155 ? 60.905 79.033  90.937  1.00 29.22  ? 155  PRO B CD  1 
ATOM   4534  N  N   . GLN B  2  156 ? 62.142 81.046  88.013  1.00 32.34  ? 156  GLN B N   1 
ATOM   4535  C  CA  . GLN B  2  156 ? 62.268 82.030  86.966  1.00 32.86  ? 156  GLN B CA  1 
ATOM   4536  C  C   . GLN B  2  156 ? 63.499 82.912  87.064  1.00 33.70  ? 156  GLN B C   1 
ATOM   4537  O  O   . GLN B  2  156 ? 64.108 83.264  86.057  1.00 34.64  ? 156  GLN B O   1 
ATOM   4538  C  CB  . GLN B  2  156 ? 61.048 82.935  86.944  1.00 32.71  ? 156  GLN B CB  1 
ATOM   4539  C  CG  . GLN B  2  156 ? 59.768 82.258  86.659  1.00 39.21  ? 156  GLN B CG  1 
ATOM   4540  C  CD  . GLN B  2  156 ? 58.999 81.947  87.896  1.00 53.96  ? 156  GLN B CD  1 
ATOM   4541  O  OE1 . GLN B  2  156 ? 59.591 81.791  88.986  1.00 61.32  ? 156  GLN B OE1 1 
ATOM   4542  N  NE2 . GLN B  2  156 ? 57.654 81.847  87.764  1.00 47.76  ? 156  GLN B NE2 1 
ATOM   4543  N  N   . ALA B  2  157 ? 63.835 83.327  88.247  1.00 34.28  ? 157  ALA B N   1 
ATOM   4544  C  CA  . ALA B  2  157 ? 64.979 84.186  88.384  1.00 35.79  ? 157  ALA B CA  1 
ATOM   4545  C  C   . ALA B  2  157 ? 66.304 83.528  87.933  1.00 37.22  ? 157  ALA B C   1 
ATOM   4546  O  O   . ALA B  2  157 ? 67.065 84.145  87.251  1.00 38.51  ? 157  ALA B O   1 
ATOM   4547  C  CB  . ALA B  2  157 ? 65.069 84.771  89.774  1.00 35.91  ? 157  ALA B CB  1 
ATOM   4548  N  N   . HIS B  2  158 ? 66.538 82.264  88.269  1.00 37.26  ? 158  HIS B N   1 
ATOM   4549  C  CA  . HIS B  2  158 ? 67.756 81.585  87.796  1.00 37.34  ? 158  HIS B CA  1 
ATOM   4550  C  C   . HIS B  2  158 ? 67.710 81.542  86.262  1.00 34.92  ? 158  HIS B C   1 
ATOM   4551  O  O   . HIS B  2  158 ? 68.689 81.861  85.571  1.00 34.19  ? 158  HIS B O   1 
ATOM   4552  C  CB  . HIS B  2  158 ? 67.778 80.080  88.215  1.00 39.10  ? 158  HIS B CB  1 
ATOM   4553  C  CG  . HIS B  2  158 ? 67.928 79.820  89.683  1.00 56.69  ? 158  HIS B CG  1 
ATOM   4554  N  ND1 . HIS B  2  158 ? 69.087 79.301  90.221  1.00 64.74  ? 158  HIS B ND1 1 
ATOM   4555  C  CD2 . HIS B  2  158 ? 67.020 79.839  90.692  1.00 54.02  ? 158  HIS B CD2 1 
ATOM   4556  C  CE1 . HIS B  2  158 ? 68.904 79.061  91.511  1.00 63.55  ? 158  HIS B CE1 1 
ATOM   4557  N  NE2 . HIS B  2  158 ? 67.658 79.374  91.820  1.00 59.04  ? 158  HIS B NE2 1 
ATOM   4558  N  N   . VAL B  2  159 ? 66.597 81.053  85.753  1.00 33.67  ? 159  VAL B N   1 
ATOM   4559  C  CA  . VAL B  2  159 ? 66.424 80.922  84.333  1.00 33.23  ? 159  VAL B CA  1 
ATOM   4560  C  C   . VAL B  2  159 ? 66.712 82.200  83.588  1.00 33.84  ? 159  VAL B C   1 
ATOM   4561  O  O   . VAL B  2  159 ? 67.572 82.226  82.729  1.00 34.28  ? 159  VAL B O   1 
ATOM   4562  C  CB  . VAL B  2  159 ? 65.065 80.404  83.986  1.00 32.58  ? 159  VAL B CB  1 
ATOM   4563  C  CG1 . VAL B  2  159 ? 64.876 80.407  82.498  1.00 29.95  ? 159  VAL B CG1 1 
ATOM   4564  C  CG2 . VAL B  2  159 ? 64.913 79.001  84.514  1.00 27.81  ? 159  VAL B CG2 1 
ATOM   4565  N  N   . ILE B  2  160 ? 66.074 83.292  83.980  1.00 33.55  ? 160  ILE B N   1 
ATOM   4566  C  CA  . ILE B  2  160 ? 66.283 84.524  83.272  1.00 33.06  ? 160  ILE B CA  1 
ATOM   4567  C  C   . ILE B  2  160 ? 67.695 85.099  83.416  1.00 33.19  ? 160  ILE B C   1 
ATOM   4568  O  O   . ILE B  2  160 ? 68.235 85.662  82.493  1.00 34.32  ? 160  ILE B O   1 
ATOM   4569  C  CB  . ILE B  2  160 ? 65.152 85.482  83.525  1.00 32.60  ? 160  ILE B CB  1 
ATOM   4570  C  CG1 . ILE B  2  160 ? 63.938 84.970  82.799  1.00 30.03  ? 160  ILE B CG1 1 
ATOM   4571  C  CG2 . ILE B  2  160 ? 65.443 86.814  82.984  1.00 27.27  ? 160  ILE B CG2 1 
ATOM   4572  C  CD1 . ILE B  2  160 ? 62.746 85.693  83.150  1.00 48.02  ? 160  ILE B CD1 1 
ATOM   4573  N  N   . GLU B  2  161 ? 68.311 84.870  84.543  1.00 32.76  ? 161  GLU B N   1 
ATOM   4574  C  CA  . GLU B  2  161 ? 69.697 85.275  84.734  1.00 32.42  ? 161  GLU B CA  1 
ATOM   4575  C  C   . GLU B  2  161 ? 70.635 84.434  83.835  1.00 32.95  ? 161  GLU B C   1 
ATOM   4576  O  O   . GLU B  2  161 ? 71.564 84.979  83.232  1.00 33.91  ? 161  GLU B O   1 
ATOM   4577  C  CB  . GLU B  2  161 ? 70.090 85.130  86.176  1.00 31.57  ? 161  GLU B CB  1 
ATOM   4578  C  CG  . GLU B  2  161 ? 69.348 86.108  87.100  1.00 50.54  ? 161  GLU B CG  1 
ATOM   4579  C  CD  . GLU B  2  161 ? 69.771 87.582  86.908  1.00 57.66  ? 161  GLU B CD  1 
ATOM   4580  O  OE1 . GLU B  2  161 ? 70.574 88.083  87.725  1.00 48.53  ? 161  GLU B OE1 1 
ATOM   4581  O  OE2 . GLU B  2  161 ? 69.286 88.242  85.967  1.00 62.71  ? 161  GLU B OE2 1 
ATOM   4582  N  N   . ASN B  2  162 ? 70.360 83.134  83.693  1.00 31.66  ? 162  ASN B N   1 
ATOM   4583  C  CA  . ASN B  2  162 ? 71.186 82.332  82.856  1.00 31.41  ? 162  ASN B CA  1 
ATOM   4584  C  C   . ASN B  2  162 ? 70.900 82.604  81.392  1.00 32.26  ? 162  ASN B C   1 
ATOM   4585  O  O   . ASN B  2  162 ? 71.797 82.428  80.519  1.00 32.97  ? 162  ASN B O   1 
ATOM   4586  C  CB  . ASN B  2  162 ? 70.993 80.865  83.121  1.00 30.92  ? 162  ASN B CB  1 
ATOM   4587  C  CG  . ASN B  2  162 ? 71.651 80.389  84.422  1.00 30.14  ? 162  ASN B CG  1 
ATOM   4588  O  OD1 . ASN B  2  162 ? 71.231 79.373  84.986  1.00 38.09  ? 162  ASN B OD1 1 
ATOM   4589  N  ND2 . ASN B  2  162 ? 72.733 81.046  84.843  1.00 26.80  ? 162  ASN B ND2 1 
ATOM   4590  N  N   . LEU B  2  163 ? 69.665 83.044  81.108  1.00 31.56  ? 163  LEU B N   1 
ATOM   4591  C  CA  . LEU B  2  163 ? 69.218 83.307  79.729  1.00 30.27  ? 163  LEU B CA  1 
ATOM   4592  C  C   . LEU B  2  163 ? 70.012 84.464  79.220  1.00 30.43  ? 163  LEU B C   1 
ATOM   4593  O  O   . LEU B  2  163 ? 70.503 84.435  78.092  1.00 31.45  ? 163  LEU B O   1 
ATOM   4594  C  CB  . LEU B  2  163 ? 67.741 83.645  79.726  1.00 29.21  ? 163  LEU B CB  1 
ATOM   4595  C  CG  . LEU B  2  163 ? 66.770 83.430  78.556  1.00 25.09  ? 163  LEU B CG  1 
ATOM   4596  C  CD1 . LEU B  2  163 ? 65.892 84.584  78.180  1.00 26.51  ? 163  LEU B CD1 1 
ATOM   4597  C  CD2 . LEU B  2  163 ? 67.132 82.493  77.397  1.00 19.72  ? 163  LEU B CD2 1 
ATOM   4598  N  N   . HIS B  2  164 ? 70.184 85.467  80.066  1.00 28.96  ? 164  HIS B N   1 
ATOM   4599  C  CA  . HIS B  2  164 ? 70.902 86.623  79.693  1.00 29.04  ? 164  HIS B CA  1 
ATOM   4600  C  C   . HIS B  2  164 ? 72.384 86.341  79.580  1.00 29.14  ? 164  HIS B C   1 
ATOM   4601  O  O   . HIS B  2  164 ? 73.009 86.762  78.609  1.00 29.44  ? 164  HIS B O   1 
ATOM   4602  C  CB  . HIS B  2  164 ? 70.624 87.751  80.665  1.00 29.68  ? 164  HIS B CB  1 
ATOM   4603  C  CG  . HIS B  2  164 ? 69.349 88.463  80.391  1.00 33.89  ? 164  HIS B CG  1 
ATOM   4604  N  ND1 . HIS B  2  164 ? 68.181 88.167  81.050  1.00 32.61  ? 164  HIS B ND1 1 
ATOM   4605  C  CD2 . HIS B  2  164 ? 69.044 89.434  79.493  1.00 30.98  ? 164  HIS B CD2 1 
ATOM   4606  C  CE1 . HIS B  2  164 ? 67.210 88.936  80.581  1.00 38.38  ? 164  HIS B CE1 1 
ATOM   4607  N  NE2 . HIS B  2  164 ? 67.707 89.709  79.632  1.00 37.24  ? 164  HIS B NE2 1 
ATOM   4608  N  N   . ALA B  2  165 ? 72.953 85.638  80.584  1.00 28.35  ? 165  ALA B N   1 
ATOM   4609  C  CA  . ALA B  2  165 ? 74.370 85.185  80.553  1.00 26.95  ? 165  ALA B CA  1 
ATOM   4610  C  C   . ALA B  2  165 ? 74.662 84.418  79.234  1.00 27.31  ? 165  ALA B C   1 
ATOM   4611  O  O   . ALA B  2  165 ? 75.699 84.594  78.638  1.00 26.97  ? 165  ALA B O   1 
ATOM   4612  C  CB  . ALA B  2  165 ? 74.653 84.278  81.739  1.00 25.84  ? 165  ALA B CB  1 
ATOM   4613  N  N   . ALA B  2  166 ? 73.709 83.570  78.812  1.00 27.86  ? 166  ALA B N   1 
ATOM   4614  C  CA  . ALA B  2  166 ? 73.831 82.802  77.594  1.00 29.12  ? 166  ALA B CA  1 
ATOM   4615  C  C   . ALA B  2  166 ? 73.695 83.632  76.326  1.00 30.12  ? 166  ALA B C   1 
ATOM   4616  O  O   . ALA B  2  166 ? 74.358 83.358  75.330  1.00 31.63  ? 166  ALA B O   1 
ATOM   4617  C  CB  . ALA B  2  166 ? 72.752 81.667  77.562  1.00 29.62  ? 166  ALA B CB  1 
ATOM   4618  N  N   . ALA B  2  167 ? 72.792 84.588  76.325  1.00 29.33  ? 167  ALA B N   1 
ATOM   4619  C  CA  . ALA B  2  167 ? 72.540 85.338  75.124  1.00 29.08  ? 167  ALA B CA  1 
ATOM   4620  C  C   . ALA B  2  167 ? 73.605 86.350  74.767  1.00 30.25  ? 167  ALA B C   1 
ATOM   4621  O  O   . ALA B  2  167 ? 73.926 86.532  73.576  1.00 31.38  ? 167  ALA B O   1 
ATOM   4622  C  CB  . ALA B  2  167 ? 71.180 86.006  75.194  1.00 28.13  ? 167  ALA B CB  1 
ATOM   4623  N  N   . TYR B  2  168 ? 74.187 86.978  75.760  1.00 30.08  ? 168  TYR B N   1 
ATOM   4624  C  CA  . TYR B  2  168 ? 75.110 88.098  75.503  1.00 31.29  ? 168  TYR B CA  1 
ATOM   4625  C  C   . TYR B  2  168 ? 76.464 87.856  75.989  1.00 33.28  ? 168  TYR B C   1 
ATOM   4626  O  O   . TYR B  2  168 ? 76.662 87.146  76.953  1.00 34.41  ? 168  TYR B O   1 
ATOM   4627  C  CB  . TYR B  2  168 ? 74.605 89.338  76.214  1.00 30.65  ? 168  TYR B CB  1 
ATOM   4628  C  CG  . TYR B  2  168 ? 73.308 89.850  75.697  1.00 20.65  ? 168  TYR B CG  1 
ATOM   4629  C  CD1 . TYR B  2  168 ? 72.120 89.511  76.307  1.00 24.56  ? 168  TYR B CD1 1 
ATOM   4630  C  CD2 . TYR B  2  168 ? 73.260 90.675  74.583  1.00 23.13  ? 168  TYR B CD2 1 
ATOM   4631  C  CE1 . TYR B  2  168 ? 70.895 89.980  75.816  1.00 23.21  ? 168  TYR B CE1 1 
ATOM   4632  C  CE2 . TYR B  2  168 ? 72.044 91.112  74.070  1.00 21.81  ? 168  TYR B CE2 1 
ATOM   4633  C  CZ  . TYR B  2  168 ? 70.874 90.773  74.713  1.00 21.70  ? 168  TYR B CZ  1 
ATOM   4634  O  OH  . TYR B  2  168 ? 69.675 91.217  74.236  1.00 36.81  ? 168  TYR B OH  1 
ATOM   4635  N  N   . ARG B  2  169 ? 77.438 88.466  75.382  1.00 34.64  ? 169  ARG B N   1 
ATOM   4636  C  CA  . ARG B  2  169 ? 78.772 88.246  75.913  1.00 37.23  ? 169  ARG B CA  1 
ATOM   4637  C  C   . ARG B  2  169 ? 79.239 89.390  76.696  1.00 38.37  ? 169  ARG B C   1 
ATOM   4638  O  O   . ARG B  2  169 ? 80.325 89.364  77.243  1.00 38.33  ? 169  ARG B O   1 
ATOM   4639  C  CB  . ARG B  2  169 ? 79.762 87.941  74.820  1.00 37.67  ? 169  ARG B CB  1 
ATOM   4640  C  CG  . ARG B  2  169 ? 79.726 88.771  73.639  1.00 38.20  ? 169  ARG B CG  1 
ATOM   4641  C  CD  . ARG B  2  169 ? 79.904 87.900  72.464  1.00 50.39  ? 169  ARG B CD  1 
ATOM   4642  N  NE  . ARG B  2  169 ? 80.446 88.522  71.303  1.00 45.81  ? 169  ARG B NE  1 
ATOM   4643  C  CZ  . ARG B  2  169 ? 80.632 87.881  70.158  1.00 54.71  ? 169  ARG B CZ  1 
ATOM   4644  N  NH1 . ARG B  2  169 ? 80.303 86.579  70.041  1.00 27.14  ? 169  ARG B NH1 1 
ATOM   4645  N  NH2 . ARG B  2  169 ? 81.163 88.535  69.122  1.00 68.77  ? 169  ARG B NH2 1 
ATOM   4646  N  N   . ASN B  2  170 ? 78.327 90.265  76.988  1.00 39.48  ? 170  ASN B N   1 
ATOM   4647  C  CA  . ASN B  2  170 ? 78.732 91.478  77.398  1.00 40.97  ? 170  ASN B CA  1 
ATOM   4648  C  C   . ASN B  2  170 ? 78.229 92.052  78.638  1.00 41.37  ? 170  ASN B C   1 
ATOM   4649  O  O   . ASN B  2  170 ? 78.704 91.766  79.705  1.00 43.62  ? 170  ASN B O   1 
ATOM   4650  C  CB  . ASN B  2  170 ? 78.403 92.431  76.228  1.00 42.25  ? 170  ASN B CB  1 
ATOM   4651  C  CG  . ASN B  2  170 ? 79.533 93.286  75.852  1.00 54.55  ? 170  ASN B CG  1 
ATOM   4652  O  OD1 . ASN B  2  170 ? 79.827 94.274  76.506  1.00 67.12  ? 170  ASN B OD1 1 
ATOM   4653  N  ND2 . ASN B  2  170 ? 80.170 92.947  74.752  1.00 73.62  ? 170  ASN B ND2 1 
ATOM   4654  N  N   . ALA B  2  171 ? 77.324 92.986  78.460  1.00 39.39  ? 171  ALA B N   1 
ATOM   4655  C  CA  . ALA B  2  171 ? 76.828 93.861  79.489  1.00 36.10  ? 171  ALA B CA  1 
ATOM   4656  C  C   . ALA B  2  171 ? 75.489 93.396  79.966  1.00 33.73  ? 171  ALA B C   1 
ATOM   4657  O  O   . ALA B  2  171 ? 75.263 93.301  81.111  1.00 32.77  ? 171  ALA B O   1 
ATOM   4658  C  CB  . ALA B  2  171 ? 76.702 95.217  78.888  1.00 35.69  ? 171  ALA B CB  1 
ATOM   4659  N  N   . LEU B  2  172 ? 74.601 93.076  79.023  1.00 32.66  ? 172  LEU B N   1 
ATOM   4660  C  CA  . LEU B  2  172 ? 73.294 92.570  79.358  1.00 30.31  ? 172  LEU B CA  1 
ATOM   4661  C  C   . LEU B  2  172 ? 73.427 91.164  79.937  1.00 28.95  ? 172  LEU B C   1 
ATOM   4662  O  O   . LEU B  2  172 ? 72.518 90.665  80.590  1.00 29.40  ? 172  LEU B O   1 
ATOM   4663  C  CB  . LEU B  2  172 ? 72.370 92.620  78.152  1.00 29.24  ? 172  LEU B CB  1 
ATOM   4664  C  CG  . LEU B  2  172 ? 71.870 94.039  77.904  1.00 28.55  ? 172  LEU B CG  1 
ATOM   4665  C  CD1 . LEU B  2  172 ? 71.164 94.194  76.589  1.00 13.46  ? 172  LEU B CD1 1 
ATOM   4666  C  CD2 . LEU B  2  172 ? 71.019 94.570  79.061  1.00 16.93  ? 172  LEU B CD2 1 
ATOM   4667  N  N   . ALA B  2  173 ? 74.611 90.589  79.804  1.00 27.62  ? 173  ALA B N   1 
ATOM   4668  C  CA  . ALA B  2  173 ? 74.875 89.275  80.344  1.00 27.84  ? 173  ALA B CA  1 
ATOM   4669  C  C   . ALA B  2  173 ? 75.000 89.290  81.825  1.00 28.48  ? 173  ALA B C   1 
ATOM   4670  O  O   . ALA B  2  173 ? 74.881 88.221  82.486  1.00 28.89  ? 173  ALA B O   1 
ATOM   4671  C  CB  . ALA B  2  173 ? 76.170 88.665  79.735  1.00 27.27  ? 173  ALA B CB  1 
ATOM   4672  N  N   . ASN B  2  174 ? 75.339 90.451  82.365  1.00 29.08  ? 174  ASN B N   1 
ATOM   4673  C  CA  . ASN B  2  174 ? 75.551 90.581  83.802  1.00 30.47  ? 174  ASN B CA  1 
ATOM   4674  C  C   . ASN B  2  174 ? 74.316 90.247  84.535  1.00 32.21  ? 174  ASN B C   1 
ATOM   4675  O  O   . ASN B  2  174 ? 73.196 90.377  84.004  1.00 33.05  ? 174  ASN B O   1 
ATOM   4676  C  CB  . ASN B  2  174 ? 75.968 91.997  84.184  1.00 30.26  ? 174  ASN B CB  1 
ATOM   4677  C  CG  . ASN B  2  174 ? 77.358 92.349  83.702  1.00 29.26  ? 174  ASN B CG  1 
ATOM   4678  O  OD1 . ASN B  2  174 ? 77.711 93.516  83.630  1.00 30.93  ? 174  ASN B OD1 1 
ATOM   4679  N  ND2 . ASN B  2  174 ? 78.147 91.344  83.373  1.00 24.32  ? 174  ASN B ND2 1 
ATOM   4680  N  N   . SER B  2  175 ? 74.483 89.808  85.748  1.00 32.64  ? 175  SER B N   1 
ATOM   4681  C  CA  . SER B  2  175 ? 73.350 89.483  86.538  1.00 33.42  ? 175  SER B CA  1 
ATOM   4682  C  C   . SER B  2  175 ? 72.861 90.643  87.373  1.00 33.21  ? 175  SER B C   1 
ATOM   4683  O  O   . SER B  2  175 ? 73.600 91.507  87.728  1.00 34.54  ? 175  SER B O   1 
ATOM   4684  C  CB  . SER B  2  175 ? 73.716 88.376  87.464  1.00 34.09  ? 175  SER B CB  1 
ATOM   4685  O  OG  . SER B  2  175 ? 72.575 87.986  88.180  1.00 53.98  ? 175  SER B OG  1 
ATOM   4686  N  N   . LEU B  2  176 ? 71.613 90.616  87.724  1.00 32.52  ? 176  LEU B N   1 
ATOM   4687  C  CA  . LEU B  2  176 ? 71.026 91.616  88.634  1.00 32.30  ? 176  LEU B CA  1 
ATOM   4688  C  C   . LEU B  2  176 ? 71.429 91.284  90.089  1.00 32.12  ? 176  LEU B C   1 
ATOM   4689  O  O   . LEU B  2  176 ? 71.117 92.040  91.015  1.00 32.59  ? 176  LEU B O   1 
ATOM   4690  C  CB  . LEU B  2  176 ? 69.550 91.433  88.593  1.00 32.68  ? 176  LEU B CB  1 
ATOM   4691  C  CG  . LEU B  2  176 ? 68.657 92.534  88.213  1.00 41.36  ? 176  LEU B CG  1 
ATOM   4692  C  CD1 . LEU B  2  176 ? 69.353 93.456  87.279  1.00 35.02  ? 176  LEU B CD1 1 
ATOM   4693  C  CD2 . LEU B  2  176 ? 67.490 91.812  87.523  1.00 35.50  ? 176  LEU B CD2 1 
ATOM   4694  N  N   . TYR B  2  177 ? 72.019 90.103  90.309  1.00 31.23  ? 177  TYR B N   1 
ATOM   4695  C  CA  . TYR B  2  177 ? 72.389 89.702  91.654  1.00 30.38  ? 177  TYR B CA  1 
ATOM   4696  C  C   . TYR B  2  177 ? 73.833 89.436  91.717  1.00 30.50  ? 177  TYR B C   1 
ATOM   4697  O  O   . TYR B  2  177 ? 74.398 88.932  90.789  1.00 31.98  ? 177  TYR B O   1 
ATOM   4698  C  CB  . TYR B  2  177 ? 71.566 88.493  92.115  1.00 30.01  ? 177  TYR B CB  1 
ATOM   4699  C  CG  . TYR B  2  177 ? 70.073 88.792  92.162  1.00 35.82  ? 177  TYR B CG  1 
ATOM   4700  C  CD1 . TYR B  2  177 ? 69.251 88.489  91.099  1.00 28.40  ? 177  TYR B CD1 1 
ATOM   4701  C  CD2 . TYR B  2  177 ? 69.507 89.451  93.255  1.00 30.83  ? 177  TYR B CD2 1 
ATOM   4702  C  CE1 . TYR B  2  177 ? 67.910 88.797  91.135  1.00 30.10  ? 177  TYR B CE1 1 
ATOM   4703  C  CE2 . TYR B  2  177 ? 68.170 89.755  93.286  1.00 16.69  ? 177  TYR B CE2 1 
ATOM   4704  C  CZ  . TYR B  2  177 ? 67.386 89.459  92.236  1.00 27.19  ? 177  TYR B CZ  1 
ATOM   4705  O  OH  . TYR B  2  177 ? 66.042 89.789  92.273  1.00 32.57  ? 177  TYR B OH  1 
ATOM   4706  N  N   . CYS B  2  178 ? 74.453 89.824  92.792  1.00 29.88  ? 178  CYS B N   1 
ATOM   4707  C  CA  . CYS B  2  178 ? 75.871 89.638  92.966  1.00 29.96  ? 178  CYS B CA  1 
ATOM   4708  C  C   . CYS B  2  178 ? 76.318 88.173  92.849  1.00 30.57  ? 178  CYS B C   1 
ATOM   4709  O  O   . CYS B  2  178 ? 75.714 87.298  93.453  1.00 31.17  ? 178  CYS B O   1 
ATOM   4710  C  CB  . CYS B  2  178 ? 76.253 90.169  94.346  1.00 29.55  ? 178  CYS B CB  1 
ATOM   4711  S  SG  . CYS B  2  178 ? 77.996 90.110  94.743  1.00 36.57  ? 178  CYS B SG  1 
ATOM   4712  N  N   . PRO B  2  179 ? 77.284 87.880  91.969  1.00 30.46  ? 179  PRO B N   1 
ATOM   4713  C  CA  . PRO B  2  179 ? 77.879 86.499  91.905  1.00 30.04  ? 179  PRO B CA  1 
ATOM   4714  C  C   . PRO B  2  179 ? 78.417 86.097  93.273  1.00 30.74  ? 179  PRO B C   1 
ATOM   4715  O  O   . PRO B  2  179 ? 79.032 86.946  93.968  1.00 30.97  ? 179  PRO B O   1 
ATOM   4716  C  CB  . PRO B  2  179 ? 79.030 86.651  90.940  1.00 28.91  ? 179  PRO B CB  1 
ATOM   4717  C  CG  . PRO B  2  179 ? 78.623 87.800  90.044  1.00 23.55  ? 179  PRO B CG  1 
ATOM   4718  C  CD  . PRO B  2  179 ? 77.748 88.743  90.878  1.00 29.39  ? 179  PRO B CD  1 
ATOM   4719  N  N   . ASP B  2  180 ? 78.224 84.818  93.646  1.00 31.18  ? 180  ASP B N   1 
ATOM   4720  C  CA  . ASP B  2  180 ? 78.627 84.318  94.961  1.00 30.69  ? 180  ASP B CA  1 
ATOM   4721  C  C   . ASP B  2  180 ? 80.026 84.637  95.306  1.00 30.25  ? 180  ASP B C   1 
ATOM   4722  O  O   . ASP B  2  180 ? 80.300 85.098  96.409  1.00 30.26  ? 180  ASP B O   1 
ATOM   4723  C  CB  . ASP B  2  180 ? 78.391 82.829  95.084  1.00 30.60  ? 180  ASP B CB  1 
ATOM   4724  C  CG  . ASP B  2  180 ? 76.930 82.467  95.003  1.00 40.92  ? 180  ASP B CG  1 
ATOM   4725  O  OD1 . ASP B  2  180 ? 76.103 83.383  94.906  1.00 43.69  ? 180  ASP B OD1 1 
ATOM   4726  O  OD2 . ASP B  2  180 ? 76.512 81.298  95.023  1.00 42.77  ? 180  ASP B OD2 1 
ATOM   4727  N  N   . TYR B  2  181 ? 80.935 84.428  94.369  1.00 30.11  ? 181  TYR B N   1 
ATOM   4728  C  CA  . TYR B  2  181 ? 82.357 84.704  94.651  1.00 30.33  ? 181  TYR B CA  1 
ATOM   4729  C  C   . TYR B  2  181 ? 82.641 86.159  95.025  1.00 30.65  ? 181  TYR B C   1 
ATOM   4730  O  O   . TYR B  2  181 ? 83.648 86.419  95.645  1.00 31.50  ? 181  TYR B O   1 
ATOM   4731  C  CB  . TYR B  2  181 ? 83.291 84.235  93.520  1.00 29.29  ? 181  TYR B CB  1 
ATOM   4732  C  CG  . TYR B  2  181 ? 83.442 85.207  92.441  1.00 25.59  ? 181  TYR B CG  1 
ATOM   4733  C  CD1 . TYR B  2  181 ? 84.496 86.163  92.454  1.00 30.59  ? 181  TYR B CD1 1 
ATOM   4734  C  CD2 . TYR B  2  181 ? 82.519 85.265  91.425  1.00 23.37  ? 181  TYR B CD2 1 
ATOM   4735  C  CE1 . TYR B  2  181 ? 84.638 87.091  91.427  1.00 25.23  ? 181  TYR B CE1 1 
ATOM   4736  C  CE2 . TYR B  2  181 ? 82.616 86.213  90.416  1.00 32.76  ? 181  TYR B CE2 1 
ATOM   4737  C  CZ  . TYR B  2  181 ? 83.661 87.114  90.407  1.00 39.19  ? 181  TYR B CZ  1 
ATOM   4738  O  OH  . TYR B  2  181 ? 83.737 88.012  89.371  1.00 41.27  ? 181  TYR B OH  1 
ATOM   4739  N  N   . ARG B  2  182 ? 81.751 87.086  94.647  1.00 30.14  ? 182  ARG B N   1 
ATOM   4740  C  CA  . ARG B  2  182 ? 81.928 88.506  95.003  1.00 31.33  ? 182  ARG B CA  1 
ATOM   4741  C  C   . ARG B  2  182 ? 81.293 88.924  96.340  1.00 32.15  ? 182  ARG B C   1 
ATOM   4742  O  O   . ARG B  2  182 ? 81.528 90.054  96.808  1.00 33.30  ? 182  ARG B O   1 
ATOM   4743  C  CB  . ARG B  2  182 ? 81.378 89.424  93.929  1.00 31.22  ? 182  ARG B CB  1 
ATOM   4744  C  CG  . ARG B  2  182 ? 82.120 89.358  92.630  1.00 34.63  ? 182  ARG B CG  1 
ATOM   4745  C  CD  . ARG B  2  182 ? 83.312 90.242  92.585  1.00 19.02  ? 182  ARG B CD  1 
ATOM   4746  N  NE  . ARG B  2  182 ? 82.940 91.663  92.621  1.00 37.52  ? 182  ARG B NE  1 
ATOM   4747  C  CZ  . ARG B  2  182 ? 83.737 92.611  93.093  1.00 40.41  ? 182  ARG B CZ  1 
ATOM   4748  N  NH1 . ARG B  2  182 ? 84.928 92.268  93.582  1.00 42.70  ? 182  ARG B NH1 1 
ATOM   4749  N  NH2 . ARG B  2  182 ? 83.334 93.883  93.122  1.00 28.89  ? 182  ARG B NH2 1 
ATOM   4750  N  N   . ILE B  2  183 ? 80.418 88.097  96.892  1.00 31.00  ? 183  ILE B N   1 
ATOM   4751  C  CA  . ILE B  2  183 ? 79.793 88.449  98.130  1.00 31.06  ? 183  ILE B CA  1 
ATOM   4752  C  C   . ILE B  2  183 ? 80.854 88.588  99.214  1.00 31.47  ? 183  ILE B C   1 
ATOM   4753  O  O   . ILE B  2  183 ? 81.650 87.682  99.458  1.00 31.59  ? 183  ILE B O   1 
ATOM   4754  C  CB  . ILE B  2  183 ? 78.758 87.419  98.527  1.00 31.41  ? 183  ILE B CB  1 
ATOM   4755  C  CG1 . ILE B  2  183 ? 77.569 87.487  97.593  1.00 36.14  ? 183  ILE B CG1 1 
ATOM   4756  C  CG2 . ILE B  2  183 ? 78.323 87.646  99.968  1.00 27.60  ? 183  ILE B CG2 1 
ATOM   4757  C  CD1 . ILE B  2  183 ? 76.461 86.462  97.950  1.00 21.73  ? 183  ILE B CD1 1 
ATOM   4758  N  N   . GLY B  2  184 ? 80.909 89.751  99.829  1.00 31.77  ? 184  GLY B N   1 
ATOM   4759  C  CA  . GLY B  2  184 ? 81.907 89.982  100.818 1.00 31.52  ? 184  GLY B CA  1 
ATOM   4760  C  C   . GLY B  2  184 ? 83.123 90.632  100.239 1.00 31.76  ? 184  GLY B C   1 
ATOM   4761  O  O   . GLY B  2  184 ? 83.933 91.149  100.980 1.00 32.30  ? 184  GLY B O   1 
ATOM   4762  N  N   . LYS B  2  185 ? 83.244 90.644  98.919  1.00 32.19  ? 185  LYS B N   1 
ATOM   4763  C  CA  . LYS B  2  185 ? 84.396 91.256  98.288  1.00 33.89  ? 185  LYS B CA  1 
ATOM   4764  C  C   . LYS B  2  185 ? 84.225 92.644  97.636  1.00 34.78  ? 185  LYS B C   1 
ATOM   4765  O  O   . LYS B  2  185 ? 85.247 93.292  97.263  1.00 35.00  ? 185  LYS B O   1 
ATOM   4766  C  CB  . LYS B  2  185 ? 85.121 90.291  97.371  1.00 34.19  ? 185  LYS B CB  1 
ATOM   4767  C  CG  . LYS B  2  185 ? 85.972 89.318  98.152  1.00 44.19  ? 185  LYS B CG  1 
ATOM   4768  C  CD  . LYS B  2  185 ? 86.556 88.268  97.258  1.00 51.49  ? 185  LYS B CD  1 
ATOM   4769  C  CE  . LYS B  2  185 ? 86.831 86.982  98.039  1.00 57.29  ? 185  LYS B CE  1 
ATOM   4770  N  NZ  . LYS B  2  185 ? 87.781 87.207  99.148  1.00 57.75  ? 185  LYS B NZ  1 
ATOM   4771  N  N   . VAL B  2  186 ? 82.987 93.114  97.491  1.00 35.26  ? 186  VAL B N   1 
ATOM   4772  C  CA  . VAL B  2  186 ? 82.822 94.417  96.900  1.00 36.49  ? 186  VAL B CA  1 
ATOM   4773  C  C   . VAL B  2  186 ? 83.275 95.486  97.895  1.00 37.70  ? 186  VAL B C   1 
ATOM   4774  O  O   . VAL B  2  186 ? 83.021 95.359  99.097  1.00 39.28  ? 186  VAL B O   1 
ATOM   4775  C  CB  . VAL B  2  186 ? 81.474 94.644  96.177  1.00 36.56  ? 186  VAL B CB  1 
ATOM   4776  C  CG1 . VAL B  2  186 ? 80.511 93.458  96.337  1.00 32.36  ? 186  VAL B CG1 1 
ATOM   4777  C  CG2 . VAL B  2  186 ? 80.871 95.909  96.522  1.00 30.37  ? 186  VAL B CG2 1 
ATOM   4778  N  N   . THR B  2  187 ? 84.089 96.438  97.421  1.00 36.47  ? 187  THR B N   1 
ATOM   4779  C  CA  . THR B  2  187 ? 84.701 97.441  98.296  1.00 35.65  ? 187  THR B CA  1 
ATOM   4780  C  C   . THR B  2  187 ? 84.040 98.797  98.290  1.00 34.89  ? 187  THR B C   1 
ATOM   4781  O  O   . THR B  2  187 ? 83.335 99.136  97.370  1.00 34.50  ? 187  THR B O   1 
ATOM   4782  C  CB  . THR B  2  187 ? 86.189 97.645  97.901  1.00 35.57  ? 187  THR B CB  1 
ATOM   4783  O  OG1 . THR B  2  187 ? 86.271 98.153  96.562  1.00 34.83  ? 187  THR B OG1 1 
ATOM   4784  C  CG2 . THR B  2  187 ? 86.912 96.372  97.847  1.00 27.04  ? 187  THR B CG2 1 
ATOM   4785  N  N   . PRO B  2  188 ? 84.209 99.543  99.378  1.00 34.87  ? 188  PRO B N   1 
ATOM   4786  C  CA  . PRO B  2  188 ? 83.752 100.935 99.434  1.00 34.75  ? 188  PRO B CA  1 
ATOM   4787  C  C   . PRO B  2  188 ? 84.283 101.769 98.285  1.00 35.04  ? 188  PRO B C   1 
ATOM   4788  O  O   . PRO B  2  188 ? 83.532 102.553 97.730  1.00 36.10  ? 188  PRO B O   1 
ATOM   4789  C  CB  . PRO B  2  188 ? 84.311 101.420 100.763 1.00 34.69  ? 188  PRO B CB  1 
ATOM   4790  C  CG  . PRO B  2  188 ? 85.267 100.283 101.192 1.00 45.39  ? 188  PRO B CG  1 
ATOM   4791  C  CD  . PRO B  2  188 ? 84.592 99.058  100.722 1.00 34.58  ? 188  PRO B CD  1 
ATOM   4792  N  N   . VAL B  2  189 ? 85.526 101.582 97.888  1.00 34.53  ? 189  VAL B N   1 
ATOM   4793  C  CA  . VAL B  2  189 ? 86.033 102.331 96.745  1.00 34.58  ? 189  VAL B CA  1 
ATOM   4794  C  C   . VAL B  2  189 ? 85.251 102.006 95.432  1.00 34.18  ? 189  VAL B C   1 
ATOM   4795  O  O   . VAL B  2  189 ? 84.929 102.929 94.656  1.00 34.10  ? 189  VAL B O   1 
ATOM   4796  C  CB  . VAL B  2  189 ? 87.581 102.195 96.590  1.00 35.23  ? 189  VAL B CB  1 
ATOM   4797  C  CG1 . VAL B  2  189 ? 88.086 100.929 97.308  1.00 53.46  ? 189  VAL B CG1 1 
ATOM   4798  C  CG2 . VAL B  2  189 ? 88.026 102.231 95.080  1.00 33.41  ? 189  VAL B CG2 1 
ATOM   4799  N  N   . GLU B  2  190 ? 84.899 100.714 95.233  1.00 33.52  ? 190  GLU B N   1 
ATOM   4800  C  CA  . GLU B  2  190 ? 84.092 100.275 94.061  1.00 32.97  ? 190  GLU B CA  1 
ATOM   4801  C  C   . GLU B  2  190 ? 82.653 100.914 94.040  1.00 32.72  ? 190  GLU B C   1 
ATOM   4802  O  O   . GLU B  2  190 ? 82.100 101.227 92.965  1.00 32.21  ? 190  GLU B O   1 
ATOM   4803  C  CB  . GLU B  2  190 ? 84.005 98.731  93.979  1.00 32.77  ? 190  GLU B CB  1 
ATOM   4804  C  CG  . GLU B  2  190 ? 85.273 98.031  93.436  1.00 28.38  ? 190  GLU B CG  1 
ATOM   4805  C  CD  . GLU B  2  190 ? 85.234 96.491  93.610  1.00 36.99  ? 190  GLU B CD  1 
ATOM   4806  O  OE1 . GLU B  2  190 ? 85.963 95.767  92.888  1.00 42.68  ? 190  GLU B OE1 1 
ATOM   4807  O  OE2 . GLU B  2  190 ? 84.473 95.995  94.461  1.00 32.71  ? 190  GLU B OE2 1 
ATOM   4808  N  N   . LEU B  2  191 ? 82.062 101.085 95.220  1.00 32.62  ? 191  LEU B N   1 
ATOM   4809  C  CA  . LEU B  2  191 ? 80.755 101.751 95.323  1.00 31.86  ? 191  LEU B CA  1 
ATOM   4810  C  C   . LEU B  2  191 ? 80.942 103.224 94.965  1.00 30.75  ? 191  LEU B C   1 
ATOM   4811  O  O   . LEU B  2  191 ? 80.211 103.742 94.134  1.00 31.12  ? 191  LEU B O   1 
ATOM   4812  C  CB  . LEU B  2  191 ? 80.143 101.600 96.738  1.00 31.66  ? 191  LEU B CB  1 
ATOM   4813  C  CG  . LEU B  2  191 ? 79.719 100.166 97.042  1.00 35.49  ? 191  LEU B CG  1 
ATOM   4814  C  CD1 . LEU B  2  191 ? 79.414 99.968  98.538  1.00 38.66  ? 191  LEU B CD1 1 
ATOM   4815  C  CD2 . LEU B  2  191 ? 78.516 99.776  96.170  1.00 36.97  ? 191  LEU B CD2 1 
ATOM   4816  N  N   . HIS B  2  192 ? 81.952 103.873 95.566  1.00 28.74  ? 192  HIS B N   1 
ATOM   4817  C  CA  . HIS B  2  192 ? 82.252 105.263 95.256  1.00 27.64  ? 192  HIS B CA  1 
ATOM   4818  C  C   . HIS B  2  192 ? 82.450 105.423 93.766  1.00 28.36  ? 192  HIS B C   1 
ATOM   4819  O  O   . HIS B  2  192 ? 81.817 106.280 93.154  1.00 29.46  ? 192  HIS B O   1 
ATOM   4820  C  CB  . HIS B  2  192 ? 83.506 105.776 96.008  1.00 27.26  ? 192  HIS B CB  1 
ATOM   4821  C  CG  . HIS B  2  192 ? 83.254 106.150 97.443  1.00 37.25  ? 192  HIS B CG  1 
ATOM   4822  N  ND1 . HIS B  2  192 ? 82.407 107.182 97.813  1.00 38.91  ? 192  HIS B ND1 1 
ATOM   4823  C  CD2 . HIS B  2  192 ? 83.740 105.632 98.599  1.00 35.26  ? 192  HIS B CD2 1 
ATOM   4824  C  CE1 . HIS B  2  192 ? 82.380 107.274 99.135  1.00 32.52  ? 192  HIS B CE1 1 
ATOM   4825  N  NE2 . HIS B  2  192 ? 83.178 106.347 99.636  1.00 32.65  ? 192  HIS B NE2 1 
ATOM   4826  N  N   . ASP B  2  193 ? 83.303 104.586 93.160  1.00 28.02  ? 193  ASP B N   1 
ATOM   4827  C  CA  . ASP B  2  193 ? 83.545 104.677 91.726  1.00 27.28  ? 193  ASP B CA  1 
ATOM   4828  C  C   . ASP B  2  193 ? 82.290 104.485 90.905  1.00 27.59  ? 193  ASP B C   1 
ATOM   4829  O  O   . ASP B  2  193 ? 82.110 105.196 89.903  1.00 28.91  ? 193  ASP B O   1 
ATOM   4830  C  CB  . ASP B  2  193 ? 84.565 103.693 91.259  1.00 26.70  ? 193  ASP B CB  1 
ATOM   4831  C  CG  . ASP B  2  193 ? 85.905 103.996 91.739  1.00 29.62  ? 193  ASP B CG  1 
ATOM   4832  O  OD1 . ASP B  2  193 ? 86.149 105.130 92.115  1.00 37.81  ? 193  ASP B OD1 1 
ATOM   4833  O  OD2 . ASP B  2  193 ? 86.815 103.152 91.760  1.00 45.74  ? 193  ASP B OD2 1 
ATOM   4834  N  N   . TYR B  2  194 ? 81.407 103.582 91.328  1.00 26.54  ? 194  TYR B N   1 
ATOM   4835  C  CA  . TYR B  2  194 ? 80.196 103.298 90.567  1.00 28.04  ? 194  TYR B CA  1 
ATOM   4836  C  C   . TYR B  2  194 ? 79.249 104.449 90.589  1.00 31.56  ? 194  TYR B C   1 
ATOM   4837  O  O   . TYR B  2  194 ? 78.536 104.693 89.591  1.00 33.26  ? 194  TYR B O   1 
ATOM   4838  C  CB  . TYR B  2  194 ? 79.481 102.078 91.098  1.00 27.47  ? 194  TYR B CB  1 
ATOM   4839  C  CG  . TYR B  2  194 ? 78.575 101.413 90.105  1.00 19.69  ? 194  TYR B CG  1 
ATOM   4840  C  CD1 . TYR B  2  194 ? 77.225 101.701 90.073  1.00 30.61  ? 194  TYR B CD1 1 
ATOM   4841  C  CD2 . TYR B  2  194 ? 79.060 100.445 89.227  1.00 22.84  ? 194  TYR B CD2 1 
ATOM   4842  C  CE1 . TYR B  2  194 ? 76.376 101.085 89.177  1.00 27.40  ? 194  TYR B CE1 1 
ATOM   4843  C  CE2 . TYR B  2  194 ? 78.218 99.825  88.313  1.00 30.97  ? 194  TYR B CE2 1 
ATOM   4844  C  CZ  . TYR B  2  194 ? 76.863 100.139 88.317  1.00 33.13  ? 194  TYR B CZ  1 
ATOM   4845  O  OH  . TYR B  2  194 ? 76.013 99.540  87.427  1.00 32.03  ? 194  TYR B OH  1 
ATOM   4846  N  N   . VAL B  2  195 ? 79.225 105.184 91.712  1.00 32.21  ? 195  VAL B N   1 
ATOM   4847  C  CA  . VAL B  2  195 ? 78.368 106.323 91.843  1.00 31.61  ? 195  VAL B CA  1 
ATOM   4848  C  C   . VAL B  2  195 ? 78.905 107.469 91.085  1.00 31.96  ? 195  VAL B C   1 
ATOM   4849  O  O   . VAL B  2  195 ? 78.173 108.121 90.373  1.00 32.21  ? 195  VAL B O   1 
ATOM   4850  C  CB  . VAL B  2  195 ? 78.195 106.720 93.286  1.00 31.46  ? 195  VAL B CB  1 
ATOM   4851  C  CG1 . VAL B  2  195 ? 77.370 108.065 93.403  1.00 11.16  ? 195  VAL B CG1 1 
ATOM   4852  C  CG2 . VAL B  2  195 ? 77.491 105.594 94.046  1.00 28.91  ? 195  VAL B CG2 1 
ATOM   4853  N  N   . GLN B  2  196 ? 80.202 107.718 91.196  1.00 32.43  ? 196  GLN B N   1 
ATOM   4854  C  CA  . GLN B  2  196 ? 80.790 108.890 90.514  1.00 32.98  ? 196  GLN B CA  1 
ATOM   4855  C  C   . GLN B  2  196 ? 80.745 108.785 89.045  1.00 32.96  ? 196  GLN B C   1 
ATOM   4856  O  O   . GLN B  2  196 ? 80.552 109.765 88.352  1.00 33.50  ? 196  GLN B O   1 
ATOM   4857  C  CB  . GLN B  2  196 ? 82.209 109.166 90.953  1.00 33.57  ? 196  GLN B CB  1 
ATOM   4858  C  CG  . GLN B  2  196 ? 82.304 109.744 92.355  1.00 52.88  ? 196  GLN B CG  1 
ATOM   4859  C  CD  . GLN B  2  196 ? 83.723 109.838 92.816  1.00 61.30  ? 196  GLN B CD  1 
ATOM   4860  O  OE1 . GLN B  2  196 ? 84.524 110.557 92.220  1.00 63.83  ? 196  GLN B OE1 1 
ATOM   4861  N  NE2 . GLN B  2  196 ? 84.065 109.074 93.848  1.00 63.29  ? 196  GLN B NE2 1 
ATOM   4862  N  N   . ASN B  2  197 ? 80.878 107.603 88.526  1.00 32.56  ? 197  ASN B N   1 
ATOM   4863  C  CA  . ASN B  2  197 ? 80.792 107.547 87.134  1.00 32.52  ? 197  ASN B CA  1 
ATOM   4864  C  C   . ASN B  2  197 ? 79.485 107.224 86.450  1.00 32.21  ? 197  ASN B C   1 
ATOM   4865  O  O   . ASN B  2  197 ? 79.377 107.375 85.213  1.00 32.71  ? 197  ASN B O   1 
ATOM   4866  C  CB  . ASN B  2  197 ? 82.035 107.027 86.471  1.00 33.13  ? 197  ASN B CB  1 
ATOM   4867  C  CG  . ASN B  2  197 ? 82.333 105.746 86.882  1.00 28.35  ? 197  ASN B CG  1 
ATOM   4868  O  OD1 . ASN B  2  197 ? 83.474 105.367 86.982  1.00 27.25  ? 197  ASN B OD1 1 
ATOM   4869  N  ND2 . ASN B  2  197 ? 81.311 105.007 87.181  1.00 31.65  ? 197  ASN B ND2 1 
ATOM   4870  N  N   . HIS B  2  198 ? 78.472 106.823 87.226  1.00 31.13  ? 198  HIS B N   1 
ATOM   4871  C  CA  . HIS B  2  198 ? 77.164 106.590 86.640  1.00 31.09  ? 198  HIS B CA  1 
ATOM   4872  C  C   . HIS B  2  198 ? 76.063 107.513 87.112  1.00 32.27  ? 198  HIS B C   1 
ATOM   4873  O  O   . HIS B  2  198 ? 75.087 107.717 86.393  1.00 33.38  ? 198  HIS B O   1 
ATOM   4874  C  CB  . HIS B  2  198 ? 76.718 105.168 86.802  1.00 30.25  ? 198  HIS B CB  1 
ATOM   4875  C  CG  . HIS B  2  198 ? 77.693 104.184 86.290  1.00 26.68  ? 198  HIS B CG  1 
ATOM   4876  N  ND1 . HIS B  2  198 ? 78.456 103.398 87.121  1.00 28.73  ? 198  HIS B ND1 1 
ATOM   4877  C  CD2 . HIS B  2  198 ? 78.075 103.883 85.028  1.00 25.57  ? 198  HIS B CD2 1 
ATOM   4878  C  CE1 . HIS B  2  198 ? 79.250 102.632 86.393  1.00 24.56  ? 198  HIS B CE1 1 
ATOM   4879  N  NE2 . HIS B  2  198 ? 79.040 102.905 85.122  1.00 32.25  ? 198  HIS B NE2 1 
ATOM   4880  N  N   . PHE B  2  199 ? 76.179 108.035 88.330  1.00 31.65  ? 199  PHE B N   1 
ATOM   4881  C  CA  . PHE B  2  199 ? 75.133 108.885 88.873  1.00 31.59  ? 199  PHE B CA  1 
ATOM   4882  C  C   . PHE B  2  199 ? 75.402 110.331 88.465  1.00 32.26  ? 199  PHE B C   1 
ATOM   4883  O  O   . PHE B  2  199 ? 75.659 111.171 89.305  1.00 32.97  ? 199  PHE B O   1 
ATOM   4884  C  CB  . PHE B  2  199 ? 75.051 108.766 90.425  1.00 31.42  ? 199  PHE B CB  1 
ATOM   4885  C  CG  . PHE B  2  199 ? 74.442 107.431 90.940  1.00 35.08  ? 199  PHE B CG  1 
ATOM   4886  C  CD1 . PHE B  2  199 ? 74.808 106.202 90.394  1.00 37.32  ? 199  PHE B CD1 1 
ATOM   4887  C  CD2 . PHE B  2  199 ? 73.534 107.433 91.982  1.00 30.97  ? 199  PHE B CD2 1 
ATOM   4888  C  CE1 . PHE B  2  199 ? 74.257 104.998 90.878  1.00 27.42  ? 199  PHE B CE1 1 
ATOM   4889  C  CE2 . PHE B  2  199 ? 72.983 106.237 92.451  1.00 36.20  ? 199  PHE B CE2 1 
ATOM   4890  C  CZ  . PHE B  2  199 ? 73.351 105.027 91.889  1.00 27.31  ? 199  PHE B CZ  1 
ATOM   4891  N  N   . THR B  2  200 ? 75.380 110.610 87.165  1.00 32.21  ? 200  THR B N   1 
ATOM   4892  C  CA  . THR B  2  200 ? 75.652 111.960 86.683  1.00 32.32  ? 200  THR B CA  1 
ATOM   4893  C  C   . THR B  2  200 ? 74.500 112.542 85.945  1.00 32.78  ? 200  THR B C   1 
ATOM   4894  O  O   . THR B  2  200 ? 73.684 111.838 85.430  1.00 32.86  ? 200  THR B O   1 
ATOM   4895  C  CB  . THR B  2  200 ? 76.860 111.969 85.770  1.00 32.67  ? 200  THR B CB  1 
ATOM   4896  O  OG1 . THR B  2  200 ? 76.559 111.244 84.557  1.00 36.55  ? 200  THR B OG1 1 
ATOM   4897  C  CG2 . THR B  2  200 ? 78.060 111.205 86.416  1.00 30.40  ? 200  THR B CG2 1 
ATOM   4898  N  N   . SER B  2  201 ? 74.500 113.865 85.825  1.00 33.76  ? 201  SER B N   1 
ATOM   4899  C  CA  . SER B  2  201 ? 73.427 114.626 85.153  1.00 33.40  ? 201  SER B CA  1 
ATOM   4900  C  C   . SER B  2  201 ? 72.913 114.074 83.848  1.00 32.61  ? 201  SER B C   1 
ATOM   4901  O  O   . SER B  2  201 ? 71.708 113.930 83.669  1.00 31.75  ? 201  SER B O   1 
ATOM   4902  C  CB  . SER B  2  201 ? 73.857 116.069 84.940  1.00 33.51  ? 201  SER B CB  1 
ATOM   4903  O  OG  . SER B  2  201 ? 74.174 116.679 86.176  1.00 38.32  ? 201  SER B OG  1 
ATOM   4904  N  N   . ALA B  2  202 ? 73.833 113.776 82.925  1.00 32.87  ? 202  ALA B N   1 
ATOM   4905  C  CA  . ALA B  2  202 ? 73.457 113.259 81.583  1.00 32.84  ? 202  ALA B CA  1 
ATOM   4906  C  C   . ALA B  2  202 ? 72.900 111.842 81.600  1.00 32.90  ? 202  ALA B C   1 
ATOM   4907  O  O   . ALA B  2  202 ? 72.443 111.335 80.565  1.00 33.62  ? 202  ALA B O   1 
ATOM   4908  C  CB  . ALA B  2  202 ? 74.626 113.340 80.628  1.00 32.58  ? 202  ALA B CB  1 
ATOM   4909  N  N   . ARG B  2  203 ? 72.977 111.185 82.749  1.00 31.80  ? 203  ARG B N   1 
ATOM   4910  C  CA  . ARG B  2  203 ? 72.477 109.840 82.866  1.00 31.82  ? 203  ARG B CA  1 
ATOM   4911  C  C   . ARG B  2  203 ? 71.354 109.805 83.822  1.00 31.48  ? 203  ARG B C   1 
ATOM   4912  O  O   . ARG B  2  203 ? 71.014 108.750 84.279  1.00 31.56  ? 203  ARG B O   1 
ATOM   4913  C  CB  . ARG B  2  203 ? 73.564 108.899 83.425  1.00 31.84  ? 203  ARG B CB  1 
ATOM   4914  C  CG  . ARG B  2  203 ? 74.925 109.082 82.810  1.00 33.28  ? 203  ARG B CG  1 
ATOM   4915  C  CD  . ARG B  2  203 ? 75.982 108.191 83.402  1.00 33.36  ? 203  ARG B CD  1 
ATOM   4916  N  NE  . ARG B  2  203 ? 75.601 106.813 83.302  1.00 26.06  ? 203  ARG B NE  1 
ATOM   4917  C  CZ  . ARG B  2  203 ? 75.936 106.041 82.301  1.00 38.70  ? 203  ARG B CZ  1 
ATOM   4918  N  NH1 . ARG B  2  203 ? 76.714 106.527 81.337  1.00 33.97  ? 203  ARG B NH1 1 
ATOM   4919  N  NH2 . ARG B  2  203 ? 75.524 104.758 82.266  1.00 34.80  ? 203  ARG B NH2 1 
ATOM   4920  N  N   . MET B  2  204 ? 70.759 110.955 84.123  1.00 30.89  ? 204  MET B N   1 
ATOM   4921  C  CA  . MET B  2  204 ? 69.733 111.000 85.139  1.00 30.96  ? 204  MET B CA  1 
ATOM   4922  C  C   . MET B  2  204 ? 68.410 111.653 84.758  1.00 31.66  ? 204  MET B C   1 
ATOM   4923  O  O   . MET B  2  204 ? 68.334 112.458 83.800  1.00 31.74  ? 204  MET B O   1 
ATOM   4924  C  CB  . MET B  2  204 ? 70.290 111.651 86.402  1.00 31.26  ? 204  MET B CB  1 
ATOM   4925  C  CG  . MET B  2  204 ? 71.077 110.683 87.335  1.00 46.99  ? 204  MET B CG  1 
ATOM   4926  S  SD  . MET B  2  204 ? 71.906 111.558 88.724  1.00 53.57  ? 204  MET B SD  1 
ATOM   4927  C  CE  . MET B  2  204 ? 70.984 112.887 88.783  1.00 41.37  ? 204  MET B CE  1 
ATOM   4928  N  N   . ALA B  2  205 ? 67.353 111.301 85.514  1.00 31.64  ? 205  ALA B N   1 
ATOM   4929  C  CA  . ALA B  2  205 ? 66.021 111.871 85.309  1.00 31.57  ? 205  ALA B CA  1 
ATOM   4930  C  C   . ALA B  2  205 ? 65.289 112.015 86.669  1.00 31.84  ? 205  ALA B C   1 
ATOM   4931  O  O   . ALA B  2  205 ? 65.204 111.060 87.427  1.00 31.57  ? 205  ALA B O   1 
ATOM   4932  C  CB  . ALA B  2  205 ? 65.234 110.997 84.387  1.00 31.48  ? 205  ALA B CB  1 
ATOM   4933  N  N   . LEU B  2  206 ? 64.777 113.214 86.975  1.00 31.79  ? 206  LEU B N   1 
ATOM   4934  C  CA  . LEU B  2  206 ? 64.068 113.444 88.270  1.00 30.94  ? 206  LEU B CA  1 
ATOM   4935  C  C   . LEU B  2  206 ? 62.596 113.585 87.979  1.00 31.13  ? 206  LEU B C   1 
ATOM   4936  O  O   . LEU B  2  206 ? 62.165 114.519 87.306  1.00 30.70  ? 206  LEU B O   1 
ATOM   4937  C  CB  . LEU B  2  206 ? 64.609 114.672 88.968  1.00 30.08  ? 206  LEU B CB  1 
ATOM   4938  C  CG  . LEU B  2  206 ? 64.143 115.015 90.381  1.00 34.96  ? 206  LEU B CG  1 
ATOM   4939  C  CD1 . LEU B  2  206 ? 64.471 113.908 91.452  1.00 18.14  ? 206  LEU B CD1 1 
ATOM   4940  C  CD2 . LEU B  2  206 ? 64.761 116.342 90.795  1.00 28.56  ? 206  LEU B CD2 1 
ATOM   4941  N  N   . ILE B  2  207 ? 61.836 112.603 88.415  1.00 31.65  ? 207  ILE B N   1 
ATOM   4942  C  CA  . ILE B  2  207 ? 60.402 112.544 88.128  1.00 32.40  ? 207  ILE B CA  1 
ATOM   4943  C  C   . ILE B  2  207 ? 59.649 112.776 89.382  1.00 33.12  ? 207  ILE B C   1 
ATOM   4944  O  O   . ILE B  2  207 ? 60.017 112.242 90.439  1.00 33.50  ? 207  ILE B O   1 
ATOM   4945  C  CB  . ILE B  2  207 ? 60.047 111.136 87.589  1.00 32.54  ? 207  ILE B CB  1 
ATOM   4946  C  CG1 . ILE B  2  207 ? 61.067 110.726 86.568  1.00 31.05  ? 207  ILE B CG1 1 
ATOM   4947  C  CG2 . ILE B  2  207 ? 58.661 111.114 86.988  1.00 25.15  ? 207  ILE B CG2 1 
ATOM   4948  C  CD1 . ILE B  2  207 ? 61.084 111.643 85.279  1.00 41.40  ? 207  ILE B CD1 1 
ATOM   4949  N  N   . GLY B  2  208 ? 58.566 113.526 89.281  1.00 33.45  ? 208  GLY B N   1 
ATOM   4950  C  CA  . GLY B  2  208 ? 57.779 113.861 90.440  1.00 34.14  ? 208  GLY B CA  1 
ATOM   4951  C  C   . GLY B  2  208 ? 56.301 113.736 90.245  1.00 34.75  ? 208  GLY B C   1 
ATOM   4952  O  O   . GLY B  2  208 ? 55.761 113.994 89.156  1.00 34.86  ? 208  GLY B O   1 
ATOM   4953  N  N   . LEU B  2  209 ? 55.634 113.368 91.325  1.00 35.28  ? 209  LEU B N   1 
ATOM   4954  C  CA  . LEU B  2  209 ? 54.213 113.161 91.312  1.00 36.08  ? 209  LEU B CA  1 
ATOM   4955  C  C   . LEU B  2  209 ? 53.650 113.771 92.532  1.00 36.22  ? 209  LEU B C   1 
ATOM   4956  O  O   . LEU B  2  209 ? 53.957 113.358 93.625  1.00 36.09  ? 209  LEU B O   1 
ATOM   4957  C  CB  . LEU B  2  209 ? 53.925 111.694 91.354  1.00 36.76  ? 209  LEU B CB  1 
ATOM   4958  C  CG  . LEU B  2  209 ? 52.876 111.374 90.366  1.00 49.74  ? 209  LEU B CG  1 
ATOM   4959  C  CD1 . LEU B  2  209 ? 53.591 111.394 89.014  1.00 48.97  ? 209  LEU B CD1 1 
ATOM   4960  C  CD2 . LEU B  2  209 ? 52.273 110.015 90.668  1.00 53.00  ? 209  LEU B CD2 1 
ATOM   4961  N  N   . GLY B  2  210 ? 52.813 114.765 92.359  1.00 36.64  ? 210  GLY B N   1 
ATOM   4962  C  CA  . GLY B  2  210 ? 52.249 115.445 93.480  1.00 36.56  ? 210  GLY B CA  1 
ATOM   4963  C  C   . GLY B  2  210 ? 53.165 116.548 93.920  1.00 36.92  ? 210  GLY B C   1 
ATOM   4964  O  O   . GLY B  2  210 ? 53.094 116.978 95.080  1.00 37.69  ? 210  GLY B O   1 
ATOM   4965  N  N   . VAL B  2  211 ? 54.096 116.942 93.047  1.00 36.74  ? 211  VAL B N   1 
ATOM   4966  C  CA  . VAL B  2  211 ? 54.969 118.103 93.315  1.00 37.43  ? 211  VAL B CA  1 
ATOM   4967  C  C   . VAL B  2  211 ? 54.812 119.044 92.171  1.00 38.13  ? 211  VAL B C   1 
ATOM   4968  O  O   . VAL B  2  211 ? 54.054 118.768 91.230  1.00 38.58  ? 211  VAL B O   1 
ATOM   4969  C  CB  . VAL B  2  211 ? 56.436 117.762 93.454  1.00 37.23  ? 211  VAL B CB  1 
ATOM   4970  C  CG1 . VAL B  2  211 ? 56.671 117.051 94.686  1.00 39.32  ? 211  VAL B CG1 1 
ATOM   4971  C  CG2 . VAL B  2  211 ? 56.888 116.955 92.295  1.00 52.46  ? 211  VAL B CG2 1 
ATOM   4972  N  N   . SER B  2  212 ? 55.516 120.158 92.224  1.00 38.20  ? 212  SER B N   1 
ATOM   4973  C  CA  . SER B  2  212 ? 55.387 121.161 91.171  1.00 38.15  ? 212  SER B CA  1 
ATOM   4974  C  C   . SER B  2  212 ? 56.675 121.281 90.389  1.00 37.50  ? 212  SER B C   1 
ATOM   4975  O  O   . SER B  2  212 ? 57.769 121.129 90.940  1.00 37.81  ? 212  SER B O   1 
ATOM   4976  C  CB  . SER B  2  212 ? 55.011 122.518 91.750  1.00 38.40  ? 212  SER B CB  1 
ATOM   4977  O  OG  . SER B  2  212 ? 56.155 123.138 92.337  1.00 40.37  ? 212  SER B OG  1 
ATOM   4978  N  N   . HIS B  2  213 ? 56.539 121.589 89.110  1.00 36.40  ? 213  HIS B N   1 
ATOM   4979  C  CA  . HIS B  2  213 ? 57.674 121.716 88.244  1.00 35.45  ? 213  HIS B CA  1 
ATOM   4980  C  C   . HIS B  2  213 ? 58.804 122.649 88.717  1.00 34.62  ? 213  HIS B C   1 
ATOM   4981  O  O   . HIS B  2  213 ? 59.968 122.235 88.665  1.00 35.00  ? 213  HIS B O   1 
ATOM   4982  C  CB  . HIS B  2  213 ? 57.257 122.018 86.827  1.00 35.57  ? 213  HIS B CB  1 
ATOM   4983  C  CG  . HIS B  2  213 ? 58.197 121.480 85.812  1.00 42.15  ? 213  HIS B CG  1 
ATOM   4984  N  ND1 . HIS B  2  213 ? 58.194 120.156 85.434  1.00 33.95  ? 213  HIS B ND1 1 
ATOM   4985  C  CD2 . HIS B  2  213 ? 59.206 122.070 85.125  1.00 40.60  ? 213  HIS B CD2 1 
ATOM   4986  C  CE1 . HIS B  2  213 ? 59.143 119.961 84.537  1.00 43.87  ? 213  HIS B CE1 1 
ATOM   4987  N  NE2 . HIS B  2  213 ? 59.780 121.103 84.341  1.00 37.55  ? 213  HIS B NE2 1 
ATOM   4988  N  N   . PRO B  2  214 ? 58.488 123.881 89.176  1.00 33.30  ? 214  PRO B N   1 
ATOM   4989  C  CA  . PRO B  2  214 ? 59.526 124.789 89.684  1.00 32.91  ? 214  PRO B CA  1 
ATOM   4990  C  C   . PRO B  2  214 ? 60.350 124.178 90.775  1.00 33.02  ? 214  PRO B C   1 
ATOM   4991  O  O   . PRO B  2  214 ? 61.573 124.281 90.737  1.00 33.04  ? 214  PRO B O   1 
ATOM   4992  C  CB  . PRO B  2  214 ? 58.717 125.982 90.247  1.00 32.61  ? 214  PRO B CB  1 
ATOM   4993  C  CG  . PRO B  2  214 ? 57.473 125.995 89.436  1.00 28.65  ? 214  PRO B CG  1 
ATOM   4994  C  CD  . PRO B  2  214 ? 57.160 124.540 89.163  1.00 33.22  ? 214  PRO B CD  1 
ATOM   4995  N  N   . VAL B  2  215 ? 59.696 123.528 91.726  1.00 33.32  ? 215  VAL B N   1 
ATOM   4996  C  CA  . VAL B  2  215 ? 60.389 122.885 92.823  1.00 33.78  ? 215  VAL B CA  1 
ATOM   4997  C  C   . VAL B  2  215 ? 61.363 121.787 92.338  1.00 34.99  ? 215  VAL B C   1 
ATOM   4998  O  O   . VAL B  2  215 ? 62.569 121.792 92.715  1.00 35.91  ? 215  VAL B O   1 
ATOM   4999  C  CB  . VAL B  2  215 ? 59.400 122.346 93.871  1.00 33.11  ? 215  VAL B CB  1 
ATOM   5000  C  CG1 . VAL B  2  215 ? 60.039 121.260 94.711  1.00 30.24  ? 215  VAL B CG1 1 
ATOM   5001  C  CG2 . VAL B  2  215 ? 58.901 123.484 94.746  1.00 22.24  ? 215  VAL B CG2 1 
ATOM   5002  N  N   . LEU B  2  216 ? 60.882 120.885 91.475  1.00 34.63  ? 216  LEU B N   1 
ATOM   5003  C  CA  . LEU B  2  216 ? 61.752 119.829 90.957  1.00 34.43  ? 216  LEU B CA  1 
ATOM   5004  C  C   . LEU B  2  216 ? 62.906 120.452 90.187  1.00 34.68  ? 216  LEU B C   1 
ATOM   5005  O  O   . LEU B  2  216 ? 64.071 120.086 90.406  1.00 34.90  ? 216  LEU B O   1 
ATOM   5006  C  CB  . LEU B  2  216 ? 60.989 118.866 90.069  1.00 33.91  ? 216  LEU B CB  1 
ATOM   5007  C  CG  . LEU B  2  216 ? 60.324 117.687 90.717  1.00 36.90  ? 216  LEU B CG  1 
ATOM   5008  C  CD1 . LEU B  2  216 ? 59.994 116.642 89.618  1.00 37.44  ? 216  LEU B CD1 1 
ATOM   5009  C  CD2 . LEU B  2  216 ? 61.242 117.061 91.806  1.00 32.80  ? 216  LEU B CD2 1 
ATOM   5010  N  N   . LYS B  2  217 ? 62.579 121.433 89.331  1.00 34.60  ? 217  LYS B N   1 
ATOM   5011  C  CA  . LYS B  2  217 ? 63.580 122.164 88.505  1.00 35.38  ? 217  LYS B CA  1 
ATOM   5012  C  C   . LYS B  2  217 ? 64.599 122.922 89.363  1.00 35.68  ? 217  LYS B C   1 
ATOM   5013  O  O   . LYS B  2  217 ? 65.763 123.006 89.006  1.00 36.05  ? 217  LYS B O   1 
ATOM   5014  C  CB  . LYS B  2  217 ? 62.865 123.152 87.577  1.00 35.74  ? 217  LYS B CB  1 
ATOM   5015  C  CG  . LYS B  2  217 ? 63.598 123.560 86.349  1.00 32.52  ? 217  LYS B CG  1 
ATOM   5016  C  CD  . LYS B  2  217 ? 62.625 124.285 85.396  1.00 39.61  ? 217  LYS B CD  1 
ATOM   5017  C  CE  . LYS B  2  217 ? 63.352 125.046 84.296  1.00 33.90  ? 217  LYS B CE  1 
ATOM   5018  N  NZ  . LYS B  2  217 ? 64.467 125.767 84.885  1.00 38.88  ? 217  LYS B NZ  1 
ATOM   5019  N  N   . GLN B  2  218 ? 64.143 123.492 90.473  1.00 35.58  ? 218  GLN B N   1 
ATOM   5020  C  CA  . GLN B  2  218 ? 65.044 124.162 91.412  1.00 36.37  ? 218  GLN B CA  1 
ATOM   5021  C  C   . GLN B  2  218 ? 65.995 123.118 92.027  1.00 36.84  ? 218  GLN B C   1 
ATOM   5022  O  O   . GLN B  2  218 ? 67.219 123.300 92.041  1.00 36.47  ? 218  GLN B O   1 
ATOM   5023  C  CB  . GLN B  2  218 ? 64.235 124.806 92.547  1.00 36.68  ? 218  GLN B CB  1 
ATOM   5024  C  CG  . GLN B  2  218 ? 65.025 125.597 93.514  1.00 42.79  ? 218  GLN B CG  1 
ATOM   5025  C  CD  . GLN B  2  218 ? 65.364 126.990 92.986  1.00 58.56  ? 218  GLN B CD  1 
ATOM   5026  O  OE1 . GLN B  2  218 ? 66.229 127.135 92.108  1.00 61.98  ? 218  GLN B OE1 1 
ATOM   5027  N  NE2 . GLN B  2  218 ? 64.677 128.024 93.516  1.00 56.99  ? 218  GLN B NE2 1 
ATOM   5028  N  N   . VAL B  2  219 ? 65.413 122.015 92.504  1.00 37.32  ? 219  VAL B N   1 
ATOM   5029  C  CA  . VAL B  2  219 ? 66.172 120.968 93.129  1.00 38.83  ? 219  VAL B CA  1 
ATOM   5030  C  C   . VAL B  2  219 ? 67.245 120.407 92.176  1.00 39.55  ? 219  VAL B C   1 
ATOM   5031  O  O   . VAL B  2  219 ? 68.408 120.192 92.566  1.00 39.40  ? 219  VAL B O   1 
ATOM   5032  C  CB  . VAL B  2  219 ? 65.236 119.832 93.597  1.00 39.65  ? 219  VAL B CB  1 
ATOM   5033  C  CG1 . VAL B  2  219 ? 65.995 118.450 93.694  1.00 30.08  ? 219  VAL B CG1 1 
ATOM   5034  C  CG2 . VAL B  2  219 ? 64.612 120.194 94.914  1.00 44.23  ? 219  VAL B CG2 1 
ATOM   5035  N  N   . ALA B  2  220 ? 66.863 120.246 90.922  1.00 40.20  ? 220  ALA B N   1 
ATOM   5036  C  CA  . ALA B  2  220 ? 67.745 119.696 89.919  1.00 40.87  ? 220  ALA B CA  1 
ATOM   5037  C  C   . ALA B  2  220 ? 68.887 120.640 89.566  1.00 41.51  ? 220  ALA B C   1 
ATOM   5038  O  O   . ALA B  2  220 ? 70.020 120.202 89.289  1.00 41.83  ? 220  ALA B O   1 
ATOM   5039  C  CB  . ALA B  2  220 ? 66.976 119.374 88.726  1.00 40.82  ? 220  ALA B CB  1 
ATOM   5040  N  N   . GLU B  2  221 ? 68.597 121.934 89.563  1.00 41.37  ? 221  GLU B N   1 
ATOM   5041  C  CA  . GLU B  2  221 ? 69.608 122.900 89.243  1.00 41.32  ? 221  GLU B CA  1 
ATOM   5042  C  C   . GLU B  2  221 ? 70.569 123.116 90.422  1.00 40.96  ? 221  GLU B C   1 
ATOM   5043  O  O   . GLU B  2  221 ? 71.747 123.361 90.226  1.00 40.74  ? 221  GLU B O   1 
ATOM   5044  C  CB  . GLU B  2  221 ? 68.979 124.198 88.734  1.00 41.68  ? 221  GLU B CB  1 
ATOM   5045  C  CG  . GLU B  2  221 ? 68.374 124.046 87.330  1.00 47.90  ? 221  GLU B CG  1 
ATOM   5046  C  CD  . GLU B  2  221 ? 67.675 125.318 86.803  1.00 48.89  ? 221  GLU B CD  1 
ATOM   5047  O  OE1 . GLU B  2  221 ? 66.753 125.854 87.492  1.00 45.73  ? 221  GLU B OE1 1 
ATOM   5048  O  OE2 . GLU B  2  221 ? 68.027 125.757 85.678  1.00 40.30  ? 221  GLU B OE2 1 
ATOM   5049  N  N   . GLN B  2  222 ? 70.072 122.947 91.639  1.00 41.15  ? 222  GLN B N   1 
ATOM   5050  C  CA  . GLN B  2  222 ? 70.906 123.115 92.824  1.00 41.65  ? 222  GLN B CA  1 
ATOM   5051  C  C   . GLN B  2  222 ? 71.702 121.868 93.186  1.00 42.02  ? 222  GLN B C   1 
ATOM   5052  O  O   . GLN B  2  222 ? 72.890 121.951 93.524  1.00 42.23  ? 222  GLN B O   1 
ATOM   5053  C  CB  . GLN B  2  222 ? 70.047 123.480 94.034  1.00 42.02  ? 222  GLN B CB  1 
ATOM   5054  C  CG  . GLN B  2  222 ? 69.429 124.900 94.001  1.00 58.71  ? 222  GLN B CG  1 
ATOM   5055  C  CD  . GLN B  2  222 ? 68.690 125.234 95.308  1.00 62.58  ? 222  GLN B CD  1 
ATOM   5056  O  OE1 . GLN B  2  222 ? 67.477 125.484 95.302  1.00 58.13  ? 222  GLN B OE1 1 
ATOM   5057  N  NE2 . GLN B  2  222 ? 69.421 125.207 96.430  1.00 63.20  ? 222  GLN B NE2 1 
ATOM   5058  N  N   . PHE B  2  223 ? 71.060 120.706 93.094  1.00 41.71  ? 223  PHE B N   1 
ATOM   5059  C  CA  . PHE B  2  223 ? 71.678 119.511 93.558  1.00 41.92  ? 223  PHE B CA  1 
ATOM   5060  C  C   . PHE B  2  223 ? 72.039 118.435 92.565  1.00 42.69  ? 223  PHE B C   1 
ATOM   5061  O  O   . PHE B  2  223 ? 72.885 117.602 92.852  1.00 42.68  ? 223  PHE B O   1 
ATOM   5062  C  CB  . PHE B  2  223 ? 70.873 118.929 94.717  1.00 41.96  ? 223  PHE B CB  1 
ATOM   5063  C  CG  . PHE B  2  223 ? 70.648 119.910 95.850  1.00 38.64  ? 223  PHE B CG  1 
ATOM   5064  C  CD1 . PHE B  2  223 ? 69.395 120.531 96.028  1.00 31.53  ? 223  PHE B CD1 1 
ATOM   5065  C  CD2 . PHE B  2  223 ? 71.707 120.261 96.702  1.00 37.28  ? 223  PHE B CD2 1 
ATOM   5066  C  CE1 . PHE B  2  223 ? 69.193 121.475 97.050  1.00 38.80  ? 223  PHE B CE1 1 
ATOM   5067  C  CE2 . PHE B  2  223 ? 71.526 121.227 97.740  1.00 44.65  ? 223  PHE B CE2 1 
ATOM   5068  C  CZ  . PHE B  2  223 ? 70.269 121.826 97.921  1.00 40.84  ? 223  PHE B CZ  1 
ATOM   5069  N  N   . LEU B  2  224 ? 71.428 118.433 91.399  1.00 43.12  ? 224  LEU B N   1 
ATOM   5070  C  CA  . LEU B  2  224 ? 71.734 117.379 90.453  1.00 43.38  ? 224  LEU B CA  1 
ATOM   5071  C  C   . LEU B  2  224 ? 72.679 117.739 89.345  1.00 44.47  ? 224  LEU B C   1 
ATOM   5072  O  O   . LEU B  2  224 ? 72.715 117.059 88.333  1.00 44.54  ? 224  LEU B O   1 
ATOM   5073  C  CB  . LEU B  2  224 ? 70.473 116.734 89.916  1.00 43.08  ? 224  LEU B CB  1 
ATOM   5074  C  CG  . LEU B  2  224 ? 69.642 116.119 91.038  1.00 39.34  ? 224  LEU B CG  1 
ATOM   5075  C  CD1 . LEU B  2  224 ? 68.421 115.533 90.516  1.00 34.75  ? 224  LEU B CD1 1 
ATOM   5076  C  CD2 . LEU B  2  224 ? 70.447 115.094 91.758  1.00 44.84  ? 224  LEU B CD2 1 
ATOM   5077  N  N   . ASN B  2  225 ? 73.452 118.818 89.521  1.00 45.39  ? 225  ASN B N   1 
ATOM   5078  C  CA  . ASN B  2  225 ? 74.452 119.184 88.516  1.00 45.61  ? 225  ASN B CA  1 
ATOM   5079  C  C   . ASN B  2  225 ? 75.778 118.498 88.816  1.00 46.37  ? 225  ASN B C   1 
ATOM   5080  O  O   . ASN B  2  225 ? 76.661 119.051 89.424  1.00 46.40  ? 225  ASN B O   1 
ATOM   5081  C  CB  . ASN B  2  225 ? 74.638 120.670 88.413  1.00 45.16  ? 225  ASN B CB  1 
ATOM   5082  C  CG  . ASN B  2  225 ? 75.219 121.057 87.118  1.00 45.65  ? 225  ASN B CG  1 
ATOM   5083  O  OD1 . ASN B  2  225 ? 74.939 120.415 86.099  1.00 46.66  ? 225  ASN B OD1 1 
ATOM   5084  N  ND2 . ASN B  2  225 ? 76.075 122.079 87.116  1.00 42.72  ? 225  ASN B ND2 1 
ATOM   5085  N  N   . ILE B  2  226 ? 75.844 117.246 88.453  1.00 47.44  ? 226  ILE B N   1 
ATOM   5086  C  CA  . ILE B  2  226 ? 76.992 116.426 88.677  1.00 48.27  ? 226  ILE B CA  1 
ATOM   5087  C  C   . ILE B  2  226 ? 77.321 115.924 87.362  1.00 50.35  ? 226  ILE B C   1 
ATOM   5088  O  O   . ILE B  2  226 ? 76.460 115.355 86.719  1.00 50.49  ? 226  ILE B O   1 
ATOM   5089  C  CB  . ILE B  2  226 ? 76.574 115.111 89.462  1.00 47.50  ? 226  ILE B CB  1 
ATOM   5090  C  CG1 . ILE B  2  226 ? 75.463 115.337 90.481  1.00 33.57  ? 226  ILE B CG1 1 
ATOM   5091  C  CG2 . ILE B  2  226 ? 77.777 114.367 89.982  1.00 36.15  ? 226  ILE B CG2 1 
ATOM   5092  C  CD1 . ILE B  2  226 ? 75.894 116.060 91.685  1.00 57.63  ? 226  ILE B CD1 1 
ATOM   5093  N  N   . ARG B  2  227 ? 78.537 116.099 86.915  1.00 52.61  ? 227  ARG B N   1 
ATOM   5094  C  CA  . ARG B  2  227 ? 78.915 115.424 85.716  1.00 55.85  ? 227  ARG B CA  1 
ATOM   5095  C  C   . ARG B  2  227 ? 80.371 115.274 85.578  1.00 58.57  ? 227  ARG B C   1 
ATOM   5096  O  O   . ARG B  2  227 ? 81.107 116.219 85.749  1.00 59.15  ? 227  ARG B O   1 
ATOM   5097  C  CB  . ARG B  2  227 ? 78.239 115.971 84.445  1.00 56.64  ? 227  ARG B CB  1 
ATOM   5098  C  CG  . ARG B  2  227 ? 77.788 114.816 83.399  1.00 58.34  ? 227  ARG B CG  1 
ATOM   5099  C  CD  . ARG B  2  227 ? 78.947 114.225 82.560  1.00 70.48  ? 227  ARG B CD  1 
ATOM   5100  N  NE  . ARG B  2  227 ? 78.531 113.169 81.628  1.00 83.34  ? 227  ARG B NE  1 
ATOM   5101  C  CZ  . ARG B  2  227 ? 78.826 113.161 80.310  1.00 88.36  ? 227  ARG B CZ  1 
ATOM   5102  N  NH1 . ARG B  2  227 ? 79.528 114.168 79.757  1.00 83.14  ? 227  ARG B NH1 1 
ATOM   5103  N  NH2 . ARG B  2  227 ? 78.407 112.156 79.548  1.00 87.93  ? 227  ARG B NH2 1 
ATOM   5104  N  N   . GLY B  2  228 ? 80.788 114.044 85.289  1.00 60.89  ? 228  GLY B N   1 
ATOM   5105  C  CA  . GLY B  2  228 ? 82.181 113.703 85.079  1.00 63.01  ? 228  GLY B CA  1 
ATOM   5106  C  C   . GLY B  2  228 ? 82.301 112.199 85.032  1.00 65.05  ? 228  GLY B C   1 
ATOM   5107  O  O   . GLY B  2  228 ? 83.313 111.637 85.415  1.00 65.64  ? 228  GLY B O   1 
ATOM   5108  N  N   . GLY B  2  229 ? 81.244 111.538 84.590  1.00 66.54  ? 229  GLY B N   1 
ATOM   5109  C  CA  . GLY B  2  229 ? 81.248 110.087 84.528  1.00 68.22  ? 229  GLY B CA  1 
ATOM   5110  C  C   . GLY B  2  229 ? 81.452 109.569 83.126  1.00 69.91  ? 229  GLY B C   1 
ATOM   5111  O  O   . GLY B  2  229 ? 82.268 110.105 82.366  1.00 70.28  ? 229  GLY B O   1 
ATOM   5112  N  N   . LEU B  2  230 ? 80.743 108.506 82.776  1.00 71.06  ? 230  LEU B N   1 
ATOM   5113  C  CA  . LEU B  2  230 ? 80.829 107.981 81.415  1.00 72.19  ? 230  LEU B CA  1 
ATOM   5114  C  C   . LEU B  2  230 ? 79.740 108.687 80.563  1.00 73.55  ? 230  LEU B C   1 
ATOM   5115  O  O   . LEU B  2  230 ? 79.107 109.657 81.037  1.00 73.36  ? 230  LEU B O   1 
ATOM   5116  C  CB  . LEU B  2  230 ? 80.724 106.437 81.398  1.00 71.77  ? 230  LEU B CB  1 
ATOM   5117  C  CG  . LEU B  2  230 ? 81.818 105.689 82.204  1.00 64.28  ? 230  LEU B CG  1 
ATOM   5118  C  CD1 . LEU B  2  230 ? 81.334 104.381 82.725  1.00 68.90  ? 230  LEU B CD1 1 
ATOM   5119  C  CD2 . LEU B  2  230 ? 83.120 105.503 81.440  1.00 64.70  ? 230  LEU B CD2 1 
ATOM   5120  N  N   . GLY B  2  231 ? 79.492 108.207 79.344  1.00 74.98  ? 231  GLY B N   1 
ATOM   5121  C  CA  . GLY B  2  231 ? 78.546 108.896 78.476  1.00 76.41  ? 231  GLY B CA  1 
ATOM   5122  C  C   . GLY B  2  231 ? 77.181 108.314 78.069  1.00 77.76  ? 231  GLY B C   1 
ATOM   5123  O  O   . GLY B  2  231 ? 76.118 108.774 78.531  1.00 77.66  ? 231  GLY B O   1 
ATOM   5124  N  N   . LEU B  2  232 ? 77.200 107.343 77.163  1.00 79.02  ? 232  LEU B N   1 
ATOM   5125  C  CA  . LEU B  2  232 ? 75.949 106.800 76.602  1.00 80.10  ? 232  LEU B CA  1 
ATOM   5126  C  C   . LEU B  2  232 ? 75.285 105.550 77.260  1.00 80.67  ? 232  LEU B C   1 
ATOM   5127  O  O   . LEU B  2  232 ? 75.508 105.223 78.461  1.00 80.61  ? 232  LEU B O   1 
ATOM   5128  C  CB  . LEU B  2  232 ? 76.054 106.628 75.054  1.00 80.28  ? 232  LEU B CB  1 
ATOM   5129  C  CG  . LEU B  2  232 ? 77.332 106.123 74.305  1.00 84.43  ? 232  LEU B CG  1 
ATOM   5130  C  CD1 . LEU B  2  232 ? 78.388 107.253 74.007  1.00 76.67  ? 232  LEU B CD1 1 
ATOM   5131  C  CD2 . LEU B  2  232 ? 77.981 104.846 74.894  1.00 76.35  ? 232  LEU B CD2 1 
ATOM   5132  N  N   . SER B  2  233 ? 74.427 104.897 76.470  1.00 80.90  ? 233  SER B N   1 
ATOM   5133  C  CA  . SER B  2  233 ? 73.738 103.687 76.901  1.00 80.68  ? 233  SER B CA  1 
ATOM   5134  C  C   . SER B  2  233 ? 74.545 102.443 76.513  1.00 80.29  ? 233  SER B C   1 
ATOM   5135  O  O   . SER B  2  233 ? 74.098 101.642 75.664  1.00 80.49  ? 233  SER B O   1 
ATOM   5136  C  CB  . SER B  2  233 ? 72.290 103.601 76.325  1.00 80.50  ? 233  SER B CB  1 
ATOM   5137  O  OG  . SER B  2  233 ? 71.376 104.466 77.018  1.00 66.30  ? 233  SER B OG  1 
ATOM   5138  N  N   . GLY B  2  234 ? 75.785 102.350 77.037  1.00 79.23  ? 234  GLY B N   1 
ATOM   5139  C  CA  . GLY B  2  234 ? 76.578 101.136 76.865  1.00 77.63  ? 234  GLY B CA  1 
ATOM   5140  C  C   . GLY B  2  234 ? 78.035 101.023 76.394  1.00 75.43  ? 234  GLY B C   1 
ATOM   5141  O  O   . GLY B  2  234 ? 78.766 101.998 76.171  1.00 75.19  ? 234  GLY B O   1 
ATOM   5142  N  N   . ALA B  2  235 ? 78.456 99.749  76.355  1.00 73.14  ? 235  ALA B N   1 
ATOM   5143  C  CA  . ALA B  2  235 ? 79.735 99.328  75.822  1.00 69.75  ? 235  ALA B CA  1 
ATOM   5144  C  C   . ALA B  2  235 ? 79.262 98.689  74.527  1.00 66.39  ? 235  ALA B C   1 
ATOM   5145  O  O   . ALA B  2  235 ? 80.061 98.441  73.587  1.00 66.64  ? 235  ALA B O   1 
ATOM   5146  C  CB  . ALA B  2  235 ? 80.372 98.260  76.743  1.00 69.33  ? 235  ALA B CB  1 
ATOM   5147  N  N   . LYS B  2  236 ? 77.921 98.505  74.487  1.00 62.47  ? 236  LYS B N   1 
ATOM   5148  C  CA  . LYS B  2  236 ? 77.141 97.872  73.407  1.00 59.03  ? 236  LYS B CA  1 
ATOM   5149  C  C   . LYS B  2  236 ? 77.015 96.374  73.604  1.00 55.62  ? 236  LYS B C   1 
ATOM   5150  O  O   . LYS B  2  236 ? 78.020 95.636  73.653  1.00 55.65  ? 236  LYS B O   1 
ATOM   5151  C  CB  . LYS B  2  236 ? 77.572 98.249  71.992  1.00 59.16  ? 236  LYS B CB  1 
ATOM   5152  C  CG  . LYS B  2  236 ? 76.676 97.629  70.921  1.00 70.83  ? 236  LYS B CG  1 
ATOM   5153  C  CD  . LYS B  2  236 ? 76.304 98.637  69.827  1.00 78.69  ? 236  LYS B CD  1 
ATOM   5154  C  CE  . LYS B  2  236 ? 75.118 98.132  68.973  1.00 84.36  ? 236  LYS B CE  1 
ATOM   5155  N  NZ  . LYS B  2  236 ? 74.373 99.260  68.316  1.00 83.65  ? 236  LYS B NZ  1 
ATOM   5156  N  N   . ALA B  2  237 ? 75.785 95.939  73.817  1.00 51.79  ? 237  ALA B N   1 
ATOM   5157  C  CA  . ALA B  2  237 ? 75.517 94.564  74.048  1.00 48.13  ? 237  ALA B CA  1 
ATOM   5158  C  C   . ALA B  2  237 ? 75.728 93.792  72.782  1.00 45.40  ? 237  ALA B C   1 
ATOM   5159  O  O   . ALA B  2  237 ? 75.091 94.042  71.803  1.00 45.11  ? 237  ALA B O   1 
ATOM   5160  C  CB  . ALA B  2  237 ? 74.155 94.406  74.507  1.00 47.98  ? 237  ALA B CB  1 
ATOM   5161  N  N   . LYS B  2  238 ? 76.684 92.889  72.799  1.00 43.54  ? 238  LYS B N   1 
ATOM   5162  C  CA  . LYS B  2  238 ? 76.950 92.055  71.649  1.00 41.35  ? 238  LYS B CA  1 
ATOM   5163  C  C   . LYS B  2  238 ? 76.206 90.750  71.837  1.00 38.61  ? 238  LYS B C   1 
ATOM   5164  O  O   . LYS B  2  238 ? 76.580 89.966  72.679  1.00 38.06  ? 238  LYS B O   1 
ATOM   5165  C  CB  . LYS B  2  238 ? 78.454 91.776  71.541  1.00 42.06  ? 238  LYS B CB  1 
ATOM   5166  C  CG  . LYS B  2  238 ? 79.348 93.050  71.430  1.00 53.61  ? 238  LYS B CG  1 
ATOM   5167  C  CD  . LYS B  2  238 ? 80.716 92.743  70.669  1.00 67.86  ? 238  LYS B CD  1 
ATOM   5168  C  CE  . LYS B  2  238 ? 81.859 92.201  71.601  1.00 69.85  ? 238  LYS B CE  1 
ATOM   5169  N  NZ  . LYS B  2  238 ? 82.795 93.281  72.124  1.00 72.38  ? 238  LYS B NZ  1 
ATOM   5170  N  N   . TYR B  2  239 ? 75.104 90.549  71.091  1.00 36.95  ? 239  TYR B N   1 
ATOM   5171  C  CA  . TYR B  2  239 ? 74.327 89.286  71.175  1.00 34.95  ? 239  TYR B CA  1 
ATOM   5172  C  C   . TYR B  2  239 ? 75.154 88.205  70.597  1.00 34.60  ? 239  TYR B C   1 
ATOM   5173  O  O   . TYR B  2  239 ? 75.626 88.333  69.491  1.00 34.79  ? 239  TYR B O   1 
ATOM   5174  C  CB  . TYR B  2  239 ? 73.081 89.365  70.358  1.00 33.89  ? 239  TYR B CB  1 
ATOM   5175  C  CG  . TYR B  2  239 ? 72.210 88.122  70.439  1.00 27.00  ? 239  TYR B CG  1 
ATOM   5176  C  CD1 . TYR B  2  239 ? 72.413 87.028  69.580  1.00 20.63  ? 239  TYR B CD1 1 
ATOM   5177  C  CD2 . TYR B  2  239 ? 71.199 88.026  71.389  1.00 17.66  ? 239  TYR B CD2 1 
ATOM   5178  C  CE1 . TYR B  2  239 ? 71.605 85.902  69.663  1.00 29.01  ? 239  TYR B CE1 1 
ATOM   5179  C  CE2 . TYR B  2  239 ? 70.396 86.947  71.457  1.00 25.88  ? 239  TYR B CE2 1 
ATOM   5180  C  CZ  . TYR B  2  239 ? 70.589 85.873  70.594  1.00 33.13  ? 239  TYR B CZ  1 
ATOM   5181  O  OH  . TYR B  2  239 ? 69.761 84.776  70.693  1.00 36.64  ? 239  TYR B OH  1 
ATOM   5182  N  N   . HIS B  2  240 ? 75.169 87.075  71.268  1.00 34.23  ? 240  HIS B N   1 
ATOM   5183  C  CA  . HIS B  2  240 ? 76.034 85.979  70.932  1.00 34.56  ? 240  HIS B CA  1 
ATOM   5184  C  C   . HIS B  2  240 ? 75.232 84.680  70.757  1.00 35.02  ? 240  HIS B C   1 
ATOM   5185  O  O   . HIS B  2  240 ? 75.243 84.076  69.685  1.00 35.64  ? 240  HIS B O   1 
ATOM   5186  C  CB  . HIS B  2  240 ? 77.092 85.932  72.073  1.00 34.63  ? 240  HIS B CB  1 
ATOM   5187  C  CG  . HIS B  2  240 ? 77.703 84.596  72.358  1.00 41.47  ? 240  HIS B CG  1 
ATOM   5188  N  ND1 . HIS B  2  240 ? 78.548 83.947  71.473  1.00 38.48  ? 240  HIS B ND1 1 
ATOM   5189  C  CD2 . HIS B  2  240 ? 77.768 83.896  73.520  1.00 39.51  ? 240  HIS B CD2 1 
ATOM   5190  C  CE1 . HIS B  2  240 ? 79.021 82.853  72.045  1.00 39.46  ? 240  HIS B CE1 1 
ATOM   5191  N  NE2 . HIS B  2  240 ? 78.562 82.800  73.288  1.00 48.82  ? 240  HIS B NE2 1 
ATOM   5192  N  N   . GLY B  2  241 ? 74.482 84.285  71.773  1.00 34.22  ? 241  GLY B N   1 
ATOM   5193  C  CA  . GLY B  2  241 ? 73.680 83.086  71.661  1.00 32.60  ? 241  GLY B CA  1 
ATOM   5194  C  C   . GLY B  2  241 ? 74.375 81.959  72.355  1.00 31.62  ? 241  GLY B C   1 
ATOM   5195  O  O   . GLY B  2  241 ? 75.536 82.051  72.676  1.00 31.51  ? 241  GLY B O   1 
ATOM   5196  N  N   . GLY B  2  242 ? 73.661 80.883  72.571  1.00 31.02  ? 242  GLY B N   1 
ATOM   5197  C  CA  . GLY B  2  242 ? 74.216 79.731  73.251  1.00 30.49  ? 242  GLY B CA  1 
ATOM   5198  C  C   . GLY B  2  242 ? 73.219 79.273  74.287  1.00 29.70  ? 242  GLY B C   1 
ATOM   5199  O  O   . GLY B  2  242 ? 72.141 79.839  74.370  1.00 29.62  ? 242  GLY B O   1 
ATOM   5200  N  N   . GLU B  2  243 ? 73.590 78.315  75.123  1.00 28.85  ? 243  GLU B N   1 
ATOM   5201  C  CA  . GLU B  2  243 ? 72.636 77.826  76.090  1.00 28.77  ? 243  GLU B CA  1 
ATOM   5202  C  C   . GLU B  2  243 ? 73.210 77.459  77.485  1.00 29.56  ? 243  GLU B C   1 
ATOM   5203  O  O   . GLU B  2  243 ? 74.327 76.984  77.602  1.00 30.45  ? 243  GLU B O   1 
ATOM   5204  C  CB  . GLU B  2  243 ? 71.907 76.653  75.494  1.00 28.10  ? 243  GLU B CB  1 
ATOM   5205  C  CG  . GLU B  2  243 ? 72.808 75.463  75.225  1.00 20.35  ? 243  GLU B CG  1 
ATOM   5206  C  CD  . GLU B  2  243 ? 72.220 74.527  74.204  1.00 30.48  ? 243  GLU B CD  1 
ATOM   5207  O  OE1 . GLU B  2  243 ? 72.880 74.268  73.191  1.00 39.77  ? 243  GLU B OE1 1 
ATOM   5208  O  OE2 . GLU B  2  243 ? 71.088 74.054  74.416  1.00 37.07  ? 243  GLU B OE2 1 
ATOM   5209  N  N   . ILE B  2  244 ? 72.460 77.720  78.538  1.00 29.43  ? 244  ILE B N   1 
ATOM   5210  C  CA  . ILE B  2  244 ? 72.916 77.326  79.861  1.00 29.79  ? 244  ILE B CA  1 
ATOM   5211  C  C   . ILE B  2  244 ? 71.938 76.365  80.471  1.00 30.74  ? 244  ILE B C   1 
ATOM   5212  O  O   . ILE B  2  244 ? 70.760 76.608  80.479  1.00 31.03  ? 244  ILE B O   1 
ATOM   5213  C  CB  . ILE B  2  244 ? 73.145 78.496  80.739  1.00 29.84  ? 244  ILE B CB  1 
ATOM   5214  C  CG1 . ILE B  2  244 ? 74.228 79.428  80.092  1.00 28.29  ? 244  ILE B CG1 1 
ATOM   5215  C  CG2 . ILE B  2  244 ? 73.540 77.999  82.192  1.00 23.91  ? 244  ILE B CG2 1 
ATOM   5216  C  CD1 . ILE B  2  244 ? 74.884 80.480  81.040  1.00 12.41  ? 244  ILE B CD1 1 
ATOM   5217  N  N   . ARG B  2  245 ? 72.443 75.252  80.967  1.00 31.49  ? 245  ARG B N   1 
ATOM   5218  C  CA  . ARG B  2  245 ? 71.609 74.194  81.509  1.00 31.66  ? 245  ARG B CA  1 
ATOM   5219  C  C   . ARG B  2  245 ? 71.898 73.861  82.974  1.00 32.41  ? 245  ARG B C   1 
ATOM   5220  O  O   . ARG B  2  245 ? 72.996 73.434  83.312  1.00 31.78  ? 245  ARG B O   1 
ATOM   5221  C  CB  . ARG B  2  245 ? 71.898 72.961  80.747  1.00 31.68  ? 245  ARG B CB  1 
ATOM   5222  C  CG  . ARG B  2  245 ? 71.432 72.927  79.366  1.00 22.02  ? 245  ARG B CG  1 
ATOM   5223  C  CD  . ARG B  2  245 ? 71.421 71.508  78.839  1.00 32.33  ? 245  ARG B CD  1 
ATOM   5224  N  NE  . ARG B  2  245 ? 70.320 71.341  77.939  1.00 35.82  ? 245  ARG B NE  1 
ATOM   5225  C  CZ  . ARG B  2  245 ? 69.559 70.287  77.872  1.00 30.24  ? 245  ARG B CZ  1 
ATOM   5226  N  NH1 . ARG B  2  245 ? 69.766 69.223  78.650  1.00 35.89  ? 245  ARG B NH1 1 
ATOM   5227  N  NH2 . ARG B  2  245 ? 68.571 70.300  77.041  1.00 38.34  ? 245  ARG B NH2 1 
ATOM   5228  N  N   . GLU B  2  246 ? 70.886 73.960  83.825  1.00 33.69  ? 246  GLU B N   1 
ATOM   5229  C  CA  . GLU B  2  246 ? 71.077 73.659  85.220  1.00 34.12  ? 246  GLU B CA  1 
ATOM   5230  C  C   . GLU B  2  246 ? 70.273 72.483  85.683  1.00 34.56  ? 246  GLU B C   1 
ATOM   5231  O  O   . GLU B  2  246 ? 69.082 72.633  85.904  1.00 34.42  ? 246  GLU B O   1 
ATOM   5232  C  CB  . GLU B  2  246 ? 70.690 74.859  86.055  1.00 34.18  ? 246  GLU B CB  1 
ATOM   5233  C  CG  . GLU B  2  246 ? 71.170 74.774  87.490  1.00 48.58  ? 246  GLU B CG  1 
ATOM   5234  C  CD  . GLU B  2  246 ? 70.872 76.040  88.251  1.00 62.40  ? 246  GLU B CD  1 
ATOM   5235  O  OE1 . GLU B  2  246 ? 71.037 77.128  87.661  1.00 77.21  ? 246  GLU B OE1 1 
ATOM   5236  O  OE2 . GLU B  2  246 ? 70.464 75.959  89.425  1.00 58.71  ? 246  GLU B OE2 1 
ATOM   5237  N  N   . GLN B  2  247 ? 70.930 71.309  85.843  1.00 35.45  ? 247  GLN B N   1 
ATOM   5238  C  CA  . GLN B  2  247 ? 70.281 70.076  86.420  1.00 36.49  ? 247  GLN B CA  1 
ATOM   5239  C  C   . GLN B  2  247 ? 69.837 70.336  87.867  1.00 37.98  ? 247  GLN B C   1 
ATOM   5240  O  O   . GLN B  2  247 ? 70.639 70.711  88.700  1.00 37.14  ? 247  GLN B O   1 
ATOM   5241  C  CB  . GLN B  2  247 ? 71.245 68.887  86.436  1.00 35.92  ? 247  GLN B CB  1 
ATOM   5242  C  CG  . GLN B  2  247 ? 71.032 67.936  85.382  1.00 43.81  ? 247  GLN B CG  1 
ATOM   5243  C  CD  . GLN B  2  247 ? 69.714 67.197  85.519  1.00 38.51  ? 247  GLN B CD  1 
ATOM   5244  O  OE1 . GLN B  2  247 ? 68.988 67.051  84.548  1.00 29.74  ? 247  GLN B OE1 1 
ATOM   5245  N  NE2 . GLN B  2  247 ? 69.428 66.699  86.717  1.00 28.28  ? 247  GLN B NE2 1 
ATOM   5246  N  N   . ASN B  2  248 ? 68.626 69.923  88.186  1.00 40.94  ? 248  ASN B N   1 
ATOM   5247  C  CA  . ASN B  2  248 ? 68.008 70.292  89.443  1.00 43.30  ? 248  ASN B CA  1 
ATOM   5248  C  C   . ASN B  2  248 ? 67.118 69.264  90.172  1.00 45.65  ? 248  ASN B C   1 
ATOM   5249  O  O   . ASN B  2  248 ? 67.113 69.232  91.390  1.00 45.59  ? 248  ASN B O   1 
ATOM   5250  C  CB  . ASN B  2  248 ? 67.087 71.436  89.096  1.00 42.94  ? 248  ASN B CB  1 
ATOM   5251  C  CG  . ASN B  2  248 ? 66.985 72.363  90.090  1.00 42.12  ? 248  ASN B CG  1 
ATOM   5252  O  OD1 . ASN B  2  248 ? 66.463 73.445  89.868  1.00 60.27  ? 248  ASN B OD1 1 
ATOM   5253  N  ND2 . ASN B  2  248 ? 67.492 72.036  91.263  1.00 65.18  ? 248  ASN B ND2 1 
ATOM   5254  N  N   . GLY B  2  249 ? 66.290 68.516  89.426  1.00 47.95  ? 249  GLY B N   1 
ATOM   5255  C  CA  . GLY B  2  249 ? 65.255 67.646  90.046  1.00 49.94  ? 249  GLY B CA  1 
ATOM   5256  C  C   . GLY B  2  249 ? 64.249 68.572  90.820  1.00 51.83  ? 249  GLY B C   1 
ATOM   5257  O  O   . GLY B  2  249 ? 64.455 68.852  92.034  1.00 52.31  ? 249  GLY B O   1 
ATOM   5258  N  N   . ASP B  2  250 ? 63.246 69.139  90.111  1.00 52.13  ? 250  ASP B N   1 
ATOM   5259  C  CA  . ASP B  2  250 ? 62.238 70.053  90.752  1.00 52.17  ? 250  ASP B CA  1 
ATOM   5260  C  C   . ASP B  2  250 ? 60.839 69.598  90.422  1.00 52.17  ? 250  ASP B C   1 
ATOM   5261  O  O   . ASP B  2  250 ? 59.848 70.246  90.797  1.00 52.48  ? 250  ASP B O   1 
ATOM   5262  C  CB  . ASP B  2  250 ? 62.403 71.496  90.272  1.00 52.36  ? 250  ASP B CB  1 
ATOM   5263  C  CG  . ASP B  2  250 ? 63.352 72.280  91.119  1.00 55.51  ? 250  ASP B CG  1 
ATOM   5264  O  OD1 . ASP B  2  250 ? 63.904 71.656  92.046  1.00 54.10  ? 250  ASP B OD1 1 
ATOM   5265  O  OD2 . ASP B  2  250 ? 63.597 73.541  90.952  1.00 40.03  ? 250  ASP B OD2 1 
ATOM   5266  N  N   . SER B  2  251 ? 60.773 68.451  89.735  1.00 51.70  ? 251  SER B N   1 
ATOM   5267  C  CA  . SER B  2  251 ? 59.522 67.844  89.194  1.00 49.77  ? 251  SER B CA  1 
ATOM   5268  C  C   . SER B  2  251 ? 59.044 68.639  87.997  1.00 46.89  ? 251  SER B C   1 
ATOM   5269  O  O   . SER B  2  251 ? 58.436 68.053  87.050  1.00 47.44  ? 251  SER B O   1 
ATOM   5270  C  CB  . SER B  2  251 ? 58.398 67.741  90.221  1.00 50.29  ? 251  SER B CB  1 
ATOM   5271  O  OG  . SER B  2  251 ? 57.163 67.387  89.575  1.00 57.73  ? 251  SER B OG  1 
ATOM   5272  N  N   . LEU B  2  252 ? 59.336 69.960  88.018  1.00 42.62  ? 252  LEU B N   1 
ATOM   5273  C  CA  . LEU B  2  252 ? 58.956 70.860  86.957  1.00 39.51  ? 252  LEU B CA  1 
ATOM   5274  C  C   . LEU B  2  252 ? 60.173 71.449  86.252  1.00 36.69  ? 252  LEU B C   1 
ATOM   5275  O  O   . LEU B  2  252 ? 61.068 72.016  86.898  1.00 37.87  ? 252  LEU B O   1 
ATOM   5276  C  CB  . LEU B  2  252 ? 58.112 71.998  87.515  1.00 39.31  ? 252  LEU B CB  1 
ATOM   5277  C  CG  . LEU B  2  252 ? 56.754 71.643  88.088  1.00 38.94  ? 252  LEU B CG  1 
ATOM   5278  C  CD1 . LEU B  2  252 ? 56.044 72.886  88.502  1.00 39.17  ? 252  LEU B CD1 1 
ATOM   5279  C  CD2 . LEU B  2  252 ? 55.949 70.907  87.071  1.00 33.82  ? 252  LEU B CD2 1 
ATOM   5280  N  N   . VAL B  2  253 ? 60.189 71.368  84.938  1.00 32.33  ? 253  VAL B N   1 
ATOM   5281  C  CA  . VAL B  2  253 ? 61.266 71.940  84.167  1.00 29.14  ? 253  VAL B CA  1 
ATOM   5282  C  C   . VAL B  2  253 ? 60.887 73.354  83.724  1.00 26.96  ? 253  VAL B C   1 
ATOM   5283  O  O   . VAL B  2  253 ? 59.770 73.593  83.278  1.00 25.95  ? 253  VAL B O   1 
ATOM   5284  C  CB  . VAL B  2  253 ? 61.560 71.088  82.939  1.00 28.93  ? 253  VAL B CB  1 
ATOM   5285  C  CG1 . VAL B  2  253 ? 62.260 71.900  81.822  1.00 18.87  ? 253  VAL B CG1 1 
ATOM   5286  C  CG2 . VAL B  2  253 ? 62.363 69.863  83.324  1.00 26.28  ? 253  VAL B CG2 1 
ATOM   5287  N  N   . HIS B  2  254 ? 61.784 74.297  83.937  1.00 26.15  ? 254  HIS B N   1 
ATOM   5288  C  CA  . HIS B  2  254 ? 61.568 75.645  83.480  1.00 26.21  ? 254  HIS B CA  1 
ATOM   5289  C  C   . HIS B  2  254 ? 62.530 75.863  82.322  1.00 27.34  ? 254  HIS B C   1 
ATOM   5290  O  O   . HIS B  2  254 ? 63.722 75.577  82.447  1.00 27.67  ? 254  HIS B O   1 
ATOM   5291  C  CB  . HIS B  2  254 ? 61.894 76.636  84.554  1.00 25.07  ? 254  HIS B CB  1 
ATOM   5292  C  CG  . HIS B  2  254 ? 60.801 76.859  85.533  1.00 31.37  ? 254  HIS B CG  1 
ATOM   5293  N  ND1 . HIS B  2  254 ? 60.160 78.077  85.663  1.00 36.87  ? 254  HIS B ND1 1 
ATOM   5294  C  CD2 . HIS B  2  254 ? 60.291 76.057  86.505  1.00 33.61  ? 254  HIS B CD2 1 
ATOM   5295  C  CE1 . HIS B  2  254 ? 59.311 78.016  86.675  1.00 35.66  ? 254  HIS B CE1 1 
ATOM   5296  N  NE2 . HIS B  2  254 ? 59.357 76.795  87.189  1.00 35.68  ? 254  HIS B NE2 1 
ATOM   5297  N  N   . ALA B  2  255 ? 62.033 76.366  81.202  1.00 27.74  ? 255  ALA B N   1 
ATOM   5298  C  CA  . ALA B  2  255 ? 62.899 76.599  80.082  1.00 28.63  ? 255  ALA B CA  1 
ATOM   5299  C  C   . ALA B  2  255 ? 62.518 77.894  79.375  1.00 29.74  ? 255  ALA B C   1 
ATOM   5300  O  O   . ALA B  2  255 ? 61.347 78.248  79.348  1.00 30.86  ? 255  ALA B O   1 
ATOM   5301  C  CB  . ALA B  2  255 ? 62.805 75.455  79.151  1.00 28.19  ? 255  ALA B CB  1 
ATOM   5302  N  N   . ALA B  2  256 ? 63.499 78.601  78.807  1.00 29.46  ? 256  ALA B N   1 
ATOM   5303  C  CA  . ALA B  2  256 ? 63.212 79.834  78.025  1.00 29.77  ? 256  ALA B CA  1 
ATOM   5304  C  C   . ALA B  2  256 ? 63.971 79.781  76.702  1.00 30.33  ? 256  ALA B C   1 
ATOM   5305  O  O   . ALA B  2  256 ? 65.161 79.497  76.699  1.00 30.59  ? 256  ALA B O   1 
ATOM   5306  C  CB  . ALA B  2  256 ? 63.595 81.064  78.794  1.00 29.58  ? 256  ALA B CB  1 
ATOM   5307  N  N   . LEU B  2  257 ? 63.271 80.024  75.587  1.00 30.37  ? 257  LEU B N   1 
ATOM   5308  C  CA  . LEU B  2  257 ? 63.867 79.954  74.237  1.00 30.68  ? 257  LEU B CA  1 
ATOM   5309  C  C   . LEU B  2  257 ? 63.685 81.285  73.662  1.00 31.66  ? 257  LEU B C   1 
ATOM   5310  O  O   . LEU B  2  257 ? 62.540 81.736  73.517  1.00 32.74  ? 257  LEU B O   1 
ATOM   5311  C  CB  . LEU B  2  257 ? 63.109 78.979  73.367  1.00 29.94  ? 257  LEU B CB  1 
ATOM   5312  C  CG  . LEU B  2  257 ? 63.879 78.091  72.379  1.00 33.06  ? 257  LEU B CG  1 
ATOM   5313  C  CD1 . LEU B  2  257 ? 63.046 77.660  71.087  1.00 19.55  ? 257  LEU B CD1 1 
ATOM   5314  C  CD2 . LEU B  2  257 ? 65.232 78.586  72.038  1.00 13.99  ? 257  LEU B CD2 1 
ATOM   5315  N  N   . VAL B  2  258 ? 64.772 81.876  73.174  1.00 30.85  ? 258  VAL B N   1 
ATOM   5316  C  CA  . VAL B  2  258 ? 64.741 83.242  72.772  1.00 30.29  ? 258  VAL B CA  1 
ATOM   5317  C  C   . VAL B  2  258 ? 65.682 83.515  71.602  1.00 29.62  ? 258  VAL B C   1 
ATOM   5318  O  O   . VAL B  2  258 ? 66.516 82.676  71.272  1.00 29.78  ? 258  VAL B O   1 
ATOM   5319  C  CB  . VAL B  2  258 ? 65.154 84.077  74.045  1.00 31.24  ? 258  VAL B CB  1 
ATOM   5320  C  CG1 . VAL B  2  258 ? 66.288 85.012  73.807  1.00 26.81  ? 258  VAL B CG1 1 
ATOM   5321  C  CG2 . VAL B  2  258 ? 63.906 84.708  74.787  1.00 27.96  ? 258  VAL B CG2 1 
ATOM   5322  N  N   . ALA B  2  259 ? 65.474 84.646  70.912  1.00 28.56  ? 259  ALA B N   1 
ATOM   5323  C  CA  . ALA B  2  259 ? 66.364 85.094  69.818  1.00 27.61  ? 259  ALA B CA  1 
ATOM   5324  C  C   . ALA B  2  259 ? 66.426 86.588  69.897  1.00 28.73  ? 259  ALA B C   1 
ATOM   5325  O  O   . ALA B  2  259 ? 65.554 87.210  70.490  1.00 28.20  ? 259  ALA B O   1 
ATOM   5326  C  CB  . ALA B  2  259 ? 65.827 84.684  68.442  1.00 25.96  ? 259  ALA B CB  1 
ATOM   5327  N  N   . GLU B  2  260 ? 67.434 87.181  69.265  1.00 30.61  ? 260  GLU B N   1 
ATOM   5328  C  CA  . GLU B  2  260 ? 67.559 88.627  69.280  1.00 32.51  ? 260  GLU B CA  1 
ATOM   5329  C  C   . GLU B  2  260 ? 66.422 89.234  68.530  1.00 33.42  ? 260  GLU B C   1 
ATOM   5330  O  O   . GLU B  2  260 ? 66.055 88.739  67.507  1.00 33.93  ? 260  GLU B O   1 
ATOM   5331  C  CB  . GLU B  2  260 ? 68.875 89.086  68.679  1.00 33.00  ? 260  GLU B CB  1 
ATOM   5332  C  CG  . GLU B  2  260 ? 69.287 90.428  69.204  1.00 35.45  ? 260  GLU B CG  1 
ATOM   5333  C  CD  . GLU B  2  260 ? 70.518 90.976  68.547  1.00 41.12  ? 260  GLU B CD  1 
ATOM   5334  O  OE1 . GLU B  2  260 ? 70.864 92.146  68.827  1.00 48.57  ? 260  GLU B OE1 1 
ATOM   5335  O  OE2 . GLU B  2  260 ? 71.154 90.245  67.777  1.00 45.50  ? 260  GLU B OE2 1 
ATOM   5336  N  N   . SER B  2  261 ? 65.820 90.272  69.094  1.00 33.89  ? 261  SER B N   1 
ATOM   5337  C  CA  . SER B  2  261 ? 64.695 90.935  68.481  1.00 34.92  ? 261  SER B CA  1 
ATOM   5338  C  C   . SER B  2  261 ? 65.033 92.387  68.199  1.00 37.58  ? 261  SER B C   1 
ATOM   5339  O  O   . SER B  2  261 ? 65.989 92.674  67.487  1.00 39.29  ? 261  SER B O   1 
ATOM   5340  C  CB  . SER B  2  261 ? 63.493 90.847  69.386  1.00 34.30  ? 261  SER B CB  1 
ATOM   5341  O  OG  . SER B  2  261 ? 63.802 91.252  70.686  1.00 27.78  ? 261  SER B OG  1 
ATOM   5342  N  N   . ALA B  2  262 ? 64.288 93.314  68.788  1.00 37.95  ? 262  ALA B N   1 
ATOM   5343  C  CA  . ALA B  2  262 ? 64.550 94.717  68.547  1.00 38.37  ? 262  ALA B CA  1 
ATOM   5344  C  C   . ALA B  2  262 ? 64.691 95.606  69.801  1.00 38.75  ? 262  ALA B C   1 
ATOM   5345  O  O   . ALA B  2  262 ? 64.034 95.373  70.848  1.00 38.48  ? 262  ALA B O   1 
ATOM   5346  C  CB  . ALA B  2  262 ? 63.531 95.265  67.660  1.00 38.43  ? 262  ALA B CB  1 
ATOM   5347  N  N   . ALA B  2  263 ? 65.524 96.637  69.660  1.00 39.13  ? 263  ALA B N   1 
ATOM   5348  C  CA  . ALA B  2  263 ? 65.751 97.636  70.711  1.00 39.61  ? 263  ALA B CA  1 
ATOM   5349  C  C   . ALA B  2  263 ? 64.488 98.419  70.968  1.00 40.81  ? 263  ALA B C   1 
ATOM   5350  O  O   . ALA B  2  263 ? 63.689 98.652  70.046  1.00 41.23  ? 263  ALA B O   1 
ATOM   5351  C  CB  . ALA B  2  263 ? 66.850 98.577  70.316  1.00 38.53  ? 263  ALA B CB  1 
ATOM   5352  N  N   . ILE B  2  264 ? 64.295 98.802  72.224  1.00 41.27  ? 264  ILE B N   1 
ATOM   5353  C  CA  . ILE B  2  264 ? 63.150 99.557  72.620  1.00 42.45  ? 264  ILE B CA  1 
ATOM   5354  C  C   . ILE B  2  264 ? 63.103 100.948 71.900  1.00 43.73  ? 264  ILE B C   1 
ATOM   5355  O  O   . ILE B  2  264 ? 64.149 101.521 71.490  1.00 43.74  ? 264  ILE B O   1 
ATOM   5356  C  CB  . ILE B  2  264 ? 63.157 99.690  74.143  1.00 42.94  ? 264  ILE B CB  1 
ATOM   5357  C  CG1 . ILE B  2  264 ? 61.741 99.509  74.715  1.00 53.12  ? 264  ILE B CG1 1 
ATOM   5358  C  CG2 . ILE B  2  264 ? 63.847 100.965 74.587  1.00 40.05  ? 264  ILE B CG2 1 
ATOM   5359  C  CD1 . ILE B  2  264 ? 61.701 99.254  76.204  1.00 48.40  ? 264  ILE B CD1 1 
ATOM   5360  N  N   . GLY B  2  265 ? 61.904 101.453 71.657  1.00 44.60  ? 265  GLY B N   1 
ATOM   5361  C  CA  . GLY B  2  265 ? 61.804 102.741 70.972  1.00 44.66  ? 265  GLY B CA  1 
ATOM   5362  C  C   . GLY B  2  265 ? 61.635 102.599 69.472  1.00 44.48  ? 265  GLY B C   1 
ATOM   5363  O  O   . GLY B  2  265 ? 60.923 103.398 68.854  1.00 44.88  ? 265  GLY B O   1 
ATOM   5364  N  N   . SER B  2  266 ? 62.274 101.576 68.880  1.00 43.53  ? 266  SER B N   1 
ATOM   5365  C  CA  . SER B  2  266 ? 62.155 101.328 67.428  1.00 42.02  ? 266  SER B CA  1 
ATOM   5366  C  C   . SER B  2  266 ? 60.760 100.799 67.071  1.00 40.33  ? 266  SER B C   1 
ATOM   5367  O  O   . SER B  2  266 ? 60.070 100.240 67.932  1.00 40.59  ? 266  SER B O   1 
ATOM   5368  C  CB  . SER B  2  266 ? 63.228 100.349 66.950  1.00 41.82  ? 266  SER B CB  1 
ATOM   5369  O  OG  . SER B  2  266 ? 62.909 99.045  67.321  1.00 55.54  ? 266  SER B OG  1 
ATOM   5370  N  N   . ALA B  2  267 ? 60.328 101.026 65.823  1.00 38.37  ? 267  ALA B N   1 
ATOM   5371  C  CA  . ALA B  2  267 ? 59.013 100.543 65.369  1.00 36.37  ? 267  ALA B CA  1 
ATOM   5372  C  C   . ALA B  2  267 ? 58.895 98.982  65.495  1.00 34.99  ? 267  ALA B C   1 
ATOM   5373  O  O   . ALA B  2  267 ? 57.868 98.468  65.903  1.00 35.17  ? 267  ALA B O   1 
ATOM   5374  C  CB  . ALA B  2  267 ? 58.730 100.998 63.934  1.00 35.47  ? 267  ALA B CB  1 
ATOM   5375  N  N   . GLU B  2  268 ? 59.983 98.275  65.214  1.00 33.27  ? 268  GLU B N   1 
ATOM   5376  C  CA  . GLU B  2  268 ? 60.018 96.826  65.277  1.00 32.56  ? 268  GLU B CA  1 
ATOM   5377  C  C   . GLU B  2  268 ? 59.700 96.279  66.680  1.00 32.67  ? 268  GLU B C   1 
ATOM   5378  O  O   . GLU B  2  268 ? 59.176 95.182  66.821  1.00 32.35  ? 268  GLU B O   1 
ATOM   5379  C  CB  . GLU B  2  268 ? 61.399 96.341  64.819  1.00 32.60  ? 268  GLU B CB  1 
ATOM   5380  C  CG  . GLU B  2  268 ? 61.463 94.907  64.329  1.00 45.66  ? 268  GLU B CG  1 
ATOM   5381  C  CD  . GLU B  2  268 ? 62.861 94.504  63.886  1.00 43.43  ? 268  GLU B CD  1 
ATOM   5382  O  OE1 . GLU B  2  268 ? 63.073 93.332  63.484  1.00 44.37  ? 268  GLU B OE1 1 
ATOM   5383  O  OE2 . GLU B  2  268 ? 63.744 95.346  63.957  1.00 51.91  ? 268  GLU B OE2 1 
ATOM   5384  N  N   . ALA B  2  269 ? 60.020 97.056  67.708  1.00 33.05  ? 269  ALA B N   1 
ATOM   5385  C  CA  . ALA B  2  269 ? 59.749 96.653  69.073  1.00 33.74  ? 269  ALA B CA  1 
ATOM   5386  C  C   . ALA B  2  269 ? 58.292 96.483  69.299  1.00 35.32  ? 269  ALA B C   1 
ATOM   5387  O  O   . ALA B  2  269 ? 57.870 95.538  69.995  1.00 36.83  ? 269  ALA B O   1 
ATOM   5388  C  CB  . ALA B  2  269 ? 60.287 97.646  70.036  1.00 33.22  ? 269  ALA B CB  1 
ATOM   5389  N  N   . ASN B  2  270 ? 57.492 97.394  68.733  1.00 34.59  ? 270  ASN B N   1 
ATOM   5390  C  CA  . ASN B  2  270 ? 56.063 97.306  68.878  1.00 33.80  ? 270  ASN B CA  1 
ATOM   5391  C  C   . ASN B  2  270 ? 55.531 96.074  68.178  1.00 33.57  ? 270  ASN B C   1 
ATOM   5392  O  O   . ASN B  2  270 ? 54.555 95.495  68.630  1.00 34.57  ? 270  ASN B O   1 
ATOM   5393  C  CB  . ASN B  2  270 ? 55.394 98.514  68.298  1.00 33.92  ? 270  ASN B CB  1 
ATOM   5394  C  CG  . ASN B  2  270 ? 55.869 99.731  68.866  1.00 32.79  ? 270  ASN B CG  1 
ATOM   5395  O  OD1 . ASN B  2  270 ? 56.329 100.608 68.162  1.00 40.61  ? 270  ASN B OD1 1 
ATOM   5396  N  ND2 . ASN B  2  270 ? 55.775 99.839  70.154  1.00 31.33  ? 270  ASN B ND2 1 
ATOM   5397  N  N   . ALA B  2  271 ? 56.144 95.706  67.039  1.00 32.13  ? 271  ALA B N   1 
ATOM   5398  C  CA  . ALA B  2  271 ? 55.738 94.510  66.302  1.00 30.89  ? 271  ALA B CA  1 
ATOM   5399  C  C   . ALA B  2  271 ? 55.944 93.270  67.204  1.00 30.82  ? 271  ALA B C   1 
ATOM   5400  O  O   . ALA B  2  271 ? 55.107 92.372  67.249  1.00 30.36  ? 271  ALA B O   1 
ATOM   5401  C  CB  . ALA B  2  271 ? 56.532 94.371  65.026  1.00 29.88  ? 271  ALA B CB  1 
ATOM   5402  N  N   . PHE B  2  272 ? 57.037 93.276  67.950  1.00 30.80  ? 272  PHE B N   1 
ATOM   5403  C  CA  . PHE B  2  272 ? 57.318 92.208  68.836  1.00 31.46  ? 272  PHE B CA  1 
ATOM   5404  C  C   . PHE B  2  272 ? 56.327 92.162  69.998  1.00 32.05  ? 272  PHE B C   1 
ATOM   5405  O  O   . PHE B  2  272 ? 55.898 91.091  70.404  1.00 31.62  ? 272  PHE B O   1 
ATOM   5406  C  CB  . PHE B  2  272 ? 58.767 92.251  69.301  1.00 31.03  ? 272  PHE B CB  1 
ATOM   5407  C  CG  . PHE B  2  272 ? 59.704 91.462  68.410  1.00 31.70  ? 272  PHE B CG  1 
ATOM   5408  C  CD1 . PHE B  2  272 ? 59.682 90.075  68.432  1.00 22.45  ? 272  PHE B CD1 1 
ATOM   5409  C  CD2 . PHE B  2  272 ? 60.559 92.113  67.494  1.00 23.04  ? 272  PHE B CD2 1 
ATOM   5410  C  CE1 . PHE B  2  272 ? 60.554 89.324  67.593  1.00 30.13  ? 272  PHE B CE1 1 
ATOM   5411  C  CE2 . PHE B  2  272 ? 61.414 91.379  66.648  1.00 27.47  ? 272  PHE B CE2 1 
ATOM   5412  C  CZ  . PHE B  2  272 ? 61.408 89.988  66.686  1.00 27.21  ? 272  PHE B CZ  1 
ATOM   5413  N  N   . SER B  2  273 ? 55.912 93.340  70.475  1.00 32.64  ? 273  SER B N   1 
ATOM   5414  C  CA  . SER B  2  273 ? 54.952 93.417  71.554  1.00 32.19  ? 273  SER B CA  1 
ATOM   5415  C  C   . SER B  2  273 ? 53.610 92.878  71.095  1.00 32.60  ? 273  SER B C   1 
ATOM   5416  O  O   . SER B  2  273 ? 52.938 92.207  71.855  1.00 33.55  ? 273  SER B O   1 
ATOM   5417  C  CB  . SER B  2  273 ? 54.810 94.845  72.057  1.00 31.57  ? 273  SER B CB  1 
ATOM   5418  O  OG  . SER B  2  273 ? 56.005 95.264  72.673  1.00 31.06  ? 273  SER B OG  1 
ATOM   5419  N  N   . VAL B  2  274 ? 53.229 93.159  69.846  1.00 31.68  ? 274  VAL B N   1 
ATOM   5420  C  CA  . VAL B  2  274 ? 51.980 92.662  69.320  1.00 31.70  ? 274  VAL B CA  1 
ATOM   5421  C  C   . VAL B  2  274 ? 52.081 91.153  69.104  1.00 32.69  ? 274  VAL B C   1 
ATOM   5422  O  O   . VAL B  2  274 ? 51.126 90.428  69.318  1.00 33.04  ? 274  VAL B O   1 
ATOM   5423  C  CB  . VAL B  2  274 ? 51.568 93.395  68.003  1.00 31.46  ? 274  VAL B CB  1 
ATOM   5424  C  CG1 . VAL B  2  274 ? 50.294 92.797  67.399  1.00 24.38  ? 274  VAL B CG1 1 
ATOM   5425  C  CG2 . VAL B  2  274 ? 51.343 94.833  68.275  1.00 32.97  ? 274  VAL B CG2 1 
ATOM   5426  N  N   . LEU B  2  275 ? 53.262 90.683  68.721  1.00 33.33  ? 275  LEU B N   1 
ATOM   5427  C  CA  . LEU B  2  275 ? 53.480 89.258  68.520  1.00 33.92  ? 275  LEU B CA  1 
ATOM   5428  C  C   . LEU B  2  275 ? 53.327 88.550  69.837  1.00 34.68  ? 275  LEU B C   1 
ATOM   5429  O  O   . LEU B  2  275 ? 52.726 87.451  69.908  1.00 35.58  ? 275  LEU B O   1 
ATOM   5430  C  CB  . LEU B  2  275 ? 54.868 88.981  67.934  1.00 33.80  ? 275  LEU B CB  1 
ATOM   5431  C  CG  . LEU B  2  275 ? 55.257 87.513  67.701  1.00 33.35  ? 275  LEU B CG  1 
ATOM   5432  C  CD1 . LEU B  2  275 ? 54.159 86.722  66.857  1.00 27.45  ? 275  LEU B CD1 1 
ATOM   5433  C  CD2 . LEU B  2  275 ? 56.626 87.443  67.046  1.00 16.26  ? 275  LEU B CD2 1 
ATOM   5434  N  N   . GLN B  2  276 ? 53.813 89.189  70.893  1.00 34.24  ? 276  GLN B N   1 
ATOM   5435  C  CA  . GLN B  2  276 ? 53.724 88.639  72.237  1.00 34.20  ? 276  GLN B CA  1 
ATOM   5436  C  C   . GLN B  2  276 ? 52.279 88.391  72.642  1.00 34.40  ? 276  GLN B C   1 
ATOM   5437  O  O   . GLN B  2  276 ? 51.962 87.375  73.279  1.00 34.43  ? 276  GLN B O   1 
ATOM   5438  C  CB  . GLN B  2  276 ? 54.365 89.578  73.197  1.00 34.41  ? 276  GLN B CB  1 
ATOM   5439  C  CG  . GLN B  2  276 ? 54.322 89.171  74.606  1.00 38.46  ? 276  GLN B CG  1 
ATOM   5440  C  CD  . GLN B  2  276 ? 54.703 90.310  75.518  1.00 33.46  ? 276  GLN B CD  1 
ATOM   5441  O  OE1 . GLN B  2  276 ? 55.295 90.093  76.529  1.00 47.13  ? 276  GLN B OE1 1 
ATOM   5442  N  NE2 . GLN B  2  276 ? 54.321 91.528  75.154  1.00 34.60  ? 276  GLN B NE2 1 
ATOM   5443  N  N   . HIS B  2  277 ? 51.383 89.266  72.215  1.00 34.46  ? 277  HIS B N   1 
ATOM   5444  C  CA  . HIS B  2  277 ? 49.993 89.080  72.553  1.00 34.80  ? 277  HIS B CA  1 
ATOM   5445  C  C   . HIS B  2  277 ? 49.225 88.170  71.617  1.00 35.66  ? 277  HIS B C   1 
ATOM   5446  O  O   . HIS B  2  277 ? 48.156 87.644  71.969  1.00 36.39  ? 277  HIS B O   1 
ATOM   5447  C  CB  . HIS B  2  277 ? 49.302 90.386  72.796  1.00 34.54  ? 277  HIS B CB  1 
ATOM   5448  C  CG  . HIS B  2  277 ? 49.700 91.025  74.081  1.00 37.57  ? 277  HIS B CG  1 
ATOM   5449  N  ND1 . HIS B  2  277 ? 50.960 91.553  74.289  1.00 42.44  ? 277  HIS B ND1 1 
ATOM   5450  C  CD2 . HIS B  2  277 ? 49.041 91.153  75.252  1.00 33.98  ? 277  HIS B CD2 1 
ATOM   5451  C  CE1 . HIS B  2  277 ? 51.035 92.034  75.516  1.00 40.72  ? 277  HIS B CE1 1 
ATOM   5452  N  NE2 . HIS B  2  277 ? 49.887 91.798  76.123  1.00 45.83  ? 277  HIS B NE2 1 
ATOM   5453  N  N   . VAL B  2  278 ? 49.758 87.970  70.424  1.00 35.37  ? 278  VAL B N   1 
ATOM   5454  C  CA  . VAL B  2  278 ? 49.143 87.065  69.504  1.00 34.74  ? 278  VAL B CA  1 
ATOM   5455  C  C   . VAL B  2  278 ? 49.393 85.673  70.078  1.00 34.88  ? 278  VAL B C   1 
ATOM   5456  O  O   . VAL B  2  278 ? 48.465 84.846  70.191  1.00 35.45  ? 278  VAL B O   1 
ATOM   5457  C  CB  . VAL B  2  278 ? 49.785 87.147  68.148  1.00 34.42  ? 278  VAL B CB  1 
ATOM   5458  C  CG1 . VAL B  2  278 ? 49.424 85.945  67.322  1.00 22.91  ? 278  VAL B CG1 1 
ATOM   5459  C  CG2 . VAL B  2  278 ? 49.396 88.412  67.460  1.00 32.61  ? 278  VAL B CG2 1 
ATOM   5460  N  N   . LEU B  2  279 ? 50.633 85.445  70.504  1.00 33.95  ? 279  LEU B N   1 
ATOM   5461  C  CA  . LEU B  2  279 ? 51.020 84.176  71.062  1.00 33.32  ? 279  LEU B CA  1 
ATOM   5462  C  C   . LEU B  2  279 ? 50.458 83.975  72.450  1.00 33.42  ? 279  LEU B C   1 
ATOM   5463  O  O   . LEU B  2  279 ? 49.838 82.985  72.693  1.00 34.16  ? 279  LEU B O   1 
ATOM   5464  C  CB  . LEU B  2  279 ? 52.540 84.023  71.053  1.00 33.03  ? 279  LEU B CB  1 
ATOM   5465  C  CG  . LEU B  2  279 ? 53.204 84.007  69.678  1.00 26.69  ? 279  LEU B CG  1 
ATOM   5466  C  CD1 . LEU B  2  279 ? 54.711 84.208  69.779  1.00 32.32  ? 279  LEU B CD1 1 
ATOM   5467  C  CD2 . LEU B  2  279 ? 52.909 82.710  69.023  1.00 25.40  ? 279  LEU B CD2 1 
ATOM   5468  N  N   . GLY B  2  280 ? 50.700 84.915  73.372  1.00 33.28  ? 280  GLY B N   1 
ATOM   5469  C  CA  . GLY B  2  280 ? 50.159 84.796  74.710  1.00 33.00  ? 280  GLY B CA  1 
ATOM   5470  C  C   . GLY B  2  280 ? 51.068 85.206  75.841  1.00 33.52  ? 280  GLY B C   1 
ATOM   5471  O  O   . GLY B  2  280 ? 52.108 84.638  76.054  1.00 34.10  ? 280  GLY B O   1 
ATOM   5472  N  N   . ALA B  2  281 ? 50.673 86.217  76.574  1.00 34.07  ? 281  ALA B N   1 
ATOM   5473  C  CA  . ALA B  2  281 ? 51.424 86.624  77.736  1.00 34.95  ? 281  ALA B CA  1 
ATOM   5474  C  C   . ALA B  2  281 ? 50.686 86.008  78.899  1.00 37.07  ? 281  ALA B C   1 
ATOM   5475  O  O   . ALA B  2  281 ? 50.228 84.833  78.827  1.00 37.41  ? 281  ALA B O   1 
ATOM   5476  C  CB  . ALA B  2  281 ? 51.435 88.086  77.854  1.00 34.34  ? 281  ALA B CB  1 
ATOM   5477  N  N   . GLY B  2  282 ? 50.507 86.771  79.961  1.00 37.90  ? 282  GLY B N   1 
ATOM   5478  C  CA  . GLY B  2  282 ? 49.791 86.243  81.124  1.00 37.94  ? 282  GLY B CA  1 
ATOM   5479  C  C   . GLY B  2  282 ? 48.324 85.967  80.848  1.00 37.43  ? 282  GLY B C   1 
ATOM   5480  O  O   . GLY B  2  282 ? 47.834 86.224  79.761  1.00 37.20  ? 282  GLY B O   1 
ATOM   5481  N  N   . PRO B  2  283 ? 47.625 85.469  81.862  1.00 37.28  ? 283  PRO B N   1 
ATOM   5482  C  CA  . PRO B  2  283 ? 46.193 85.129  81.774  1.00 37.02  ? 283  PRO B CA  1 
ATOM   5483  C  C   . PRO B  2  283 ? 45.274 86.327  82.012  1.00 37.08  ? 283  PRO B C   1 
ATOM   5484  O  O   . PRO B  2  283 ? 45.683 87.278  82.647  1.00 38.05  ? 283  PRO B O   1 
ATOM   5485  C  CB  . PRO B  2  283 ? 46.005 84.200  82.952  1.00 36.74  ? 283  PRO B CB  1 
ATOM   5486  C  CG  . PRO B  2  283 ? 47.318 84.104  83.589  1.00 30.29  ? 283  PRO B CG  1 
ATOM   5487  C  CD  . PRO B  2  283 ? 48.163 85.205  83.195  1.00 36.84  ? 283  PRO B CD  1 
ATOM   5488  N  N   . HIS B  2  284 ? 44.022 86.242  81.584  1.00 36.17  ? 284  HIS B N   1 
ATOM   5489  C  CA  . HIS B  2  284 ? 43.082 87.336  81.801  1.00 35.03  ? 284  HIS B CA  1 
ATOM   5490  C  C   . HIS B  2  284 ? 41.942 86.856  82.690  1.00 34.46  ? 284  HIS B C   1 
ATOM   5491  O  O   . HIS B  2  284 ? 41.180 87.651  83.229  1.00 35.04  ? 284  HIS B O   1 
ATOM   5492  C  CB  . HIS B  2  284 ? 42.490 87.822  80.469  1.00 35.06  ? 284  HIS B CB  1 
ATOM   5493  C  CG  . HIS B  2  284 ? 43.478 88.487  79.551  1.00 42.99  ? 284  HIS B CG  1 
ATOM   5494  N  ND1 . HIS B  2  284 ? 44.623 87.860  79.100  1.00 46.19  ? 284  HIS B ND1 1 
ATOM   5495  C  CD2 . HIS B  2  284 ? 43.459 89.702  78.956  1.00 32.10  ? 284  HIS B CD2 1 
ATOM   5496  C  CE1 . HIS B  2  284 ? 45.284 88.679  78.306  1.00 43.17  ? 284  HIS B CE1 1 
ATOM   5497  N  NE2 . HIS B  2  284 ? 44.604 89.805  78.211  1.00 41.64  ? 284  HIS B NE2 1 
ATOM   5498  N  N   . VAL B  2  285 ? 41.787 85.545  82.807  1.00 33.11  ? 285  VAL B N   1 
ATOM   5499  C  CA  . VAL B  2  285 ? 40.677 85.009  83.589  1.00 31.90  ? 285  VAL B CA  1 
ATOM   5500  C  C   . VAL B  2  285 ? 41.161 84.068  84.668  1.00 31.33  ? 285  VAL B C   1 
ATOM   5501  O  O   . VAL B  2  285 ? 42.044 83.275  84.441  1.00 32.19  ? 285  VAL B O   1 
ATOM   5502  C  CB  . VAL B  2  285 ? 39.643 84.315  82.667  1.00 31.38  ? 285  VAL B CB  1 
ATOM   5503  C  CG1 . VAL B  2  285 ? 38.465 83.790  83.471  1.00 16.71  ? 285  VAL B CG1 1 
ATOM   5504  C  CG2 . VAL B  2  285 ? 39.156 85.316  81.586  1.00 16.41  ? 285  VAL B CG2 1 
ATOM   5505  N  N   . LYS B  2  286 ? 40.626 84.200  85.859  1.00 30.08  ? 286  LYS B N   1 
ATOM   5506  C  CA  . LYS B  2  286 ? 41.050 83.345  86.923  1.00 29.51  ? 286  LYS B CA  1 
ATOM   5507  C  C   . LYS B  2  286 ? 40.650 81.939  86.639  1.00 30.23  ? 286  LYS B C   1 
ATOM   5508  O  O   . LYS B  2  286 ? 39.473 81.643  86.521  1.00 31.02  ? 286  LYS B O   1 
ATOM   5509  C  CB  . LYS B  2  286 ? 40.467 83.793  88.243  1.00 28.90  ? 286  LYS B CB  1 
ATOM   5510  C  CG  . LYS B  2  286 ? 41.207 83.264  89.424  1.00 10.37  ? 286  LYS B CG  1 
ATOM   5511  C  CD  . LYS B  2  286 ? 40.482 83.605  90.731  1.00 15.13  ? 286  LYS B CD  1 
ATOM   5512  C  CE  . LYS B  2  286 ? 41.301 83.190  91.950  1.00 9.77   ? 286  LYS B CE  1 
ATOM   5513  N  NZ  . LYS B  2  286 ? 40.673 83.562  93.205  1.00 13.14  ? 286  LYS B NZ  1 
ATOM   5514  N  N   . ARG B  2  287 ? 41.647 81.070  86.544  1.00 30.56  ? 287  ARG B N   1 
ATOM   5515  C  CA  . ARG B  2  287 ? 41.465 79.653  86.281  1.00 31.06  ? 287  ARG B CA  1 
ATOM   5516  C  C   . ARG B  2  287 ? 40.824 79.412  84.941  1.00 32.47  ? 287  ARG B C   1 
ATOM   5517  O  O   . ARG B  2  287 ? 39.869 78.634  84.833  1.00 33.10  ? 287  ARG B O   1 
ATOM   5518  C  CB  . ARG B  2  287 ? 40.671 78.941  87.402  1.00 30.84  ? 287  ARG B CB  1 
ATOM   5519  C  CG  . ARG B  2  287 ? 41.109 79.247  88.808  1.00 25.51  ? 287  ARG B CG  1 
ATOM   5520  C  CD  . ARG B  2  287 ? 40.442 78.389  89.850  1.00 24.93  ? 287  ARG B CD  1 
ATOM   5521  N  NE  . ARG B  2  287 ? 39.917 79.192  90.954  1.00 34.93  ? 287  ARG B NE  1 
ATOM   5522  C  CZ  . ARG B  2  287 ? 40.400 79.181  92.186  1.00 42.59  ? 287  ARG B CZ  1 
ATOM   5523  N  NH1 . ARG B  2  287 ? 41.439 78.424  92.492  1.00 48.33  ? 287  ARG B NH1 1 
ATOM   5524  N  NH2 . ARG B  2  287 ? 39.843 79.924  93.119  1.00 41.61  ? 287  ARG B NH2 1 
ATOM   5525  N  N   . GLY B  2  288 ? 41.326 80.081  83.907  1.00 33.05  ? 288  GLY B N   1 
ATOM   5526  C  CA  . GLY B  2  288 ? 40.745 79.935  82.578  1.00 33.38  ? 288  GLY B CA  1 
ATOM   5527  C  C   . GLY B  2  288 ? 41.528 79.055  81.629  1.00 33.38  ? 288  GLY B C   1 
ATOM   5528  O  O   . GLY B  2  288 ? 42.728 78.856  81.821  1.00 33.25  ? 288  GLY B O   1 
ATOM   5529  N  N   . SER B  2  289 ? 40.854 78.586  80.575  1.00 33.80  ? 289  SER B N   1 
ATOM   5530  C  CA  . SER B  2  289 ? 41.455 77.741  79.528  1.00 34.94  ? 289  SER B CA  1 
ATOM   5531  C  C   . SER B  2  289 ? 42.439 78.520  78.690  1.00 36.35  ? 289  SER B C   1 
ATOM   5532  O  O   . SER B  2  289 ? 43.251 77.933  77.970  1.00 35.90  ? 289  SER B O   1 
ATOM   5533  C  CB  . SER B  2  289 ? 40.384 77.243  78.577  1.00 34.65  ? 289  SER B CB  1 
ATOM   5534  O  OG  . SER B  2  289 ? 39.343 76.640  79.272  1.00 55.72  ? 289  SER B OG  1 
ATOM   5535  N  N   . ASN B  2  290 ? 42.294 79.842  78.713  1.00 38.15  ? 290  ASN B N   1 
ATOM   5536  C  CA  . ASN B  2  290 ? 43.159 80.726  77.950  1.00 40.15  ? 290  ASN B CA  1 
ATOM   5537  C  C   . ASN B  2  290 ? 42.894 80.511  76.463  1.00 41.09  ? 290  ASN B C   1 
ATOM   5538  O  O   . ASN B  2  290 ? 43.813 80.194  75.690  1.00 41.89  ? 290  ASN B O   1 
ATOM   5539  C  CB  . ASN B  2  290 ? 44.641 80.454  78.263  1.00 40.58  ? 290  ASN B CB  1 
ATOM   5540  C  CG  . ASN B  2  290 ? 45.003 80.711  79.724  1.00 52.63  ? 290  ASN B CG  1 
ATOM   5541  O  OD1 . ASN B  2  290 ? 46.116 80.983  80.012  1.00 58.20  ? 290  ASN B OD1 1 
ATOM   5542  N  ND2 . ASN B  2  290 ? 44.044 80.621  80.622  1.00 58.55  ? 290  ASN B ND2 1 
ATOM   5543  N  N   . ALA B  2  291 ? 41.632 80.651  76.080  1.00 40.90  ? 291  ALA B N   1 
ATOM   5544  C  CA  . ALA B  2  291 ? 41.207 80.430  74.706  1.00 40.97  ? 291  ALA B CA  1 
ATOM   5545  C  C   . ALA B  2  291 ? 41.960 81.251  73.632  1.00 41.41  ? 291  ALA B C   1 
ATOM   5546  O  O   . ALA B  2  291 ? 42.413 80.691  72.634  1.00 41.32  ? 291  ALA B O   1 
ATOM   5547  C  CB  . ALA B  2  291 ? 39.743 80.607  74.588  1.00 40.54  ? 291  ALA B CB  1 
ATOM   5548  N  N   . THR B  2  292 ? 42.150 82.552  73.866  1.00 41.76  ? 292  THR B N   1 
ATOM   5549  C  CA  . THR B  2  292 ? 42.845 83.382  72.877  1.00 42.21  ? 292  THR B CA  1 
ATOM   5550  C  C   . THR B  2  292 ? 44.365 83.254  72.878  1.00 42.32  ? 292  THR B C   1 
ATOM   5551  O  O   . THR B  2  292 ? 45.035 84.011  72.193  1.00 42.93  ? 292  THR B O   1 
ATOM   5552  C  CB  . THR B  2  292 ? 42.434 84.893  72.974  1.00 42.36  ? 292  THR B CB  1 
ATOM   5553  O  OG1 . THR B  2  292 ? 42.775 85.412  74.263  1.00 51.57  ? 292  THR B OG1 1 
ATOM   5554  C  CG2 . THR B  2  292 ? 40.927 85.053  72.921  1.00 47.70  ? 292  THR B CG2 1 
ATOM   5555  N  N   . SER B  2  293 ? 44.918 82.313  73.645  1.00 41.56  ? 293  SER B N   1 
ATOM   5556  C  CA  . SER B  2  293 ? 46.369 82.157  73.669  1.00 40.95  ? 293  SER B CA  1 
ATOM   5557  C  C   . SER B  2  293 ? 46.869 81.082  72.755  1.00 40.30  ? 293  SER B C   1 
ATOM   5558  O  O   . SER B  2  293 ? 46.809 79.871  73.088  1.00 41.19  ? 293  SER B O   1 
ATOM   5559  C  CB  . SER B  2  293 ? 46.886 81.891  75.063  1.00 41.45  ? 293  SER B CB  1 
ATOM   5560  O  OG  . SER B  2  293 ? 48.308 81.725  75.024  1.00 56.76  ? 293  SER B OG  1 
ATOM   5561  N  N   . SER B  2  294 ? 47.399 81.518  71.620  1.00 38.75  ? 294  SER B N   1 
ATOM   5562  C  CA  . SER B  2  294 ? 47.996 80.655  70.595  1.00 37.38  ? 294  SER B CA  1 
ATOM   5563  C  C   . SER B  2  294 ? 48.985 79.623  71.105  1.00 35.74  ? 294  SER B C   1 
ATOM   5564  O  O   . SER B  2  294 ? 48.943 78.487  70.688  1.00 35.77  ? 294  SER B O   1 
ATOM   5565  C  CB  . SER B  2  294 ? 48.719 81.511  69.558  1.00 37.50  ? 294  SER B CB  1 
ATOM   5566  O  OG  . SER B  2  294 ? 48.040 81.518  68.332  1.00 48.00  ? 294  SER B OG  1 
ATOM   5567  N  N   . LEU B  2  295 ? 49.903 80.030  71.960  1.00 34.28  ? 295  LEU B N   1 
ATOM   5568  C  CA  . LEU B  2  295 ? 50.891 79.085  72.452  1.00 33.96  ? 295  LEU B CA  1 
ATOM   5569  C  C   . LEU B  2  295 ? 50.258 78.044  73.319  1.00 33.75  ? 295  LEU B C   1 
ATOM   5570  O  O   . LEU B  2  295 ? 50.487 76.840  73.141  1.00 33.74  ? 295  LEU B O   1 
ATOM   5571  C  CB  . LEU B  2  295 ? 51.974 79.785  73.249  1.00 33.42  ? 295  LEU B CB  1 
ATOM   5572  C  CG  . LEU B  2  295 ? 52.947 80.610  72.474  1.00 26.96  ? 295  LEU B CG  1 
ATOM   5573  C  CD1 . LEU B  2  295 ? 54.007 81.139  73.419  1.00 25.62  ? 295  LEU B CD1 1 
ATOM   5574  C  CD2 . LEU B  2  295 ? 53.594 79.764  71.371  1.00 32.62  ? 295  LEU B CD2 1 
ATOM   5575  N  N   . TYR B  2  296 ? 49.413 78.508  74.226  1.00 33.38  ? 296  TYR B N   1 
ATOM   5576  C  CA  . TYR B  2  296 ? 48.785 77.638  75.175  1.00 33.36  ? 296  TYR B CA  1 
ATOM   5577  C  C   . TYR B  2  296 ? 47.950 76.546  74.521  1.00 32.92  ? 296  TYR B C   1 
ATOM   5578  O  O   . TYR B  2  296 ? 48.165 75.375  74.769  1.00 32.60  ? 296  TYR B O   1 
ATOM   5579  C  CB  . TYR B  2  296 ? 47.984 78.440  76.172  1.00 33.26  ? 296  TYR B CB  1 
ATOM   5580  C  CG  . TYR B  2  296 ? 47.850 77.769  77.508  1.00 30.11  ? 296  TYR B CG  1 
ATOM   5581  C  CD1 . TYR B  2  296 ? 48.667 78.152  78.576  1.00 26.86  ? 296  TYR B CD1 1 
ATOM   5582  C  CD2 . TYR B  2  296 ? 46.877 76.762  77.727  1.00 26.09  ? 296  TYR B CD2 1 
ATOM   5583  C  CE1 . TYR B  2  296 ? 48.548 77.559  79.810  1.00 25.18  ? 296  TYR B CE1 1 
ATOM   5584  C  CE2 . TYR B  2  296 ? 46.745 76.154  78.965  1.00 25.96  ? 296  TYR B CE2 1 
ATOM   5585  C  CZ  . TYR B  2  296 ? 47.584 76.561  80.011  1.00 30.28  ? 296  TYR B CZ  1 
ATOM   5586  O  OH  . TYR B  2  296 ? 47.471 75.994  81.247  1.00 28.68  ? 296  TYR B OH  1 
ATOM   5587  N  N   . GLN B  2  297 ? 47.067 76.933  73.618  1.00 32.66  ? 297  GLN B N   1 
ATOM   5588  C  CA  . GLN B  2  297 ? 46.236 75.962  72.940  1.00 32.09  ? 297  GLN B CA  1 
ATOM   5589  C  C   . GLN B  2  297 ? 47.066 75.042  72.115  1.00 32.15  ? 297  GLN B C   1 
ATOM   5590  O  O   . GLN B  2  297 ? 46.756 73.872  71.995  1.00 32.06  ? 297  GLN B O   1 
ATOM   5591  C  CB  . GLN B  2  297 ? 45.218 76.650  72.064  1.00 31.80  ? 297  GLN B CB  1 
ATOM   5592  C  CG  . GLN B  2  297 ? 44.299 77.579  72.811  1.00 37.57  ? 297  GLN B CG  1 
ATOM   5593  C  CD  . GLN B  2  297 ? 43.463 76.868  73.865  1.00 42.69  ? 297  GLN B CD  1 
ATOM   5594  O  OE1 . GLN B  2  297 ? 42.964 75.773  73.635  1.00 43.48  ? 297  GLN B OE1 1 
ATOM   5595  N  NE2 . GLN B  2  297 ? 43.299 77.508  75.018  1.00 47.16  ? 297  GLN B NE2 1 
ATOM   5596  N  N   . ALA B  2  298 ? 48.158 75.551  71.567  1.00 32.74  ? 298  ALA B N   1 
ATOM   5597  C  CA  . ALA B  2  298 ? 49.004 74.713  70.755  1.00 33.49  ? 298  ALA B CA  1 
ATOM   5598  C  C   . ALA B  2  298 ? 49.724 73.610  71.560  1.00 35.16  ? 298  ALA B C   1 
ATOM   5599  O  O   . ALA B  2  298 ? 49.864 72.488  71.078  1.00 35.18  ? 298  ALA B O   1 
ATOM   5600  C  CB  . ALA B  2  298 ? 49.950 75.508  69.973  1.00 32.75  ? 298  ALA B CB  1 
ATOM   5601  N  N   . VAL B  2  299 ? 50.142 73.927  72.785  1.00 36.38  ? 299  VAL B N   1 
ATOM   5602  C  CA  . VAL B  2  299 ? 50.806 72.940  73.623  1.00 37.69  ? 299  VAL B CA  1 
ATOM   5603  C  C   . VAL B  2  299 ? 49.781 71.975  74.189  1.00 39.51  ? 299  VAL B C   1 
ATOM   5604  O  O   . VAL B  2  299 ? 49.960 70.722  74.116  1.00 39.71  ? 299  VAL B O   1 
ATOM   5605  C  CB  . VAL B  2  299 ? 51.558 73.586  74.793  1.00 37.50  ? 299  VAL B CB  1 
ATOM   5606  C  CG1 . VAL B  2  299 ? 52.103 72.535  75.698  1.00 40.65  ? 299  VAL B CG1 1 
ATOM   5607  C  CG2 . VAL B  2  299 ? 52.686 74.455  74.292  1.00 35.18  ? 299  VAL B CG2 1 
ATOM   5608  N  N   . ALA B  2  300 ? 48.675 72.541  74.692  1.00 40.90  ? 300  ALA B N   1 
ATOM   5609  C  CA  . ALA B  2  300 ? 47.592 71.761  75.316  1.00 42.39  ? 300  ALA B CA  1 
ATOM   5610  C  C   . ALA B  2  300 ? 47.089 70.624  74.435  1.00 44.70  ? 300  ALA B C   1 
ATOM   5611  O  O   . ALA B  2  300 ? 46.923 69.491  74.894  1.00 45.02  ? 300  ALA B O   1 
ATOM   5612  C  CB  . ALA B  2  300 ? 46.459 72.660  75.702  1.00 41.77  ? 300  ALA B CB  1 
ATOM   5613  N  N   . LYS B  2  301 ? 46.859 70.948  73.169  1.00 46.35  ? 301  LYS B N   1 
ATOM   5614  C  CA  . LYS B  2  301 ? 46.396 70.012  72.175  1.00 47.81  ? 301  LYS B CA  1 
ATOM   5615  C  C   . LYS B  2  301 ? 47.121 68.651  72.273  1.00 49.19  ? 301  LYS B C   1 
ATOM   5616  O  O   . LYS B  2  301 ? 46.476 67.615  72.361  1.00 49.64  ? 301  LYS B O   1 
ATOM   5617  C  CB  . LYS B  2  301 ? 46.582 70.642  70.794  1.00 48.06  ? 301  LYS B CB  1 
ATOM   5618  C  CG  . LYS B  2  301 ? 46.049 69.857  69.633  1.00 58.00  ? 301  LYS B CG  1 
ATOM   5619  C  CD  . LYS B  2  301 ? 46.326 70.601  68.303  1.00 61.58  ? 301  LYS B CD  1 
ATOM   5620  C  CE  . LYS B  2  301 ? 46.361 69.633  67.105  1.00 66.77  ? 301  LYS B CE  1 
ATOM   5621  N  NZ  . LYS B  2  301 ? 46.982 70.271  65.906  1.00 66.28  ? 301  LYS B NZ  1 
ATOM   5622  N  N   . GLY B  2  302 ? 48.454 68.666  72.340  1.00 50.15  ? 302  GLY B N   1 
ATOM   5623  C  CA  . GLY B  2  302 ? 49.212 67.417  72.428  1.00 50.70  ? 302  GLY B CA  1 
ATOM   5624  C  C   . GLY B  2  302 ? 49.876 67.082  73.778  1.00 51.07  ? 302  GLY B C   1 
ATOM   5625  O  O   . GLY B  2  302 ? 50.667 66.136  73.853  1.00 51.26  ? 302  GLY B O   1 
ATOM   5626  N  N   . VAL B  2  303 ? 49.601 67.874  74.826  1.00 50.81  ? 303  VAL B N   1 
ATOM   5627  C  CA  . VAL B  2  303 ? 50.174 67.623  76.155  1.00 50.46  ? 303  VAL B CA  1 
ATOM   5628  C  C   . VAL B  2  303 ? 49.062 67.621  77.183  1.00 51.72  ? 303  VAL B C   1 
ATOM   5629  O  O   . VAL B  2  303 ? 48.307 68.585  77.299  1.00 51.70  ? 303  VAL B O   1 
ATOM   5630  C  CB  . VAL B  2  303 ? 51.264 68.651  76.530  1.00 49.70  ? 303  VAL B CB  1 
ATOM   5631  C  CG1 . VAL B  2  303 ? 51.707 68.477  77.993  1.00 33.90  ? 303  VAL B CG1 1 
ATOM   5632  C  CG2 . VAL B  2  303 ? 52.450 68.517  75.608  1.00 33.93  ? 303  VAL B CG2 1 
ATOM   5633  N  N   . HIS B  2  304 ? 48.966 66.536  77.942  1.00 53.12  ? 304  HIS B N   1 
ATOM   5634  C  CA  . HIS B  2  304 ? 47.874 66.380  78.879  1.00 54.61  ? 304  HIS B CA  1 
ATOM   5635  C  C   . HIS B  2  304 ? 48.248 66.460  80.345  1.00 55.55  ? 304  HIS B C   1 
ATOM   5636  O  O   . HIS B  2  304 ? 48.672 65.480  80.936  1.00 56.55  ? 304  HIS B O   1 
ATOM   5637  C  CB  . HIS B  2  304 ? 47.116 65.072  78.588  1.00 55.26  ? 304  HIS B CB  1 
ATOM   5638  C  CG  . HIS B  2  304 ? 46.982 64.766  77.118  1.00 67.41  ? 304  HIS B CG  1 
ATOM   5639  N  ND1 . HIS B  2  304 ? 46.006 65.336  76.320  1.00 67.49  ? 304  HIS B ND1 1 
ATOM   5640  C  CD2 . HIS B  2  304 ? 47.730 63.987  76.295  1.00 66.36  ? 304  HIS B CD2 1 
ATOM   5641  C  CE1 . HIS B  2  304 ? 46.148 64.903  75.078  1.00 68.09  ? 304  HIS B CE1 1 
ATOM   5642  N  NE2 . HIS B  2  304 ? 47.190 64.092  75.034  1.00 68.00  ? 304  HIS B NE2 1 
ATOM   5643  N  N   . GLN B  2  305 ? 48.144 67.658  80.908  1.00 55.20  ? 305  GLN B N   1 
ATOM   5644  C  CA  . GLN B  2  305 ? 48.317 67.871  82.325  1.00 54.03  ? 305  GLN B CA  1 
ATOM   5645  C  C   . GLN B  2  305 ? 49.245 69.035  82.648  1.00 51.84  ? 305  GLN B C   1 
ATOM   5646  O  O   . GLN B  2  305 ? 49.621 69.775  81.744  1.00 52.49  ? 305  GLN B O   1 
ATOM   5647  C  CB  . GLN B  2  305 ? 46.922 68.162  82.928  1.00 54.76  ? 305  GLN B CB  1 
ATOM   5648  C  CG  . GLN B  2  305 ? 46.556 69.734  83.153  1.00 69.12  ? 305  GLN B CG  1 
ATOM   5649  C  CD  . GLN B  2  305 ? 46.240 70.568  81.843  1.00 79.55  ? 305  GLN B CD  1 
ATOM   5650  O  OE1 . GLN B  2  305 ? 45.141 71.113  81.710  1.00 89.25  ? 305  GLN B OE1 1 
ATOM   5651  N  NE2 . GLN B  2  305 ? 47.221 70.708  80.952  1.00 78.62  ? 305  GLN B NE2 1 
ATOM   5652  N  N   . PRO B  2  306 ? 49.723 69.118  83.901  1.00 48.81  ? 306  PRO B N   1 
ATOM   5653  C  CA  . PRO B  2  306 ? 50.447 70.331  84.394  1.00 46.31  ? 306  PRO B CA  1 
ATOM   5654  C  C   . PRO B  2  306 ? 51.427 70.944  83.454  1.00 43.12  ? 306  PRO B C   1 
ATOM   5655  O  O   . PRO B  2  306 ? 52.399 70.260  83.034  1.00 42.63  ? 306  PRO B O   1 
ATOM   5656  C  CB  . PRO B  2  306 ? 51.155 69.836  85.653  1.00 46.53  ? 306  PRO B CB  1 
ATOM   5657  C  CG  . PRO B  2  306 ? 50.300 68.699  86.108  1.00 47.95  ? 306  PRO B CG  1 
ATOM   5658  C  CD  . PRO B  2  306 ? 49.794 68.012  84.862  1.00 47.98  ? 306  PRO B CD  1 
ATOM   5659  N  N   . PHE B  2  307 ? 51.129 72.186  83.055  1.00 40.79  ? 307  PHE B N   1 
ATOM   5660  C  CA  . PHE B  2  307 ? 52.023 72.997  82.210  1.00 38.65  ? 307  PHE B CA  1 
ATOM   5661  C  C   . PHE B  2  307 ? 51.633 74.467  82.095  1.00 37.43  ? 307  PHE B C   1 
ATOM   5662  O  O   . PHE B  2  307 ? 50.471 74.856  82.276  1.00 37.69  ? 307  PHE B O   1 
ATOM   5663  C  CB  . PHE B  2  307 ? 52.176 72.413  80.773  1.00 38.27  ? 307  PHE B CB  1 
ATOM   5664  C  CG  . PHE B  2  307 ? 51.128 72.888  79.800  1.00 38.76  ? 307  PHE B CG  1 
ATOM   5665  C  CD1 . PHE B  2  307 ? 51.327 74.052  79.034  1.00 36.23  ? 307  PHE B CD1 1 
ATOM   5666  C  CD2 . PHE B  2  307 ? 49.949 72.166  79.621  1.00 42.07  ? 307  PHE B CD2 1 
ATOM   5667  C  CE1 . PHE B  2  307 ? 50.360 74.492  78.158  1.00 42.87  ? 307  PHE B CE1 1 
ATOM   5668  C  CE2 . PHE B  2  307 ? 48.975 72.597  78.730  1.00 40.49  ? 307  PHE B CE2 1 
ATOM   5669  C  CZ  . PHE B  2  307 ? 49.182 73.762  77.993  1.00 45.01  ? 307  PHE B CZ  1 
ATOM   5670  N  N   . ASP B  2  308 ? 52.620 75.283  81.769  1.00 35.73  ? 308  ASP B N   1 
ATOM   5671  C  CA  . ASP B  2  308 ? 52.366 76.637  81.443  1.00 33.48  ? 308  ASP B CA  1 
ATOM   5672  C  C   . ASP B  2  308 ? 53.273 77.127  80.285  1.00 31.89  ? 308  ASP B C   1 
ATOM   5673  O  O   . ASP B  2  308 ? 54.320 76.528  80.009  1.00 31.61  ? 308  ASP B O   1 
ATOM   5674  C  CB  . ASP B  2  308 ? 52.424 77.545  82.638  1.00 33.12  ? 308  ASP B CB  1 
ATOM   5675  C  CG  . ASP B  2  308 ? 51.815 78.905  82.330  1.00 44.45  ? 308  ASP B CG  1 
ATOM   5676  O  OD1 . ASP B  2  308 ? 51.981 79.884  83.101  1.00 49.02  ? 308  ASP B OD1 1 
ATOM   5677  O  OD2 . ASP B  2  308 ? 51.183 79.086  81.271  1.00 32.08  ? 308  ASP B OD2 1 
ATOM   5678  N  N   . VAL B  2  309 ? 52.780 78.112  79.527  1.00 30.66  ? 309  VAL B N   1 
ATOM   5679  C  CA  . VAL B  2  309 ? 53.565 78.765  78.465  1.00 30.23  ? 309  VAL B CA  1 
ATOM   5680  C  C   . VAL B  2  309 ? 53.208 80.169  78.318  1.00 30.22  ? 309  VAL B C   1 
ATOM   5681  O  O   . VAL B  2  309 ? 52.026 80.548  78.435  1.00 30.58  ? 309  VAL B O   1 
ATOM   5682  C  CB  . VAL B  2  309 ? 53.326 78.244  77.086  1.00 29.62  ? 309  VAL B CB  1 
ATOM   5683  C  CG1 . VAL B  2  309 ? 54.331 77.398  76.702  1.00 27.68  ? 309  VAL B CG1 1 
ATOM   5684  C  CG2 . VAL B  2  309 ? 51.989 77.674  76.944  1.00 25.35  ? 309  VAL B CG2 1 
ATOM   5685  N  N   . SER B  2  310 ? 54.187 80.941  77.908  1.00 29.60  ? 310  SER B N   1 
ATOM   5686  C  CA  . SER B  2  310 ? 53.959 82.323  77.642  1.00 29.41  ? 310  SER B CA  1 
ATOM   5687  C  C   . SER B  2  310 ? 55.057 82.857  76.788  1.00 28.87  ? 310  SER B C   1 
ATOM   5688  O  O   . SER B  2  310 ? 56.198 82.423  76.895  1.00 28.66  ? 310  SER B O   1 
ATOM   5689  C  CB  . SER B  2  310 ? 53.880 83.125  78.943  1.00 29.37  ? 310  SER B CB  1 
ATOM   5690  O  OG  . SER B  2  310 ? 54.169 84.464  78.709  1.00 41.66  ? 310  SER B OG  1 
ATOM   5691  N  N   . ALA B  2  311 ? 54.717 83.813  75.935  1.00 28.16  ? 311  ALA B N   1 
ATOM   5692  C  CA  . ALA B  2  311 ? 55.713 84.483  75.159  1.00 27.44  ? 311  ALA B CA  1 
ATOM   5693  C  C   . ALA B  2  311 ? 56.519 85.336  76.153  1.00 28.00  ? 311  ALA B C   1 
ATOM   5694  O  O   . ALA B  2  311 ? 56.010 85.705  77.227  1.00 26.79  ? 311  ALA B O   1 
ATOM   5695  C  CB  . ALA B  2  311 ? 55.087 85.337  74.133  1.00 26.43  ? 311  ALA B CB  1 
ATOM   5696  N  N   . PHE B  2  312 ? 57.774 85.610  75.787  1.00 29.28  ? 312  PHE B N   1 
ATOM   5697  C  CA  . PHE B  2  312 ? 58.705 86.368  76.574  1.00 30.30  ? 312  PHE B CA  1 
ATOM   5698  C  C   . PHE B  2  312 ? 59.239 87.465  75.694  1.00 32.30  ? 312  PHE B C   1 
ATOM   5699  O  O   . PHE B  2  312 ? 59.646 87.226  74.573  1.00 33.01  ? 312  PHE B O   1 
ATOM   5700  C  CB  . PHE B  2  312 ? 59.855 85.478  76.983  1.00 30.23  ? 312  PHE B CB  1 
ATOM   5701  C  CG  . PHE B  2  312 ? 60.876 86.159  77.811  1.00 19.87  ? 312  PHE B CG  1 
ATOM   5702  C  CD1 . PHE B  2  312 ? 60.737 86.209  79.184  1.00 19.30  ? 312  PHE B CD1 1 
ATOM   5703  C  CD2 . PHE B  2  312 ? 61.998 86.756  77.218  1.00 27.00  ? 312  PHE B CD2 1 
ATOM   5704  C  CE1 . PHE B  2  312 ? 61.696 86.842  79.977  1.00 18.60  ? 312  PHE B CE1 1 
ATOM   5705  C  CE2 . PHE B  2  312 ? 62.971 87.391  77.988  1.00 22.40  ? 312  PHE B CE2 1 
ATOM   5706  C  CZ  . PHE B  2  312 ? 62.830 87.433  79.360  1.00 24.48  ? 312  PHE B CZ  1 
ATOM   5707  N  N   . ASN B  2  313 ? 59.336 88.657  76.234  1.00 33.12  ? 313  ASN B N   1 
ATOM   5708  C  CA  . ASN B  2  313 ? 59.748 89.743  75.450  1.00 33.11  ? 313  ASN B CA  1 
ATOM   5709  C  C   . ASN B  2  313 ? 60.478 90.746  76.278  1.00 32.77  ? 313  ASN B C   1 
ATOM   5710  O  O   . ASN B  2  313 ? 59.906 91.375  77.133  1.00 32.26  ? 313  ASN B O   1 
ATOM   5711  C  CB  . ASN B  2  313 ? 58.517 90.362  74.831  1.00 33.78  ? 313  ASN B CB  1 
ATOM   5712  C  CG  . ASN B  2  313 ? 58.823 91.543  74.027  1.00 42.26  ? 313  ASN B CG  1 
ATOM   5713  O  OD1 . ASN B  2  313 ? 58.162 92.577  74.153  1.00 44.13  ? 313  ASN B OD1 1 
ATOM   5714  N  ND2 . ASN B  2  313 ? 59.841 91.431  73.172  1.00 49.02  ? 313  ASN B ND2 1 
ATOM   5715  N  N   . ALA B  2  314 ? 61.764 90.893  76.027  1.00 32.66  ? 314  ALA B N   1 
ATOM   5716  C  CA  . ALA B  2  314 ? 62.552 91.821  76.782  1.00 33.44  ? 314  ALA B CA  1 
ATOM   5717  C  C   . ALA B  2  314 ? 63.120 92.800  75.823  1.00 34.51  ? 314  ALA B C   1 
ATOM   5718  O  O   . ALA B  2  314 ? 63.620 92.425  74.786  1.00 36.21  ? 314  ALA B O   1 
ATOM   5719  C  CB  . ALA B  2  314 ? 63.644 91.097  77.488  1.00 33.86  ? 314  ALA B CB  1 
ATOM   5720  N  N   . SER B  2  315 ? 63.025 94.064  76.122  1.00 33.69  ? 315  SER B N   1 
ATOM   5721  C  CA  . SER B  2  315 ? 63.544 95.030  75.193  1.00 33.16  ? 315  SER B CA  1 
ATOM   5722  C  C   . SER B  2  315 ? 64.464 95.996  75.884  1.00 33.18  ? 315  SER B C   1 
ATOM   5723  O  O   . SER B  2  315 ? 64.119 96.541  76.902  1.00 33.43  ? 315  SER B O   1 
ATOM   5724  C  CB  . SER B  2  315 ? 62.433 95.756  74.515  1.00 32.49  ? 315  SER B CB  1 
ATOM   5725  O  OG  . SER B  2  315 ? 62.945 96.404  73.400  1.00 50.86  ? 315  SER B OG  1 
ATOM   5726  N  N   . TYR B  2  316 ? 65.632 96.203  75.320  1.00 32.68  ? 316  TYR B N   1 
ATOM   5727  C  CA  . TYR B  2  316 ? 66.598 97.065  75.917  1.00 33.80  ? 316  TYR B CA  1 
ATOM   5728  C  C   . TYR B  2  316 ? 67.003 98.234  75.010  1.00 35.74  ? 316  TYR B C   1 
ATOM   5729  O  O   . TYR B  2  316 ? 66.503 98.402  73.882  1.00 36.84  ? 316  TYR B O   1 
ATOM   5730  C  CB  . TYR B  2  316 ? 67.809 96.247  76.340  1.00 33.94  ? 316  TYR B CB  1 
ATOM   5731  C  CG  . TYR B  2  316 ? 67.442 95.120  77.259  1.00 34.96  ? 316  TYR B CG  1 
ATOM   5732  C  CD1 . TYR B  2  316 ? 67.533 93.796  76.845  1.00 30.37  ? 316  TYR B CD1 1 
ATOM   5733  C  CD2 . TYR B  2  316 ? 66.942 95.377  78.537  1.00 31.11  ? 316  TYR B CD2 1 
ATOM   5734  C  CE1 . TYR B  2  316 ? 67.201 92.758  77.711  1.00 29.44  ? 316  TYR B CE1 1 
ATOM   5735  C  CE2 . TYR B  2  316 ? 66.591 94.350  79.386  1.00 31.31  ? 316  TYR B CE2 1 
ATOM   5736  C  CZ  . TYR B  2  316 ? 66.706 93.046  78.964  1.00 26.59  ? 316  TYR B CZ  1 
ATOM   5737  O  OH  . TYR B  2  316 ? 66.330 92.038  79.808  1.00 28.89  ? 316  TYR B OH  1 
ATOM   5738  N  N   . SER B  2  317 ? 67.926 99.027  75.478  1.00 35.69  ? 317  SER B N   1 
ATOM   5739  C  CA  . SER B  2  317 ? 68.324 100.199 74.738  1.00 34.95  ? 317  SER B CA  1 
ATOM   5740  C  C   . SER B  2  317 ? 68.960 99.906  73.409  1.00 34.78  ? 317  SER B C   1 
ATOM   5741  O  O   . SER B  2  317 ? 68.787 100.676 72.481  1.00 35.90  ? 317  SER B O   1 
ATOM   5742  C  CB  . SER B  2  317 ? 69.273 101.031 75.574  1.00 34.84  ? 317  SER B CB  1 
ATOM   5743  O  OG  . SER B  2  317 ? 70.444 100.265 75.868  1.00 38.81  ? 317  SER B OG  1 
ATOM   5744  N  N   . ASP B  2  318 ? 69.696 98.805  73.305  1.00 33.94  ? 318  ASP B N   1 
ATOM   5745  C  CA  . ASP B  2  318 ? 70.428 98.478  72.067  1.00 33.32  ? 318  ASP B CA  1 
ATOM   5746  C  C   . ASP B  2  318 ? 70.242 97.023  71.653  1.00 34.14  ? 318  ASP B C   1 
ATOM   5747  O  O   . ASP B  2  318 ? 71.023 96.506  70.876  1.00 35.39  ? 318  ASP B O   1 
ATOM   5748  C  CB  . ASP B  2  318 ? 71.935 98.739  72.258  1.00 32.15  ? 318  ASP B CB  1 
ATOM   5749  C  CG  . ASP B  2  318 ? 72.505 98.005  73.502  1.00 42.36  ? 318  ASP B CG  1 
ATOM   5750  O  OD1 . ASP B  2  318 ? 73.782 97.944  73.722  1.00 33.81  ? 318  ASP B OD1 1 
ATOM   5751  O  OD2 . ASP B  2  318 ? 71.737 97.456  74.318  1.00 34.38  ? 318  ASP B OD2 1 
ATOM   5752  N  N   . SER B  2  319 ? 69.241 96.351  72.200  1.00 33.22  ? 319  SER B N   1 
ATOM   5753  C  CA  . SER B  2  319 ? 69.012 94.953  71.864  1.00 31.69  ? 319  SER B CA  1 
ATOM   5754  C  C   . SER B  2  319 ? 67.665 94.534  72.359  1.00 30.23  ? 319  SER B C   1 
ATOM   5755  O  O   . SER B  2  319 ? 66.939 95.315  72.917  1.00 29.53  ? 319  SER B O   1 
ATOM   5756  C  CB  . SER B  2  319 ? 70.076 94.060  72.532  1.00 31.79  ? 319  SER B CB  1 
ATOM   5757  O  OG  . SER B  2  319 ? 70.138 92.784  71.911  1.00 36.36  ? 319  SER B OG  1 
ATOM   5758  N  N   . GLY B  2  320 ? 67.338 93.275  72.161  1.00 29.62  ? 320  GLY B N   1 
ATOM   5759  C  CA  . GLY B  2  320 ? 66.077 92.758  72.623  1.00 28.88  ? 320  GLY B CA  1 
ATOM   5760  C  C   . GLY B  2  320 ? 66.120 91.259  72.594  1.00 28.80  ? 320  GLY B C   1 
ATOM   5761  O  O   . GLY B  2  320 ? 66.872 90.656  71.805  1.00 28.90  ? 320  GLY B O   1 
ATOM   5762  N  N   . LEU B  2  321 ? 65.347 90.636  73.469  1.00 28.59  ? 321  LEU B N   1 
ATOM   5763  C  CA  . LEU B  2  321 ? 65.238 89.171  73.492  1.00 28.26  ? 321  LEU B CA  1 
ATOM   5764  C  C   . LEU B  2  321 ? 63.788 88.841  73.432  1.00 28.46  ? 321  LEU B C   1 
ATOM   5765  O  O   . LEU B  2  321 ? 63.050 89.266  74.288  1.00 28.86  ? 321  LEU B O   1 
ATOM   5766  C  CB  . LEU B  2  321 ? 65.765 88.602  74.781  1.00 27.89  ? 321  LEU B CB  1 
ATOM   5767  C  CG  . LEU B  2  321 ? 67.231 88.748  75.147  1.00 25.76  ? 321  LEU B CG  1 
ATOM   5768  C  CD1 . LEU B  2  321 ? 67.434 87.992  76.464  1.00 21.20  ? 321  LEU B CD1 1 
ATOM   5769  C  CD2 . LEU B  2  321 ? 68.114 88.156  74.034  1.00 19.62  ? 321  LEU B CD2 1 
ATOM   5770  N  N   . PHE B  2  322 ? 63.363 88.136  72.377  1.00 28.40  ? 322  PHE B N   1 
ATOM   5771  C  CA  . PHE B  2  322 ? 61.980 87.677  72.274  1.00 28.26  ? 322  PHE B CA  1 
ATOM   5772  C  C   . PHE B  2  322 ? 61.912 86.164  72.061  1.00 27.61  ? 322  PHE B C   1 
ATOM   5773  O  O   . PHE B  2  322 ? 62.770 85.595  71.397  1.00 26.45  ? 322  PHE B O   1 
ATOM   5774  C  CB  . PHE B  2  322 ? 61.224 88.370  71.138  1.00 28.45  ? 322  PHE B CB  1 
ATOM   5775  C  CG  . PHE B  2  322 ? 59.894 87.750  70.853  1.00 23.30  ? 322  PHE B CG  1 
ATOM   5776  C  CD1 . PHE B  2  322 ? 58.766 88.161  71.544  1.00 30.98  ? 322  PHE B CD1 1 
ATOM   5777  C  CD2 . PHE B  2  322 ? 59.778 86.692  69.952  1.00 27.98  ? 322  PHE B CD2 1 
ATOM   5778  C  CE1 . PHE B  2  322 ? 57.529 87.545  71.316  1.00 35.53  ? 322  PHE B CE1 1 
ATOM   5779  C  CE2 . PHE B  2  322 ? 58.556 86.043  69.758  1.00 21.14  ? 322  PHE B CE2 1 
ATOM   5780  C  CZ  . PHE B  2  322 ? 57.443 86.471  70.414  1.00 30.25  ? 322  PHE B CZ  1 
ATOM   5781  N  N   . GLY B  2  323 ? 60.837 85.545  72.595  1.00 28.44  ? 323  GLY B N   1 
ATOM   5782  C  CA  . GLY B  2  323 ? 60.569 84.110  72.450  1.00 28.93  ? 323  GLY B CA  1 
ATOM   5783  C  C   . GLY B  2  323 ? 59.497 83.604  73.413  1.00 28.87  ? 323  GLY B C   1 
ATOM   5784  O  O   . GLY B  2  323 ? 58.488 84.254  73.619  1.00 29.13  ? 323  GLY B O   1 
ATOM   5785  N  N   . PHE B  2  324 ? 59.691 82.424  73.974  1.00 28.26  ? 324  PHE B N   1 
ATOM   5786  C  CA  . PHE B  2  324 ? 58.727 81.931  74.921  1.00 27.83  ? 324  PHE B CA  1 
ATOM   5787  C  C   . PHE B  2  324 ? 59.387 81.280  76.112  1.00 27.89  ? 324  PHE B C   1 
ATOM   5788  O  O   . PHE B  2  324 ? 60.587 80.993  76.088  1.00 28.04  ? 324  PHE B O   1 
ATOM   5789  C  CB  . PHE B  2  324 ? 57.737 80.992  74.262  1.00 27.49  ? 324  PHE B CB  1 
ATOM   5790  C  CG  . PHE B  2  324 ? 58.365 79.841  73.618  1.00 26.36  ? 324  PHE B CG  1 
ATOM   5791  C  CD1 . PHE B  2  324 ? 58.792 78.737  74.383  1.00 17.99  ? 324  PHE B CD1 1 
ATOM   5792  C  CD2 . PHE B  2  324 ? 58.566 79.829  72.235  1.00 20.97  ? 324  PHE B CD2 1 
ATOM   5793  C  CE1 . PHE B  2  324 ? 59.416 77.674  73.784  1.00 26.72  ? 324  PHE B CE1 1 
ATOM   5794  C  CE2 . PHE B  2  324 ? 59.210 78.781  71.634  1.00 26.63  ? 324  PHE B CE2 1 
ATOM   5795  C  CZ  . PHE B  2  324 ? 59.633 77.683  72.402  1.00 27.54  ? 324  PHE B CZ  1 
ATOM   5796  N  N   . TYR B  2  325 ? 58.586 81.052  77.156  1.00 27.71  ? 325  TYR B N   1 
ATOM   5797  C  CA  . TYR B  2  325 ? 59.022 80.457  78.415  1.00 27.25  ? 325  TYR B CA  1 
ATOM   5798  C  C   . TYR B  2  325 ? 58.000 79.303  78.722  1.00 29.08  ? 325  TYR B C   1 
ATOM   5799  O  O   . TYR B  2  325 ? 56.796 79.472  78.509  1.00 30.26  ? 325  TYR B O   1 
ATOM   5800  C  CB  . TYR B  2  325 ? 58.965 81.528  79.490  1.00 25.72  ? 325  TYR B CB  1 
ATOM   5801  C  CG  . TYR B  2  325 ? 59.621 81.177  80.809  1.00 30.01  ? 325  TYR B CG  1 
ATOM   5802  C  CD1 . TYR B  2  325 ? 60.829 81.740  81.183  1.00 27.21  ? 325  TYR B CD1 1 
ATOM   5803  C  CD2 . TYR B  2  325 ? 59.022 80.303  81.688  1.00 30.06  ? 325  TYR B CD2 1 
ATOM   5804  C  CE1 . TYR B  2  325 ? 61.410 81.409  82.382  1.00 27.38  ? 325  TYR B CE1 1 
ATOM   5805  C  CE2 . TYR B  2  325 ? 59.589 79.995  82.891  1.00 31.83  ? 325  TYR B CE2 1 
ATOM   5806  C  CZ  . TYR B  2  325 ? 60.766 80.534  83.234  1.00 30.67  ? 325  TYR B CZ  1 
ATOM   5807  O  OH  . TYR B  2  325 ? 61.319 80.164  84.435  1.00 33.52  ? 325  TYR B OH  1 
ATOM   5808  N  N   . THR B  2  326 ? 58.491 78.118  79.132  1.00 28.51  ? 326  THR B N   1 
ATOM   5809  C  CA  . THR B  2  326 ? 57.614 76.985  79.415  1.00 26.93  ? 326  THR B CA  1 
ATOM   5810  C  C   . THR B  2  326 ? 57.879 76.397  80.765  1.00 26.71  ? 326  THR B C   1 
ATOM   5811  O  O   . THR B  2  326 ? 59.025 76.360  81.216  1.00 27.16  ? 326  THR B O   1 
ATOM   5812  C  CB  . THR B  2  326 ? 57.862 75.875  78.433  1.00 26.63  ? 326  THR B CB  1 
ATOM   5813  O  OG1 . THR B  2  326 ? 59.208 75.402  78.572  1.00 24.62  ? 326  THR B OG1 1 
ATOM   5814  C  CG2 . THR B  2  326 ? 57.791 76.357  77.036  1.00 19.07  ? 326  THR B CG2 1 
ATOM   5815  N  N   . ILE B  2  327 ? 56.829 75.918  81.413  1.00 26.13  ? 327  ILE B N   1 
ATOM   5816  C  CA  . ILE B  2  327 ? 56.970 75.205  82.664  1.00 26.60  ? 327  ILE B CA  1 
ATOM   5817  C  C   . ILE B  2  327 ? 56.277 73.891  82.459  1.00 26.68  ? 327  ILE B C   1 
ATOM   5818  O  O   . ILE B  2  327 ? 55.132 73.868  82.032  1.00 27.05  ? 327  ILE B O   1 
ATOM   5819  C  CB  . ILE B  2  327 ? 56.298 75.948  83.783  1.00 26.81  ? 327  ILE B CB  1 
ATOM   5820  C  CG1 . ILE B  2  327 ? 57.054 77.206  84.106  1.00 21.91  ? 327  ILE B CG1 1 
ATOM   5821  C  CG2 . ILE B  2  327 ? 56.194 75.080  85.038  1.00 17.75  ? 327  ILE B CG2 1 
ATOM   5822  C  CD1 . ILE B  2  327 ? 56.296 78.056  85.069  1.00 21.35  ? 327  ILE B CD1 1 
ATOM   5823  N  N   . SER B  2  328 ? 56.944 72.788  82.730  1.00 26.59  ? 328  SER B N   1 
ATOM   5824  C  CA  . SER B  2  328 ? 56.268 71.488  82.544  1.00 26.84  ? 328  SER B CA  1 
ATOM   5825  C  C   . SER B  2  328 ? 56.936 70.380  83.283  1.00 27.27  ? 328  SER B C   1 
ATOM   5826  O  O   . SER B  2  328 ? 58.077 70.502  83.664  1.00 28.25  ? 328  SER B O   1 
ATOM   5827  C  CB  . SER B  2  328 ? 56.266 71.114  81.067  1.00 26.50  ? 328  SER B CB  1 
ATOM   5828  O  OG  . SER B  2  328 ? 57.599 70.909  80.639  1.00 19.17  ? 328  SER B OG  1 
ATOM   5829  N  N   . GLN B  2  329 ? 56.223 69.279  83.465  1.00 26.93  ? 329  GLN B N   1 
ATOM   5830  C  CA  . GLN B  2  329 ? 56.820 68.080  84.040  1.00 27.18  ? 329  GLN B CA  1 
ATOM   5831  C  C   . GLN B  2  329 ? 58.112 67.687  83.264  1.00 27.29  ? 329  GLN B C   1 
ATOM   5832  O  O   . GLN B  2  329 ? 58.162 67.805  82.042  1.00 26.71  ? 329  GLN B O   1 
ATOM   5833  C  CB  . GLN B  2  329 ? 55.840 66.910  83.947  1.00 26.77  ? 329  GLN B CB  1 
ATOM   5834  C  CG  . GLN B  2  329 ? 54.531 67.154  84.584  1.00 36.12  ? 329  GLN B CG  1 
ATOM   5835  C  CD  . GLN B  2  329 ? 54.635 67.314  86.082  1.00 49.36  ? 329  GLN B CD  1 
ATOM   5836  O  OE1 . GLN B  2  329 ? 53.986 68.211  86.670  1.00 57.40  ? 329  GLN B OE1 1 
ATOM   5837  N  NE2 . GLN B  2  329 ? 55.445 66.453  86.725  1.00 46.07  ? 329  GLN B NE2 1 
ATOM   5838  N  N   . ALA B  2  330 ? 59.120 67.194  83.991  1.00 27.79  ? 330  ALA B N   1 
ATOM   5839  C  CA  . ALA B  2  330 ? 60.410 66.791  83.397  1.00 28.29  ? 330  ALA B CA  1 
ATOM   5840  C  C   . ALA B  2  330 ? 60.361 66.027  82.032  1.00 29.49  ? 330  ALA B C   1 
ATOM   5841  O  O   . ALA B  2  330 ? 61.115 66.358  81.100  1.00 30.94  ? 330  ALA B O   1 
ATOM   5842  C  CB  . ALA B  2  330 ? 61.300 66.029  84.450  1.00 27.26  ? 330  ALA B CB  1 
ATOM   5843  N  N   . ALA B  2  331 ? 59.439 65.086  81.904  1.00 29.51  ? 331  ALA B N   1 
ATOM   5844  C  CA  . ALA B  2  331 ? 59.307 64.244  80.675  1.00 29.78  ? 331  ALA B CA  1 
ATOM   5845  C  C   . ALA B  2  331 ? 58.553 64.892  79.497  1.00 30.96  ? 331  ALA B C   1 
ATOM   5846  O  O   . ALA B  2  331 ? 58.755 64.529  78.359  1.00 31.65  ? 331  ALA B O   1 
ATOM   5847  C  CB  . ALA B  2  331 ? 58.700 62.826  81.028  1.00 27.95  ? 331  ALA B CB  1 
ATOM   5848  N  N   . SER B  2  332 ? 57.707 65.861  79.784  1.00 31.77  ? 332  SER B N   1 
ATOM   5849  C  CA  . SER B  2  332 ? 56.956 66.564  78.744  1.00 32.15  ? 332  SER B CA  1 
ATOM   5850  C  C   . SER B  2  332 ? 57.722 67.798  78.198  1.00 32.35  ? 332  SER B C   1 
ATOM   5851  O  O   . SER B  2  332 ? 57.249 68.468  77.252  1.00 32.70  ? 332  SER B O   1 
ATOM   5852  C  CB  . SER B  2  332 ? 55.602 67.048  79.308  1.00 32.29  ? 332  SER B CB  1 
ATOM   5853  O  OG  . SER B  2  332 ? 54.694 65.986  79.526  1.00 35.62  ? 332  SER B OG  1 
ATOM   5854  N  N   . ALA B  2  333 ? 58.873 68.121  78.793  1.00 31.97  ? 333  ALA B N   1 
ATOM   5855  C  CA  . ALA B  2  333 ? 59.617 69.343  78.380  1.00 31.73  ? 333  ALA B CA  1 
ATOM   5856  C  C   . ALA B  2  333 ? 59.855 69.427  76.901  1.00 30.89  ? 333  ALA B C   1 
ATOM   5857  O  O   . ALA B  2  333 ? 59.609 70.443  76.306  1.00 30.65  ? 333  ALA B O   1 
ATOM   5858  C  CB  . ALA B  2  333 ? 60.942 69.490  79.147  1.00 31.93  ? 333  ALA B CB  1 
ATOM   5859  N  N   . GLY B  2  334 ? 60.324 68.334  76.316  1.00 30.53  ? 334  GLY B N   1 
ATOM   5860  C  CA  . GLY B  2  334 ? 60.586 68.290  74.899  1.00 30.40  ? 334  GLY B CA  1 
ATOM   5861  C  C   . GLY B  2  334 ? 59.350 68.565  74.080  1.00 30.33  ? 334  GLY B C   1 
ATOM   5862  O  O   . GLY B  2  334 ? 59.378 69.380  73.175  1.00 30.62  ? 334  GLY B O   1 
ATOM   5863  N  N   . ASP B  2  335 ? 58.262 67.896  74.424  1.00 29.96  ? 335  ASP B N   1 
ATOM   5864  C  CA  . ASP B  2  335 ? 57.022 68.062  73.734  1.00 29.90  ? 335  ASP B CA  1 
ATOM   5865  C  C   . ASP B  2  335 ? 56.479 69.469  73.887  1.00 30.78  ? 335  ASP B C   1 
ATOM   5866  O  O   . ASP B  2  335 ? 56.154 70.111  72.897  1.00 31.92  ? 335  ASP B O   1 
ATOM   5867  C  CB  . ASP B  2  335 ? 56.040 67.010  74.174  1.00 29.24  ? 335  ASP B CB  1 
ATOM   5868  C  CG  . ASP B  2  335 ? 56.569 65.635  73.942  1.00 33.69  ? 335  ASP B CG  1 
ATOM   5869  O  OD1 . ASP B  2  335 ? 56.255 64.705  74.717  1.00 43.03  ? 335  ASP B OD1 1 
ATOM   5870  O  OD2 . ASP B  2  335 ? 57.364 65.394  73.019  1.00 29.46  ? 335  ASP B OD2 1 
ATOM   5871  N  N   . VAL B  2  336 ? 56.441 69.979  75.106  1.00 30.34  ? 336  VAL B N   1 
ATOM   5872  C  CA  . VAL B  2  336 ? 55.965 71.339  75.307  1.00 30.36  ? 336  VAL B CA  1 
ATOM   5873  C  C   . VAL B  2  336 ? 56.783 72.370  74.478  1.00 30.12  ? 336  VAL B C   1 
ATOM   5874  O  O   . VAL B  2  336 ? 56.217 73.145  73.709  1.00 29.60  ? 336  VAL B O   1 
ATOM   5875  C  CB  . VAL B  2  336 ? 55.961 71.717  76.762  1.00 30.29  ? 336  VAL B CB  1 
ATOM   5876  C  CG1 . VAL B  2  336 ? 55.618 73.176  76.915  1.00 18.31  ? 336  VAL B CG1 1 
ATOM   5877  C  CG2 . VAL B  2  336 ? 54.974 70.850  77.510  1.00 27.59  ? 336  VAL B CG2 1 
ATOM   5878  N  N   . ILE B  2  337 ? 58.100 72.309  74.595  1.00 30.60  ? 337  ILE B N   1 
ATOM   5879  C  CA  . ILE B  2  337 ? 58.973 73.189  73.849  1.00 31.35  ? 337  ILE B CA  1 
ATOM   5880  C  C   . ILE B  2  337 ? 58.752 73.049  72.358  1.00 31.50  ? 337  ILE B C   1 
ATOM   5881  O  O   . ILE B  2  337 ? 58.427 74.023  71.683  1.00 32.33  ? 337  ILE B O   1 
ATOM   5882  C  CB  . ILE B  2  337 ? 60.430 72.959  74.252  1.00 31.97  ? 337  ILE B CB  1 
ATOM   5883  C  CG1 . ILE B  2  337 ? 60.660 73.544  75.653  1.00 35.96  ? 337  ILE B CG1 1 
ATOM   5884  C  CG2 . ILE B  2  337 ? 61.364 73.634  73.304  1.00 33.26  ? 337  ILE B CG2 1 
ATOM   5885  C  CD1 . ILE B  2  337 ? 61.821 72.939  76.377  1.00 40.92  ? 337  ILE B CD1 1 
ATOM   5886  N  N   . LYS B  2  338 ? 58.813 71.839  71.851  1.00 31.21  ? 338  LYS B N   1 
ATOM   5887  C  CA  . LYS B  2  338 ? 58.578 71.629  70.405  1.00 30.88  ? 338  LYS B CA  1 
ATOM   5888  C  C   . LYS B  2  338 ? 57.219 72.121  69.879  1.00 30.06  ? 338  LYS B C   1 
ATOM   5889  O  O   . LYS B  2  338 ? 57.164 72.730  68.809  1.00 30.75  ? 338  LYS B O   1 
ATOM   5890  C  CB  . LYS B  2  338 ? 58.900 70.193  69.971  1.00 30.99  ? 338  LYS B CB  1 
ATOM   5891  C  CG  . LYS B  2  338 ? 60.424 69.856  70.183  1.00 41.85  ? 338  LYS B CG  1 
ATOM   5892  C  CD  . LYS B  2  338 ? 60.793 68.389  69.883  1.00 43.73  ? 338  LYS B CD  1 
ATOM   5893  C  CE  . LYS B  2  338 ? 62.245 68.133  70.335  1.00 46.25  ? 338  LYS B CE  1 
ATOM   5894  N  NZ  . LYS B  2  338 ? 62.646 66.682  70.423  1.00 46.65  ? 338  LYS B NZ  1 
ATOM   5895  N  N   . ALA B  2  339 ? 56.146 71.913  70.652  1.00 28.50  ? 339  ALA B N   1 
ATOM   5896  C  CA  . ALA B  2  339 ? 54.822 72.365  70.255  1.00 27.69  ? 339  ALA B CA  1 
ATOM   5897  C  C   . ALA B  2  339 ? 54.811 73.869  70.190  1.00 29.64  ? 339  ALA B C   1 
ATOM   5898  O  O   . ALA B  2  339 ? 54.283 74.444  69.235  1.00 30.40  ? 339  ALA B O   1 
ATOM   5899  C  CB  . ALA B  2  339 ? 53.803 71.904  71.210  1.00 26.48  ? 339  ALA B CB  1 
ATOM   5900  N  N   . ALA B  2  340 ? 55.418 74.505  71.200  1.00 30.29  ? 340  ALA B N   1 
ATOM   5901  C  CA  . ALA B  2  340 ? 55.475 75.937  71.287  1.00 31.68  ? 340  ALA B CA  1 
ATOM   5902  C  C   . ALA B  2  340 ? 56.239 76.531  70.129  1.00 32.60  ? 340  ALA B C   1 
ATOM   5903  O  O   . ALA B  2  340 ? 55.768 77.473  69.473  1.00 32.33  ? 340  ALA B O   1 
ATOM   5904  C  CB  . ALA B  2  340 ? 56.133 76.380  72.645  1.00 32.24  ? 340  ALA B CB  1 
ATOM   5905  N  N   . TYR B  2  341 ? 57.434 75.996  69.895  1.00 33.67  ? 341  TYR B N   1 
ATOM   5906  C  CA  . TYR B  2  341 ? 58.290 76.465  68.813  1.00 34.20  ? 341  TYR B CA  1 
ATOM   5907  C  C   . TYR B  2  341 ? 57.544 76.339  67.502  1.00 34.66  ? 341  TYR B C   1 
ATOM   5908  O  O   . TYR B  2  341 ? 57.541 77.283  66.714  1.00 35.50  ? 341  TYR B O   1 
ATOM   5909  C  CB  . TYR B  2  341 ? 59.590 75.657  68.750  1.00 34.09  ? 341  TYR B CB  1 
ATOM   5910  C  CG  . TYR B  2  341 ? 60.664 76.220  67.802  1.00 33.96  ? 341  TYR B CG  1 
ATOM   5911  C  CD1 . TYR B  2  341 ? 60.697 77.554  67.468  1.00 34.81  ? 341  TYR B CD1 1 
ATOM   5912  C  CD2 . TYR B  2  341 ? 61.692 75.412  67.333  1.00 33.77  ? 341  TYR B CD2 1 
ATOM   5913  C  CE1 . TYR B  2  341 ? 61.695 78.064  66.658  1.00 31.53  ? 341  TYR B CE1 1 
ATOM   5914  C  CE2 . TYR B  2  341 ? 62.672 75.907  66.536  1.00 32.92  ? 341  TYR B CE2 1 
ATOM   5915  C  CZ  . TYR B  2  341 ? 62.672 77.241  66.202  1.00 31.27  ? 341  TYR B CZ  1 
ATOM   5916  O  OH  . TYR B  2  341 ? 63.663 77.746  65.421  1.00 25.25  ? 341  TYR B OH  1 
ATOM   5917  N  N   . ASN B  2  342 ? 56.869 75.201  67.280  1.00 33.92  ? 342  ASN B N   1 
ATOM   5918  C  CA  . ASN B  2  342 ? 56.135 75.024  66.037  1.00 33.87  ? 342  ASN B CA  1 
ATOM   5919  C  C   . ASN B  2  342 ? 54.998 76.017  65.891  1.00 34.10  ? 342  ASN B C   1 
ATOM   5920  O  O   . ASN B  2  342 ? 54.626 76.379  64.774  1.00 35.09  ? 342  ASN B O   1 
ATOM   5921  C  CB  . ASN B  2  342 ? 55.599 73.597  65.873  1.00 33.91  ? 342  ASN B CB  1 
ATOM   5922  C  CG  . ASN B  2  342 ? 56.715 72.550  65.689  1.00 36.94  ? 342  ASN B CG  1 
ATOM   5923  O  OD1 . ASN B  2  342 ? 56.496 71.358  65.925  1.00 35.64  ? 342  ASN B OD1 1 
ATOM   5924  N  ND2 . ASN B  2  342 ? 57.909 72.997  65.284  1.00 32.45  ? 342  ASN B ND2 1 
ATOM   5925  N  N   . GLN B  2  343 ? 54.423 76.450  67.002  1.00 33.20  ? 343  GLN B N   1 
ATOM   5926  C  CA  . GLN B  2  343 ? 53.338 77.395  66.912  1.00 32.67  ? 343  GLN B CA  1 
ATOM   5927  C  C   . GLN B  2  343 ? 53.821 78.747  66.373  1.00 32.93  ? 343  GLN B C   1 
ATOM   5928  O  O   . GLN B  2  343 ? 53.143 79.375  65.544  1.00 32.99  ? 343  GLN B O   1 
ATOM   5929  C  CB  . GLN B  2  343 ? 52.597 77.543  68.233  1.00 32.12  ? 343  GLN B CB  1 
ATOM   5930  C  CG  . GLN B  2  343 ? 51.610 78.724  68.273  1.00 30.98  ? 343  GLN B CG  1 
ATOM   5931  C  CD  . GLN B  2  343 ? 50.511 78.657  67.179  1.00 43.73  ? 343  GLN B CD  1 
ATOM   5932  O  OE1 . GLN B  2  343 ? 50.536 77.799  66.284  1.00 47.87  ? 343  GLN B OE1 1 
ATOM   5933  N  NE2 . GLN B  2  343 ? 49.568 79.545  67.268  1.00 42.10  ? 343  GLN B NE2 1 
ATOM   5934  N  N   . VAL B  2  344 ? 55.003 79.174  66.817  1.00 32.79  ? 344  VAL B N   1 
ATOM   5935  C  CA  . VAL B  2  344 ? 55.568 80.402  66.331  1.00 33.23  ? 344  VAL B CA  1 
ATOM   5936  C  C   . VAL B  2  344 ? 55.842 80.249  64.846  1.00 34.29  ? 344  VAL B C   1 
ATOM   5937  O  O   . VAL B  2  344 ? 55.477 81.113  64.056  1.00 34.72  ? 344  VAL B O   1 
ATOM   5938  C  CB  . VAL B  2  344 ? 56.865 80.749  67.016  1.00 33.19  ? 344  VAL B CB  1 
ATOM   5939  C  CG1 . VAL B  2  344 ? 57.299 82.133  66.594  1.00 23.49  ? 344  VAL B CG1 1 
ATOM   5940  C  CG2 . VAL B  2  344 ? 56.717 80.663  68.539  1.00 25.64  ? 344  VAL B CG2 1 
ATOM   5941  N  N   . LYS B  2  345 ? 56.443 79.111  64.467  1.00 34.58  ? 345  LYS B N   1 
ATOM   5942  C  CA  . LYS B  2  345 ? 56.738 78.802  63.060  1.00 34.76  ? 345  LYS B CA  1 
ATOM   5943  C  C   . LYS B  2  345 ? 55.515 79.013  62.178  1.00 34.86  ? 345  LYS B C   1 
ATOM   5944  O  O   . LYS B  2  345 ? 55.618 79.557  61.073  1.00 35.12  ? 345  LYS B O   1 
ATOM   5945  C  CB  . LYS B  2  345 ? 57.223 77.348  62.923  1.00 34.81  ? 345  LYS B CB  1 
ATOM   5946  C  CG  . LYS B  2  345 ? 58.742 77.170  62.968  1.00 30.19  ? 345  LYS B CG  1 
ATOM   5947  C  CD  . LYS B  2  345 ? 59.135 75.725  63.265  1.00 30.13  ? 345  LYS B CD  1 
ATOM   5948  C  CE  . LYS B  2  345 ? 60.468 75.383  62.568  1.00 40.28  ? 345  LYS B CE  1 
ATOM   5949  N  NZ  . LYS B  2  345 ? 61.300 74.374  63.322  1.00 38.79  ? 345  LYS B NZ  1 
ATOM   5950  N  N   . THR B  2  346 ? 54.359 78.586  62.685  1.00 34.51  ? 346  THR B N   1 
ATOM   5951  C  CA  . THR B  2  346 ? 53.085 78.725  61.994  1.00 34.23  ? 346  THR B CA  1 
ATOM   5952  C  C   . THR B  2  346 ? 52.740 80.175  61.651  1.00 33.71  ? 346  THR B C   1 
ATOM   5953  O  O   . THR B  2  346 ? 52.253 80.455  60.557  1.00 34.21  ? 346  THR B O   1 
ATOM   5954  C  CB  . THR B  2  346 ? 51.961 78.021  62.816  1.00 34.51  ? 346  THR B CB  1 
ATOM   5955  O  OG1 . THR B  2  346 ? 51.662 76.767  62.207  1.00 42.42  ? 346  THR B OG1 1 
ATOM   5956  C  CG2 . THR B  2  346 ? 50.618 78.775  62.756  1.00 36.53  ? 346  THR B CG2 1 
ATOM   5957  N  N   . ILE B  2  347 ? 53.031 81.091  62.564  1.00 32.89  ? 347  ILE B N   1 
ATOM   5958  C  CA  . ILE B  2  347 ? 52.791 82.513  62.321  1.00 32.66  ? 347  ILE B CA  1 
ATOM   5959  C  C   . ILE B  2  347 ? 53.858 83.062  61.389  1.00 32.66  ? 347  ILE B C   1 
ATOM   5960  O  O   . ILE B  2  347 ? 53.602 83.965  60.612  1.00 33.06  ? 347  ILE B O   1 
ATOM   5961  C  CB  . ILE B  2  347 ? 52.808 83.277  63.642  1.00 32.59  ? 347  ILE B CB  1 
ATOM   5962  C  CG1 . ILE B  2  347 ? 51.719 82.739  64.540  1.00 31.64  ? 347  ILE B CG1 1 
ATOM   5963  C  CG2 . ILE B  2  347 ? 52.620 84.772  63.422  1.00 29.10  ? 347  ILE B CG2 1 
ATOM   5964  C  CD1 . ILE B  2  347 ? 51.766 83.252  65.835  1.00 34.33  ? 347  ILE B CD1 1 
ATOM   5965  N  N   . ALA B  2  348 ? 55.050 82.492  61.449  1.00 32.84  ? 348  ALA B N   1 
ATOM   5966  C  CA  . ALA B  2  348 ? 56.133 82.924  60.593  1.00 34.01  ? 348  ALA B CA  1 
ATOM   5967  C  C   . ALA B  2  348 ? 55.879 82.500  59.132  1.00 36.21  ? 348  ALA B C   1 
ATOM   5968  O  O   . ALA B  2  348 ? 56.367 83.136  58.201  1.00 37.50  ? 348  ALA B O   1 
ATOM   5969  C  CB  . ALA B  2  348 ? 57.444 82.389  61.086  1.00 33.47  ? 348  ALA B CB  1 
ATOM   5970  N  N   . GLN B  2  349 ? 55.081 81.453  58.944  1.00 36.74  ? 349  GLN B N   1 
ATOM   5971  C  CA  . GLN B  2  349 ? 54.741 80.979  57.620  1.00 37.24  ? 349  GLN B CA  1 
ATOM   5972  C  C   . GLN B  2  349 ? 53.491 81.670  57.066  1.00 38.29  ? 349  GLN B C   1 
ATOM   5973  O  O   . GLN B  2  349 ? 53.024 81.322  55.984  1.00 39.21  ? 349  GLN B O   1 
ATOM   5974  C  CB  . GLN B  2  349 ? 54.555 79.470  57.621  1.00 37.04  ? 349  GLN B CB  1 
ATOM   5975  C  CG  . GLN B  2  349 ? 55.842 78.693  57.712  1.00 39.66  ? 349  GLN B CG  1 
ATOM   5976  C  CD  . GLN B  2  349 ? 55.624 77.254  58.204  1.00 52.84  ? 349  GLN B CD  1 
ATOM   5977  O  OE1 . GLN B  2  349 ? 54.490 76.847  58.486  1.00 53.57  ? 349  GLN B OE1 1 
ATOM   5978  N  NE2 . GLN B  2  349 ? 56.709 76.496  58.322  1.00 55.16  ? 349  GLN B NE2 1 
ATOM   5979  N  N   . GLY B  2  350 ? 52.927 82.617  57.818  1.00 38.18  ? 350  GLY B N   1 
ATOM   5980  C  CA  . GLY B  2  350 ? 51.788 83.385  57.333  1.00 38.16  ? 350  GLY B CA  1 
ATOM   5981  C  C   . GLY B  2  350 ? 50.424 83.090  57.954  1.00 38.21  ? 350  GLY B C   1 
ATOM   5982  O  O   . GLY B  2  350 ? 49.453 83.830  57.714  1.00 38.27  ? 350  GLY B O   1 
ATOM   5983  N  N   . ASN B  2  351 ? 50.335 82.060  58.778  1.00 37.84  ? 351  ASN B N   1 
ATOM   5984  C  CA  . ASN B  2  351 ? 49.047 81.704  59.340  1.00 38.27  ? 351  ASN B CA  1 
ATOM   5985  C  C   . ASN B  2  351 ? 48.632 82.507  60.541  1.00 39.18  ? 351  ASN B C   1 
ATOM   5986  O  O   . ASN B  2  351 ? 48.510 81.994  61.707  1.00 39.65  ? 351  ASN B O   1 
ATOM   5987  C  CB  . ASN B  2  351 ? 48.938 80.230  59.548  1.00 38.35  ? 351  ASN B CB  1 
ATOM   5988  C  CG  . ASN B  2  351 ? 49.226 79.483  58.306  1.00 41.08  ? 351  ASN B CG  1 
ATOM   5989  O  OD1 . ASN B  2  351 ? 50.384 79.301  57.935  1.00 42.00  ? 351  ASN B OD1 1 
ATOM   5990  N  ND2 . ASN B  2  351 ? 48.183 79.102  57.597  1.00 47.03  ? 351  ASN B ND2 1 
ATOM   5991  N  N   . LEU B  2  352 ? 48.383 83.775  60.262  1.00 38.91  ? 352  LEU B N   1 
ATOM   5992  C  CA  . LEU B  2  352 ? 47.999 84.719  61.255  1.00 38.74  ? 352  LEU B CA  1 
ATOM   5993  C  C   . LEU B  2  352 ? 46.784 85.448  60.709  1.00 39.63  ? 352  LEU B C   1 
ATOM   5994  O  O   . LEU B  2  352 ? 46.774 85.848  59.557  1.00 39.42  ? 352  LEU B O   1 
ATOM   5995  C  CB  . LEU B  2  352 ? 49.148 85.672  61.472  1.00 37.93  ? 352  LEU B CB  1 
ATOM   5996  C  CG  . LEU B  2  352 ? 48.915 86.837  62.388  1.00 30.75  ? 352  LEU B CG  1 
ATOM   5997  C  CD1 . LEU B  2  352 ? 48.725 86.369  63.807  1.00 29.28  ? 352  LEU B CD1 1 
ATOM   5998  C  CD2 . LEU B  2  352 ? 50.082 87.745  62.283  1.00 31.96  ? 352  LEU B CD2 1 
ATOM   5999  N  N   . SER B  2  353 ? 45.754 85.604  61.540  1.00 40.74  ? 353  SER B N   1 
ATOM   6000  C  CA  . SER B  2  353 ? 44.466 86.234  61.129  1.00 41.49  ? 353  SER B CA  1 
ATOM   6001  C  C   . SER B  2  353 ? 44.586 87.745  60.981  1.00 42.76  ? 353  SER B C   1 
ATOM   6002  O  O   . SER B  2  353 ? 45.624 88.275  60.645  1.00 43.86  ? 353  SER B O   1 
ATOM   6003  C  CB  . SER B  2  353 ? 43.422 85.954  62.219  1.00 41.24  ? 353  SER B CB  1 
ATOM   6004  O  OG  . SER B  2  353 ? 42.166 85.676  61.713  1.00 37.31  ? 353  SER B OG  1 
ATOM   6005  N  N   . ASN B  2  354 ? 43.481 88.422  61.151  1.00 42.86  ? 354  ASN B N   1 
ATOM   6006  C  CA  . ASN B  2  354 ? 43.474 89.865  61.178  1.00 42.80  ? 354  ASN B CA  1 
ATOM   6007  C  C   . ASN B  2  354 ? 42.818 90.208  62.495  1.00 42.40  ? 354  ASN B C   1 
ATOM   6008  O  O   . ASN B  2  354 ? 43.332 91.052  63.231  1.00 42.44  ? 354  ASN B O   1 
ATOM   6009  C  CB  . ASN B  2  354 ? 42.763 90.500  59.977  1.00 43.26  ? 354  ASN B CB  1 
ATOM   6010  C  CG  . ASN B  2  354 ? 42.661 92.019  60.096  1.00 54.91  ? 354  ASN B CG  1 
ATOM   6011  O  OD1 . ASN B  2  354 ? 41.709 92.554  60.680  1.00 52.88  ? 354  ASN B OD1 1 
ATOM   6012  N  ND2 . ASN B  2  354 ? 43.654 92.718  59.562  1.00 64.02  ? 354  ASN B ND2 1 
ATOM   6013  N  N   . PRO B  2  355 ? 41.660 89.577  62.803  1.00 41.99  ? 355  PRO B N   1 
ATOM   6014  C  CA  . PRO B  2  355 ? 41.079 89.714  64.133  1.00 41.95  ? 355  PRO B CA  1 
ATOM   6015  C  C   . PRO B  2  355 ? 42.035 89.202  65.216  1.00 41.48  ? 355  PRO B C   1 
ATOM   6016  O  O   . PRO B  2  355 ? 41.859 89.583  66.362  1.00 41.67  ? 355  PRO B O   1 
ATOM   6017  C  CB  . PRO B  2  355 ? 39.831 88.826  64.059  1.00 42.34  ? 355  PRO B CB  1 
ATOM   6018  C  CG  . PRO B  2  355 ? 40.063 87.984  62.842  1.00 45.21  ? 355  PRO B CG  1 
ATOM   6019  C  CD  . PRO B  2  355 ? 40.700 88.901  61.892  1.00 41.58  ? 355  PRO B CD  1 
ATOM   6020  N  N   . ASP B  2  356 ? 43.023 88.364  64.863  1.00 41.08  ? 356  ASP B N   1 
ATOM   6021  C  CA  . ASP B  2  356 ? 44.009 87.888  65.864  1.00 40.59  ? 356  ASP B CA  1 
ATOM   6022  C  C   . ASP B  2  356 ? 44.927 89.007  66.261  1.00 39.82  ? 356  ASP B C   1 
ATOM   6023  O  O   . ASP B  2  356 ? 45.126 89.260  67.436  1.00 40.12  ? 356  ASP B O   1 
ATOM   6024  C  CB  . ASP B  2  356 ? 44.827 86.701  65.356  1.00 40.68  ? 356  ASP B CB  1 
ATOM   6025  C  CG  . ASP B  2  356 ? 44.070 85.380  65.467  1.00 42.09  ? 356  ASP B CG  1 
ATOM   6026  O  OD1 . ASP B  2  356 ? 44.547 84.358  64.893  1.00 36.86  ? 356  ASP B OD1 1 
ATOM   6027  O  OD2 . ASP B  2  356 ? 42.988 85.279  66.101  1.00 38.52  ? 356  ASP B OD2 1 
ATOM   6028  N  N   . VAL B  2  357 ? 45.478 89.688  65.264  1.00 38.71  ? 357  VAL B N   1 
ATOM   6029  C  CA  . VAL B  2  357 ? 46.340 90.818  65.492  1.00 37.75  ? 357  VAL B CA  1 
ATOM   6030  C  C   . VAL B  2  357 ? 45.533 91.913  66.186  1.00 37.87  ? 357  VAL B C   1 
ATOM   6031  O  O   . VAL B  2  357 ? 46.032 92.587  67.099  1.00 37.71  ? 357  VAL B O   1 
ATOM   6032  C  CB  . VAL B  2  357 ? 46.885 91.327  64.181  1.00 37.39  ? 357  VAL B CB  1 
ATOM   6033  C  CG1 . VAL B  2  357 ? 47.869 92.400  64.402  1.00 36.65  ? 357  VAL B CG1 1 
ATOM   6034  C  CG2 . VAL B  2  357 ? 47.536 90.202  63.438  1.00 36.22  ? 357  VAL B CG2 1 
ATOM   6035  N  N   . GLN B  2  358 ? 44.255 92.031  65.798  1.00 38.03  ? 358  GLN B N   1 
ATOM   6036  C  CA  . GLN B  2  358 ? 43.334 93.001  66.399  1.00 38.12  ? 358  GLN B CA  1 
ATOM   6037  C  C   . GLN B  2  358 ? 43.124 92.693  67.881  1.00 38.14  ? 358  GLN B C   1 
ATOM   6038  O  O   . GLN B  2  358 ? 43.153 93.605  68.741  1.00 39.02  ? 358  GLN B O   1 
ATOM   6039  C  CB  . GLN B  2  358 ? 41.998 92.989  65.675  1.00 38.14  ? 358  GLN B CB  1 
ATOM   6040  C  CG  . GLN B  2  358 ? 41.356 94.339  65.542  1.00 54.70  ? 358  GLN B CG  1 
ATOM   6041  C  CD  . GLN B  2  358 ? 42.245 95.330  64.785  1.00 64.97  ? 358  GLN B CD  1 
ATOM   6042  O  OE1 . GLN B  2  358 ? 42.457 96.469  65.242  1.00 66.51  ? 358  GLN B OE1 1 
ATOM   6043  N  NE2 . GLN B  2  358 ? 42.777 94.897  63.638  1.00 65.20  ? 358  GLN B NE2 1 
ATOM   6044  N  N   . ALA B  2  359 ? 42.933 91.416  68.190  1.00 36.97  ? 359  ALA B N   1 
ATOM   6045  C  CA  . ALA B  2  359 ? 42.752 91.001  69.568  1.00 35.70  ? 359  ALA B CA  1 
ATOM   6046  C  C   . ALA B  2  359 ? 44.036 91.250  70.324  1.00 34.56  ? 359  ALA B C   1 
ATOM   6047  O  O   . ALA B  2  359 ? 44.007 91.728  71.453  1.00 34.47  ? 359  ALA B O   1 
ATOM   6048  C  CB  . ALA B  2  359 ? 42.362 89.525  69.651  1.00 35.44  ? 359  ALA B CB  1 
ATOM   6049  N  N   . ALA B  2  360 ? 45.168 90.958  69.691  1.00 33.74  ? 360  ALA B N   1 
ATOM   6050  C  CA  . ALA B  2  360 ? 46.449 91.162  70.348  1.00 33.88  ? 360  ALA B CA  1 
ATOM   6051  C  C   . ALA B  2  360 ? 46.643 92.661  70.628  1.00 33.99  ? 360  ALA B C   1 
ATOM   6052  O  O   . ALA B  2  360 ? 46.959 93.040  71.737  1.00 33.63  ? 360  ALA B O   1 
ATOM   6053  C  CB  . ALA B  2  360 ? 47.560 90.617  69.530  1.00 33.67  ? 360  ALA B CB  1 
ATOM   6054  N  N   . LYS B  2  361 ? 46.347 93.497  69.632  1.00 34.46  ? 361  LYS B N   1 
ATOM   6055  C  CA  . LYS B  2  361 ? 46.434 94.944  69.802  1.00 34.72  ? 361  LYS B CA  1 
ATOM   6056  C  C   . LYS B  2  361 ? 45.587 95.384  70.977  1.00 35.48  ? 361  LYS B C   1 
ATOM   6057  O  O   . LYS B  2  361 ? 46.034 96.180  71.788  1.00 35.78  ? 361  LYS B O   1 
ATOM   6058  C  CB  . LYS B  2  361 ? 45.997 95.684  68.550  1.00 34.13  ? 361  LYS B CB  1 
ATOM   6059  C  CG  . LYS B  2  361 ? 47.063 95.807  67.457  1.00 23.93  ? 361  LYS B CG  1 
ATOM   6060  C  CD  . LYS B  2  361 ? 46.509 96.716  66.349  1.00 39.82  ? 361  LYS B CD  1 
ATOM   6061  C  CE  . LYS B  2  361 ? 47.491 96.990  65.267  1.00 37.30  ? 361  LYS B CE  1 
ATOM   6062  N  NZ  . LYS B  2  361 ? 48.152 95.763  64.819  1.00 38.67  ? 361  LYS B NZ  1 
ATOM   6063  N  N   . ASN B  2  362 ? 44.391 94.822  71.111  1.00 35.54  ? 362  ASN B N   1 
ATOM   6064  C  CA  . ASN B  2  362 ? 43.535 95.206  72.218  1.00 35.98  ? 362  ASN B CA  1 
ATOM   6065  C  C   . ASN B  2  362 ? 44.055 94.733  73.537  1.00 36.37  ? 362  ASN B C   1 
ATOM   6066  O  O   . ASN B  2  362 ? 43.834 95.393  74.564  1.00 37.31  ? 362  ASN B O   1 
ATOM   6067  C  CB  . ASN B  2  362 ? 42.130 94.683  72.055  1.00 36.29  ? 362  ASN B CB  1 
ATOM   6068  C  CG  . ASN B  2  362 ? 41.428 95.277  70.905  1.00 36.87  ? 362  ASN B CG  1 
ATOM   6069  O  OD1 . ASN B  2  362 ? 40.441 94.730  70.447  1.00 35.71  ? 362  ASN B OD1 1 
ATOM   6070  N  ND2 . ASN B  2  362 ? 41.932 96.409  70.401  1.00 32.57  ? 362  ASN B ND2 1 
ATOM   6071  N  N   . LYS B  2  363 ? 44.721 93.578  73.546  1.00 35.44  ? 363  LYS B N   1 
ATOM   6072  C  CA  . LYS B  2  363 ? 45.250 93.075  74.786  1.00 35.12  ? 363  LYS B CA  1 
ATOM   6073  C  C   . LYS B  2  363 ? 46.418 93.938  75.215  1.00 35.09  ? 363  LYS B C   1 
ATOM   6074  O  O   . LYS B  2  363 ? 46.477 94.391  76.366  1.00 35.33  ? 363  LYS B O   1 
ATOM   6075  C  CB  . LYS B  2  363 ? 45.580 91.573  74.709  1.00 35.68  ? 363  LYS B CB  1 
ATOM   6076  C  CG  . LYS B  2  363 ? 44.292 90.656  74.625  1.00 38.18  ? 363  LYS B CG  1 
ATOM   6077  C  CD  . LYS B  2  363 ? 44.569 89.157  74.889  1.00 35.28  ? 363  LYS B CD  1 
ATOM   6078  C  CE  . LYS B  2  363 ? 44.589 88.313  73.637  1.00 41.48  ? 363  LYS B CE  1 
ATOM   6079  N  NZ  . LYS B  2  363 ? 45.090 86.939  73.950  1.00 47.42  ? 363  LYS B NZ  1 
ATOM   6080  N  N   . LEU B  2  364 ? 47.275 94.278  74.253  1.00 34.85  ? 364  LEU B N   1 
ATOM   6081  C  CA  . LEU B  2  364 ? 48.437 95.159  74.495  1.00 34.38  ? 364  LEU B CA  1 
ATOM   6082  C  C   . LEU B  2  364 ? 48.071 96.579  74.939  1.00 33.76  ? 364  LEU B C   1 
ATOM   6083  O  O   . LEU B  2  364 ? 48.688 97.132  75.843  1.00 33.08  ? 364  LEU B O   1 
ATOM   6084  C  CB  . LEU B  2  364 ? 49.273 95.253  73.253  1.00 34.57  ? 364  LEU B CB  1 
ATOM   6085  C  CG  . LEU B  2  364 ? 50.483 96.157  73.310  1.00 32.36  ? 364  LEU B CG  1 
ATOM   6086  C  CD1 . LEU B  2  364 ? 51.409 95.728  74.434  1.00 21.77  ? 364  LEU B CD1 1 
ATOM   6087  C  CD2 . LEU B  2  364 ? 51.170 96.050  71.991  1.00 42.46  ? 364  LEU B CD2 1 
ATOM   6088  N  N   . LYS B  2  365 ? 47.077 97.161  74.293  1.00 34.06  ? 365  LYS B N   1 
ATOM   6089  C  CA  . LYS B  2  365 ? 46.667 98.512  74.628  1.00 34.16  ? 365  LYS B CA  1 
ATOM   6090  C  C   . LYS B  2  365 ? 45.966 98.545  75.975  1.00 34.43  ? 365  LYS B C   1 
ATOM   6091  O  O   . LYS B  2  365 ? 46.301 99.360  76.839  1.00 34.97  ? 365  LYS B O   1 
ATOM   6092  C  CB  . LYS B  2  365 ? 45.759 99.099  73.553  1.00 34.02  ? 365  LYS B CB  1 
ATOM   6093  C  CG  . LYS B  2  365 ? 46.379 99.214  72.155  1.00 28.20  ? 365  LYS B CG  1 
ATOM   6094  C  CD  . LYS B  2  365 ? 45.472 100.054 71.282  1.00 36.66  ? 365  LYS B CD  1 
ATOM   6095  C  CE  . LYS B  2  365 ? 45.139 99.388  69.985  1.00 36.32  ? 365  LYS B CE  1 
ATOM   6096  N  NZ  . LYS B  2  365 ? 43.991 100.092 69.304  1.00 27.16  ? 365  LYS B NZ  1 
ATOM   6097  N  N   . ALA B  2  366 ? 45.019 97.643  76.185  1.00 34.03  ? 366  ALA B N   1 
ATOM   6098  C  CA  . ALA B  2  366 ? 44.314 97.648  77.443  1.00 33.62  ? 366  ALA B CA  1 
ATOM   6099  C  C   . ALA B  2  366 ? 45.304 97.515  78.598  1.00 33.31  ? 366  ALA B C   1 
ATOM   6100  O  O   . ALA B  2  366 ? 45.234 98.265  79.558  1.00 33.42  ? 366  ALA B O   1 
ATOM   6101  C  CB  . ALA B  2  366 ? 43.285 96.574  77.483  1.00 33.56  ? 366  ALA B CB  1 
ATOM   6102  N  N   . GLY B  2  367 ? 46.294 96.637  78.430  1.00 32.87  ? 367  GLY B N   1 
ATOM   6103  C  CA  . GLY B  2  367 ? 47.300 96.387  79.448  1.00 32.77  ? 367  GLY B CA  1 
ATOM   6104  C  C   . GLY B  2  367 ? 48.262 97.543  79.746  1.00 32.82  ? 367  GLY B C   1 
ATOM   6105  O  O   . GLY B  2  367 ? 48.649 97.747  80.904  1.00 32.75  ? 367  GLY B O   1 
ATOM   6106  N  N   . TYR B  2  368 ? 48.659 98.277  78.711  1.00 32.20  ? 368  TYR B N   1 
ATOM   6107  C  CA  . TYR B  2  368 ? 49.524 99.391  78.901  1.00 31.98  ? 368  TYR B CA  1 
ATOM   6108  C  C   . TYR B  2  368 ? 48.782 100.466 79.674  1.00 32.78  ? 368  TYR B C   1 
ATOM   6109  O  O   . TYR B  2  368 ? 49.316 101.063 80.627  1.00 33.17  ? 368  TYR B O   1 
ATOM   6110  C  CB  . TYR B  2  368 ? 49.975 99.957  77.576  1.00 31.54  ? 368  TYR B CB  1 
ATOM   6111  C  CG  . TYR B  2  368 ? 50.799 101.233 77.722  1.00 32.64  ? 368  TYR B CG  1 
ATOM   6112  C  CD1 . TYR B  2  368 ? 52.073 101.201 78.279  1.00 30.59  ? 368  TYR B CD1 1 
ATOM   6113  C  CD2 . TYR B  2  368 ? 50.291 102.459 77.332  1.00 24.13  ? 368  TYR B CD2 1 
ATOM   6114  C  CE1 . TYR B  2  368 ? 52.826 102.366 78.439  1.00 33.40  ? 368  TYR B CE1 1 
ATOM   6115  C  CE2 . TYR B  2  368 ? 51.040 103.628 77.489  1.00 31.80  ? 368  TYR B CE2 1 
ATOM   6116  C  CZ  . TYR B  2  368 ? 52.308 103.563 78.051  1.00 31.09  ? 368  TYR B CZ  1 
ATOM   6117  O  OH  . TYR B  2  368 ? 53.058 104.692 78.174  1.00 32.48  ? 368  TYR B OH  1 
ATOM   6118  N  N   . LEU B  2  369 ? 47.559 100.735 79.263  1.00 32.83  ? 369  LEU B N   1 
ATOM   6119  C  CA  . LEU B  2  369 ? 46.779 101.723 79.937  1.00 32.63  ? 369  LEU B CA  1 
ATOM   6120  C  C   . LEU B  2  369 ? 46.592 101.285 81.366  1.00 33.52  ? 369  LEU B C   1 
ATOM   6121  O  O   . LEU B  2  369 ? 46.685 102.080 82.272  1.00 34.54  ? 369  LEU B O   1 
ATOM   6122  C  CB  . LEU B  2  369 ? 45.456 101.929 79.245  1.00 31.94  ? 369  LEU B CB  1 
ATOM   6123  C  CG  . LEU B  2  369 ? 45.549 102.727 77.956  1.00 27.74  ? 369  LEU B CG  1 
ATOM   6124  C  CD1 . LEU B  2  369 ? 44.235 102.821 77.329  1.00 22.20  ? 369  LEU B CD1 1 
ATOM   6125  C  CD2 . LEU B  2  369 ? 46.094 104.124 78.203  1.00 27.85  ? 369  LEU B CD2 1 
ATOM   6126  N  N   . MET B  2  370 ? 46.430 99.992  81.573  1.00 33.58  ? 370  MET B N   1 
ATOM   6127  C  CA  . MET B  2  370 ? 46.281 99.471  82.917  1.00 33.41  ? 370  MET B CA  1 
ATOM   6128  C  C   . MET B  2  370 ? 47.584 99.609  83.740  1.00 33.69  ? 370  MET B C   1 
ATOM   6129  O  O   . MET B  2  370 ? 47.556 99.884  84.931  1.00 33.67  ? 370  MET B O   1 
ATOM   6130  C  CB  . MET B  2  370 ? 45.775 98.042  82.874  1.00 32.60  ? 370  MET B CB  1 
ATOM   6131  C  CG  . MET B  2  370 ? 44.285 97.971  82.951  1.00 28.63  ? 370  MET B CG  1 
ATOM   6132  S  SD  . MET B  2  370 ? 43.471 96.593  82.060  1.00 41.46  ? 370  MET B SD  1 
ATOM   6133  C  CE  . MET B  2  370 ? 44.386 95.423  82.561  1.00 29.03  ? 370  MET B CE  1 
ATOM   6134  N  N   . SER B  2  371 ? 48.707 99.511  83.054  1.00 33.82  ? 371  SER B N   1 
ATOM   6135  C  CA  . SER B  2  371 ? 50.007 99.617  83.654  1.00 33.69  ? 371  SER B CA  1 
ATOM   6136  C  C   . SER B  2  371 ? 50.289 101.032 84.261  1.00 34.33  ? 371  SER B C   1 
ATOM   6137  O  O   . SER B  2  371 ? 51.082 101.165 85.215  1.00 35.15  ? 371  SER B O   1 
ATOM   6138  C  CB  . SER B  2  371 ? 51.051 99.294  82.603  1.00 33.11  ? 371  SER B CB  1 
ATOM   6139  O  OG  . SER B  2  371 ? 52.265 98.987  83.187  1.00 52.17  ? 371  SER B OG  1 
ATOM   6140  N  N   . VAL B  2  372 ? 49.670 102.074 83.719  1.00 33.47  ? 372  VAL B N   1 
ATOM   6141  C  CA  . VAL B  2  372 ? 49.916 103.394 84.264  1.00 33.50  ? 372  VAL B CA  1 
ATOM   6142  C  C   . VAL B  2  372 ? 48.725 103.991 85.001  1.00 33.88  ? 372  VAL B C   1 
ATOM   6143  O  O   . VAL B  2  372 ? 48.597 105.219 85.121  1.00 34.12  ? 372  VAL B O   1 
ATOM   6144  C  CB  . VAL B  2  372 ? 50.419 104.344 83.217  1.00 33.41  ? 372  VAL B CB  1 
ATOM   6145  C  CG1 . VAL B  2  372 ? 51.805 103.940 82.799  1.00 29.45  ? 372  VAL B CG1 1 
ATOM   6146  C  CG2 . VAL B  2  372 ? 49.454 104.380 82.005  1.00 19.29  ? 372  VAL B CG2 1 
ATOM   6147  N  N   . GLU B  2  373 ? 47.876 103.113 85.511  1.00 33.81  ? 373  GLU B N   1 
ATOM   6148  C  CA  . GLU B  2  373 ? 46.672 103.471 86.237  1.00 33.84  ? 373  GLU B CA  1 
ATOM   6149  C  C   . GLU B  2  373 ? 47.002 104.091 87.568  1.00 34.36  ? 373  GLU B C   1 
ATOM   6150  O  O   . GLU B  2  373 ? 46.337 105.029 88.024  1.00 34.67  ? 373  GLU B O   1 
ATOM   6151  C  CB  . GLU B  2  373 ? 45.928 102.203 86.520  1.00 34.03  ? 373  GLU B CB  1 
ATOM   6152  C  CG  . GLU B  2  373 ? 44.438 102.309 86.553  1.00 39.41  ? 373  GLU B CG  1 
ATOM   6153  C  CD  . GLU B  2  373 ? 43.802 101.075 86.010  1.00 33.23  ? 373  GLU B CD  1 
ATOM   6154  O  OE1 . GLU B  2  373 ? 42.604 101.033 85.888  1.00 53.86  ? 373  GLU B OE1 1 
ATOM   6155  O  OE2 . GLU B  2  373 ? 44.521 100.153 85.680  1.00 52.35  ? 373  GLU B OE2 1 
ATOM   6156  N  N   . SER B  2  374 ? 48.030 103.555 88.197  1.00 34.64  ? 374  SER B N   1 
ATOM   6157  C  CA  . SER B  2  374 ? 48.444 103.984 89.504  1.00 35.26  ? 374  SER B CA  1 
ATOM   6158  C  C   . SER B  2  374 ? 49.674 104.825 89.455  1.00 36.58  ? 374  SER B C   1 
ATOM   6159  O  O   . SER B  2  374 ? 50.395 104.809 88.468  1.00 37.41  ? 374  SER B O   1 
ATOM   6160  C  CB  . SER B  2  374 ? 48.783 102.757 90.322  1.00 35.30  ? 374  SER B CB  1 
ATOM   6161  O  OG  . SER B  2  374 ? 49.832 102.010 89.704  1.00 34.74  ? 374  SER B OG  1 
ATOM   6162  N  N   . SER B  2  375 ? 49.970 105.471 90.584  1.00 37.22  ? 375  SER B N   1 
ATOM   6163  C  CA  . SER B  2  375 ? 51.160 106.296 90.766  1.00 37.88  ? 375  SER B CA  1 
ATOM   6164  C  C   . SER B  2  375 ? 52.445 105.507 90.513  1.00 38.94  ? 375  SER B C   1 
ATOM   6165  O  O   . SER B  2  375 ? 53.299 105.930 89.769  1.00 40.12  ? 375  SER B O   1 
ATOM   6166  C  CB  . SER B  2  375 ? 51.191 106.836 92.179  1.00 37.86  ? 375  SER B CB  1 
ATOM   6167  O  OG  . SER B  2  375 ? 50.036 107.579 92.453  1.00 39.48  ? 375  SER B OG  1 
ATOM   6168  N  N   . GLU B  2  376 ? 52.548 104.341 91.104  1.00 38.96  ? 376  GLU B N   1 
ATOM   6169  C  CA  . GLU B  2  376 ? 53.729 103.524 90.957  1.00 38.55  ? 376  GLU B CA  1 
ATOM   6170  C  C   . GLU B  2  376 ? 53.997 103.141 89.498  1.00 38.40  ? 376  GLU B C   1 
ATOM   6171  O  O   . GLU B  2  376 ? 55.131 103.203 89.027  1.00 38.98  ? 376  GLU B O   1 
ATOM   6172  C  CB  . GLU B  2  376 ? 53.598 102.273 91.818  1.00 38.34  ? 376  GLU B CB  1 
ATOM   6173  C  CG  . GLU B  2  376 ? 54.909 101.564 92.085  1.00 50.52  ? 376  GLU B CG  1 
ATOM   6174  C  CD  . GLU B  2  376 ? 54.764 100.346 92.998  1.00 53.62  ? 376  GLU B CD  1 
ATOM   6175  O  OE1 . GLU B  2  376 ? 54.616 100.520 94.248  1.00 54.65  ? 376  GLU B OE1 1 
ATOM   6176  O  OE2 . GLU B  2  376 ? 54.825 99.216  92.477  1.00 50.99  ? 376  GLU B OE2 1 
ATOM   6177  N  N   . GLY B  2  377 ? 52.956 102.784 88.777  1.00 37.79  ? 377  GLY B N   1 
ATOM   6178  C  CA  . GLY B  2  377 ? 53.134 102.356 87.410  1.00 37.78  ? 377  GLY B CA  1 
ATOM   6179  C  C   . GLY B  2  377 ? 53.386 103.517 86.471  1.00 37.93  ? 377  GLY B C   1 
ATOM   6180  O  O   . GLY B  2  377 ? 54.190 103.408 85.508  1.00 37.67  ? 377  GLY B O   1 
ATOM   6181  N  N   . PHE B  2  378 ? 52.711 104.643 86.753  1.00 37.22  ? 378  PHE B N   1 
ATOM   6182  C  CA  . PHE B  2  378 ? 52.871 105.812 85.969  1.00 36.52  ? 378  PHE B CA  1 
ATOM   6183  C  C   . PHE B  2  378 ? 54.270 106.348 86.117  1.00 36.42  ? 378  PHE B C   1 
ATOM   6184  O  O   . PHE B  2  378 ? 54.959 106.576 85.115  1.00 37.01  ? 378  PHE B O   1 
ATOM   6185  C  CB  . PHE B  2  378 ? 51.869 106.885 86.382  1.00 36.48  ? 378  PHE B CB  1 
ATOM   6186  C  CG  . PHE B  2  378 ? 51.984 108.148 85.589  1.00 23.93  ? 378  PHE B CG  1 
ATOM   6187  C  CD1 . PHE B  2  378 ? 51.527 108.199 84.289  1.00 21.27  ? 378  PHE B CD1 1 
ATOM   6188  C  CD2 . PHE B  2  378 ? 52.588 109.282 86.138  1.00 27.77  ? 378  PHE B CD2 1 
ATOM   6189  C  CE1 . PHE B  2  378 ? 51.644 109.387 83.518  1.00 24.39  ? 378  PHE B CE1 1 
ATOM   6190  C  CE2 . PHE B  2  378 ? 52.704 110.478 85.397  1.00 27.70  ? 378  PHE B CE2 1 
ATOM   6191  C  CZ  . PHE B  2  378 ? 52.230 110.526 84.085  1.00 29.61  ? 378  PHE B CZ  1 
ATOM   6192  N  N   . LEU B  2  379 ? 54.709 106.523 87.361  1.00 35.54  ? 379  LEU B N   1 
ATOM   6193  C  CA  . LEU B  2  379 ? 56.019 107.098 87.633  1.00 35.22  ? 379  LEU B CA  1 
ATOM   6194  C  C   . LEU B  2  379 ? 57.149 106.278 87.040  1.00 35.31  ? 379  LEU B C   1 
ATOM   6195  O  O   . LEU B  2  379 ? 58.135 106.814 86.553  1.00 35.84  ? 379  LEU B O   1 
ATOM   6196  C  CB  . LEU B  2  379 ? 56.241 107.280 89.130  1.00 35.18  ? 379  LEU B CB  1 
ATOM   6197  C  CG  . LEU B  2  379 ? 57.408 108.180 89.521  1.00 30.49  ? 379  LEU B CG  1 
ATOM   6198  C  CD1 . LEU B  2  379 ? 56.908 109.535 89.835  1.00 29.45  ? 379  LEU B CD1 1 
ATOM   6199  C  CD2 . LEU B  2  379 ? 58.124 107.626 90.691  1.00 25.26  ? 379  LEU B CD2 1 
ATOM   6200  N  N   . ASP B  2  380 ? 57.009 104.981 87.065  1.00 34.70  ? 380  ASP B N   1 
ATOM   6201  C  CA  . ASP B  2  380 ? 58.038 104.154 86.514  1.00 34.37  ? 380  ASP B CA  1 
ATOM   6202  C  C   . ASP B  2  380 ? 58.091 104.292 84.967  1.00 33.48  ? 380  ASP B C   1 
ATOM   6203  O  O   . ASP B  2  380 ? 59.140 104.272 84.381  1.00 33.34  ? 380  ASP B O   1 
ATOM   6204  C  CB  . ASP B  2  380 ? 57.830 102.696 86.970  1.00 34.92  ? 380  ASP B CB  1 
ATOM   6205  C  CG  . ASP B  2  380 ? 58.749 101.706 86.249  1.00 55.39  ? 380  ASP B CG  1 
ATOM   6206  O  OD1 . ASP B  2  380 ? 58.275 100.596 85.935  1.00 66.82  ? 380  ASP B OD1 1 
ATOM   6207  O  OD2 . ASP B  2  380 ? 59.957 101.935 85.966  1.00 64.72  ? 380  ASP B OD2 1 
ATOM   6208  N  N   . GLU B  2  381 ? 56.940 104.461 84.344  1.00 33.33  ? 381  GLU B N   1 
ATOM   6209  C  CA  . GLU B  2  381 ? 56.867 104.578 82.918  1.00 33.61  ? 381  GLU B CA  1 
ATOM   6210  C  C   . GLU B  2  381 ? 57.439 105.925 82.486  1.00 34.93  ? 381  GLU B C   1 
ATOM   6211  O  O   . GLU B  2  381 ? 58.161 106.009 81.505  1.00 35.88  ? 381  GLU B O   1 
ATOM   6212  C  CB  . GLU B  2  381 ? 55.408 104.416 82.457  1.00 33.57  ? 381  GLU B CB  1 
ATOM   6213  C  CG  . GLU B  2  381 ? 55.121 104.774 80.999  1.00 38.02  ? 381  GLU B CG  1 
ATOM   6214  C  CD  . GLU B  2  381 ? 55.695 103.766 80.032  1.00 42.65  ? 381  GLU B CD  1 
ATOM   6215  O  OE1 . GLU B  2  381 ? 55.788 104.060 78.833  1.00 53.25  ? 381  GLU B OE1 1 
ATOM   6216  O  OE2 . GLU B  2  381 ? 56.026 102.668 80.464  1.00 33.09  ? 381  GLU B OE2 1 
ATOM   6217  N  N   . VAL B  2  382 ? 57.147 106.973 83.244  1.00 34.67  ? 382  VAL B N   1 
ATOM   6218  C  CA  . VAL B  2  382 ? 57.682 108.261 82.919  1.00 34.54  ? 382  VAL B CA  1 
ATOM   6219  C  C   . VAL B  2  382 ? 59.185 108.272 83.110  1.00 34.99  ? 382  VAL B C   1 
ATOM   6220  O  O   . VAL B  2  382 ? 59.904 108.735 82.248  1.00 36.14  ? 382  VAL B O   1 
ATOM   6221  C  CB  . VAL B  2  382 ? 57.004 109.386 83.708  1.00 34.21  ? 382  VAL B CB  1 
ATOM   6222  C  CG1 . VAL B  2  382 ? 57.641 110.707 83.404  1.00 22.27  ? 382  VAL B CG1 1 
ATOM   6223  C  CG2 . VAL B  2  382 ? 55.549 109.443 83.355  1.00 29.50  ? 382  VAL B CG2 1 
ATOM   6224  N  N   . GLY B  2  383 ? 59.658 107.735 84.224  1.00 34.35  ? 383  GLY B N   1 
ATOM   6225  C  CA  . GLY B  2  383 ? 61.086 107.661 84.478  1.00 34.62  ? 383  GLY B CA  1 
ATOM   6226  C  C   . GLY B  2  383 ? 61.859 106.861 83.408  1.00 35.30  ? 383  GLY B C   1 
ATOM   6227  O  O   . GLY B  2  383 ? 62.867 107.328 82.864  1.00 36.34  ? 383  GLY B O   1 
ATOM   6228  N  N   . SER B  2  384 ? 61.350 105.707 83.044  1.00 34.66  ? 384  SER B N   1 
ATOM   6229  C  CA  . SER B  2  384 ? 62.038 104.866 82.052  1.00 34.77  ? 384  SER B CA  1 
ATOM   6230  C  C   . SER B  2  384 ? 62.064 105.485 80.682  1.00 34.41  ? 384  SER B C   1 
ATOM   6231  O  O   . SER B  2  384 ? 63.015 105.310 79.929  1.00 34.22  ? 384  SER B O   1 
ATOM   6232  C  CB  . SER B  2  384 ? 61.391 103.492 81.978  1.00 34.63  ? 384  SER B CB  1 
ATOM   6233  O  OG  . SER B  2  384 ? 61.299 102.879 83.277  1.00 36.99  ? 384  SER B OG  1 
ATOM   6234  N  N   . GLN B  2  385 ? 60.993 106.211 80.362  1.00 34.03  ? 385  GLN B N   1 
ATOM   6235  C  CA  . GLN B  2  385 ? 60.861 106.882 79.093  1.00 32.34  ? 385  GLN B CA  1 
ATOM   6236  C  C   . GLN B  2  385 ? 61.840 107.990 79.033  1.00 32.29  ? 385  GLN B C   1 
ATOM   6237  O  O   . GLN B  2  385 ? 62.462 108.199 78.024  1.00 32.47  ? 385  GLN B O   1 
ATOM   6238  C  CB  . GLN B  2  385 ? 59.467 107.450 78.936  1.00 31.46  ? 385  GLN B CB  1 
ATOM   6239  C  CG  . GLN B  2  385 ? 58.520 106.564 78.224  1.00 27.58  ? 385  GLN B CG  1 
ATOM   6240  C  CD  . GLN B  2  385 ? 57.309 107.328 77.721  1.00 42.16  ? 385  GLN B CD  1 
ATOM   6241  O  OE1 . GLN B  2  385 ? 56.165 106.955 78.014  1.00 40.86  ? 385  GLN B OE1 1 
ATOM   6242  N  NE2 . GLN B  2  385 ? 57.555 108.413 76.950  1.00 41.70  ? 385  GLN B NE2 1 
ATOM   6243  N  N   . ALA B  2  386 ? 62.009 108.687 80.143  1.00 32.18  ? 386  ALA B N   1 
ATOM   6244  C  CA  . ALA B  2  386 ? 62.912 109.813 80.181  1.00 32.52  ? 386  ALA B CA  1 
ATOM   6245  C  C   . ALA B  2  386 ? 64.329 109.348 79.872  1.00 32.91  ? 386  ALA B C   1 
ATOM   6246  O  O   . ALA B  2  386 ? 65.070 110.009 79.113  1.00 33.21  ? 386  ALA B O   1 
ATOM   6247  C  CB  . ALA B  2  386 ? 62.853 110.460 81.495  1.00 32.50  ? 386  ALA B CB  1 
ATOM   6248  N  N   . LEU B  2  387 ? 64.687 108.189 80.417  1.00 32.39  ? 387  LEU B N   1 
ATOM   6249  C  CA  . LEU B  2  387 ? 66.003 107.610 80.216  1.00 32.69  ? 387  LEU B CA  1 
ATOM   6250  C  C   . LEU B  2  387 ? 66.228 107.056 78.839  1.00 33.07  ? 387  LEU B C   1 
ATOM   6251  O  O   . LEU B  2  387 ? 67.220 107.350 78.208  1.00 32.66  ? 387  LEU B O   1 
ATOM   6252  C  CB  . LEU B  2  387 ? 66.250 106.516 81.241  1.00 33.33  ? 387  LEU B CB  1 
ATOM   6253  C  CG  . LEU B  2  387 ? 67.210 106.860 82.363  1.00 38.26  ? 387  LEU B CG  1 
ATOM   6254  C  CD1 . LEU B  2  387 ? 67.426 108.383 82.555  1.00 31.82  ? 387  LEU B CD1 1 
ATOM   6255  C  CD2 . LEU B  2  387 ? 66.836 106.177 83.623  1.00 29.79  ? 387  LEU B CD2 1 
ATOM   6256  N  N   . ALA B  2  388 ? 65.321 106.200 78.397  1.00 34.29  ? 388  ALA B N   1 
ATOM   6257  C  CA  . ALA B  2  388 ? 65.424 105.584 77.080  1.00 35.25  ? 388  ALA B CA  1 
ATOM   6258  C  C   . ALA B  2  388 ? 65.277 106.576 75.909  1.00 36.60  ? 388  ALA B C   1 
ATOM   6259  O  O   . ALA B  2  388 ? 66.101 106.578 74.971  1.00 36.97  ? 388  ALA B O   1 
ATOM   6260  C  CB  . ALA B  2  388 ? 64.414 104.530 76.954  1.00 34.90  ? 388  ALA B CB  1 
ATOM   6261  N  N   . ALA B  2  389 ? 64.227 107.421 75.971  1.00 36.68  ? 389  ALA B N   1 
ATOM   6262  C  CA  . ALA B  2  389 ? 63.894 108.340 74.868  1.00 35.77  ? 389  ALA B CA  1 
ATOM   6263  C  C   . ALA B  2  389 ? 64.217 109.799 75.072  1.00 35.91  ? 389  ALA B C   1 
ATOM   6264  O  O   . ALA B  2  389 ? 64.373 110.526 74.101  1.00 36.33  ? 389  ALA B O   1 
ATOM   6265  C  CB  . ALA B  2  389 ? 62.433 108.197 74.489  1.00 34.73  ? 389  ALA B CB  1 
ATOM   6266  N  N   . GLY B  2  390 ? 64.246 110.251 76.319  1.00 35.60  ? 390  GLY B N   1 
ATOM   6267  C  CA  . GLY B  2  390 ? 64.475 111.673 76.599  1.00 35.44  ? 390  GLY B CA  1 
ATOM   6268  C  C   . GLY B  2  390 ? 63.220 112.451 76.320  1.00 34.99  ? 390  GLY B C   1 
ATOM   6269  O  O   . GLY B  2  390 ? 63.256 113.647 76.126  1.00 35.02  ? 390  GLY B O   1 
ATOM   6270  N  N   . SER B  2  391 ? 62.098 111.739 76.299  1.00 34.97  ? 391  SER B N   1 
ATOM   6271  C  CA  . SER B  2  391 ? 60.798 112.320 75.985  1.00 35.04  ? 391  SER B CA  1 
ATOM   6272  C  C   . SER B  2  391 ? 59.731 111.761 76.845  1.00 34.34  ? 391  SER B C   1 
ATOM   6273  O  O   . SER B  2  391 ? 59.959 110.823 77.619  1.00 34.69  ? 391  SER B O   1 
ATOM   6274  C  CB  . SER B  2  391 ? 60.414 111.949 74.558  1.00 34.92  ? 391  SER B CB  1 
ATOM   6275  O  OG  . SER B  2  391 ? 60.972 112.853 73.666  1.00 60.76  ? 391  SER B OG  1 
ATOM   6276  N  N   . TYR B  2  392 ? 58.540 112.322 76.692  1.00 33.10  ? 392  TYR B N   1 
ATOM   6277  C  CA  . TYR B  2  392 ? 57.365 111.770 77.312  1.00 31.99  ? 392  TYR B CA  1 
ATOM   6278  C  C   . TYR B  2  392 ? 56.321 111.574 76.226  1.00 31.41  ? 392  TYR B C   1 
ATOM   6279  O  O   . TYR B  2  392 ? 55.849 112.529 75.620  1.00 30.77  ? 392  TYR B O   1 
ATOM   6280  C  CB  . TYR B  2  392 ? 56.808 112.596 78.467  1.00 31.41  ? 392  TYR B CB  1 
ATOM   6281  C  CG  . TYR B  2  392 ? 55.451 112.058 78.907  1.00 27.91  ? 392  TYR B CG  1 
ATOM   6282  C  CD1 . TYR B  2  392 ? 54.300 112.780 78.679  1.00 19.85  ? 392  TYR B CD1 1 
ATOM   6283  C  CD2 . TYR B  2  392 ? 55.321 110.765 79.450  1.00 36.25  ? 392  TYR B CD2 1 
ATOM   6284  C  CE1 . TYR B  2  392 ? 53.053 112.290 79.022  1.00 30.70  ? 392  TYR B CE1 1 
ATOM   6285  C  CE2 . TYR B  2  392 ? 54.054 110.253 79.798  1.00 36.09  ? 392  TYR B CE2 1 
ATOM   6286  C  CZ  . TYR B  2  392 ? 52.925 111.043 79.577  1.00 34.86  ? 392  TYR B CZ  1 
ATOM   6287  O  OH  . TYR B  2  392 ? 51.663 110.603 79.908  1.00 39.04  ? 392  TYR B OH  1 
ATOM   6288  N  N   . THR B  2  393 ? 55.948 110.328 76.003  1.00 31.62  ? 393  THR B N   1 
ATOM   6289  C  CA  . THR B  2  393 ? 54.988 110.015 74.985  1.00 31.95  ? 393  THR B CA  1 
ATOM   6290  C  C   . THR B  2  393 ? 53.658 109.716 75.624  1.00 32.62  ? 393  THR B C   1 
ATOM   6291  O  O   . THR B  2  393 ? 53.536 108.771 76.360  1.00 33.08  ? 393  THR B O   1 
ATOM   6292  C  CB  . THR B  2  393 ? 55.485 108.829 74.178  1.00 31.79  ? 393  THR B CB  1 
ATOM   6293  O  OG1 . THR B  2  393 ? 56.821 109.089 73.744  1.00 23.76  ? 393  THR B OG1 1 
ATOM   6294  C  CG2 . THR B  2  393 ? 54.712 108.679 72.891  1.00 19.88  ? 393  THR B CG2 1 
ATOM   6295  N  N   . PRO B  2  394 ? 52.659 110.539 75.334  1.00 33.03  ? 394  PRO B N   1 
ATOM   6296  C  CA  . PRO B  2  394 ? 51.314 110.379 75.911  1.00 33.53  ? 394  PRO B CA  1 
ATOM   6297  C  C   . PRO B  2  394 ? 50.681 109.053 75.522  1.00 34.69  ? 394  PRO B C   1 
ATOM   6298  O  O   . PRO B  2  394 ? 51.000 108.542 74.450  1.00 35.43  ? 394  PRO B O   1 
ATOM   6299  C  CB  . PRO B  2  394 ? 50.515 111.529 75.265  1.00 32.94  ? 394  PRO B CB  1 
ATOM   6300  C  CG  . PRO B  2  394 ? 51.487 112.456 74.754  1.00 19.89  ? 394  PRO B CG  1 
ATOM   6301  C  CD  . PRO B  2  394 ? 52.745 111.706 74.445  1.00 32.87  ? 394  PRO B CD  1 
ATOM   6302  N  N   . PRO B  2  395 ? 49.786 108.515 76.365  1.00 35.00  ? 395  PRO B N   1 
ATOM   6303  C  CA  . PRO B  2  395 ? 49.081 107.260 76.067  1.00 34.21  ? 395  PRO B CA  1 
ATOM   6304  C  C   . PRO B  2  395 ? 48.434 107.237 74.660  1.00 33.76  ? 395  PRO B C   1 
ATOM   6305  O  O   . PRO B  2  395 ? 48.415 106.163 74.033  1.00 34.62  ? 395  PRO B O   1 
ATOM   6306  C  CB  . PRO B  2  395 ? 47.973 107.237 77.119  1.00 33.74  ? 395  PRO B CB  1 
ATOM   6307  C  CG  . PRO B  2  395 ? 48.493 108.007 78.229  1.00 32.54  ? 395  PRO B CG  1 
ATOM   6308  C  CD  . PRO B  2  395 ? 49.373 109.072 77.668  1.00 35.24  ? 395  PRO B CD  1 
ATOM   6309  N  N   . SER B  2  396 ? 47.967 108.393 74.166  1.00 31.99  ? 396  SER B N   1 
ATOM   6310  C  CA  . SER B  2  396 ? 47.280 108.467 72.851  1.00 30.63  ? 396  SER B CA  1 
ATOM   6311  C  C   . SER B  2  396 ? 48.198 108.081 71.741  1.00 29.33  ? 396  SER B C   1 
ATOM   6312  O  O   . SER B  2  396 ? 47.801 107.388 70.796  1.00 28.86  ? 396  SER B O   1 
ATOM   6313  C  CB  . SER B  2  396 ? 46.736 109.902 72.550  1.00 30.29  ? 396  SER B CB  1 
ATOM   6314  O  OG  . SER B  2  396 ? 46.774 110.731 73.694  1.00 37.89  ? 396  SER B OG  1 
ATOM   6315  N  N   . THR B  2  397 ? 49.431 108.539 71.827  1.00 28.64  ? 397  THR B N   1 
ATOM   6316  C  CA  . THR B  2  397 ? 50.349 108.259 70.772  1.00 28.68  ? 397  THR B CA  1 
ATOM   6317  C  C   . THR B  2  397 ? 50.967 106.929 70.843  1.00 28.45  ? 397  THR B C   1 
ATOM   6318  O  O   . THR B  2  397 ? 51.391 106.390 69.826  1.00 27.89  ? 397  THR B O   1 
ATOM   6319  C  CB  . THR B  2  397 ? 51.325 109.416 70.516  1.00 29.09  ? 397  THR B CB  1 
ATOM   6320  O  OG1 . THR B  2  397 ? 52.687 108.953 70.548  1.00 31.35  ? 397  THR B OG1 1 
ATOM   6321  C  CG2 . THR B  2  397 ? 51.242 110.377 71.601  1.00 29.29  ? 397  THR B CG2 1 
ATOM   6322  N  N   . VAL B  2  398 ? 51.006 106.366 72.051  1.00 28.87  ? 398  VAL B N   1 
ATOM   6323  C  CA  . VAL B  2  398 ? 51.470 105.020 72.209  1.00 29.21  ? 398  VAL B CA  1 
ATOM   6324  C  C   . VAL B  2  398 ? 50.419 104.125 71.572  1.00 29.80  ? 398  VAL B C   1 
ATOM   6325  O  O   . VAL B  2  398 ? 50.751 103.217 70.842  1.00 30.02  ? 398  VAL B O   1 
ATOM   6326  C  CB  . VAL B  2  398 ? 51.635 104.638 73.665  1.00 29.40  ? 398  VAL B CB  1 
ATOM   6327  C  CG1 . VAL B  2  398 ? 51.653 103.113 73.814  1.00 20.23  ? 398  VAL B CG1 1 
ATOM   6328  C  CG2 . VAL B  2  398 ? 52.898 105.223 74.210  1.00 28.20  ? 398  VAL B CG2 1 
ATOM   6329  N  N   . LEU B  2  399 ? 49.134 104.439 71.809  1.00 30.33  ? 399  LEU B N   1 
ATOM   6330  C  CA  . LEU B  2  399 ? 48.049 103.668 71.226  1.00 31.21  ? 399  LEU B CA  1 
ATOM   6331  C  C   . LEU B  2  399 ? 48.105 103.803 69.716  1.00 31.92  ? 399  LEU B C   1 
ATOM   6332  O  O   . LEU B  2  399 ? 47.832 102.843 68.980  1.00 32.67  ? 399  LEU B O   1 
ATOM   6333  C  CB  . LEU B  2  399 ? 46.694 104.134 71.740  1.00 31.50  ? 399  LEU B CB  1 
ATOM   6334  C  CG  . LEU B  2  399 ? 46.358 103.864 73.212  1.00 40.37  ? 399  LEU B CG  1 
ATOM   6335  C  CD1 . LEU B  2  399 ? 44.853 103.818 73.414  1.00 36.36  ? 399  LEU B CD1 1 
ATOM   6336  C  CD2 . LEU B  2  399 ? 47.012 102.589 73.718  1.00 24.60  ? 399  LEU B CD2 1 
ATOM   6337  N  N   . GLN B  2  400 ? 48.501 104.982 69.255  1.00 31.56  ? 400  GLN B N   1 
ATOM   6338  C  CA  . GLN B  2  400 ? 48.645 105.232 67.840  1.00 31.48  ? 400  GLN B CA  1 
ATOM   6339  C  C   . GLN B  2  400 ? 49.765 104.383 67.252  1.00 31.74  ? 400  GLN B C   1 
ATOM   6340  O  O   . GLN B  2  400 ? 49.594 103.782 66.185  1.00 31.91  ? 400  GLN B O   1 
ATOM   6341  C  CB  . GLN B  2  400 ? 48.937 106.699 67.611  1.00 31.18  ? 400  GLN B CB  1 
ATOM   6342  C  CG  . GLN B  2  400 ? 49.403 107.050 66.258  1.00 22.92  ? 400  GLN B CG  1 
ATOM   6343  C  CD  . GLN B  2  400 ? 49.354 108.561 66.014  1.00 34.49  ? 400  GLN B CD  1 
ATOM   6344  O  OE1 . GLN B  2  400 ? 48.283 109.174 66.085  1.00 28.66  ? 400  GLN B OE1 1 
ATOM   6345  N  NE2 . GLN B  2  400 ? 50.510 109.157 65.751  1.00 34.18  ? 400  GLN B NE2 1 
ATOM   6346  N  N   . GLN B  2  401 ? 50.886 104.302 67.976  1.00 31.73  ? 401  GLN B N   1 
ATOM   6347  C  CA  . GLN B  2  401 ? 52.080 103.540 67.529  1.00 32.23  ? 401  GLN B CA  1 
ATOM   6348  C  C   . GLN B  2  401 ? 51.799 102.050 67.409  1.00 31.80  ? 401  GLN B C   1 
ATOM   6349  O  O   . GLN B  2  401 ? 52.387 101.356 66.570  1.00 31.53  ? 401  GLN B O   1 
ATOM   6350  C  CB  . GLN B  2  401 ? 53.293 103.768 68.496  1.00 32.40  ? 401  GLN B CB  1 
ATOM   6351  C  CG  . GLN B  2  401 ? 53.985 105.158 68.351  1.00 45.21  ? 401  GLN B CG  1 
ATOM   6352  C  CD  . GLN B  2  401 ? 54.767 105.547 69.594  1.00 41.86  ? 401  GLN B CD  1 
ATOM   6353  O  OE1 . GLN B  2  401 ? 55.667 104.832 70.024  1.00 48.45  ? 401  GLN B OE1 1 
ATOM   6354  N  NE2 . GLN B  2  401 ? 54.384 106.629 70.196  1.00 48.77  ? 401  GLN B NE2 1 
ATOM   6355  N  N   . ILE B  2  402 ? 50.921 101.571 68.278  1.00 31.59  ? 402  ILE B N   1 
ATOM   6356  C  CA  . ILE B  2  402 ? 50.553 100.192 68.308  1.00 31.58  ? 402  ILE B CA  1 
ATOM   6357  C  C   . ILE B  2  402 ? 49.706 99.908  67.117  1.00 31.34  ? 402  ILE B C   1 
ATOM   6358  O  O   . ILE B  2  402 ? 49.890 98.907  66.445  1.00 31.64  ? 402  ILE B O   1 
ATOM   6359  C  CB  . ILE B  2  402 ? 49.785 99.885  69.604  1.00 31.64  ? 402  ILE B CB  1 
ATOM   6360  C  CG1 . ILE B  2  402 ? 50.745 99.819  70.756  1.00 25.96  ? 402  ILE B CG1 1 
ATOM   6361  C  CG2 . ILE B  2  402 ? 49.091 98.571  69.503  1.00 27.09  ? 402  ILE B CG2 1 
ATOM   6362  C  CD1 . ILE B  2  402 ? 50.120 100.015 72.023  1.00 36.97  ? 402  ILE B CD1 1 
ATOM   6363  N  N   . ASP B  2  403 ? 48.806 100.827 66.815  1.00 30.72  ? 403  ASP B N   1 
ATOM   6364  C  CA  . ASP B  2  403 ? 47.939 100.665 65.691  1.00 30.25  ? 403  ASP B CA  1 
ATOM   6365  C  C   . ASP B  2  403 ? 48.681 100.623 64.346  1.00 30.49  ? 403  ASP B C   1 
ATOM   6366  O  O   . ASP B  2  403 ? 48.272 99.899  63.439  1.00 31.36  ? 403  ASP B O   1 
ATOM   6367  C  CB  . ASP B  2  403 ? 46.848 101.708 65.705  1.00 30.25  ? 403  ASP B CB  1 
ATOM   6368  C  CG  . ASP B  2  403 ? 45.734 101.373 66.685  1.00 35.83  ? 403  ASP B CG  1 
ATOM   6369  O  OD1 . ASP B  2  403 ? 45.217 102.297 67.360  1.00 35.47  ? 403  ASP B OD1 1 
ATOM   6370  O  OD2 . ASP B  2  403 ? 45.282 100.211 66.817  1.00 48.90  ? 403  ASP B OD2 1 
ATOM   6371  N  N   . ALA B  2  404 ? 49.819 101.324 64.249  1.00 30.21  ? 404  ALA B N   1 
ATOM   6372  C  CA  . ALA B  2  404 ? 50.609 101.371 62.999  1.00 29.96  ? 404  ALA B CA  1 
ATOM   6373  C  C   . ALA B  2  404 ? 51.238 100.019 62.686  1.00 30.57  ? 404  ALA B C   1 
ATOM   6374  O  O   . ALA B  2  404 ? 51.598 99.748  61.535  1.00 31.61  ? 404  ALA B O   1 
ATOM   6375  C  CB  . ALA B  2  404 ? 51.682 102.457 63.055  1.00 29.34  ? 404  ALA B CB  1 
ATOM   6376  N  N   . VAL B  2  405 ? 51.398 99.188  63.705  1.00 29.50  ? 405  VAL B N   1 
ATOM   6377  C  CA  . VAL B  2  405 ? 51.887 97.863  63.498  1.00 29.13  ? 405  VAL B CA  1 
ATOM   6378  C  C   . VAL B  2  405 ? 50.905 97.059  62.557  1.00 29.24  ? 405  VAL B C   1 
ATOM   6379  O  O   . VAL B  2  405 ? 49.729 96.886  62.878  1.00 29.34  ? 405  VAL B O   1 
ATOM   6380  C  CB  . VAL B  2  405 ? 51.992 97.130  64.815  1.00 28.58  ? 405  VAL B CB  1 
ATOM   6381  C  CG1 . VAL B  2  405 ? 52.353 95.645  64.583  1.00 23.36  ? 405  VAL B CG1 1 
ATOM   6382  C  CG2 . VAL B  2  405 ? 52.983 97.782  65.656  1.00 23.01  ? 405  VAL B CG2 1 
ATOM   6383  N  N   . ALA B  2  406 ? 51.400 96.623  61.404  1.00 28.66  ? 406  ALA B N   1 
ATOM   6384  C  CA  . ALA B  2  406 ? 50.592 95.853  60.488  1.00 28.99  ? 406  ALA B CA  1 
ATOM   6385  C  C   . ALA B  2  406 ? 50.783 94.357  60.746  1.00 30.42  ? 406  ALA B C   1 
ATOM   6386  O  O   . ALA B  2  406 ? 51.717 93.952  61.431  1.00 30.65  ? 406  ALA B O   1 
ATOM   6387  C  CB  . ALA B  2  406 ? 50.970 96.173  59.075  1.00 28.34  ? 406  ALA B CB  1 
ATOM   6388  N  N   . ASP B  2  407 ? 49.873 93.551  60.198  1.00 31.37  ? 407  ASP B N   1 
ATOM   6389  C  CA  . ASP B  2  407 ? 49.946 92.102  60.275  1.00 32.27  ? 407  ASP B CA  1 
ATOM   6390  C  C   . ASP B  2  407 ? 51.290 91.591  59.755  1.00 32.92  ? 407  ASP B C   1 
ATOM   6391  O  O   . ASP B  2  407 ? 51.887 90.697  60.340  1.00 33.91  ? 407  ASP B O   1 
ATOM   6392  C  CB  . ASP B  2  407 ? 48.821 91.479  59.444  1.00 32.45  ? 407  ASP B CB  1 
ATOM   6393  C  CG  . ASP B  2  407 ? 47.434 91.766  60.025  1.00 41.77  ? 407  ASP B CG  1 
ATOM   6394  O  OD1 . ASP B  2  407 ? 46.458 91.101  59.592  1.00 44.75  ? 407  ASP B OD1 1 
ATOM   6395  O  OD2 . ASP B  2  407 ? 47.232 92.625  60.925  1.00 33.72  ? 407  ASP B OD2 1 
ATOM   6396  N  N   . ALA B  2  408 ? 51.764 92.173  58.665  1.00 32.62  ? 408  ALA B N   1 
ATOM   6397  C  CA  . ALA B  2  408 ? 53.030 91.785  58.089  1.00 32.31  ? 408  ALA B CA  1 
ATOM   6398  C  C   . ALA B  2  408 ? 54.206 92.122  59.028  1.00 32.99  ? 408  ALA B C   1 
ATOM   6399  O  O   . ALA B  2  408 ? 55.239 91.459  58.979  1.00 34.39  ? 408  ALA B O   1 
ATOM   6400  C  CB  . ALA B  2  408 ? 53.221 92.435  56.723  1.00 31.50  ? 408  ALA B CB  1 
ATOM   6401  N  N   . ASP B  2  409 ? 54.054 93.121  59.886  1.00 31.69  ? 409  ASP B N   1 
ATOM   6402  C  CA  . ASP B  2  409 ? 55.132 93.428  60.797  1.00 32.35  ? 409  ASP B CA  1 
ATOM   6403  C  C   . ASP B  2  409 ? 55.250 92.290  61.840  1.00 33.14  ? 409  ASP B C   1 
ATOM   6404  O  O   . ASP B  2  409 ? 56.358 91.865  62.201  1.00 33.94  ? 409  ASP B O   1 
ATOM   6405  C  CB  . ASP B  2  409 ? 54.899 94.785  61.508  1.00 32.52  ? 409  ASP B CB  1 
ATOM   6406  C  CG  . ASP B  2  409 ? 54.823 95.935  60.549  1.00 32.80  ? 409  ASP B CG  1 
ATOM   6407  O  OD1 . ASP B  2  409 ? 55.742 96.073  59.725  1.00 33.42  ? 409  ASP B OD1 1 
ATOM   6408  O  OD2 . ASP B  2  409 ? 53.883 96.764  60.542  1.00 40.48  ? 409  ASP B OD2 1 
ATOM   6409  N  N   . VAL B  2  410 ? 54.097 91.831  62.324  1.00 32.55  ? 410  VAL B N   1 
ATOM   6410  C  CA  . VAL B  2  410 ? 54.022 90.740  63.268  1.00 32.17  ? 410  VAL B CA  1 
ATOM   6411  C  C   . VAL B  2  410 ? 54.576 89.477  62.630  1.00 32.28  ? 410  VAL B C   1 
ATOM   6412  O  O   . VAL B  2  410 ? 55.412 88.779  63.236  1.00 32.70  ? 410  VAL B O   1 
ATOM   6413  C  CB  . VAL B  2  410 ? 52.579 90.470  63.646  1.00 31.90  ? 410  VAL B CB  1 
ATOM   6414  C  CG1 . VAL B  2  410 ? 52.495 89.310  64.611  1.00 16.01  ? 410  VAL B CG1 1 
ATOM   6415  C  CG2 . VAL B  2  410 ? 51.964 91.700  64.218  1.00 26.07  ? 410  VAL B CG2 1 
ATOM   6416  N  N   . ILE B  2  411 ? 54.102 89.169  61.411  1.00 31.70  ? 411  ILE B N   1 
ATOM   6417  C  CA  . ILE B  2  411 ? 54.614 88.012  60.678  1.00 31.78  ? 411  ILE B CA  1 
ATOM   6418  C  C   . ILE B  2  411 ? 56.138 88.107  60.566  1.00 32.27  ? 411  ILE B C   1 
ATOM   6419  O  O   . ILE B  2  411 ? 56.836 87.168  60.920  1.00 32.19  ? 411  ILE B O   1 
ATOM   6420  C  CB  . ILE B  2  411 ? 53.951 87.885  59.267  1.00 31.72  ? 411  ILE B CB  1 
ATOM   6421  C  CG1 . ILE B  2  411 ? 52.521 87.404  59.408  1.00 29.73  ? 411  ILE B CG1 1 
ATOM   6422  C  CG2 . ILE B  2  411 ? 54.722 86.879  58.376  1.00 9.87   ? 411  ILE B CG2 1 
ATOM   6423  C  CD1 . ILE B  2  411 ? 51.660 87.909  58.418  1.00 25.26  ? 411  ILE B CD1 1 
ATOM   6424  N  N   . ASN B  2  412 ? 56.646 89.282  60.167  1.00 32.91  ? 412  ASN B N   1 
ATOM   6425  C  CA  . ASN B  2  412 ? 58.097 89.480  60.049  1.00 33.63  ? 412  ASN B CA  1 
ATOM   6426  C  C   . ASN B  2  412 ? 58.912 89.265  61.376  1.00 34.44  ? 412  ASN B C   1 
ATOM   6427  O  O   . ASN B  2  412 ? 60.040 88.683  61.341  1.00 35.72  ? 412  ASN B O   1 
ATOM   6428  C  CB  . ASN B  2  412 ? 58.416 90.823  59.441  1.00 33.19  ? 412  ASN B CB  1 
ATOM   6429  C  CG  . ASN B  2  412 ? 58.022 90.908  57.984  1.00 36.90  ? 412  ASN B CG  1 
ATOM   6430  O  OD1 . ASN B  2  412 ? 58.036 89.920  57.265  1.00 37.09  ? 412  ASN B OD1 1 
ATOM   6431  N  ND2 . ASN B  2  412 ? 57.644 92.107  57.546  1.00 41.75  ? 412  ASN B ND2 1 
ATOM   6432  N  N   . ALA B  2  413 ? 58.350 89.712  62.514  1.00 33.00  ? 413  ALA B N   1 
ATOM   6433  C  CA  . ALA B  2  413 ? 58.989 89.514  63.802  1.00 32.63  ? 413  ALA B CA  1 
ATOM   6434  C  C   . ALA B  2  413 ? 59.083 88.002  64.116  1.00 32.81  ? 413  ALA B C   1 
ATOM   6435  O  O   . ALA B  2  413 ? 60.137 87.502  64.556  1.00 32.03  ? 413  ALA B O   1 
ATOM   6436  C  CB  . ALA B  2  413 ? 58.228 90.241  64.898  1.00 32.21  ? 413  ALA B CB  1 
ATOM   6437  N  N   . ALA B  2  414 ? 57.993 87.284  63.851  1.00 33.67  ? 414  ALA B N   1 
ATOM   6438  C  CA  . ALA B  2  414 ? 57.953 85.836  64.058  1.00 34.43  ? 414  ALA B CA  1 
ATOM   6439  C  C   . ALA B  2  414 ? 59.011 85.178  63.205  1.00 35.07  ? 414  ALA B C   1 
ATOM   6440  O  O   . ALA B  2  414 ? 59.773 84.319  63.674  1.00 35.67  ? 414  ALA B O   1 
ATOM   6441  C  CB  . ALA B  2  414 ? 56.634 85.314  63.710  1.00 34.54  ? 414  ALA B CB  1 
ATOM   6442  N  N   . LYS B  2  415 ? 59.101 85.626  61.965  1.00 35.08  ? 415  LYS B N   1 
ATOM   6443  C  CA  . LYS B  2  415 ? 60.066 85.106  61.037  1.00 35.36  ? 415  LYS B CA  1 
ATOM   6444  C  C   . LYS B  2  415 ? 61.500 85.393  61.521  1.00 35.67  ? 415  LYS B C   1 
ATOM   6445  O  O   . LYS B  2  415 ? 62.417 84.604  61.292  1.00 36.30  ? 415  LYS B O   1 
ATOM   6446  C  CB  . LYS B  2  415 ? 59.823 85.707  59.682  1.00 35.74  ? 415  LYS B CB  1 
ATOM   6447  C  CG  . LYS B  2  415 ? 60.431 84.937  58.561  1.00 48.17  ? 415  LYS B CG  1 
ATOM   6448  C  CD  . LYS B  2  415 ? 60.142 85.589  57.220  1.00 46.14  ? 415  LYS B CD  1 
ATOM   6449  C  CE  . LYS B  2  415 ? 58.664 85.626  56.929  1.00 48.02  ? 415  LYS B CE  1 
ATOM   6450  N  NZ  . LYS B  2  415 ? 58.404 86.185  55.535  1.00 57.02  ? 415  LYS B NZ  1 
ATOM   6451  N  N   . LYS B  2  416 ? 61.677 86.503  62.230  1.00 35.07  ? 416  LYS B N   1 
ATOM   6452  C  CA  . LYS B  2  416 ? 62.987 86.853  62.761  1.00 34.03  ? 416  LYS B CA  1 
ATOM   6453  C  C   . LYS B  2  416 ? 63.338 85.930  63.914  1.00 32.70  ? 416  LYS B C   1 
ATOM   6454  O  O   . LYS B  2  416 ? 64.491 85.551  64.084  1.00 32.70  ? 416  LYS B O   1 
ATOM   6455  C  CB  . LYS B  2  416 ? 63.005 88.317  63.214  1.00 34.14  ? 416  LYS B CB  1 
ATOM   6456  C  CG  . LYS B  2  416 ? 64.321 88.800  63.811  1.00 39.53  ? 416  LYS B CG  1 
ATOM   6457  C  CD  . LYS B  2  416 ? 64.521 90.278  63.458  1.00 36.84  ? 416  LYS B CD  1 
ATOM   6458  C  CE  . LYS B  2  416 ? 65.782 90.845  64.007  1.00 40.23  ? 416  LYS B CE  1 
ATOM   6459  N  NZ  . LYS B  2  416 ? 65.861 92.253  63.565  1.00 49.84  ? 416  LYS B NZ  1 
ATOM   6460  N  N   . PHE B  2  417 ? 62.345 85.562  64.702  1.00 31.26  ? 417  PHE B N   1 
ATOM   6461  C  CA  . PHE B  2  417 ? 62.611 84.678  65.781  1.00 31.34  ? 417  PHE B CA  1 
ATOM   6462  C  C   . PHE B  2  417 ? 63.015 83.304  65.238  1.00 31.21  ? 417  PHE B C   1 
ATOM   6463  O  O   . PHE B  2  417 ? 64.042 82.746  65.617  1.00 30.75  ? 417  PHE B O   1 
ATOM   6464  C  CB  . PHE B  2  417 ? 61.394 84.529  66.684  1.00 31.78  ? 417  PHE B CB  1 
ATOM   6465  C  CG  . PHE B  2  417 ? 61.506 83.398  67.655  1.00 24.57  ? 417  PHE B CG  1 
ATOM   6466  C  CD1 . PHE B  2  417 ? 62.313 83.523  68.783  1.00 27.57  ? 417  PHE B CD1 1 
ATOM   6467  C  CD2 . PHE B  2  417 ? 60.827 82.197  67.435  1.00 17.94  ? 417  PHE B CD2 1 
ATOM   6468  C  CE1 . PHE B  2  417 ? 62.440 82.477  69.707  1.00 19.60  ? 417  PHE B CE1 1 
ATOM   6469  C  CE2 . PHE B  2  417 ? 60.941 81.141  68.350  1.00 25.37  ? 417  PHE B CE2 1 
ATOM   6470  C  CZ  . PHE B  2  417 ? 61.767 81.291  69.494  1.00 21.77  ? 417  PHE B CZ  1 
ATOM   6471  N  N   . VAL B  2  418 ? 62.229 82.799  64.306  1.00 31.05  ? 418  VAL B N   1 
ATOM   6472  C  CA  . VAL B  2  418 ? 62.472 81.482  63.773  1.00 30.80  ? 418  VAL B CA  1 
ATOM   6473  C  C   . VAL B  2  418 ? 63.849 81.245  63.155  1.00 30.18  ? 418  VAL B C   1 
ATOM   6474  O  O   . VAL B  2  418 ? 64.440 80.193  63.339  1.00 30.69  ? 418  VAL B O   1 
ATOM   6475  C  CB  . VAL B  2  418 ? 61.314 81.027  62.843  1.00 30.94  ? 418  VAL B CB  1 
ATOM   6476  C  CG1 . VAL B  2  418 ? 61.709 79.806  61.991  1.00 14.39  ? 418  VAL B CG1 1 
ATOM   6477  C  CG2 . VAL B  2  418 ? 60.112 80.746  63.663  1.00 28.79  ? 418  VAL B CG2 1 
ATOM   6478  N  N   . SER B  2  419 ? 64.402 82.237  62.520  1.00 29.26  ? 419  SER B N   1 
ATOM   6479  C  CA  . SER B  2  419 ? 65.680 82.042  61.849  1.00 29.27  ? 419  SER B CA  1 
ATOM   6480  C  C   . SER B  2  419 ? 66.883 82.650  62.534  1.00 29.70  ? 419  SER B C   1 
ATOM   6481  O  O   . SER B  2  419 ? 67.975 82.587  62.006  1.00 29.52  ? 419  SER B O   1 
ATOM   6482  C  CB  . SER B  2  419 ? 65.574 82.631  60.473  1.00 29.38  ? 419  SER B CB  1 
ATOM   6483  O  OG  . SER B  2  419 ? 65.147 83.975  60.615  1.00 29.90  ? 419  SER B OG  1 
ATOM   6484  N  N   . GLY B  2  420 ? 66.685 83.296  63.685  1.00 30.44  ? 420  GLY B N   1 
ATOM   6485  C  CA  . GLY B  2  420 ? 67.797 83.919  64.370  1.00 31.10  ? 420  GLY B CA  1 
ATOM   6486  C  C   . GLY B  2  420 ? 68.513 82.928  65.238  1.00 31.85  ? 420  GLY B C   1 
ATOM   6487  O  O   . GLY B  2  420 ? 67.910 81.940  65.643  1.00 31.16  ? 420  GLY B O   1 
ATOM   6488  N  N   . ARG B  2  421 ? 69.808 83.180  65.518  1.00 32.93  ? 421  ARG B N   1 
ATOM   6489  C  CA  . ARG B  2  421 ? 70.584 82.291  66.365  1.00 33.26  ? 421  ARG B CA  1 
ATOM   6490  C  C   . ARG B  2  421 ? 69.923 82.346  67.735  1.00 33.82  ? 421  ARG B C   1 
ATOM   6491  O  O   . ARG B  2  421 ? 69.610 83.391  68.218  1.00 34.83  ? 421  ARG B O   1 
ATOM   6492  C  CB  . ARG B  2  421 ? 72.056 82.708  66.422  1.00 33.54  ? 421  ARG B CB  1 
ATOM   6493  C  CG  . ARG B  2  421 ? 72.977 81.626  67.076  1.00 49.85  ? 421  ARG B CG  1 
ATOM   6494  C  CD  . ARG B  2  421 ? 74.500 81.891  66.975  1.00 68.03  ? 421  ARG B CD  1 
ATOM   6495  N  NE  . ARG B  2  421 ? 75.283 80.960  67.817  1.00 78.72  ? 421  ARG B NE  1 
ATOM   6496  C  CZ  . ARG B  2  421 ? 76.535 81.197  68.254  1.00 90.59  ? 421  ARG B CZ  1 
ATOM   6497  N  NH1 . ARG B  2  421 ? 77.154 82.334  67.924  1.00 98.12  ? 421  ARG B NH1 1 
ATOM   6498  N  NH2 . ARG B  2  421 ? 77.169 80.300  69.020  1.00 88.00  ? 421  ARG B NH2 1 
ATOM   6499  N  N   . LYS B  2  422 ? 69.686 81.200  68.326  1.00 33.52  ? 422  LYS B N   1 
ATOM   6500  C  CA  . LYS B  2  422 ? 68.965 81.127  69.566  1.00 33.02  ? 422  LYS B CA  1 
ATOM   6501  C  C   . LYS B  2  422 ? 69.752 81.202  70.841  1.00 32.20  ? 422  LYS B C   1 
ATOM   6502  O  O   . LYS B  2  422 ? 70.949 80.973  70.865  1.00 32.75  ? 422  LYS B O   1 
ATOM   6503  C  CB  . LYS B  2  422 ? 68.104 79.848  69.586  1.00 33.15  ? 422  LYS B CB  1 
ATOM   6504  C  CG  . LYS B  2  422 ? 66.694 80.078  69.103  1.00 37.72  ? 422  LYS B CG  1 
ATOM   6505  C  CD  . LYS B  2  422 ? 66.612 79.925  67.722  1.00 41.59  ? 422  LYS B CD  1 
ATOM   6506  C  CE  . LYS B  2  422 ? 65.355 80.467  67.189  1.00 31.22  ? 422  LYS B CE  1 
ATOM   6507  N  NZ  . LYS B  2  422 ? 65.351 80.077  65.705  1.00 20.34  ? 422  LYS B NZ  1 
ATOM   6508  N  N   . SER B  2  423 ? 69.038 81.467  71.918  1.00 31.26  ? 423  SER B N   1 
ATOM   6509  C  CA  . SER B  2  423 ? 69.605 81.475  73.238  1.00 31.28  ? 423  SER B CA  1 
ATOM   6510  C  C   . SER B  2  423 ? 68.657 80.754  74.127  1.00 31.60  ? 423  SER B C   1 
ATOM   6511  O  O   . SER B  2  423 ? 67.464 80.935  74.020  1.00 32.55  ? 423  SER B O   1 
ATOM   6512  C  CB  . SER B  2  423 ? 69.787 82.869  73.725  1.00 31.25  ? 423  SER B CB  1 
ATOM   6513  O  OG  . SER B  2  423 ? 70.838 83.488  73.018  1.00 41.82  ? 423  SER B OG  1 
ATOM   6514  N  N   . MET B  2  424 ? 69.162 79.904  75.000  1.00 31.21  ? 424  MET B N   1 
ATOM   6515  C  CA  . MET B  2  424 ? 68.264 79.187  75.863  1.00 31.06  ? 424  MET B CA  1 
ATOM   6516  C  C   . MET B  2  424 ? 68.802 78.868  77.234  1.00 29.81  ? 424  MET B C   1 
ATOM   6517  O  O   . MET B  2  424 ? 69.983 78.594  77.395  1.00 29.38  ? 424  MET B O   1 
ATOM   6518  C  CB  . MET B  2  424 ? 67.642 77.918  75.145  1.00 31.73  ? 424  MET B CB  1 
ATOM   6519  C  CG  . MET B  2  424 ? 68.050 76.610  75.666  1.00 43.38  ? 424  MET B CG  1 
ATOM   6520  S  SD  . MET B  2  424 ? 67.247 75.098  74.833  1.00 52.26  ? 424  MET B SD  1 
ATOM   6521  C  CE  . MET B  2  424 ? 65.949 75.226  75.207  1.00 18.33  ? 424  MET B CE  1 
ATOM   6522  N  N   . ALA B  2  425 ? 67.924 78.964  78.241  1.00 28.97  ? 425  ALA B N   1 
ATOM   6523  C  CA  . ALA B  2  425 ? 68.264 78.595  79.622  1.00 27.42  ? 425  ALA B CA  1 
ATOM   6524  C  C   . ALA B  2  425 ? 67.163 77.647  80.126  1.00 27.48  ? 425  ALA B C   1 
ATOM   6525  O  O   . ALA B  2  425 ? 65.974 77.785  79.722  1.00 27.91  ? 425  ALA B O   1 
ATOM   6526  C  CB  . ALA B  2  425 ? 68.344 79.767  80.461  1.00 26.41  ? 425  ALA B CB  1 
ATOM   6527  N  N   . ALA B  2  426 ? 67.545 76.673  80.967  1.00 26.60  ? 426  ALA B N   1 
ATOM   6528  C  CA  . ALA B  2  426 ? 66.595 75.694  81.467  1.00 26.42  ? 426  ALA B CA  1 
ATOM   6529  C  C   . ALA B  2  426 ? 67.000 75.118  82.813  1.00 27.39  ? 426  ALA B C   1 
ATOM   6530  O  O   . ALA B  2  426 ? 68.155 74.907  83.056  1.00 28.71  ? 426  ALA B O   1 
ATOM   6531  C  CB  . ALA B  2  426 ? 66.421 74.610  80.482  1.00 25.83  ? 426  ALA B CB  1 
ATOM   6532  N  N   . SER B  2  427 ? 66.054 74.903  83.702  1.00 27.15  ? 427  SER B N   1 
ATOM   6533  C  CA  . SER B  2  427 ? 66.389 74.313  84.991  1.00 28.18  ? 427  SER B CA  1 
ATOM   6534  C  C   . SER B  2  427 ? 65.388 73.252  85.346  1.00 28.47  ? 427  SER B C   1 
ATOM   6535  O  O   . SER B  2  427 ? 64.218 73.343  84.968  1.00 29.14  ? 427  SER B O   1 
ATOM   6536  C  CB  . SER B  2  427 ? 66.391 75.351  86.056  1.00 28.97  ? 427  SER B CB  1 
ATOM   6537  O  OG  . SER B  2  427 ? 65.091 75.803  86.254  1.00 50.41  ? 427  SER B OG  1 
ATOM   6538  N  N   . GLY B  2  428 ? 65.835 72.239  86.072  1.00 28.39  ? 428  GLY B N   1 
ATOM   6539  C  CA  . GLY B  2  428 ? 64.972 71.115  86.464  1.00 28.68  ? 428  GLY B CA  1 
ATOM   6540  C  C   . GLY B  2  428 ? 65.692 69.816  86.155  1.00 29.58  ? 428  GLY B C   1 
ATOM   6541  O  O   . GLY B  2  428 ? 66.920 69.806  86.025  1.00 29.92  ? 428  GLY B O   1 
ATOM   6542  N  N   . ASN B  2  429 ? 64.954 68.708  86.094  1.00 30.10  ? 429  ASN B N   1 
ATOM   6543  C  CA  . ASN B  2  429 ? 65.539 67.445  85.666  1.00 30.16  ? 429  ASN B CA  1 
ATOM   6544  C  C   . ASN B  2  429 ? 65.456 67.508  84.160  1.00 30.08  ? 429  ASN B C   1 
ATOM   6545  O  O   . ASN B  2  429 ? 64.408 67.288  83.599  1.00 30.33  ? 429  ASN B O   1 
ATOM   6546  C  CB  . ASN B  2  429 ? 64.731 66.276  86.173  1.00 30.55  ? 429  ASN B CB  1 
ATOM   6547  C  CG  . ASN B  2  429 ? 65.384 64.955  85.878  1.00 32.06  ? 429  ASN B CG  1 
ATOM   6548  O  OD1 . ASN B  2  429 ? 66.090 64.794  84.881  1.00 39.06  ? 429  ASN B OD1 1 
ATOM   6549  N  ND2 . ASN B  2  429 ? 65.157 64.008  86.728  1.00 40.42  ? 429  ASN B ND2 1 
ATOM   6550  N  N   . LEU B  2  430 ? 66.599 67.778  83.522  1.00 30.16  ? 430  LEU B N   1 
ATOM   6551  C  CA  . LEU B  2  430 ? 66.683 68.048  82.096  1.00 29.67  ? 430  LEU B CA  1 
ATOM   6552  C  C   . LEU B  2  430 ? 66.815 66.882  81.164  1.00 30.56  ? 430  LEU B C   1 
ATOM   6553  O  O   . LEU B  2  430 ? 67.063 67.089  79.982  1.00 31.52  ? 430  LEU B O   1 
ATOM   6554  C  CB  . LEU B  2  430 ? 67.811 69.031  81.817  1.00 29.11  ? 430  LEU B CB  1 
ATOM   6555  C  CG  . LEU B  2  430 ? 67.858 70.280  82.694  1.00 30.93  ? 430  LEU B CG  1 
ATOM   6556  C  CD1 . LEU B  2  430 ? 69.013 71.187  82.284  1.00 29.03  ? 430  LEU B CD1 1 
ATOM   6557  C  CD2 . LEU B  2  430 ? 66.549 71.046  82.586  1.00 39.20  ? 430  LEU B CD2 1 
ATOM   6558  N  N   . GLY B  2  431 ? 66.589 65.666  81.665  1.00 30.38  ? 431  GLY B N   1 
ATOM   6559  C  CA  . GLY B  2  431 ? 66.704 64.454  80.879  1.00 29.69  ? 431  GLY B CA  1 
ATOM   6560  C  C   . GLY B  2  431 ? 65.917 64.371  79.601  1.00 29.79  ? 431  GLY B C   1 
ATOM   6561  O  O   . GLY B  2  431 ? 66.216 63.608  78.788  1.00 30.25  ? 431  GLY B O   1 
ATOM   6562  N  N   . HIS B  2  432 ? 64.898 65.172  79.443  1.00 30.24  ? 432  HIS B N   1 
ATOM   6563  C  CA  . HIS B  2  432 ? 64.126 65.150  78.197  1.00 29.71  ? 432  HIS B CA  1 
ATOM   6564  C  C   . HIS B  2  432 ? 63.976 66.555  77.657  1.00 28.75  ? 432  HIS B C   1 
ATOM   6565  O  O   . HIS B  2  432 ? 63.033 66.846  76.953  1.00 28.07  ? 432  HIS B O   1 
ATOM   6566  C  CB  . HIS B  2  432 ? 62.743 64.544  78.422  1.00 29.56  ? 432  HIS B CB  1 
ATOM   6567  C  CG  . HIS B  2  432 ? 62.774 63.107  78.785  1.00 36.05  ? 432  HIS B CG  1 
ATOM   6568  N  ND1 . HIS B  2  432 ? 62.938 62.672  80.082  1.00 38.24  ? 432  HIS B ND1 1 
ATOM   6569  C  CD2 . HIS B  2  432 ? 62.650 61.989  78.021  1.00 35.70  ? 432  HIS B CD2 1 
ATOM   6570  C  CE1 . HIS B  2  432 ? 62.934 61.346  80.101  1.00 33.10  ? 432  HIS B CE1 1 
ATOM   6571  N  NE2 . HIS B  2  432 ? 62.753 60.912  78.863  1.00 29.61  ? 432  HIS B NE2 1 
ATOM   6572  N  N   . THR B  2  433 ? 64.872 67.439  78.065  1.00 28.64  ? 433  THR B N   1 
ATOM   6573  C  CA  . THR B  2  433 ? 64.841 68.800  77.592  1.00 28.94  ? 433  THR B CA  1 
ATOM   6574  C  C   . THR B  2  433 ? 65.809 68.917  76.414  1.00 29.10  ? 433  THR B C   1 
ATOM   6575  O  O   . THR B  2  433 ? 66.950 68.578  76.563  1.00 29.38  ? 433  THR B O   1 
ATOM   6576  C  CB  . THR B  2  433 ? 65.251 69.723  78.692  1.00 28.81  ? 433  THR B CB  1 
ATOM   6577  O  OG1 . THR B  2  433 ? 64.266 69.688  79.729  1.00 32.17  ? 433  THR B OG1 1 
ATOM   6578  C  CG2 . THR B  2  433 ? 65.181 71.121  78.228  1.00 30.91  ? 433  THR B CG2 1 
ATOM   6579  N  N   . PRO B  2  434 ? 65.321 69.309  75.235  1.00 29.08  ? 434  PRO B N   1 
ATOM   6580  C  CA  . PRO B  2  434 ? 66.139 69.428  74.038  1.00 30.59  ? 434  PRO B CA  1 
ATOM   6581  C  C   . PRO B  2  434 ? 67.197 70.563  74.097  1.00 33.99  ? 434  PRO B C   1 
ATOM   6582  O  O   . PRO B  2  434 ? 66.955 71.586  74.736  1.00 34.51  ? 434  PRO B O   1 
ATOM   6583  C  CB  . PRO B  2  434 ? 65.094 69.739  72.965  1.00 29.93  ? 434  PRO B CB  1 
ATOM   6584  C  CG  . PRO B  2  434 ? 64.052 70.368  73.691  1.00 29.17  ? 434  PRO B CG  1 
ATOM   6585  C  CD  . PRO B  2  434 ? 63.912 69.540  74.923  1.00 29.02  ? 434  PRO B CD  1 
ATOM   6586  N  N   . PHE B  2  435 ? 68.286 70.395  73.323  1.00 36.17  ? 435  PHE B N   1 
ATOM   6587  C  CA  . PHE B  2  435 ? 69.470 71.279  73.260  1.00 37.26  ? 435  PHE B CA  1 
ATOM   6588  C  C   . PHE B  2  435 ? 69.569 72.402  72.234  1.00 40.60  ? 435  PHE B C   1 
ATOM   6589  O  O   . PHE B  2  435 ? 70.687 72.899  72.018  1.00 43.11  ? 435  PHE B O   1 
ATOM   6590  C  CB  . PHE B  2  435 ? 70.687 70.433  72.945  1.00 35.84  ? 435  PHE B CB  1 
ATOM   6591  C  CG  . PHE B  2  435 ? 71.372 69.930  74.095  1.00 31.16  ? 435  PHE B CG  1 
ATOM   6592  C  CD1 . PHE B  2  435 ? 72.285 70.715  74.752  1.00 26.65  ? 435  PHE B CD1 1 
ATOM   6593  C  CD2 . PHE B  2  435 ? 71.205 68.583  74.505  1.00 36.16  ? 435  PHE B CD2 1 
ATOM   6594  C  CE1 . PHE B  2  435 ? 72.968 70.235  75.870  1.00 23.75  ? 435  PHE B CE1 1 
ATOM   6595  C  CE2 . PHE B  2  435 ? 71.888 68.091  75.610  1.00 23.03  ? 435  PHE B CE2 1 
ATOM   6596  C  CZ  . PHE B  2  435 ? 72.764 68.932  76.307  1.00 27.34  ? 435  PHE B CZ  1 
ATOM   6597  N  N   . ILE B  2  436 ? 68.511 72.793  71.553  1.00 40.64  ? 436  ILE B N   1 
ATOM   6598  C  CA  . ILE B  2  436 ? 68.649 73.880  70.453  1.00 39.76  ? 436  ILE B CA  1 
ATOM   6599  C  C   . ILE B  2  436 ? 68.991 73.149  69.213  1.00 39.20  ? 436  ILE B C   1 
ATOM   6600  O  O   . ILE B  2  436 ? 68.251 73.184  68.289  1.00 39.53  ? 436  ILE B O   1 
ATOM   6601  C  CB  . ILE B  2  436 ? 69.723 74.991  70.741  1.00 39.39  ? 436  ILE B CB  1 
ATOM   6602  C  CG1 . ILE B  2  436 ? 69.323 75.870  71.894  1.00 37.27  ? 436  ILE B CG1 1 
ATOM   6603  C  CG2 . ILE B  2  436 ? 69.916 75.939  69.509  1.00 21.90  ? 436  ILE B CG2 1 
ATOM   6604  C  CD1 . ILE B  2  436 ? 70.285 77.054  72.071  1.00 28.83  ? 436  ILE B CD1 1 
ATOM   6605  N  N   . ASP B  2  437 ? 70.145 72.484  69.211  1.00 38.83  ? 437  ASP B N   1 
ATOM   6606  C  CA  . ASP B  2  437 ? 70.525 71.519  68.159  1.00 38.71  ? 437  ASP B CA  1 
ATOM   6607  C  C   . ASP B  2  437 ? 69.291 70.766  67.702  1.00 39.58  ? 437  ASP B C   1 
ATOM   6608  O  O   . ASP B  2  437 ? 69.027 70.599  66.525  1.00 40.69  ? 437  ASP B O   1 
ATOM   6609  C  CB  . ASP B  2  437 ? 71.344 70.413  68.836  1.00 38.36  ? 437  ASP B CB  1 
ATOM   6610  C  CG  . ASP B  2  437 ? 72.739 70.456  68.503  1.00 42.27  ? 437  ASP B CG  1 
ATOM   6611  O  OD1 . ASP B  2  437 ? 73.077 71.085  67.499  1.00 59.17  ? 437  ASP B OD1 1 
ATOM   6612  O  OD2 . ASP B  2  437 ? 73.604 69.865  69.170  1.00 48.45  ? 437  ASP B OD2 1 
ATOM   6613  N  N   . GLU B  2  438 ? 68.552 70.291  68.685  1.00 39.32  ? 438  GLU B N   1 
ATOM   6614  C  CA  . GLU B  2  438 ? 67.424 69.425  68.484  1.00 38.80  ? 438  GLU B CA  1 
ATOM   6615  C  C   . GLU B  2  438 ? 66.061 70.076  68.349  1.00 39.01  ? 438  GLU B C   1 
ATOM   6616  O  O   . GLU B  2  438 ? 65.043 69.375  68.410  1.00 39.53  ? 438  GLU B O   1 
ATOM   6617  C  CB  . GLU B  2  438 ? 67.401 68.450  69.648  1.00 37.85  ? 438  GLU B CB  1 
ATOM   6618  C  CG  . GLU B  2  438 ? 68.798 67.976  69.965  1.00 29.50  ? 438  GLU B CG  1 
ATOM   6619  C  CD  . GLU B  2  438 ? 68.919 67.263  71.289  1.00 32.56  ? 438  GLU B CD  1 
ATOM   6620  O  OE1 . GLU B  2  438 ? 68.172 67.601  72.212  1.00 33.00  ? 438  GLU B OE1 1 
ATOM   6621  O  OE2 . GLU B  2  438 ? 69.793 66.368  71.406  1.00 43.33  ? 438  GLU B OE2 1 
ATOM   6622  N  N   . LEU B  2  439 ? 66.008 71.378  68.137  1.00 38.35  ? 439  LEU B N   1 
ATOM   6623  C  CA  . LEU B  2  439 ? 64.724 72.026  68.062  1.00 39.40  ? 439  LEU B CA  1 
ATOM   6624  C  C   . LEU B  2  439 ? 64.055 72.085  66.686  1.00 41.22  ? 439  LEU B C   1 
ATOM   6625  O  O   . LEU B  2  439 ? 62.800 72.287  66.560  1.00 41.22  ? 439  LEU B O   1 
ATOM   6626  C  CB  . LEU B  2  439 ? 64.795 73.372  68.681  1.00 39.95  ? 439  LEU B CB  1 
ATOM   6627  C  CG  . LEU B  2  439 ? 64.780 73.213  70.167  1.00 42.59  ? 439  LEU B CG  1 
ATOM   6628  C  CD1 . LEU B  2  439 ? 64.669 74.535  70.776  1.00 44.08  ? 439  LEU B CD1 1 
ATOM   6629  C  CD2 . LEU B  2  439 ? 63.575 72.356  70.513  1.00 38.81  ? 439  LEU B CD2 1 
ATOM   6630  O  OXT . LEU B  2  439 ? 64.739 71.911  65.674  1.00 42.42  ? 439  LEU B OXT 1 
ATOM   6631  N  N   . THR C  3  2   ? 66.722 89.711  123.891 1.00 81.02  ? 2    THR C N   1 
ATOM   6632  C  CA  . THR C  3  2   ? 66.943 88.859  125.096 1.00 80.65  ? 2    THR C CA  1 
ATOM   6633  C  C   . THR C  3  2   ? 66.089 89.335  126.270 1.00 79.18  ? 2    THR C C   1 
ATOM   6634  O  O   . THR C  3  2   ? 65.566 90.478  126.277 1.00 79.73  ? 2    THR C O   1 
ATOM   6635  C  CB  . THR C  3  2   ? 68.506 88.762  125.523 1.00 81.38  ? 2    THR C CB  1 
ATOM   6636  O  OG1 . THR C  3  2   ? 69.053 90.075  125.727 1.00 95.31  ? 2    THR C OG1 1 
ATOM   6637  C  CG2 . THR C  3  2   ? 69.387 88.177  124.375 1.00 86.08  ? 2    THR C CG2 1 
ATOM   6638  N  N   . ASN C  3  3   ? 65.946 88.434  127.252 1.00 76.54  ? 3    ASN C N   1 
ATOM   6639  C  CA  . ASN C  3  3   ? 65.156 88.641  128.465 1.00 73.45  ? 3    ASN C CA  1 
ATOM   6640  C  C   . ASN C  3  3   ? 66.058 89.211  129.560 1.00 70.92  ? 3    ASN C C   1 
ATOM   6641  O  O   . ASN C  3  3   ? 67.000 89.933  129.278 1.00 71.84  ? 3    ASN C O   1 
ATOM   6642  C  CB  . ASN C  3  3   ? 64.629 87.281  128.912 1.00 73.11  ? 3    ASN C CB  1 
ATOM   6643  C  CG  . ASN C  3  3   ? 63.250 87.347  129.493 1.00 64.35  ? 3    ASN C CG  1 
ATOM   6644  O  OD1 . ASN C  3  3   ? 62.862 88.331  130.077 1.00 68.52  ? 3    ASN C OD1 1 
ATOM   6645  N  ND2 . ASN C  3  3   ? 62.512 86.277  129.350 1.00 69.82  ? 3    ASN C ND2 1 
ATOM   6646  N  N   . ILE C  3  4   ? 65.741 88.928  130.810 1.00 67.63  ? 4    ILE C N   1 
ATOM   6647  C  CA  . ILE C  3  4   ? 66.579 89.364  131.931 1.00 64.53  ? 4    ILE C CA  1 
ATOM   6648  C  C   . ILE C  3  4   ? 66.849 88.088  132.726 1.00 61.63  ? 4    ILE C C   1 
ATOM   6649  O  O   . ILE C  3  4   ? 67.955 87.854  133.201 1.00 61.08  ? 4    ILE C O   1 
ATOM   6650  C  CB  . ILE C  3  4   ? 65.838 90.413  132.847 1.00 64.46  ? 4    ILE C CB  1 
ATOM   6651  C  CG1 . ILE C  3  4   ? 64.814 91.273  132.058 1.00 68.56  ? 4    ILE C CG1 1 
ATOM   6652  C  CG2 . ILE C  3  4   ? 66.841 91.248  133.620 1.00 54.33  ? 4    ILE C CG2 1 
ATOM   6653  C  CD1 . ILE C  3  4   ? 65.425 92.404  131.191 1.00 72.60  ? 4    ILE C CD1 1 
ATOM   6654  N  N   . ARG C  3  5   ? 65.805 87.264  132.832 1.00 59.29  ? 5    ARG C N   1 
ATOM   6655  C  CA  . ARG C  3  5   ? 65.849 85.979  133.512 1.00 57.06  ? 5    ARG C CA  1 
ATOM   6656  C  C   . ARG C  3  5   ? 66.830 85.067  132.867 1.00 55.12  ? 5    ARG C C   1 
ATOM   6657  O  O   . ARG C  3  5   ? 67.610 84.392  133.544 1.00 55.12  ? 5    ARG C O   1 
ATOM   6658  C  CB  . ARG C  3  5   ? 64.509 85.292  133.371 1.00 56.88  ? 5    ARG C CB  1 
ATOM   6659  C  CG  . ARG C  3  5   ? 63.564 85.450  134.482 1.00 51.36  ? 5    ARG C CG  1 
ATOM   6660  C  CD  . ARG C  3  5   ? 62.266 84.690  134.243 1.00 48.64  ? 5    ARG C CD  1 
ATOM   6661  N  NE  . ARG C  3  5   ? 62.482 83.521  133.391 1.00 48.24  ? 5    ARG C NE  1 
ATOM   6662  C  CZ  . ARG C  3  5   ? 61.972 83.377  132.159 1.00 50.65  ? 5    ARG C CZ  1 
ATOM   6663  N  NH1 . ARG C  3  5   ? 61.224 84.325  131.639 1.00 52.30  ? 5    ARG C NH1 1 
ATOM   6664  N  NH2 . ARG C  3  5   ? 62.227 82.292  131.449 1.00 41.03  ? 5    ARG C NH2 1 
ATOM   6665  N  N   . LYS C  3  6   ? 66.766 85.008  131.546 1.00 53.22  ? 6    LYS C N   1 
ATOM   6666  C  CA  . LYS C  3  6   ? 67.600 84.109  130.799 1.00 52.09  ? 6    LYS C CA  1 
ATOM   6667  C  C   . LYS C  3  6   ? 69.072 84.468  130.759 1.00 51.84  ? 6    LYS C C   1 
ATOM   6668  O  O   . LYS C  3  6   ? 69.912 83.571  130.713 1.00 52.48  ? 6    LYS C O   1 
ATOM   6669  C  CB  . LYS C  3  6   ? 67.097 83.960  129.358 1.00 51.63  ? 6    LYS C CB  1 
ATOM   6670  C  CG  . LYS C  3  6   ? 65.667 83.631  129.215 1.00 39.77  ? 6    LYS C CG  1 
ATOM   6671  C  CD  . LYS C  3  6   ? 65.393 83.260  127.818 1.00 51.46  ? 6    LYS C CD  1 
ATOM   6672  C  CE  . LYS C  3  6   ? 63.917 83.103  127.567 1.00 51.94  ? 6    LYS C CE  1 
ATOM   6673  N  NZ  . LYS C  3  6   ? 63.620 83.166  126.101 1.00 58.33  ? 6    LYS C NZ  1 
ATOM   6674  N  N   . SER C  3  7   ? 69.392 85.770  130.790 1.00 50.57  ? 7    SER C N   1 
ATOM   6675  C  CA  . SER C  3  7   ? 70.785 86.219  130.610 1.00 49.35  ? 7    SER C CA  1 
ATOM   6676  C  C   . SER C  3  7   ? 71.621 86.531  131.858 1.00 48.24  ? 7    SER C C   1 
ATOM   6677  O  O   . SER C  3  7   ? 72.825 86.312  131.854 1.00 48.60  ? 7    SER C O   1 
ATOM   6678  C  CB  . SER C  3  7   ? 70.832 87.403  129.652 1.00 49.35  ? 7    SER C CB  1 
ATOM   6679  O  OG  . SER C  3  7   ? 70.253 88.561  130.248 1.00 46.15  ? 7    SER C OG  1 
ATOM   6680  N  N   . HIS C  3  8   ? 70.990 87.090  132.890 1.00 46.76  ? 8    HIS C N   1 
ATOM   6681  C  CA  . HIS C  3  8   ? 71.679 87.454  134.146 1.00 45.45  ? 8    HIS C CA  1 
ATOM   6682  C  C   . HIS C  3  8   ? 72.310 86.224  134.828 1.00 45.29  ? 8    HIS C C   1 
ATOM   6683  O  O   . HIS C  3  8   ? 71.614 85.205  135.092 1.00 45.54  ? 8    HIS C O   1 
ATOM   6684  C  CB  . HIS C  3  8   ? 70.680 88.139  135.092 1.00 44.96  ? 8    HIS C CB  1 
ATOM   6685  C  CG  . HIS C  3  8   ? 71.288 88.679  136.353 1.00 41.67  ? 8    HIS C CG  1 
ATOM   6686  N  ND1 . HIS C  3  8   ? 72.114 89.783  136.371 1.00 30.85  ? 8    HIS C ND1 1 
ATOM   6687  C  CD2 . HIS C  3  8   ? 71.143 88.298  137.645 1.00 41.37  ? 8    HIS C CD2 1 
ATOM   6688  C  CE1 . HIS C  3  8   ? 72.462 90.049  137.616 1.00 38.14  ? 8    HIS C CE1 1 
ATOM   6689  N  NE2 . HIS C  3  8   ? 71.887 89.162  138.408 1.00 45.73  ? 8    HIS C NE2 1 
ATOM   6690  N  N   . PRO C  3  9   ? 73.609 86.320  135.126 1.00 44.70  ? 9    PRO C N   1 
ATOM   6691  C  CA  . PRO C  3  9   ? 74.374 85.227  135.742 1.00 44.51  ? 9    PRO C CA  1 
ATOM   6692  C  C   . PRO C  3  9   ? 73.699 84.578  136.914 1.00 45.08  ? 9    PRO C C   1 
ATOM   6693  O  O   . PRO C  3  9   ? 73.690 83.360  137.000 1.00 45.43  ? 9    PRO C O   1 
ATOM   6694  C  CB  . PRO C  3  9   ? 75.636 85.910  136.195 1.00 44.07  ? 9    PRO C CB  1 
ATOM   6695  C  CG  . PRO C  3  9   ? 75.817 86.969  135.232 1.00 44.51  ? 9    PRO C CG  1 
ATOM   6696  C  CD  . PRO C  3  9   ? 74.443 87.501  134.901 1.00 44.53  ? 9    PRO C CD  1 
ATOM   6697  N  N   . LEU C  3  10  ? 73.135 85.379  137.803 1.00 45.43  ? 10   LEU C N   1 
ATOM   6698  C  CA  . LEU C  3  10  ? 72.429 84.859  138.968 1.00 45.44  ? 10   LEU C CA  1 
ATOM   6699  C  C   . LEU C  3  10  ? 71.048 84.292  138.639 1.00 45.19  ? 10   LEU C C   1 
ATOM   6700  O  O   . LEU C  3  10  ? 70.727 83.211  139.052 1.00 45.00  ? 10   LEU C O   1 
ATOM   6701  C  CB  . LEU C  3  10  ? 72.294 85.941  140.043 1.00 45.58  ? 10   LEU C CB  1 
ATOM   6702  C  CG  . LEU C  3  10  ? 73.040 85.749  141.354 1.00 47.36  ? 10   LEU C CG  1 
ATOM   6703  C  CD1 . LEU C  3  10  ? 72.483 86.753  142.395 1.00 43.22  ? 10   LEU C CD1 1 
ATOM   6704  C  CD2 . LEU C  3  10  ? 72.846 84.308  141.848 1.00 43.83  ? 10   LEU C CD2 1 
ATOM   6705  N  N   . MET C  3  11  ? 70.246 85.040  137.882 1.00 45.65  ? 11   MET C N   1 
ATOM   6706  C  CA  . MET C  3  11  ? 68.887 84.613  137.564 1.00 46.36  ? 11   MET C CA  1 
ATOM   6707  C  C   . MET C  3  11  ? 68.848 83.375  136.694 1.00 46.47  ? 11   MET C C   1 
ATOM   6708  O  O   . MET C  3  11  ? 67.947 82.597  136.820 1.00 46.14  ? 11   MET C O   1 
ATOM   6709  C  CB  . MET C  3  11  ? 68.037 85.761  136.984 1.00 46.89  ? 11   MET C CB  1 
ATOM   6710  C  CG  . MET C  3  11  ? 67.934 87.028  137.926 1.00 60.78  ? 11   MET C CG  1 
ATOM   6711  S  SD  . MET C  3  11  ? 66.730 88.369  137.382 1.00 61.81  ? 11   MET C SD  1 
ATOM   6712  C  CE  . MET C  3  11  ? 64.915 87.399  137.744 1.00 65.89  ? 11   MET C CE  1 
ATOM   6713  N  N   . LYS C  3  12  ? 69.853 83.228  135.800 1.00 46.91  ? 12   LYS C N   1 
ATOM   6714  C  CA  . LYS C  3  12  ? 70.024 82.036  134.932 1.00 46.53  ? 12   LYS C CA  1 
ATOM   6715  C  C   . LYS C  3  12  ? 69.825 80.808  135.748 1.00 46.29  ? 12   LYS C C   1 
ATOM   6716  O  O   . LYS C  3  12  ? 68.979 79.964  135.437 1.00 46.14  ? 12   LYS C O   1 
ATOM   6717  C  CB  . LYS C  3  12  ? 71.472 81.950  134.443 1.00 46.64  ? 12   LYS C CB  1 
ATOM   6718  C  CG  . LYS C  3  12  ? 71.767 82.371  133.059 1.00 35.47  ? 12   LYS C CG  1 
ATOM   6719  C  CD  . LYS C  3  12  ? 73.248 82.067  132.776 1.00 40.89  ? 12   LYS C CD  1 
ATOM   6720  C  CE  . LYS C  3  12  ? 73.827 83.016  131.706 1.00 54.49  ? 12   LYS C CE  1 
ATOM   6721  N  NZ  . LYS C  3  12  ? 75.253 83.462  132.035 1.00 57.52  ? 12   LYS C NZ  1 
ATOM   6722  N  N   . ILE C  3  13  ? 70.634 80.702  136.807 1.00 46.37  ? 13   ILE C N   1 
ATOM   6723  C  CA  . ILE C  3  13  ? 70.593 79.554  137.706 1.00 46.57  ? 13   ILE C CA  1 
ATOM   6724  C  C   . ILE C  3  13  ? 69.179 79.295  138.178 1.00 46.18  ? 13   ILE C C   1 
ATOM   6725  O  O   . ILE C  3  13  ? 68.710 78.172  138.085 1.00 47.49  ? 13   ILE C O   1 
ATOM   6726  C  CB  . ILE C  3  13  ? 71.547 79.752  138.907 1.00 47.18  ? 13   ILE C CB  1 
ATOM   6727  C  CG1 . ILE C  3  13  ? 72.908 80.302  138.433 1.00 56.11  ? 13   ILE C CG1 1 
ATOM   6728  C  CG2 . ILE C  3  13  ? 71.688 78.455  139.724 1.00 36.14  ? 13   ILE C CG2 1 
ATOM   6729  C  CD1 . ILE C  3  13  ? 73.708 79.335  137.585 1.00 65.12  ? 13   ILE C CD1 1 
ATOM   6730  N  N   . VAL C  3  14  ? 68.478 80.346  138.620 1.00 44.29  ? 14   VAL C N   1 
ATOM   6731  C  CA  . VAL C  3  14  ? 67.101 80.206  139.074 1.00 42.98  ? 14   VAL C CA  1 
ATOM   6732  C  C   . VAL C  3  14  ? 66.177 79.713  137.933 1.00 42.72  ? 14   VAL C C   1 
ATOM   6733  O  O   . VAL C  3  14  ? 65.376 78.745  138.104 1.00 41.99  ? 14   VAL C O   1 
ATOM   6734  C  CB  . VAL C  3  14  ? 66.569 81.517  139.577 1.00 42.37  ? 14   VAL C CB  1 
ATOM   6735  C  CG1 . VAL C  3  14  ? 65.447 81.286  140.542 1.00 36.30  ? 14   VAL C CG1 1 
ATOM   6736  C  CG2 . VAL C  3  14  ? 67.641 82.258  140.240 1.00 48.22  ? 14   VAL C CG2 1 
ATOM   6737  N  N   . ASN C  3  15  ? 66.321 80.360  136.780 1.00 42.89  ? 15   ASN C N   1 
ATOM   6738  C  CA  . ASN C  3  15  ? 65.543 80.077  135.612 1.00 43.34  ? 15   ASN C CA  1 
ATOM   6739  C  C   . ASN C  3  15  ? 65.714 78.637  135.186 1.00 44.07  ? 15   ASN C C   1 
ATOM   6740  O  O   . ASN C  3  15  ? 64.734 77.912  134.972 1.00 43.77  ? 15   ASN C O   1 
ATOM   6741  C  CB  . ASN C  3  15  ? 65.956 81.012  134.495 1.00 43.60  ? 15   ASN C CB  1 
ATOM   6742  C  CG  . ASN C  3  15  ? 65.047 80.926  133.298 1.00 54.44  ? 15   ASN C CG  1 
ATOM   6743  O  OD1 . ASN C  3  15  ? 63.856 81.228  133.388 1.00 52.30  ? 15   ASN C OD1 1 
ATOM   6744  N  ND2 . ASN C  3  15  ? 65.603 80.514  132.158 1.00 51.32  ? 15   ASN C ND2 1 
ATOM   6745  N  N   . ASN C  3  16  ? 66.966 78.192  135.164 1.00 44.82  ? 16   ASN C N   1 
ATOM   6746  C  CA  . ASN C  3  16  ? 67.291 76.841  134.743 1.00 45.00  ? 16   ASN C CA  1 
ATOM   6747  C  C   . ASN C  3  16  ? 66.931 75.778  135.760 1.00 45.32  ? 16   ASN C C   1 
ATOM   6748  O  O   . ASN C  3  16  ? 66.961 74.580  135.458 1.00 46.22  ? 16   ASN C O   1 
ATOM   6749  C  CB  . ASN C  3  16  ? 68.771 76.740  134.330 1.00 44.86  ? 16   ASN C CB  1 
ATOM   6750  C  CG  . ASN C  3  16  ? 69.119 77.676  133.147 1.00 57.89  ? 16   ASN C CG  1 
ATOM   6751  O  OD1 . ASN C  3  16  ? 68.270 77.977  132.311 1.00 55.52  ? 16   ASN C OD1 1 
ATOM   6752  N  ND2 . ASN C  3  16  ? 70.364 78.163  133.112 1.00 64.44  ? 16   ASN C ND2 1 
ATOM   6753  N  N   . ALA C  3  17  ? 66.533 76.197  136.946 1.00 44.66  ? 17   ALA C N   1 
ATOM   6754  C  CA  . ALA C  3  17  ? 66.209 75.244  137.969 1.00 44.04  ? 17   ALA C CA  1 
ATOM   6755  C  C   . ALA C  3  17  ? 64.751 75.266  138.421 1.00 43.87  ? 17   ALA C C   1 
ATOM   6756  O  O   . ALA C  3  17  ? 64.262 74.282  138.901 1.00 44.60  ? 17   ALA C O   1 
ATOM   6757  C  CB  . ALA C  3  17  ? 67.131 75.413  139.136 1.00 44.15  ? 17   ALA C CB  1 
ATOM   6758  N  N   . PHE C  3  18  ? 64.057 76.392  138.288 1.00 43.45  ? 18   PHE C N   1 
ATOM   6759  C  CA  . PHE C  3  18  ? 62.662 76.465  138.771 1.00 42.93  ? 18   PHE C CA  1 
ATOM   6760  C  C   . PHE C  3  18  ? 61.672 77.145  137.837 1.00 42.09  ? 18   PHE C C   1 
ATOM   6761  O  O   . PHE C  3  18  ? 60.501 77.235  138.170 1.00 42.96  ? 18   PHE C O   1 
ATOM   6762  C  CB  . PHE C  3  18  ? 62.580 77.213  140.124 1.00 43.35  ? 18   PHE C CB  1 
ATOM   6763  C  CG  . PHE C  3  18  ? 63.692 76.880  141.091 1.00 58.20  ? 18   PHE C CG  1 
ATOM   6764  C  CD1 . PHE C  3  18  ? 63.766 75.640  141.693 1.00 69.99  ? 18   PHE C CD1 1 
ATOM   6765  C  CD2 . PHE C  3  18  ? 64.627 77.825  141.432 1.00 66.78  ? 18   PHE C CD2 1 
ATOM   6766  C  CE1 . PHE C  3  18  ? 64.792 75.340  142.586 1.00 72.29  ? 18   PHE C CE1 1 
ATOM   6767  C  CE2 . PHE C  3  18  ? 65.646 77.533  142.336 1.00 73.37  ? 18   PHE C CE2 1 
ATOM   6768  C  CZ  . PHE C  3  18  ? 65.724 76.289  142.905 1.00 74.90  ? 18   PHE C CZ  1 
ATOM   6769  N  N   . ILE C  3  19  ? 62.136 77.713  136.721 1.00 40.10  ? 19   ILE C N   1 
ATOM   6770  C  CA  . ILE C  3  19  ? 61.226 78.407  135.821 1.00 38.20  ? 19   ILE C CA  1 
ATOM   6771  C  C   . ILE C  3  19  ? 61.009 77.723  134.464 1.00 36.62  ? 19   ILE C C   1 
ATOM   6772  O  O   . ILE C  3  19  ? 59.896 77.350  134.117 1.00 36.74  ? 19   ILE C O   1 
ATOM   6773  C  CB  . ILE C  3  19  ? 61.689 79.794  135.570 1.00 38.25  ? 19   ILE C CB  1 
ATOM   6774  C  CG1 . ILE C  3  19  ? 62.259 80.421  136.830 1.00 42.28  ? 19   ILE C CG1 1 
ATOM   6775  C  CG2 . ILE C  3  19  ? 60.577 80.620  134.937 1.00 39.04  ? 19   ILE C CG2 1 
ATOM   6776  C  CD1 . ILE C  3  19  ? 61.321 80.801  137.758 1.00 32.65  ? 19   ILE C CD1 1 
ATOM   6777  N  N   . ASP C  3  20  ? 62.076 77.599  133.694 1.00 34.32  ? 20   ASP C N   1 
ATOM   6778  C  CA  . ASP C  3  20  ? 61.981 77.071  132.359 1.00 31.97  ? 20   ASP C CA  1 
ATOM   6779  C  C   . ASP C  3  20  ? 62.440 75.672  132.250 1.00 29.78  ? 20   ASP C C   1 
ATOM   6780  O  O   . ASP C  3  20  ? 62.526 75.124  131.165 1.00 28.10  ? 20   ASP C O   1 
ATOM   6781  C  CB  . ASP C  3  20  ? 62.782 77.932  131.430 1.00 32.20  ? 20   ASP C CB  1 
ATOM   6782  C  CG  . ASP C  3  20  ? 62.066 79.166  131.048 1.00 34.15  ? 20   ASP C CG  1 
ATOM   6783  O  OD1 . ASP C  3  20  ? 62.626 79.931  130.232 1.00 26.80  ? 20   ASP C OD1 1 
ATOM   6784  O  OD2 . ASP C  3  20  ? 60.937 79.476  131.505 1.00 27.59  ? 20   ASP C OD2 1 
ATOM   6785  N  N   . LEU C  3  21  ? 62.770 75.098  133.382 1.00 29.95  ? 21   LEU C N   1 
ATOM   6786  C  CA  . LEU C  3  21  ? 63.227 73.739  133.441 1.00 30.13  ? 21   LEU C CA  1 
ATOM   6787  C  C   . LEU C  3  21  ? 62.176 72.829  132.827 1.00 30.55  ? 21   LEU C C   1 
ATOM   6788  O  O   . LEU C  3  21  ? 60.983 72.869  133.208 1.00 30.27  ? 21   LEU C O   1 
ATOM   6789  C  CB  . LEU C  3  21  ? 63.458 73.366  134.898 1.00 30.36  ? 21   LEU C CB  1 
ATOM   6790  C  CG  . LEU C  3  21  ? 63.675 71.905  135.256 1.00 38.56  ? 21   LEU C CG  1 
ATOM   6791  C  CD1 . LEU C  3  21  ? 65.085 71.479  134.932 1.00 34.05  ? 21   LEU C CD1 1 
ATOM   6792  C  CD2 . LEU C  3  21  ? 63.405 71.734  136.728 1.00 44.84  ? 21   LEU C CD2 1 
ATOM   6793  N  N   . PRO C  3  22  ? 62.573 72.093  131.791 1.00 31.02  ? 22   PRO C N   1 
ATOM   6794  C  CA  . PRO C  3  22  ? 61.655 71.119  131.142 1.00 30.36  ? 22   PRO C CA  1 
ATOM   6795  C  C   . PRO C  3  22  ? 61.444 69.988  132.102 1.00 30.77  ? 22   PRO C C   1 
ATOM   6796  O  O   . PRO C  3  22  ? 62.438 69.334  132.492 1.00 31.12  ? 22   PRO C O   1 
ATOM   6797  C  CB  . PRO C  3  22  ? 62.442 70.627  129.937 1.00 29.70  ? 22   PRO C CB  1 
ATOM   6798  C  CG  . PRO C  3  22  ? 63.545 71.651  129.745 1.00 24.46  ? 22   PRO C CG  1 
ATOM   6799  C  CD  . PRO C  3  22  ? 63.899 72.140  131.150 1.00 30.76  ? 22   PRO C CD  1 
ATOM   6800  N  N   . ALA C  3  23  ? 60.189 69.798  132.524 1.00 30.35  ? 23   ALA C N   1 
ATOM   6801  C  CA  . ALA C  3  23  ? 59.814 68.773  133.461 1.00 30.51  ? 23   ALA C CA  1 
ATOM   6802  C  C   . ALA C  3  23  ? 58.810 67.816  132.785 1.00 30.84  ? 23   ALA C C   1 
ATOM   6803  O  O   . ALA C  3  23  ? 58.075 68.239  131.895 1.00 31.19  ? 23   ALA C O   1 
ATOM   6804  C  CB  . ALA C  3  23  ? 59.175 69.426  134.661 1.00 30.49  ? 23   ALA C CB  1 
ATOM   6805  N  N   . PRO C  3  24  ? 58.750 66.549  133.217 1.00 30.37  ? 24   PRO C N   1 
ATOM   6806  C  CA  . PRO C  3  24  ? 57.827 65.602  132.613 1.00 30.48  ? 24   PRO C CA  1 
ATOM   6807  C  C   . PRO C  3  24  ? 56.459 65.988  133.002 1.00 32.49  ? 24   PRO C C   1 
ATOM   6808  O  O   . PRO C  3  24  ? 56.250 66.374  134.119 1.00 34.39  ? 24   PRO C O   1 
ATOM   6809  C  CB  . PRO C  3  24  ? 58.196 64.286  133.278 1.00 29.84  ? 24   PRO C CB  1 
ATOM   6810  C  CG  . PRO C  3  24  ? 59.496 64.489  133.838 1.00 30.45  ? 24   PRO C CG  1 
ATOM   6811  C  CD  . PRO C  3  24  ? 59.530 65.923  134.292 1.00 30.12  ? 24   PRO C CD  1 
ATOM   6812  N  N   . SER C  3  25  ? 55.511 65.839  132.114 1.00 32.96  ? 25   SER C N   1 
ATOM   6813  C  CA  . SER C  3  25  ? 54.151 66.250  132.389 1.00 33.68  ? 25   SER C CA  1 
ATOM   6814  C  C   . SER C  3  25  ? 53.385 65.348  133.300 1.00 34.50  ? 25   SER C C   1 
ATOM   6815  O  O   . SER C  3  25  ? 52.264 65.684  133.683 1.00 35.13  ? 25   SER C O   1 
ATOM   6816  C  CB  . SER C  3  25  ? 53.389 66.253  131.101 1.00 33.94  ? 25   SER C CB  1 
ATOM   6817  O  OG  . SER C  3  25  ? 53.150 64.916  130.704 1.00 29.69  ? 25   SER C OG  1 
ATOM   6818  N  N   . ASN C  3  26  ? 53.949 64.193  133.640 1.00 34.59  ? 26   ASN C N   1 
ATOM   6819  C  CA  . ASN C  3  26  ? 53.191 63.192  134.384 1.00 34.63  ? 26   ASN C CA  1 
ATOM   6820  C  C   . ASN C  3  26  ? 53.729 62.788  135.749 1.00 34.53  ? 26   ASN C C   1 
ATOM   6821  O  O   . ASN C  3  26  ? 53.354 61.739  136.261 1.00 33.53  ? 26   ASN C O   1 
ATOM   6822  C  CB  . ASN C  3  26  ? 53.055 61.931  133.518 1.00 34.72  ? 26   ASN C CB  1 
ATOM   6823  C  CG  . ASN C  3  26  ? 54.355 61.162  133.428 1.00 36.61  ? 26   ASN C CG  1 
ATOM   6824  O  OD1 . ASN C  3  26  ? 55.387 61.745  133.187 1.00 31.84  ? 26   ASN C OD1 1 
ATOM   6825  N  ND2 . ASN C  3  26  ? 54.315 59.857  133.734 1.00 37.85  ? 26   ASN C ND2 1 
ATOM   6826  N  N   . ILE C  3  27  ? 54.672 63.551  136.306 1.00 35.77  ? 27   ILE C N   1 
ATOM   6827  C  CA  . ILE C  3  27  ? 55.165 63.210  137.642 1.00 36.03  ? 27   ILE C CA  1 
ATOM   6828  C  C   . ILE C  3  27  ? 54.047 63.456  138.621 1.00 36.99  ? 27   ILE C C   1 
ATOM   6829  O  O   . ILE C  3  27  ? 53.245 64.384  138.446 1.00 37.59  ? 27   ILE C O   1 
ATOM   6830  C  CB  . ILE C  3  27  ? 56.463 63.957  138.044 1.00 35.31  ? 27   ILE C CB  1 
ATOM   6831  C  CG1 . ILE C  3  27  ? 56.357 65.423  137.733 1.00 39.23  ? 27   ILE C CG1 1 
ATOM   6832  C  CG2 . ILE C  3  27  ? 57.635 63.370  137.349 1.00 35.79  ? 27   ILE C CG2 1 
ATOM   6833  C  CD1 . ILE C  3  27  ? 57.617 66.305  138.124 1.00 27.42  ? 27   ILE C CD1 1 
ATOM   6834  N  N   . SER C  3  28  ? 53.952 62.581  139.609 1.00 37.04  ? 28   SER C N   1 
ATOM   6835  C  CA  . SER C  3  28  ? 52.903 62.646  140.602 1.00 37.66  ? 28   SER C CA  1 
ATOM   6836  C  C   . SER C  3  28  ? 53.447 63.048  142.003 1.00 37.81  ? 28   SER C C   1 
ATOM   6837  O  O   . SER C  3  28  ? 54.644 63.254  142.174 1.00 37.75  ? 28   SER C O   1 
ATOM   6838  C  CB  . SER C  3  28  ? 52.335 61.256  140.738 1.00 37.58  ? 28   SER C CB  1 
ATOM   6839  O  OG  . SER C  3  28  ? 53.369 60.373  141.151 1.00 31.22  ? 28   SER C OG  1 
ATOM   6840  N  N   . SER C  3  29  ? 52.538 63.157  142.985 1.00 37.70  ? 29   SER C N   1 
ATOM   6841  C  CA  . SER C  3  29  ? 52.939 63.351  144.389 1.00 37.84  ? 29   SER C CA  1 
ATOM   6842  C  C   . SER C  3  29  ? 53.797 62.134  144.531 1.00 37.31  ? 29   SER C C   1 
ATOM   6843  O  O   . SER C  3  29  ? 53.399 61.081  144.101 1.00 38.00  ? 29   SER C O   1 
ATOM   6844  C  CB  . SER C  3  29  ? 51.715 63.176  145.331 1.00 38.27  ? 29   SER C CB  1 
ATOM   6845  O  OG  . SER C  3  29  ? 50.527 63.766  144.808 1.00 42.50  ? 29   SER C OG  1 
ATOM   6846  N  N   . TRP C  3  30  ? 54.957 62.291  145.114 1.00 36.11  ? 30   TRP C N   1 
ATOM   6847  C  CA  . TRP C  3  30  ? 56.014 61.227  145.253 1.00 35.78  ? 30   TRP C CA  1 
ATOM   6848  C  C   . TRP C  3  30  ? 57.161 61.940  144.637 1.00 36.21  ? 30   TRP C C   1 
ATOM   6849  O  O   . TRP C  3  30  ? 58.288 61.661  144.912 1.00 37.37  ? 30   TRP C O   1 
ATOM   6850  C  CB  . TRP C  3  30  ? 55.792 59.874  144.491 1.00 34.58  ? 30   TRP C CB  1 
ATOM   6851  C  CG  . TRP C  3  30  ? 54.746 58.873  145.076 1.00 34.95  ? 30   TRP C CG  1 
ATOM   6852  C  CD1 . TRP C  3  30  ? 53.756 58.223  144.375 1.00 27.12  ? 30   TRP C CD1 1 
ATOM   6853  C  CD2 . TRP C  3  30  ? 54.614 58.413  146.443 1.00 32.98  ? 30   TRP C CD2 1 
ATOM   6854  N  NE1 . TRP C  3  30  ? 53.022 57.436  145.219 1.00 20.49  ? 30   TRP C NE1 1 
ATOM   6855  C  CE2 . TRP C  3  30  ? 53.526 57.534  146.485 1.00 26.85  ? 30   TRP C CE2 1 
ATOM   6856  C  CE3 . TRP C  3  30  ? 55.295 58.664  147.623 1.00 27.27  ? 30   TRP C CE3 1 
ATOM   6857  C  CZ2 . TRP C  3  30  ? 53.113 56.922  147.653 1.00 32.62  ? 30   TRP C CZ2 1 
ATOM   6858  C  CZ3 . TRP C  3  30  ? 54.871 58.054  148.771 1.00 32.34  ? 30   TRP C CZ3 1 
ATOM   6859  C  CH2 . TRP C  3  30  ? 53.805 57.190  148.775 1.00 32.23  ? 30   TRP C CH2 1 
ATOM   6860  N  N   . TRP C  3  31  ? 56.858 62.868  143.766 1.00 35.40  ? 31   TRP C N   1 
ATOM   6861  C  CA  . TRP C  3  31  ? 57.883 63.689  143.246 1.00 35.40  ? 31   TRP C CA  1 
ATOM   6862  C  C   . TRP C  3  31  ? 57.940 64.947  144.092 1.00 35.85  ? 31   TRP C C   1 
ATOM   6863  O  O   . TRP C  3  31  ? 58.877 65.729  143.975 1.00 37.22  ? 31   TRP C O   1 
ATOM   6864  C  CB  . TRP C  3  31  ? 57.681 63.996  141.746 1.00 35.20  ? 31   TRP C CB  1 
ATOM   6865  C  CG  . TRP C  3  31  ? 58.447 63.045  140.883 1.00 31.91  ? 31   TRP C CG  1 
ATOM   6866  C  CD1 . TRP C  3  31  ? 59.637 63.267  140.321 1.00 26.87  ? 31   TRP C CD1 1 
ATOM   6867  C  CD2 . TRP C  3  31  ? 58.111 61.678  140.584 1.00 30.58  ? 31   TRP C CD2 1 
ATOM   6868  N  NE1 . TRP C  3  31  ? 60.085 62.141  139.672 1.00 24.68  ? 31   TRP C NE1 1 
ATOM   6869  C  CE2 . TRP C  3  31  ? 59.162 61.152  139.811 1.00 30.66  ? 31   TRP C CE2 1 
ATOM   6870  C  CE3 . TRP C  3  31  ? 57.027 60.852  140.886 1.00 38.08  ? 31   TRP C CE3 1 
ATOM   6871  C  CZ2 . TRP C  3  31  ? 59.159 59.842  139.308 1.00 33.03  ? 31   TRP C CZ2 1 
ATOM   6872  C  CZ3 . TRP C  3  31  ? 57.027 59.529  140.399 1.00 44.79  ? 31   TRP C CZ3 1 
ATOM   6873  C  CH2 . TRP C  3  31  ? 58.094 59.043  139.627 1.00 40.80  ? 31   TRP C CH2 1 
ATOM   6874  N  N   . ASN C  3  32  ? 56.963 65.132  144.982 1.00 34.59  ? 32   ASN C N   1 
ATOM   6875  C  CA  . ASN C  3  32  ? 56.935 66.333  145.820 1.00 33.84  ? 32   ASN C CA  1 
ATOM   6876  C  C   . ASN C  3  32  ? 57.916 66.302  146.960 1.00 33.22  ? 32   ASN C C   1 
ATOM   6877  O  O   . ASN C  3  32  ? 58.348 67.342  147.421 1.00 32.72  ? 32   ASN C O   1 
ATOM   6878  C  CB  . ASN C  3  32  ? 55.541 66.621  146.375 1.00 33.92  ? 32   ASN C CB  1 
ATOM   6879  C  CG  . ASN C  3  32  ? 54.605 67.234  145.346 1.00 38.27  ? 32   ASN C CG  1 
ATOM   6880  O  OD1 . ASN C  3  32  ? 54.250 68.400  145.446 1.00 44.37  ? 32   ASN C OD1 1 
ATOM   6881  N  ND2 . ASN C  3  32  ? 54.142 66.427  144.407 1.00 39.95  ? 32   ASN C ND2 1 
ATOM   6882  N  N   . PHE C  3  33  ? 58.321 65.107  147.373 1.00 33.43  ? 33   PHE C N   1 
ATOM   6883  C  CA  . PHE C  3  33  ? 59.208 64.968  148.525 1.00 34.11  ? 33   PHE C CA  1 
ATOM   6884  C  C   . PHE C  3  33  ? 60.611 65.603  148.374 1.00 35.88  ? 33   PHE C C   1 
ATOM   6885  O  O   . PHE C  3  33  ? 61.288 65.902  149.372 1.00 36.61  ? 33   PHE C O   1 
ATOM   6886  C  CB  . PHE C  3  33  ? 59.212 63.539  149.077 1.00 33.45  ? 33   PHE C CB  1 
ATOM   6887  C  CG  . PHE C  3  33  ? 57.843 63.069  149.509 1.00 34.13  ? 33   PHE C CG  1 
ATOM   6888  C  CD1 . PHE C  3  33  ? 57.338 63.412  150.761 1.00 34.08  ? 33   PHE C CD1 1 
ATOM   6889  C  CD2 . PHE C  3  33  ? 57.019 62.343  148.632 1.00 36.64  ? 33   PHE C CD2 1 
ATOM   6890  C  CE1 . PHE C  3  33  ? 56.031 63.014  151.159 1.00 31.03  ? 33   PHE C CE1 1 
ATOM   6891  C  CE2 . PHE C  3  33  ? 55.718 61.924  149.021 1.00 30.22  ? 33   PHE C CE2 1 
ATOM   6892  C  CZ  . PHE C  3  33  ? 55.220 62.272  150.278 1.00 28.21  ? 33   PHE C CZ  1 
ATOM   6893  N  N   . GLY C  3  34  ? 61.004 65.891  147.144 1.00 36.07  ? 34   GLY C N   1 
ATOM   6894  C  CA  . GLY C  3  34  ? 62.253 66.560  146.930 1.00 36.61  ? 34   GLY C CA  1 
ATOM   6895  C  C   . GLY C  3  34  ? 62.195 68.013  147.387 1.00 36.79  ? 34   GLY C C   1 
ATOM   6896  O  O   . GLY C  3  34  ? 63.131 68.501  148.025 1.00 37.47  ? 34   GLY C O   1 
ATOM   6897  N  N   . SER C  3  35  ? 61.113 68.708  147.034 1.00 35.80  ? 35   SER C N   1 
ATOM   6898  C  CA  . SER C  3  35  ? 60.925 70.091  147.453 1.00 34.63  ? 35   SER C CA  1 
ATOM   6899  C  C   . SER C  3  35  ? 60.582 70.112  148.971 1.00 34.03  ? 35   SER C C   1 
ATOM   6900  O  O   . SER C  3  35  ? 61.052 70.981  149.718 1.00 33.52  ? 35   SER C O   1 
ATOM   6901  C  CB  . SER C  3  35  ? 59.828 70.779  146.621 1.00 34.09  ? 35   SER C CB  1 
ATOM   6902  O  OG  . SER C  3  35  ? 58.632 70.011  146.595 1.00 26.50  ? 35   SER C OG  1 
ATOM   6903  N  N   . LEU C  3  36  ? 59.804 69.124  149.408 1.00 33.41  ? 36   LEU C N   1 
ATOM   6904  C  CA  . LEU C  3  36  ? 59.444 69.001  150.806 1.00 32.95  ? 36   LEU C CA  1 
ATOM   6905  C  C   . LEU C  3  36  ? 60.672 68.774  151.681 1.00 33.00  ? 36   LEU C C   1 
ATOM   6906  O  O   . LEU C  3  36  ? 60.727 69.276  152.780 1.00 33.13  ? 36   LEU C O   1 
ATOM   6907  C  CB  . LEU C  3  36  ? 58.423 67.904  151.008 1.00 32.47  ? 36   LEU C CB  1 
ATOM   6908  C  CG  . LEU C  3  36  ? 57.114 68.219  150.316 1.00 29.14  ? 36   LEU C CG  1 
ATOM   6909  C  CD1 . LEU C  3  36  ? 56.123 67.085  150.505 1.00 18.99  ? 36   LEU C CD1 1 
ATOM   6910  C  CD2 . LEU C  3  36  ? 56.562 69.538  150.830 1.00 26.66  ? 36   LEU C CD2 1 
ATOM   6911  N  N   . LEU C  3  37  ? 61.648 67.999  151.194 1.00 32.88  ? 37   LEU C N   1 
ATOM   6912  C  CA  . LEU C  3  37  ? 62.903 67.838  151.935 1.00 32.92  ? 37   LEU C CA  1 
ATOM   6913  C  C   . LEU C  3  37  ? 63.599 69.237  151.950 1.00 33.60  ? 37   LEU C C   1 
ATOM   6914  O  O   . LEU C  3  37  ? 64.149 69.668  152.990 1.00 33.91  ? 37   LEU C O   1 
ATOM   6915  C  CB  . LEU C  3  37  ? 63.822 66.767  151.285 1.00 32.57  ? 37   LEU C CB  1 
ATOM   6916  C  CG  . LEU C  3  37  ? 63.381 65.299  151.470 1.00 32.30  ? 37   LEU C CG  1 
ATOM   6917  C  CD1 . LEU C  3  37  ? 64.051 64.349  150.516 1.00 22.34  ? 37   LEU C CD1 1 
ATOM   6918  C  CD2 . LEU C  3  37  ? 63.522 64.839  152.890 1.00 28.11  ? 37   LEU C CD2 1 
ATOM   6919  N  N   . GLY C  3  38  ? 63.526 69.949  150.807 1.00 33.16  ? 38   GLY C N   1 
ATOM   6920  C  CA  . GLY C  3  38  ? 64.073 71.284  150.700 1.00 32.78  ? 38   GLY C CA  1 
ATOM   6921  C  C   . GLY C  3  38  ? 63.506 72.174  151.794 1.00 32.80  ? 38   GLY C C   1 
ATOM   6922  O  O   . GLY C  3  38  ? 64.261 72.753  152.531 1.00 32.66  ? 38   GLY C O   1 
ATOM   6923  N  N   . ILE C  3  39  ? 62.167 72.217  151.917 1.00 33.42  ? 39   ILE C N   1 
ATOM   6924  C  CA  . ILE C  3  39  ? 61.465 72.980  152.975 1.00 34.09  ? 39   ILE C CA  1 
ATOM   6925  C  C   . ILE C  3  39  ? 61.876 72.496  154.388 1.00 34.12  ? 39   ILE C C   1 
ATOM   6926  O  O   . ILE C  3  39  ? 62.188 73.305  155.254 1.00 34.01  ? 39   ILE C O   1 
ATOM   6927  C  CB  . ILE C  3  39  ? 59.880 72.844  152.830 1.00 34.53  ? 39   ILE C CB  1 
ATOM   6928  C  CG1 . ILE C  3  39  ? 59.419 73.202  151.412 1.00 40.32  ? 39   ILE C CG1 1 
ATOM   6929  C  CG2 . ILE C  3  39  ? 59.154 73.741  153.866 1.00 33.09  ? 39   ILE C CG2 1 
ATOM   6930  C  CD1 . ILE C  3  39  ? 58.867 74.586  151.277 1.00 38.96  ? 39   ILE C CD1 1 
ATOM   6931  N  N   . CYS C  3  40  ? 61.919 71.177  154.585 1.00 34.01  ? 40   CYS C N   1 
ATOM   6932  C  CA  . CYS C  3  40  ? 62.279 70.619  155.890 1.00 34.27  ? 40   CYS C CA  1 
ATOM   6933  C  C   . CYS C  3  40  ? 63.686 71.023  156.251 1.00 35.02  ? 40   CYS C C   1 
ATOM   6934  O  O   . CYS C  3  40  ? 63.972 71.267  157.414 1.00 35.62  ? 40   CYS C O   1 
ATOM   6935  C  CB  . CYS C  3  40  ? 62.149 69.069  155.933 1.00 34.08  ? 40   CYS C CB  1 
ATOM   6936  S  SG  . CYS C  3  40  ? 60.429 68.368  155.955 1.00 30.96  ? 40   CYS C SG  1 
ATOM   6937  N  N   . LEU C  3  41  ? 64.566 71.123  155.253 1.00 34.84  ? 41   LEU C N   1 
ATOM   6938  C  CA  . LEU C  3  41  ? 65.931 71.505  155.524 1.00 34.46  ? 41   LEU C CA  1 
ATOM   6939  C  C   . LEU C  3  41  ? 65.977 72.898  155.976 1.00 34.73  ? 41   LEU C C   1 
ATOM   6940  O  O   . LEU C  3  41  ? 66.682 73.204  156.932 1.00 34.51  ? 41   LEU C O   1 
ATOM   6941  C  CB  . LEU C  3  41  ? 66.832 71.311  154.328 1.00 34.09  ? 41   LEU C CB  1 
ATOM   6942  C  CG  . LEU C  3  41  ? 68.318 71.662  154.522 1.00 30.26  ? 41   LEU C CG  1 
ATOM   6943  C  CD1 . LEU C  3  41  ? 68.968 71.052  155.775 1.00 22.11  ? 41   LEU C CD1 1 
ATOM   6944  C  CD2 . LEU C  3  41  ? 69.100 71.307  153.315 1.00 33.48  ? 41   LEU C CD2 1 
ATOM   6945  N  N   . ILE C  3  42  ? 65.221 73.777  155.324 1.00 35.36  ? 42   ILE C N   1 
ATOM   6946  C  CA  . ILE C  3  42  ? 65.250 75.172  155.766 1.00 36.17  ? 42   ILE C CA  1 
ATOM   6947  C  C   . ILE C  3  42  ? 64.551 75.400  157.086 1.00 35.83  ? 42   ILE C C   1 
ATOM   6948  O  O   . ILE C  3  42  ? 65.064 76.107  157.929 1.00 35.82  ? 42   ILE C O   1 
ATOM   6949  C  CB  . ILE C  3  42  ? 64.923 76.267  154.611 1.00 36.89  ? 42   ILE C CB  1 
ATOM   6950  C  CG1 . ILE C  3  42  ? 64.031 77.401  155.150 1.00 46.18  ? 42   ILE C CG1 1 
ATOM   6951  C  CG2 . ILE C  3  42  ? 64.265 75.649  153.432 1.00 46.74  ? 42   ILE C CG2 1 
ATOM   6952  C  CD1 . ILE C  3  42  ? 63.800 78.551  154.150 1.00 50.88  ? 42   ILE C CD1 1 
ATOM   6953  N  N   . LEU C  3  43  ? 63.434 74.695  157.289 1.00 35.94  ? 43   LEU C N   1 
ATOM   6954  C  CA  . LEU C  3  43  ? 62.664 74.757  158.522 1.00 35.89  ? 43   LEU C CA  1 
ATOM   6955  C  C   . LEU C  3  43  ? 63.524 74.328  159.696 1.00 35.67  ? 43   LEU C C   1 
ATOM   6956  O  O   . LEU C  3  43  ? 63.513 74.982  160.752 1.00 35.52  ? 43   LEU C O   1 
ATOM   6957  C  CB  . LEU C  3  43  ? 61.432 73.882  158.408 1.00 36.33  ? 43   LEU C CB  1 
ATOM   6958  C  CG  . LEU C  3  43  ? 60.391 73.878  159.530 1.00 47.28  ? 43   LEU C CG  1 
ATOM   6959  C  CD1 . LEU C  3  43  ? 58.997 74.000  158.920 1.00 46.13  ? 43   LEU C CD1 1 
ATOM   6960  C  CD2 . LEU C  3  43  ? 60.508 72.610  160.396 1.00 47.17  ? 43   LEU C CD2 1 
ATOM   6961  N  N   . GLN C  3  44  ? 64.303 73.253  159.498 1.00 35.53  ? 44   GLN C N   1 
ATOM   6962  C  CA  . GLN C  3  44  ? 65.255 72.766  160.526 1.00 35.58  ? 44   GLN C CA  1 
ATOM   6963  C  C   . GLN C  3  44  ? 66.352 73.755  160.843 1.00 35.33  ? 44   GLN C C   1 
ATOM   6964  O  O   . GLN C  3  44  ? 66.804 73.823  161.958 1.00 35.55  ? 44   GLN C O   1 
ATOM   6965  C  CB  . GLN C  3  44  ? 65.900 71.438  160.117 1.00 35.65  ? 44   GLN C CB  1 
ATOM   6966  C  CG  . GLN C  3  44  ? 65.006 70.258  160.279 1.00 40.85  ? 44   GLN C CG  1 
ATOM   6967  C  CD  . GLN C  3  44  ? 64.300 70.239  161.626 1.00 39.61  ? 44   GLN C CD  1 
ATOM   6968  O  OE1 . GLN C  3  44  ? 63.153 70.730  161.749 1.00 29.72  ? 44   GLN C OE1 1 
ATOM   6969  N  NE2 . GLN C  3  44  ? 64.969 69.661  162.646 1.00 32.76  ? 44   GLN C NE2 1 
ATOM   6970  N  N   . ILE C  3  45  ? 66.788 74.497  159.844 1.00 35.09  ? 45   ILE C N   1 
ATOM   6971  C  CA  . ILE C  3  45  ? 67.842 75.490  160.014 1.00 35.40  ? 45   ILE C CA  1 
ATOM   6972  C  C   . ILE C  3  45  ? 67.352 76.741  160.726 1.00 36.09  ? 45   ILE C C   1 
ATOM   6973  O  O   . ILE C  3  45  ? 67.973 77.208  161.657 1.00 36.00  ? 45   ILE C O   1 
ATOM   6974  C  CB  . ILE C  3  45  ? 68.470 75.831  158.641 1.00 35.27  ? 45   ILE C CB  1 
ATOM   6975  C  CG1 . ILE C  3  45  ? 69.397 74.699  158.212 1.00 33.22  ? 45   ILE C CG1 1 
ATOM   6976  C  CG2 . ILE C  3  45  ? 69.225 77.136  158.684 1.00 20.35  ? 45   ILE C CG2 1 
ATOM   6977  C  CD1 . ILE C  3  45  ? 70.079 74.937  156.922 1.00 39.67  ? 45   ILE C CD1 1 
ATOM   6978  N  N   . LEU C  3  46  ? 66.193 77.230  160.316 1.00 37.07  ? 46   LEU C N   1 
ATOM   6979  C  CA  . LEU C  3  46  ? 65.593 78.430  160.888 1.00 37.70  ? 46   LEU C CA  1 
ATOM   6980  C  C   . LEU C  3  46  ? 65.181 78.261  162.385 1.00 37.89  ? 46   LEU C C   1 
ATOM   6981  O  O   . LEU C  3  46  ? 65.622 79.029  163.235 1.00 38.52  ? 46   LEU C O   1 
ATOM   6982  C  CB  . LEU C  3  46  ? 64.419 78.851  160.039 1.00 38.27  ? 46   LEU C CB  1 
ATOM   6983  C  CG  . LEU C  3  46  ? 64.402 80.326  159.710 1.00 57.37  ? 46   LEU C CG  1 
ATOM   6984  C  CD1 . LEU C  3  46  ? 63.927 80.592  158.268 1.00 57.13  ? 46   LEU C CD1 1 
ATOM   6985  C  CD2 . LEU C  3  46  ? 63.583 81.079  160.742 1.00 65.39  ? 46   LEU C CD2 1 
ATOM   6986  N  N   . THR C  3  47  ? 64.352 77.259  162.698 1.00 37.09  ? 47   THR C N   1 
ATOM   6987  C  CA  . THR C  3  47  ? 64.002 76.994  164.088 1.00 36.07  ? 47   THR C CA  1 
ATOM   6988  C  C   . THR C  3  47  ? 65.247 76.559  164.835 1.00 35.94  ? 47   THR C C   1 
ATOM   6989  O  O   . THR C  3  47  ? 65.386 76.837  166.003 1.00 36.60  ? 47   THR C O   1 
ATOM   6990  C  CB  . THR C  3  47  ? 62.938 75.894  164.214 1.00 35.80  ? 47   THR C CB  1 
ATOM   6991  O  OG1 . THR C  3  47  ? 63.407 74.692  163.583 1.00 28.25  ? 47   THR C OG1 1 
ATOM   6992  C  CG2 . THR C  3  47  ? 61.642 76.281  163.457 1.00 17.13  ? 47   THR C CG2 1 
ATOM   6993  N  N   . GLY C  3  48  ? 66.145 75.862  164.156 1.00 35.44  ? 48   GLY C N   1 
ATOM   6994  C  CA  . GLY C  3  48  ? 67.405 75.476  164.757 1.00 35.41  ? 48   GLY C CA  1 
ATOM   6995  C  C   . GLY C  3  48  ? 68.261 76.677  165.199 1.00 35.73  ? 48   GLY C C   1 
ATOM   6996  O  O   . GLY C  3  48  ? 68.876 76.629  166.262 1.00 36.35  ? 48   GLY C O   1 
ATOM   6997  N  N   . LEU C  3  49  ? 68.280 77.754  164.402 1.00 35.06  ? 49   LEU C N   1 
ATOM   6998  C  CA  . LEU C  3  49  ? 69.057 78.952  164.746 1.00 34.76  ? 49   LEU C CA  1 
ATOM   6999  C  C   . LEU C  3  49  ? 68.458 79.687  165.946 1.00 34.62  ? 49   LEU C C   1 
ATOM   7000  O  O   . LEU C  3  49  ? 69.176 80.076  166.873 1.00 34.58  ? 49   LEU C O   1 
ATOM   7001  C  CB  . LEU C  3  49  ? 69.167 79.919  163.546 1.00 34.83  ? 49   LEU C CB  1 
ATOM   7002  C  CG  . LEU C  3  49  ? 70.177 81.080  163.736 1.00 39.82  ? 49   LEU C CG  1 
ATOM   7003  C  CD1 . LEU C  3  49  ? 71.606 80.516  163.850 1.00 33.95  ? 49   LEU C CD1 1 
ATOM   7004  C  CD2 . LEU C  3  49  ? 70.099 82.202  162.626 1.00 32.05  ? 49   LEU C CD2 1 
ATOM   7005  N  N   . PHE C  3  50  ? 67.143 79.861  165.939 1.00 34.70  ? 50   PHE C N   1 
ATOM   7006  C  CA  . PHE C  3  50  ? 66.477 80.556  167.035 1.00 35.17  ? 50   PHE C CA  1 
ATOM   7007  C  C   . PHE C  3  50  ? 66.648 79.811  168.385 1.00 35.25  ? 50   PHE C C   1 
ATOM   7008  O  O   . PHE C  3  50  ? 66.768 80.440  169.441 1.00 35.08  ? 50   PHE C O   1 
ATOM   7009  C  CB  . PHE C  3  50  ? 65.009 80.833  166.713 1.00 35.34  ? 50   PHE C CB  1 
ATOM   7010  C  CG  . PHE C  3  50  ? 64.801 82.006  165.795 1.00 36.20  ? 50   PHE C CG  1 
ATOM   7011  C  CD1 . PHE C  3  50  ? 65.197 81.946  164.449 1.00 41.31  ? 50   PHE C CD1 1 
ATOM   7012  C  CD2 . PHE C  3  50  ? 64.201 83.163  166.257 1.00 30.37  ? 50   PHE C CD2 1 
ATOM   7013  C  CE1 . PHE C  3  50  ? 65.008 83.038  163.597 1.00 41.28  ? 50   PHE C CE1 1 
ATOM   7014  C  CE2 . PHE C  3  50  ? 64.002 84.239  165.415 1.00 34.71  ? 50   PHE C CE2 1 
ATOM   7015  C  CZ  . PHE C  3  50  ? 64.413 84.183  164.084 1.00 35.19  ? 50   PHE C CZ  1 
ATOM   7016  N  N   . LEU C  3  51  ? 66.698 78.483  168.333 1.00 34.95  ? 51   LEU C N   1 
ATOM   7017  C  CA  . LEU C  3  51  ? 66.953 77.722  169.525 1.00 35.09  ? 51   LEU C CA  1 
ATOM   7018  C  C   . LEU C  3  51  ? 68.380 77.964  170.002 1.00 35.22  ? 51   LEU C C   1 
ATOM   7019  O  O   . LEU C  3  51  ? 68.616 78.127  171.195 1.00 35.64  ? 51   LEU C O   1 
ATOM   7020  C  CB  . LEU C  3  51  ? 66.707 76.226  169.303 1.00 35.40  ? 51   LEU C CB  1 
ATOM   7021  C  CG  . LEU C  3  51  ? 65.230 75.830  169.218 1.00 32.86  ? 51   LEU C CG  1 
ATOM   7022  C  CD1 . LEU C  3  51  ? 65.089 74.405  168.963 1.00 35.63  ? 51   LEU C CD1 1 
ATOM   7023  C  CD2 . LEU C  3  51  ? 64.515 76.215  170.469 1.00 36.67  ? 51   LEU C CD2 1 
ATOM   7024  N  N   . ALA C  3  52  ? 69.317 78.069  169.063 1.00 34.98  ? 52   ALA C N   1 
ATOM   7025  C  CA  . ALA C  3  52  ? 70.735 78.296  169.406 1.00 34.58  ? 52   ALA C CA  1 
ATOM   7026  C  C   . ALA C  3  52  ? 70.979 79.656  170.060 1.00 34.67  ? 52   ALA C C   1 
ATOM   7027  O  O   . ALA C  3  52  ? 72.024 79.878  170.667 1.00 34.98  ? 52   ALA C O   1 
ATOM   7028  C  CB  . ALA C  3  52  ? 71.646 78.101  168.164 1.00 34.10  ? 52   ALA C CB  1 
ATOM   7029  N  N   . MET C  3  53  ? 70.003 80.558  169.942 1.00 34.39  ? 53   MET C N   1 
ATOM   7030  C  CA  . MET C  3  53  ? 70.096 81.887  170.559 1.00 34.05  ? 53   MET C CA  1 
ATOM   7031  C  C   . MET C  3  53  ? 69.806 81.860  172.082 1.00 33.76  ? 53   MET C C   1 
ATOM   7032  O  O   . MET C  3  53  ? 69.920 82.885  172.763 1.00 33.65  ? 53   MET C O   1 
ATOM   7033  C  CB  . MET C  3  53  ? 69.131 82.872  169.874 1.00 33.99  ? 53   MET C CB  1 
ATOM   7034  C  CG  . MET C  3  53  ? 69.352 83.053  168.367 1.00 35.93  ? 53   MET C CG  1 
ATOM   7035  S  SD  . MET C  3  53  ? 68.296 84.374  167.639 1.00 33.06  ? 53   MET C SD  1 
ATOM   7036  C  CE  . MET C  3  53  ? 67.004 84.100  168.343 1.00 43.46  ? 53   MET C CE  1 
ATOM   7037  N  N   . HIS C  3  54  ? 69.414 80.697  172.607 1.00 33.47  ? 54   HIS C N   1 
ATOM   7038  C  CA  . HIS C  3  54  ? 69.105 80.573  174.029 1.00 33.08  ? 54   HIS C CA  1 
ATOM   7039  C  C   . HIS C  3  54  ? 69.654 79.294  174.608 1.00 33.63  ? 54   HIS C C   1 
ATOM   7040  O  O   . HIS C  3  54  ? 69.787 79.170  175.808 1.00 33.48  ? 54   HIS C O   1 
ATOM   7041  C  CB  . HIS C  3  54  ? 67.613 80.570  174.259 1.00 32.69  ? 54   HIS C CB  1 
ATOM   7042  C  CG  . HIS C  3  54  ? 66.884 81.645  173.544 1.00 27.29  ? 54   HIS C CG  1 
ATOM   7043  N  ND1 . HIS C  3  54  ? 66.670 82.888  174.094 1.00 31.14  ? 54   HIS C ND1 1 
ATOM   7044  C  CD2 . HIS C  3  54  ? 66.281 81.659  172.336 1.00 29.08  ? 54   HIS C CD2 1 
ATOM   7045  C  CE1 . HIS C  3  54  ? 65.978 83.627  173.246 1.00 30.45  ? 54   HIS C CE1 1 
ATOM   7046  N  NE2 . HIS C  3  54  ? 65.737 82.908  172.169 1.00 26.97  ? 54   HIS C NE2 1 
ATOM   7047  N  N   . TYR C  3  55  ? 69.909 78.312  173.754 1.00 34.55  ? 55   TYR C N   1 
ATOM   7048  C  CA  . TYR C  3  55  ? 70.411 77.024  174.210 1.00 35.25  ? 55   TYR C CA  1 
ATOM   7049  C  C   . TYR C  3  55  ? 71.840 77.123  174.768 1.00 36.67  ? 55   TYR C C   1 
ATOM   7050  O  O   . TYR C  3  55  ? 72.647 77.924  174.291 1.00 37.03  ? 55   TYR C O   1 
ATOM   7051  C  CB  . TYR C  3  55  ? 70.364 75.989  173.063 1.00 34.73  ? 55   TYR C CB  1 
ATOM   7052  C  CG  . TYR C  3  55  ? 71.038 74.679  173.414 1.00 29.50  ? 55   TYR C CG  1 
ATOM   7053  C  CD1 . TYR C  3  55  ? 72.287 74.382  172.935 1.00 27.22  ? 55   TYR C CD1 1 
ATOM   7054  C  CD2 . TYR C  3  55  ? 70.433 73.765  174.289 1.00 29.68  ? 55   TYR C CD2 1 
ATOM   7055  C  CE1 . TYR C  3  55  ? 72.912 73.213  173.270 1.00 28.01  ? 55   TYR C CE1 1 
ATOM   7056  C  CE2 . TYR C  3  55  ? 71.063 72.586  174.635 1.00 21.75  ? 55   TYR C CE2 1 
ATOM   7057  C  CZ  . TYR C  3  55  ? 72.307 72.323  174.122 1.00 21.00  ? 55   TYR C CZ  1 
ATOM   7058  O  OH  . TYR C  3  55  ? 72.974 71.181  174.461 1.00 15.96  ? 55   TYR C OH  1 
ATOM   7059  N  N   . THR C  3  56  ? 72.135 76.343  175.801 1.00 37.59  ? 56   THR C N   1 
ATOM   7060  C  CA  . THR C  3  56  ? 73.489 76.292  176.317 1.00 38.93  ? 56   THR C CA  1 
ATOM   7061  C  C   . THR C  3  56  ? 74.026 74.904  176.110 1.00 40.18  ? 56   THR C C   1 
ATOM   7062  O  O   . THR C  3  56  ? 73.373 73.928  176.457 1.00 40.96  ? 56   THR C O   1 
ATOM   7063  C  CB  . THR C  3  56  ? 73.563 76.583  177.817 1.00 39.15  ? 56   THR C CB  1 
ATOM   7064  O  OG1 . THR C  3  56  ? 72.597 77.568  178.207 1.00 40.73  ? 56   THR C OG1 1 
ATOM   7065  C  CG2 . THR C  3  56  ? 74.897 77.212  178.126 1.00 43.66  ? 56   THR C CG2 1 
ATOM   7066  N  N   . SER C  3  57  ? 75.246 74.811  175.627 1.00 40.51  ? 57   SER C N   1 
ATOM   7067  C  CA  . SER C  3  57  ? 75.876 73.533  175.394 1.00 40.93  ? 57   SER C CA  1 
ATOM   7068  C  C   . SER C  3  57  ? 76.582 72.909  176.636 1.00 41.52  ? 57   SER C C   1 
ATOM   7069  O  O   . SER C  3  57  ? 77.345 71.960  176.501 1.00 41.61  ? 57   SER C O   1 
ATOM   7070  C  CB  . SER C  3  57  ? 76.855 73.668  174.248 1.00 40.93  ? 57   SER C CB  1 
ATOM   7071  O  OG  . SER C  3  57  ? 77.973 72.872  174.465 1.00 36.94  ? 57   SER C OG  1 
ATOM   7072  N  N   . ASP C  3  58  ? 76.310 73.429  177.828 1.00 42.13  ? 58   ASP C N   1 
ATOM   7073  C  CA  . ASP C  3  58  ? 76.950 72.899  179.054 1.00 42.80  ? 58   ASP C CA  1 
ATOM   7074  C  C   . ASP C  3  58  ? 76.023 71.994  179.888 1.00 42.57  ? 58   ASP C C   1 
ATOM   7075  O  O   . ASP C  3  58  ? 74.903 72.391  180.233 1.00 42.17  ? 58   ASP C O   1 
ATOM   7076  C  CB  . ASP C  3  58  ? 77.466 74.045  179.927 1.00 43.45  ? 58   ASP C CB  1 
ATOM   7077  C  CG  . ASP C  3  58  ? 78.705 73.662  180.734 1.00 52.77  ? 58   ASP C CG  1 
ATOM   7078  O  OD1 . ASP C  3  58  ? 79.129 72.479  180.671 1.00 56.50  ? 58   ASP C OD1 1 
ATOM   7079  O  OD2 . ASP C  3  58  ? 79.324 74.480  181.449 1.00 49.28  ? 58   ASP C OD2 1 
ATOM   7080  N  N   . THR C  3  59  ? 76.538 70.818  180.278 1.00 42.89  ? 59   THR C N   1 
ATOM   7081  C  CA  . THR C  3  59  ? 75.762 69.819  181.058 1.00 43.30  ? 59   THR C CA  1 
ATOM   7082  C  C   . THR C  3  59  ? 75.056 70.405  182.282 1.00 43.99  ? 59   THR C C   1 
ATOM   7083  O  O   . THR C  3  59  ? 73.984 69.938  182.681 1.00 44.30  ? 59   THR C O   1 
ATOM   7084  C  CB  . THR C  3  59  ? 76.639 68.591  181.473 1.00 42.93  ? 59   THR C CB  1 
ATOM   7085  O  OG1 . THR C  3  59  ? 77.633 68.994  182.425 1.00 39.92  ? 59   THR C OG1 1 
ATOM   7086  C  CG2 . THR C  3  59  ? 77.450 68.079  180.298 1.00 32.72  ? 59   THR C CG2 1 
ATOM   7087  N  N   . THR C  3  60  ? 75.653 71.436  182.845 1.00 44.17  ? 60   THR C N   1 
ATOM   7088  C  CA  . THR C  3  60  ? 75.113 72.146  183.984 1.00 44.66  ? 60   THR C CA  1 
ATOM   7089  C  C   . THR C  3  60  ? 73.778 72.856  183.675 1.00 45.11  ? 60   THR C C   1 
ATOM   7090  O  O   . THR C  3  60  ? 72.857 72.870  184.504 1.00 45.50  ? 60   THR C O   1 
ATOM   7091  C  CB  . THR C  3  60  ? 76.157 73.173  184.426 1.00 44.62  ? 60   THR C CB  1 
ATOM   7092  O  OG1 . THR C  3  60  ? 77.046 72.555  185.351 1.00 44.55  ? 60   THR C OG1 1 
ATOM   7093  C  CG2 . THR C  3  60  ? 75.538 74.308  185.211 1.00 45.23  ? 60   THR C CG2 1 
ATOM   7094  N  N   . THR C  3  61  ? 73.651 73.366  182.455 1.00 44.92  ? 61   THR C N   1 
ATOM   7095  C  CA  . THR C  3  61  ? 72.497 74.163  182.094 1.00 44.53  ? 61   THR C CA  1 
ATOM   7096  C  C   . THR C  3  61  ? 71.807 73.721  180.815 1.00 43.49  ? 61   THR C C   1 
ATOM   7097  O  O   . THR C  3  61  ? 70.824 74.327  180.405 1.00 43.48  ? 61   THR C O   1 
ATOM   7098  C  CB  . THR C  3  61  ? 72.940 75.630  181.984 1.00 45.08  ? 61   THR C CB  1 
ATOM   7099  O  OG1 . THR C  3  61  ? 72.097 76.334  181.066 1.00 57.23  ? 61   THR C OG1 1 
ATOM   7100  C  CG2 . THR C  3  61  ? 74.306 75.697  181.319 1.00 46.82  ? 61   THR C CG2 1 
ATOM   7101  N  N   . ALA C  3  62  ? 72.296 72.651  180.205 1.00 42.34  ? 62   ALA C N   1 
ATOM   7102  C  CA  . ALA C  3  62  ? 71.724 72.168  178.969 1.00 41.62  ? 62   ALA C CA  1 
ATOM   7103  C  C   . ALA C  3  62  ? 70.195 71.978  179.042 1.00 41.30  ? 62   ALA C C   1 
ATOM   7104  O  O   . ALA C  3  62  ? 69.439 72.654  178.314 1.00 41.39  ? 62   ALA C O   1 
ATOM   7105  C  CB  . ALA C  3  62  ? 72.394 70.892  178.550 1.00 41.66  ? 62   ALA C CB  1 
ATOM   7106  N  N   . PHE C  3  63  ? 69.751 71.079  179.933 1.00 40.47  ? 63   PHE C N   1 
ATOM   7107  C  CA  . PHE C  3  63  ? 68.327 70.771  180.115 1.00 39.55  ? 63   PHE C CA  1 
ATOM   7108  C  C   . PHE C  3  63  ? 67.569 72.022  180.511 1.00 38.45  ? 63   PHE C C   1 
ATOM   7109  O  O   . PHE C  3  63  ? 66.503 72.302  179.975 1.00 38.35  ? 63   PHE C O   1 
ATOM   7110  C  CB  . PHE C  3  63  ? 68.171 69.719  181.220 1.00 39.76  ? 63   PHE C CB  1 
ATOM   7111  C  CG  . PHE C  3  63  ? 66.860 68.996  181.209 1.00 44.56  ? 63   PHE C CG  1 
ATOM   7112  C  CD1 . PHE C  3  63  ? 66.788 67.677  180.770 1.00 42.03  ? 63   PHE C CD1 1 
ATOM   7113  C  CD2 . PHE C  3  63  ? 65.706 69.598  181.719 1.00 49.02  ? 63   PHE C CD2 1 
ATOM   7114  C  CE1 . PHE C  3  63  ? 65.581 66.993  180.800 1.00 45.86  ? 63   PHE C CE1 1 
ATOM   7115  C  CE2 . PHE C  3  63  ? 64.497 68.924  181.743 1.00 49.05  ? 63   PHE C CE2 1 
ATOM   7116  C  CZ  . PHE C  3  63  ? 64.430 67.635  181.278 1.00 47.56  ? 63   PHE C CZ  1 
ATOM   7117  N  N   . SER C  3  64  ? 68.138 72.763  181.455 1.00 37.52  ? 64   SER C N   1 
ATOM   7118  C  CA  . SER C  3  64  ? 67.533 73.975  181.983 1.00 37.14  ? 64   SER C CA  1 
ATOM   7119  C  C   . SER C  3  64  ? 67.291 75.016  180.896 1.00 36.52  ? 64   SER C C   1 
ATOM   7120  O  O   . SER C  3  64  ? 66.247 75.656  180.870 1.00 35.98  ? 64   SER C O   1 
ATOM   7121  C  CB  . SER C  3  64  ? 68.425 74.559  183.094 1.00 37.47  ? 64   SER C CB  1 
ATOM   7122  O  OG  . SER C  3  64  ? 67.670 75.312  184.034 1.00 47.24  ? 64   SER C OG  1 
ATOM   7123  N  N   . SER C  3  65  ? 68.271 75.175  179.997 1.00 36.44  ? 65   SER C N   1 
ATOM   7124  C  CA  . SER C  3  65  ? 68.149 76.106  178.888 1.00 36.16  ? 65   SER C CA  1 
ATOM   7125  C  C   . SER C  3  65  ? 67.033 75.646  177.954 1.00 35.67  ? 65   SER C C   1 
ATOM   7126  O  O   . SER C  3  65  ? 66.273 76.457  177.460 1.00 35.69  ? 65   SER C O   1 
ATOM   7127  C  CB  . SER C  3  65  ? 69.467 76.241  178.129 1.00 36.46  ? 65   SER C CB  1 
ATOM   7128  O  OG  . SER C  3  65  ? 69.775 75.062  177.392 1.00 47.41  ? 65   SER C OG  1 
ATOM   7129  N  N   . VAL C  3  66  ? 66.927 74.337  177.733 1.00 35.25  ? 66   VAL C N   1 
ATOM   7130  C  CA  . VAL C  3  66  ? 65.835 73.812  176.921 1.00 35.48  ? 66   VAL C CA  1 
ATOM   7131  C  C   . VAL C  3  66  ? 64.475 74.137  177.618 1.00 35.76  ? 66   VAL C C   1 
ATOM   7132  O  O   . VAL C  3  66  ? 63.507 74.555  176.957 1.00 35.60  ? 66   VAL C O   1 
ATOM   7133  C  CB  . VAL C  3  66  ? 65.993 72.280  176.655 1.00 35.53  ? 66   VAL C CB  1 
ATOM   7134  C  CG1 . VAL C  3  66  ? 64.778 71.712  175.913 1.00 31.05  ? 66   VAL C CG1 1 
ATOM   7135  C  CG2 . VAL C  3  66  ? 67.269 71.998  175.873 1.00 36.26  ? 66   VAL C CG2 1 
ATOM   7136  N  N   . THR C  3  67  ? 64.444 74.012  178.953 1.00 36.18  ? 67   THR C N   1 
ATOM   7137  C  CA  . THR C  3  67  ? 63.239 74.328  179.735 1.00 37.02  ? 67   THR C CA  1 
ATOM   7138  C  C   . THR C  3  67  ? 62.999 75.832  179.723 1.00 36.87  ? 67   THR C C   1 
ATOM   7139  O  O   . THR C  3  67  ? 61.867 76.287  179.585 1.00 36.50  ? 67   THR C O   1 
ATOM   7140  C  CB  . THR C  3  67  ? 63.374 73.851  181.221 1.00 37.87  ? 67   THR C CB  1 
ATOM   7141  O  OG1 . THR C  3  67  ? 63.905 72.520  181.273 1.00 52.70  ? 67   THR C OG1 1 
ATOM   7142  C  CG2 . THR C  3  67  ? 62.001 73.701  181.841 1.00 42.65  ? 67   THR C CG2 1 
ATOM   7143  N  N   . HIS C  3  68  ? 64.085 76.596  179.876 1.00 37.16  ? 68   HIS C N   1 
ATOM   7144  C  CA  . HIS C  3  68  ? 64.031 78.060  179.834 1.00 37.64  ? 68   HIS C CA  1 
ATOM   7145  C  C   . HIS C  3  68  ? 63.304 78.535  178.549 1.00 37.66  ? 68   HIS C C   1 
ATOM   7146  O  O   . HIS C  3  68  ? 62.474 79.446  178.595 1.00 37.68  ? 68   HIS C O   1 
ATOM   7147  C  CB  . HIS C  3  68  ? 65.464 78.645  179.908 1.00 37.97  ? 68   HIS C CB  1 
ATOM   7148  C  CG  . HIS C  3  68  ? 65.548 80.102  179.562 1.00 46.36  ? 68   HIS C CG  1 
ATOM   7149  N  ND1 . HIS C  3  68  ? 66.072 80.553  178.371 1.00 46.08  ? 68   HIS C ND1 1 
ATOM   7150  C  CD2 . HIS C  3  68  ? 65.174 81.207  180.250 1.00 50.03  ? 68   HIS C CD2 1 
ATOM   7151  C  CE1 . HIS C  3  68  ? 66.016 81.872  178.339 1.00 50.05  ? 68   HIS C CE1 1 
ATOM   7152  N  NE2 . HIS C  3  68  ? 65.472 82.294  179.465 1.00 50.66  ? 68   HIS C NE2 1 
ATOM   7153  N  N   . ILE C  3  69  ? 63.579 77.841  177.438 1.00 37.46  ? 69   ILE C N   1 
ATOM   7154  C  CA  . ILE C  3  69  ? 62.991 78.133  176.146 1.00 37.38  ? 69   ILE C CA  1 
ATOM   7155  C  C   . ILE C  3  69  ? 61.474 77.939  176.112 1.00 37.45  ? 69   ILE C C   1 
ATOM   7156  O  O   . ILE C  3  69  ? 60.739 78.826  175.685 1.00 37.50  ? 69   ILE C O   1 
ATOM   7157  C  CB  . ILE C  3  69  ? 63.722 77.297  175.024 1.00 37.39  ? 69   ILE C CB  1 
ATOM   7158  C  CG1 . ILE C  3  69  ? 65.078 77.942  174.691 1.00 37.50  ? 69   ILE C CG1 1 
ATOM   7159  C  CG2 . ILE C  3  69  ? 62.872 77.202  173.752 1.00 36.29  ? 69   ILE C CG2 1 
ATOM   7160  C  CD1 . ILE C  3  69  ? 66.157 76.966  174.168 1.00 32.78  ? 69   ILE C CD1 1 
ATOM   7161  N  N   . CYS C  3  70  ? 61.001 76.828  176.656 1.00 37.54  ? 70   CYS C N   1 
ATOM   7162  C  CA  . CYS C  3  70  ? 59.574 76.516  176.611 1.00 37.44  ? 70   CYS C CA  1 
ATOM   7163  C  C   . CYS C  3  70  ? 58.647 77.302  177.553 1.00 37.68  ? 70   CYS C C   1 
ATOM   7164  O  O   . CYS C  3  70  ? 57.449 77.412  177.292 1.00 38.08  ? 70   CYS C O   1 
ATOM   7165  C  CB  . CYS C  3  70  ? 59.371 75.035  176.775 1.00 37.10  ? 70   CYS C CB  1 
ATOM   7166  S  SG  . CYS C  3  70  ? 60.330 74.093  175.585 1.00 39.01  ? 70   CYS C SG  1 
ATOM   7167  N  N   . ARG C  3  71  ? 59.196 77.873  178.617 1.00 37.40  ? 71   ARG C N   1 
ATOM   7168  C  CA  . ARG C  3  71  ? 58.368 78.590  179.588 1.00 37.47  ? 71   ARG C CA  1 
ATOM   7169  C  C   . ARG C  3  71  ? 58.552 80.080  179.499 1.00 37.26  ? 71   ARG C C   1 
ATOM   7170  O  O   . ARG C  3  71  ? 57.583 80.856  179.525 1.00 36.87  ? 71   ARG C O   1 
ATOM   7171  C  CB  . ARG C  3  71  ? 58.768 78.182  181.007 1.00 37.77  ? 71   ARG C CB  1 
ATOM   7172  C  CG  . ARG C  3  71  ? 59.153 76.731  181.187 1.00 41.30  ? 71   ARG C CG  1 
ATOM   7173  C  CD  . ARG C  3  71  ? 58.218 75.937  182.037 1.00 46.33  ? 71   ARG C CD  1 
ATOM   7174  N  NE  . ARG C  3  71  ? 58.778 74.627  182.354 1.00 47.84  ? 71   ARG C NE  1 
ATOM   7175  C  CZ  . ARG C  3  71  ? 58.316 73.834  183.302 1.00 40.24  ? 71   ARG C CZ  1 
ATOM   7176  N  NH1 . ARG C  3  71  ? 57.290 74.213  184.026 1.00 29.29  ? 71   ARG C NH1 1 
ATOM   7177  N  NH2 . ARG C  3  71  ? 58.867 72.649  183.506 1.00 41.92  ? 71   ARG C NH2 1 
ATOM   7178  N  N   . ASP C  3  72  ? 59.814 80.482  179.426 1.00 37.37  ? 72   ASP C N   1 
ATOM   7179  C  CA  . ASP C  3  72  ? 60.176 81.880  179.453 1.00 37.40  ? 72   ASP C CA  1 
ATOM   7180  C  C   . ASP C  3  72  ? 60.308 82.593  178.104 1.00 36.99  ? 72   ASP C C   1 
ATOM   7181  O  O   . ASP C  3  72  ? 59.773 83.702  177.938 1.00 36.70  ? 72   ASP C O   1 
ATOM   7182  C  CB  . ASP C  3  72  ? 61.435 82.079  180.318 1.00 37.74  ? 72   ASP C CB  1 
ATOM   7183  C  CG  . ASP C  3  72  ? 61.212 81.660  181.821 1.00 36.90  ? 72   ASP C CG  1 
ATOM   7184  O  OD1 . ASP C  3  72  ? 60.041 81.509  182.238 1.00 25.54  ? 72   ASP C OD1 1 
ATOM   7185  O  OD2 . ASP C  3  72  ? 62.159 81.482  182.636 1.00 27.77  ? 72   ASP C OD2 1 
ATOM   7186  N  N   . VAL C  3  73  ? 61.029 81.969  177.153 1.00 36.77  ? 73   VAL C N   1 
ATOM   7187  C  CA  . VAL C  3  73  ? 61.253 82.560  175.809 1.00 36.00  ? 73   VAL C CA  1 
ATOM   7188  C  C   . VAL C  3  73  ? 59.938 82.677  175.078 1.00 35.46  ? 73   VAL C C   1 
ATOM   7189  O  O   . VAL C  3  73  ? 59.189 81.718  175.011 1.00 35.60  ? 73   VAL C O   1 
ATOM   7190  C  CB  . VAL C  3  73  ? 62.261 81.728  174.973 1.00 35.82  ? 73   VAL C CB  1 
ATOM   7191  C  CG1 . VAL C  3  73  ? 62.371 82.270  173.552 1.00 40.49  ? 73   VAL C CG1 1 
ATOM   7192  C  CG2 . VAL C  3  73  ? 63.628 81.724  175.640 1.00 32.78  ? 73   VAL C CG2 1 
ATOM   7193  N  N   . ASN C  3  74  ? 59.622 83.889  174.612 1.00 35.12  ? 74   ASN C N   1 
ATOM   7194  C  CA  . ASN C  3  74  ? 58.363 84.142  173.905 1.00 34.95  ? 74   ASN C CA  1 
ATOM   7195  C  C   . ASN C  3  74  ? 58.239 83.226  172.737 1.00 34.78  ? 74   ASN C C   1 
ATOM   7196  O  O   . ASN C  3  74  ? 59.123 83.183  171.895 1.00 34.60  ? 74   ASN C O   1 
ATOM   7197  C  CB  . ASN C  3  74  ? 58.278 85.592  173.411 1.00 34.88  ? 74   ASN C CB  1 
ATOM   7198  C  CG  . ASN C  3  74  ? 58.497 86.595  174.509 1.00 39.26  ? 74   ASN C CG  1 
ATOM   7199  O  OD1 . ASN C  3  74  ? 59.296 87.530  174.361 1.00 37.38  ? 74   ASN C OD1 1 
ATOM   7200  N  ND2 . ASN C  3  74  ? 57.795 86.412  175.638 1.00 37.66  ? 74   ASN C ND2 1 
ATOM   7201  N  N   . TYR C  3  75  ? 57.185 82.413  172.738 1.00 34.45  ? 75   TYR C N   1 
ATOM   7202  C  CA  . TYR C  3  75  ? 56.944 81.492  171.650 1.00 33.54  ? 75   TYR C CA  1 
ATOM   7203  C  C   . TYR C  3  75  ? 58.075 80.511  171.478 1.00 33.68  ? 75   TYR C C   1 
ATOM   7204  O  O   . TYR C  3  75  ? 58.227 79.910  170.417 1.00 33.88  ? 75   TYR C O   1 
ATOM   7205  C  CB  . TYR C  3  75  ? 56.718 82.258  170.376 1.00 32.80  ? 75   TYR C CB  1 
ATOM   7206  C  CG  . TYR C  3  75  ? 55.546 83.142  170.452 1.00 27.58  ? 75   TYR C CG  1 
ATOM   7207  C  CD1 . TYR C  3  75  ? 55.688 84.482  170.683 1.00 25.64  ? 75   TYR C CD1 1 
ATOM   7208  C  CD2 . TYR C  3  75  ? 54.269 82.629  170.323 1.00 35.06  ? 75   TYR C CD2 1 
ATOM   7209  C  CE1 . TYR C  3  75  ? 54.595 85.300  170.773 1.00 32.78  ? 75   TYR C CE1 1 
ATOM   7210  C  CE2 . TYR C  3  75  ? 53.162 83.441  170.396 1.00 34.69  ? 75   TYR C CE2 1 
ATOM   7211  C  CZ  . TYR C  3  75  ? 53.326 84.770  170.624 1.00 33.37  ? 75   TYR C CZ  1 
ATOM   7212  O  OH  . TYR C  3  75  ? 52.220 85.585  170.706 1.00 33.60  ? 75   TYR C OH  1 
ATOM   7213  N  N   . GLY C  3  76  ? 58.862 80.330  172.536 1.00 33.81  ? 76   GLY C N   1 
ATOM   7214  C  CA  . GLY C  3  76  ? 59.985 79.427  172.494 1.00 34.37  ? 76   GLY C CA  1 
ATOM   7215  C  C   . GLY C  3  76  ? 59.528 77.999  172.316 1.00 35.31  ? 76   GLY C C   1 
ATOM   7216  O  O   . GLY C  3  76  ? 60.184 77.206  171.635 1.00 35.96  ? 76   GLY C O   1 
ATOM   7217  N  N   . TRP C  3  77  ? 58.367 77.682  172.879 1.00 35.42  ? 77   TRP C N   1 
ATOM   7218  C  CA  . TRP C  3  77  ? 57.849 76.337  172.806 1.00 35.50  ? 77   TRP C CA  1 
ATOM   7219  C  C   . TRP C  3  77  ? 57.545 75.822  171.409 1.00 35.57  ? 77   TRP C C   1 
ATOM   7220  O  O   . TRP C  3  77  ? 57.961 74.707  171.088 1.00 35.89  ? 77   TRP C O   1 
ATOM   7221  C  CB  . TRP C  3  77  ? 56.683 76.118  173.761 1.00 35.35  ? 77   TRP C CB  1 
ATOM   7222  C  CG  . TRP C  3  77  ? 55.579 77.061  173.574 1.00 32.85  ? 77   TRP C CG  1 
ATOM   7223  C  CD1 . TRP C  3  77  ? 55.420 78.266  174.190 1.00 29.56  ? 77   TRP C CD1 1 
ATOM   7224  C  CD2 . TRP C  3  77  ? 54.440 76.891  172.726 1.00 34.51  ? 77   TRP C CD2 1 
ATOM   7225  N  NE1 . TRP C  3  77  ? 54.253 78.862  173.774 1.00 32.42  ? 77   TRP C NE1 1 
ATOM   7226  C  CE2 . TRP C  3  77  ? 53.631 78.039  172.872 1.00 32.83  ? 77   TRP C CE2 1 
ATOM   7227  C  CE3 . TRP C  3  77  ? 54.010 75.877  171.854 1.00 36.62  ? 77   TRP C CE3 1 
ATOM   7228  C  CZ2 . TRP C  3  77  ? 52.425 78.203  172.181 1.00 31.53  ? 77   TRP C CZ2 1 
ATOM   7229  C  CZ3 . TRP C  3  77  ? 52.824 76.057  171.149 1.00 31.27  ? 77   TRP C CZ3 1 
ATOM   7230  C  CH2 . TRP C  3  77  ? 52.048 77.210  171.323 1.00 27.87  ? 77   TRP C CH2 1 
ATOM   7231  N  N   . ILE C  3  78  ? 56.871 76.630  170.558 1.00 35.07  ? 78   ILE C N   1 
ATOM   7232  C  CA  . ILE C  3  78  ? 56.539 76.165  169.175 1.00 34.47  ? 78   ILE C CA  1 
ATOM   7233  C  C   . ILE C  3  78  ? 57.814 75.933  168.434 1.00 34.28  ? 78   ILE C C   1 
ATOM   7234  O  O   . ILE C  3  78  ? 58.005 74.885  167.847 1.00 34.63  ? 78   ILE C O   1 
ATOM   7235  C  CB  . ILE C  3  78  ? 55.739 77.178  168.387 1.00 34.15  ? 78   ILE C CB  1 
ATOM   7236  C  CG1 . ILE C  3  78  ? 55.400 78.368  169.201 1.00 37.05  ? 78   ILE C CG1 1 
ATOM   7237  C  CG2 . ILE C  3  78  ? 54.536 76.559  167.777 1.00 31.93  ? 78   ILE C CG2 1 
ATOM   7238  C  CD1 . ILE C  3  78  ? 55.318 79.544  168.374 1.00 36.87  ? 78   ILE C CD1 1 
ATOM   7239  N  N   . ILE C  3  79  ? 58.700 76.925  168.479 1.00 33.76  ? 79   ILE C N   1 
ATOM   7240  C  CA  . ILE C  3  79  ? 60.006 76.830  167.835 1.00 33.13  ? 79   ILE C CA  1 
ATOM   7241  C  C   . ILE C  3  79  ? 60.661 75.502  168.219 1.00 32.87  ? 79   ILE C C   1 
ATOM   7242  O  O   . ILE C  3  79  ? 61.030 74.705  167.328 1.00 32.98  ? 79   ILE C O   1 
ATOM   7243  C  CB  . ILE C  3  79  ? 60.910 78.061  168.226 1.00 32.69  ? 79   ILE C CB  1 
ATOM   7244  C  CG1 . ILE C  3  79  ? 60.385 79.344  167.528 1.00 25.97  ? 79   ILE C CG1 1 
ATOM   7245  C  CG2 . ILE C  3  79  ? 62.348 77.796  167.845 1.00 23.23  ? 79   ILE C CG2 1 
ATOM   7246  C  CD1 . ILE C  3  79  ? 61.072 80.645  167.931 1.00 20.63  ? 79   ILE C CD1 1 
ATOM   7247  N  N   . ARG C  3  80  ? 60.726 75.225  169.536 1.00 32.12  ? 80   ARG C N   1 
ATOM   7248  C  CA  . ARG C  3  80  ? 61.277 73.953  170.030 1.00 31.62  ? 80   ARG C CA  1 
ATOM   7249  C  C   . ARG C  3  80  ? 60.540 72.709  169.438 1.00 30.54  ? 80   ARG C C   1 
ATOM   7250  O  O   . ARG C  3  80  ? 61.185 71.769  169.016 1.00 30.18  ? 80   ARG C O   1 
ATOM   7251  C  CB  . ARG C  3  80  ? 61.266 73.899  171.573 1.00 31.85  ? 80   ARG C CB  1 
ATOM   7252  C  CG  . ARG C  3  80  ? 62.113 72.715  172.207 1.00 33.72  ? 80   ARG C CG  1 
ATOM   7253  C  CD  . ARG C  3  80  ? 61.438 71.273  172.164 1.00 26.58  ? 80   ARG C CD  1 
ATOM   7254  N  NE  . ARG C  3  80  ? 62.291 70.225  172.743 1.00 18.68  ? 80   ARG C NE  1 
ATOM   7255  C  CZ  . ARG C  3  80  ? 62.271 69.882  174.041 1.00 25.88  ? 80   ARG C CZ  1 
ATOM   7256  N  NH1 . ARG C  3  80  ? 61.434 70.497  174.886 1.00 21.56  ? 80   ARG C NH1 1 
ATOM   7257  N  NH2 . ARG C  3  80  ? 63.100 68.949  174.500 1.00 20.87  ? 80   ARG C NH2 1 
ATOM   7258  N  N   . TYR C  3  81  ? 59.207 72.730  169.409 1.00 30.12  ? 81   TYR C N   1 
ATOM   7259  C  CA  . TYR C  3  81  ? 58.444 71.567  168.895 1.00 30.21  ? 81   TYR C CA  1 
ATOM   7260  C  C   . TYR C  3  81  ? 58.447 71.474  167.395 1.00 29.95  ? 81   TYR C C   1 
ATOM   7261  O  O   . TYR C  3  81  ? 58.368 70.386  166.838 1.00 29.79  ? 81   TYR C O   1 
ATOM   7262  C  CB  . TYR C  3  81  ? 57.028 71.493  169.477 1.00 30.21  ? 81   TYR C CB  1 
ATOM   7263  C  CG  . TYR C  3  81  ? 57.057 71.383  170.988 1.00 39.19  ? 81   TYR C CG  1 
ATOM   7264  C  CD1 . TYR C  3  81  ? 58.011 70.586  171.621 1.00 38.70  ? 81   TYR C CD1 1 
ATOM   7265  C  CD2 . TYR C  3  81  ? 56.184 72.118  171.787 1.00 33.47  ? 81   TYR C CD2 1 
ATOM   7266  C  CE1 . TYR C  3  81  ? 58.088 70.511  173.001 1.00 33.45  ? 81   TYR C CE1 1 
ATOM   7267  C  CE2 . TYR C  3  81  ? 56.267 72.051  173.158 1.00 35.39  ? 81   TYR C CE2 1 
ATOM   7268  C  CZ  . TYR C  3  81  ? 57.235 71.240  173.754 1.00 32.05  ? 81   TYR C CZ  1 
ATOM   7269  O  OH  . TYR C  3  81  ? 57.332 71.157  175.101 1.00 37.90  ? 81   TYR C OH  1 
ATOM   7270  N  N   . MET C  3  82  ? 58.583 72.617  166.735 1.00 29.73  ? 82   MET C N   1 
ATOM   7271  C  CA  . MET C  3  82  ? 58.665 72.624  165.297 1.00 29.08  ? 82   MET C CA  1 
ATOM   7272  C  C   . MET C  3  82  ? 59.969 71.969  164.934 1.00 28.96  ? 82   MET C C   1 
ATOM   7273  O  O   . MET C  3  82  ? 60.033 71.175  163.990 1.00 29.50  ? 82   MET C O   1 
ATOM   7274  C  CB  . MET C  3  82  ? 58.622 74.026  164.750 1.00 28.44  ? 82   MET C CB  1 
ATOM   7275  C  CG  . MET C  3  82  ? 57.257 74.638  164.735 1.00 25.43  ? 82   MET C CG  1 
ATOM   7276  S  SD  . MET C  3  82  ? 57.350 76.291  164.058 1.00 37.34  ? 82   MET C SD  1 
ATOM   7277  C  CE  . MET C  3  82  ? 55.808 76.968  164.451 1.00 27.74  ? 82   MET C CE  1 
ATOM   7278  N  N   . HIS C  3  83  ? 60.993 72.246  165.733 1.00 28.02  ? 83   HIS C N   1 
ATOM   7279  C  CA  . HIS C  3  83  ? 62.275 71.676  165.507 1.00 27.20  ? 83   HIS C CA  1 
ATOM   7280  C  C   . HIS C  3  83  ? 62.216 70.187  165.663 1.00 27.77  ? 83   HIS C C   1 
ATOM   7281  O  O   . HIS C  3  83  ? 62.518 69.445  164.722 1.00 27.74  ? 83   HIS C O   1 
ATOM   7282  C  CB  . HIS C  3  83  ? 63.281 72.244  166.454 1.00 26.21  ? 83   HIS C CB  1 
ATOM   7283  C  CG  . HIS C  3  83  ? 64.668 72.089  165.973 1.00 21.21  ? 83   HIS C CG  1 
ATOM   7284  N  ND1 . HIS C  3  83  ? 65.094 72.622  164.775 1.00 26.67  ? 83   HIS C ND1 1 
ATOM   7285  C  CD2 . HIS C  3  83  ? 65.708 71.394  166.466 1.00 20.54  ? 83   HIS C CD2 1 
ATOM   7286  C  CE1 . HIS C  3  83  ? 66.360 72.309  164.586 1.00 22.76  ? 83   HIS C CE1 1 
ATOM   7287  N  NE2 . HIS C  3  83  ? 66.758 71.572  165.600 1.00 21.37  ? 83   HIS C NE2 1 
ATOM   7288  N  N   . ALA C  3  84  ? 61.779 69.753  166.849 1.00 28.44  ? 84   ALA C N   1 
ATOM   7289  C  CA  . ALA C  3  84  ? 61.635 68.340  167.188 1.00 29.33  ? 84   ALA C CA  1 
ATOM   7290  C  C   . ALA C  3  84  ? 60.784 67.586  166.167 1.00 30.30  ? 84   ALA C C   1 
ATOM   7291  O  O   . ALA C  3  84  ? 61.235 66.578  165.589 1.00 30.09  ? 84   ALA C O   1 
ATOM   7292  C  CB  . ALA C  3  84  ? 61.027 68.183  168.607 1.00 29.41  ? 84   ALA C CB  1 
ATOM   7293  N  N   . ASN C  3  85  ? 59.568 68.075  165.919 1.00 31.36  ? 85   ASN C N   1 
ATOM   7294  C  CA  . ASN C  3  85  ? 58.691 67.407  164.961 1.00 32.84  ? 85   ASN C CA  1 
ATOM   7295  C  C   . ASN C  3  85  ? 59.121 67.511  163.496 1.00 34.22  ? 85   ASN C C   1 
ATOM   7296  O  O   . ASN C  3  85  ? 58.832 66.601  162.682 1.00 34.37  ? 85   ASN C O   1 
ATOM   7297  C  CB  . ASN C  3  85  ? 57.230 67.760  165.177 1.00 32.73  ? 85   ASN C CB  1 
ATOM   7298  C  CG  . ASN C  3  85  ? 56.663 67.086  166.421 1.00 46.16  ? 85   ASN C CG  1 
ATOM   7299  O  OD1 . ASN C  3  85  ? 56.786 65.850  166.589 1.00 38.58  ? 85   ASN C OD1 1 
ATOM   7300  N  ND2 . ASN C  3  85  ? 56.086 67.892  167.333 1.00 46.86  ? 85   ASN C ND2 1 
ATOM   7301  N  N   . GLY C  3  86  ? 59.857 68.586  163.177 1.00 34.62  ? 86   GLY C N   1 
ATOM   7302  C  CA  . GLY C  3  86  ? 60.356 68.789  161.845 1.00 35.38  ? 86   GLY C CA  1 
ATOM   7303  C  C   . GLY C  3  86  ? 61.392 67.744  161.530 1.00 36.06  ? 86   GLY C C   1 
ATOM   7304  O  O   . GLY C  3  86  ? 61.504 67.290  160.387 1.00 36.10  ? 86   GLY C O   1 
ATOM   7305  N  N   . ALA C  3  87  ? 62.154 67.352  162.553 1.00 36.25  ? 87   ALA C N   1 
ATOM   7306  C  CA  . ALA C  3  87  ? 63.147 66.309  162.388 1.00 36.26  ? 87   ALA C CA  1 
ATOM   7307  C  C   . ALA C  3  87  ? 62.441 64.989  161.965 1.00 36.47  ? 87   ALA C C   1 
ATOM   7308  O  O   . ALA C  3  87  ? 62.962 64.229  161.161 1.00 36.72  ? 87   ALA C O   1 
ATOM   7309  C  CB  . ALA C  3  87  ? 63.935 66.115  163.678 1.00 35.95  ? 87   ALA C CB  1 
ATOM   7310  N  N   . SER C  3  88  ? 61.249 64.747  162.505 1.00 36.10  ? 88   SER C N   1 
ATOM   7311  C  CA  . SER C  3  88  ? 60.498 63.552  162.146 1.00 35.48  ? 88   SER C CA  1 
ATOM   7312  C  C   . SER C  3  88  ? 59.908 63.707  160.761 1.00 34.73  ? 88   SER C C   1 
ATOM   7313  O  O   . SER C  3  88  ? 59.923 62.774  159.968 1.00 33.91  ? 88   SER C O   1 
ATOM   7314  C  CB  . SER C  3  88  ? 59.410 63.263  163.170 1.00 35.37  ? 88   SER C CB  1 
ATOM   7315  O  OG  . SER C  3  88  ? 59.922 62.515  164.259 1.00 28.64  ? 88   SER C OG  1 
ATOM   7316  N  N   . MET C  3  89  ? 59.399 64.903  160.474 1.00 35.04  ? 89   MET C N   1 
ATOM   7317  C  CA  . MET C  3  89  ? 58.868 65.195  159.158 1.00 35.62  ? 89   MET C CA  1 
ATOM   7318  C  C   . MET C  3  89  ? 59.976 65.001  158.104 1.00 35.78  ? 89   MET C C   1 
ATOM   7319  O  O   . MET C  3  89  ? 59.727 64.437  157.035 1.00 36.06  ? 89   MET C O   1 
ATOM   7320  C  CB  . MET C  3  89  ? 58.301 66.616  159.080 1.00 35.68  ? 89   MET C CB  1 
ATOM   7321  C  CG  . MET C  3  89  ? 57.030 66.844  159.886 1.00 36.43  ? 89   MET C CG  1 
ATOM   7322  S  SD  . MET C  3  89  ? 55.783 65.542  159.697 1.00 37.66  ? 89   MET C SD  1 
ATOM   7323  C  CE  . MET C  3  89  ? 55.539 65.497  157.878 1.00 36.10  ? 89   MET C CE  1 
ATOM   7324  N  N   . PHE C  3  90  ? 61.205 65.386  158.471 1.00 35.33  ? 90   PHE C N   1 
ATOM   7325  C  CA  . PHE C  3  90  ? 62.374 65.231  157.630 1.00 35.50  ? 90   PHE C CA  1 
ATOM   7326  C  C   . PHE C  3  90  ? 62.617 63.746  157.366 1.00 36.05  ? 90   PHE C C   1 
ATOM   7327  O  O   . PHE C  3  90  ? 63.062 63.384  156.297 1.00 37.20  ? 90   PHE C O   1 
ATOM   7328  C  CB  . PHE C  3  90  ? 63.594 65.840  158.326 1.00 35.58  ? 90   PHE C CB  1 
ATOM   7329  C  CG  . PHE C  3  90  ? 64.699 66.315  157.388 1.00 33.00  ? 90   PHE C CG  1 
ATOM   7330  C  CD1 . PHE C  3  90  ? 64.955 65.688  156.182 1.00 34.08  ? 90   PHE C CD1 1 
ATOM   7331  C  CD2 . PHE C  3  90  ? 65.529 67.371  157.772 1.00 33.84  ? 90   PHE C CD2 1 
ATOM   7332  C  CE1 . PHE C  3  90  ? 65.993 66.117  155.358 1.00 30.48  ? 90   PHE C CE1 1 
ATOM   7333  C  CE2 . PHE C  3  90  ? 66.580 67.797  156.959 1.00 30.49  ? 90   PHE C CE2 1 
ATOM   7334  C  CZ  . PHE C  3  90  ? 66.810 67.174  155.758 1.00 33.46  ? 90   PHE C CZ  1 
ATOM   7335  N  N   . PHE C  3  91  ? 62.324 62.879  158.317 1.00 35.62  ? 91   PHE C N   1 
ATOM   7336  C  CA  . PHE C  3  91  ? 62.534 61.464  158.053 1.00 35.18  ? 91   PHE C CA  1 
ATOM   7337  C  C   . PHE C  3  91  ? 61.414 60.797  157.288 1.00 35.36  ? 91   PHE C C   1 
ATOM   7338  O  O   . PHE C  3  91  ? 61.672 59.911  156.481 1.00 35.61  ? 91   PHE C O   1 
ATOM   7339  C  CB  . PHE C  3  91  ? 62.990 60.684  159.272 1.00 34.97  ? 91   PHE C CB  1 
ATOM   7340  C  CG  . PHE C  3  91  ? 64.458 60.890  159.606 1.00 32.03  ? 91   PHE C CG  1 
ATOM   7341  C  CD1 . PHE C  3  91  ? 64.866 61.979  160.370 1.00 20.05  ? 91   PHE C CD1 1 
ATOM   7342  C  CD2 . PHE C  3  91  ? 65.423 60.013  159.132 1.00 35.77  ? 91   PHE C CD2 1 
ATOM   7343  C  CE1 . PHE C  3  91  ? 66.205 62.183  160.670 1.00 23.64  ? 91   PHE C CE1 1 
ATOM   7344  C  CE2 . PHE C  3  91  ? 66.790 60.221  159.419 1.00 38.28  ? 91   PHE C CE2 1 
ATOM   7345  C  CZ  . PHE C  3  91  ? 67.178 61.296  160.188 1.00 29.47  ? 91   PHE C CZ  1 
ATOM   7346  N  N   . ILE C  3  92  ? 60.170 61.238  157.506 1.00 35.32  ? 92   ILE C N   1 
ATOM   7347  C  CA  . ILE C  3  92  ? 59.044 60.696  156.734 1.00 35.36  ? 92   ILE C CA  1 
ATOM   7348  C  C   . ILE C  3  92  ? 59.280 61.045  155.232 1.00 35.29  ? 92   ILE C C   1 
ATOM   7349  O  O   . ILE C  3  92  ? 59.192 60.153  154.332 1.00 35.67  ? 92   ILE C O   1 
ATOM   7350  C  CB  . ILE C  3  92  ? 57.695 61.282  157.223 1.00 35.65  ? 92   ILE C CB  1 
ATOM   7351  C  CG1 . ILE C  3  92  ? 57.234 60.572  158.502 1.00 44.76  ? 92   ILE C CG1 1 
ATOM   7352  C  CG2 . ILE C  3  92  ? 56.601 61.095  156.164 1.00 24.05  ? 92   ILE C CG2 1 
ATOM   7353  C  CD1 . ILE C  3  92  ? 56.741 59.106  158.249 1.00 60.58  ? 92   ILE C CD1 1 
ATOM   7354  N  N   . CYS C  3  93  ? 59.658 62.301  154.969 1.00 34.09  ? 93   CYS C N   1 
ATOM   7355  C  CA  . CYS C  3  93  ? 59.909 62.718  153.602 1.00 32.99  ? 93   CYS C CA  1 
ATOM   7356  C  C   . CYS C  3  93  ? 61.102 61.985  153.012 1.00 32.67  ? 93   CYS C C   1 
ATOM   7357  O  O   . CYS C  3  93  ? 61.029 61.465  151.893 1.00 33.14  ? 93   CYS C O   1 
ATOM   7358  C  CB  . CYS C  3  93  ? 60.031 64.221  153.504 1.00 32.40  ? 93   CYS C CB  1 
ATOM   7359  S  SG  . CYS C  3  93  ? 58.522 65.052  154.106 1.00 36.92  ? 93   CYS C SG  1 
ATOM   7360  N  N   . LEU C  3  94  ? 62.141 61.829  153.811 1.00 32.09  ? 94   LEU C N   1 
ATOM   7361  C  CA  . LEU C  3  94  ? 63.345 61.142  153.389 1.00 32.14  ? 94   LEU C CA  1 
ATOM   7362  C  C   . LEU C  3  94  ? 62.999 59.723  152.953 1.00 32.89  ? 94   LEU C C   1 
ATOM   7363  O  O   . LEU C  3  94  ? 63.390 59.280  151.873 1.00 32.85  ? 94   LEU C O   1 
ATOM   7364  C  CB  . LEU C  3  94  ? 64.307 61.108  154.548 1.00 32.09  ? 94   LEU C CB  1 
ATOM   7365  C  CG  . LEU C  3  94  ? 65.812 61.306  154.457 1.00 31.63  ? 94   LEU C CG  1 
ATOM   7366  C  CD1 . LEU C  3  94  ? 66.246 62.400  153.473 1.00 22.44  ? 94   LEU C CD1 1 
ATOM   7367  C  CD2 . LEU C  3  94  ? 66.263 61.639  155.833 1.00 29.92  ? 94   LEU C CD2 1 
ATOM   7368  N  N   . TYR C  3  95  ? 62.192 59.036  153.767 1.00 33.59  ? 95   TYR C N   1 
ATOM   7369  C  CA  . TYR C  3  95  ? 61.792 57.658  153.453 1.00 33.52  ? 95   TYR C CA  1 
ATOM   7370  C  C   . TYR C  3  95  ? 60.888 57.540  152.248 1.00 33.24  ? 95   TYR C C   1 
ATOM   7371  O  O   . TYR C  3  95  ? 61.060 56.653  151.458 1.00 33.19  ? 95   TYR C O   1 
ATOM   7372  C  CB  . TYR C  3  95  ? 61.269 56.902  154.687 1.00 33.67  ? 95   TYR C CB  1 
ATOM   7373  C  CG  . TYR C  3  95  ? 62.340 56.719  155.748 1.00 37.06  ? 95   TYR C CG  1 
ATOM   7374  C  CD1 . TYR C  3  95  ? 63.670 56.502  155.389 1.00 39.28  ? 95   TYR C CD1 1 
ATOM   7375  C  CD2 . TYR C  3  95  ? 62.032 56.791  157.093 1.00 37.21  ? 95   TYR C CD2 1 
ATOM   7376  C  CE1 . TYR C  3  95  ? 64.648 56.361  156.334 1.00 39.89  ? 95   TYR C CE1 1 
ATOM   7377  C  CE2 . TYR C  3  95  ? 63.005 56.643  158.055 1.00 42.21  ? 95   TYR C CE2 1 
ATOM   7378  C  CZ  . TYR C  3  95  ? 64.313 56.433  157.677 1.00 45.78  ? 95   TYR C CZ  1 
ATOM   7379  O  OH  . TYR C  3  95  ? 65.294 56.295  158.647 1.00 52.75  ? 95   TYR C OH  1 
ATOM   7380  N  N   . MET C  3  96  ? 59.925 58.437  152.111 1.00 33.58  ? 96   MET C N   1 
ATOM   7381  C  CA  . MET C  3  96  ? 59.096 58.468  150.886 1.00 34.32  ? 96   MET C CA  1 
ATOM   7382  C  C   . MET C  3  96  ? 60.028 58.594  149.632 1.00 34.26  ? 96   MET C C   1 
ATOM   7383  O  O   . MET C  3  96  ? 59.954 57.796  148.687 1.00 33.75  ? 96   MET C O   1 
ATOM   7384  C  CB  . MET C  3  96  ? 58.209 59.706  150.911 1.00 34.65  ? 96   MET C CB  1 
ATOM   7385  C  CG  . MET C  3  96  ? 56.808 59.487  151.293 1.00 45.80  ? 96   MET C CG  1 
ATOM   7386  S  SD  . MET C  3  96  ? 56.489 58.435  152.611 1.00 50.56  ? 96   MET C SD  1 
ATOM   7387  C  CE  . MET C  3  96  ? 54.877 59.003  153.041 1.00 56.14  ? 96   MET C CE  1 
ATOM   7388  N  N   . HIS C  3  97  ? 60.912 59.596  149.694 1.00 34.34  ? 97   HIS C N   1 
ATOM   7389  C  CA  . HIS C  3  97  ? 61.850 59.918  148.643 1.00 34.78  ? 97   HIS C CA  1 
ATOM   7390  C  C   . HIS C  3  97  ? 62.703 58.753  148.196 1.00 34.50  ? 97   HIS C C   1 
ATOM   7391  O  O   . HIS C  3  97  ? 62.847 58.526  146.996 1.00 34.76  ? 97   HIS C O   1 
ATOM   7392  C  CB  . HIS C  3  97  ? 62.754 61.007  149.142 1.00 35.50  ? 97   HIS C CB  1 
ATOM   7393  C  CG  . HIS C  3  97  ? 63.370 61.842  148.073 1.00 31.98  ? 97   HIS C CG  1 
ATOM   7394  N  ND1 . HIS C  3  97  ? 62.637 62.704  147.289 1.00 39.59  ? 97   HIS C ND1 1 
ATOM   7395  C  CD2 . HIS C  3  97  ? 64.664 62.062  147.762 1.00 35.16  ? 97   HIS C CD2 1 
ATOM   7396  C  CE1 . HIS C  3  97  ? 63.452 63.377  146.501 1.00 31.96  ? 97   HIS C CE1 1 
ATOM   7397  N  NE2 . HIS C  3  97  ? 64.688 63.021  146.782 1.00 31.27  ? 97   HIS C NE2 1 
ATOM   7398  N  N   . VAL C  3  98  ? 63.310 58.043  149.146 1.00 34.00  ? 98   VAL C N   1 
ATOM   7399  C  CA  . VAL C  3  98  ? 64.146 56.901  148.799 1.00 34.46  ? 98   VAL C CA  1 
ATOM   7400  C  C   . VAL C  3  98  ? 63.278 55.788  148.189 1.00 35.67  ? 98   VAL C C   1 
ATOM   7401  O  O   . VAL C  3  98  ? 63.604 55.228  147.116 1.00 36.73  ? 98   VAL C O   1 
ATOM   7402  C  CB  . VAL C  3  98  ? 64.894 56.353  150.010 1.00 34.41  ? 98   VAL C CB  1 
ATOM   7403  C  CG1 . VAL C  3  98  ? 65.574 54.967  149.683 1.00 17.55  ? 98   VAL C CG1 1 
ATOM   7404  C  CG2 . VAL C  3  98  ? 65.915 57.357  150.499 1.00 30.23  ? 98   VAL C CG2 1 
ATOM   7405  N  N   . GLY C  3  99  ? 62.149 55.513  148.827 1.00 35.17  ? 99   GLY C N   1 
ATOM   7406  C  CA  . GLY C  3  99  ? 61.240 54.510  148.331 1.00 34.90  ? 99   GLY C CA  1 
ATOM   7407  C  C   . GLY C  3  99  ? 60.751 54.826  146.924 1.00 34.43  ? 99   GLY C C   1 
ATOM   7408  O  O   . GLY C  3  99  ? 60.705 53.929  146.056 1.00 34.77  ? 99   GLY C O   1 
ATOM   7409  N  N   . ARG C  3  100 ? 60.398 56.093  146.691 1.00 33.23  ? 100  ARG C N   1 
ATOM   7410  C  CA  . ARG C  3  100 ? 59.930 56.518  145.388 1.00 32.53  ? 100  ARG C CA  1 
ATOM   7411  C  C   . ARG C  3  100 ? 61.007 56.184  144.364 1.00 31.97  ? 100  ARG C C   1 
ATOM   7412  O  O   . ARG C  3  100 ? 60.724 55.649  143.322 1.00 30.98  ? 100  ARG C O   1 
ATOM   7413  C  CB  . ARG C  3  100 ? 59.634 58.034  145.391 1.00 32.49  ? 100  ARG C CB  1 
ATOM   7414  C  CG  . ARG C  3  100 ? 59.157 58.615  144.033 1.00 25.75  ? 100  ARG C CG  1 
ATOM   7415  C  CD  . ARG C  3  100 ? 60.268 58.888  143.013 1.00 27.26  ? 100  ARG C CD  1 
ATOM   7416  N  NE  . ARG C  3  100 ? 61.430 59.559  143.602 1.00 25.96  ? 100  ARG C NE  1 
ATOM   7417  C  CZ  . ARG C  3  100 ? 61.670 60.863  143.487 1.00 27.70  ? 100  ARG C CZ  1 
ATOM   7418  N  NH1 . ARG C  3  100 ? 60.828 61.638  142.790 1.00 18.70  ? 100  ARG C NH1 1 
ATOM   7419  N  NH2 . ARG C  3  100 ? 62.757 61.402  144.063 1.00 24.73  ? 100  ARG C NH2 1 
ATOM   7420  N  N   . GLY C  3  101 ? 62.255 56.489  144.705 1.00 32.42  ? 101  GLY C N   1 
ATOM   7421  C  CA  . GLY C  3  101 ? 63.368 56.219  143.825 1.00 32.65  ? 101  GLY C CA  1 
ATOM   7422  C  C   . GLY C  3  101 ? 63.523 54.744  143.501 1.00 32.72  ? 101  GLY C C   1 
ATOM   7423  O  O   . GLY C  3  101 ? 63.818 54.364  142.362 1.00 31.87  ? 101  GLY C O   1 
ATOM   7424  N  N   . LEU C  3  102 ? 63.295 53.915  144.509 1.00 33.59  ? 102  LEU C N   1 
ATOM   7425  C  CA  . LEU C  3  102 ? 63.427 52.481  144.365 1.00 34.45  ? 102  LEU C CA  1 
ATOM   7426  C  C   . LEU C  3  102 ? 62.308 51.867  143.475 1.00 34.21  ? 102  LEU C C   1 
ATOM   7427  O  O   . LEU C  3  102 ? 62.585 51.126  142.534 1.00 34.45  ? 102  LEU C O   1 
ATOM   7428  C  CB  . LEU C  3  102 ? 63.463 51.828  145.737 1.00 34.98  ? 102  LEU C CB  1 
ATOM   7429  C  CG  . LEU C  3  102 ? 64.423 50.666  145.923 1.00 47.55  ? 102  LEU C CG  1 
ATOM   7430  C  CD1 . LEU C  3  102 ? 64.351 50.239  147.372 1.00 57.23  ? 102  LEU C CD1 1 
ATOM   7431  C  CD2 . LEU C  3  102 ? 64.087 49.459  144.979 1.00 48.79  ? 102  LEU C CD2 1 
ATOM   7432  N  N   . TYR C  3  103 ? 61.077 52.210  143.765 1.00 33.74  ? 103  TYR C N   1 
ATOM   7433  C  CA  . TYR C  3  103 ? 59.978 51.717  143.011 1.00 34.04  ? 103  TYR C CA  1 
ATOM   7434  C  C   . TYR C  3  103 ? 60.112 52.120  141.554 1.00 35.61  ? 103  TYR C C   1 
ATOM   7435  O  O   . TYR C  3  103 ? 59.985 51.277  140.640 1.00 36.96  ? 103  TYR C O   1 
ATOM   7436  C  CB  . TYR C  3  103 ? 58.707 52.316  143.552 1.00 33.64  ? 103  TYR C CB  1 
ATOM   7437  C  CG  . TYR C  3  103 ? 57.442 51.734  142.975 1.00 33.97  ? 103  TYR C CG  1 
ATOM   7438  C  CD1 . TYR C  3  103 ? 56.697 50.760  143.677 1.00 30.01  ? 103  TYR C CD1 1 
ATOM   7439  C  CD2 . TYR C  3  103 ? 56.964 52.169  141.765 1.00 30.81  ? 103  TYR C CD2 1 
ATOM   7440  C  CE1 . TYR C  3  103 ? 55.527 50.239  143.143 1.00 23.95  ? 103  TYR C CE1 1 
ATOM   7441  C  CE2 . TYR C  3  103 ? 55.818 51.674  141.229 1.00 29.14  ? 103  TYR C CE2 1 
ATOM   7442  C  CZ  . TYR C  3  103 ? 55.094 50.719  141.898 1.00 33.40  ? 103  TYR C CZ  1 
ATOM   7443  O  OH  . TYR C  3  103 ? 53.937 50.276  141.307 1.00 18.47  ? 103  TYR C OH  1 
ATOM   7444  N  N   . TYR C  3  104 ? 60.392 53.395  141.334 1.00 34.98  ? 104  TYR C N   1 
ATOM   7445  C  CA  . TYR C  3  104 ? 60.419 53.941  140.024 1.00 34.44  ? 104  TYR C CA  1 
ATOM   7446  C  C   . TYR C  3  104 ? 61.679 53.793  139.219 1.00 34.67  ? 104  TYR C C   1 
ATOM   7447  O  O   . TYR C  3  104 ? 61.708 54.206  138.085 1.00 34.99  ? 104  TYR C O   1 
ATOM   7448  C  CB  . TYR C  3  104 ? 59.879 55.395  140.024 1.00 34.12  ? 104  TYR C CB  1 
ATOM   7449  C  CG  . TYR C  3  104 ? 58.399 55.428  140.323 1.00 37.62  ? 104  TYR C CG  1 
ATOM   7450  C  CD1 . TYR C  3  104 ? 57.915 55.811  141.578 1.00 39.12  ? 104  TYR C CD1 1 
ATOM   7451  C  CD2 . TYR C  3  104 ? 57.496 54.969  139.402 1.00 38.49  ? 104  TYR C CD2 1 
ATOM   7452  C  CE1 . TYR C  3  104 ? 56.563 55.807  141.852 1.00 28.22  ? 104  TYR C CE1 1 
ATOM   7453  C  CE2 . TYR C  3  104 ? 56.142 54.953  139.665 1.00 36.16  ? 104  TYR C CE2 1 
ATOM   7454  C  CZ  . TYR C  3  104 ? 55.676 55.369  140.879 1.00 36.05  ? 104  TYR C CZ  1 
ATOM   7455  O  OH  . TYR C  3  104 ? 54.317 55.321  141.119 1.00 31.85  ? 104  TYR C OH  1 
ATOM   7456  N  N   . GLY C  3  105 ? 62.719 53.186  139.769 1.00 34.52  ? 105  GLY C N   1 
ATOM   7457  C  CA  . GLY C  3  105 ? 63.957 53.038  138.997 1.00 35.16  ? 105  GLY C CA  1 
ATOM   7458  C  C   . GLY C  3  105 ? 64.835 54.305  138.924 1.00 36.64  ? 105  GLY C C   1 
ATOM   7459  O  O   . GLY C  3  105 ? 65.885 54.322  138.242 1.00 37.46  ? 105  GLY C O   1 
ATOM   7460  N  N   . SER C  3  106 ? 64.427 55.357  139.639 1.00 36.27  ? 106  SER C N   1 
ATOM   7461  C  CA  . SER C  3  106 ? 65.148 56.603  139.640 1.00 36.29  ? 106  SER C CA  1 
ATOM   7462  C  C   . SER C  3  106 ? 66.624 56.488  139.955 1.00 36.50  ? 106  SER C C   1 
ATOM   7463  O  O   . SER C  3  106 ? 67.401 57.283  139.501 1.00 36.98  ? 106  SER C O   1 
ATOM   7464  C  CB  . SER C  3  106 ? 64.489 57.583  140.567 1.00 36.15  ? 106  SER C CB  1 
ATOM   7465  O  OG  . SER C  3  106 ? 63.151 57.816  140.150 1.00 38.87  ? 106  SER C OG  1 
ATOM   7466  N  N   . TYR C  3  107 ? 67.009 55.444  140.665 1.00 36.35  ? 107  TYR C N   1 
ATOM   7467  C  CA  . TYR C  3  107 ? 68.396 55.228  141.030 1.00 36.45  ? 107  TYR C CA  1 
ATOM   7468  C  C   . TYR C  3  107 ? 69.348 55.060  139.867 1.00 36.86  ? 107  TYR C C   1 
ATOM   7469  O  O   . TYR C  3  107 ? 70.569 55.074  140.061 1.00 37.61  ? 107  TYR C O   1 
ATOM   7470  C  CB  . TYR C  3  107 ? 68.511 54.007  141.912 1.00 36.86  ? 107  TYR C CB  1 
ATOM   7471  C  CG  . TYR C  3  107 ? 67.777 52.794  141.395 1.00 43.04  ? 107  TYR C CG  1 
ATOM   7472  C  CD1 . TYR C  3  107 ? 66.481 52.490  141.840 1.00 42.51  ? 107  TYR C CD1 1 
ATOM   7473  C  CD2 . TYR C  3  107 ? 68.388 51.919  140.495 1.00 42.60  ? 107  TYR C CD2 1 
ATOM   7474  C  CE1 . TYR C  3  107 ? 65.800 51.353  141.370 1.00 42.90  ? 107  TYR C CE1 1 
ATOM   7475  C  CE2 . TYR C  3  107 ? 67.724 50.790  140.023 1.00 45.54  ? 107  TYR C CE2 1 
ATOM   7476  C  CZ  . TYR C  3  107 ? 66.432 50.518  140.457 1.00 41.01  ? 107  TYR C CZ  1 
ATOM   7477  O  OH  . TYR C  3  107 ? 65.796 49.412  140.000 1.00 45.47  ? 107  TYR C OH  1 
ATOM   7478  N  N   . THR C  3  108 ? 68.815 54.868  138.652 1.00 36.06  ? 108  THR C N   1 
ATOM   7479  C  CA  . THR C  3  108 ? 69.666 54.682  137.486 1.00 34.91  ? 108  THR C CA  1 
ATOM   7480  C  C   . THR C  3  108 ? 70.491 55.916  137.177 1.00 34.49  ? 108  THR C C   1 
ATOM   7481  O  O   . THR C  3  108 ? 71.420 55.860  136.394 1.00 35.08  ? 108  THR C O   1 
ATOM   7482  C  CB  . THR C  3  108 ? 68.878 54.240  136.309 1.00 34.97  ? 108  THR C CB  1 
ATOM   7483  O  OG1 . THR C  3  108 ? 67.832 55.192  136.036 1.00 30.85  ? 108  THR C OG1 1 
ATOM   7484  C  CG2 . THR C  3  108 ? 68.144 52.889  136.639 1.00 29.65  ? 108  THR C CG2 1 
ATOM   7485  N  N   . PHE C  3  109 ? 70.109 57.038  137.782 1.00 33.50  ? 109  PHE C N   1 
ATOM   7486  C  CA  . PHE C  3  109 ? 70.898 58.269  137.745 1.00 32.70  ? 109  PHE C CA  1 
ATOM   7487  C  C   . PHE C  3  109 ? 71.936 58.072  138.857 1.00 32.70  ? 109  PHE C C   1 
ATOM   7488  O  O   . PHE C  3  109 ? 71.758 58.603  139.975 1.00 32.71  ? 109  PHE C O   1 
ATOM   7489  C  CB  . PHE C  3  109 ? 70.018 59.459  138.168 1.00 32.07  ? 109  PHE C CB  1 
ATOM   7490  C  CG  . PHE C  3  109 ? 68.929 59.779  137.221 1.00 25.01  ? 109  PHE C CG  1 
ATOM   7491  C  CD1 . PHE C  3  109 ? 69.047 59.479  135.862 1.00 26.82  ? 109  PHE C CD1 1 
ATOM   7492  C  CD2 . PHE C  3  109 ? 67.796 60.435  137.662 1.00 19.03  ? 109  PHE C CD2 1 
ATOM   7493  C  CE1 . PHE C  3  109 ? 68.047 59.796  134.992 1.00 23.79  ? 109  PHE C CE1 1 
ATOM   7494  C  CE2 . PHE C  3  109 ? 66.778 60.760  136.781 1.00 14.74  ? 109  PHE C CE2 1 
ATOM   7495  C  CZ  . PHE C  3  109 ? 66.892 60.434  135.462 1.00 23.64  ? 109  PHE C CZ  1 
ATOM   7496  N  N   . LEU C  3  110 ? 73.009 57.343  138.568 1.00 32.83  ? 110  LEU C N   1 
ATOM   7497  C  CA  . LEU C  3  110 ? 73.997 56.961  139.618 1.00 33.42  ? 110  LEU C CA  1 
ATOM   7498  C  C   . LEU C  3  110 ? 74.489 58.056  140.567 1.00 33.29  ? 110  LEU C C   1 
ATOM   7499  O  O   . LEU C  3  110 ? 74.331 57.938  141.824 1.00 32.48  ? 110  LEU C O   1 
ATOM   7500  C  CB  . LEU C  3  110 ? 75.196 56.219  139.025 1.00 34.26  ? 110  LEU C CB  1 
ATOM   7501  C  CG  . LEU C  3  110 ? 74.989 55.107  137.992 1.00 46.58  ? 110  LEU C CG  1 
ATOM   7502  C  CD1 . LEU C  3  110 ? 76.347 54.399  137.717 1.00 39.90  ? 110  LEU C CD1 1 
ATOM   7503  C  CD2 . LEU C  3  110 ? 73.931 54.092  138.485 1.00 53.15  ? 110  LEU C CD2 1 
ATOM   7504  N  N   . GLU C  3  111 ? 75.093 59.108  139.989 1.00 33.82  ? 111  GLU C N   1 
ATOM   7505  C  CA  . GLU C  3  111 ? 75.642 60.217  140.784 1.00 34.10  ? 111  GLU C CA  1 
ATOM   7506  C  C   . GLU C  3  111 ? 74.584 60.885  141.631 1.00 33.69  ? 111  GLU C C   1 
ATOM   7507  O  O   . GLU C  3  111 ? 74.779 61.044  142.803 1.00 34.33  ? 111  GLU C O   1 
ATOM   7508  C  CB  . GLU C  3  111 ? 76.338 61.228  139.906 1.00 34.67  ? 111  GLU C CB  1 
ATOM   7509  C  CG  . GLU C  3  111 ? 77.513 60.657  139.150 1.00 48.95  ? 111  GLU C CG  1 
ATOM   7510  C  CD  . GLU C  3  111 ? 77.442 60.975  137.672 1.00 59.84  ? 111  GLU C CD  1 
ATOM   7511  O  OE1 . GLU C  3  111 ? 76.569 60.356  136.973 1.00 55.61  ? 111  GLU C OE1 1 
ATOM   7512  O  OE2 . GLU C  3  111 ? 78.236 61.846  137.207 1.00 60.21  ? 111  GLU C OE2 1 
ATOM   7513  N  N   . THR C  3  112 ? 73.440 61.214  141.038 1.00 32.99  ? 112  THR C N   1 
ATOM   7514  C  CA  . THR C  3  112 ? 72.337 61.838  141.774 1.00 33.03  ? 112  THR C CA  1 
ATOM   7515  C  C   . THR C  3  112 ? 71.990 61.001  143.013 1.00 33.93  ? 112  THR C C   1 
ATOM   7516  O  O   . THR C  3  112 ? 71.977 61.506  144.139 1.00 33.84  ? 112  THR C O   1 
ATOM   7517  C  CB  . THR C  3  112 ? 71.104 61.898  140.874 1.00 32.94  ? 112  THR C CB  1 
ATOM   7518  O  OG1 . THR C  3  112 ? 71.300 62.861  139.823 1.00 34.18  ? 112  THR C OG1 1 
ATOM   7519  C  CG2 . THR C  3  112 ? 69.856 62.407  141.644 1.00 22.08  ? 112  THR C CG2 1 
ATOM   7520  N  N   . TRP C  3  113 ? 71.770 59.703  142.779 1.00 34.51  ? 113  TRP C N   1 
ATOM   7521  C  CA  . TRP C  3  113 ? 71.377 58.739  143.816 1.00 34.78  ? 113  TRP C CA  1 
ATOM   7522  C  C   . TRP C  3  113 ? 72.452 58.526  144.835 1.00 34.86  ? 113  TRP C C   1 
ATOM   7523  O  O   . TRP C  3  113 ? 72.175 58.491  146.029 1.00 34.80  ? 113  TRP C O   1 
ATOM   7524  C  CB  . TRP C  3  113 ? 71.009 57.403  143.156 1.00 34.64  ? 113  TRP C CB  1 
ATOM   7525  C  CG  . TRP C  3  113 ? 70.743 56.250  144.062 1.00 27.11  ? 113  TRP C CG  1 
ATOM   7526  C  CD1 . TRP C  3  113 ? 71.637 55.273  144.452 1.00 29.38  ? 113  TRP C CD1 1 
ATOM   7527  C  CD2 . TRP C  3  113 ? 69.476 55.866  144.612 1.00 24.13  ? 113  TRP C CD2 1 
ATOM   7528  N  NE1 . TRP C  3  113 ? 71.003 54.345  145.250 1.00 20.73  ? 113  TRP C NE1 1 
ATOM   7529  C  CE2 . TRP C  3  113 ? 69.671 54.677  145.345 1.00 21.20  ? 113  TRP C CE2 1 
ATOM   7530  C  CE3 . TRP C  3  113 ? 68.200 56.403  144.558 1.00 25.00  ? 113  TRP C CE3 1 
ATOM   7531  C  CZ2 . TRP C  3  113 ? 68.641 54.038  146.009 1.00 25.15  ? 113  TRP C CZ2 1 
ATOM   7532  C  CZ3 . TRP C  3  113 ? 67.174 55.747  145.208 1.00 30.28  ? 113  TRP C CZ3 1 
ATOM   7533  C  CH2 . TRP C  3  113 ? 67.402 54.585  145.924 1.00 21.54  ? 113  TRP C CH2 1 
ATOM   7534  N  N   . ASN C  3  114 ? 73.683 58.359  144.376 1.00 34.65  ? 114  ASN C N   1 
ATOM   7535  C  CA  . ASN C  3  114 ? 74.761 58.150  145.313 1.00 34.62  ? 114  ASN C CA  1 
ATOM   7536  C  C   . ASN C  3  114 ? 74.975 59.356  146.174 1.00 34.32  ? 114  ASN C C   1 
ATOM   7537  O  O   . ASN C  3  114 ? 75.305 59.230  147.352 1.00 34.14  ? 114  ASN C O   1 
ATOM   7538  C  CB  . ASN C  3  114 ? 76.032 57.717  144.625 1.00 35.04  ? 114  ASN C CB  1 
ATOM   7539  C  CG  . ASN C  3  114 ? 76.097 56.240  144.446 1.00 41.78  ? 114  ASN C CG  1 
ATOM   7540  O  OD1 . ASN C  3  114 ? 77.140 55.625  144.633 1.00 55.95  ? 114  ASN C OD1 1 
ATOM   7541  N  ND2 . ASN C  3  114 ? 74.980 55.647  144.159 1.00 38.88  ? 114  ASN C ND2 1 
ATOM   7542  N  N   . ILE C  3  115 ? 74.778 60.539  145.589 1.00 34.24  ? 115  ILE C N   1 
ATOM   7543  C  CA  . ILE C  3  115 ? 74.858 61.753  146.350 1.00 34.07  ? 115  ILE C CA  1 
ATOM   7544  C  C   . ILE C  3  115 ? 73.710 61.691  147.356 1.00 33.49  ? 115  ILE C C   1 
ATOM   7545  O  O   . ILE C  3  115 ? 73.889 62.002  148.518 1.00 32.88  ? 115  ILE C O   1 
ATOM   7546  C  CB  . ILE C  3  115 ? 74.725 62.973  145.459 1.00 34.22  ? 115  ILE C CB  1 
ATOM   7547  C  CG1 . ILE C  3  115 ? 76.059 63.271  144.754 1.00 40.24  ? 115  ILE C CG1 1 
ATOM   7548  C  CG2 . ILE C  3  115 ? 74.322 64.162  146.268 1.00 31.94  ? 115  ILE C CG2 1 
ATOM   7549  C  CD1 . ILE C  3  115 ? 77.220 63.585  145.693 1.00 42.48  ? 115  ILE C CD1 1 
ATOM   7550  N  N   . GLY C  3  116 ? 72.564 61.173  146.917 1.00 33.39  ? 116  GLY C N   1 
ATOM   7551  C  CA  . GLY C  3  116 ? 71.413 61.040  147.794 1.00 33.65  ? 116  GLY C CA  1 
ATOM   7552  C  C   . GLY C  3  116 ? 71.711 60.169  149.014 1.00 34.12  ? 116  GLY C C   1 
ATOM   7553  O  O   . GLY C  3  116 ? 71.225 60.444  150.097 1.00 34.54  ? 116  GLY C O   1 
ATOM   7554  N  N   . VAL C  3  117 ? 72.509 59.113  148.829 1.00 33.85  ? 117  VAL C N   1 
ATOM   7555  C  CA  . VAL C  3  117 ? 72.889 58.242  149.939 1.00 33.63  ? 117  VAL C CA  1 
ATOM   7556  C  C   . VAL C  3  117 ? 73.719 59.038  150.957 1.00 33.70  ? 117  VAL C C   1 
ATOM   7557  O  O   . VAL C  3  117 ? 73.465 58.964  152.161 1.00 33.34  ? 117  VAL C O   1 
ATOM   7558  C  CB  . VAL C  3  117 ? 73.654 57.002  149.456 1.00 33.43  ? 117  VAL C CB  1 
ATOM   7559  C  CG1 . VAL C  3  117 ? 74.317 56.289  150.612 1.00 22.83  ? 117  VAL C CG1 1 
ATOM   7560  C  CG2 . VAL C  3  117 ? 72.701 56.048  148.708 1.00 36.44  ? 117  VAL C CG2 1 
ATOM   7561  N  N   . ILE C  3  118 ? 74.687 59.823  150.451 1.00 34.14  ? 118  ILE C N   1 
ATOM   7562  C  CA  . ILE C  3  118 ? 75.500 60.685  151.290 1.00 34.91  ? 118  ILE C CA  1 
ATOM   7563  C  C   . ILE C  3  118 ? 74.557 61.641  152.067 1.00 34.98  ? 118  ILE C C   1 
ATOM   7564  O  O   . ILE C  3  118 ? 74.729 61.835  153.281 1.00 34.98  ? 118  ILE C O   1 
ATOM   7565  C  CB  . ILE C  3  118 ? 76.525 61.508  150.431 1.00 35.78  ? 118  ILE C CB  1 
ATOM   7566  C  CG1 . ILE C  3  118 ? 77.500 60.581  149.697 1.00 48.21  ? 118  ILE C CG1 1 
ATOM   7567  C  CG2 . ILE C  3  118 ? 77.305 62.572  151.309 1.00 30.49  ? 118  ILE C CG2 1 
ATOM   7568  C  CD1 . ILE C  3  118 ? 78.590 60.018  150.580 1.00 53.01  ? 118  ILE C CD1 1 
ATOM   7569  N  N   . LEU C  3  119 ? 73.531 62.178  151.377 1.00 34.62  ? 119  LEU C N   1 
ATOM   7570  C  CA  . LEU C  3  119 ? 72.547 63.060  152.022 1.00 34.10  ? 119  LEU C CA  1 
ATOM   7571  C  C   . LEU C  3  119 ? 71.771 62.352  153.101 1.00 34.87  ? 119  LEU C C   1 
ATOM   7572  O  O   . LEU C  3  119 ? 71.488 62.939  154.116 1.00 35.70  ? 119  LEU C O   1 
ATOM   7573  C  CB  . LEU C  3  119 ? 71.590 63.691  151.036 1.00 33.06  ? 119  LEU C CB  1 
ATOM   7574  C  CG  . LEU C  3  119 ? 72.159 64.820  150.191 1.00 30.56  ? 119  LEU C CG  1 
ATOM   7575  C  CD1 . LEU C  3  119 ? 71.338 64.977  148.946 1.00 25.08  ? 119  LEU C CD1 1 
ATOM   7576  C  CD2 . LEU C  3  119 ? 72.232 66.129  150.969 1.00 24.51  ? 119  LEU C CD2 1 
ATOM   7577  N  N   . LEU C  3  120 ? 71.446 61.081  152.894 1.00 34.74  ? 120  LEU C N   1 
ATOM   7578  C  CA  . LEU C  3  120 ? 70.739 60.321  153.918 1.00 34.74  ? 120  LEU C CA  1 
ATOM   7579  C  C   . LEU C  3  120 ? 71.629 60.146  155.173 1.00 34.79  ? 120  LEU C C   1 
ATOM   7580  O  O   . LEU C  3  120 ? 71.227 60.511  156.283 1.00 34.91  ? 120  LEU C O   1 
ATOM   7581  C  CB  . LEU C  3  120 ? 70.315 58.959  153.388 1.00 34.41  ? 120  LEU C CB  1 
ATOM   7582  C  CG  . LEU C  3  120 ? 69.741 58.064  154.467 1.00 28.98  ? 120  LEU C CG  1 
ATOM   7583  C  CD1 . LEU C  3  120 ? 68.509 58.693  154.999 1.00 31.50  ? 120  LEU C CD1 1 
ATOM   7584  C  CD2 . LEU C  3  120 ? 69.448 56.703  153.920 1.00 30.81  ? 120  LEU C CD2 1 
ATOM   7585  N  N   . LEU C  3  121 ? 72.828 59.607  154.970 1.00 34.62  ? 121  LEU C N   1 
ATOM   7586  C  CA  . LEU C  3  121 ? 73.791 59.415  156.039 1.00 35.30  ? 121  LEU C CA  1 
ATOM   7587  C  C   . LEU C  3  121 ? 74.026 60.700  156.839 1.00 36.28  ? 121  LEU C C   1 
ATOM   7588  O  O   . LEU C  3  121 ? 74.049 60.676  158.101 1.00 36.91  ? 121  LEU C O   1 
ATOM   7589  C  CB  . LEU C  3  121 ? 75.121 58.956  155.450 1.00 35.13  ? 121  LEU C CB  1 
ATOM   7590  C  CG  . LEU C  3  121 ? 75.101 57.534  154.952 1.00 37.31  ? 121  LEU C CG  1 
ATOM   7591  C  CD1 . LEU C  3  121 ? 76.254 57.253  154.047 1.00 28.56  ? 121  LEU C CD1 1 
ATOM   7592  C  CD2 . LEU C  3  121 ? 75.127 56.642  156.142 1.00 37.08  ? 121  LEU C CD2 1 
ATOM   7593  N  N   . THR C  3  122 ? 74.213 61.809  156.111 1.00 35.75  ? 122  THR C N   1 
ATOM   7594  C  CA  . THR C  3  122 ? 74.454 63.090  156.706 1.00 35.54  ? 122  THR C CA  1 
ATOM   7595  C  C   . THR C  3  122 ? 73.324 63.566  157.576 1.00 35.65  ? 122  THR C C   1 
ATOM   7596  O  O   . THR C  3  122 ? 73.569 63.991  158.690 1.00 36.39  ? 122  THR C O   1 
ATOM   7597  C  CB  . THR C  3  122 ? 74.794 64.125  155.655 1.00 35.88  ? 122  THR C CB  1 
ATOM   7598  O  OG1 . THR C  3  122 ? 75.889 63.659  154.876 1.00 42.46  ? 122  THR C OG1 1 
ATOM   7599  C  CG2 . THR C  3  122 ? 75.362 65.302  156.280 1.00 33.98  ? 122  THR C CG2 1 
ATOM   7600  N  N   . VAL C  3  123 ? 72.079 63.516  157.104 1.00 35.33  ? 123  VAL C N   1 
ATOM   7601  C  CA  . VAL C  3  123 ? 70.989 63.917  158.009 1.00 35.44  ? 123  VAL C CA  1 
ATOM   7602  C  C   . VAL C  3  123 ? 70.775 62.948  159.152 1.00 35.54  ? 123  VAL C C   1 
ATOM   7603  O  O   . VAL C  3  123 ? 70.333 63.337  160.251 1.00 35.71  ? 123  VAL C O   1 
ATOM   7604  C  CB  . VAL C  3  123 ? 69.660 64.515  157.341 1.00 35.56  ? 123  VAL C CB  1 
ATOM   7605  C  CG1 . VAL C  3  123 ? 69.771 64.662  155.850 1.00 39.17  ? 123  VAL C CG1 1 
ATOM   7606  C  CG2 . VAL C  3  123 ? 68.435 63.781  157.752 1.00 16.76  ? 123  VAL C CG2 1 
ATOM   7607  N  N   . MET C  3  124 ? 71.183 61.703  158.945 1.00 35.20  ? 124  MET C N   1 
ATOM   7608  C  CA  . MET C  3  124 ? 71.089 60.727  160.017 1.00 34.95  ? 124  MET C CA  1 
ATOM   7609  C  C   . MET C  3  124 ? 72.112 61.095  161.087 1.00 35.32  ? 124  MET C C   1 
ATOM   7610  O  O   . MET C  3  124 ? 71.742 61.264  162.284 1.00 35.62  ? 124  MET C O   1 
ATOM   7611  C  CB  . MET C  3  124 ? 71.320 59.313  159.518 1.00 34.30  ? 124  MET C CB  1 
ATOM   7612  C  CG  . MET C  3  124 ? 70.079 58.593  159.157 1.00 32.37  ? 124  MET C CG  1 
ATOM   7613  S  SD  . MET C  3  124 ? 70.442 56.908  158.495 1.00 39.37  ? 124  MET C SD  1 
ATOM   7614  C  CE  . MET C  3  124 ? 72.117 56.680  159.206 1.00 42.20  ? 124  MET C CE  1 
ATOM   7615  N  N   . ALA C  3  125 ? 73.382 61.271  160.668 1.00 34.92  ? 125  ALA C N   1 
ATOM   7616  C  CA  . ALA C  3  125 ? 74.436 61.668  161.601 1.00 34.67  ? 125  ALA C CA  1 
ATOM   7617  C  C   . ALA C  3  125 ? 74.021 62.950  162.250 1.00 33.71  ? 125  ALA C C   1 
ATOM   7618  O  O   . ALA C  3  125 ? 74.186 63.107  163.469 1.00 33.62  ? 125  ALA C O   1 
ATOM   7619  C  CB  . ALA C  3  125 ? 75.760 61.841  160.908 1.00 34.99  ? 125  ALA C CB  1 
ATOM   7620  N  N   . THR C  3  126 ? 73.394 63.839  161.462 1.00 32.74  ? 126  THR C N   1 
ATOM   7621  C  CA  . THR C  3  126 ? 72.909 65.116  162.008 1.00 32.84  ? 126  THR C CA  1 
ATOM   7622  C  C   . THR C  3  126 ? 71.849 64.958  163.115 1.00 32.83  ? 126  THR C C   1 
ATOM   7623  O  O   . THR C  3  126 ? 72.015 65.511  164.199 1.00 32.73  ? 126  THR C O   1 
ATOM   7624  C  CB  . THR C  3  126 ? 72.374 66.069  160.905 1.00 32.64  ? 126  THR C CB  1 
ATOM   7625  O  OG1 . THR C  3  126 ? 73.435 66.426  160.023 1.00 34.76  ? 126  THR C OG1 1 
ATOM   7626  C  CG2 . THR C  3  126 ? 71.968 67.401  161.508 1.00 12.01  ? 126  THR C CG2 1 
ATOM   7627  N  N   . ALA C  3  127 ? 70.783 64.186  162.841 1.00 32.69  ? 127  ALA C N   1 
ATOM   7628  C  CA  . ALA C  3  127 ? 69.675 64.010  163.807 1.00 32.41  ? 127  ALA C CA  1 
ATOM   7629  C  C   . ALA C  3  127 ? 70.058 63.271  165.101 1.00 32.69  ? 127  ALA C C   1 
ATOM   7630  O  O   . ALA C  3  127 ? 69.541 63.580  166.181 1.00 32.04  ? 127  ALA C O   1 
ATOM   7631  C  CB  . ALA C  3  127 ? 68.510 63.385  163.162 1.00 31.96  ? 127  ALA C CB  1 
ATOM   7632  N  N   . PHE C  3  128 ? 70.954 62.299  164.975 1.00 33.56  ? 128  PHE C N   1 
ATOM   7633  C  CA  . PHE C  3  128 ? 71.464 61.572  166.119 1.00 34.49  ? 128  PHE C CA  1 
ATOM   7634  C  C   . PHE C  3  128 ? 72.095 62.563  167.066 1.00 35.66  ? 128  PHE C C   1 
ATOM   7635  O  O   . PHE C  3  128 ? 71.708 62.627  168.204 1.00 36.59  ? 128  PHE C O   1 
ATOM   7636  C  CB  . PHE C  3  128 ? 72.466 60.502  165.657 1.00 34.85  ? 128  PHE C CB  1 
ATOM   7637  C  CG  . PHE C  3  128 ? 73.425 60.039  166.725 1.00 41.86  ? 128  PHE C CG  1 
ATOM   7638  C  CD1 . PHE C  3  128 ? 74.795 59.998  166.461 1.00 48.09  ? 128  PHE C CD1 1 
ATOM   7639  C  CD2 . PHE C  3  128 ? 72.970 59.578  167.954 1.00 47.23  ? 128  PHE C CD2 1 
ATOM   7640  C  CE1 . PHE C  3  128 ? 75.693 59.567  167.415 1.00 49.97  ? 128  PHE C CE1 1 
ATOM   7641  C  CE2 . PHE C  3  128 ? 73.873 59.146  168.925 1.00 51.64  ? 128  PHE C CE2 1 
ATOM   7642  C  CZ  . PHE C  3  128 ? 75.237 59.146  168.652 1.00 52.53  ? 128  PHE C CZ  1 
ATOM   7643  N  N   . MET C  3  129 ? 73.017 63.393  166.577 1.00 36.16  ? 129  MET C N   1 
ATOM   7644  C  CA  . MET C  3  129 ? 73.655 64.405  167.432 1.00 36.58  ? 129  MET C CA  1 
ATOM   7645  C  C   . MET C  3  129 ? 72.656 65.415  167.975 1.00 37.01  ? 129  MET C C   1 
ATOM   7646  O  O   . MET C  3  129 ? 72.864 65.986  169.063 1.00 38.13  ? 129  MET C O   1 
ATOM   7647  C  CB  . MET C  3  129 ? 74.798 65.127  166.707 1.00 36.67  ? 129  MET C CB  1 
ATOM   7648  C  CG  . MET C  3  129 ? 76.096 64.326  166.667 1.00 43.99  ? 129  MET C CG  1 
ATOM   7649  S  SD  . MET C  3  129 ? 77.235 64.848  165.382 1.00 51.41  ? 129  MET C SD  1 
ATOM   7650  C  CE  . MET C  3  129 ? 78.707 63.690  165.682 1.00 51.72  ? 129  MET C CE  1 
ATOM   7651  N  N   . GLY C  3  130 ? 71.559 65.611  167.253 1.00 36.13  ? 130  GLY C N   1 
ATOM   7652  C  CA  . GLY C  3  130 ? 70.546 66.549  167.666 1.00 35.66  ? 130  GLY C CA  1 
ATOM   7653  C  C   . GLY C  3  130 ? 69.917 66.120  168.930 1.00 35.83  ? 130  GLY C C   1 
ATOM   7654  O  O   . GLY C  3  130 ? 69.926 66.847  169.900 1.00 35.88  ? 130  GLY C O   1 
ATOM   7655  N  N   . TYR C  3  131 ? 69.426 64.884  168.934 1.00 36.02  ? 131  TYR C N   1 
ATOM   7656  C  CA  . TYR C  3  131 ? 68.724 64.295  170.070 1.00 35.64  ? 131  TYR C CA  1 
ATOM   7657  C  C   . TYR C  3  131 ? 69.497 64.269  171.416 1.00 35.66  ? 131  TYR C C   1 
ATOM   7658  O  O   . TYR C  3  131 ? 68.888 64.211  172.483 1.00 35.89  ? 131  TYR C O   1 
ATOM   7659  C  CB  . TYR C  3  131 ? 68.233 62.908  169.706 1.00 35.58  ? 131  TYR C CB  1 
ATOM   7660  C  CG  . TYR C  3  131 ? 67.178 62.400  170.634 1.00 49.40  ? 131  TYR C CG  1 
ATOM   7661  C  CD1 . TYR C  3  131 ? 67.375 61.217  171.369 1.00 51.43  ? 131  TYR C CD1 1 
ATOM   7662  C  CD2 . TYR C  3  131 ? 65.987 63.120  170.828 1.00 49.30  ? 131  TYR C CD2 1 
ATOM   7663  C  CE1 . TYR C  3  131 ? 66.406 60.746  172.241 1.00 55.49  ? 131  TYR C CE1 1 
ATOM   7664  C  CE2 . TYR C  3  131 ? 65.012 62.668  171.710 1.00 52.89  ? 131  TYR C CE2 1 
ATOM   7665  C  CZ  . TYR C  3  131 ? 65.222 61.472  172.418 1.00 57.15  ? 131  TYR C CZ  1 
ATOM   7666  O  OH  . TYR C  3  131 ? 64.251 60.994  173.295 1.00 58.16  ? 131  TYR C OH  1 
ATOM   7667  N  N   . VAL C  3  132 ? 70.828 64.340  171.356 1.00 35.00  ? 132  VAL C N   1 
ATOM   7668  C  CA  . VAL C  3  132 ? 71.642 64.292  172.552 1.00 34.03  ? 132  VAL C CA  1 
ATOM   7669  C  C   . VAL C  3  132 ? 71.650 65.619  173.257 1.00 34.10  ? 132  VAL C C   1 
ATOM   7670  O  O   . VAL C  3  132 ? 71.718 65.676  174.457 1.00 34.34  ? 132  VAL C O   1 
ATOM   7671  C  CB  . VAL C  3  132 ? 73.086 63.850  172.228 1.00 33.56  ? 132  VAL C CB  1 
ATOM   7672  C  CG1 . VAL C  3  132 ? 73.934 63.749  173.493 1.00 16.29  ? 132  VAL C CG1 1 
ATOM   7673  C  CG2 . VAL C  3  132 ? 73.070 62.515  171.504 1.00 31.05  ? 132  VAL C CG2 1 
ATOM   7674  N  N   . LEU C  3  133 ? 71.476 66.682  172.491 1.00 34.53  ? 133  LEU C N   1 
ATOM   7675  C  CA  . LEU C  3  133 ? 71.538 68.063  173.000 1.00 34.64  ? 133  LEU C CA  1 
ATOM   7676  C  C   . LEU C  3  133 ? 70.731 68.472  174.272 1.00 35.16  ? 133  LEU C C   1 
ATOM   7677  O  O   . LEU C  3  133 ? 71.266 69.217  175.108 1.00 35.07  ? 133  LEU C O   1 
ATOM   7678  C  CB  . LEU C  3  133 ? 71.410 69.112  171.861 1.00 34.04  ? 133  LEU C CB  1 
ATOM   7679  C  CG  . LEU C  3  133 ? 72.399 69.006  170.694 1.00 31.57  ? 133  LEU C CG  1 
ATOM   7680  C  CD1 . LEU C  3  133 ? 72.184 70.108  169.640 1.00 23.76  ? 133  LEU C CD1 1 
ATOM   7681  C  CD2 . LEU C  3  133 ? 73.839 69.007  171.180 1.00 36.74  ? 133  LEU C CD2 1 
ATOM   7682  N  N   . PRO C  3  134 ? 69.473 68.013  174.427 1.00 35.63  ? 134  PRO C N   1 
ATOM   7683  C  CA  . PRO C  3  134 ? 68.687 68.352  175.631 1.00 36.44  ? 134  PRO C CA  1 
ATOM   7684  C  C   . PRO C  3  134 ? 69.246 67.693  176.903 1.00 36.44  ? 134  PRO C C   1 
ATOM   7685  O  O   . PRO C  3  134 ? 68.919 68.134  178.003 1.00 36.60  ? 134  PRO C O   1 
ATOM   7686  C  CB  . PRO C  3  134 ? 67.294 67.781  175.329 1.00 37.14  ? 134  PRO C CB  1 
ATOM   7687  C  CG  . PRO C  3  134 ? 67.269 67.514  173.888 1.00 41.81  ? 134  PRO C CG  1 
ATOM   7688  C  CD  . PRO C  3  134 ? 68.688 67.211  173.486 1.00 36.09  ? 134  PRO C CD  1 
ATOM   7689  N  N   . TRP C  3  135 ? 70.093 66.675  176.719 1.00 36.45  ? 135  TRP C N   1 
ATOM   7690  C  CA  . TRP C  3  135 ? 70.753 65.947  177.802 1.00 36.83  ? 135  TRP C CA  1 
ATOM   7691  C  C   . TRP C  3  135 ? 69.762 65.236  178.690 1.00 37.80  ? 135  TRP C C   1 
ATOM   7692  O  O   . TRP C  3  135 ? 69.856 65.301  179.918 1.00 38.12  ? 135  TRP C O   1 
ATOM   7693  C  CB  . TRP C  3  135 ? 71.680 66.856  178.613 1.00 36.49  ? 135  TRP C CB  1 
ATOM   7694  C  CG  . TRP C  3  135 ? 72.874 66.165  179.255 1.00 32.73  ? 135  TRP C CG  1 
ATOM   7695  C  CD1 . TRP C  3  135 ? 73.214 66.189  180.577 1.00 39.30  ? 135  TRP C CD1 1 
ATOM   7696  C  CD2 . TRP C  3  135 ? 73.897 65.389  178.599 1.00 34.33  ? 135  TRP C CD2 1 
ATOM   7697  N  NE1 . TRP C  3  135 ? 74.372 65.481  180.786 1.00 38.00  ? 135  TRP C NE1 1 
ATOM   7698  C  CE2 . TRP C  3  135 ? 74.814 64.984  179.586 1.00 35.14  ? 135  TRP C CE2 1 
ATOM   7699  C  CE3 . TRP C  3  135 ? 74.131 64.994  177.277 1.00 37.46  ? 135  TRP C CE3 1 
ATOM   7700  C  CZ2 . TRP C  3  135 ? 75.947 64.207  179.291 1.00 32.75  ? 135  TRP C CZ2 1 
ATOM   7701  C  CZ3 . TRP C  3  135 ? 75.263 64.222  176.994 1.00 33.45  ? 135  TRP C CZ3 1 
ATOM   7702  C  CH2 . TRP C  3  135 ? 76.139 63.835  177.999 1.00 32.62  ? 135  TRP C CH2 1 
ATOM   7703  N  N   . GLY C  3  136 ? 68.765 64.602  178.056 1.00 38.15  ? 136  GLY C N   1 
ATOM   7704  C  CA  . GLY C  3  136 ? 67.778 63.816  178.765 1.00 38.01  ? 136  GLY C CA  1 
ATOM   7705  C  C   . GLY C  3  136 ? 68.337 62.423  178.971 1.00 38.01  ? 136  GLY C C   1 
ATOM   7706  O  O   . GLY C  3  136 ? 69.428 62.105  178.482 1.00 37.87  ? 136  GLY C O   1 
ATOM   7707  N  N   . GLN C  3  137 ? 67.610 61.592  179.707 1.00 38.12  ? 137  GLN C N   1 
ATOM   7708  C  CA  . GLN C  3  137 ? 68.055 60.237  179.948 1.00 38.15  ? 137  GLN C CA  1 
ATOM   7709  C  C   . GLN C  3  137 ? 68.234 59.501  178.632 1.00 38.27  ? 137  GLN C C   1 
ATOM   7710  O  O   . GLN C  3  137 ? 69.215 58.786  178.441 1.00 38.25  ? 137  GLN C O   1 
ATOM   7711  C  CB  . GLN C  3  137 ? 67.074 59.497  180.850 1.00 38.22  ? 137  GLN C CB  1 
ATOM   7712  C  CG  . GLN C  3  137 ? 67.403 59.581  182.315 1.00 37.88  ? 137  GLN C CG  1 
ATOM   7713  C  CD  . GLN C  3  137 ? 68.429 58.581  182.722 1.00 45.72  ? 137  GLN C CD  1 
ATOM   7714  O  OE1 . GLN C  3  137 ? 69.621 58.868  182.705 1.00 53.10  ? 137  GLN C OE1 1 
ATOM   7715  N  NE2 . GLN C  3  137 ? 67.980 57.396  183.095 1.00 47.32  ? 137  GLN C NE2 1 
ATOM   7716  N  N   . MET C  3  138 ? 67.318 59.726  177.694 1.00 38.38  ? 138  MET C N   1 
ATOM   7717  C  CA  . MET C  3  138 ? 67.423 59.072  176.399 1.00 38.39  ? 138  MET C CA  1 
ATOM   7718  C  C   . MET C  3  138 ? 68.488 59.663  175.516 1.00 38.00  ? 138  MET C C   1 
ATOM   7719  O  O   . MET C  3  138 ? 69.021 58.988  174.642 1.00 37.95  ? 138  MET C O   1 
ATOM   7720  C  CB  . MET C  3  138 ? 66.076 58.972  175.686 1.00 38.52  ? 138  MET C CB  1 
ATOM   7721  C  CG  . MET C  3  138 ? 65.144 57.944  176.324 1.00 44.34  ? 138  MET C CG  1 
ATOM   7722  S  SD  . MET C  3  138 ? 65.950 56.323  176.755 1.00 48.94  ? 138  MET C SD  1 
ATOM   7723  C  CE  . MET C  3  138 ? 66.560 55.807  175.208 1.00 46.20  ? 138  MET C CE  1 
ATOM   7724  N  N   . SER C  3  139 ? 68.817 60.919  175.770 1.00 37.70  ? 139  SER C N   1 
ATOM   7725  C  CA  . SER C  3  139 ? 69.857 61.583  175.034 1.00 37.65  ? 139  SER C CA  1 
ATOM   7726  C  C   . SER C  3  139 ? 71.198 60.956  175.391 1.00 37.90  ? 139  SER C C   1 
ATOM   7727  O  O   . SER C  3  139 ? 71.981 60.602  174.521 1.00 38.11  ? 139  SER C O   1 
ATOM   7728  C  CB  . SER C  3  139 ? 69.891 63.063  175.393 1.00 37.31  ? 139  SER C CB  1 
ATOM   7729  O  OG  . SER C  3  139 ? 68.646 63.688  175.156 1.00 30.19  ? 139  SER C OG  1 
ATOM   7730  N  N   . PHE C  3  140 ? 71.421 60.780  176.678 1.00 37.92  ? 140  PHE C N   1 
ATOM   7731  C  CA  . PHE C  3  140 ? 72.668 60.263  177.177 1.00 38.10  ? 140  PHE C CA  1 
ATOM   7732  C  C   . PHE C  3  140 ? 72.881 58.785  176.903 1.00 38.09  ? 140  PHE C C   1 
ATOM   7733  O  O   . PHE C  3  140 ? 73.976 58.367  176.544 1.00 37.68  ? 140  PHE C O   1 
ATOM   7734  C  CB  . PHE C  3  140 ? 72.763 60.532  178.676 1.00 38.43  ? 140  PHE C CB  1 
ATOM   7735  C  CG  . PHE C  3  140 ? 73.906 59.865  179.324 1.00 41.72  ? 140  PHE C CG  1 
ATOM   7736  C  CD1 . PHE C  3  140 ? 75.170 60.391  179.218 1.00 41.92  ? 140  PHE C CD1 1 
ATOM   7737  C  CD2 . PHE C  3  140 ? 73.734 58.673  180.005 1.00 41.53  ? 140  PHE C CD2 1 
ATOM   7738  C  CE1 . PHE C  3  140 ? 76.237 59.765  179.804 1.00 43.70  ? 140  PHE C CE1 1 
ATOM   7739  C  CE2 . PHE C  3  140 ? 74.806 58.034  180.561 1.00 45.58  ? 140  PHE C CE2 1 
ATOM   7740  C  CZ  . PHE C  3  140 ? 76.065 58.591  180.465 1.00 44.19  ? 140  PHE C CZ  1 
ATOM   7741  N  N   . TRP C  3  141 ? 71.845 57.993  177.137 1.00 38.71  ? 141  TRP C N   1 
ATOM   7742  C  CA  . TRP C  3  141 ? 71.921 56.547  176.934 1.00 39.43  ? 141  TRP C CA  1 
ATOM   7743  C  C   . TRP C  3  141 ? 71.839 56.189  175.457 1.00 39.73  ? 141  TRP C C   1 
ATOM   7744  O  O   . TRP C  3  141 ? 72.353 55.154  175.016 1.00 39.56  ? 141  TRP C O   1 
ATOM   7745  C  CB  . TRP C  3  141 ? 70.870 55.825  177.777 1.00 39.66  ? 141  TRP C CB  1 
ATOM   7746  C  CG  . TRP C  3  141 ? 71.183 55.911  179.294 1.00 44.00  ? 141  TRP C CG  1 
ATOM   7747  C  CD1 . TRP C  3  141 ? 70.517 56.647  180.235 1.00 41.24  ? 141  TRP C CD1 1 
ATOM   7748  C  CD2 . TRP C  3  141 ? 72.267 55.274  179.985 1.00 44.70  ? 141  TRP C CD2 1 
ATOM   7749  N  NE1 . TRP C  3  141 ? 71.104 56.484  181.466 1.00 41.41  ? 141  TRP C NE1 1 
ATOM   7750  C  CE2 . TRP C  3  141 ? 72.184 55.650  181.337 1.00 43.41  ? 141  TRP C CE2 1 
ATOM   7751  C  CE3 . TRP C  3  141 ? 73.303 54.410  179.595 1.00 46.44  ? 141  TRP C CE3 1 
ATOM   7752  C  CZ2 . TRP C  3  141 ? 73.080 55.200  182.288 1.00 44.57  ? 141  TRP C CZ2 1 
ATOM   7753  C  CZ3 . TRP C  3  141 ? 74.194 53.971  180.545 1.00 44.82  ? 141  TRP C CZ3 1 
ATOM   7754  C  CH2 . TRP C  3  141 ? 74.079 54.364  181.872 1.00 45.27  ? 141  TRP C CH2 1 
ATOM   7755  N  N   . GLY C  3  142 ? 71.185 57.051  174.700 1.00 40.02  ? 142  GLY C N   1 
ATOM   7756  C  CA  . GLY C  3  142 ? 71.160 56.909  173.278 1.00 40.36  ? 142  GLY C CA  1 
ATOM   7757  C  C   . GLY C  3  142 ? 72.586 57.172  172.803 1.00 40.63  ? 142  GLY C C   1 
ATOM   7758  O  O   . GLY C  3  142 ? 73.175 56.338  172.114 1.00 41.20  ? 142  GLY C O   1 
ATOM   7759  N  N   . ALA C  3  143 ? 73.164 58.295  173.255 1.00 39.90  ? 143  ALA C N   1 
ATOM   7760  C  CA  . ALA C  3  143 ? 74.542 58.675  172.916 1.00 39.63  ? 143  ALA C CA  1 
ATOM   7761  C  C   . ALA C  3  143 ? 75.541 57.596  173.290 1.00 39.54  ? 143  ALA C C   1 
ATOM   7762  O  O   . ALA C  3  143 ? 76.547 57.369  172.582 1.00 39.11  ? 143  ALA C O   1 
ATOM   7763  C  CB  . ALA C  3  143 ? 74.908 59.949  173.609 1.00 39.81  ? 143  ALA C CB  1 
ATOM   7764  N  N   . THR C  3  144 ? 75.271 56.944  174.418 1.00 39.77  ? 144  THR C N   1 
ATOM   7765  C  CA  . THR C  3  144 ? 76.123 55.896  174.913 1.00 39.78  ? 144  THR C CA  1 
ATOM   7766  C  C   . THR C  3  144 ? 76.024 54.653  174.045 1.00 39.97  ? 144  THR C C   1 
ATOM   7767  O  O   . THR C  3  144 ? 77.009 54.260  173.414 1.00 40.23  ? 144  THR C O   1 
ATOM   7768  C  CB  . THR C  3  144 ? 75.787 55.573  176.379 1.00 39.70  ? 144  THR C CB  1 
ATOM   7769  O  OG1 . THR C  3  144 ? 75.888 56.771  177.170 1.00 39.53  ? 144  THR C OG1 1 
ATOM   7770  C  CG2 . THR C  3  144 ? 76.842 54.645  176.980 1.00 29.99  ? 144  THR C CG2 1 
ATOM   7771  N  N   . VAL C  3  145 ? 74.831 54.068  173.962 1.00 39.99  ? 145  VAL C N   1 
ATOM   7772  C  CA  . VAL C  3  145 ? 74.640 52.847  173.180 1.00 40.64  ? 145  VAL C CA  1 
ATOM   7773  C  C   . VAL C  3  145 ? 75.211 52.946  171.772 1.00 41.20  ? 145  VAL C C   1 
ATOM   7774  O  O   . VAL C  3  145 ? 75.915 52.035  171.311 1.00 41.06  ? 145  VAL C O   1 
ATOM   7775  C  CB  . VAL C  3  145 ? 73.160 52.456  173.084 1.00 40.71  ? 145  VAL C CB  1 
ATOM   7776  C  CG1 . VAL C  3  145 ? 72.946 51.382  172.045 1.00 38.76  ? 145  VAL C CG1 1 
ATOM   7777  C  CG2 . VAL C  3  145 ? 72.666 52.006  174.373 1.00 40.34  ? 145  VAL C CG2 1 
ATOM   7778  N  N   . ILE C  3  146 ? 74.997 54.102  171.140 1.00 41.76  ? 146  ILE C N   1 
ATOM   7779  C  CA  . ILE C  3  146 ? 75.406 54.319  169.747 1.00 42.05  ? 146  ILE C CA  1 
ATOM   7780  C  C   . ILE C  3  146 ? 76.854 54.368  169.485 1.00 42.49  ? 146  ILE C C   1 
ATOM   7781  O  O   . ILE C  3  146 ? 77.383 53.529  168.762 1.00 42.10  ? 146  ILE C O   1 
ATOM   7782  C  CB  . ILE C  3  146 ? 74.723 55.531  169.162 1.00 42.03  ? 146  ILE C CB  1 
ATOM   7783  C  CG1 . ILE C  3  146 ? 73.291 55.260  169.181 1.00 36.08  ? 146  ILE C CG1 1 
ATOM   7784  C  CG2 . ILE C  3  146 ? 75.098 55.701  167.677 1.00 42.65  ? 146  ILE C CG2 1 
ATOM   7785  C  CD1 . ILE C  3  146 ? 73.106 53.927  168.957 1.00 37.40  ? 146  ILE C CD1 1 
ATOM   7786  N  N   . THR C  3  147 ? 77.505 55.365  170.061 1.00 43.19  ? 147  THR C N   1 
ATOM   7787  C  CA  . THR C  3  147 ? 78.921 55.561  169.881 1.00 43.79  ? 147  THR C CA  1 
ATOM   7788  C  C   . THR C  3  147 ? 79.729 54.303  170.173 1.00 43.04  ? 147  THR C C   1 
ATOM   7789  O  O   . THR C  3  147 ? 80.589 53.899  169.370 1.00 42.80  ? 147  THR C O   1 
ATOM   7790  C  CB  . THR C  3  147 ? 79.370 56.682  170.745 1.00 44.77  ? 147  THR C CB  1 
ATOM   7791  O  OG1 . THR C  3  147 ? 78.708 57.891  170.321 1.00 58.77  ? 147  THR C OG1 1 
ATOM   7792  C  CG2 . THR C  3  147 ? 80.857 56.962  170.509 1.00 58.95  ? 147  THR C CG2 1 
ATOM   7793  N  N   . ASN C  3  148 ? 79.378 53.636  171.272 1.00 42.46  ? 148  ASN C N   1 
ATOM   7794  C  CA  . ASN C  3  148 ? 80.044 52.413  171.688 1.00 41.89  ? 148  ASN C CA  1 
ATOM   7795  C  C   . ASN C  3  148 ? 80.068 51.288  170.673 1.00 41.57  ? 148  ASN C C   1 
ATOM   7796  O  O   . ASN C  3  148 ? 80.849 50.353  170.811 1.00 41.57  ? 148  ASN C O   1 
ATOM   7797  C  CB  . ASN C  3  148 ? 79.465 51.919  172.981 1.00 41.75  ? 148  ASN C CB  1 
ATOM   7798  C  CG  . ASN C  3  148 ? 80.393 52.123  174.155 1.00 43.46  ? 148  ASN C CG  1 
ATOM   7799  O  OD1 . ASN C  3  148 ? 81.623 52.001  174.026 1.00 41.02  ? 148  ASN C OD1 1 
ATOM   7800  N  ND2 . ASN C  3  148 ? 79.816 52.412  175.322 1.00 46.00  ? 148  ASN C ND2 1 
ATOM   7801  N  N   . LEU C  3  149 ? 79.205 51.376  169.659 1.00 41.32  ? 149  LEU C N   1 
ATOM   7802  C  CA  . LEU C  3  149 ? 79.156 50.381  168.582 1.00 40.96  ? 149  LEU C CA  1 
ATOM   7803  C  C   . LEU C  3  149 ? 80.489 50.319  167.898 1.00 40.46  ? 149  LEU C C   1 
ATOM   7804  O  O   . LEU C  3  149 ? 81.002 49.237  167.587 1.00 40.09  ? 149  LEU C O   1 
ATOM   7805  C  CB  . LEU C  3  149 ? 78.105 50.774  167.530 1.00 40.94  ? 149  LEU C CB  1 
ATOM   7806  C  CG  . LEU C  3  149 ? 76.669 50.335  167.720 1.00 38.25  ? 149  LEU C CG  1 
ATOM   7807  C  CD1 . LEU C  3  149 ? 75.766 51.082  166.787 1.00 40.99  ? 149  LEU C CD1 1 
ATOM   7808  C  CD2 . LEU C  3  149 ? 76.585 48.882  167.457 1.00 45.64  ? 149  LEU C CD2 1 
ATOM   7809  N  N   . LEU C  3  150 ? 81.071 51.498  167.709 1.00 40.27  ? 150  LEU C N   1 
ATOM   7810  C  CA  . LEU C  3  150 ? 82.325 51.648  167.014 1.00 40.26  ? 150  LEU C CA  1 
ATOM   7811  C  C   . LEU C  3  150 ? 83.504 50.907  167.680 1.00 40.18  ? 150  LEU C C   1 
ATOM   7812  O  O   . LEU C  3  150 ? 84.540 50.694  167.054 1.00 40.25  ? 150  LEU C O   1 
ATOM   7813  C  CB  . LEU C  3  150 ? 82.622 53.141  166.806 1.00 40.29  ? 150  LEU C CB  1 
ATOM   7814  C  CG  . LEU C  3  150 ? 81.504 53.967  166.098 1.00 38.60  ? 150  LEU C CG  1 
ATOM   7815  C  CD1 . LEU C  3  150 ? 81.592 55.469  166.368 1.00 37.90  ? 150  LEU C CD1 1 
ATOM   7816  C  CD2 . LEU C  3  150 ? 81.453 53.709  164.635 1.00 28.61  ? 150  LEU C CD2 1 
ATOM   7817  N  N   . SER C  3  151 ? 83.297 50.440  168.916 1.00 40.01  ? 151  SER C N   1 
ATOM   7818  C  CA  . SER C  3  151 ? 84.333 49.713  169.664 1.00 40.08  ? 151  SER C CA  1 
ATOM   7819  C  C   . SER C  3  151 ? 84.481 48.263  169.206 1.00 39.81  ? 151  SER C C   1 
ATOM   7820  O  O   . SER C  3  151 ? 85.316 47.520  169.744 1.00 39.81  ? 151  SER C O   1 
ATOM   7821  C  CB  . SER C  3  151 ? 84.022 49.723  171.155 1.00 40.19  ? 151  SER C CB  1 
ATOM   7822  O  OG  . SER C  3  151 ? 82.927 48.858  171.436 1.00 41.67  ? 151  SER C OG  1 
ATOM   7823  N  N   . ALA C  3  152 ? 83.644 47.859  168.243 1.00 39.39  ? 152  ALA C N   1 
ATOM   7824  C  CA  . ALA C  3  152 ? 83.667 46.505  167.689 1.00 38.92  ? 152  ALA C CA  1 
ATOM   7825  C  C   . ALA C  3  152 ? 84.663 46.405  166.544 1.00 38.40  ? 152  ALA C C   1 
ATOM   7826  O  O   . ALA C  3  152 ? 85.030 45.309  166.126 1.00 38.18  ? 152  ALA C O   1 
ATOM   7827  C  CB  . ALA C  3  152 ? 82.283 46.101  167.219 1.00 39.01  ? 152  ALA C CB  1 
ATOM   7828  N  N   . ILE C  3  153 ? 85.064 47.555  166.017 1.00 38.18  ? 153  ILE C N   1 
ATOM   7829  C  CA  . ILE C  3  153 ? 86.053 47.599  164.963 1.00 38.08  ? 153  ILE C CA  1 
ATOM   7830  C  C   . ILE C  3  153 ? 87.367 47.138  165.566 1.00 38.17  ? 153  ILE C C   1 
ATOM   7831  O  O   . ILE C  3  153 ? 87.858 47.722  166.520 1.00 38.10  ? 153  ILE C O   1 
ATOM   7832  C  CB  . ILE C  3  153 ? 86.156 49.014  164.396 1.00 37.97  ? 153  ILE C CB  1 
ATOM   7833  C  CG1 . ILE C  3  153 ? 84.806 49.427  163.789 1.00 28.18  ? 153  ILE C CG1 1 
ATOM   7834  C  CG2 . ILE C  3  153 ? 87.284 49.105  163.350 1.00 40.61  ? 153  ILE C CG2 1 
ATOM   7835  C  CD1 . ILE C  3  153 ? 84.790 50.814  163.200 1.00 29.26  ? 153  ILE C CD1 1 
ATOM   7836  N  N   . PRO C  3  154 ? 87.905 46.063  165.017 1.00 38.51  ? 154  PRO C N   1 
ATOM   7837  C  CA  . PRO C  3  154 ? 89.117 45.423  165.538 1.00 39.23  ? 154  PRO C CA  1 
ATOM   7838  C  C   . PRO C  3  154 ? 90.352 46.318  165.661 1.00 40.17  ? 154  PRO C C   1 
ATOM   7839  O  O   . PRO C  3  154 ? 90.621 47.102  164.741 1.00 40.40  ? 154  PRO C O   1 
ATOM   7840  C  CB  . PRO C  3  154 ? 89.395 44.327  164.503 1.00 39.20  ? 154  PRO C CB  1 
ATOM   7841  C  CG  . PRO C  3  154 ? 88.080 44.086  163.832 1.00 40.29  ? 154  PRO C CG  1 
ATOM   7842  C  CD  . PRO C  3  154 ? 87.404 45.398  163.802 1.00 38.58  ? 154  PRO C CD  1 
ATOM   7843  N  N   . TYR C  3  155 ? 91.035 46.259  166.817 1.00 40.78  ? 155  TYR C N   1 
ATOM   7844  C  CA  . TYR C  3  155 ? 92.323 46.966  167.025 1.00 41.47  ? 155  TYR C CA  1 
ATOM   7845  C  C   . TYR C  3  155 ? 92.287 48.512  167.087 1.00 41.35  ? 155  TYR C C   1 
ATOM   7846  O  O   . TYR C  3  155 ? 93.163 49.117  167.682 1.00 41.42  ? 155  TYR C O   1 
ATOM   7847  C  CB  . TYR C  3  155 ? 93.324 46.501  165.934 1.00 42.02  ? 155  TYR C CB  1 
ATOM   7848  C  CG  . TYR C  3  155 ? 94.783 46.915  166.101 1.00 50.57  ? 155  TYR C CG  1 
ATOM   7849  C  CD1 . TYR C  3  155 ? 95.545 46.443  167.170 1.00 51.95  ? 155  TYR C CD1 1 
ATOM   7850  C  CD2 . TYR C  3  155 ? 95.425 47.701  165.126 1.00 49.30  ? 155  TYR C CD2 1 
ATOM   7851  C  CE1 . TYR C  3  155 ? 96.903 46.782  167.298 1.00 52.78  ? 155  TYR C CE1 1 
ATOM   7852  C  CE2 . TYR C  3  155 ? 96.776 48.044  165.244 1.00 48.02  ? 155  TYR C CE2 1 
ATOM   7853  C  CZ  . TYR C  3  155 ? 97.510 47.578  166.334 1.00 48.07  ? 155  TYR C CZ  1 
ATOM   7854  O  OH  . TYR C  3  155 ? 98.840 47.902  166.468 1.00 39.08  ? 155  TYR C OH  1 
ATOM   7855  N  N   . ILE C  3  156 ? 91.271 49.126  166.483 1.00 41.10  ? 156  ILE C N   1 
ATOM   7856  C  CA  . ILE C  3  156 ? 91.157 50.593  166.408 1.00 40.95  ? 156  ILE C CA  1 
ATOM   7857  C  C   . ILE C  3  156 ? 89.931 51.110  167.196 1.00 39.97  ? 156  ILE C C   1 
ATOM   7858  O  O   . ILE C  3  156 ? 89.908 52.252  167.655 1.00 39.45  ? 156  ILE C O   1 
ATOM   7859  C  CB  . ILE C  3  156 ? 91.035 51.021  164.865 1.00 41.70  ? 156  ILE C CB  1 
ATOM   7860  C  CG1 . ILE C  3  156 ? 92.312 50.640  164.081 1.00 52.69  ? 156  ILE C CG1 1 
ATOM   7861  C  CG2 . ILE C  3  156 ? 90.722 52.519  164.698 1.00 47.24  ? 156  ILE C CG2 1 
ATOM   7862  C  CD1 . ILE C  3  156 ? 92.239 50.925  162.525 1.00 46.14  ? 156  ILE C CD1 1 
ATOM   7863  N  N   . GLY C  3  157 ? 88.950 50.230  167.387 1.00 39.58  ? 157  GLY C N   1 
ATOM   7864  C  CA  . GLY C  3  157 ? 87.684 50.570  168.028 1.00 39.29  ? 157  GLY C CA  1 
ATOM   7865  C  C   . GLY C  3  157 ? 87.649 51.261  169.378 1.00 39.11  ? 157  GLY C C   1 
ATOM   7866  O  O   . GLY C  3  157 ? 86.817 52.144  169.585 1.00 39.10  ? 157  GLY C O   1 
ATOM   7867  N  N   . THR C  3  158 ? 88.510 50.842  170.307 1.00 38.81  ? 158  THR C N   1 
ATOM   7868  C  CA  . THR C  3  158 ? 88.542 51.447  171.642 1.00 38.68  ? 158  THR C CA  1 
ATOM   7869  C  C   . THR C  3  158 ? 89.039 52.900  171.554 1.00 38.73  ? 158  THR C C   1 
ATOM   7870  O  O   . THR C  3  158 ? 88.380 53.826  172.050 1.00 38.89  ? 158  THR C O   1 
ATOM   7871  C  CB  . THR C  3  158 ? 89.446 50.613  172.619 1.00 38.69  ? 158  THR C CB  1 
ATOM   7872  O  OG1 . THR C  3  158 ? 89.017 49.235  172.643 1.00 33.25  ? 158  THR C OG1 1 
ATOM   7873  C  CG2 . THR C  3  158 ? 89.246 51.073  174.051 1.00 36.49  ? 158  THR C CG2 1 
ATOM   7874  N  N   . ASN C  3  159 ? 90.188 53.089  170.899 1.00 38.53  ? 159  ASN C N   1 
ATOM   7875  C  CA  . ASN C  3  159 ? 90.773 54.432  170.686 1.00 38.32  ? 159  ASN C CA  1 
ATOM   7876  C  C   . ASN C  3  159 ? 89.819 55.387  169.909 1.00 37.93  ? 159  ASN C C   1 
ATOM   7877  O  O   . ASN C  3  159 ? 89.790 56.584  170.168 1.00 38.21  ? 159  ASN C O   1 
ATOM   7878  C  CB  . ASN C  3  159 ? 92.104 54.322  169.912 1.00 38.30  ? 159  ASN C CB  1 
ATOM   7879  C  CG  . ASN C  3  159 ? 93.109 53.410  170.591 1.00 37.31  ? 159  ASN C CG  1 
ATOM   7880  O  OD1 . ASN C  3  159 ? 93.373 52.295  170.126 1.00 37.08  ? 159  ASN C OD1 1 
ATOM   7881  N  ND2 . ASN C  3  159 ? 93.687 53.882  171.686 1.00 35.59  ? 159  ASN C ND2 1 
ATOM   7882  N  N   . LEU C  3  160 ? 89.056 54.820  168.969 1.00 37.12  ? 160  LEU C N   1 
ATOM   7883  C  CA  . LEU C  3  160 ? 88.113 55.564  168.128 1.00 36.45  ? 160  LEU C CA  1 
ATOM   7884  C  C   . LEU C  3  160 ? 86.940 56.077  168.937 1.00 35.85  ? 160  LEU C C   1 
ATOM   7885  O  O   . LEU C  3  160 ? 86.529 57.218  168.792 1.00 35.87  ? 160  LEU C O   1 
ATOM   7886  C  CB  . LEU C  3  160 ? 87.606 54.645  167.006 1.00 36.35  ? 160  LEU C CB  1 
ATOM   7887  C  CG  . LEU C  3  160 ? 86.939 55.189  165.738 1.00 39.81  ? 160  LEU C CG  1 
ATOM   7888  C  CD1 . LEU C  3  160 ? 87.297 54.296  164.557 1.00 38.41  ? 160  LEU C CD1 1 
ATOM   7889  C  CD2 . LEU C  3  160 ? 85.410 55.310  165.875 1.00 36.16  ? 160  LEU C CD2 1 
ATOM   7890  N  N   . VAL C  3  161 ? 86.388 55.216  169.771 1.00 35.38  ? 161  VAL C N   1 
ATOM   7891  C  CA  . VAL C  3  161 ? 85.258 55.585  170.598 1.00 35.07  ? 161  VAL C CA  1 
ATOM   7892  C  C   . VAL C  3  161 ? 85.667 56.621  171.640 1.00 34.60  ? 161  VAL C C   1 
ATOM   7893  O  O   . VAL C  3  161 ? 84.943 57.604  171.875 1.00 34.51  ? 161  VAL C O   1 
ATOM   7894  C  CB  . VAL C  3  161 ? 84.647 54.355  171.268 1.00 35.13  ? 161  VAL C CB  1 
ATOM   7895  C  CG1 . VAL C  3  161 ? 83.727 54.751  172.361 1.00 33.55  ? 161  VAL C CG1 1 
ATOM   7896  C  CG2 . VAL C  3  161 ? 83.918 53.554  170.266 1.00 32.97  ? 161  VAL C CG2 1 
ATOM   7897  N  N   . GLU C  3  162 ? 86.850 56.431  172.222 1.00 34.08  ? 162  GLU C N   1 
ATOM   7898  C  CA  . GLU C  3  162 ? 87.358 57.369  173.203 1.00 34.03  ? 162  GLU C CA  1 
ATOM   7899  C  C   . GLU C  3  162 ? 87.729 58.710  172.563 1.00 33.54  ? 162  GLU C C   1 
ATOM   7900  O  O   . GLU C  3  162 ? 87.627 59.755  173.200 1.00 33.31  ? 162  GLU C O   1 
ATOM   7901  C  CB  . GLU C  3  162 ? 88.528 56.776  173.987 1.00 34.30  ? 162  GLU C CB  1 
ATOM   7902  C  CG  . GLU C  3  162 ? 88.088 55.889  175.154 1.00 44.59  ? 162  GLU C CG  1 
ATOM   7903  C  CD  . GLU C  3  162 ? 89.169 54.902  175.609 1.00 47.12  ? 162  GLU C CD  1 
ATOM   7904  O  OE1 . GLU C  3  162 ? 90.277 54.921  175.039 1.00 53.61  ? 162  GLU C OE1 1 
ATOM   7905  O  OE2 . GLU C  3  162 ? 88.902 54.100  176.534 1.00 47.80  ? 162  GLU C OE2 1 
ATOM   7906  N  N   . TRP C  3  163 ? 88.132 58.671  171.294 1.00 33.32  ? 163  TRP C N   1 
ATOM   7907  C  CA  . TRP C  3  163 ? 88.470 59.882  170.573 1.00 33.21  ? 163  TRP C CA  1 
ATOM   7908  C  C   . TRP C  3  163 ? 87.242 60.729  170.318 1.00 33.29  ? 163  TRP C C   1 
ATOM   7909  O  O   . TRP C  3  163 ? 87.288 61.933  170.497 1.00 33.10  ? 163  TRP C O   1 
ATOM   7910  C  CB  . TRP C  3  163 ? 89.193 59.590  169.244 1.00 33.24  ? 163  TRP C CB  1 
ATOM   7911  C  CG  . TRP C  3  163 ? 89.558 60.860  168.465 1.00 37.72  ? 163  TRP C CG  1 
ATOM   7912  C  CD1 . TRP C  3  163 ? 90.382 61.861  168.877 1.00 37.53  ? 163  TRP C CD1 1 
ATOM   7913  C  CD2 . TRP C  3  163 ? 89.083 61.248  167.163 1.00 43.05  ? 163  TRP C CD2 1 
ATOM   7914  N  NE1 . TRP C  3  163 ? 90.454 62.845  167.921 1.00 39.96  ? 163  TRP C NE1 1 
ATOM   7915  C  CE2 . TRP C  3  163 ? 89.675 62.489  166.853 1.00 44.29  ? 163  TRP C CE2 1 
ATOM   7916  C  CE3 . TRP C  3  163 ? 88.229 60.660  166.216 1.00 43.50  ? 163  TRP C CE3 1 
ATOM   7917  C  CZ2 . TRP C  3  163 ? 89.438 63.157  165.644 1.00 43.58  ? 163  TRP C CZ2 1 
ATOM   7918  C  CZ3 . TRP C  3  163 ? 87.997 61.324  165.018 1.00 44.89  ? 163  TRP C CZ3 1 
ATOM   7919  C  CH2 . TRP C  3  163 ? 88.598 62.560  164.746 1.00 45.78  ? 163  TRP C CH2 1 
ATOM   7920  N  N   . ILE C  3  164 ? 86.133 60.119  169.902 1.00 33.60  ? 164  ILE C N   1 
ATOM   7921  C  CA  . ILE C  3  164 ? 84.966 60.937  169.674 1.00 34.31  ? 164  ILE C CA  1 
ATOM   7922  C  C   . ILE C  3  164 ? 84.256 61.325  170.957 1.00 35.55  ? 164  ILE C C   1 
ATOM   7923  O  O   . ILE C  3  164 ? 83.571 62.332  170.998 1.00 35.39  ? 164  ILE C O   1 
ATOM   7924  C  CB  . ILE C  3  164 ? 84.012 60.384  168.597 1.00 34.30  ? 164  ILE C CB  1 
ATOM   7925  C  CG1 . ILE C  3  164 ? 82.798 59.716  169.203 1.00 37.40  ? 164  ILE C CG1 1 
ATOM   7926  C  CG2 . ILE C  3  164 ? 84.745 59.531  167.575 1.00 39.86  ? 164  ILE C CG2 1 
ATOM   7927  C  CD1 . ILE C  3  164 ? 81.529 60.005  168.447 1.00 40.08  ? 164  ILE C CD1 1 
ATOM   7928  N  N   . TRP C  3  165 ? 84.467 60.543  172.024 1.00 37.10  ? 165  TRP C N   1 
ATOM   7929  C  CA  . TRP C  3  165 ? 83.882 60.845  173.342 1.00 38.23  ? 165  TRP C CA  1 
ATOM   7930  C  C   . TRP C  3  165 ? 84.567 62.061  174.020 1.00 38.65  ? 165  TRP C C   1 
ATOM   7931  O  O   . TRP C  3  165 ? 83.900 62.932  174.586 1.00 38.63  ? 165  TRP C O   1 
ATOM   7932  C  CB  . TRP C  3  165 ? 84.011 59.649  174.255 1.00 38.77  ? 165  TRP C CB  1 
ATOM   7933  C  CG  . TRP C  3  165 ? 82.895 58.675  174.174 1.00 46.24  ? 165  TRP C CG  1 
ATOM   7934  C  CD1 . TRP C  3  165 ? 81.683 58.847  173.559 1.00 43.47  ? 165  TRP C CD1 1 
ATOM   7935  C  CD2 . TRP C  3  165 ? 82.862 57.381  174.771 1.00 47.39  ? 165  TRP C CD2 1 
ATOM   7936  N  NE1 . TRP C  3  165 ? 80.902 57.730  173.737 1.00 46.44  ? 165  TRP C NE1 1 
ATOM   7937  C  CE2 . TRP C  3  165 ? 81.606 56.808  174.470 1.00 50.25  ? 165  TRP C CE2 1 
ATOM   7938  C  CE3 . TRP C  3  165 ? 83.781 56.626  175.522 1.00 45.41  ? 165  TRP C CE3 1 
ATOM   7939  C  CZ2 . TRP C  3  165 ? 81.239 55.525  174.907 1.00 49.71  ? 165  TRP C CZ2 1 
ATOM   7940  C  CZ3 . TRP C  3  165 ? 83.416 55.343  175.948 1.00 45.71  ? 165  TRP C CZ3 1 
ATOM   7941  C  CH2 . TRP C  3  165 ? 82.160 54.815  175.648 1.00 46.29  ? 165  TRP C CH2 1 
ATOM   7942  N  N   . GLY C  3  166 ? 85.894 62.113  173.941 1.00 39.10  ? 166  GLY C N   1 
ATOM   7943  C  CA  . GLY C  3  166 ? 86.650 63.185  174.568 1.00 39.81  ? 166  GLY C CA  1 
ATOM   7944  C  C   . GLY C  3  166 ? 86.825 62.829  176.025 1.00 40.75  ? 166  GLY C C   1 
ATOM   7945  O  O   . GLY C  3  166 ? 86.873 63.704  176.915 1.00 41.07  ? 166  GLY C O   1 
ATOM   7946  N  N   . GLY C  3  167 ? 86.886 61.517  176.261 1.00 40.98  ? 167  GLY C N   1 
ATOM   7947  C  CA  . GLY C  3  167 ? 87.009 60.942  177.573 1.00 40.86  ? 167  GLY C CA  1 
ATOM   7948  C  C   . GLY C  3  167 ? 86.698 59.454  177.514 1.00 40.84  ? 167  GLY C C   1 
ATOM   7949  O  O   . GLY C  3  167 ? 86.788 58.821  176.454 1.00 40.55  ? 167  GLY C O   1 
ATOM   7950  N  N   . PHE C  3  168 ? 86.331 58.895  178.661 1.00 41.18  ? 168  PHE C N   1 
ATOM   7951  C  CA  . PHE C  3  168 ? 86.007 57.475  178.765 1.00 41.29  ? 168  PHE C CA  1 
ATOM   7952  C  C   . PHE C  3  168 ? 84.507 57.294  178.834 1.00 41.17  ? 168  PHE C C   1 
ATOM   7953  O  O   . PHE C  3  168 ? 84.020 56.184  178.977 1.00 41.09  ? 168  PHE C O   1 
ATOM   7954  C  CB  . PHE C  3  168 ? 86.655 56.873  180.003 1.00 41.36  ? 168  PHE C CB  1 
ATOM   7955  C  CG  . PHE C  3  168 ? 88.160 56.942  180.000 1.00 47.74  ? 168  PHE C CG  1 
ATOM   7956  C  CD1 . PHE C  3  168 ? 88.906 56.182  179.097 1.00 47.47  ? 168  PHE C CD1 1 
ATOM   7957  C  CD2 . PHE C  3  168 ? 88.837 57.756  180.908 1.00 46.15  ? 168  PHE C CD2 1 
ATOM   7958  C  CE1 . PHE C  3  168 ? 90.301 56.235  179.101 1.00 43.27  ? 168  PHE C CE1 1 
ATOM   7959  C  CE2 . PHE C  3  168 ? 90.226 57.809  180.912 1.00 46.25  ? 168  PHE C CE2 1 
ATOM   7960  C  CZ  . PHE C  3  168 ? 90.956 57.044  180.005 1.00 42.88  ? 168  PHE C CZ  1 
ATOM   7961  N  N   . SER C  3  169 ? 83.780 58.406  178.745 1.00 41.28  ? 169  SER C N   1 
ATOM   7962  C  CA  . SER C  3  169 ? 82.330 58.385  178.774 1.00 41.52  ? 169  SER C CA  1 
ATOM   7963  C  C   . SER C  3  169 ? 81.744 59.510  177.992 1.00 42.01  ? 169  SER C C   1 
ATOM   7964  O  O   . SER C  3  169 ? 82.458 60.367  177.471 1.00 42.04  ? 169  SER C O   1 
ATOM   7965  C  CB  . SER C  3  169 ? 81.814 58.479  180.193 1.00 41.25  ? 169  SER C CB  1 
ATOM   7966  O  OG  . SER C  3  169 ? 81.771 57.207  180.783 1.00 48.42  ? 169  SER C OG  1 
ATOM   7967  N  N   . VAL C  3  170 ? 80.424 59.505  177.917 1.00 42.44  ? 170  VAL C N   1 
ATOM   7968  C  CA  . VAL C  3  170 ? 79.680 60.551  177.265 1.00 43.07  ? 170  VAL C CA  1 
ATOM   7969  C  C   . VAL C  3  170 ? 79.542 61.661  178.318 1.00 43.57  ? 170  VAL C C   1 
ATOM   7970  O  O   . VAL C  3  170 ? 78.594 61.668  179.105 1.00 43.89  ? 170  VAL C O   1 
ATOM   7971  C  CB  . VAL C  3  170 ? 78.299 60.031  176.839 1.00 43.28  ? 170  VAL C CB  1 
ATOM   7972  C  CG1 . VAL C  3  170 ? 77.523 61.085  176.091 1.00 49.03  ? 170  VAL C CG1 1 
ATOM   7973  C  CG2 . VAL C  3  170 ? 78.452 58.773  175.982 1.00 49.09  ? 170  VAL C CG2 1 
ATOM   7974  N  N   . ASP C  3  171 ? 80.504 62.594  178.332 1.00 43.48  ? 171  ASP C N   1 
ATOM   7975  C  CA  . ASP C  3  171 ? 80.545 63.625  179.370 1.00 43.25  ? 171  ASP C CA  1 
ATOM   7976  C  C   . ASP C  3  171 ? 80.342 65.081  178.892 1.00 43.06  ? 171  ASP C C   1 
ATOM   7977  O  O   . ASP C  3  171 ? 79.424 65.371  178.113 1.00 43.61  ? 171  ASP C O   1 
ATOM   7978  C  CB  . ASP C  3  171 ? 81.845 63.494  180.169 1.00 43.23  ? 171  ASP C CB  1 
ATOM   7979  C  CG  . ASP C  3  171 ? 81.678 63.877  181.613 1.00 47.36  ? 171  ASP C CG  1 
ATOM   7980  O  OD1 . ASP C  3  171 ? 80.642 64.509  181.950 1.00 41.02  ? 171  ASP C OD1 1 
ATOM   7981  O  OD2 . ASP C  3  171 ? 82.526 63.591  182.485 1.00 53.11  ? 171  ASP C OD2 1 
ATOM   7982  N  N   . LYS C  3  172 ? 81.186 65.987  179.407 1.00 42.11  ? 172  LYS C N   1 
ATOM   7983  C  CA  . LYS C  3  172 ? 81.118 67.409  179.098 1.00 41.22  ? 172  LYS C CA  1 
ATOM   7984  C  C   . LYS C  3  172 ? 81.609 67.639  177.697 1.00 40.28  ? 172  LYS C C   1 
ATOM   7985  O  O   . LYS C  3  172 ? 80.948 68.289  176.896 1.00 39.51  ? 172  LYS C O   1 
ATOM   7986  C  CB  . LYS C  3  172 ? 82.015 68.212  180.068 1.00 41.22  ? 172  LYS C CB  1 
ATOM   7987  C  CG  . LYS C  3  172 ? 81.573 68.197  181.531 1.00 50.05  ? 172  LYS C CG  1 
ATOM   7988  C  CD  . LYS C  3  172 ? 82.692 68.696  182.476 1.00 45.99  ? 172  LYS C CD  1 
ATOM   7989  C  CE  . LYS C  3  172 ? 82.353 68.367  183.924 1.00 51.15  ? 172  LYS C CE  1 
ATOM   7990  N  NZ  . LYS C  3  172 ? 83.412 68.822  184.873 1.00 55.04  ? 172  LYS C NZ  1 
ATOM   7991  N  N   . ALA C  3  173 ? 82.794 67.098  177.432 1.00 40.20  ? 173  ALA C N   1 
ATOM   7992  C  CA  . ALA C  3  173 ? 83.464 67.215  176.171 1.00 40.36  ? 173  ALA C CA  1 
ATOM   7993  C  C   . ALA C  3  173 ? 82.584 66.701  175.028 1.00 41.03  ? 173  ALA C C   1 
ATOM   7994  O  O   . ALA C  3  173 ? 82.486 67.336  173.968 1.00 41.36  ? 173  ALA C O   1 
ATOM   7995  C  CB  . ALA C  3  173 ? 84.774 66.464  176.222 1.00 40.26  ? 173  ALA C CB  1 
ATOM   7996  N  N   . THR C  3  174 ? 81.894 65.594  175.283 1.00 40.71  ? 174  THR C N   1 
ATOM   7997  C  CA  . THR C  3  174 ? 81.010 64.976  174.319 1.00 40.07  ? 174  THR C CA  1 
ATOM   7998  C  C   . THR C  3  174 ? 79.761 65.813  173.936 1.00 39.65  ? 174  THR C C   1 
ATOM   7999  O  O   . THR C  3  174 ? 79.363 65.808  172.789 1.00 40.04  ? 174  THR C O   1 
ATOM   8000  C  CB  . THR C  3  174 ? 80.575 63.598  174.829 1.00 40.30  ? 174  THR C CB  1 
ATOM   8001  O  OG1 . THR C  3  174 ? 81.640 63.004  175.577 1.00 44.58  ? 174  THR C OG1 1 
ATOM   8002  C  CG2 . THR C  3  174 ? 80.385 62.636  173.667 1.00 41.47  ? 174  THR C CG2 1 
ATOM   8003  N  N   . LEU C  3  175 ? 79.136 66.500  174.895 1.00 39.21  ? 175  LEU C N   1 
ATOM   8004  C  CA  . LEU C  3  175 ? 77.924 67.310  174.584 1.00 38.85  ? 175  LEU C CA  1 
ATOM   8005  C  C   . LEU C  3  175 ? 78.250 68.505  173.690 1.00 38.56  ? 175  LEU C C   1 
ATOM   8006  O  O   . LEU C  3  175 ? 77.612 68.695  172.646 1.00 38.40  ? 175  LEU C O   1 
ATOM   8007  C  CB  . LEU C  3  175 ? 77.255 67.826  175.858 1.00 38.75  ? 175  LEU C CB  1 
ATOM   8008  C  CG  . LEU C  3  175 ? 75.710 67.881  175.921 1.00 41.04  ? 175  LEU C CG  1 
ATOM   8009  C  CD1 . LEU C  3  175 ? 75.235 68.865  176.979 1.00 44.23  ? 175  LEU C CD1 1 
ATOM   8010  C  CD2 . LEU C  3  175 ? 75.015 68.135  174.618 1.00 34.40  ? 175  LEU C CD2 1 
ATOM   8011  N  N   . THR C  3  176 ? 79.241 69.309  174.121 1.00 38.20  ? 176  THR C N   1 
ATOM   8012  C  CA  . THR C  3  176 ? 79.670 70.515  173.404 1.00 37.82  ? 176  THR C CA  1 
ATOM   8013  C  C   . THR C  3  176 ? 80.084 70.169  171.998 1.00 37.06  ? 176  THR C C   1 
ATOM   8014  O  O   . THR C  3  176 ? 79.751 70.856  171.045 1.00 36.73  ? 176  THR C O   1 
ATOM   8015  C  CB  . THR C  3  176 ? 80.846 71.214  174.163 1.00 38.13  ? 176  THR C CB  1 
ATOM   8016  O  OG1 . THR C  3  176 ? 80.463 71.464  175.524 1.00 45.96  ? 176  THR C OG1 1 
ATOM   8017  C  CG2 . THR C  3  176 ? 81.069 72.613  173.624 1.00 39.66  ? 176  THR C CG2 1 
ATOM   8018  N  N   . ARG C  3  177 ? 80.810 69.079  171.906 1.00 36.63  ? 177  ARG C N   1 
ATOM   8019  C  CA  . ARG C  3  177 ? 81.268 68.527  170.689 1.00 36.01  ? 177  ARG C CA  1 
ATOM   8020  C  C   . ARG C  3  177 ? 80.072 68.351  169.797 1.00 36.55  ? 177  ARG C C   1 
ATOM   8021  O  O   . ARG C  3  177 ? 79.970 68.990  168.759 1.00 36.84  ? 177  ARG C O   1 
ATOM   8022  C  CB  . ARG C  3  177 ? 81.819 67.185  171.011 1.00 35.51  ? 177  ARG C CB  1 
ATOM   8023  C  CG  . ARG C  3  177 ? 82.662 66.623  170.050 1.00 41.60  ? 177  ARG C CG  1 
ATOM   8024  C  CD  . ARG C  3  177 ? 83.405 65.475  170.581 1.00 34.07  ? 177  ARG C CD  1 
ATOM   8025  N  NE  . ARG C  3  177 ? 84.469 65.904  171.462 1.00 35.44  ? 177  ARG C NE  1 
ATOM   8026  C  CZ  . ARG C  3  177 ? 85.650 65.341  171.488 1.00 36.70  ? 177  ARG C CZ  1 
ATOM   8027  N  NH1 . ARG C  3  177 ? 85.893 64.303  170.697 1.00 38.53  ? 177  ARG C NH1 1 
ATOM   8028  N  NH2 . ARG C  3  177 ? 86.588 65.790  172.301 1.00 22.08  ? 177  ARG C NH2 1 
ATOM   8029  N  N   . PHE C  3  178 ? 79.132 67.518  170.234 1.00 36.69  ? 178  PHE C N   1 
ATOM   8030  C  CA  . PHE C  3  178 ? 77.894 67.256  169.461 1.00 36.95  ? 178  PHE C CA  1 
ATOM   8031  C  C   . PHE C  3  178 ? 77.114 68.515  169.046 1.00 37.26  ? 178  PHE C C   1 
ATOM   8032  O  O   . PHE C  3  178 ? 76.393 68.469  168.087 1.00 37.85  ? 178  PHE C O   1 
ATOM   8033  C  CB  . PHE C  3  178 ? 76.927 66.294  170.209 1.00 36.84  ? 178  PHE C CB  1 
ATOM   8034  C  CG  . PHE C  3  178 ? 77.239 64.826  170.030 1.00 21.71  ? 178  PHE C CG  1 
ATOM   8035  C  CD1 . PHE C  3  178 ? 76.250 63.883  170.223 1.00 26.07  ? 178  PHE C CD1 1 
ATOM   8036  C  CD2 . PHE C  3  178 ? 78.525 64.392  169.688 1.00 23.03  ? 178  PHE C CD2 1 
ATOM   8037  C  CE1 . PHE C  3  178 ? 76.522 62.526  170.075 1.00 28.06  ? 178  PHE C CE1 1 
ATOM   8038  C  CE2 . PHE C  3  178 ? 78.814 63.034  169.541 1.00 21.32  ? 178  PHE C CE2 1 
ATOM   8039  C  CZ  . PHE C  3  178 ? 77.816 62.103  169.733 1.00 27.62  ? 178  PHE C CZ  1 
ATOM   8040  N  N   . PHE C  3  179 ? 77.233 69.614  169.805 1.00 37.02  ? 179  PHE C N   1 
ATOM   8041  C  CA  . PHE C  3  179 ? 76.546 70.872  169.449 1.00 36.32  ? 179  PHE C CA  1 
ATOM   8042  C  C   . PHE C  3  179 ? 77.146 71.420  168.171 1.00 35.95  ? 179  PHE C C   1 
ATOM   8043  O  O   . PHE C  3  179 ? 76.439 71.644  167.178 1.00 36.10  ? 179  PHE C O   1 
ATOM   8044  C  CB  . PHE C  3  179 ? 76.703 71.927  170.558 1.00 35.75  ? 179  PHE C CB  1 
ATOM   8045  C  CG  . PHE C  3  179 ? 75.879 73.166  170.334 1.00 29.95  ? 179  PHE C CG  1 
ATOM   8046  C  CD1 . PHE C  3  179 ? 76.412 74.424  170.555 1.00 37.35  ? 179  PHE C CD1 1 
ATOM   8047  C  CD2 . PHE C  3  179 ? 74.559 73.070  169.888 1.00 37.67  ? 179  PHE C CD2 1 
ATOM   8048  C  CE1 . PHE C  3  179 ? 75.637 75.574  170.341 1.00 39.05  ? 179  PHE C CE1 1 
ATOM   8049  C  CE2 . PHE C  3  179 ? 73.793 74.205  169.670 1.00 34.13  ? 179  PHE C CE2 1 
ATOM   8050  C  CZ  . PHE C  3  179 ? 74.323 75.453  169.899 1.00 34.20  ? 179  PHE C CZ  1 
ATOM   8051  N  N   . ALA C  3  180 ? 78.465 71.607  168.213 1.00 35.13  ? 180  ALA C N   1 
ATOM   8052  C  CA  . ALA C  3  180 ? 79.242 72.137  167.109 1.00 34.54  ? 180  ALA C CA  1 
ATOM   8053  C  C   . ALA C  3  180 ? 78.981 71.395  165.768 1.00 33.55  ? 180  ALA C C   1 
ATOM   8054  O  O   . ALA C  3  180 ? 78.669 72.025  164.755 1.00 32.58  ? 180  ALA C O   1 
ATOM   8055  C  CB  . ALA C  3  180 ? 80.765 72.128  167.474 1.00 34.53  ? 180  ALA C CB  1 
ATOM   8056  N  N   . PHE C  3  181 ? 79.047 70.061  165.808 1.00 33.53  ? 181  PHE C N   1 
ATOM   8057  C  CA  . PHE C  3  181 ? 78.822 69.233  164.621 1.00 33.38  ? 181  PHE C CA  1 
ATOM   8058  C  C   . PHE C  3  181 ? 77.381 69.309  164.136 1.00 33.51  ? 181  PHE C C   1 
ATOM   8059  O  O   . PHE C  3  181 ? 77.125 69.227  162.928 1.00 33.66  ? 181  PHE C O   1 
ATOM   8060  C  CB  . PHE C  3  181 ? 79.204 67.777  164.882 1.00 32.90  ? 181  PHE C CB  1 
ATOM   8061  C  CG  . PHE C  3  181 ? 80.649 67.568  165.141 1.00 28.34  ? 181  PHE C CG  1 
ATOM   8062  C  CD1 . PHE C  3  181 ? 81.614 68.192  164.341 1.00 30.84  ? 181  PHE C CD1 1 
ATOM   8063  C  CD2 . PHE C  3  181 ? 81.065 66.753  166.182 1.00 31.04  ? 181  PHE C CD2 1 
ATOM   8064  C  CE1 . PHE C  3  181 ? 82.973 68.007  164.579 1.00 24.12  ? 181  PHE C CE1 1 
ATOM   8065  C  CE2 . PHE C  3  181 ? 82.422 66.566  166.439 1.00 35.57  ? 181  PHE C CE2 1 
ATOM   8066  C  CZ  . PHE C  3  181 ? 83.381 67.194  165.626 1.00 34.94  ? 181  PHE C CZ  1 
ATOM   8067  N  N   . HIS C  3  182 ? 76.446 69.496  165.078 1.00 33.14  ? 182  HIS C N   1 
ATOM   8068  C  CA  . HIS C  3  182 ? 75.015 69.584  164.761 1.00 32.67  ? 182  HIS C CA  1 
ATOM   8069  C  C   . HIS C  3  182 ? 74.689 70.946  164.188 1.00 33.18  ? 182  HIS C C   1 
ATOM   8070  O  O   . HIS C  3  182 ? 73.609 71.149  163.614 1.00 33.23  ? 182  HIS C O   1 
ATOM   8071  C  CB  . HIS C  3  182 ? 74.196 69.356  166.015 1.00 32.05  ? 182  HIS C CB  1 
ATOM   8072  C  CG  . HIS C  3  182 ? 72.723 69.321  165.788 1.00 25.24  ? 182  HIS C CG  1 
ATOM   8073  N  ND1 . HIS C  3  182 ? 72.084 68.236  165.232 1.00 28.76  ? 182  HIS C ND1 1 
ATOM   8074  C  CD2 . HIS C  3  182 ? 71.756 70.226  166.062 1.00 20.65  ? 182  HIS C CD2 1 
ATOM   8075  C  CE1 . HIS C  3  182 ? 70.785 68.474  165.170 1.00 19.90  ? 182  HIS C CE1 1 
ATOM   8076  N  NE2 . HIS C  3  182 ? 70.558 69.661  165.690 1.00 17.50  ? 182  HIS C NE2 1 
ATOM   8077  N  N   . PHE C  3  183 ? 75.608 71.898  164.367 1.00 33.52  ? 183  PHE C N   1 
ATOM   8078  C  CA  . PHE C  3  183 ? 75.414 73.234  163.843 1.00 34.29  ? 183  PHE C CA  1 
ATOM   8079  C  C   . PHE C  3  183 ? 75.968 73.292  162.383 1.00 34.93  ? 183  PHE C C   1 
ATOM   8080  O  O   . PHE C  3  183 ? 75.297 73.773  161.461 1.00 34.73  ? 183  PHE C O   1 
ATOM   8081  C  CB  . PHE C  3  183 ? 76.118 74.269  164.746 1.00 34.36  ? 183  PHE C CB  1 
ATOM   8082  C  CG  . PHE C  3  183 ? 75.503 75.674  164.690 1.00 38.95  ? 183  PHE C CG  1 
ATOM   8083  C  CD1 . PHE C  3  183 ? 75.294 76.330  163.474 1.00 37.78  ? 183  PHE C CD1 1 
ATOM   8084  C  CD2 . PHE C  3  183 ? 75.157 76.335  165.855 1.00 35.64  ? 183  PHE C CD2 1 
ATOM   8085  C  CE1 . PHE C  3  183 ? 74.737 77.624  163.438 1.00 34.15  ? 183  PHE C CE1 1 
ATOM   8086  C  CE2 . PHE C  3  183 ? 74.595 77.617  165.816 1.00 32.81  ? 183  PHE C CE2 1 
ATOM   8087  C  CZ  . PHE C  3  183 ? 74.385 78.249  164.603 1.00 33.58  ? 183  PHE C CZ  1 
ATOM   8088  N  N   . ILE C  3  184 ? 77.155 72.738  162.180 1.00 35.48  ? 184  ILE C N   1 
ATOM   8089  C  CA  . ILE C  3  184 ? 77.779 72.806  160.894 1.00 36.11  ? 184  ILE C CA  1 
ATOM   8090  C  C   . ILE C  3  184 ? 77.243 71.821  159.869 1.00 37.30  ? 184  ILE C C   1 
ATOM   8091  O  O   . ILE C  3  184 ? 77.183 72.150  158.667 1.00 38.00  ? 184  ILE C O   1 
ATOM   8092  C  CB  . ILE C  3  184 ? 79.303 72.748  161.017 1.00 36.00  ? 184  ILE C CB  1 
ATOM   8093  C  CG1 . ILE C  3  184 ? 79.970 73.127  159.689 1.00 35.96  ? 184  ILE C CG1 1 
ATOM   8094  C  CG2 . ILE C  3  184 ? 79.754 71.396  161.538 1.00 23.49  ? 184  ILE C CG2 1 
ATOM   8095  C  CD1 . ILE C  3  184 ? 81.439 73.480  159.825 1.00 42.73  ? 184  ILE C CD1 1 
ATOM   8096  N  N   . LEU C  3  185 ? 76.805 70.633  160.323 1.00 37.16  ? 185  LEU C N   1 
ATOM   8097  C  CA  . LEU C  3  185 ? 76.303 69.608  159.391 1.00 36.85  ? 185  LEU C CA  1 
ATOM   8098  C  C   . LEU C  3  185 ? 75.195 69.987  158.395 1.00 36.26  ? 185  LEU C C   1 
ATOM   8099  O  O   . LEU C  3  185 ? 75.311 69.659  157.228 1.00 36.25  ? 185  LEU C O   1 
ATOM   8100  C  CB  . LEU C  3  185 ? 76.068 68.242  160.055 1.00 37.13  ? 185  LEU C CB  1 
ATOM   8101  C  CG  . LEU C  3  185 ? 77.277 67.309  159.988 1.00 40.55  ? 185  LEU C CG  1 
ATOM   8102  C  CD1 . LEU C  3  185 ? 77.071 66.094  160.809 1.00 31.51  ? 185  LEU C CD1 1 
ATOM   8103  C  CD2 . LEU C  3  185 ? 77.582 66.937  158.545 1.00 36.73  ? 185  LEU C CD2 1 
ATOM   8104  N  N   . PRO C  3  186 ? 74.139 70.677  158.836 1.00 35.96  ? 186  PRO C N   1 
ATOM   8105  C  CA  . PRO C  3  186 ? 73.077 71.086  157.922 1.00 36.28  ? 186  PRO C CA  1 
ATOM   8106  C  C   . PRO C  3  186 ? 73.518 72.077  156.800 1.00 36.31  ? 186  PRO C C   1 
ATOM   8107  O  O   . PRO C  3  186 ? 72.868 72.133  155.736 1.00 36.64  ? 186  PRO C O   1 
ATOM   8108  C  CB  . PRO C  3  186 ? 72.048 71.716  158.859 1.00 36.09  ? 186  PRO C CB  1 
ATOM   8109  C  CG  . PRO C  3  186 ? 72.303 71.078  160.105 1.00 30.53  ? 186  PRO C CG  1 
ATOM   8110  C  CD  . PRO C  3  186 ? 73.790 71.019  160.220 1.00 35.81  ? 186  PRO C CD  1 
ATOM   8111  N  N   . PHE C  3  187 ? 74.595 72.808  157.014 1.00 35.70  ? 187  PHE C N   1 
ATOM   8112  C  CA  . PHE C  3  187 ? 75.074 73.700  155.985 1.00 35.63  ? 187  PHE C CA  1 
ATOM   8113  C  C   . PHE C  3  187 ? 75.766 72.888  154.927 1.00 35.92  ? 187  PHE C C   1 
ATOM   8114  O  O   . PHE C  3  187 ? 75.503 73.047  153.726 1.00 35.73  ? 187  PHE C O   1 
ATOM   8115  C  CB  . PHE C  3  187 ? 75.956 74.792  156.576 1.00 35.53  ? 187  PHE C CB  1 
ATOM   8116  C  CG  . PHE C  3  187 ? 75.245 75.626  157.586 1.00 33.66  ? 187  PHE C CG  1 
ATOM   8117  C  CD1 . PHE C  3  187 ? 75.741 75.772  158.858 1.00 39.46  ? 187  PHE C CD1 1 
ATOM   8118  C  CD2 . PHE C  3  187 ? 74.018 76.196  157.281 1.00 31.11  ? 187  PHE C CD2 1 
ATOM   8119  C  CE1 . PHE C  3  187 ? 75.054 76.506  159.785 1.00 43.68  ? 187  PHE C CE1 1 
ATOM   8120  C  CE2 . PHE C  3  187 ? 73.319 76.915  158.214 1.00 33.41  ? 187  PHE C CE2 1 
ATOM   8121  C  CZ  . PHE C  3  187 ? 73.825 77.067  159.457 1.00 40.25  ? 187  PHE C CZ  1 
ATOM   8122  N  N   . ILE C  3  188 ? 76.589 71.954  155.371 1.00 36.43  ? 188  ILE C N   1 
ATOM   8123  C  CA  . ILE C  3  188 ? 77.259 71.060  154.457 1.00 37.03  ? 188  ILE C CA  1 
ATOM   8124  C  C   . ILE C  3  188 ? 76.183 70.281  153.659 1.00 37.34  ? 188  ILE C C   1 
ATOM   8125  O  O   . ILE C  3  188 ? 76.217 70.273  152.418 1.00 37.47  ? 188  ILE C O   1 
ATOM   8126  C  CB  . ILE C  3  188 ? 78.226 70.143  155.222 1.00 37.20  ? 188  ILE C CB  1 
ATOM   8127  C  CG1 . ILE C  3  188 ? 79.506 70.943  155.594 1.00 36.22  ? 188  ILE C CG1 1 
ATOM   8128  C  CG2 . ILE C  3  188 ? 78.569 68.921  154.394 1.00 29.15  ? 188  ILE C CG2 1 
ATOM   8129  C  CD1 . ILE C  3  188 ? 80.222 70.451  156.831 1.00 32.54  ? 188  ILE C CD1 1 
ATOM   8130  N  N   . ILE C  3  189 ? 75.181 69.722  154.372 1.00 36.96  ? 189  ILE C N   1 
ATOM   8131  C  CA  . ILE C  3  189 ? 74.028 69.044  153.730 1.00 36.19  ? 189  ILE C CA  1 
ATOM   8132  C  C   . ILE C  3  189 ? 73.507 69.892  152.584 1.00 36.20  ? 189  ILE C C   1 
ATOM   8133  O  O   . ILE C  3  189 ? 73.298 69.398  151.493 1.00 36.31  ? 189  ILE C O   1 
ATOM   8134  C  CB  . ILE C  3  189 ? 72.866 68.847  154.758 1.00 35.73  ? 189  ILE C CB  1 
ATOM   8135  C  CG1 . ILE C  3  189 ? 73.148 67.696  155.655 1.00 25.89  ? 189  ILE C CG1 1 
ATOM   8136  C  CG2 . ILE C  3  189 ? 71.532 68.557  154.064 1.00 23.66  ? 189  ILE C CG2 1 
ATOM   8137  C  CD1 . ILE C  3  189 ? 72.138 67.556  156.750 1.00 33.90  ? 189  ILE C CD1 1 
ATOM   8138  N  N   . MET C  3  190 ? 73.342 71.184  152.828 1.00 36.50  ? 190  MET C N   1 
ATOM   8139  C  CA  . MET C  3  190 ? 72.810 72.062  151.807 1.00 36.75  ? 190  MET C CA  1 
ATOM   8140  C  C   . MET C  3  190 ? 73.702 72.142  150.590 1.00 36.09  ? 190  MET C C   1 
ATOM   8141  O  O   . MET C  3  190 ? 73.227 71.972  149.481 1.00 36.26  ? 190  MET C O   1 
ATOM   8142  C  CB  . MET C  3  190 ? 72.478 73.434  152.353 1.00 37.07  ? 190  MET C CB  1 
ATOM   8143  C  CG  . MET C  3  190 ? 71.327 74.077  151.618 1.00 44.12  ? 190  MET C CG  1 
ATOM   8144  S  SD  . MET C  3  190 ? 70.695 75.501  152.487 1.00 56.01  ? 190  MET C SD  1 
ATOM   8145  C  CE  . MET C  3  190 ? 72.157 76.412  152.766 1.00 26.52  ? 190  MET C CE  1 
ATOM   8146  N  N   . ALA C  3  191 ? 75.004 72.320  150.795 1.00 35.39  ? 191  ALA C N   1 
ATOM   8147  C  CA  . ALA C  3  191 ? 75.944 72.344  149.660 1.00 34.98  ? 191  ALA C CA  1 
ATOM   8148  C  C   . ALA C  3  191 ? 75.824 71.028  148.855 1.00 35.39  ? 191  ALA C C   1 
ATOM   8149  O  O   . ALA C  3  191 ? 75.872 71.039  147.637 1.00 36.40  ? 191  ALA C O   1 
ATOM   8150  C  CB  . ALA C  3  191 ? 77.416 72.581  150.133 1.00 33.94  ? 191  ALA C CB  1 
ATOM   8151  N  N   . ILE C  3  192 ? 75.596 69.927  149.546 1.00 34.85  ? 192  ILE C N   1 
ATOM   8152  C  CA  . ILE C  3  192 ? 75.468 68.643  148.901 1.00 34.56  ? 192  ILE C CA  1 
ATOM   8153  C  C   . ILE C  3  192 ? 74.137 68.528  148.221 1.00 34.74  ? 192  ILE C C   1 
ATOM   8154  O  O   . ILE C  3  192 ? 74.043 67.944  147.154 1.00 35.46  ? 192  ILE C O   1 
ATOM   8155  C  CB  . ILE C  3  192 ? 75.672 67.511  149.906 1.00 34.51  ? 192  ILE C CB  1 
ATOM   8156  C  CG1 . ILE C  3  192 ? 77.052 67.607  150.546 1.00 37.62  ? 192  ILE C CG1 1 
ATOM   8157  C  CG2 . ILE C  3  192 ? 75.589 66.188  149.238 1.00 40.17  ? 192  ILE C CG2 1 
ATOM   8158  C  CD1 . ILE C  3  192 ? 77.246 66.623  151.747 1.00 39.65  ? 192  ILE C CD1 1 
ATOM   8159  N  N   . ALA C  3  193 ? 73.105 69.129  148.796 1.00 34.71  ? 193  ALA C N   1 
ATOM   8160  C  CA  . ALA C  3  193 ? 71.768 69.111  148.163 1.00 35.19  ? 193  ALA C CA  1 
ATOM   8161  C  C   . ALA C  3  193 ? 71.803 69.880  146.823 1.00 36.16  ? 193  ALA C C   1 
ATOM   8162  O  O   . ALA C  3  193 ? 71.037 69.609  145.916 1.00 36.82  ? 193  ALA C O   1 
ATOM   8163  C  CB  . ALA C  3  193 ? 70.737 69.708  149.081 1.00 34.93  ? 193  ALA C CB  1 
ATOM   8164  N  N   . MET C  3  194 ? 72.714 70.835  146.723 1.00 36.39  ? 194  MET C N   1 
ATOM   8165  C  CA  . MET C  3  194 ? 72.889 71.610  145.501 1.00 36.16  ? 194  MET C CA  1 
ATOM   8166  C  C   . MET C  3  194 ? 73.606 70.790  144.433 1.00 35.73  ? 194  MET C C   1 
ATOM   8167  O  O   . MET C  3  194 ? 73.275 70.872  143.277 1.00 35.54  ? 194  MET C O   1 
ATOM   8168  C  CB  . MET C  3  194 ? 73.624 72.924  145.806 1.00 36.05  ? 194  MET C CB  1 
ATOM   8169  C  CG  . MET C  3  194 ? 72.729 73.947  146.479 1.00 34.19  ? 194  MET C CG  1 
ATOM   8170  S  SD  . MET C  3  194 ? 73.632 75.263  147.273 1.00 61.31  ? 194  MET C SD  1 
ATOM   8171  C  CE  . MET C  3  194 ? 72.206 76.232  148.147 1.00 59.73  ? 194  MET C CE  1 
ATOM   8172  N  N   . VAL C  3  195 ? 74.565 69.973  144.857 1.00 35.92  ? 195  VAL C N   1 
ATOM   8173  C  CA  . VAL C  3  195 ? 75.305 69.079  143.963 1.00 36.57  ? 195  VAL C CA  1 
ATOM   8174  C  C   . VAL C  3  195 ? 74.352 67.947  143.496 1.00 37.97  ? 195  VAL C C   1 
ATOM   8175  O  O   . VAL C  3  195 ? 74.419 67.463  142.327 1.00 39.14  ? 195  VAL C O   1 
ATOM   8176  C  CB  . VAL C  3  195 ? 76.558 68.489  144.695 1.00 36.48  ? 195  VAL C CB  1 
ATOM   8177  C  CG1 . VAL C  3  195 ? 77.215 67.372  143.873 1.00 29.19  ? 195  VAL C CG1 1 
ATOM   8178  C  CG2 . VAL C  3  195 ? 77.617 69.654  145.036 1.00 24.25  ? 195  VAL C CG2 1 
ATOM   8179  N  N   . HIS C  3  196 ? 73.448 67.567  144.396 1.00 37.38  ? 196  HIS C N   1 
ATOM   8180  C  CA  . HIS C  3  196 ? 72.423 66.565  144.144 1.00 36.97  ? 196  HIS C CA  1 
ATOM   8181  C  C   . HIS C  3  196 ? 71.562 67.078  142.989 1.00 36.92  ? 196  HIS C C   1 
ATOM   8182  O  O   . HIS C  3  196 ? 71.361 66.396  141.973 1.00 36.99  ? 196  HIS C O   1 
ATOM   8183  C  CB  . HIS C  3  196 ? 71.568 66.450  145.432 1.00 36.56  ? 196  HIS C CB  1 
ATOM   8184  C  CG  . HIS C  3  196 ? 70.564 65.352  145.423 1.00 29.28  ? 196  HIS C CG  1 
ATOM   8185  N  ND1 . HIS C  3  196 ? 70.904 64.029  145.231 1.00 33.06  ? 196  HIS C ND1 1 
ATOM   8186  C  CD2 . HIS C  3  196 ? 69.236 65.361  145.710 1.00 30.93  ? 196  HIS C CD2 1 
ATOM   8187  C  CE1 . HIS C  3  196 ? 69.814 63.281  145.329 1.00 17.07  ? 196  HIS C CE1 1 
ATOM   8188  N  NE2 . HIS C  3  196 ? 68.794 64.067  145.630 1.00 19.96  ? 196  HIS C NE2 1 
ATOM   8189  N  N   . LEU C  3  197 ? 71.115 68.316  143.134 1.00 36.66  ? 197  LEU C N   1 
ATOM   8190  C  CA  . LEU C  3  197 ? 70.282 68.973  142.146 1.00 36.58  ? 197  LEU C CA  1 
ATOM   8191  C  C   . LEU C  3  197 ? 71.086 69.279  140.847 1.00 35.78  ? 197  LEU C C   1 
ATOM   8192  O  O   . LEU C  3  197 ? 70.512 69.354  139.734 1.00 35.18  ? 197  LEU C O   1 
ATOM   8193  C  CB  . LEU C  3  197 ? 69.754 70.259  142.744 1.00 37.01  ? 197  LEU C CB  1 
ATOM   8194  C  CG  . LEU C  3  197 ? 68.287 70.552  142.608 1.00 41.28  ? 197  LEU C CG  1 
ATOM   8195  C  CD1 . LEU C  3  197 ? 67.530 69.338  143.013 1.00 44.44  ? 197  LEU C CD1 1 
ATOM   8196  C  CD2 . LEU C  3  197 ? 67.959 71.728  143.531 1.00 39.26  ? 197  LEU C CD2 1 
ATOM   8197  N  N   . LEU C  3  198 ? 72.399 69.468  141.001 1.00 35.51  ? 198  LEU C N   1 
ATOM   8198  C  CA  . LEU C  3  198 ? 73.269 69.712  139.852 1.00 35.13  ? 198  LEU C CA  1 
ATOM   8199  C  C   . LEU C  3  198 ? 73.275 68.470  138.965 1.00 34.84  ? 198  LEU C C   1 
ATOM   8200  O  O   . LEU C  3  198 ? 72.983 68.571  137.790 1.00 35.35  ? 198  LEU C O   1 
ATOM   8201  C  CB  . LEU C  3  198 ? 74.683 70.076  140.275 1.00 34.78  ? 198  LEU C CB  1 
ATOM   8202  C  CG  . LEU C  3  198 ? 75.643 70.436  139.132 1.00 41.45  ? 198  LEU C CG  1 
ATOM   8203  C  CD1 . LEU C  3  198 ? 75.071 71.591  138.306 1.00 47.35  ? 198  LEU C CD1 1 
ATOM   8204  C  CD2 . LEU C  3  198 ? 77.052 70.804  139.657 1.00 32.06  ? 198  LEU C CD2 1 
ATOM   8205  N  N   . PHE C  3  199 ? 73.548 67.295  139.546 1.00 33.80  ? 199  PHE C N   1 
ATOM   8206  C  CA  . PHE C  3  199 ? 73.538 66.053  138.767 1.00 33.08  ? 199  PHE C CA  1 
ATOM   8207  C  C   . PHE C  3  199 ? 72.173 65.706  138.202 1.00 32.51  ? 199  PHE C C   1 
ATOM   8208  O  O   . PHE C  3  199 ? 72.083 65.213  137.082 1.00 32.49  ? 199  PHE C O   1 
ATOM   8209  C  CB  . PHE C  3  199 ? 74.082 64.902  139.554 1.00 33.00  ? 199  PHE C CB  1 
ATOM   8210  C  CG  . PHE C  3  199 ? 75.530 64.910  139.651 1.00 37.51  ? 199  PHE C CG  1 
ATOM   8211  C  CD1 . PHE C  3  199 ? 76.300 64.860  138.503 1.00 31.01  ? 199  PHE C CD1 1 
ATOM   8212  C  CD2 . PHE C  3  199 ? 76.156 65.014  140.886 1.00 35.56  ? 199  PHE C CD2 1 
ATOM   8213  C  CE1 . PHE C  3  199 ? 77.668 64.868  138.576 1.00 34.66  ? 199  PHE C CE1 1 
ATOM   8214  C  CE2 . PHE C  3  199 ? 77.521 65.031  140.977 1.00 37.71  ? 199  PHE C CE2 1 
ATOM   8215  C  CZ  . PHE C  3  199 ? 78.293 64.965  139.816 1.00 38.56  ? 199  PHE C CZ  1 
ATOM   8216  N  N   . LEU C  3  200 ? 71.119 66.000  138.965 1.00 31.87  ? 200  LEU C N   1 
ATOM   8217  C  CA  . LEU C  3  200 ? 69.764 65.758  138.541 1.00 31.68  ? 200  LEU C CA  1 
ATOM   8218  C  C   . LEU C  3  200 ? 69.448 66.524  137.265 1.00 31.74  ? 200  LEU C C   1 
ATOM   8219  O  O   . LEU C  3  200 ? 68.719 66.033  136.355 1.00 31.70  ? 200  LEU C O   1 
ATOM   8220  C  CB  . LEU C  3  200 ? 68.782 66.196  139.618 1.00 32.03  ? 200  LEU C CB  1 
ATOM   8221  C  CG  . LEU C  3  200 ? 67.370 65.786  139.183 1.00 39.86  ? 200  LEU C CG  1 
ATOM   8222  C  CD1 . LEU C  3  200 ? 67.254 64.275  139.180 1.00 41.17  ? 200  LEU C CD1 1 
ATOM   8223  C  CD2 . LEU C  3  200 ? 66.222 66.458  139.934 1.00 23.14  ? 200  LEU C CD2 1 
ATOM   8224  N  N   . HIS C  3  201 ? 70.023 67.700  137.154 1.00 32.00  ? 201  HIS C N   1 
ATOM   8225  C  CA  . HIS C  3  201 ? 69.762 68.514  135.993 1.00 32.18  ? 201  HIS C CA  1 
ATOM   8226  C  C   . HIS C  3  201 ? 70.321 68.061  134.696 1.00 31.69  ? 201  HIS C C   1 
ATOM   8227  O  O   . HIS C  3  201 ? 69.798 68.411  133.673 1.00 31.75  ? 201  HIS C O   1 
ATOM   8228  C  CB  . HIS C  3  201 ? 69.940 69.984  136.266 1.00 32.51  ? 201  HIS C CB  1 
ATOM   8229  C  CG  . HIS C  3  201 ? 68.895 70.534  137.185 1.00 44.03  ? 201  HIS C CG  1 
ATOM   8230  N  ND1 . HIS C  3  201 ? 69.020 71.751  137.817 1.00 41.93  ? 201  HIS C ND1 1 
ATOM   8231  C  CD2 . HIS C  3  201 ? 67.704 70.013  137.593 1.00 40.56  ? 201  HIS C CD2 1 
ATOM   8232  C  CE1 . HIS C  3  201 ? 67.950 71.962  138.567 1.00 42.97  ? 201  HIS C CE1 1 
ATOM   8233  N  NE2 . HIS C  3  201 ? 67.136 70.925  138.443 1.00 39.49  ? 201  HIS C NE2 1 
ATOM   8234  N  N   . GLU C  3  202 ? 71.354 67.229  134.726 1.00 31.50  ? 202  GLU C N   1 
ATOM   8235  C  CA  . GLU C  3  202 ? 71.889 66.680  133.478 1.00 31.95  ? 202  GLU C CA  1 
ATOM   8236  C  C   . GLU C  3  202 ? 70.818 65.862  132.694 1.00 32.47  ? 202  GLU C C   1 
ATOM   8237  O  O   . GLU C  3  202 ? 70.881 65.793  131.463 1.00 33.26  ? 202  GLU C O   1 
ATOM   8238  C  CB  . GLU C  3  202 ? 73.079 65.786  133.731 1.00 31.54  ? 202  GLU C CB  1 
ATOM   8239  C  CG  . GLU C  3  202 ? 74.247 66.476  134.322 1.00 44.50  ? 202  GLU C CG  1 
ATOM   8240  C  CD  . GLU C  3  202 ? 74.912 67.366  133.337 1.00 49.78  ? 202  GLU C CD  1 
ATOM   8241  O  OE1 . GLU C  3  202 ? 74.655 68.590  133.383 1.00 44.60  ? 202  GLU C OE1 1 
ATOM   8242  O  OE2 . GLU C  3  202 ? 75.685 66.837  132.501 1.00 57.09  ? 202  GLU C OE2 1 
ATOM   8243  N  N   . THR C  3  203 ? 69.839 65.275  133.399 1.00 31.32  ? 203  THR C N   1 
ATOM   8244  C  CA  . THR C  3  203 ? 68.839 64.466  132.731 1.00 31.41  ? 203  THR C CA  1 
ATOM   8245  C  C   . THR C  3  203 ? 67.429 64.978  132.879 1.00 31.52  ? 203  THR C C   1 
ATOM   8246  O  O   . THR C  3  203 ? 66.584 64.735  132.052 1.00 31.24  ? 203  THR C O   1 
ATOM   8247  C  CB  . THR C  3  203 ? 68.852 63.029  133.301 1.00 31.62  ? 203  THR C CB  1 
ATOM   8248  O  OG1 . THR C  3  203 ? 68.448 63.067  134.682 1.00 34.22  ? 203  THR C OG1 1 
ATOM   8249  C  CG2 . THR C  3  203 ? 70.286 62.447  133.326 1.00 22.45  ? 203  THR C CG2 1 
ATOM   8250  N  N   . GLY C  3  204 ? 67.162 65.656  133.961 1.00 32.03  ? 204  GLY C N   1 
ATOM   8251  C  CA  . GLY C  3  204 ? 65.808 66.054  134.229 1.00 31.40  ? 204  GLY C CA  1 
ATOM   8252  C  C   . GLY C  3  204 ? 65.214 64.912  135.018 1.00 30.74  ? 204  GLY C C   1 
ATOM   8253  O  O   . GLY C  3  204 ? 65.888 63.930  135.286 1.00 30.40  ? 204  GLY C O   1 
ATOM   8254  N  N   . SER C  3  205 ? 63.950 65.029  135.374 1.00 30.97  ? 205  SER C N   1 
ATOM   8255  C  CA  . SER C  3  205 ? 63.287 64.034  136.202 1.00 31.27  ? 205  SER C CA  1 
ATOM   8256  C  C   . SER C  3  205 ? 62.837 62.766  135.487 1.00 32.05  ? 205  SER C C   1 
ATOM   8257  O  O   . SER C  3  205 ? 62.625 62.752  134.280 1.00 32.40  ? 205  SER C O   1 
ATOM   8258  C  CB  . SER C  3  205 ? 62.079 64.668  136.914 1.00 31.17  ? 205  SER C CB  1 
ATOM   8259  O  OG  . SER C  3  205 ? 62.472 65.385  138.081 1.00 38.68  ? 205  SER C OG  1 
ATOM   8260  N  N   . ASN C  3  206 ? 62.679 61.700  136.257 1.00 32.47  ? 206  ASN C N   1 
ATOM   8261  C  CA  . ASN C  3  206 ? 62.149 60.436  135.746 1.00 33.06  ? 206  ASN C CA  1 
ATOM   8262  C  C   . ASN C  3  206 ? 60.665 60.618  135.934 1.00 33.63  ? 206  ASN C C   1 
ATOM   8263  O  O   . ASN C  3  206 ? 60.240 61.683  136.360 1.00 34.13  ? 206  ASN C O   1 
ATOM   8264  C  CB  . ASN C  3  206 ? 62.689 59.288  136.621 1.00 33.21  ? 206  ASN C CB  1 
ATOM   8265  C  CG  . ASN C  3  206 ? 62.201 57.897  136.197 1.00 37.67  ? 206  ASN C CG  1 
ATOM   8266  O  OD1 . ASN C  3  206 ? 62.261 56.975  136.988 1.00 43.67  ? 206  ASN C OD1 1 
ATOM   8267  N  ND2 . ASN C  3  206 ? 61.764 57.745  134.960 1.00 37.26  ? 206  ASN C ND2 1 
ATOM   8268  N  N   . ASN C  3  207 ? 59.865 59.623  135.582 1.00 33.89  ? 207  ASN C N   1 
ATOM   8269  C  CA  . ASN C  3  207 ? 58.426 59.701  135.769 1.00 34.29  ? 207  ASN C CA  1 
ATOM   8270  C  C   . ASN C  3  207 ? 57.900 58.323  136.047 1.00 35.05  ? 207  ASN C C   1 
ATOM   8271  O  O   . ASN C  3  207 ? 58.640 57.345  135.899 1.00 35.54  ? 207  ASN C O   1 
ATOM   8272  C  CB  . ASN C  3  207 ? 57.737 60.305  134.566 1.00 33.78  ? 207  ASN C CB  1 
ATOM   8273  C  CG  . ASN C  3  207 ? 57.737 59.407  133.411 1.00 37.55  ? 207  ASN C CG  1 
ATOM   8274  O  OD1 . ASN C  3  207 ? 56.805 58.576  133.241 1.00 30.66  ? 207  ASN C OD1 1 
ATOM   8275  N  ND2 . ASN C  3  207 ? 58.789 59.536  132.544 1.00 25.91  ? 207  ASN C ND2 1 
ATOM   8276  N  N   . PRO C  3  208 ? 56.645 58.238  136.521 1.00 34.82  ? 208  PRO C N   1 
ATOM   8277  C  CA  . PRO C  3  208 ? 56.023 56.964  136.833 1.00 34.19  ? 208  PRO C CA  1 
ATOM   8278  C  C   . PRO C  3  208 ? 56.178 55.819  135.851 1.00 33.88  ? 208  PRO C C   1 
ATOM   8279  O  O   . PRO C  3  208 ? 56.340 54.671  136.313 1.00 34.77  ? 208  PRO C O   1 
ATOM   8280  C  CB  . PRO C  3  208 ? 54.565 57.338  137.003 1.00 34.12  ? 208  PRO C CB  1 
ATOM   8281  C  CG  . PRO C  3  208 ? 54.648 58.693  137.650 1.00 31.69  ? 208  PRO C CG  1 
ATOM   8282  C  CD  . PRO C  3  208 ? 55.764 59.374  136.916 1.00 34.74  ? 208  PRO C CD  1 
ATOM   8283  N  N   . THR C  3  209 ? 56.140 56.082  134.555 1.00 32.49  ? 209  THR C N   1 
ATOM   8284  C  CA  . THR C  3  209 ? 56.221 54.990  133.563 1.00 31.65  ? 209  THR C CA  1 
ATOM   8285  C  C   . THR C  3  209 ? 57.619 54.464  133.379 1.00 31.12  ? 209  THR C C   1 
ATOM   8286  O  O   . THR C  3  209 ? 57.806 53.377  132.854 1.00 30.92  ? 209  THR C O   1 
ATOM   8287  C  CB  . THR C  3  209 ? 55.709 55.454  132.193 1.00 31.62  ? 209  THR C CB  1 
ATOM   8288  O  OG1 . THR C  3  209 ? 56.587 56.478  131.677 1.00 32.77  ? 209  THR C OG1 1 
ATOM   8289  C  CG2 . THR C  3  209 ? 54.329 56.132  132.320 1.00 18.12  ? 209  THR C CG2 1 
ATOM   8290  N  N   . GLY C  3  210 ? 58.606 55.256  133.780 1.00 30.64  ? 210  GLY C N   1 
ATOM   8291  C  CA  . GLY C  3  210 ? 60.009 54.904  133.589 1.00 30.14  ? 210  GLY C CA  1 
ATOM   8292  C  C   . GLY C  3  210 ? 60.450 55.048  132.139 1.00 29.50  ? 210  GLY C C   1 
ATOM   8293  O  O   . GLY C  3  210 ? 61.581 54.700  131.782 1.00 29.44  ? 210  GLY C O   1 
ATOM   8294  N  N   . ILE C  3  211 ? 59.539 55.526  131.298 1.00 29.11  ? 211  ILE C N   1 
ATOM   8295  C  CA  . ILE C  3  211 ? 59.809 55.714  129.877 1.00 28.93  ? 211  ILE C CA  1 
ATOM   8296  C  C   . ILE C  3  211 ? 60.227 57.136  129.686 1.00 29.71  ? 211  ILE C C   1 
ATOM   8297  O  O   . ILE C  3  211 ? 59.736 58.011  130.359 1.00 30.36  ? 211  ILE C O   1 
ATOM   8298  C  CB  . ILE C  3  211 ? 58.509 55.460  129.067 1.00 28.40  ? 211  ILE C CB  1 
ATOM   8299  C  CG1 . ILE C  3  211 ? 58.117 53.994  129.145 1.00 25.17  ? 211  ILE C CG1 1 
ATOM   8300  C  CG2 . ILE C  3  211 ? 58.697 55.804  127.611 1.00 8.22   ? 211  ILE C CG2 1 
ATOM   8301  C  CD1 . ILE C  3  211 ? 56.773 53.726  128.593 1.00 21.18  ? 211  ILE C CD1 1 
ATOM   8302  N  N   . SER C  3  212 ? 61.131 57.389  128.774 1.00 30.11  ? 212  SER C N   1 
ATOM   8303  C  CA  . SER C  3  212 ? 61.550 58.779  128.543 1.00 30.51  ? 212  SER C CA  1 
ATOM   8304  C  C   . SER C  3  212 ? 60.380 59.740  128.214 1.00 30.52  ? 212  SER C C   1 
ATOM   8305  O  O   . SER C  3  212 ? 59.454 59.386  127.496 1.00 29.98  ? 212  SER C O   1 
ATOM   8306  C  CB  . SER C  3  212 ? 62.656 58.873  127.496 1.00 29.95  ? 212  SER C CB  1 
ATOM   8307  O  OG  . SER C  3  212 ? 62.700 60.175  126.984 1.00 39.68  ? 212  SER C OG  1 
ATOM   8308  N  N   . SER C  3  213 ? 60.464 60.957  128.751 1.00 31.35  ? 213  SER C N   1 
ATOM   8309  C  CA  . SER C  3  213 ? 59.412 61.980  128.589 1.00 31.93  ? 213  SER C CA  1 
ATOM   8310  C  C   . SER C  3  213 ? 59.791 63.236  127.746 1.00 32.65  ? 213  SER C C   1 
ATOM   8311  O  O   . SER C  3  213 ? 59.056 64.239  127.771 1.00 33.17  ? 213  SER C O   1 
ATOM   8312  C  CB  . SER C  3  213 ? 58.894 62.422  129.964 1.00 31.67  ? 213  SER C CB  1 
ATOM   8313  O  OG  . SER C  3  213 ? 59.975 62.775  130.847 1.00 20.69  ? 213  SER C OG  1 
ATOM   8314  N  N   . ASP C  3  214 ? 60.903 63.173  126.993 1.00 32.43  ? 214  ASP C N   1 
ATOM   8315  C  CA  . ASP C  3  214 ? 61.349 64.313  126.139 1.00 32.30  ? 214  ASP C CA  1 
ATOM   8316  C  C   . ASP C  3  214 ? 60.260 64.723  125.179 1.00 31.62  ? 214  ASP C C   1 
ATOM   8317  O  O   . ASP C  3  214 ? 60.179 65.850  124.746 1.00 31.91  ? 214  ASP C O   1 
ATOM   8318  C  CB  . ASP C  3  214 ? 62.535 63.895  125.300 1.00 32.83  ? 214  ASP C CB  1 
ATOM   8319  C  CG  . ASP C  3  214 ? 63.831 63.844  126.081 1.00 41.15  ? 214  ASP C CG  1 
ATOM   8320  O  OD1 . ASP C  3  214 ? 64.865 63.467  125.468 1.00 42.87  ? 214  ASP C OD1 1 
ATOM   8321  O  OD2 . ASP C  3  214 ? 63.913 64.112  127.297 1.00 27.83  ? 214  ASP C OD2 1 
ATOM   8322  N  N   . VAL C  3  215 ? 59.409 63.774  124.890 1.00 30.80  ? 215  VAL C N   1 
ATOM   8323  C  CA  . VAL C  3  215 ? 58.315 63.902  123.961 1.00 29.39  ? 215  VAL C CA  1 
ATOM   8324  C  C   . VAL C  3  215 ? 57.145 64.712  124.520 1.00 27.98  ? 215  VAL C C   1 
ATOM   8325  O  O   . VAL C  3  215 ? 56.330 65.238  123.769 1.00 27.78  ? 215  VAL C O   1 
ATOM   8326  C  CB  . VAL C  3  215 ? 57.919 62.461  123.523 1.00 29.98  ? 215  VAL C CB  1 
ATOM   8327  C  CG1 . VAL C  3  215 ? 56.425 62.226  123.458 1.00 34.57  ? 215  VAL C CG1 1 
ATOM   8328  C  CG2 . VAL C  3  215 ? 58.731 62.021  122.225 1.00 11.40  ? 215  VAL C CG2 1 
ATOM   8329  N  N   . ASP C  3  216 ? 57.155 64.942  125.822 1.00 27.44  ? 216  ASP C N   1 
ATOM   8330  C  CA  . ASP C  3  216 ? 56.077 65.662  126.463 1.00 27.94  ? 216  ASP C CA  1 
ATOM   8331  C  C   . ASP C  3  216 ? 56.536 66.344  127.753 1.00 28.05  ? 216  ASP C C   1 
ATOM   8332  O  O   . ASP C  3  216 ? 56.139 65.977  128.834 1.00 28.30  ? 216  ASP C O   1 
ATOM   8333  C  CB  . ASP C  3  216 ? 54.952 64.670  126.782 1.00 29.01  ? 216  ASP C CB  1 
ATOM   8334  C  CG  . ASP C  3  216 ? 53.720 65.331  127.327 1.00 36.78  ? 216  ASP C CG  1 
ATOM   8335  O  OD1 . ASP C  3  216 ? 53.572 66.578  127.158 1.00 34.67  ? 216  ASP C OD1 1 
ATOM   8336  O  OD2 . ASP C  3  216 ? 52.841 64.676  127.931 1.00 29.63  ? 216  ASP C OD2 1 
ATOM   8337  N  N   . LYS C  3  217 ? 57.373 67.336  127.628 1.00 28.07  ? 217  LYS C N   1 
ATOM   8338  C  CA  . LYS C  3  217 ? 57.823 68.064  128.773 1.00 27.07  ? 217  LYS C CA  1 
ATOM   8339  C  C   . LYS C  3  217 ? 56.987 69.337  128.897 1.00 26.83  ? 217  LYS C C   1 
ATOM   8340  O  O   . LYS C  3  217 ? 56.443 69.866  127.895 1.00 25.92  ? 217  LYS C O   1 
ATOM   8341  C  CB  . LYS C  3  217 ? 59.296 68.467  128.609 1.00 26.77  ? 217  LYS C CB  1 
ATOM   8342  C  CG  . LYS C  3  217 ? 60.269 67.323  128.523 1.00 34.59  ? 217  LYS C CG  1 
ATOM   8343  C  CD  . LYS C  3  217 ? 60.551 66.661  129.876 1.00 31.61  ? 217  LYS C CD  1 
ATOM   8344  C  CE  . LYS C  3  217 ? 61.545 65.526  129.700 1.00 35.23  ? 217  LYS C CE  1 
ATOM   8345  N  NZ  . LYS C  3  217 ? 62.200 65.134  130.957 1.00 47.60  ? 217  LYS C NZ  1 
ATOM   8346  N  N   . ILE C  3  218 ? 56.844 69.804  130.134 1.00 27.27  ? 218  ILE C N   1 
ATOM   8347  C  CA  . ILE C  3  218 ? 56.185 71.091  130.429 1.00 26.84  ? 218  ILE C CA  1 
ATOM   8348  C  C   . ILE C  3  218 ? 57.130 71.925  131.294 1.00 26.92  ? 218  ILE C C   1 
ATOM   8349  O  O   . ILE C  3  218 ? 58.034 71.365  131.983 1.00 26.56  ? 218  ILE C O   1 
ATOM   8350  C  CB  . ILE C  3  218 ? 54.907 70.878  131.127 1.00 26.34  ? 218  ILE C CB  1 
ATOM   8351  C  CG1 . ILE C  3  218 ? 55.137 70.130  132.447 1.00 21.76  ? 218  ILE C CG1 1 
ATOM   8352  C  CG2 . ILE C  3  218 ? 53.937 70.193  130.198 1.00 28.80  ? 218  ILE C CG2 1 
ATOM   8353  C  CD1 . ILE C  3  218 ? 53.874 69.863  133.229 1.00 29.44  ? 218  ILE C CD1 1 
ATOM   8354  N  N   . PRO C  3  219 ? 56.957 73.246  131.271 1.00 27.61  ? 219  PRO C N   1 
ATOM   8355  C  CA  . PRO C  3  219 ? 57.808 74.136  132.083 1.00 28.51  ? 219  PRO C CA  1 
ATOM   8356  C  C   . PRO C  3  219 ? 57.507 73.875  133.548 1.00 30.20  ? 219  PRO C C   1 
ATOM   8357  O  O   . PRO C  3  219 ? 56.352 73.539  133.921 1.00 29.67  ? 219  PRO C O   1 
ATOM   8358  C  CB  . PRO C  3  219 ? 57.284 75.526  131.767 1.00 27.64  ? 219  PRO C CB  1 
ATOM   8359  C  CG  . PRO C  3  219 ? 56.230 75.366  130.778 1.00 26.21  ? 219  PRO C CG  1 
ATOM   8360  C  CD  . PRO C  3  219 ? 55.884 73.971  130.586 1.00 27.33  ? 219  PRO C CD  1 
ATOM   8361  N  N   . PHE C  3  220 ? 58.505 74.029  134.379 1.00 31.97  ? 220  PHE C N   1 
ATOM   8362  C  CA  . PHE C  3  220 ? 58.297 73.874  135.780 1.00 34.13  ? 220  PHE C CA  1 
ATOM   8363  C  C   . PHE C  3  220 ? 57.417 75.100  136.238 1.00 36.14  ? 220  PHE C C   1 
ATOM   8364  O  O   . PHE C  3  220 ? 56.637 74.973  137.146 1.00 36.82  ? 220  PHE C O   1 
ATOM   8365  C  CB  . PHE C  3  220 ? 59.647 73.853  136.457 1.00 34.55  ? 220  PHE C CB  1 
ATOM   8366  C  CG  . PHE C  3  220 ? 59.605 73.475  137.854 1.00 38.20  ? 220  PHE C CG  1 
ATOM   8367  C  CD1 . PHE C  3  220 ? 59.468 74.435  138.843 1.00 46.42  ? 220  PHE C CD1 1 
ATOM   8368  C  CD2 . PHE C  3  220 ? 59.766 72.169  138.217 1.00 49.28  ? 220  PHE C CD2 1 
ATOM   8369  C  CE1 . PHE C  3  220 ? 59.443 74.085  140.169 1.00 52.37  ? 220  PHE C CE1 1 
ATOM   8370  C  CE2 . PHE C  3  220 ? 59.735 71.800  139.531 1.00 48.88  ? 220  PHE C CE2 1 
ATOM   8371  C  CZ  . PHE C  3  220 ? 59.573 72.754  140.518 1.00 54.26  ? 220  PHE C CZ  1 
ATOM   8372  N  N   . HIS C  3  221 ? 57.501 76.214  135.473 1.00 37.27  ? 221  HIS C N   1 
ATOM   8373  C  CA  . HIS C  3  221 ? 56.787 77.490  135.686 1.00 38.44  ? 221  HIS C CA  1 
ATOM   8374  C  C   . HIS C  3  221 ? 55.330 77.798  135.897 1.00 40.27  ? 221  HIS C C   1 
ATOM   8375  O  O   . HIS C  3  221 ? 55.010 78.924  135.870 1.00 43.03  ? 221  HIS C O   1 
ATOM   8376  C  CB  . HIS C  3  221 ? 57.574 78.562  136.469 1.00 37.88  ? 221  HIS C CB  1 
ATOM   8377  C  CG  . HIS C  3  221 ? 56.684 79.701  136.937 1.00 25.41  ? 221  HIS C CG  1 
ATOM   8378  N  ND1 . HIS C  3  221 ? 55.950 79.637  138.122 1.00 19.64  ? 221  HIS C ND1 1 
ATOM   8379  C  CD2 . HIS C  3  221 ? 56.216 80.798  136.270 1.00 15.36  ? 221  HIS C CD2 1 
ATOM   8380  C  CE1 . HIS C  3  221 ? 55.168 80.706  138.212 1.00 22.36  ? 221  HIS C CE1 1 
ATOM   8381  N  NE2 . HIS C  3  221 ? 55.286 81.409  137.090 1.00 25.98  ? 221  HIS C NE2 1 
ATOM   8382  N  N   . PRO C  3  222 ? 54.443 76.987  135.701 1.00 39.02  ? 222  PRO C N   1 
ATOM   8383  C  CA  . PRO C  3  222 ? 53.174 77.227  136.377 1.00 36.70  ? 222  PRO C CA  1 
ATOM   8384  C  C   . PRO C  3  222 ? 52.832 75.936  137.115 1.00 35.53  ? 222  PRO C C   1 
ATOM   8385  O  O   . PRO C  3  222 ? 52.615 75.963  138.310 1.00 35.49  ? 222  PRO C O   1 
ATOM   8386  C  CB  . PRO C  3  222 ? 52.214 77.563  135.236 1.00 36.20  ? 222  PRO C CB  1 
ATOM   8387  C  CG  . PRO C  3  222 ? 53.113 77.519  133.977 1.00 42.74  ? 222  PRO C CG  1 
ATOM   8388  C  CD  . PRO C  3  222 ? 54.258 76.514  134.345 1.00 39.83  ? 222  PRO C CD  1 
ATOM   8389  N  N   . TYR C  3  223 ? 53.027 74.821  136.419 1.00 34.54  ? 223  TYR C N   1 
ATOM   8390  C  CA  . TYR C  3  223 ? 52.696 73.490  136.844 1.00 34.39  ? 223  TYR C CA  1 
ATOM   8391  C  C   . TYR C  3  223 ? 53.329 72.924  138.135 1.00 34.03  ? 223  TYR C C   1 
ATOM   8392  O  O   . TYR C  3  223 ? 52.617 72.488  139.051 1.00 32.91  ? 223  TYR C O   1 
ATOM   8393  C  CB  . TYR C  3  223 ? 52.881 72.545  135.660 1.00 34.65  ? 223  TYR C CB  1 
ATOM   8394  C  CG  . TYR C  3  223 ? 52.139 73.018  134.431 1.00 39.40  ? 223  TYR C CG  1 
ATOM   8395  C  CD1 . TYR C  3  223 ? 50.754 73.152  134.450 1.00 40.08  ? 223  TYR C CD1 1 
ATOM   8396  C  CD2 . TYR C  3  223 ? 52.829 73.391  133.253 1.00 43.97  ? 223  TYR C CD2 1 
ATOM   8397  C  CE1 . TYR C  3  223 ? 50.050 73.633  133.331 1.00 39.52  ? 223  TYR C CE1 1 
ATOM   8398  C  CE2 . TYR C  3  223 ? 52.127 73.867  132.117 1.00 35.88  ? 223  TYR C CE2 1 
ATOM   8399  C  CZ  . TYR C  3  223 ? 50.735 73.983  132.176 1.00 34.02  ? 223  TYR C CZ  1 
ATOM   8400  O  OH  . TYR C  3  223 ? 50.024 74.436  131.104 1.00 31.93  ? 223  TYR C OH  1 
ATOM   8401  N  N   . TYR C  3  224 ? 54.645 72.950  138.224 1.00 34.43  ? 224  TYR C N   1 
ATOM   8402  C  CA  . TYR C  3  224 ? 55.288 72.412  139.415 1.00 34.29  ? 224  TYR C CA  1 
ATOM   8403  C  C   . TYR C  3  224 ? 55.630 73.393  140.481 1.00 34.29  ? 224  TYR C C   1 
ATOM   8404  O  O   . TYR C  3  224 ? 56.024 72.989  141.554 1.00 34.68  ? 224  TYR C O   1 
ATOM   8405  C  CB  . TYR C  3  224 ? 56.447 71.515  139.080 1.00 33.94  ? 224  TYR C CB  1 
ATOM   8406  C  CG  . TYR C  3  224 ? 56.004 70.388  138.295 1.00 32.25  ? 224  TYR C CG  1 
ATOM   8407  C  CD1 . TYR C  3  224 ? 55.040 69.516  138.798 1.00 30.67  ? 224  TYR C CD1 1 
ATOM   8408  C  CD2 . TYR C  3  224 ? 56.429 70.225  136.988 1.00 30.58  ? 224  TYR C CD2 1 
ATOM   8409  C  CE1 . TYR C  3  224 ? 54.545 68.460  138.024 1.00 35.97  ? 224  TYR C CE1 1 
ATOM   8410  C  CE2 . TYR C  3  224 ? 55.967 69.159  136.209 1.00 35.20  ? 224  TYR C CE2 1 
ATOM   8411  C  CZ  . TYR C  3  224 ? 55.018 68.284  136.731 1.00 33.29  ? 224  TYR C CZ  1 
ATOM   8412  O  OH  . TYR C  3  224 ? 54.547 67.247  135.959 1.00 26.85  ? 224  TYR C OH  1 
ATOM   8413  N  N   . THR C  3  225 ? 55.520 74.692  140.195 1.00 33.58  ? 225  THR C N   1 
ATOM   8414  C  CA  . THR C  3  225 ? 55.723 75.653  141.251 1.00 33.53  ? 225  THR C CA  1 
ATOM   8415  C  C   . THR C  3  225 ? 54.510 75.543  142.171 1.00 33.06  ? 225  THR C C   1 
ATOM   8416  O  O   . THR C  3  225 ? 54.645 75.298  143.344 1.00 32.67  ? 225  THR C O   1 
ATOM   8417  C  CB  . THR C  3  225 ? 55.890 77.096  140.723 1.00 33.57  ? 225  THR C CB  1 
ATOM   8418  O  OG1 . THR C  3  225 ? 55.170 77.251  139.508 1.00 44.11  ? 225  THR C OG1 1 
ATOM   8419  C  CG2 . THR C  3  225 ? 57.306 77.342  140.306 1.00 29.82  ? 225  THR C CG2 1 
ATOM   8420  N  N   . ILE C  3  226 ? 53.327 75.646  141.588 1.00 32.99  ? 226  ILE C N   1 
ATOM   8421  C  CA  . ILE C  3  226 ? 52.095 75.549  142.353 1.00 32.83  ? 226  ILE C CA  1 
ATOM   8422  C  C   . ILE C  3  226 ? 51.810 74.184  142.947 1.00 31.60  ? 226  ILE C C   1 
ATOM   8423  O  O   . ILE C  3  226 ? 51.274 74.118  144.011 1.00 31.81  ? 226  ILE C O   1 
ATOM   8424  C  CB  . ILE C  3  226 ? 50.880 76.059  141.556 1.00 33.51  ? 226  ILE C CB  1 
ATOM   8425  C  CG1 . ILE C  3  226 ? 49.810 76.596  142.500 1.00 32.55  ? 226  ILE C CG1 1 
ATOM   8426  C  CG2 . ILE C  3  226 ? 50.322 74.969  140.646 1.00 30.56  ? 226  ILE C CG2 1 
ATOM   8427  C  CD1 . ILE C  3  226 ? 49.097 77.765  141.959 1.00 41.02  ? 226  ILE C CD1 1 
ATOM   8428  N  N   . LYS C  3  227 ? 52.186 73.101  142.268 1.00 30.86  ? 227  LYS C N   1 
ATOM   8429  C  CA  . LYS C  3  227 ? 51.979 71.758  142.824 1.00 30.44  ? 227  LYS C CA  1 
ATOM   8430  C  C   . LYS C  3  227 ? 52.906 71.570  144.050 1.00 31.13  ? 227  LYS C C   1 
ATOM   8431  O  O   . LYS C  3  227 ? 52.518 70.917  145.033 1.00 31.63  ? 227  LYS C O   1 
ATOM   8432  C  CB  . LYS C  3  227 ? 52.175 70.672  141.756 1.00 30.28  ? 227  LYS C CB  1 
ATOM   8433  C  CG  . LYS C  3  227 ? 52.321 69.189  142.244 1.00 39.33  ? 227  LYS C CG  1 
ATOM   8434  C  CD  . LYS C  3  227 ? 51.813 68.148  141.146 1.00 38.40  ? 227  LYS C CD  1 
ATOM   8435  C  CE  . LYS C  3  227 ? 52.425 66.696  141.329 1.00 31.42  ? 227  LYS C CE  1 
ATOM   8436  N  NZ  . LYS C  3  227 ? 53.999 66.696  141.434 1.00 25.25  ? 227  LYS C NZ  1 
ATOM   8437  N  N   . ASP C  3  228 ? 54.076 72.238  144.042 1.00 31.09  ? 228  ASP C N   1 
ATOM   8438  C  CA  . ASP C  3  228 ? 55.013 72.153  145.186 1.00 30.72  ? 228  ASP C CA  1 
ATOM   8439  C  C   . ASP C  3  228 ? 54.487 73.011  146.321 1.00 30.38  ? 228  ASP C C   1 
ATOM   8440  O  O   . ASP C  3  228 ? 54.708 72.712  147.519 1.00 29.64  ? 228  ASP C O   1 
ATOM   8441  C  CB  . ASP C  3  228 ? 56.387 72.676  144.818 1.00 30.50  ? 228  ASP C CB  1 
ATOM   8442  C  CG  . ASP C  3  228 ? 57.192 71.703  144.053 1.00 31.35  ? 228  ASP C CG  1 
ATOM   8443  O  OD1 . ASP C  3  228 ? 56.707 70.562  143.779 1.00 30.45  ? 228  ASP C OD1 1 
ATOM   8444  O  OD2 . ASP C  3  228 ? 58.345 72.000  143.670 1.00 31.59  ? 228  ASP C OD2 1 
ATOM   8445  N  N   . ILE C  3  229 ? 53.856 74.118  145.942 1.00 30.39  ? 229  ILE C N   1 
ATOM   8446  C  CA  . ILE C  3  229 ? 53.267 74.991  146.903 1.00 30.70  ? 229  ILE C CA  1 
ATOM   8447  C  C   . ILE C  3  229 ? 52.176 74.224  147.653 1.00 31.84  ? 229  ILE C C   1 
ATOM   8448  O  O   . ILE C  3  229 ? 52.304 74.017  148.856 1.00 31.90  ? 229  ILE C O   1 
ATOM   8449  C  CB  . ILE C  3  229 ? 52.739 76.271  146.258 1.00 29.91  ? 229  ILE C CB  1 
ATOM   8450  C  CG1 . ILE C  3  229 ? 53.907 77.235  146.026 1.00 20.95  ? 229  ILE C CG1 1 
ATOM   8451  C  CG2 . ILE C  3  229 ? 51.669 76.923  147.155 1.00 8.12   ? 229  ILE C CG2 1 
ATOM   8452  C  CD1 . ILE C  3  229 ? 53.473 78.637  145.623 1.00 19.72  ? 229  ILE C CD1 1 
ATOM   8453  N  N   . LEU C  3  230 ? 51.187 73.684  146.907 1.00 32.44  ? 230  LEU C N   1 
ATOM   8454  C  CA  . LEU C  3  230 ? 50.073 72.910  147.488 1.00 32.33  ? 230  LEU C CA  1 
ATOM   8455  C  C   . LEU C  3  230 ? 50.610 71.825  148.389 1.00 32.64  ? 230  LEU C C   1 
ATOM   8456  O  O   . LEU C  3  230 ? 50.090 71.601  149.466 1.00 32.57  ? 230  LEU C O   1 
ATOM   8457  C  CB  . LEU C  3  230 ? 49.202 72.304  146.370 1.00 32.20  ? 230  LEU C CB  1 
ATOM   8458  C  CG  . LEU C  3  230 ? 48.099 71.269  146.717 1.00 24.00  ? 230  LEU C CG  1 
ATOM   8459  C  CD1 . LEU C  3  230 ? 47.079 71.834  147.687 1.00 18.94  ? 230  LEU C CD1 1 
ATOM   8460  C  CD2 . LEU C  3  230 ? 47.405 70.835  145.458 1.00 14.38  ? 230  LEU C CD2 1 
ATOM   8461  N  N   . GLY C  3  231 ? 51.718 71.216  147.968 1.00 33.29  ? 231  GLY C N   1 
ATOM   8462  C  CA  . GLY C  3  231 ? 52.360 70.156  148.721 1.00 33.97  ? 231  GLY C CA  1 
ATOM   8463  C  C   . GLY C  3  231 ? 53.079 70.586  150.002 1.00 34.47  ? 231  GLY C C   1 
ATOM   8464  O  O   . GLY C  3  231 ? 53.154 69.818  150.956 1.00 34.96  ? 231  GLY C O   1 
ATOM   8465  N  N   . ALA C  3  232 ? 53.640 71.786  150.008 1.00 34.30  ? 232  ALA C N   1 
ATOM   8466  C  CA  . ALA C  3  232 ? 54.342 72.280  151.189 1.00 34.40  ? 232  ALA C CA  1 
ATOM   8467  C  C   . ALA C  3  232 ? 53.306 72.604  152.236 1.00 34.61  ? 232  ALA C C   1 
ATOM   8468  O  O   . ALA C  3  232 ? 53.534 72.410  153.425 1.00 34.40  ? 232  ALA C O   1 
ATOM   8469  C  CB  . ALA C  3  232 ? 55.197 73.537  150.844 1.00 34.22  ? 232  ALA C CB  1 
ATOM   8470  N  N   . LEU C  3  233 ? 52.136 73.048  151.765 1.00 34.78  ? 233  LEU C N   1 
ATOM   8471  C  CA  . LEU C  3  233 ? 51.021 73.374  152.617 1.00 35.42  ? 233  LEU C CA  1 
ATOM   8472  C  C   . LEU C  3  233 ? 50.568 72.086  153.312 1.00 36.62  ? 233  LEU C C   1 
ATOM   8473  O  O   . LEU C  3  233 ? 50.185 72.091  154.476 1.00 36.56  ? 233  LEU C O   1 
ATOM   8474  C  CB  . LEU C  3  233 ? 49.891 73.937  151.777 1.00 35.06  ? 233  LEU C CB  1 
ATOM   8475  C  CG  . LEU C  3  233 ? 48.673 74.484  152.494 1.00 35.54  ? 233  LEU C CG  1 
ATOM   8476  C  CD1 . LEU C  3  233 ? 49.074 75.673  153.330 1.00 39.32  ? 233  LEU C CD1 1 
ATOM   8477  C  CD2 . LEU C  3  233 ? 47.625 74.881  151.500 1.00 33.65  ? 233  LEU C CD2 1 
ATOM   8478  N  N   . LEU C  3  234 ? 50.656 70.973  152.591 1.00 37.36  ? 234  LEU C N   1 
ATOM   8479  C  CA  . LEU C  3  234 ? 50.308 69.692  153.167 1.00 37.67  ? 234  LEU C CA  1 
ATOM   8480  C  C   . LEU C  3  234 ? 51.371 69.249  154.183 1.00 37.09  ? 234  LEU C C   1 
ATOM   8481  O  O   . LEU C  3  234 ? 51.058 68.553  155.134 1.00 36.71  ? 234  LEU C O   1 
ATOM   8482  C  CB  . LEU C  3  234 ? 50.107 68.640  152.069 1.00 38.19  ? 234  LEU C CB  1 
ATOM   8483  C  CG  . LEU C  3  234 ? 48.779 68.758  151.322 1.00 40.53  ? 234  LEU C CG  1 
ATOM   8484  C  CD1 . LEU C  3  234 ? 48.813 67.945  150.072 1.00 45.37  ? 234  LEU C CD1 1 
ATOM   8485  C  CD2 . LEU C  3  234 ? 47.634 68.303  152.222 1.00 40.81  ? 234  LEU C CD2 1 
ATOM   8486  N  N   . LEU C  3  235 ? 52.626 69.691  153.988 1.00 36.69  ? 235  LEU C N   1 
ATOM   8487  C  CA  . LEU C  3  235 ? 53.687 69.354  154.935 1.00 36.17  ? 235  LEU C CA  1 
ATOM   8488  C  C   . LEU C  3  235 ? 53.480 70.177  156.170 1.00 36.05  ? 235  LEU C C   1 
ATOM   8489  O  O   . LEU C  3  235 ? 53.733 69.712  157.277 1.00 36.48  ? 235  LEU C O   1 
ATOM   8490  C  CB  . LEU C  3  235 ? 55.077 69.651  154.374 1.00 35.92  ? 235  LEU C CB  1 
ATOM   8491  C  CG  . LEU C  3  235 ? 56.234 69.336  155.348 1.00 29.71  ? 235  LEU C CG  1 
ATOM   8492  C  CD1 . LEU C  3  235 ? 56.633 67.928  155.202 1.00 30.91  ? 235  LEU C CD1 1 
ATOM   8493  C  CD2 . LEU C  3  235 ? 57.475 70.284  155.216 1.00 25.66  ? 235  LEU C CD2 1 
ATOM   8494  N  N   . ILE C  3  236 ? 52.987 71.398  155.993 1.00 35.64  ? 236  ILE C N   1 
ATOM   8495  C  CA  . ILE C  3  236 ? 52.769 72.267  157.137 1.00 35.66  ? 236  ILE C CA  1 
ATOM   8496  C  C   . ILE C  3  236 ? 51.681 71.705  158.000 1.00 35.36  ? 236  ILE C C   1 
ATOM   8497  O  O   . ILE C  3  236 ? 51.868 71.564  159.211 1.00 35.36  ? 236  ILE C O   1 
ATOM   8498  C  CB  . ILE C  3  236 ? 52.499 73.718  156.720 1.00 35.90  ? 236  ILE C CB  1 
ATOM   8499  C  CG1 . ILE C  3  236 ? 53.757 74.319  156.091 1.00 39.92  ? 236  ILE C CG1 1 
ATOM   8500  C  CG2 . ILE C  3  236 ? 52.129 74.559  157.915 1.00 37.12  ? 236  ILE C CG2 1 
ATOM   8501  C  CD1 . ILE C  3  236 ? 55.033 73.981  156.848 1.00 45.16  ? 236  ILE C CD1 1 
ATOM   8502  N  N   . LEU C  3  237 ? 50.584 71.274  157.361 1.00 35.04  ? 237  LEU C N   1 
ATOM   8503  C  CA  . LEU C  3  237 ? 49.462 70.640  158.073 1.00 34.13  ? 237  LEU C CA  1 
ATOM   8504  C  C   . LEU C  3  237 ? 49.960 69.504  158.930 1.00 33.48  ? 237  LEU C C   1 
ATOM   8505  O  O   . LEU C  3  237 ? 49.805 69.550  160.125 1.00 32.63  ? 237  LEU C O   1 
ATOM   8506  C  CB  . LEU C  3  237 ? 48.386 70.150  157.113 1.00 33.70  ? 237  LEU C CB  1 
ATOM   8507  C  CG  . LEU C  3  237 ? 47.143 69.563  157.805 1.00 32.71  ? 237  LEU C CG  1 
ATOM   8508  C  CD1 . LEU C  3  237 ? 46.658 70.439  158.895 1.00 26.88  ? 237  LEU C CD1 1 
ATOM   8509  C  CD2 . LEU C  3  237 ? 46.050 69.344  156.830 1.00 32.73  ? 237  LEU C CD2 1 
ATOM   8510  N  N   . ALA C  3  238 ? 50.626 68.524  158.312 1.00 33.95  ? 238  ALA C N   1 
ATOM   8511  C  CA  . ALA C  3  238 ? 51.171 67.384  159.063 1.00 34.64  ? 238  ALA C CA  1 
ATOM   8512  C  C   . ALA C  3  238 ? 52.038 67.831  160.256 1.00 35.63  ? 238  ALA C C   1 
ATOM   8513  O  O   . ALA C  3  238 ? 51.767 67.445  161.398 1.00 35.84  ? 238  ALA C O   1 
ATOM   8514  C  CB  . ALA C  3  238 ? 51.921 66.443  158.163 1.00 34.25  ? 238  ALA C CB  1 
ATOM   8515  N  N   . LEU C  3  239 ? 53.026 68.693  159.997 1.00 36.39  ? 239  LEU C N   1 
ATOM   8516  C  CA  . LEU C  3  239 ? 53.898 69.225  161.057 1.00 36.47  ? 239  LEU C CA  1 
ATOM   8517  C  C   . LEU C  3  239 ? 53.104 69.931  162.147 1.00 36.96  ? 239  LEU C C   1 
ATOM   8518  O  O   . LEU C  3  239 ? 53.186 69.561  163.289 1.00 37.18  ? 239  LEU C O   1 
ATOM   8519  C  CB  . LEU C  3  239 ? 54.919 70.191  160.483 1.00 36.47  ? 239  LEU C CB  1 
ATOM   8520  C  CG  . LEU C  3  239 ? 55.814 70.910  161.515 1.00 38.88  ? 239  LEU C CG  1 
ATOM   8521  C  CD1 . LEU C  3  239 ? 56.809 69.981  162.161 1.00 33.59  ? 239  LEU C CD1 1 
ATOM   8522  C  CD2 . LEU C  3  239 ? 56.535 72.097  160.886 1.00 35.93  ? 239  LEU C CD2 1 
ATOM   8523  N  N   . MET C  3  240 ? 52.289 70.912  161.774 1.00 37.42  ? 240  MET C N   1 
ATOM   8524  C  CA  . MET C  3  240 ? 51.504 71.659  162.757 1.00 37.99  ? 240  MET C CA  1 
ATOM   8525  C  C   . MET C  3  240 ? 50.489 70.828  163.535 1.00 38.77  ? 240  MET C C   1 
ATOM   8526  O  O   . MET C  3  240 ? 50.231 71.103  164.701 1.00 39.49  ? 240  MET C O   1 
ATOM   8527  C  CB  . MET C  3  240 ? 50.854 72.889  162.137 1.00 37.93  ? 240  MET C CB  1 
ATOM   8528  C  CG  . MET C  3  240 ? 51.850 73.967  161.663 1.00 43.19  ? 240  MET C CG  1 
ATOM   8529  S  SD  . MET C  3  240 ? 52.819 74.763  163.000 1.00 51.28  ? 240  MET C SD  1 
ATOM   8530  C  CE  . MET C  3  240 ? 54.108 73.761  163.115 1.00 35.11  ? 240  MET C CE  1 
ATOM   8531  N  N   . LEU C  3  241 ? 49.923 69.819  162.883 1.00 38.68  ? 241  LEU C N   1 
ATOM   8532  C  CA  . LEU C  3  241 ? 49.000 68.912  163.511 1.00 39.24  ? 241  LEU C CA  1 
ATOM   8533  C  C   . LEU C  3  241 ? 49.770 68.210  164.609 1.00 39.43  ? 241  LEU C C   1 
ATOM   8534  O  O   . LEU C  3  241 ? 49.304 68.095  165.740 1.00 39.42  ? 241  LEU C O   1 
ATOM   8535  C  CB  . LEU C  3  241 ? 48.531 67.879  162.493 1.00 39.84  ? 241  LEU C CB  1 
ATOM   8536  C  CG  . LEU C  3  241 ? 47.086 67.391  162.493 1.00 50.67  ? 241  LEU C CG  1 
ATOM   8537  C  CD1 . LEU C  3  241 ? 46.077 68.567  162.561 1.00 48.42  ? 241  LEU C CD1 1 
ATOM   8538  C  CD2 . LEU C  3  241 ? 46.843 66.537  161.236 1.00 54.69  ? 241  LEU C CD2 1 
ATOM   8539  N  N   . LEU C  3  242 ? 50.981 67.792  164.284 1.00 39.47  ? 242  LEU C N   1 
ATOM   8540  C  CA  . LEU C  3  242 ? 51.824 67.141  165.247 1.00 39.50  ? 242  LEU C CA  1 
ATOM   8541  C  C   . LEU C  3  242 ? 52.156 68.104  166.393 1.00 39.08  ? 242  LEU C C   1 
ATOM   8542  O  O   . LEU C  3  242 ? 51.734 67.877  167.485 1.00 38.96  ? 242  LEU C O   1 
ATOM   8543  C  CB  . LEU C  3  242 ? 53.096 66.633  164.573 1.00 40.05  ? 242  LEU C CB  1 
ATOM   8544  C  CG  . LEU C  3  242 ? 53.492 65.178  164.817 1.00 46.12  ? 242  LEU C CG  1 
ATOM   8545  C  CD1 . LEU C  3  242 ? 52.346 64.261  164.453 1.00 43.39  ? 242  LEU C CD1 1 
ATOM   8546  C  CD2 . LEU C  3  242 ? 54.705 64.851  163.998 1.00 39.80  ? 242  LEU C CD2 1 
ATOM   8547  N  N   . VAL C  3  243 ? 52.821 69.239  166.099 1.00 38.99  ? 243  VAL C N   1 
ATOM   8548  C  CA  . VAL C  3  243 ? 53.225 70.223  167.166 1.00 38.58  ? 243  VAL C CA  1 
ATOM   8549  C  C   . VAL C  3  243 ? 52.153 70.974  167.988 1.00 38.53  ? 243  VAL C C   1 
ATOM   8550  O  O   . VAL C  3  243 ? 52.358 71.247  169.186 1.00 37.99  ? 243  VAL C O   1 
ATOM   8551  C  CB  . VAL C  3  243 ? 54.447 71.193  166.748 1.00 38.66  ? 243  VAL C CB  1 
ATOM   8552  C  CG1 . VAL C  3  243 ? 54.993 70.878  165.380 1.00 34.55  ? 243  VAL C CG1 1 
ATOM   8553  C  CG2 . VAL C  3  243 ? 54.102 72.722  166.924 1.00 22.33  ? 243  VAL C CG2 1 
ATOM   8554  N  N   . LEU C  3  244 ? 51.025 71.309  167.371 1.00 38.98  ? 244  LEU C N   1 
ATOM   8555  C  CA  . LEU C  3  244 ? 49.978 72.030  168.107 1.00 39.51  ? 244  LEU C CA  1 
ATOM   8556  C  C   . LEU C  3  244 ? 48.897 71.114  168.730 1.00 40.04  ? 244  LEU C C   1 
ATOM   8557  O  O   . LEU C  3  244 ? 47.924 71.609  169.315 1.00 40.20  ? 244  LEU C O   1 
ATOM   8558  C  CB  . LEU C  3  244 ? 49.324 73.088  167.229 1.00 39.39  ? 244  LEU C CB  1 
ATOM   8559  C  CG  . LEU C  3  244 ? 50.247 74.098  166.571 1.00 40.62  ? 244  LEU C CG  1 
ATOM   8560  C  CD1 . LEU C  3  244 ? 49.467 74.927  165.615 1.00 42.84  ? 244  LEU C CD1 1 
ATOM   8561  C  CD2 . LEU C  3  244 ? 50.939 74.969  167.600 1.00 36.18  ? 244  LEU C CD2 1 
ATOM   8562  N  N   . PHE C  3  245 ? 49.061 69.795  168.594 1.00 40.08  ? 245  PHE C N   1 
ATOM   8563  C  CA  . PHE C  3  245 ? 48.096 68.855  169.155 1.00 40.04  ? 245  PHE C CA  1 
ATOM   8564  C  C   . PHE C  3  245 ? 48.727 67.645  169.809 1.00 40.26  ? 245  PHE C C   1 
ATOM   8565  O  O   . PHE C  3  245 ? 48.171 67.110  170.730 1.00 40.64  ? 245  PHE C O   1 
ATOM   8566  C  CB  . PHE C  3  245 ? 47.100 68.374  168.106 1.00 39.90  ? 245  PHE C CB  1 
ATOM   8567  C  CG  . PHE C  3  245 ? 46.059 69.392  167.719 1.00 37.37  ? 245  PHE C CG  1 
ATOM   8568  C  CD1 . PHE C  3  245 ? 45.255 69.986  168.670 1.00 33.52  ? 245  PHE C CD1 1 
ATOM   8569  C  CD2 . PHE C  3  245 ? 45.835 69.695  166.380 1.00 35.37  ? 245  PHE C CD2 1 
ATOM   8570  C  CE1 . PHE C  3  245 ? 44.282 70.893  168.298 1.00 32.79  ? 245  PHE C CE1 1 
ATOM   8571  C  CE2 . PHE C  3  245 ? 44.866 70.590  166.016 1.00 30.99  ? 245  PHE C CE2 1 
ATOM   8572  C  CZ  . PHE C  3  245 ? 44.091 71.191  166.973 1.00 34.05  ? 245  PHE C CZ  1 
ATOM   8573  N  N   . ALA C  3  246 ? 49.882 67.208  169.328 1.00 40.32  ? 246  ALA C N   1 
ATOM   8574  C  CA  . ALA C  3  246 ? 50.530 66.009  169.894 1.00 40.52  ? 246  ALA C CA  1 
ATOM   8575  C  C   . ALA C  3  246 ? 52.052 66.086  169.780 1.00 41.04  ? 246  ALA C C   1 
ATOM   8576  O  O   . ALA C  3  246 ? 52.664 65.271  169.110 1.00 41.38  ? 246  ALA C O   1 
ATOM   8577  C  CB  . ALA C  3  246 ? 50.009 64.758  169.171 1.00 40.48  ? 246  ALA C CB  1 
ATOM   8578  N  N   . PRO C  3  247 ? 52.662 67.021  170.499 1.00 41.24  ? 247  PRO C N   1 
ATOM   8579  C  CA  . PRO C  3  247 ? 54.095 67.298  170.393 1.00 41.49  ? 247  PRO C CA  1 
ATOM   8580  C  C   . PRO C  3  247 ? 55.018 66.266  170.980 1.00 41.77  ? 247  PRO C C   1 
ATOM   8581  O  O   . PRO C  3  247 ? 56.230 66.357  170.785 1.00 41.50  ? 247  PRO C O   1 
ATOM   8582  C  CB  . PRO C  3  247 ? 54.239 68.580  171.186 1.00 41.67  ? 247  PRO C CB  1 
ATOM   8583  C  CG  . PRO C  3  247 ? 52.853 69.012  171.453 1.00 37.24  ? 247  PRO C CG  1 
ATOM   8584  C  CD  . PRO C  3  247 ? 52.043 67.834  171.538 1.00 41.04  ? 247  PRO C CD  1 
ATOM   8585  N  N   . ASP C  3  248 ? 54.474 65.320  171.716 1.00 42.48  ? 248  ASP C N   1 
ATOM   8586  C  CA  . ASP C  3  248 ? 55.286 64.306  172.311 1.00 43.13  ? 248  ASP C CA  1 
ATOM   8587  C  C   . ASP C  3  248 ? 54.931 62.935  171.784 1.00 43.11  ? 248  ASP C C   1 
ATOM   8588  O  O   . ASP C  3  248 ? 55.585 61.962  172.109 1.00 43.28  ? 248  ASP C O   1 
ATOM   8589  C  CB  . ASP C  3  248 ? 55.156 64.362  173.823 1.00 43.75  ? 248  ASP C CB  1 
ATOM   8590  C  CG  . ASP C  3  248 ? 55.673 65.687  174.410 1.00 56.65  ? 248  ASP C CG  1 
ATOM   8591  O  OD1 . ASP C  3  248 ? 54.833 66.568  174.703 1.00 60.15  ? 248  ASP C OD1 1 
ATOM   8592  O  OD2 . ASP C  3  248 ? 56.898 65.932  174.602 1.00 52.48  ? 248  ASP C OD2 1 
ATOM   8593  N  N   . LEU C  3  249 ? 53.903 62.876  170.942 1.00 43.25  ? 249  LEU C N   1 
ATOM   8594  C  CA  . LEU C  3  249 ? 53.414 61.607  170.363 1.00 43.73  ? 249  LEU C CA  1 
ATOM   8595  C  C   . LEU C  3  249 ? 54.561 60.703  169.841 1.00 43.93  ? 249  LEU C C   1 
ATOM   8596  O  O   . LEU C  3  249 ? 54.619 59.508  170.158 1.00 43.52  ? 249  LEU C O   1 
ATOM   8597  C  CB  . LEU C  3  249 ? 52.444 61.908  169.230 1.00 43.83  ? 249  LEU C CB  1 
ATOM   8598  C  CG  . LEU C  3  249 ? 51.501 60.816  168.759 1.00 48.87  ? 249  LEU C CG  1 
ATOM   8599  C  CD1 . LEU C  3  249 ? 50.166 60.964  169.484 1.00 46.33  ? 249  LEU C CD1 1 
ATOM   8600  C  CD2 . LEU C  3  249 ? 51.300 60.941  167.251 1.00 44.95  ? 249  LEU C CD2 1 
ATOM   8601  N  N   . LEU C  3  250 ? 55.485 61.304  169.072 1.00 44.04  ? 250  LEU C N   1 
ATOM   8602  C  CA  . LEU C  3  250 ? 56.627 60.577  168.519 1.00 44.15  ? 250  LEU C CA  1 
ATOM   8603  C  C   . LEU C  3  250 ? 57.838 60.695  169.434 1.00 44.39  ? 250  LEU C C   1 
ATOM   8604  O  O   . LEU C  3  250 ? 58.927 60.210  169.103 1.00 44.42  ? 250  LEU C O   1 
ATOM   8605  C  CB  . LEU C  3  250 ? 56.996 61.119  167.132 1.00 43.92  ? 250  LEU C CB  1 
ATOM   8606  C  CG  . LEU C  3  250 ? 55.918 61.186  166.046 1.00 46.57  ? 250  LEU C CG  1 
ATOM   8607  C  CD1 . LEU C  3  250 ? 56.505 61.738  164.789 1.00 50.23  ? 250  LEU C CD1 1 
ATOM   8608  C  CD2 . LEU C  3  250 ? 55.297 59.810  165.769 1.00 48.13  ? 250  LEU C CD2 1 
ATOM   8609  N  N   . GLY C  3  251 ? 57.650 61.352  170.575 1.00 44.50  ? 251  GLY C N   1 
ATOM   8610  C  CA  . GLY C  3  251 ? 58.725 61.553  171.523 1.00 45.12  ? 251  GLY C CA  1 
ATOM   8611  C  C   . GLY C  3  251 ? 58.703 60.594  172.698 1.00 46.14  ? 251  GLY C C   1 
ATOM   8612  O  O   . GLY C  3  251 ? 57.649 60.029  173.065 1.00 46.31  ? 251  GLY C O   1 
ATOM   8613  N  N   . ASP C  3  252 ? 59.865 60.442  173.318 1.00 46.65  ? 252  ASP C N   1 
ATOM   8614  C  CA  . ASP C  3  252 ? 60.038 59.556  174.450 1.00 46.90  ? 252  ASP C CA  1 
ATOM   8615  C  C   . ASP C  3  252 ? 59.985 60.313  175.802 1.00 46.90  ? 252  ASP C C   1 
ATOM   8616  O  O   . ASP C  3  252 ? 60.879 61.099  176.110 1.00 46.58  ? 252  ASP C O   1 
ATOM   8617  C  CB  . ASP C  3  252 ? 61.380 58.811  174.303 1.00 47.03  ? 252  ASP C CB  1 
ATOM   8618  C  CG  . ASP C  3  252 ? 61.591 57.729  175.373 1.00 56.28  ? 252  ASP C CG  1 
ATOM   8619  O  OD1 . ASP C  3  252 ? 62.465 56.860  175.148 1.00 59.40  ? 252  ASP C OD1 1 
ATOM   8620  O  OD2 . ASP C  3  252 ? 60.943 57.653  176.455 1.00 56.05  ? 252  ASP C OD2 1 
ATOM   8621  N  N   . PRO C  3  253 ? 58.949 60.026  176.609 1.00 47.44  ? 253  PRO C N   1 
ATOM   8622  C  CA  . PRO C  3  253 ? 58.795 60.622  177.961 1.00 47.76  ? 253  PRO C CA  1 
ATOM   8623  C  C   . PRO C  3  253 ? 59.807 59.991  178.922 1.00 47.77  ? 253  PRO C C   1 
ATOM   8624  O  O   . PRO C  3  253 ? 59.440 59.058  179.605 1.00 48.52  ? 253  PRO C O   1 
ATOM   8625  C  CB  . PRO C  3  253 ? 57.376 60.164  178.389 1.00 47.79  ? 253  PRO C CB  1 
ATOM   8626  C  CG  . PRO C  3  253 ? 56.730 59.589  177.143 1.00 51.61  ? 253  PRO C CG  1 
ATOM   8627  C  CD  . PRO C  3  253 ? 57.849 59.094  176.284 1.00 47.51  ? 253  PRO C CD  1 
ATOM   8628  N  N   . ASP C  3  254 ? 61.036 60.490  178.959 1.00 47.32  ? 254  ASP C N   1 
ATOM   8629  C  CA  . ASP C  3  254 ? 62.115 59.922  179.784 1.00 47.30  ? 254  ASP C CA  1 
ATOM   8630  C  C   . ASP C  3  254 ? 63.293 60.793  179.457 1.00 47.35  ? 254  ASP C C   1 
ATOM   8631  O  O   . ASP C  3  254 ? 64.250 60.916  180.222 1.00 47.12  ? 254  ASP C O   1 
ATOM   8632  C  CB  . ASP C  3  254 ? 62.434 58.473  179.351 1.00 47.37  ? 254  ASP C CB  1 
ATOM   8633  C  CG  . ASP C  3  254 ? 63.067 57.639  180.472 1.00 50.26  ? 254  ASP C CG  1 
ATOM   8634  O  OD1 . ASP C  3  254 ? 63.499 56.496  180.191 1.00 44.94  ? 254  ASP C OD1 1 
ATOM   8635  O  OD2 . ASP C  3  254 ? 63.153 58.034  181.662 1.00 56.92  ? 254  ASP C OD2 1 
ATOM   8636  N  N   . ASN C  3  255 ? 63.215 61.396  178.276 1.00 47.60  ? 255  ASN C N   1 
ATOM   8637  C  CA  . ASN C  3  255 ? 64.203 62.337  177.837 1.00 47.51  ? 255  ASN C CA  1 
ATOM   8638  C  C   . ASN C  3  255 ? 63.841 63.612  178.524 1.00 47.42  ? 255  ASN C C   1 
ATOM   8639  O  O   . ASN C  3  255 ? 64.443 64.654  178.294 1.00 47.49  ? 255  ASN C O   1 
ATOM   8640  C  CB  . ASN C  3  255 ? 64.143 62.520  176.346 1.00 47.42  ? 255  ASN C CB  1 
ATOM   8641  C  CG  . ASN C  3  255 ? 65.440 62.944  175.787 1.00 48.75  ? 255  ASN C CG  1 
ATOM   8642  O  OD1 . ASN C  3  255 ? 66.469 62.344  176.079 1.00 49.59  ? 255  ASN C OD1 1 
ATOM   8643  N  ND2 . ASN C  3  255 ? 65.429 64.012  174.996 1.00 49.09  ? 255  ASN C ND2 1 
ATOM   8644  N  N   . TYR C  3  256 ? 62.791 63.515  179.344 1.00 47.18  ? 256  TYR C N   1 
ATOM   8645  C  CA  . TYR C  3  256 ? 62.326 64.601  180.164 1.00 46.78  ? 256  TYR C CA  1 
ATOM   8646  C  C   . TYR C  3  256 ? 62.968 64.502  181.536 1.00 46.02  ? 256  TYR C C   1 
ATOM   8647  O  O   . TYR C  3  256 ? 62.905 65.428  182.314 1.00 46.24  ? 256  TYR C O   1 
ATOM   8648  C  CB  . TYR C  3  256 ? 60.817 64.585  180.277 1.00 46.82  ? 256  TYR C CB  1 
ATOM   8649  C  CG  . TYR C  3  256 ? 60.166 65.389  179.218 1.00 53.14  ? 256  TYR C CG  1 
ATOM   8650  C  CD1 . TYR C  3  256 ? 59.878 64.831  177.977 1.00 57.03  ? 256  TYR C CD1 1 
ATOM   8651  C  CD2 . TYR C  3  256 ? 59.880 66.730  179.423 1.00 54.98  ? 256  TYR C CD2 1 
ATOM   8652  C  CE1 . TYR C  3  256 ? 59.280 65.584  176.968 1.00 63.85  ? 256  TYR C CE1 1 
ATOM   8653  C  CE2 . TYR C  3  256 ? 59.290 67.497  178.432 1.00 61.90  ? 256  TYR C CE2 1 
ATOM   8654  C  CZ  . TYR C  3  256 ? 58.991 66.920  177.197 1.00 65.65  ? 256  TYR C CZ  1 
ATOM   8655  O  OH  . TYR C  3  256 ? 58.406 67.676  176.201 1.00 65.14  ? 256  TYR C OH  1 
ATOM   8656  N  N   . THR C  3  257 ? 63.562 63.363  181.846 1.00 44.98  ? 257  THR C N   1 
ATOM   8657  C  CA  . THR C  3  257 ? 64.276 63.258  183.104 1.00 44.12  ? 257  THR C CA  1 
ATOM   8658  C  C   . THR C  3  257 ? 65.759 63.470  182.768 1.00 43.30  ? 257  THR C C   1 
ATOM   8659  O  O   . THR C  3  257 ? 66.281 62.841  181.857 1.00 43.44  ? 257  THR C O   1 
ATOM   8660  C  CB  . THR C  3  257 ? 63.985 61.873  183.881 1.00 43.90  ? 257  THR C CB  1 
ATOM   8661  O  OG1 . THR C  3  257 ? 64.800 60.828  183.368 1.00 45.76  ? 257  THR C OG1 1 
ATOM   8662  C  CG2 . THR C  3  257 ? 62.560 61.361  183.611 1.00 39.26  ? 257  THR C CG2 1 
ATOM   8663  N  N   . PRO C  3  258 ? 66.374 64.458  183.412 1.00 42.43  ? 258  PRO C N   1 
ATOM   8664  C  CA  . PRO C  3  258 ? 67.789 64.796  183.201 1.00 42.01  ? 258  PRO C CA  1 
ATOM   8665  C  C   . PRO C  3  258 ? 68.722 63.617  183.217 1.00 41.96  ? 258  PRO C C   1 
ATOM   8666  O  O   . PRO C  3  258 ? 68.513 62.689  183.955 1.00 41.96  ? 258  PRO C O   1 
ATOM   8667  C  CB  . PRO C  3  258 ? 68.097 65.715  184.374 1.00 41.86  ? 258  PRO C CB  1 
ATOM   8668  C  CG  . PRO C  3  258 ? 66.817 66.394  184.636 1.00 43.29  ? 258  PRO C CG  1 
ATOM   8669  C  CD  . PRO C  3  258 ? 65.727 65.377  184.361 1.00 42.38  ? 258  PRO C CD  1 
ATOM   8670  N  N   . ALA C  3  259 ? 69.751 63.672  182.390 1.00 42.53  ? 259  ALA C N   1 
ATOM   8671  C  CA  . ALA C  3  259 ? 70.728 62.591  182.290 1.00 43.17  ? 259  ALA C CA  1 
ATOM   8672  C  C   . ALA C  3  259 ? 71.275 62.178  183.639 1.00 43.79  ? 259  ALA C C   1 
ATOM   8673  O  O   . ALA C  3  259 ? 71.536 63.008  184.501 1.00 43.38  ? 259  ALA C O   1 
ATOM   8674  C  CB  . ALA C  3  259 ? 71.872 62.976  181.351 1.00 42.90  ? 259  ALA C CB  1 
ATOM   8675  N  N   . ASN C  3  260 ? 71.419 60.879  183.808 1.00 44.84  ? 260  ASN C N   1 
ATOM   8676  C  CA  . ASN C  3  260 ? 71.928 60.306  185.016 1.00 45.93  ? 260  ASN C CA  1 
ATOM   8677  C  C   . ASN C  3  260 ? 72.800 59.130  184.595 1.00 47.20  ? 260  ASN C C   1 
ATOM   8678  O  O   . ASN C  3  260 ? 72.280 58.063  184.286 1.00 47.56  ? 260  ASN C O   1 
ATOM   8679  C  CB  . ASN C  3  260 ? 70.758 59.815  185.874 1.00 45.77  ? 260  ASN C CB  1 
ATOM   8680  C  CG  . ASN C  3  260 ? 71.103 59.745  187.356 1.00 49.25  ? 260  ASN C CG  1 
ATOM   8681  O  OD1 . ASN C  3  260 ? 72.217 59.385  187.735 1.00 47.96  ? 260  ASN C OD1 1 
ATOM   8682  N  ND2 . ASN C  3  260 ? 70.139 60.093  188.201 1.00 45.12  ? 260  ASN C ND2 1 
ATOM   8683  N  N   . PRO C  3  261 ? 74.126 59.332  184.576 1.00 48.03  ? 261  PRO C N   1 
ATOM   8684  C  CA  . PRO C  3  261 ? 75.103 58.291  184.174 1.00 48.77  ? 261  PRO C CA  1 
ATOM   8685  C  C   . PRO C  3  261 ? 75.118 57.006  185.039 1.00 49.91  ? 261  PRO C C   1 
ATOM   8686  O  O   . PRO C  3  261 ? 75.925 56.101  184.773 1.00 50.04  ? 261  PRO C O   1 
ATOM   8687  C  CB  . PRO C  3  261 ? 76.452 59.004  184.310 1.00 48.72  ? 261  PRO C CB  1 
ATOM   8688  C  CG  . PRO C  3  261 ? 76.129 60.460  184.294 1.00 50.97  ? 261  PRO C CG  1 
ATOM   8689  C  CD  . PRO C  3  261 ? 74.785 60.596  184.934 1.00 48.30  ? 261  PRO C CD  1 
ATOM   8690  N  N   . LEU C  3  262 ? 74.255 56.936  186.053 1.00 50.68  ? 262  LEU C N   1 
ATOM   8691  C  CA  . LEU C  3  262 ? 74.186 55.770  186.923 1.00 51.48  ? 262  LEU C CA  1 
ATOM   8692  C  C   . LEU C  3  262 ? 72.840 55.063  186.717 1.00 52.50  ? 262  LEU C C   1 
ATOM   8693  O  O   . LEU C  3  262 ? 72.710 53.855  186.971 1.00 52.73  ? 262  LEU C O   1 
ATOM   8694  C  CB  . LEU C  3  262 ? 74.338 56.190  188.406 1.00 51.12  ? 262  LEU C CB  1 
ATOM   8695  C  CG  . LEU C  3  262 ? 75.388 57.269  188.771 1.00 45.52  ? 262  LEU C CG  1 
ATOM   8696  C  CD1 . LEU C  3  262 ? 75.200 57.783  190.198 1.00 42.07  ? 262  LEU C CD1 1 
ATOM   8697  C  CD2 . LEU C  3  262 ? 76.818 56.789  188.549 1.00 40.66  ? 262  LEU C CD2 1 
ATOM   8698  N  N   . ASN C  3  263 ? 71.844 55.823  186.246 1.00 52.90  ? 263  ASN C N   1 
ATOM   8699  C  CA  . ASN C  3  263 ? 70.488 55.292  186.026 1.00 53.14  ? 263  ASN C CA  1 
ATOM   8700  C  C   . ASN C  3  263 ? 70.243 54.853  184.558 1.00 53.49  ? 263  ASN C C   1 
ATOM   8701  O  O   . ASN C  3  263 ? 70.071 55.689  183.663 1.00 53.64  ? 263  ASN C O   1 
ATOM   8702  C  CB  . ASN C  3  263 ? 69.434 56.332  186.470 1.00 52.95  ? 263  ASN C CB  1 
ATOM   8703  C  CG  . ASN C  3  263 ? 68.028 55.724  186.672 1.00 50.22  ? 263  ASN C CG  1 
ATOM   8704  O  OD1 . ASN C  3  263 ? 67.832 54.497  186.609 1.00 43.78  ? 263  ASN C OD1 1 
ATOM   8705  N  ND2 . ASN C  3  263 ? 67.052 56.592  186.935 1.00 49.37  ? 263  ASN C ND2 1 
ATOM   8706  N  N   . THR C  3  264 ? 70.244 53.540  184.332 1.00 53.49  ? 264  THR C N   1 
ATOM   8707  C  CA  . THR C  3  264 ? 70.001 52.975  183.010 1.00 53.38  ? 264  THR C CA  1 
ATOM   8708  C  C   . THR C  3  264 ? 68.556 52.643  182.966 1.00 53.47  ? 264  THR C C   1 
ATOM   8709  O  O   . THR C  3  264 ? 68.097 51.799  183.718 1.00 53.48  ? 264  THR C O   1 
ATOM   8710  C  CB  . THR C  3  264 ? 70.751 51.662  182.856 1.00 53.33  ? 264  THR C CB  1 
ATOM   8711  O  OG1 . THR C  3  264 ? 71.721 51.528  183.902 1.00 56.25  ? 264  THR C OG1 1 
ATOM   8712  C  CG2 . THR C  3  264 ? 71.544 51.630  181.550 1.00 46.81  ? 264  THR C CG2 1 
ATOM   8713  N  N   . PRO C  3  265 ? 67.819 53.295  182.097 1.00 53.73  ? 265  PRO C N   1 
ATOM   8714  C  CA  . PRO C  3  265 ? 66.397 53.006  181.952 1.00 54.14  ? 265  PRO C CA  1 
ATOM   8715  C  C   . PRO C  3  265 ? 66.231 51.596  181.374 1.00 54.53  ? 265  PRO C C   1 
ATOM   8716  O  O   . PRO C  3  265 ? 67.120 51.141  180.641 1.00 54.53  ? 265  PRO C O   1 
ATOM   8717  C  CB  . PRO C  3  265 ? 65.937 54.039  180.919 1.00 54.11  ? 265  PRO C CB  1 
ATOM   8718  C  CG  . PRO C  3  265 ? 67.031 55.059  180.876 1.00 53.24  ? 265  PRO C CG  1 
ATOM   8719  C  CD  . PRO C  3  265 ? 68.277 54.343  181.180 1.00 53.49  ? 265  PRO C CD  1 
ATOM   8720  N  N   . PRO C  3  266 ? 65.174 50.883  181.775 1.00 54.85  ? 266  PRO C N   1 
ATOM   8721  C  CA  . PRO C  3  266 ? 64.869 49.549  181.215 1.00 54.83  ? 266  PRO C CA  1 
ATOM   8722  C  C   . PRO C  3  266 ? 64.645 49.658  179.706 1.00 54.88  ? 266  PRO C C   1 
ATOM   8723  O  O   . PRO C  3  266 ? 64.995 48.747  178.971 1.00 54.68  ? 266  PRO C O   1 
ATOM   8724  C  CB  . PRO C  3  266 ? 63.555 49.187  181.895 1.00 54.76  ? 266  PRO C CB  1 
ATOM   8725  C  CG  . PRO C  3  266 ? 63.560 49.984  183.176 1.00 55.28  ? 266  PRO C CG  1 
ATOM   8726  C  CD  . PRO C  3  266 ? 64.241 51.266  182.854 1.00 54.89  ? 266  PRO C CD  1 
ATOM   8727  N  N   . HIS C  3  267 ? 64.067 50.796  179.295 1.00 55.14  ? 267  HIS C N   1 
ATOM   8728  C  CA  . HIS C  3  267 ? 63.765 51.177  177.898 1.00 55.62  ? 267  HIS C CA  1 
ATOM   8729  C  C   . HIS C  3  267 ? 64.957 51.003  176.945 1.00 54.96  ? 267  HIS C C   1 
ATOM   8730  O  O   . HIS C  3  267 ? 65.238 49.910  176.447 1.00 55.45  ? 267  HIS C O   1 
ATOM   8731  C  CB  . HIS C  3  267 ? 63.445 52.684  177.888 1.00 56.40  ? 267  HIS C CB  1 
ATOM   8732  C  CG  . HIS C  3  267 ? 62.194 53.052  177.161 1.00 70.08  ? 267  HIS C CG  1 
ATOM   8733  N  ND1 . HIS C  3  267 ? 62.192 53.478  175.850 1.00 74.85  ? 267  HIS C ND1 1 
ATOM   8734  C  CD2 . HIS C  3  267 ? 60.914 53.151  177.590 1.00 74.22  ? 267  HIS C CD2 1 
ATOM   8735  C  CE1 . HIS C  3  267 ? 60.957 53.778  175.489 1.00 77.92  ? 267  HIS C CE1 1 
ATOM   8736  N  NE2 . HIS C  3  267 ? 60.162 53.587  176.526 1.00 80.04  ? 267  HIS C NE2 1 
ATOM   8737  N  N   . ILE C  3  268 ? 65.627 52.123  176.692 1.00 53.64  ? 268  ILE C N   1 
ATOM   8738  C  CA  . ILE C  3  268 ? 66.771 52.205  175.793 1.00 52.47  ? 268  ILE C CA  1 
ATOM   8739  C  C   . ILE C  3  268 ? 66.548 51.791  174.343 1.00 51.44  ? 268  ILE C C   1 
ATOM   8740  O  O   . ILE C  3  268 ? 66.779 50.636  173.945 1.00 51.58  ? 268  ILE C O   1 
ATOM   8741  C  CB  . ILE C  3  268 ? 68.048 51.690  176.411 1.00 52.30  ? 268  ILE C CB  1 
ATOM   8742  C  CG1 . ILE C  3  268 ? 68.273 52.424  177.729 1.00 55.71  ? 268  ILE C CG1 1 
ATOM   8743  C  CG2 . ILE C  3  268 ? 69.204 51.971  175.507 1.00 52.27  ? 268  ILE C CG2 1 
ATOM   8744  C  CD1 . ILE C  3  268 ? 69.557 52.096  178.412 1.00 59.88  ? 268  ILE C CD1 1 
ATOM   8745  N  N   . LYS C  3  269 ? 66.066 52.764  173.572 1.00 50.05  ? 269  LYS C N   1 
ATOM   8746  C  CA  . LYS C  3  269 ? 65.770 52.610  172.162 1.00 48.31  ? 269  LYS C CA  1 
ATOM   8747  C  C   . LYS C  3  269 ? 66.006 53.983  171.466 1.00 46.77  ? 269  LYS C C   1 
ATOM   8748  O  O   . LYS C  3  269 ? 66.040 55.025  172.114 1.00 46.53  ? 269  LYS C O   1 
ATOM   8749  C  CB  . LYS C  3  269 ? 64.298 52.142  171.985 1.00 48.21  ? 269  LYS C CB  1 
ATOM   8750  C  CG  . LYS C  3  269 ? 63.228 53.170  172.429 1.00 51.68  ? 269  LYS C CG  1 
ATOM   8751  C  CD  . LYS C  3  269 ? 61.808 52.657  172.154 1.00 56.03  ? 269  LYS C CD  1 
ATOM   8752  C  CE  . LYS C  3  269 ? 60.773 53.806  172.014 1.00 58.05  ? 269  LYS C CE  1 
ATOM   8753  N  NZ  . LYS C  3  269 ? 59.408 53.295  171.567 1.00 53.40  ? 269  LYS C NZ  1 
ATOM   8754  N  N   . PRO C  3  270 ? 66.259 53.962  170.171 1.00 45.60  ? 270  PRO C N   1 
ATOM   8755  C  CA  . PRO C  3  270 ? 66.439 55.182  169.394 1.00 43.60  ? 270  PRO C CA  1 
ATOM   8756  C  C   . PRO C  3  270 ? 65.182 55.969  169.194 1.00 41.71  ? 270  PRO C C   1 
ATOM   8757  O  O   . PRO C  3  270 ? 64.090 55.641  169.706 1.00 41.70  ? 270  PRO C O   1 
ATOM   8758  C  CB  . PRO C  3  270 ? 66.789 54.650  167.992 1.00 43.70  ? 270  PRO C CB  1 
ATOM   8759  C  CG  . PRO C  3  270 ? 67.061 53.253  168.112 1.00 42.75  ? 270  PRO C CG  1 
ATOM   8760  C  CD  . PRO C  3  270 ? 66.524 52.765  169.376 1.00 46.06  ? 270  PRO C CD  1 
ATOM   8761  N  N   . GLU C  3  271 ? 65.337 57.018  168.399 1.00 39.69  ? 271  GLU C N   1 
ATOM   8762  C  CA  . GLU C  3  271 ? 64.215 57.749  167.914 1.00 37.66  ? 271  GLU C CA  1 
ATOM   8763  C  C   . GLU C  3  271 ? 63.690 56.805  166.807 1.00 35.25  ? 271  GLU C C   1 
ATOM   8764  O  O   . GLU C  3  271 ? 64.459 56.033  166.224 1.00 34.34  ? 271  GLU C O   1 
ATOM   8765  C  CB  . GLU C  3  271 ? 64.664 59.084  167.335 1.00 37.86  ? 271  GLU C CB  1 
ATOM   8766  C  CG  . GLU C  3  271 ? 64.769 60.194  168.371 1.00 42.48  ? 271  GLU C CG  1 
ATOM   8767  C  CD  . GLU C  3  271 ? 63.414 60.545  168.968 1.00 45.63  ? 271  GLU C CD  1 
ATOM   8768  O  OE1 . GLU C  3  271 ? 63.184 60.271  170.167 1.00 44.61  ? 271  GLU C OE1 1 
ATOM   8769  O  OE2 . GLU C  3  271 ? 62.563 61.082  168.228 1.00 50.48  ? 271  GLU C OE2 1 
ATOM   8770  N  N   . TRP C  3  272 ? 62.394 56.852  166.548 1.00 33.90  ? 272  TRP C N   1 
ATOM   8771  C  CA  . TRP C  3  272 ? 61.757 55.944  165.601 1.00 32.76  ? 272  TRP C CA  1 
ATOM   8772  C  C   . TRP C  3  272 ? 62.428 55.727  164.223 1.00 32.26  ? 272  TRP C C   1 
ATOM   8773  O  O   . TRP C  3  272 ? 62.367 54.616  163.653 1.00 32.61  ? 272  TRP C O   1 
ATOM   8774  C  CB  . TRP C  3  272 ? 60.298 56.310  165.423 1.00 32.64  ? 272  TRP C CB  1 
ATOM   8775  C  CG  . TRP C  3  272 ? 60.108 57.586  164.710 1.00 35.23  ? 272  TRP C CG  1 
ATOM   8776  C  CD1 . TRP C  3  272 ? 60.060 58.826  165.259 1.00 38.97  ? 272  TRP C CD1 1 
ATOM   8777  C  CD2 . TRP C  3  272 ? 59.969 57.765  163.303 1.00 30.90  ? 272  TRP C CD2 1 
ATOM   8778  N  NE1 . TRP C  3  272 ? 59.875 59.768  164.281 1.00 37.01  ? 272  TRP C NE1 1 
ATOM   8779  C  CE2 . TRP C  3  272 ? 59.822 59.139  163.066 1.00 39.55  ? 272  TRP C CE2 1 
ATOM   8780  C  CE3 . TRP C  3  272 ? 59.934 56.893  162.209 1.00 28.17  ? 272  TRP C CE3 1 
ATOM   8781  C  CZ2 . TRP C  3  272 ? 59.639 59.669  161.776 1.00 37.58  ? 272  TRP C CZ2 1 
ATOM   8782  C  CZ3 . TRP C  3  272 ? 59.756 57.414  160.942 1.00 26.39  ? 272  TRP C CZ3 1 
ATOM   8783  C  CH2 . TRP C  3  272 ? 59.607 58.788  160.737 1.00 32.33  ? 272  TRP C CH2 1 
ATOM   8784  N  N   . TYR C  3  273 ? 63.052 56.775  163.688 1.00 30.93  ? 273  TYR C N   1 
ATOM   8785  C  CA  . TYR C  3  273 ? 63.679 56.689  162.402 1.00 30.13  ? 273  TYR C CA  1 
ATOM   8786  C  C   . TYR C  3  273 ? 64.904 55.752  162.277 1.00 29.73  ? 273  TYR C C   1 
ATOM   8787  O  O   . TYR C  3  273 ? 65.342 55.452  161.183 1.00 28.60  ? 273  TYR C O   1 
ATOM   8788  C  CB  . TYR C  3  273 ? 63.898 58.062  161.790 1.00 30.15  ? 273  TYR C CB  1 
ATOM   8789  C  CG  . TYR C  3  273 ? 64.239 59.180  162.782 1.00 25.35  ? 273  TYR C CG  1 
ATOM   8790  C  CD1 . TYR C  3  273 ? 63.247 60.034  163.276 1.00 22.71  ? 273  TYR C CD1 1 
ATOM   8791  C  CD2 . TYR C  3  273 ? 65.540 59.409  163.172 1.00 21.60  ? 273  TYR C CD2 1 
ATOM   8792  C  CE1 . TYR C  3  273 ? 63.551 61.057  164.154 1.00 16.55  ? 273  TYR C CE1 1 
ATOM   8793  C  CE2 . TYR C  3  273 ? 65.864 60.451  164.059 1.00 20.76  ? 273  TYR C CE2 1 
ATOM   8794  C  CZ  . TYR C  3  273 ? 64.874 61.269  164.536 1.00 19.43  ? 273  TYR C CZ  1 
ATOM   8795  O  OH  . TYR C  3  273 ? 65.195 62.285  165.429 1.00 19.51  ? 273  TYR C OH  1 
ATOM   8796  N  N   . PHE C  3  274 ? 65.397 55.250  163.404 1.00 30.79  ? 274  PHE C N   1 
ATOM   8797  C  CA  . PHE C  3  274 ? 66.521 54.291  163.398 1.00 31.74  ? 274  PHE C CA  1 
ATOM   8798  C  C   . PHE C  3  274 ? 66.084 52.898  163.894 1.00 31.93  ? 274  PHE C C   1 
ATOM   8799  O  O   . PHE C  3  274 ? 66.894 51.946  163.912 1.00 31.44  ? 274  PHE C O   1 
ATOM   8800  C  CB  . PHE C  3  274 ? 67.647 54.763  164.317 1.00 32.14  ? 274  PHE C CB  1 
ATOM   8801  C  CG  . PHE C  3  274 ? 68.254 56.068  163.936 1.00 38.28  ? 274  PHE C CG  1 
ATOM   8802  C  CD1 . PHE C  3  274 ? 69.222 56.134  162.958 1.00 43.31  ? 274  PHE C CD1 1 
ATOM   8803  C  CD2 . PHE C  3  274 ? 67.910 57.227  164.612 1.00 40.67  ? 274  PHE C CD2 1 
ATOM   8804  C  CE1 . PHE C  3  274 ? 69.834 57.343  162.646 1.00 47.17  ? 274  PHE C CE1 1 
ATOM   8805  C  CE2 . PHE C  3  274 ? 68.527 58.431  164.314 1.00 42.85  ? 274  PHE C CE2 1 
ATOM   8806  C  CZ  . PHE C  3  274 ? 69.465 58.494  163.315 1.00 45.20  ? 274  PHE C CZ  1 
ATOM   8807  N  N   . LEU C  3  275 ? 64.826 52.788  164.317 1.00 32.55  ? 275  LEU C N   1 
ATOM   8808  C  CA  . LEU C  3  275 ? 64.308 51.536  164.873 1.00 33.59  ? 275  LEU C CA  1 
ATOM   8809  C  C   . LEU C  3  275 ? 64.490 50.289  163.994 1.00 33.77  ? 275  LEU C C   1 
ATOM   8810  O  O   . LEU C  3  275 ? 64.807 49.213  164.509 1.00 33.31  ? 275  LEU C O   1 
ATOM   8811  C  CB  . LEU C  3  275 ? 62.853 51.695  165.335 1.00 34.25  ? 275  LEU C CB  1 
ATOM   8812  C  CG  . LEU C  3  275 ? 62.634 52.627  166.557 1.00 38.29  ? 275  LEU C CG  1 
ATOM   8813  C  CD1 . LEU C  3  275 ? 61.157 52.721  166.970 1.00 39.13  ? 275  LEU C CD1 1 
ATOM   8814  C  CD2 . LEU C  3  275 ? 63.441 52.169  167.706 1.00 34.16  ? 275  LEU C CD2 1 
ATOM   8815  N  N   . PHE C  3  276 ? 64.335 50.450  162.671 1.00 34.24  ? 276  PHE C N   1 
ATOM   8816  C  CA  . PHE C  3  276 ? 64.530 49.338  161.735 1.00 34.67  ? 276  PHE C CA  1 
ATOM   8817  C  C   . PHE C  3  276 ? 65.993 48.871  161.711 1.00 34.87  ? 276  PHE C C   1 
ATOM   8818  O  O   . PHE C  3  276 ? 66.271 47.668  161.680 1.00 35.09  ? 276  PHE C O   1 
ATOM   8819  C  CB  . PHE C  3  276 ? 64.051 49.706  160.310 1.00 35.18  ? 276  PHE C CB  1 
ATOM   8820  C  CG  . PHE C  3  276 ? 65.016 50.561  159.537 1.00 40.91  ? 276  PHE C CG  1 
ATOM   8821  C  CD1 . PHE C  3  276 ? 65.076 51.922  159.751 1.00 35.44  ? 276  PHE C CD1 1 
ATOM   8822  C  CD2 . PHE C  3  276 ? 65.873 49.990  158.592 1.00 42.62  ? 276  PHE C CD2 1 
ATOM   8823  C  CE1 . PHE C  3  276 ? 65.962 52.688  159.071 1.00 37.45  ? 276  PHE C CE1 1 
ATOM   8824  C  CE2 . PHE C  3  276 ? 66.773 50.755  157.923 1.00 36.16  ? 276  PHE C CE2 1 
ATOM   8825  C  CZ  . PHE C  3  276 ? 66.810 52.109  158.147 1.00 43.63  ? 276  PHE C CZ  1 
ATOM   8826  N  N   . ALA C  3  277 ? 66.915 49.830  161.761 1.00 35.05  ? 277  ALA C N   1 
ATOM   8827  C  CA  . ALA C  3  277 ? 68.333 49.541  161.743 1.00 35.60  ? 277  ALA C CA  1 
ATOM   8828  C  C   . ALA C  3  277 ? 68.727 48.963  163.074 1.00 36.09  ? 277  ALA C C   1 
ATOM   8829  O  O   . ALA C  3  277 ? 69.591 48.083  163.151 1.00 35.92  ? 277  ALA C O   1 
ATOM   8830  C  CB  . ALA C  3  277 ? 69.114 50.808  161.472 1.00 35.82  ? 277  ALA C CB  1 
ATOM   8831  N  N   . TYR C  3  278 ? 68.088 49.484  164.130 1.00 36.64  ? 278  TYR C N   1 
ATOM   8832  C  CA  . TYR C  3  278 ? 68.285 49.013  165.506 1.00 37.11  ? 278  TYR C CA  1 
ATOM   8833  C  C   . TYR C  3  278 ? 67.875 47.551  165.605 1.00 37.05  ? 278  TYR C C   1 
ATOM   8834  O  O   . TYR C  3  278 ? 68.576 46.741  166.228 1.00 36.39  ? 278  TYR C O   1 
ATOM   8835  C  CB  . TYR C  3  278 ? 67.425 49.835  166.461 1.00 37.34  ? 278  TYR C CB  1 
ATOM   8836  C  CG  . TYR C  3  278 ? 67.607 49.514  167.934 1.00 49.09  ? 278  TYR C CG  1 
ATOM   8837  C  CD1 . TYR C  3  278 ? 68.869 49.294  168.475 1.00 56.52  ? 278  TYR C CD1 1 
ATOM   8838  C  CD2 . TYR C  3  278 ? 66.515 49.457  168.792 1.00 50.32  ? 278  TYR C CD2 1 
ATOM   8839  C  CE1 . TYR C  3  278 ? 69.035 49.024  169.852 1.00 54.93  ? 278  TYR C CE1 1 
ATOM   8840  C  CE2 . TYR C  3  278 ? 66.679 49.219  170.155 1.00 52.06  ? 278  TYR C CE2 1 
ATOM   8841  C  CZ  . TYR C  3  278 ? 67.941 48.989  170.667 1.00 55.11  ? 278  TYR C CZ  1 
ATOM   8842  O  OH  . TYR C  3  278 ? 68.104 48.736  172.006 1.00 65.50  ? 278  TYR C OH  1 
ATOM   8843  N  N   . ALA C  3  279 ? 66.732 47.221  164.991 1.00 37.63  ? 279  ALA C N   1 
ATOM   8844  C  CA  . ALA C  3  279 ? 66.233 45.851  164.988 1.00 38.46  ? 279  ALA C CA  1 
ATOM   8845  C  C   . ALA C  3  279 ? 67.185 44.939  164.238 1.00 39.44  ? 279  ALA C C   1 
ATOM   8846  O  O   . ALA C  3  279 ? 67.433 43.832  164.661 1.00 39.64  ? 279  ALA C O   1 
ATOM   8847  C  CB  . ALA C  3  279 ? 64.880 45.783  164.385 1.00 38.29  ? 279  ALA C CB  1 
ATOM   8848  N  N   . ILE C  3  280 ? 67.717 45.413  163.120 1.00 40.21  ? 280  ILE C N   1 
ATOM   8849  C  CA  . ILE C  3  280 ? 68.655 44.618  162.364 1.00 41.22  ? 280  ILE C CA  1 
ATOM   8850  C  C   . ILE C  3  280 ? 69.937 44.372  163.178 1.00 42.67  ? 280  ILE C C   1 
ATOM   8851  O  O   . ILE C  3  280 ? 70.422 43.240  163.263 1.00 43.19  ? 280  ILE C O   1 
ATOM   8852  C  CB  . ILE C  3  280 ? 68.923 45.263  161.002 1.00 41.00  ? 280  ILE C CB  1 
ATOM   8853  C  CG1 . ILE C  3  280 ? 67.707 45.046  160.113 1.00 39.53  ? 280  ILE C CG1 1 
ATOM   8854  C  CG2 . ILE C  3  280 ? 70.172 44.670  160.346 1.00 37.13  ? 280  ILE C CG2 1 
ATOM   8855  C  CD1 . ILE C  3  280 ? 67.872 45.516  158.700 1.00 38.51  ? 280  ILE C CD1 1 
ATOM   8856  N  N   . LEU C  3  281 ? 70.416 45.421  163.848 1.00 43.59  ? 281  LEU C N   1 
ATOM   8857  C  CA  . LEU C  3  281 ? 71.620 45.347  164.694 1.00 44.02  ? 281  LEU C CA  1 
ATOM   8858  C  C   . LEU C  3  281 ? 71.525 44.247  165.778 1.00 44.11  ? 281  LEU C C   1 
ATOM   8859  O  O   . LEU C  3  281 ? 72.286 43.276  165.740 1.00 44.13  ? 281  LEU C O   1 
ATOM   8860  C  CB  . LEU C  3  281 ? 71.915 46.720  165.319 1.00 43.98  ? 281  LEU C CB  1 
ATOM   8861  C  CG  . LEU C  3  281 ? 72.785 46.810  166.570 1.00 45.50  ? 281  LEU C CG  1 
ATOM   8862  C  CD1 . LEU C  3  281 ? 74.145 46.365  166.298 1.00 45.85  ? 281  LEU C CD1 1 
ATOM   8863  C  CD2 . LEU C  3  281 ? 72.804 48.210  167.098 1.00 46.86  ? 281  LEU C CD2 1 
ATOM   8864  N  N   . ARG C  3  282 ? 70.544 44.353  166.674 1.00 44.18  ? 282  ARG C N   1 
ATOM   8865  C  CA  . ARG C  3  282 ? 70.415 43.374  167.764 1.00 44.70  ? 282  ARG C CA  1 
ATOM   8866  C  C   . ARG C  3  282 ? 69.917 41.945  167.394 1.00 44.88  ? 282  ARG C C   1 
ATOM   8867  O  O   . ARG C  3  282 ? 69.905 41.034  168.244 1.00 45.03  ? 282  ARG C O   1 
ATOM   8868  C  CB  . ARG C  3  282 ? 69.684 43.961  168.978 1.00 44.72  ? 282  ARG C CB  1 
ATOM   8869  C  CG  . ARG C  3  282 ? 68.336 44.503  168.684 1.00 45.80  ? 282  ARG C CG  1 
ATOM   8870  C  CD  . ARG C  3  282 ? 67.802 45.436  169.763 1.00 48.49  ? 282  ARG C CD  1 
ATOM   8871  N  NE  . ARG C  3  282 ? 66.381 45.685  169.554 1.00 52.89  ? 282  ARG C NE  1 
ATOM   8872  C  CZ  . ARG C  3  282 ? 65.541 46.121  170.487 1.00 53.19  ? 282  ARG C CZ  1 
ATOM   8873  N  NH1 . ARG C  3  282 ? 65.973 46.398  171.723 1.00 51.14  ? 282  ARG C NH1 1 
ATOM   8874  N  NH2 . ARG C  3  282 ? 64.270 46.313  170.175 1.00 50.53  ? 282  ARG C NH2 1 
ATOM   8875  N  N   . SER C  3  283 ? 69.585 41.747  166.123 1.00 44.84  ? 283  SER C N   1 
ATOM   8876  C  CA  . SER C  3  283 ? 69.158 40.443  165.623 1.00 45.01  ? 283  SER C CA  1 
ATOM   8877  C  C   . SER C  3  283 ? 70.342 39.514  165.527 1.00 44.82  ? 283  SER C C   1 
ATOM   8878  O  O   . SER C  3  283 ? 70.191 38.327  165.289 1.00 44.64  ? 283  SER C O   1 
ATOM   8879  C  CB  . SER C  3  283 ? 68.600 40.593  164.215 1.00 45.14  ? 283  SER C CB  1 
ATOM   8880  O  OG  . SER C  3  283 ? 67.620 41.599  164.157 1.00 57.02  ? 283  SER C OG  1 
ATOM   8881  N  N   . ILE C  3  284 ? 71.525 40.074  165.676 1.00 44.98  ? 284  ILE C N   1 
ATOM   8882  C  CA  . ILE C  3  284 ? 72.742 39.329  165.511 1.00 45.06  ? 284  ILE C CA  1 
ATOM   8883  C  C   . ILE C  3  284 ? 73.428 39.108  166.824 1.00 45.13  ? 284  ILE C C   1 
ATOM   8884  O  O   . ILE C  3  284 ? 73.711 40.055  167.553 1.00 44.75  ? 284  ILE C O   1 
ATOM   8885  C  CB  . ILE C  3  284 ? 73.669 40.075  164.513 1.00 45.04  ? 284  ILE C CB  1 
ATOM   8886  C  CG1 . ILE C  3  284 ? 72.896 40.399  163.239 1.00 44.61  ? 284  ILE C CG1 1 
ATOM   8887  C  CG2 . ILE C  3  284 ? 74.918 39.263  164.201 1.00 41.53  ? 284  ILE C CG2 1 
ATOM   8888  C  CD1 . ILE C  3  284 ? 73.749 40.550  162.052 1.00 52.58  ? 284  ILE C CD1 1 
ATOM   8889  N  N   . PRO C  3  285 ? 73.675 37.842  167.154 1.00 45.86  ? 285  PRO C N   1 
ATOM   8890  C  CA  . PRO C  3  285 ? 74.356 37.503  168.403 1.00 46.25  ? 285  PRO C CA  1 
ATOM   8891  C  C   . PRO C  3  285 ? 75.859 37.722  168.246 1.00 46.56  ? 285  PRO C C   1 
ATOM   8892  O  O   . PRO C  3  285 ? 76.637 36.785  168.472 1.00 47.10  ? 285  PRO C O   1 
ATOM   8893  C  CB  . PRO C  3  285 ? 74.054 35.998  168.576 1.00 45.80  ? 285  PRO C CB  1 
ATOM   8894  C  CG  . PRO C  3  285 ? 73.077 35.671  167.520 1.00 47.20  ? 285  PRO C CG  1 
ATOM   8895  C  CD  . PRO C  3  285 ? 73.300 36.638  166.398 1.00 45.85  ? 285  PRO C CD  1 
ATOM   8896  N  N   . ASN C  3  286 ? 76.249 38.929  167.825 1.00 45.89  ? 286  ASN C N   1 
ATOM   8897  C  CA  . ASN C  3  286 ? 77.649 39.282  167.664 1.00 45.37  ? 286  ASN C CA  1 
ATOM   8898  C  C   . ASN C  3  286 ? 77.844 40.781  167.676 1.00 45.12  ? 286  ASN C C   1 
ATOM   8899  O  O   . ASN C  3  286 ? 77.026 41.535  167.149 1.00 45.21  ? 286  ASN C O   1 
ATOM   8900  C  CB  . ASN C  3  286 ? 78.241 38.688  166.393 1.00 45.19  ? 286  ASN C CB  1 
ATOM   8901  C  CG  . ASN C  3  286 ? 79.749 38.572  166.459 1.00 43.88  ? 286  ASN C CG  1 
ATOM   8902  O  OD1 . ASN C  3  286 ? 80.471 39.570  166.359 1.00 42.28  ? 286  ASN C OD1 1 
ATOM   8903  N  ND2 . ASN C  3  286 ? 80.236 37.356  166.649 1.00 38.91  ? 286  ASN C ND2 1 
ATOM   8904  N  N   . LYS C  3  287 ? 78.945 41.196  168.280 1.00 44.80  ? 287  LYS C N   1 
ATOM   8905  C  CA  . LYS C  3  287 ? 79.306 42.587  168.420 1.00 44.32  ? 287  LYS C CA  1 
ATOM   8906  C  C   . LYS C  3  287 ? 79.713 43.173  167.053 1.00 43.74  ? 287  LYS C C   1 
ATOM   8907  O  O   . LYS C  3  287 ? 79.172 44.199  166.622 1.00 43.89  ? 287  LYS C O   1 
ATOM   8908  C  CB  . LYS C  3  287 ? 80.473 42.680  169.425 1.00 44.51  ? 287  LYS C CB  1 
ATOM   8909  C  CG  . LYS C  3  287 ? 80.918 44.079  169.850 1.00 44.53  ? 287  LYS C CG  1 
ATOM   8910  C  CD  . LYS C  3  287 ? 82.302 43.990  170.545 1.00 41.20  ? 287  LYS C CD  1 
ATOM   8911  C  CE  . LYS C  3  287 ? 82.751 45.314  171.139 1.00 37.48  ? 287  LYS C CE  1 
ATOM   8912  N  NZ  . LYS C  3  287 ? 81.738 45.883  172.034 1.00 30.83  ? 287  LYS C NZ  1 
ATOM   8913  N  N   . LEU C  3  288 ? 80.631 42.491  166.361 1.00 42.95  ? 288  LEU C N   1 
ATOM   8914  C  CA  . LEU C  3  288 ? 81.130 42.965  165.056 1.00 42.18  ? 288  LEU C CA  1 
ATOM   8915  C  C   . LEU C  3  288 ? 80.087 42.851  163.987 1.00 41.16  ? 288  LEU C C   1 
ATOM   8916  O  O   . LEU C  3  288 ? 79.807 43.807  163.294 1.00 41.35  ? 288  LEU C O   1 
ATOM   8917  C  CB  . LEU C  3  288 ? 82.389 42.192  164.626 1.00 42.40  ? 288  LEU C CB  1 
ATOM   8918  C  CG  . LEU C  3  288 ? 83.087 42.601  163.325 1.00 43.86  ? 288  LEU C CG  1 
ATOM   8919  C  CD1 . LEU C  3  288 ? 83.629 44.007  163.441 1.00 42.83  ? 288  LEU C CD1 1 
ATOM   8920  C  CD2 . LEU C  3  288 ? 84.209 41.620  162.969 1.00 42.56  ? 288  LEU C CD2 1 
ATOM   8921  N  N   . GLY C  3  289 ? 79.494 41.669  163.876 1.00 40.08  ? 289  GLY C N   1 
ATOM   8922  C  CA  . GLY C  3  289 ? 78.497 41.396  162.867 1.00 38.70  ? 289  GLY C CA  1 
ATOM   8923  C  C   . GLY C  3  289 ? 77.281 42.263  162.974 1.00 37.63  ? 289  GLY C C   1 
ATOM   8924  O  O   . GLY C  3  289 ? 76.697 42.620  161.976 1.00 37.36  ? 289  GLY C O   1 
ATOM   8925  N  N   . GLY C  3  290 ? 76.913 42.620  164.192 1.00 37.27  ? 290  GLY C N   1 
ATOM   8926  C  CA  . GLY C  3  290 ? 75.740 43.425  164.409 1.00 37.23  ? 290  GLY C CA  1 
ATOM   8927  C  C   . GLY C  3  290 ? 75.906 44.786  163.814 1.00 37.23  ? 290  GLY C C   1 
ATOM   8928  O  O   . GLY C  3  290 ? 75.015 45.307  163.155 1.00 37.17  ? 290  GLY C O   1 
ATOM   8929  N  N   . VAL C  3  291 ? 77.074 45.360  164.033 1.00 37.27  ? 291  VAL C N   1 
ATOM   8930  C  CA  . VAL C  3  291 ? 77.365 46.673  163.531 1.00 37.07  ? 291  VAL C CA  1 
ATOM   8931  C  C   . VAL C  3  291 ? 77.790 46.611  162.066 1.00 36.97  ? 291  VAL C C   1 
ATOM   8932  O  O   . VAL C  3  291 ? 77.677 47.600  161.337 1.00 37.54  ? 291  VAL C O   1 
ATOM   8933  C  CB  . VAL C  3  291 ? 78.426 47.412  164.413 1.00 36.94  ? 291  VAL C CB  1 
ATOM   8934  C  CG1 . VAL C  3  291 ? 79.784 46.794  164.265 1.00 37.00  ? 291  VAL C CG1 1 
ATOM   8935  C  CG2 . VAL C  3  291 ? 78.469 48.904  164.084 1.00 34.88  ? 291  VAL C CG2 1 
ATOM   8936  N  N   . LEU C  3  292 ? 78.244 45.444  161.621 1.00 35.98  ? 292  LEU C N   1 
ATOM   8937  C  CA  . LEU C  3  292 ? 78.645 45.307  160.250 1.00 35.26  ? 292  LEU C CA  1 
ATOM   8938  C  C   . LEU C  3  292 ? 77.351 45.255  159.452 1.00 35.59  ? 292  LEU C C   1 
ATOM   8939  O  O   . LEU C  3  292 ? 77.211 45.935  158.446 1.00 36.09  ? 292  LEU C O   1 
ATOM   8940  C  CB  . LEU C  3  292 ? 79.496 44.051  160.058 1.00 34.76  ? 292  LEU C CB  1 
ATOM   8941  C  CG  . LEU C  3  292 ? 80.775 44.117  159.203 1.00 31.43  ? 292  LEU C CG  1 
ATOM   8942  C  CD1 . LEU C  3  292 ? 81.679 45.287  159.570 1.00 26.90  ? 292  LEU C CD1 1 
ATOM   8943  C  CD2 . LEU C  3  292 ? 81.555 42.797  159.290 1.00 30.13  ? 292  LEU C CD2 1 
ATOM   8944  N  N   . ALA C  3  293 ? 76.362 44.536  159.970 1.00 35.61  ? 293  ALA C N   1 
ATOM   8945  C  CA  . ALA C  3  293 ? 75.075 44.437  159.296 1.00 35.61  ? 293  ALA C CA  1 
ATOM   8946  C  C   . ALA C  3  293 ? 74.221 45.661  159.501 1.00 35.79  ? 293  ALA C C   1 
ATOM   8947  O  O   . ALA C  3  293 ? 73.299 45.900  158.733 1.00 36.04  ? 293  ALA C O   1 
ATOM   8948  C  CB  . ALA C  3  293 ? 74.343 43.223  159.724 1.00 35.80  ? 293  ALA C CB  1 
ATOM   8949  N  N   . LEU C  3  294 ? 74.493 46.419  160.563 1.00 35.85  ? 294  LEU C N   1 
ATOM   8950  C  CA  . LEU C  3  294 ? 73.747 47.658  160.817 1.00 35.76  ? 294  LEU C CA  1 
ATOM   8951  C  C   . LEU C  3  294 ? 74.112 48.636  159.708 1.00 36.06  ? 294  LEU C C   1 
ATOM   8952  O  O   . LEU C  3  294 ? 73.240 49.239  159.054 1.00 36.50  ? 294  LEU C O   1 
ATOM   8953  C  CB  . LEU C  3  294 ? 74.130 48.251  162.168 1.00 35.30  ? 294  LEU C CB  1 
ATOM   8954  C  CG  . LEU C  3  294 ? 73.792 49.729  162.350 1.00 35.36  ? 294  LEU C CG  1 
ATOM   8955  C  CD1 . LEU C  3  294 ? 72.412 49.909  162.900 1.00 35.31  ? 294  LEU C CD1 1 
ATOM   8956  C  CD2 . LEU C  3  294 ? 74.812 50.403  163.229 1.00 29.96  ? 294  LEU C CD2 1 
ATOM   8957  N  N   . ALA C  3  295 ? 75.406 48.767  159.490 1.00 35.69  ? 295  ALA C N   1 
ATOM   8958  C  CA  . ALA C  3  295 ? 75.918 49.623  158.468 1.00 35.59  ? 295  ALA C CA  1 
ATOM   8959  C  C   . ALA C  3  295 ? 75.380 49.177  157.118 1.00 35.99  ? 295  ALA C C   1 
ATOM   8960  O  O   . ALA C  3  295 ? 74.790 49.975  156.390 1.00 36.01  ? 295  ALA C O   1 
ATOM   8961  C  CB  . ALA C  3  295 ? 77.463 49.579  158.466 1.00 35.17  ? 295  ALA C CB  1 
ATOM   8962  N  N   . PHE C  3  296 ? 75.530 47.880  156.819 1.00 36.17  ? 296  PHE C N   1 
ATOM   8963  C  CA  . PHE C  3  296 ? 75.108 47.319  155.527 1.00 36.31  ? 296  PHE C CA  1 
ATOM   8964  C  C   . PHE C  3  296 ? 73.611 47.520  155.219 1.00 35.70  ? 296  PHE C C   1 
ATOM   8965  O  O   . PHE C  3  296 ? 73.234 47.531  154.079 1.00 35.69  ? 296  PHE C O   1 
ATOM   8966  C  CB  . PHE C  3  296 ? 75.511 45.823  155.414 1.00 36.85  ? 296  PHE C CB  1 
ATOM   8967  C  CG  . PHE C  3  296 ? 75.644 45.301  153.957 1.00 48.25  ? 296  PHE C CG  1 
ATOM   8968  C  CD1 . PHE C  3  296 ? 74.694 44.422  153.417 1.00 44.86  ? 296  PHE C CD1 1 
ATOM   8969  C  CD2 . PHE C  3  296 ? 76.745 45.641  153.168 1.00 54.75  ? 296  PHE C CD2 1 
ATOM   8970  C  CE1 . PHE C  3  296 ? 74.814 43.923  152.103 1.00 36.24  ? 296  PHE C CE1 1 
ATOM   8971  C  CE2 . PHE C  3  296 ? 76.862 45.137  151.845 1.00 53.17  ? 296  PHE C CE2 1 
ATOM   8972  C  CZ  . PHE C  3  296 ? 75.884 44.271  151.334 1.00 44.08  ? 296  PHE C CZ  1 
ATOM   8973  N  N   . SER C  3  297 ? 72.783 47.736  156.247 1.00 35.42  ? 297  SER C N   1 
ATOM   8974  C  CA  . SER C  3  297 ? 71.330 47.935  156.034 1.00 35.13  ? 297  SER C CA  1 
ATOM   8975  C  C   . SER C  3  297 ? 71.029 49.316  155.444 1.00 34.93  ? 297  SER C C   1 
ATOM   8976  O  O   . SER C  3  297 ? 69.915 49.588  154.933 1.00 34.42  ? 297  SER C O   1 
ATOM   8977  C  CB  . SER C  3  297 ? 70.534 47.703  157.313 1.00 34.63  ? 297  SER C CB  1 
ATOM   8978  O  OG  . SER C  3  297 ? 70.569 48.823  158.152 1.00 36.35  ? 297  SER C OG  1 
ATOM   8979  N  N   . ILE C  3  298 ? 72.012 50.188  155.526 1.00 35.03  ? 298  ILE C N   1 
ATOM   8980  C  CA  . ILE C  3  298 ? 71.888 51.491  154.930 1.00 35.28  ? 298  ILE C CA  1 
ATOM   8981  C  C   . ILE C  3  298 ? 72.712 51.634  153.678 1.00 34.53  ? 298  ILE C C   1 
ATOM   8982  O  O   . ILE C  3  298 ? 72.186 52.047  152.645 1.00 34.68  ? 298  ILE C O   1 
ATOM   8983  C  CB  . ILE C  3  298 ? 72.134 52.607  155.943 1.00 35.99  ? 298  ILE C CB  1 
ATOM   8984  C  CG1 . ILE C  3  298 ? 70.794 53.142  156.398 1.00 49.38  ? 298  ILE C CG1 1 
ATOM   8985  C  CG2 . ILE C  3  298 ? 72.889 53.744  155.324 1.00 44.13  ? 298  ILE C CG2 1 
ATOM   8986  C  CD1 . ILE C  3  298 ? 69.871 53.397  155.242 1.00 56.78  ? 298  ILE C CD1 1 
ATOM   8987  N  N   . LEU C  3  299 ? 73.965 51.171  153.725 1.00 34.12  ? 299  LEU C N   1 
ATOM   8988  C  CA  . LEU C  3  299 ? 74.871 51.267  152.570 1.00 34.29  ? 299  LEU C CA  1 
ATOM   8989  C  C   . LEU C  3  299 ? 74.467 50.389  151.391 1.00 34.84  ? 299  LEU C C   1 
ATOM   8990  O  O   . LEU C  3  299 ? 75.091 50.454  150.323 1.00 35.14  ? 299  LEU C O   1 
ATOM   8991  C  CB  . LEU C  3  299 ? 76.299 50.931  152.965 1.00 33.97  ? 299  LEU C CB  1 
ATOM   8992  C  CG  . LEU C  3  299 ? 76.976 51.903  153.897 1.00 40.05  ? 299  LEU C CG  1 
ATOM   8993  C  CD1 . LEU C  3  299 ? 78.365 51.395  154.294 1.00 41.66  ? 299  LEU C CD1 1 
ATOM   8994  C  CD2 . LEU C  3  299 ? 77.061 53.259  153.243 1.00 39.75  ? 299  LEU C CD2 1 
ATOM   8995  N  N   . ILE C  3  300 ? 73.432 49.561  151.582 1.00 34.60  ? 300  ILE C N   1 
ATOM   8996  C  CA  . ILE C  3  300 ? 72.971 48.670  150.545 1.00 34.19  ? 300  ILE C CA  1 
ATOM   8997  C  C   . ILE C  3  300 ? 72.337 49.446  149.396 1.00 34.36  ? 300  ILE C C   1 
ATOM   8998  O  O   . ILE C  3  300 ? 72.331 48.980  148.248 1.00 34.31  ? 300  ILE C O   1 
ATOM   8999  C  CB  . ILE C  3  300 ? 72.006 47.629  151.129 1.00 34.25  ? 300  ILE C CB  1 
ATOM   9000  C  CG1 . ILE C  3  300 ? 71.706 46.520  150.110 1.00 27.82  ? 300  ILE C CG1 1 
ATOM   9001  C  CG2 . ILE C  3  300 ? 70.736 48.303  151.678 1.00 36.15  ? 300  ILE C CG2 1 
ATOM   9002  C  CD1 . ILE C  3  300 ? 71.409 45.250  150.714 1.00 31.66  ? 300  ILE C CD1 1 
ATOM   9003  N  N   . LEU C  3  301 ? 71.866 50.664  149.691 1.00 34.61  ? 301  LEU C N   1 
ATOM   9004  C  CA  . LEU C  3  301 ? 71.269 51.527  148.681 1.00 34.64  ? 301  LEU C CA  1 
ATOM   9005  C  C   . LEU C  3  301 ? 72.279 51.829  147.592 1.00 35.00  ? 301  LEU C C   1 
ATOM   9006  O  O   . LEU C  3  301 ? 71.914 52.198  146.500 1.00 35.58  ? 301  LEU C O   1 
ATOM   9007  C  CB  . LEU C  3  301 ? 70.815 52.827  149.299 1.00 34.70  ? 301  LEU C CB  1 
ATOM   9008  C  CG  . LEU C  3  301 ? 69.760 52.794  150.381 1.00 33.34  ? 301  LEU C CG  1 
ATOM   9009  C  CD1 . LEU C  3  301 ? 69.637 54.200  150.960 1.00 23.77  ? 301  LEU C CD1 1 
ATOM   9010  C  CD2 . LEU C  3  301 ? 68.465 52.334  149.813 1.00 20.75  ? 301  LEU C CD2 1 
ATOM   9011  N  N   . ALA C  3  302 ? 73.561 51.693  147.910 1.00 34.88  ? 302  ALA C N   1 
ATOM   9012  C  CA  . ALA C  3  302 ? 74.593 51.907  146.939 1.00 35.00  ? 302  ALA C CA  1 
ATOM   9013  C  C   . ALA C  3  302 ? 74.790 50.663  146.071 1.00 36.10  ? 302  ALA C C   1 
ATOM   9014  O  O   . ALA C  3  302 ? 75.452 50.725  145.062 1.00 36.69  ? 302  ALA C O   1 
ATOM   9015  C  CB  . ALA C  3  302 ? 75.873 52.306  147.598 1.00 34.67  ? 302  ALA C CB  1 
ATOM   9016  N  N   . LEU C  3  303 ? 74.218 49.530  146.473 1.00 36.72  ? 303  LEU C N   1 
ATOM   9017  C  CA  . LEU C  3  303 ? 74.332 48.314  145.673 1.00 37.22  ? 303  LEU C CA  1 
ATOM   9018  C  C   . LEU C  3  303 ? 73.147 48.159  144.762 1.00 37.58  ? 303  LEU C C   1 
ATOM   9019  O  O   . LEU C  3  303 ? 73.232 47.466  143.725 1.00 37.46  ? 303  LEU C O   1 
ATOM   9020  C  CB  . LEU C  3  303 ? 74.464 47.066  146.539 1.00 37.46  ? 303  LEU C CB  1 
ATOM   9021  C  CG  . LEU C  3  303 ? 75.803 46.812  147.234 1.00 50.49  ? 303  LEU C CG  1 
ATOM   9022  C  CD1 . LEU C  3  303 ? 75.971 45.288  147.456 1.00 45.95  ? 303  LEU C CD1 1 
ATOM   9023  C  CD2 . LEU C  3  303 ? 77.020 47.399  146.439 1.00 42.20  ? 303  LEU C CD2 1 
ATOM   9024  N  N   . ILE C  3  304 ? 72.032 48.797  145.134 1.00 37.77  ? 304  ILE C N   1 
ATOM   9025  C  CA  . ILE C  3  304 ? 70.799 48.712  144.331 1.00 38.01  ? 304  ILE C CA  1 
ATOM   9026  C  C   . ILE C  3  304 ? 70.926 48.851  142.780 1.00 38.96  ? 304  ILE C C   1 
ATOM   9027  O  O   . ILE C  3  304 ? 70.596 47.917  142.090 1.00 39.92  ? 304  ILE C O   1 
ATOM   9028  C  CB  . ILE C  3  304 ? 69.625 49.487  144.959 1.00 37.53  ? 304  ILE C CB  1 
ATOM   9029  C  CG1 . ILE C  3  304 ? 69.148 48.748  146.223 1.00 40.46  ? 304  ILE C CG1 1 
ATOM   9030  C  CG2 . ILE C  3  304 ? 68.501 49.640  143.967 1.00 28.92  ? 304  ILE C CG2 1 
ATOM   9031  C  CD1 . ILE C  3  304 ? 68.042 49.428  146.955 1.00 39.71  ? 304  ILE C CD1 1 
ATOM   9032  N  N   . PRO C  3  305 ? 71.485 49.952  142.246 1.00 39.08  ? 305  PRO C N   1 
ATOM   9033  C  CA  . PRO C  3  305 ? 71.668 50.059  140.791 1.00 39.02  ? 305  PRO C CA  1 
ATOM   9034  C  C   . PRO C  3  305 ? 72.417 48.869  140.168 1.00 38.86  ? 305  PRO C C   1 
ATOM   9035  O  O   . PRO C  3  305 ? 72.209 48.625  138.995 1.00 38.98  ? 305  PRO C O   1 
ATOM   9036  C  CB  . PRO C  3  305 ? 72.527 51.336  140.634 1.00 38.66  ? 305  PRO C CB  1 
ATOM   9037  C  CG  . PRO C  3  305 ? 72.163 52.151  141.786 1.00 42.87  ? 305  PRO C CG  1 
ATOM   9038  C  CD  . PRO C  3  305 ? 71.958 51.176  142.934 1.00 38.98  ? 305  PRO C CD  1 
ATOM   9039  N  N   . LEU C  3  306 ? 73.260 48.152  140.926 1.00 38.42  ? 306  LEU C N   1 
ATOM   9040  C  CA  . LEU C  3  306 ? 73.990 47.020  140.349 1.00 38.41  ? 306  LEU C CA  1 
ATOM   9041  C  C   . LEU C  3  306 ? 73.133 45.759  140.319 1.00 38.79  ? 306  LEU C C   1 
ATOM   9042  O  O   . LEU C  3  306 ? 73.429 44.790  139.612 1.00 38.63  ? 306  LEU C O   1 
ATOM   9043  C  CB  . LEU C  3  306 ? 75.308 46.776  141.072 1.00 38.55  ? 306  LEU C CB  1 
ATOM   9044  C  CG  . LEU C  3  306 ? 76.223 48.033  141.275 1.00 51.83  ? 306  LEU C CG  1 
ATOM   9045  C  CD1 . LEU C  3  306 ? 77.503 47.719  142.086 1.00 47.17  ? 306  LEU C CD1 1 
ATOM   9046  C  CD2 . LEU C  3  306 ? 76.586 48.738  139.945 1.00 53.06  ? 306  LEU C CD2 1 
ATOM   9047  N  N   . LEU C  3  307 ? 72.023 45.811  141.025 1.00 38.98  ? 307  LEU C N   1 
ATOM   9048  C  CA  . LEU C  3  307 ? 71.149 44.695  141.122 1.00 38.96  ? 307  LEU C CA  1 
ATOM   9049  C  C   . LEU C  3  307 ? 69.894 44.896  140.311 1.00 38.90  ? 307  LEU C C   1 
ATOM   9050  O  O   . LEU C  3  307 ? 68.895 44.138  140.483 1.00 39.30  ? 307  LEU C O   1 
ATOM   9051  C  CB  . LEU C  3  307 ? 70.800 44.439  142.583 1.00 39.17  ? 307  LEU C CB  1 
ATOM   9052  C  CG  . LEU C  3  307 ? 71.999 44.239  143.491 1.00 34.08  ? 307  LEU C CG  1 
ATOM   9053  C  CD1 . LEU C  3  307 ? 71.620 44.519  144.919 1.00 41.50  ? 307  LEU C CD1 1 
ATOM   9054  C  CD2 . LEU C  3  307 ? 72.602 42.837  143.330 1.00 41.07  ? 307  LEU C CD2 1 
ATOM   9055  N  N   . HIS C  3  308 ? 69.890 45.941  139.475 1.00 38.11  ? 308  HIS C N   1 
ATOM   9056  C  CA  . HIS C  3  308 ? 68.758 46.162  138.589 1.00 37.35  ? 308  HIS C CA  1 
ATOM   9057  C  C   . HIS C  3  308 ? 68.905 45.123  137.508 1.00 37.00  ? 308  HIS C C   1 
ATOM   9058  O  O   . HIS C  3  308 ? 69.968 44.972  136.904 1.00 37.40  ? 308  HIS C O   1 
ATOM   9059  C  CB  . HIS C  3  308 ? 68.746 47.543  137.994 1.00 37.20  ? 308  HIS C CB  1 
ATOM   9060  C  CG  . HIS C  3  308 ? 67.490 47.852  137.240 1.00 35.70  ? 308  HIS C CG  1 
ATOM   9061  N  ND1 . HIS C  3  308 ? 66.383 48.420  137.838 1.00 33.23  ? 308  HIS C ND1 1 
ATOM   9062  C  CD2 . HIS C  3  308 ? 67.140 47.611  135.955 1.00 28.30  ? 308  HIS C CD2 1 
ATOM   9063  C  CE1 . HIS C  3  308 ? 65.430 48.570  136.939 1.00 30.68  ? 308  HIS C CE1 1 
ATOM   9064  N  NE2 . HIS C  3  308 ? 65.857 48.070  135.793 1.00 33.14  ? 308  HIS C NE2 1 
ATOM   9065  N  N   . THR C  3  309 ? 67.834 44.436  137.222 1.00 35.86  ? 309  THR C N   1 
ATOM   9066  C  CA  . THR C  3  309 ? 67.942 43.323  136.375 1.00 34.63  ? 309  THR C CA  1 
ATOM   9067  C  C   . THR C  3  309 ? 66.852 43.349  135.293 1.00 33.84  ? 309  THR C C   1 
ATOM   9068  O  O   . THR C  3  309 ? 66.995 42.761  134.229 1.00 33.01  ? 309  THR C O   1 
ATOM   9069  C  CB  . THR C  3  309 ? 67.859 42.082  137.308 1.00 34.48  ? 309  THR C CB  1 
ATOM   9070  O  OG1 . THR C  3  309 ? 68.794 41.084  136.922 1.00 35.53  ? 309  THR C OG1 1 
ATOM   9071  C  CG2 . THR C  3  309 ? 66.605 41.457  137.237 1.00 21.38  ? 309  THR C CG2 1 
ATOM   9072  N  N   . SER C  3  310 ? 65.821 44.127  135.547 1.00 34.45  ? 310  SER C N   1 
ATOM   9073  C  CA  . SER C  3  310 ? 64.705 44.257  134.641 1.00 35.51  ? 310  SER C CA  1 
ATOM   9074  C  C   . SER C  3  310 ? 65.012 45.105  133.381 1.00 36.26  ? 310  SER C C   1 
ATOM   9075  O  O   . SER C  3  310 ? 65.789 46.058  133.421 1.00 36.73  ? 310  SER C O   1 
ATOM   9076  C  CB  . SER C  3  310 ? 63.534 44.875  135.385 1.00 35.77  ? 310  SER C CB  1 
ATOM   9077  O  OG  . SER C  3  310 ? 62.639 45.506  134.494 1.00 43.98  ? 310  SER C OG  1 
ATOM   9078  N  N   . LYS C  3  311 ? 64.365 44.760  132.281 1.00 36.28  ? 311  LYS C N   1 
ATOM   9079  C  CA  . LYS C  3  311 ? 64.524 45.505  131.065 1.00 36.12  ? 311  LYS C CA  1 
ATOM   9080  C  C   . LYS C  3  311 ? 63.698 46.803  131.056 1.00 35.95  ? 311  LYS C C   1 
ATOM   9081  O  O   . LYS C  3  311 ? 63.928 47.677  130.243 1.00 36.44  ? 311  LYS C O   1 
ATOM   9082  C  CB  . LYS C  3  311 ? 64.315 44.618  129.812 1.00 36.31  ? 311  LYS C CB  1 
ATOM   9083  C  CG  . LYS C  3  311 ? 65.584 43.741  129.491 1.00 42.08  ? 311  LYS C CG  1 
ATOM   9084  C  CD  . LYS C  3  311 ? 65.605 43.147  128.102 1.00 36.13  ? 311  LYS C CD  1 
ATOM   9085  C  CE  . LYS C  3  311 ? 65.525 44.206  127.039 1.00 39.09  ? 311  LYS C CE  1 
ATOM   9086  N  NZ  . LYS C  3  311 ? 65.837 43.644  125.663 1.00 43.10  ? 311  LYS C NZ  1 
ATOM   9087  N  N   . GLN C  3  312 ? 62.742 46.915  131.967 1.00 35.65  ? 312  GLN C N   1 
ATOM   9088  C  CA  . GLN C  3  312 ? 61.970 48.157  132.139 1.00 35.45  ? 312  GLN C CA  1 
ATOM   9089  C  C   . GLN C  3  312 ? 62.552 48.907  133.358 1.00 36.43  ? 312  GLN C C   1 
ATOM   9090  O  O   . GLN C  3  312 ? 63.162 48.298  134.245 1.00 36.99  ? 312  GLN C O   1 
ATOM   9091  C  CB  . GLN C  3  312 ? 60.495 47.865  132.346 1.00 34.73  ? 312  GLN C CB  1 
ATOM   9092  C  CG  . GLN C  3  312 ? 59.840 47.282  131.141 1.00 28.47  ? 312  GLN C CG  1 
ATOM   9093  C  CD  . GLN C  3  312 ? 58.672 46.364  131.471 1.00 37.71  ? 312  GLN C CD  1 
ATOM   9094  O  OE1 . GLN C  3  312 ? 57.531 46.628  131.070 1.00 43.51  ? 312  GLN C OE1 1 
ATOM   9095  N  NE2 . GLN C  3  312 ? 58.953 45.273  132.188 1.00 41.69  ? 312  GLN C NE2 1 
ATOM   9096  N  N   . ARG C  3  313 ? 62.360 50.216  133.403 1.00 36.60  ? 313  ARG C N   1 
ATOM   9097  C  CA  . ARG C  3  313 ? 62.934 51.029  134.467 1.00 35.91  ? 313  ARG C CA  1 
ATOM   9098  C  C   . ARG C  3  313 ? 62.060 51.128  135.694 1.00 35.95  ? 313  ARG C C   1 
ATOM   9099  O  O   . ARG C  3  313 ? 62.534 50.936  136.804 1.00 36.49  ? 313  ARG C O   1 
ATOM   9100  C  CB  . ARG C  3  313 ? 63.218 52.403  133.949 1.00 35.57  ? 313  ARG C CB  1 
ATOM   9101  C  CG  . ARG C  3  313 ? 63.991 53.275  134.886 1.00 35.35  ? 313  ARG C CG  1 
ATOM   9102  C  CD  . ARG C  3  313 ? 64.271 54.601  134.313 1.00 30.50  ? 313  ARG C CD  1 
ATOM   9103  N  NE  . ARG C  3  313 ? 64.938 55.478  135.244 1.00 40.14  ? 313  ARG C NE  1 
ATOM   9104  C  CZ  . ARG C  3  313 ? 65.257 56.739  134.968 1.00 39.14  ? 313  ARG C CZ  1 
ATOM   9105  N  NH1 . ARG C  3  313 ? 64.964 57.263  133.768 1.00 35.48  ? 313  ARG C NH1 1 
ATOM   9106  N  NH2 . ARG C  3  313 ? 65.880 57.463  135.872 1.00 31.40  ? 313  ARG C NH2 1 
ATOM   9107  N  N   . SER C  3  314 ? 60.773 51.385  135.495 1.00 35.05  ? 314  SER C N   1 
ATOM   9108  C  CA  . SER C  3  314 ? 59.862 51.583  136.608 1.00 34.50  ? 314  SER C CA  1 
ATOM   9109  C  C   . SER C  3  314 ? 59.197 50.293  137.050 1.00 35.22  ? 314  SER C C   1 
ATOM   9110  O  O   . SER C  3  314 ? 59.442 49.238  136.478 1.00 35.71  ? 314  SER C O   1 
ATOM   9111  C  CB  . SER C  3  314 ? 58.813 52.586  136.182 1.00 34.05  ? 314  SER C CB  1 
ATOM   9112  O  OG  . SER C  3  314 ? 57.809 52.745  137.145 1.00 21.67  ? 314  SER C OG  1 
ATOM   9113  N  N   . MET C  3  315 ? 58.359 50.359  138.075 1.00 35.45  ? 315  MET C N   1 
ATOM   9114  C  CA  . MET C  3  315 ? 57.637 49.162  138.490 1.00 36.03  ? 315  MET C CA  1 
ATOM   9115  C  C   . MET C  3  315 ? 56.196 49.201  138.057 1.00 36.04  ? 315  MET C C   1 
ATOM   9116  O  O   . MET C  3  315 ? 55.484 48.181  138.157 1.00 36.94  ? 315  MET C O   1 
ATOM   9117  C  CB  . MET C  3  315 ? 57.751 48.881  139.982 1.00 36.27  ? 315  MET C CB  1 
ATOM   9118  C  CG  . MET C  3  315 ? 59.035 48.181  140.373 1.00 41.08  ? 315  MET C CG  1 
ATOM   9119  S  SD  . MET C  3  315 ? 59.156 47.817  142.166 1.00 35.70  ? 315  MET C SD  1 
ATOM   9120  C  CE  . MET C  3  315 ? 60.956 47.595  142.290 1.00 23.99  ? 315  MET C CE  1 
ATOM   9121  N  N   . MET C  3  316 ? 55.772 50.353  137.537 1.00 34.73  ? 316  MET C N   1 
ATOM   9122  C  CA  . MET C  3  316 ? 54.411 50.554  137.024 1.00 34.59  ? 316  MET C CA  1 
ATOM   9123  C  C   . MET C  3  316 ? 53.875 49.383  136.212 1.00 34.65  ? 316  MET C C   1 
ATOM   9124  O  O   . MET C  3  316 ? 52.746 49.011  136.364 1.00 34.84  ? 316  MET C O   1 
ATOM   9125  C  CB  . MET C  3  316 ? 54.370 51.800  136.158 1.00 35.26  ? 316  MET C CB  1 
ATOM   9126  C  CG  . MET C  3  316 ? 53.099 51.997  135.382 1.00 35.84  ? 316  MET C CG  1 
ATOM   9127  S  SD  . MET C  3  316 ? 52.757 53.720  135.174 1.00 37.48  ? 316  MET C SD  1 
ATOM   9128  C  CE  . MET C  3  316 ? 51.016 53.650  134.597 1.00 40.77  ? 316  MET C CE  1 
ATOM   9129  N  N   . PHE C  3  317 ? 54.705 48.814  135.346 1.00 34.78  ? 317  PHE C N   1 
ATOM   9130  C  CA  . PHE C  3  317 ? 54.292 47.700  134.528 1.00 34.52  ? 317  PHE C CA  1 
ATOM   9131  C  C   . PHE C  3  317 ? 54.809 46.370  135.055 1.00 34.67  ? 317  PHE C C   1 
ATOM   9132  O  O   . PHE C  3  317 ? 54.711 45.362  134.386 1.00 35.00  ? 317  PHE C O   1 
ATOM   9133  C  CB  . PHE C  3  317 ? 54.718 47.880  133.054 1.00 34.88  ? 317  PHE C CB  1 
ATOM   9134  C  CG  . PHE C  3  317 ? 54.346 49.229  132.455 1.00 32.59  ? 317  PHE C CG  1 
ATOM   9135  C  CD1 . PHE C  3  317 ? 53.028 49.650  132.427 1.00 30.43  ? 317  PHE C CD1 1 
ATOM   9136  C  CD2 . PHE C  3  317 ? 55.329 50.069  131.936 1.00 28.79  ? 317  PHE C CD2 1 
ATOM   9137  C  CE1 . PHE C  3  317 ? 52.685 50.901  131.896 1.00 31.47  ? 317  PHE C CE1 1 
ATOM   9138  C  CE2 . PHE C  3  317 ? 54.998 51.324  131.390 1.00 33.00  ? 317  PHE C CE2 1 
ATOM   9139  C  CZ  . PHE C  3  317 ? 53.675 51.736  131.376 1.00 34.83  ? 317  PHE C CZ  1 
ATOM   9140  N  N   . ARG C  3  318 ? 55.395 46.348  136.228 1.00 34.51  ? 318  ARG C N   1 
ATOM   9141  C  CA  . ARG C  3  318 ? 55.807 45.060  136.739 1.00 34.85  ? 318  ARG C CA  1 
ATOM   9142  C  C   . ARG C  3  318 ? 55.159 44.549  138.087 1.00 35.75  ? 318  ARG C C   1 
ATOM   9143  O  O   . ARG C  3  318 ? 55.605 44.905  139.196 1.00 36.68  ? 318  ARG C O   1 
ATOM   9144  C  CB  . ARG C  3  318 ? 57.284 44.768  136.550 1.00 34.33  ? 318  ARG C CB  1 
ATOM   9145  C  CG  . ARG C  3  318 ? 58.145 45.923  136.420 1.00 38.35  ? 318  ARG C CG  1 
ATOM   9146  C  CD  . ARG C  3  318 ? 59.608 45.562  136.357 1.00 36.80  ? 318  ARG C CD  1 
ATOM   9147  N  NE  . ARG C  3  318 ? 60.438 46.702  136.675 1.00 37.72  ? 318  ARG C NE  1 
ATOM   9148  C  CZ  . ARG C  3  318 ? 61.349 46.734  137.640 1.00 41.19  ? 318  ARG C CZ  1 
ATOM   9149  N  NH1 . ARG C  3  318 ? 61.578 45.661  138.407 1.00 30.60  ? 318  ARG C NH1 1 
ATOM   9150  N  NH2 . ARG C  3  318 ? 62.060 47.852  137.832 1.00 52.11  ? 318  ARG C NH2 1 
ATOM   9151  N  N   . PRO C  3  319 ? 54.139 43.688  137.952 1.00 34.99  ? 319  PRO C N   1 
ATOM   9152  C  CA  . PRO C  3  319 ? 53.342 43.205  139.093 1.00 35.13  ? 319  PRO C CA  1 
ATOM   9153  C  C   . PRO C  3  319 ? 54.105 42.406  140.144 1.00 34.72  ? 319  PRO C C   1 
ATOM   9154  O  O   . PRO C  3  319 ? 53.955 42.657  141.317 1.00 34.45  ? 319  PRO C O   1 
ATOM   9155  C  CB  . PRO C  3  319 ? 52.270 42.287  138.411 1.00 35.75  ? 319  PRO C CB  1 
ATOM   9156  C  CG  . PRO C  3  319 ? 52.318 42.678  136.892 1.00 32.06  ? 319  PRO C CG  1 
ATOM   9157  C  CD  . PRO C  3  319 ? 53.734 43.055  136.679 1.00 34.63  ? 319  PRO C CD  1 
ATOM   9158  N  N   . LEU C  3  320 ? 54.874 41.427  139.708 1.00 34.96  ? 320  LEU C N   1 
ATOM   9159  C  CA  . LEU C  3  320 ? 55.631 40.580  140.597 1.00 34.94  ? 320  LEU C CA  1 
ATOM   9160  C  C   . LEU C  3  320 ? 56.521 41.442  141.436 1.00 35.16  ? 320  LEU C C   1 
ATOM   9161  O  O   . LEU C  3  320 ? 56.609 41.251  142.638 1.00 34.68  ? 320  LEU C O   1 
ATOM   9162  C  CB  . LEU C  3  320 ? 56.483 39.625  139.776 1.00 34.98  ? 320  LEU C CB  1 
ATOM   9163  C  CG  . LEU C  3  320 ? 56.752 38.203  140.224 1.00 49.26  ? 320  LEU C CG  1 
ATOM   9164  C  CD1 . LEU C  3  320 ? 57.309 37.412  139.063 1.00 48.81  ? 320  LEU C CD1 1 
ATOM   9165  C  CD2 . LEU C  3  320 ? 57.670 38.122  141.446 1.00 55.31  ? 320  LEU C CD2 1 
ATOM   9166  N  N   . SER C  3  321 ? 57.162 42.431  140.790 1.00 35.96  ? 321  SER C N   1 
ATOM   9167  C  CA  . SER C  3  321 ? 58.097 43.358  141.489 1.00 36.66  ? 321  SER C CA  1 
ATOM   9168  C  C   . SER C  3  321 ? 57.431 44.291  142.464 1.00 37.14  ? 321  SER C C   1 
ATOM   9169  O  O   . SER C  3  321 ? 58.028 44.662  143.482 1.00 37.33  ? 321  SER C O   1 
ATOM   9170  C  CB  . SER C  3  321 ? 58.973 44.125  140.513 1.00 36.27  ? 321  SER C CB  1 
ATOM   9171  O  OG  . SER C  3  321 ? 60.047 43.310  140.107 1.00 31.43  ? 321  SER C OG  1 
ATOM   9172  N  N   . GLN C  3  322 ? 56.207 44.692  142.138 1.00 37.06  ? 322  GLN C N   1 
ATOM   9173  C  CA  . GLN C  3  322 ? 55.429 45.500  143.018 1.00 37.57  ? 322  GLN C CA  1 
ATOM   9174  C  C   . GLN C  3  322 ? 55.238 44.785  144.353 1.00 38.38  ? 322  GLN C C   1 
ATOM   9175  O  O   . GLN C  3  322 ? 55.414 45.388  145.400 1.00 38.79  ? 322  GLN C O   1 
ATOM   9176  C  CB  . GLN C  3  322 ? 54.071 45.724  142.432 1.00 37.87  ? 322  GLN C CB  1 
ATOM   9177  C  CG  . GLN C  3  322 ? 53.985 46.795  141.469 1.00 49.92  ? 322  GLN C CG  1 
ATOM   9178  C  CD  . GLN C  3  322 ? 52.573 47.283  141.356 1.00 60.82  ? 322  GLN C CD  1 
ATOM   9179  O  OE1 . GLN C  3  322 ? 51.913 47.050  140.353 1.00 64.26  ? 322  GLN C OE1 1 
ATOM   9180  N  NE2 . GLN C  3  322 ? 52.091 47.938  142.393 1.00 63.02  ? 322  GLN C NE2 1 
ATOM   9181  N  N   . CYS C  3  323 ? 54.841 43.494  144.295 1.00 38.60  ? 323  CYS C N   1 
ATOM   9182  C  CA  . CYS C  3  323 ? 54.563 42.680  145.500 1.00 38.07  ? 323  CYS C CA  1 
ATOM   9183  C  C   . CYS C  3  323 ? 55.776 42.598  146.372 1.00 38.05  ? 323  CYS C C   1 
ATOM   9184  O  O   . CYS C  3  323 ? 55.698 42.799  147.581 1.00 38.04  ? 323  CYS C O   1 
ATOM   9185  C  CB  . CYS C  3  323 ? 54.106 41.278  145.118 1.00 37.91  ? 323  CYS C CB  1 
ATOM   9186  S  SG  . CYS C  3  323 ? 52.487 41.198  144.303 1.00 40.19  ? 323  CYS C SG  1 
ATOM   9187  N  N   . LEU C  3  324 ? 56.913 42.345  145.749 1.00 38.15  ? 324  LEU C N   1 
ATOM   9188  C  CA  . LEU C  3  324 ? 58.171 42.297  146.460 1.00 38.10  ? 324  LEU C CA  1 
ATOM   9189  C  C   . LEU C  3  324 ? 58.531 43.644  147.085 1.00 37.35  ? 324  LEU C C   1 
ATOM   9190  O  O   . LEU C  3  324 ? 59.058 43.700  148.185 1.00 37.22  ? 324  LEU C O   1 
ATOM   9191  C  CB  . LEU C  3  324 ? 59.295 41.786  145.548 1.00 38.33  ? 324  LEU C CB  1 
ATOM   9192  C  CG  . LEU C  3  324 ? 59.152 40.276  145.240 1.00 36.97  ? 324  LEU C CG  1 
ATOM   9193  C  CD1 . LEU C  3  324 ? 60.367 39.757  144.484 1.00 24.99  ? 324  LEU C CD1 1 
ATOM   9194  C  CD2 . LEU C  3  324 ? 58.961 39.484  146.544 1.00 27.49  ? 324  LEU C CD2 1 
ATOM   9195  N  N   . PHE C  3  325 ? 58.214 44.716  146.397 1.00 37.18  ? 325  PHE C N   1 
ATOM   9196  C  CA  . PHE C  3  325 ? 58.475 46.048  146.924 1.00 37.37  ? 325  PHE C CA  1 
ATOM   9197  C  C   . PHE C  3  325 ? 57.623 46.280  148.158 1.00 38.46  ? 325  PHE C C   1 
ATOM   9198  O  O   . PHE C  3  325 ? 58.127 46.687  149.193 1.00 39.50  ? 325  PHE C O   1 
ATOM   9199  C  CB  . PHE C  3  325 ? 58.150 47.103  145.879 1.00 36.67  ? 325  PHE C CB  1 
ATOM   9200  C  CG  . PHE C  3  325 ? 58.238 48.490  146.375 1.00 26.38  ? 325  PHE C CG  1 
ATOM   9201  C  CD1 . PHE C  3  325 ? 59.457 49.169  146.350 1.00 31.14  ? 325  PHE C CD1 1 
ATOM   9202  C  CD2 . PHE C  3  325 ? 57.092 49.172  146.791 1.00 22.62  ? 325  PHE C CD2 1 
ATOM   9203  C  CE1 . PHE C  3  325 ? 59.539 50.465  146.786 1.00 26.80  ? 325  PHE C CE1 1 
ATOM   9204  C  CE2 . PHE C  3  325 ? 57.165 50.468  147.237 1.00 15.37  ? 325  PHE C CE2 1 
ATOM   9205  C  CZ  . PHE C  3  325 ? 58.385 51.121  147.243 1.00 27.02  ? 325  PHE C CZ  1 
ATOM   9206  N  N   . TRP C  3  326 ? 56.327 46.002  148.062 1.00 38.13  ? 326  TRP C N   1 
ATOM   9207  C  CA  . TRP C  3  326 ? 55.452 46.239  149.194 1.00 37.66  ? 326  TRP C CA  1 
ATOM   9208  C  C   . TRP C  3  326 ? 55.753 45.377  150.384 1.00 37.08  ? 326  TRP C C   1 
ATOM   9209  O  O   . TRP C  3  326 ? 55.535 45.783  151.528 1.00 37.04  ? 326  TRP C O   1 
ATOM   9210  C  CB  . TRP C  3  326 ? 54.016 46.194  148.801 1.00 37.59  ? 326  TRP C CB  1 
ATOM   9211  C  CG  . TRP C  3  326 ? 53.664 47.335  148.006 1.00 44.49  ? 326  TRP C CG  1 
ATOM   9212  C  CD1 . TRP C  3  326 ? 53.282 47.332  146.706 1.00 45.48  ? 326  TRP C CD1 1 
ATOM   9213  C  CD2 . TRP C  3  326 ? 53.706 48.710  148.407 1.00 42.88  ? 326  TRP C CD2 1 
ATOM   9214  N  NE1 . TRP C  3  326 ? 53.045 48.613  146.283 1.00 43.70  ? 326  TRP C NE1 1 
ATOM   9215  C  CE2 . TRP C  3  326 ? 53.298 49.476  147.313 1.00 41.57  ? 326  TRP C CE2 1 
ATOM   9216  C  CE3 . TRP C  3  326 ? 54.016 49.367  149.596 1.00 41.52  ? 326  TRP C CE3 1 
ATOM   9217  C  CZ2 . TRP C  3  326 ? 53.217 50.843  147.359 1.00 40.17  ? 326  TRP C CZ2 1 
ATOM   9218  C  CZ3 . TRP C  3  326 ? 53.913 50.731  149.641 1.00 35.41  ? 326  TRP C CZ3 1 
ATOM   9219  C  CH2 . TRP C  3  326 ? 53.513 51.453  148.535 1.00 41.51  ? 326  TRP C CH2 1 
ATOM   9220  N  N   . ALA C  3  327 ? 56.307 44.206  150.115 1.00 36.38  ? 327  ALA C N   1 
ATOM   9221  C  CA  . ALA C  3  327 ? 56.756 43.325  151.163 1.00 35.90  ? 327  ALA C CA  1 
ATOM   9222  C  C   . ALA C  3  327 ? 58.017 43.936  151.826 1.00 36.51  ? 327  ALA C C   1 
ATOM   9223  O  O   . ALA C  3  327 ? 58.307 43.633  152.973 1.00 36.22  ? 327  ALA C O   1 
ATOM   9224  C  CB  . ALA C  3  327 ? 57.058 41.934  150.604 1.00 34.90  ? 327  ALA C CB  1 
ATOM   9225  N  N   . LEU C  3  328 ? 58.762 44.789  151.088 1.00 36.92  ? 328  LEU C N   1 
ATOM   9226  C  CA  . LEU C  3  328 ? 59.948 45.443  151.670 1.00 37.91  ? 328  LEU C CA  1 
ATOM   9227  C  C   . LEU C  3  328 ? 59.508 46.519  152.640 1.00 38.45  ? 328  LEU C C   1 
ATOM   9228  O  O   . LEU C  3  328 ? 60.092 46.681  153.698 1.00 38.30  ? 328  LEU C O   1 
ATOM   9229  C  CB  . LEU C  3  328 ? 60.828 46.093  150.604 1.00 38.04  ? 328  LEU C CB  1 
ATOM   9230  C  CG  . LEU C  3  328 ? 62.215 46.446  151.105 1.00 40.49  ? 328  LEU C CG  1 
ATOM   9231  C  CD1 . LEU C  3  328 ? 63.068 45.230  151.032 1.00 50.81  ? 328  LEU C CD1 1 
ATOM   9232  C  CD2 . LEU C  3  328 ? 62.835 47.552  150.315 1.00 40.14  ? 328  LEU C CD2 1 
ATOM   9233  N  N   . VAL C  3  329 ? 58.489 47.279  152.242 1.00 38.90  ? 329  VAL C N   1 
ATOM   9234  C  CA  . VAL C  3  329 ? 57.941 48.336  153.085 1.00 39.26  ? 329  VAL C CA  1 
ATOM   9235  C  C   . VAL C  3  329 ? 57.294 47.718  154.307 1.00 39.75  ? 329  VAL C C   1 
ATOM   9236  O  O   . VAL C  3  329 ? 57.542 48.165  155.434 1.00 39.79  ? 329  VAL C O   1 
ATOM   9237  C  CB  . VAL C  3  329 ? 56.934 49.175  152.328 1.00 39.17  ? 329  VAL C CB  1 
ATOM   9238  C  CG1 . VAL C  3  329 ? 56.210 50.110  153.251 1.00 27.00  ? 329  VAL C CG1 1 
ATOM   9239  C  CG2 . VAL C  3  329 ? 57.635 49.938  151.217 1.00 40.50  ? 329  VAL C CG2 1 
ATOM   9240  N  N   . ALA C  3  330 ? 56.506 46.645  154.087 1.00 39.87  ? 330  ALA C N   1 
ATOM   9241  C  CA  . ALA C  3  330 ? 55.852 45.919  155.194 1.00 39.85  ? 330  ALA C CA  1 
ATOM   9242  C  C   . ALA C  3  330 ? 56.908 45.337  156.143 1.00 40.14  ? 330  ALA C C   1 
ATOM   9243  O  O   . ALA C  3  330 ? 56.751 45.397  157.361 1.00 40.14  ? 330  ALA C O   1 
ATOM   9244  C  CB  . ALA C  3  330 ? 54.918 44.804  154.668 1.00 39.57  ? 330  ALA C CB  1 
ATOM   9245  N  N   . ASP C  3  331 ? 58.005 44.822  155.571 1.00 40.22  ? 331  ASP C N   1 
ATOM   9246  C  CA  . ASP C  3  331 ? 59.118 44.278  156.366 1.00 39.77  ? 331  ASP C CA  1 
ATOM   9247  C  C   . ASP C  3  331 ? 59.825 45.392  157.185 1.00 38.79  ? 331  ASP C C   1 
ATOM   9248  O  O   . ASP C  3  331 ? 60.357 45.142  158.277 1.00 38.75  ? 331  ASP C O   1 
ATOM   9249  C  CB  . ASP C  3  331 ? 60.130 43.593  155.470 1.00 39.81  ? 331  ASP C CB  1 
ATOM   9250  C  CG  . ASP C  3  331 ? 61.073 42.755  156.234 1.00 39.79  ? 331  ASP C CG  1 
ATOM   9251  O  OD1 . ASP C  3  331 ? 62.253 42.646  155.824 1.00 44.83  ? 331  ASP C OD1 1 
ATOM   9252  O  OD2 . ASP C  3  331 ? 60.730 42.177  157.276 1.00 29.63  ? 331  ASP C OD2 1 
ATOM   9253  N  N   . LEU C  3  332 ? 59.797 46.609  156.661 1.00 37.67  ? 332  LEU C N   1 
ATOM   9254  C  CA  . LEU C  3  332 ? 60.381 47.731  157.353 1.00 37.32  ? 332  LEU C CA  1 
ATOM   9255  C  C   . LEU C  3  332 ? 59.452 48.244  158.473 1.00 37.30  ? 332  LEU C C   1 
ATOM   9256  O  O   . LEU C  3  332 ? 59.897 49.017  159.332 1.00 37.67  ? 332  LEU C O   1 
ATOM   9257  C  CB  . LEU C  3  332 ? 60.737 48.869  156.382 1.00 36.86  ? 332  LEU C CB  1 
ATOM   9258  C  CG  . LEU C  3  332 ? 61.968 48.662  155.504 1.00 36.60  ? 332  LEU C CG  1 
ATOM   9259  C  CD1 . LEU C  3  332 ? 61.989 49.692  154.364 1.00 45.02  ? 332  LEU C CD1 1 
ATOM   9260  C  CD2 . LEU C  3  332 ? 63.242 48.735  156.315 1.00 36.98  ? 332  LEU C CD2 1 
ATOM   9261  N  N   . LEU C  3  333 ? 58.160 47.883  158.434 1.00 36.48  ? 333  LEU C N   1 
ATOM   9262  C  CA  . LEU C  3  333 ? 57.282 48.287  159.516 1.00 36.50  ? 333  LEU C CA  1 
ATOM   9263  C  C   . LEU C  3  333 ? 57.611 47.357  160.636 1.00 36.24  ? 333  LEU C C   1 
ATOM   9264  O  O   . LEU C  3  333 ? 57.789 47.781  161.786 1.00 36.31  ? 333  LEU C O   1 
ATOM   9265  C  CB  . LEU C  3  333 ? 55.805 48.123  159.187 1.00 36.90  ? 333  LEU C CB  1 
ATOM   9266  C  CG  . LEU C  3  333 ? 55.043 49.001  158.206 1.00 47.55  ? 333  LEU C CG  1 
ATOM   9267  C  CD1 . LEU C  3  333 ? 53.609 49.231  158.772 1.00 39.69  ? 333  LEU C CD1 1 
ATOM   9268  C  CD2 . LEU C  3  333 ? 55.736 50.323  157.955 1.00 48.47  ? 333  LEU C CD2 1 
ATOM   9269  N  N   . THR C  3  334 ? 57.741 46.080  160.282 1.00 35.87  ? 334  THR C N   1 
ATOM   9270  C  CA  . THR C  3  334 ? 58.045 45.013  161.237 1.00 35.74  ? 334  THR C CA  1 
ATOM   9271  C  C   . THR C  3  334 ? 59.342 45.332  161.948 1.00 35.60  ? 334  THR C C   1 
ATOM   9272  O  O   . THR C  3  334 ? 59.436 45.249  163.181 1.00 35.64  ? 334  THR C O   1 
ATOM   9273  C  CB  . THR C  3  334 ? 58.213 43.684  160.489 1.00 35.82  ? 334  THR C CB  1 
ATOM   9274  O  OG1 . THR C  3  334 ? 57.098 43.473  159.627 1.00 48.93  ? 334  THR C OG1 1 
ATOM   9275  C  CG2 . THR C  3  334 ? 58.170 42.515  161.433 1.00 22.02  ? 334  THR C CG2 1 
ATOM   9276  N  N   . LEU C  3  335 ? 60.341 45.725  161.167 1.00 35.15  ? 335  LEU C N   1 
ATOM   9277  C  CA  . LEU C  3  335 ? 61.623 46.055  161.727 1.00 34.09  ? 335  LEU C CA  1 
ATOM   9278  C  C   . LEU C  3  335 ? 61.548 47.210  162.726 1.00 33.02  ? 335  LEU C C   1 
ATOM   9279  O  O   . LEU C  3  335 ? 62.089 47.094  163.834 1.00 32.18  ? 335  LEU C O   1 
ATOM   9280  C  CB  . LEU C  3  335 ? 62.662 46.268  160.633 1.00 33.68  ? 335  LEU C CB  1 
ATOM   9281  C  CG  . LEU C  3  335 ? 63.109 44.923  160.038 1.00 34.19  ? 335  LEU C CG  1 
ATOM   9282  C  CD1 . LEU C  3  335 ? 63.923 45.100  158.758 1.00 28.17  ? 335  LEU C CD1 1 
ATOM   9283  C  CD2 . LEU C  3  335 ? 63.853 44.007  161.088 1.00 30.98  ? 335  LEU C CD2 1 
ATOM   9284  N  N   . THR C  3  336 ? 60.801 48.276  162.392 1.00 32.54  ? 336  THR C N   1 
ATOM   9285  C  CA  . THR C  3  336 ? 60.710 49.378  163.332 1.00 32.70  ? 336  THR C CA  1 
ATOM   9286  C  C   . THR C  3  336 ? 59.914 48.997  164.554 1.00 32.51  ? 336  THR C C   1 
ATOM   9287  O  O   . THR C  3  336 ? 60.324 49.273  165.679 1.00 32.35  ? 336  THR C O   1 
ATOM   9288  C  CB  . THR C  3  336 ? 60.270 50.789  162.689 1.00 32.85  ? 336  THR C CB  1 
ATOM   9289  O  OG1 . THR C  3  336 ? 58.941 50.734  162.196 1.00 31.54  ? 336  THR C OG1 1 
ATOM   9290  C  CG2 . THR C  3  336 ? 61.070 51.101  161.476 1.00 31.46  ? 336  THR C CG2 1 
ATOM   9291  N  N   . TRP C  3  337 ? 58.807 48.306  164.337 1.00 32.70  ? 337  TRP C N   1 
ATOM   9292  C  CA  . TRP C  3  337 ? 57.988 47.820  165.434 1.00 32.49  ? 337  TRP C CA  1 
ATOM   9293  C  C   . TRP C  3  337 ? 58.862 46.958  166.384 1.00 32.25  ? 337  TRP C C   1 
ATOM   9294  O  O   . TRP C  3  337 ? 58.955 47.260  167.568 1.00 32.07  ? 337  TRP C O   1 
ATOM   9295  C  CB  . TRP C  3  337 ? 56.824 47.030  164.883 1.00 32.83  ? 337  TRP C CB  1 
ATOM   9296  C  CG  . TRP C  3  337 ? 56.174 46.112  165.863 1.00 41.64  ? 337  TRP C CG  1 
ATOM   9297  C  CD1 . TRP C  3  337 ? 55.616 46.449  167.066 1.00 41.28  ? 337  TRP C CD1 1 
ATOM   9298  C  CD2 . TRP C  3  337 ? 55.976 44.707  165.713 1.00 41.07  ? 337  TRP C CD2 1 
ATOM   9299  N  NE1 . TRP C  3  337 ? 55.101 45.333  167.678 1.00 45.77  ? 337  TRP C NE1 1 
ATOM   9300  C  CE2 . TRP C  3  337 ? 55.306 44.248  166.867 1.00 45.30  ? 337  TRP C CE2 1 
ATOM   9301  C  CE3 . TRP C  3  337 ? 56.305 43.779  164.723 1.00 40.06  ? 337  TRP C CE3 1 
ATOM   9302  C  CZ2 . TRP C  3  337 ? 54.957 42.899  167.052 1.00 41.45  ? 337  TRP C CZ2 1 
ATOM   9303  C  CZ3 . TRP C  3  337 ? 55.938 42.444  164.908 1.00 40.36  ? 337  TRP C CZ3 1 
ATOM   9304  C  CH2 . TRP C  3  337 ? 55.292 42.022  166.065 1.00 35.41  ? 337  TRP C CH2 1 
ATOM   9305  N  N   . ILE C  3  338 ? 59.543 45.935  165.842 1.00 32.34  ? 338  ILE C N   1 
ATOM   9306  C  CA  . ILE C  3  338 ? 60.455 45.083  166.658 1.00 32.53  ? 338  ILE C CA  1 
ATOM   9307  C  C   . ILE C  3  338 ? 61.515 45.914  167.362 1.00 33.40  ? 338  ILE C C   1 
ATOM   9308  O  O   . ILE C  3  338 ? 61.735 45.737  168.540 1.00 33.78  ? 338  ILE C O   1 
ATOM   9309  C  CB  . ILE C  3  338 ? 61.145 43.990  165.792 1.00 32.26  ? 338  ILE C CB  1 
ATOM   9310  C  CG1 . ILE C  3  338 ? 60.164 42.862  165.467 1.00 27.58  ? 338  ILE C CG1 1 
ATOM   9311  C  CG2 . ILE C  3  338 ? 62.430 43.449  166.484 1.00 15.63  ? 338  ILE C CG2 1 
ATOM   9312  C  CD1 . ILE C  3  338 ? 59.514 42.312  166.653 1.00 31.35  ? 338  ILE C CD1 1 
ATOM   9313  N  N   . GLY C  3  339 ? 62.139 46.854  166.625 1.00 33.97  ? 339  GLY C N   1 
ATOM   9314  C  CA  . GLY C  3  339 ? 63.164 47.745  167.163 1.00 34.28  ? 339  GLY C CA  1 
ATOM   9315  C  C   . GLY C  3  339 ? 62.687 48.541  168.355 1.00 35.28  ? 339  GLY C C   1 
ATOM   9316  O  O   . GLY C  3  339 ? 63.458 48.824  169.247 1.00 35.71  ? 339  GLY C O   1 
ATOM   9317  N  N   . GLY C  3  340 ? 61.397 48.872  168.386 1.00 36.09  ? 340  GLY C N   1 
ATOM   9318  C  CA  . GLY C  3  340 ? 60.807 49.569  169.526 1.00 36.95  ? 340  GLY C CA  1 
ATOM   9319  C  C   . GLY C  3  340 ? 60.322 48.605  170.649 1.00 37.87  ? 340  GLY C C   1 
ATOM   9320  O  O   . GLY C  3  340 ? 59.626 49.029  171.584 1.00 37.69  ? 340  GLY C O   1 
ATOM   9321  N  N   . GLN C  3  341 ? 60.707 47.321  170.557 1.00 38.63  ? 341  GLN C N   1 
ATOM   9322  C  CA  . GLN C  3  341 ? 60.311 46.293  171.547 1.00 39.42  ? 341  GLN C CA  1 
ATOM   9323  C  C   . GLN C  3  341 ? 61.515 45.613  172.206 1.00 40.19  ? 341  GLN C C   1 
ATOM   9324  O  O   . GLN C  3  341 ? 62.553 45.459  171.580 1.00 40.11  ? 341  GLN C O   1 
ATOM   9325  C  CB  . GLN C  3  341 ? 59.443 45.187  170.883 1.00 39.20  ? 341  GLN C CB  1 
ATOM   9326  C  CG  . GLN C  3  341 ? 58.154 45.643  170.264 1.00 34.90  ? 341  GLN C CG  1 
ATOM   9327  C  CD  . GLN C  3  341 ? 57.303 46.505  171.177 1.00 36.50  ? 341  GLN C CD  1 
ATOM   9328  O  OE1 . GLN C  3  341 ? 56.616 47.391  170.700 1.00 45.64  ? 341  GLN C OE1 1 
ATOM   9329  N  NE2 . GLN C  3  341 ? 57.336 46.239  172.486 1.00 29.12  ? 341  GLN C NE2 1 
ATOM   9330  N  N   . PRO C  3  342 ? 61.345 45.163  173.457 1.00 40.98  ? 342  PRO C N   1 
ATOM   9331  C  CA  . PRO C  3  342 ? 62.411 44.456  174.188 1.00 41.58  ? 342  PRO C CA  1 
ATOM   9332  C  C   . PRO C  3  342 ? 62.893 43.159  173.499 1.00 41.98  ? 342  PRO C C   1 
ATOM   9333  O  O   . PRO C  3  342 ? 62.135 42.508  172.788 1.00 41.59  ? 342  PRO C O   1 
ATOM   9334  C  CB  . PRO C  3  342 ? 61.736 44.098  175.520 1.00 41.57  ? 342  PRO C CB  1 
ATOM   9335  C  CG  . PRO C  3  342 ? 60.620 45.054  175.659 1.00 43.77  ? 342  PRO C CG  1 
ATOM   9336  C  CD  . PRO C  3  342 ? 60.136 45.338  174.283 1.00 41.02  ? 342  PRO C CD  1 
ATOM   9337  N  N   . VAL C  3  343 ? 64.148 42.794  173.746 1.00 42.84  ? 343  VAL C N   1 
ATOM   9338  C  CA  . VAL C  3  343 ? 64.743 41.580  173.172 1.00 43.54  ? 343  VAL C CA  1 
ATOM   9339  C  C   . VAL C  3  343 ? 64.424 40.342  174.070 1.00 43.78  ? 343  VAL C C   1 
ATOM   9340  O  O   . VAL C  3  343 ? 65.333 39.733  174.640 1.00 43.66  ? 343  VAL C O   1 
ATOM   9341  C  CB  . VAL C  3  343 ? 66.314 41.738  173.024 1.00 43.68  ? 343  VAL C CB  1 
ATOM   9342  C  CG1 . VAL C  3  343 ? 66.854 40.874  171.878 1.00 45.78  ? 343  VAL C CG1 1 
ATOM   9343  C  CG2 . VAL C  3  343 ? 66.675 43.187  172.765 1.00 42.56  ? 343  VAL C CG2 1 
ATOM   9344  N  N   . GLU C  3  344 ? 63.127 40.000  174.181 1.00 43.95  ? 344  GLU C N   1 
ATOM   9345  C  CA  . GLU C  3  344 ? 62.654 38.862  175.000 1.00 44.28  ? 344  GLU C CA  1 
ATOM   9346  C  C   . GLU C  3  344 ? 61.973 37.833  174.068 1.00 44.03  ? 344  GLU C C   1 
ATOM   9347  O  O   . GLU C  3  344 ? 62.503 37.581  172.992 1.00 43.92  ? 344  GLU C O   1 
ATOM   9348  C  CB  . GLU C  3  344 ? 61.690 39.350  176.091 1.00 44.60  ? 344  GLU C CB  1 
ATOM   9349  C  CG  . GLU C  3  344 ? 62.299 40.372  177.052 1.00 54.82  ? 344  GLU C CG  1 
ATOM   9350  C  CD  . GLU C  3  344 ? 61.371 40.720  178.211 1.00 62.82  ? 344  GLU C CD  1 
ATOM   9351  O  OE1 . GLU C  3  344 ? 61.438 41.877  178.707 1.00 55.25  ? 344  GLU C OE1 1 
ATOM   9352  O  OE2 . GLU C  3  344 ? 60.579 39.826  178.634 1.00 68.10  ? 344  GLU C OE2 1 
ATOM   9353  N  N   . HIS C  3  345 ? 60.805 37.240  174.467 1.00 43.48  ? 345  HIS C N   1 
ATOM   9354  C  CA  . HIS C  3  345 ? 60.098 36.291  173.569 1.00 42.58  ? 345  HIS C CA  1 
ATOM   9355  C  C   . HIS C  3  345 ? 59.642 36.821  172.184 1.00 42.40  ? 345  HIS C C   1 
ATOM   9356  O  O   . HIS C  3  345 ? 60.078 37.915  171.862 1.00 44.07  ? 345  HIS C O   1 
ATOM   9357  C  CB  . HIS C  3  345 ? 59.273 35.182  174.251 1.00 43.02  ? 345  HIS C CB  1 
ATOM   9358  C  CG  . HIS C  3  345 ? 59.095 33.949  173.396 1.00 43.76  ? 345  HIS C CG  1 
ATOM   9359  N  ND1 . HIS C  3  345 ? 57.862 33.534  172.926 1.00 29.73  ? 345  HIS C ND1 1 
ATOM   9360  C  CD2 . HIS C  3  345 ? 60.002 33.086  172.881 1.00 44.06  ? 345  HIS C CD2 1 
ATOM   9361  C  CE1 . HIS C  3  345 ? 58.024 32.481  172.147 1.00 35.66  ? 345  HIS C CE1 1 
ATOM   9362  N  NE2 . HIS C  3  345 ? 59.309 32.177  172.117 1.00 41.31  ? 345  HIS C NE2 1 
ATOM   9363  N  N   . PRO C  3  346 ? 58.563 36.357  171.584 1.00 40.58  ? 346  PRO C N   1 
ATOM   9364  C  CA  . PRO C  3  346 ? 58.381 36.454  170.126 1.00 39.46  ? 346  PRO C CA  1 
ATOM   9365  C  C   . PRO C  3  346 ? 59.497 37.263  169.420 1.00 39.10  ? 346  PRO C C   1 
ATOM   9366  O  O   . PRO C  3  346 ? 60.358 36.743  168.692 1.00 39.14  ? 346  PRO C O   1 
ATOM   9367  C  CB  . PRO C  3  346 ? 57.076 37.223  169.991 1.00 39.06  ? 346  PRO C CB  1 
ATOM   9368  C  CG  . PRO C  3  346 ? 56.405 37.032  171.129 1.00 29.98  ? 346  PRO C CG  1 
ATOM   9369  C  CD  . PRO C  3  346 ? 57.280 36.506  172.239 1.00 40.65  ? 346  PRO C CD  1 
ATOM   9370  N  N   . TYR C  3  347 ? 59.434 38.557  169.689 1.00 38.31  ? 347  TYR C N   1 
ATOM   9371  C  CA  . TYR C  3  347 ? 60.316 39.583  169.215 1.00 37.86  ? 347  TYR C CA  1 
ATOM   9372  C  C   . TYR C  3  347 ? 61.732 39.235  168.742 1.00 37.30  ? 347  TYR C C   1 
ATOM   9373  O  O   . TYR C  3  347 ? 62.186 39.813  167.758 1.00 37.28  ? 347  TYR C O   1 
ATOM   9374  C  CB  . TYR C  3  347 ? 60.324 40.723  170.217 1.00 38.03  ? 347  TYR C CB  1 
ATOM   9375  C  CG  . TYR C  3  347 ? 58.909 41.216  170.611 1.00 39.86  ? 347  TYR C CG  1 
ATOM   9376  C  CD1 . TYR C  3  347 ? 57.854 41.187  169.694 1.00 37.91  ? 347  TYR C CD1 1 
ATOM   9377  C  CD2 . TYR C  3  347 ? 58.646 41.724  171.895 1.00 34.87  ? 347  TYR C CD2 1 
ATOM   9378  C  CE1 . TYR C  3  347 ? 56.603 41.650  170.026 1.00 37.13  ? 347  TYR C CE1 1 
ATOM   9379  C  CE2 . TYR C  3  347 ? 57.392 42.204  172.227 1.00 30.12  ? 347  TYR C CE2 1 
ATOM   9380  C  CZ  . TYR C  3  347 ? 56.374 42.157  171.286 1.00 36.71  ? 347  TYR C CZ  1 
ATOM   9381  O  OH  . TYR C  3  347 ? 55.120 42.606  171.595 1.00 40.42  ? 347  TYR C OH  1 
ATOM   9382  N  N   . ILE C  3  348 ? 62.437 38.325  169.429 1.00 36.82  ? 348  ILE C N   1 
ATOM   9383  C  CA  . ILE C  3  348 ? 63.806 37.948  168.982 1.00 36.80  ? 348  ILE C CA  1 
ATOM   9384  C  C   . ILE C  3  348 ? 63.805 37.242  167.629 1.00 37.50  ? 348  ILE C C   1 
ATOM   9385  O  O   . ILE C  3  348 ? 64.443 37.697  166.695 1.00 37.70  ? 348  ILE C O   1 
ATOM   9386  C  CB  . ILE C  3  348 ? 64.604 37.068  170.051 1.00 36.52  ? 348  ILE C CB  1 
ATOM   9387  C  CG1 . ILE C  3  348 ? 64.964 37.891  171.282 1.00 35.38  ? 348  ILE C CG1 1 
ATOM   9388  C  CG2 . ILE C  3  348 ? 65.936 36.552  169.450 1.00 23.18  ? 348  ILE C CG2 1 
ATOM   9389  C  CD1 . ILE C  3  348 ? 65.764 37.100  172.367 1.00 26.37  ? 348  ILE C CD1 1 
ATOM   9390  N  N   . THR C  3  349 ? 63.040 36.159  167.518 1.00 38.19  ? 349  THR C N   1 
ATOM   9391  C  CA  . THR C  3  349 ? 63.023 35.361  166.293 1.00 38.49  ? 349  THR C CA  1 
ATOM   9392  C  C   . THR C  3  349 ? 62.315 35.997  165.116 1.00 39.01  ? 349  THR C C   1 
ATOM   9393  O  O   . THR C  3  349 ? 62.668 35.734  163.971 1.00 38.95  ? 349  THR C O   1 
ATOM   9394  C  CB  . THR C  3  349 ? 62.528 33.905  166.553 1.00 38.31  ? 349  THR C CB  1 
ATOM   9395  O  OG1 . THR C  3  349 ? 61.228 33.937  167.132 1.00 39.87  ? 349  THR C OG1 1 
ATOM   9396  C  CG2 . THR C  3  349 ? 63.400 33.218  167.645 1.00 28.59  ? 349  THR C CG2 1 
ATOM   9397  N  N   . ILE C  3  350 ? 61.313 36.825  165.370 1.00 39.63  ? 350  ILE C N   1 
ATOM   9398  C  CA  . ILE C  3  350 ? 60.658 37.472  164.250 1.00 40.18  ? 350  ILE C CA  1 
ATOM   9399  C  C   . ILE C  3  350 ? 61.503 38.581  163.734 1.00 41.12  ? 350  ILE C C   1 
ATOM   9400  O  O   . ILE C  3  350 ? 61.646 38.740  162.520 1.00 41.86  ? 350  ILE C O   1 
ATOM   9401  C  CB  . ILE C  3  350 ? 59.213 37.937  164.547 1.00 40.24  ? 350  ILE C CB  1 
ATOM   9402  C  CG1 . ILE C  3  350 ? 59.076 39.411  164.208 1.00 35.31  ? 350  ILE C CG1 1 
ATOM   9403  C  CG2 . ILE C  3  350 ? 58.791 37.656  166.000 1.00 33.25  ? 350  ILE C CG2 1 
ATOM   9404  C  CD1 . ILE C  3  350 ? 57.857 39.910  164.505 1.00 50.29  ? 350  ILE C CD1 1 
ATOM   9405  N  N   . GLY C  3  351 ? 62.165 39.296  164.652 1.00 41.15  ? 351  GLY C N   1 
ATOM   9406  C  CA  . GLY C  3  351 ? 63.040 40.397  164.279 1.00 40.71  ? 351  GLY C CA  1 
ATOM   9407  C  C   . GLY C  3  351 ? 64.321 39.867  163.683 1.00 40.30  ? 351  GLY C C   1 
ATOM   9408  O  O   . GLY C  3  351 ? 65.041 40.589  163.005 1.00 40.89  ? 351  GLY C O   1 
ATOM   9409  N  N   . GLN C  3  352 ? 64.604 38.594  163.944 1.00 39.27  ? 352  GLN C N   1 
ATOM   9410  C  CA  . GLN C  3  352 ? 65.781 37.937  163.411 1.00 38.62  ? 352  GLN C CA  1 
ATOM   9411  C  C   . GLN C  3  352 ? 65.518 37.534  161.979 1.00 38.21  ? 352  GLN C C   1 
ATOM   9412  O  O   . GLN C  3  352 ? 66.379 37.706  161.108 1.00 38.59  ? 352  GLN C O   1 
ATOM   9413  C  CB  . GLN C  3  352 ? 66.063 36.692  164.205 1.00 38.59  ? 352  GLN C CB  1 
ATOM   9414  C  CG  . GLN C  3  352 ? 67.510 36.303  164.333 1.00 41.63  ? 352  GLN C CG  1 
ATOM   9415  C  CD  . GLN C  3  352 ? 67.690 35.184  165.397 1.00 48.95  ? 352  GLN C CD  1 
ATOM   9416  O  OE1 . GLN C  3  352 ? 68.712 34.489  165.420 1.00 52.11  ? 352  GLN C OE1 1 
ATOM   9417  N  NE2 . GLN C  3  352 ? 66.678 35.013  166.256 1.00 34.07  ? 352  GLN C NE2 1 
ATOM   9418  N  N   . LEU C  3  353 ? 64.319 36.989  161.736 1.00 37.14  ? 353  LEU C N   1 
ATOM   9419  C  CA  . LEU C  3  353 ? 63.923 36.512  160.405 1.00 35.49  ? 353  LEU C CA  1 
ATOM   9420  C  C   . LEU C  3  353 ? 63.628 37.659  159.484 1.00 34.33  ? 353  LEU C C   1 
ATOM   9421  O  O   . LEU C  3  353 ? 63.844 37.549  158.283 1.00 34.64  ? 353  LEU C O   1 
ATOM   9422  C  CB  . LEU C  3  353 ? 62.690 35.604  160.488 1.00 35.05  ? 353  LEU C CB  1 
ATOM   9423  C  CG  . LEU C  3  353 ? 62.779 34.203  161.098 1.00 29.72  ? 353  LEU C CG  1 
ATOM   9424  C  CD1 . LEU C  3  353 ? 61.377 33.726  161.376 1.00 28.35  ? 353  LEU C CD1 1 
ATOM   9425  C  CD2 . LEU C  3  353 ? 63.536 33.206  160.201 1.00 25.10  ? 353  LEU C CD2 1 
ATOM   9426  N  N   . ALA C  3  354 ? 63.105 38.758  160.042 1.00 32.91  ? 354  ALA C N   1 
ATOM   9427  C  CA  . ALA C  3  354 ? 62.775 39.948  159.241 1.00 31.82  ? 354  ALA C CA  1 
ATOM   9428  C  C   . ALA C  3  354 ? 64.051 40.575  158.701 1.00 31.13  ? 354  ALA C C   1 
ATOM   9429  O  O   . ALA C  3  354 ? 64.082 41.037  157.573 1.00 30.40  ? 354  ALA C O   1 
ATOM   9430  C  CB  . ALA C  3  354 ? 61.989 40.934  160.045 1.00 31.53  ? 354  ALA C CB  1 
ATOM   9431  N  N   . SER C  3  355 ? 65.116 40.524  159.512 1.00 31.42  ? 355  SER C N   1 
ATOM   9432  C  CA  . SER C  3  355 ? 66.427 41.004  159.120 1.00 31.88  ? 355  SER C CA  1 
ATOM   9433  C  C   . SER C  3  355 ? 66.959 40.213  157.943 1.00 33.14  ? 355  SER C C   1 
ATOM   9434  O  O   . SER C  3  355 ? 67.436 40.814  156.951 1.00 33.90  ? 355  SER C O   1 
ATOM   9435  C  CB  . SER C  3  355 ? 67.392 40.957  160.264 1.00 31.28  ? 355  SER C CB  1 
ATOM   9436  O  OG  . SER C  3  355 ? 66.988 41.872  161.248 1.00 31.24  ? 355  SER C OG  1 
ATOM   9437  N  N   . VAL C  3  356 ? 66.851 38.883  158.019 1.00 33.27  ? 356  VAL C N   1 
ATOM   9438  C  CA  . VAL C  3  356 ? 67.261 38.024  156.914 1.00 33.70  ? 356  VAL C CA  1 
ATOM   9439  C  C   . VAL C  3  356 ? 66.432 38.387  155.651 1.00 34.28  ? 356  VAL C C   1 
ATOM   9440  O  O   . VAL C  3  356 ? 67.008 38.596  154.563 1.00 34.29  ? 356  VAL C O   1 
ATOM   9441  C  CB  . VAL C  3  356 ? 67.070 36.503  157.234 1.00 33.44  ? 356  VAL C CB  1 
ATOM   9442  C  CG1 . VAL C  3  356 ? 67.711 35.662  156.160 1.00 36.93  ? 356  VAL C CG1 1 
ATOM   9443  C  CG2 . VAL C  3  356 ? 67.668 36.161  158.546 1.00 28.02  ? 356  VAL C CG2 1 
ATOM   9444  N  N   . LEU C  3  357 ? 65.100 38.527  155.833 1.00 34.37  ? 357  LEU C N   1 
ATOM   9445  C  CA  . LEU C  3  357 ? 64.170 38.871  154.746 1.00 34.94  ? 357  LEU C CA  1 
ATOM   9446  C  C   . LEU C  3  357 ? 64.531 40.180  154.063 1.00 35.62  ? 357  LEU C C   1 
ATOM   9447  O  O   . LEU C  3  357 ? 64.498 40.276  152.848 1.00 36.00  ? 357  LEU C O   1 
ATOM   9448  C  CB  . LEU C  3  357 ? 62.736 38.956  155.260 1.00 35.11  ? 357  LEU C CB  1 
ATOM   9449  C  CG  . LEU C  3  357 ? 61.634 39.185  154.216 1.00 35.61  ? 357  LEU C CG  1 
ATOM   9450  C  CD1 . LEU C  3  357 ? 61.538 37.990  153.328 1.00 41.25  ? 357  LEU C CD1 1 
ATOM   9451  C  CD2 . LEU C  3  357 ? 60.269 39.475  154.868 1.00 37.09  ? 357  LEU C CD2 1 
ATOM   9452  N  N   . TYR C  3  358 ? 64.871 41.183  154.852 1.00 35.84  ? 358  TYR C N   1 
ATOM   9453  C  CA  . TYR C  3  358 ? 65.264 42.477  154.312 1.00 35.90  ? 358  TYR C CA  1 
ATOM   9454  C  C   . TYR C  3  358 ? 66.367 42.259  153.267 1.00 36.16  ? 358  TYR C C   1 
ATOM   9455  O  O   . TYR C  3  358 ? 66.226 42.657  152.103 1.00 36.25  ? 358  TYR C O   1 
ATOM   9456  C  CB  . TYR C  3  358 ? 65.756 43.391  155.455 1.00 35.56  ? 358  TYR C CB  1 
ATOM   9457  C  CG  . TYR C  3  358 ? 66.265 44.781  155.030 1.00 32.93  ? 358  TYR C CG  1 
ATOM   9458  C  CD1 . TYR C  3  358 ? 65.372 45.834  154.780 1.00 32.38  ? 358  TYR C CD1 1 
ATOM   9459  C  CD2 . TYR C  3  358 ? 67.629 45.050  154.947 1.00 24.34  ? 358  TYR C CD2 1 
ATOM   9460  C  CE1 . TYR C  3  358 ? 65.821 47.081  154.425 1.00 29.98  ? 358  TYR C CE1 1 
ATOM   9461  C  CE2 . TYR C  3  358 ? 68.082 46.302  154.597 1.00 33.69  ? 358  TYR C CE2 1 
ATOM   9462  C  CZ  . TYR C  3  358 ? 67.173 47.316  154.331 1.00 30.74  ? 358  TYR C CZ  1 
ATOM   9463  O  OH  . TYR C  3  358 ? 67.627 48.569  153.976 1.00 27.21  ? 358  TYR C OH  1 
ATOM   9464  N  N   . PHE C  3  359 ? 67.423 41.559  153.672 1.00 36.16  ? 359  PHE C N   1 
ATOM   9465  C  CA  . PHE C  3  359 ? 68.539 41.290  152.789 1.00 35.84  ? 359  PHE C CA  1 
ATOM   9466  C  C   . PHE C  3  359 ? 68.252 40.224  151.729 1.00 36.24  ? 359  PHE C C   1 
ATOM   9467  O  O   . PHE C  3  359 ? 68.865 40.224  150.690 1.00 36.26  ? 359  PHE C O   1 
ATOM   9468  C  CB  . PHE C  3  359 ? 69.791 40.952  153.576 1.00 35.26  ? 359  PHE C CB  1 
ATOM   9469  C  CG  . PHE C  3  359 ? 70.316 42.080  154.342 1.00 32.03  ? 359  PHE C CG  1 
ATOM   9470  C  CD1 . PHE C  3  359 ? 71.040 43.089  153.704 1.00 39.52  ? 359  PHE C CD1 1 
ATOM   9471  C  CD2 . PHE C  3  359 ? 70.099 42.169  155.705 1.00 38.72  ? 359  PHE C CD2 1 
ATOM   9472  C  CE1 . PHE C  3  359 ? 71.510 44.180  154.400 1.00 30.42  ? 359  PHE C CE1 1 
ATOM   9473  C  CE2 . PHE C  3  359 ? 70.577 43.248  156.426 1.00 40.94  ? 359  PHE C CE2 1 
ATOM   9474  C  CZ  . PHE C  3  359 ? 71.290 44.269  155.761 1.00 43.14  ? 359  PHE C CZ  1 
ATOM   9475  N  N   . LEU C  3  360 ? 67.325 39.315  151.992 1.00 36.55  ? 360  LEU C N   1 
ATOM   9476  C  CA  . LEU C  3  360 ? 67.008 38.302  150.986 1.00 36.79  ? 360  LEU C CA  1 
ATOM   9477  C  C   . LEU C  3  360 ? 66.189 38.968  149.883 1.00 37.64  ? 360  LEU C C   1 
ATOM   9478  O  O   . LEU C  3  360 ? 66.340 38.651  148.671 1.00 38.30  ? 360  LEU C O   1 
ATOM   9479  C  CB  . LEU C  3  360 ? 66.205 37.178  151.571 1.00 36.05  ? 360  LEU C CB  1 
ATOM   9480  C  CG  . LEU C  3  360 ? 66.135 35.966  150.656 1.00 36.99  ? 360  LEU C CG  1 
ATOM   9481  C  CD1 . LEU C  3  360 ? 67.484 35.231  150.692 1.00 38.77  ? 360  LEU C CD1 1 
ATOM   9482  C  CD2 . LEU C  3  360 ? 64.974 35.012  151.051 1.00 36.49  ? 360  LEU C CD2 1 
ATOM   9483  N  N   . LEU C  3  361 ? 65.358 39.915  150.298 1.00 36.65  ? 361  LEU C N   1 
ATOM   9484  C  CA  . LEU C  3  361 ? 64.506 40.617  149.411 1.00 36.10  ? 361  LEU C CA  1 
ATOM   9485  C  C   . LEU C  3  361 ? 65.359 41.492  148.421 1.00 37.09  ? 361  LEU C C   1 
ATOM   9486  O  O   . LEU C  3  361 ? 65.431 41.202  147.212 1.00 37.34  ? 361  LEU C O   1 
ATOM   9487  C  CB  . LEU C  3  361 ? 63.590 41.462  150.240 1.00 35.25  ? 361  LEU C CB  1 
ATOM   9488  C  CG  . LEU C  3  361 ? 62.142 41.596  149.912 1.00 28.33  ? 361  LEU C CG  1 
ATOM   9489  C  CD1 . LEU C  3  361 ? 61.626 40.406  149.227 1.00 25.37  ? 361  LEU C CD1 1 
ATOM   9490  C  CD2 . LEU C  3  361 ? 61.375 41.871  151.191 1.00 17.01  ? 361  LEU C CD2 1 
ATOM   9491  N  N   . ILE C  3  362 ? 66.041 42.499  148.952 1.00 37.03  ? 362  ILE C N   1 
ATOM   9492  C  CA  . ILE C  3  362 ? 66.855 43.378  148.143 1.00 36.98  ? 362  ILE C CA  1 
ATOM   9493  C  C   . ILE C  3  362 ? 67.979 42.667  147.370 1.00 37.81  ? 362  ILE C C   1 
ATOM   9494  O  O   . ILE C  3  362 ? 68.228 42.955  146.183 1.00 38.76  ? 362  ILE C O   1 
ATOM   9495  C  CB  . ILE C  3  362 ? 67.513 44.432  149.041 1.00 36.61  ? 362  ILE C CB  1 
ATOM   9496  C  CG1 . ILE C  3  362 ? 66.487 45.369  149.659 1.00 27.42  ? 362  ILE C CG1 1 
ATOM   9497  C  CG2 . ILE C  3  362 ? 68.494 45.194  148.289 1.00 19.11  ? 362  ILE C CG2 1 
ATOM   9498  C  CD1 . ILE C  3  362 ? 67.056 46.173  150.824 1.00 29.71  ? 362  ILE C CD1 1 
ATOM   9499  N  N   . LEU C  3  363 ? 68.643 41.741  148.020 1.00 37.46  ? 363  LEU C N   1 
ATOM   9500  C  CA  . LEU C  3  363 ? 69.823 41.141  147.430 1.00 37.71  ? 363  LEU C CA  1 
ATOM   9501  C  C   . LEU C  3  363 ? 69.590 39.948  146.482 1.00 38.37  ? 363  LEU C C   1 
ATOM   9502  O  O   . LEU C  3  363 ? 70.433 39.660  145.607 1.00 38.81  ? 363  LEU C O   1 
ATOM   9503  C  CB  . LEU C  3  363 ? 70.775 40.733  148.547 1.00 37.41  ? 363  LEU C CB  1 
ATOM   9504  C  CG  . LEU C  3  363 ? 72.256 41.018  148.448 1.00 37.06  ? 363  LEU C CG  1 
ATOM   9505  C  CD1 . LEU C  3  363 ? 72.488 42.528  148.267 1.00 26.02  ? 363  LEU C CD1 1 
ATOM   9506  C  CD2 . LEU C  3  363 ? 72.962 40.478  149.733 1.00 20.77  ? 363  LEU C CD2 1 
ATOM   9507  N  N   . VAL C  3  364 ? 68.464 39.245  146.657 1.00 38.13  ? 364  VAL C N   1 
ATOM   9508  C  CA  . VAL C  3  364 ? 68.205 38.033  145.893 1.00 36.93  ? 364  VAL C CA  1 
ATOM   9509  C  C   . VAL C  3  364 ? 66.845 38.011  145.232 1.00 36.92  ? 364  VAL C C   1 
ATOM   9510  O  O   . VAL C  3  364 ? 66.756 37.831  144.032 1.00 37.26  ? 364  VAL C O   1 
ATOM   9511  C  CB  . VAL C  3  364 ? 68.390 36.738  146.816 1.00 36.54  ? 364  VAL C CB  1 
ATOM   9512  C  CG1 . VAL C  3  364 ? 67.680 35.437  146.208 1.00 20.42  ? 364  VAL C CG1 1 
ATOM   9513  C  CG2 . VAL C  3  364 ? 69.867 36.479  147.108 1.00 24.32  ? 364  VAL C CG2 1 
ATOM   9514  N  N   . LEU C  3  365 ? 65.790 38.233  146.018 1.00 36.87  ? 365  LEU C N   1 
ATOM   9515  C  CA  . LEU C  3  365 ? 64.393 38.127  145.543 1.00 36.76  ? 365  LEU C CA  1 
ATOM   9516  C  C   . LEU C  3  365 ? 63.986 39.135  144.480 1.00 37.25  ? 365  LEU C C   1 
ATOM   9517  O  O   . LEU C  3  365 ? 63.464 38.753  143.437 1.00 37.02  ? 365  LEU C O   1 
ATOM   9518  C  CB  . LEU C  3  365 ? 63.397 38.131  146.731 1.00 36.60  ? 365  LEU C CB  1 
ATOM   9519  C  CG  . LEU C  3  365 ? 62.907 36.771  147.311 1.00 42.05  ? 365  LEU C CG  1 
ATOM   9520  C  CD1 . LEU C  3  365 ? 63.999 35.667  147.407 1.00 35.53  ? 365  LEU C CD1 1 
ATOM   9521  C  CD2 . LEU C  3  365 ? 62.096 36.906  148.626 1.00 30.31  ? 365  LEU C CD2 1 
ATOM   9522  N  N   . MET C  3  366 ? 64.231 40.425  144.745 1.00 37.89  ? 366  MET C N   1 
ATOM   9523  C  CA  . MET C  3  366 ? 63.901 41.489  143.778 1.00 37.77  ? 366  MET C CA  1 
ATOM   9524  C  C   . MET C  3  366 ? 64.590 41.349  142.416 1.00 37.15  ? 366  MET C C   1 
ATOM   9525  O  O   . MET C  3  366 ? 63.916 41.470  141.380 1.00 36.91  ? 366  MET C O   1 
ATOM   9526  C  CB  . MET C  3  366 ? 64.009 42.889  144.386 1.00 37.90  ? 366  MET C CB  1 
ATOM   9527  C  CG  . MET C  3  366 ? 63.134 43.055  145.642 1.00 48.85  ? 366  MET C CG  1 
ATOM   9528  S  SD  . MET C  3  366 ? 63.153 44.699  146.393 1.00 53.43  ? 366  MET C SD  1 
ATOM   9529  C  CE  . MET C  3  366 ? 62.121 45.591  145.282 1.00 56.69  ? 366  MET C CE  1 
ATOM   9530  N  N   . PRO C  3  367 ? 65.910 41.099  142.396 1.00 36.79  ? 367  PRO C N   1 
ATOM   9531  C  CA  . PRO C  3  367 ? 66.607 40.822  141.123 1.00 37.24  ? 367  PRO C CA  1 
ATOM   9532  C  C   . PRO C  3  367 ? 66.010 39.583  140.409 1.00 37.90  ? 367  PRO C C   1 
ATOM   9533  O  O   . PRO C  3  367 ? 65.637 39.671  139.244 1.00 38.64  ? 367  PRO C O   1 
ATOM   9534  C  CB  . PRO C  3  367 ? 68.031 40.523  141.565 1.00 37.12  ? 367  PRO C CB  1 
ATOM   9535  C  CG  . PRO C  3  367 ? 68.183 41.242  142.836 1.00 42.61  ? 367  PRO C CG  1 
ATOM   9536  C  CD  . PRO C  3  367 ? 66.855 41.182  143.523 1.00 36.34  ? 367  PRO C CD  1 
ATOM   9537  N  N   . THR C  3  368 ? 65.888 38.459  141.116 1.00 37.08  ? 368  THR C N   1 
ATOM   9538  C  CA  . THR C  3  368 ? 65.320 37.270  140.528 1.00 36.15  ? 368  THR C CA  1 
ATOM   9539  C  C   . THR C  3  368 ? 63.947 37.563  139.874 1.00 35.92  ? 368  THR C C   1 
ATOM   9540  O  O   . THR C  3  368 ? 63.684 37.121  138.751 1.00 37.28  ? 368  THR C O   1 
ATOM   9541  C  CB  . THR C  3  368 ? 65.222 36.154  141.580 1.00 36.21  ? 368  THR C CB  1 
ATOM   9542  O  OG1 . THR C  3  368 ? 66.549 35.805  142.015 1.00 34.17  ? 368  THR C OG1 1 
ATOM   9543  C  CG2 . THR C  3  368 ? 64.640 34.807  140.955 1.00 12.91  ? 368  THR C CG2 1 
ATOM   9544  N  N   . ALA C  3  369 ? 63.111 38.355  140.541 1.00 34.06  ? 369  ALA C N   1 
ATOM   9545  C  CA  . ALA C  3  369 ? 61.808 38.724  139.992 1.00 32.28  ? 369  ALA C CA  1 
ATOM   9546  C  C   . ALA C  3  369 ? 61.947 39.443  138.674 1.00 31.32  ? 369  ALA C C   1 
ATOM   9547  O  O   . ALA C  3  369 ? 61.184 39.219  137.778 1.00 30.45  ? 369  ALA C O   1 
ATOM   9548  C  CB  . ALA C  3  369 ? 61.057 39.583  140.952 1.00 31.87  ? 369  ALA C CB  1 
ATOM   9549  N  N   . GLY C  3  370 ? 62.937 40.328  138.579 1.00 31.87  ? 370  GLY C N   1 
ATOM   9550  C  CA  . GLY C  3  370 ? 63.176 41.089  137.354 1.00 31.72  ? 370  GLY C CA  1 
ATOM   9551  C  C   . GLY C  3  370 ? 63.526 40.170  136.178 1.00 31.65  ? 370  GLY C C   1 
ATOM   9552  O  O   . GLY C  3  370 ? 63.047 40.366  135.063 1.00 31.34  ? 370  GLY C O   1 
ATOM   9553  N  N   . THR C  3  371 ? 64.330 39.145  136.449 1.00 31.76  ? 371  THR C N   1 
ATOM   9554  C  CA  . THR C  3  371 ? 64.717 38.193  135.430 1.00 31.77  ? 371  THR C CA  1 
ATOM   9555  C  C   . THR C  3  371 ? 63.513 37.419  134.985 1.00 31.92  ? 371  THR C C   1 
ATOM   9556  O  O   . THR C  3  371 ? 63.300 37.232  133.777 1.00 32.07  ? 371  THR C O   1 
ATOM   9557  C  CB  . THR C  3  371 ? 65.783 37.245  135.958 1.00 31.72  ? 371  THR C CB  1 
ATOM   9558  O  OG1 . THR C  3  371 ? 66.964 37.993  136.279 1.00 35.86  ? 371  THR C OG1 1 
ATOM   9559  C  CG2 . THR C  3  371 ? 66.257 36.314  134.859 1.00 26.62  ? 371  THR C CG2 1 
ATOM   9560  N  N   . ILE C  3  372 ? 62.686 37.002  135.955 1.00 32.04  ? 372  ILE C N   1 
ATOM   9561  C  CA  . ILE C  3  372 ? 61.456 36.243  135.643 1.00 32.11  ? 372  ILE C CA  1 
ATOM   9562  C  C   . ILE C  3  372 ? 60.508 37.080  134.781 1.00 32.46  ? 372  ILE C C   1 
ATOM   9563  O  O   . ILE C  3  372 ? 60.018 36.612  133.748 1.00 33.15  ? 372  ILE C O   1 
ATOM   9564  C  CB  . ILE C  3  372 ? 60.760 35.750  136.929 1.00 31.72  ? 372  ILE C CB  1 
ATOM   9565  C  CG1 . ILE C  3  372 ? 61.553 34.585  137.528 1.00 24.51  ? 372  ILE C CG1 1 
ATOM   9566  C  CG2 . ILE C  3  372 ? 59.298 35.294  136.630 1.00 25.27  ? 372  ILE C CG2 1 
ATOM   9567  C  CD1 . ILE C  3  372 ? 61.068 34.155  138.906 1.00 22.52  ? 372  ILE C CD1 1 
ATOM   9568  N  N   . GLU C  3  373 ? 60.338 38.341  135.163 1.00 31.66  ? 373  GLU C N   1 
ATOM   9569  C  CA  . GLU C  3  373 ? 59.466 39.243  134.459 1.00 31.18  ? 373  GLU C CA  1 
ATOM   9570  C  C   . GLU C  3  373 ? 59.917 39.475  133.032 1.00 30.99  ? 373  GLU C C   1 
ATOM   9571  O  O   . GLU C  3  373 ? 59.093 39.544  132.112 1.00 31.20  ? 373  GLU C O   1 
ATOM   9572  C  CB  . GLU C  3  373 ? 59.370 40.545  135.203 1.00 31.04  ? 373  GLU C CB  1 
ATOM   9573  C  CG  . GLU C  3  373 ? 58.690 40.419  136.538 1.00 28.40  ? 373  GLU C CG  1 
ATOM   9574  C  CD  . GLU C  3  373 ? 58.660 41.713  137.303 1.00 32.62  ? 373  GLU C CD  1 
ATOM   9575  O  OE1 . GLU C  3  373 ? 57.664 41.941  138.027 1.00 31.83  ? 373  GLU C OE1 1 
ATOM   9576  O  OE2 . GLU C  3  373 ? 59.623 42.512  137.178 1.00 30.82  ? 373  GLU C OE2 1 
ATOM   9577  N  N   . ASN C  3  374 ? 61.228 39.585  132.843 1.00 30.36  ? 374  ASN C N   1 
ATOM   9578  C  CA  . ASN C  3  374 ? 61.770 39.777  131.530 1.00 29.35  ? 374  ASN C CA  1 
ATOM   9579  C  C   . ASN C  3  374 ? 61.343 38.584  130.717 1.00 28.87  ? 374  ASN C C   1 
ATOM   9580  O  O   . ASN C  3  374 ? 60.746 38.735  129.649 1.00 28.41  ? 374  ASN C O   1 
ATOM   9581  C  CB  . ASN C  3  374 ? 63.291 39.836  131.568 1.00 29.05  ? 374  ASN C CB  1 
ATOM   9582  C  CG  . ASN C  3  374 ? 63.823 41.147  132.116 1.00 36.39  ? 374  ASN C CG  1 
ATOM   9583  O  OD1 . ASN C  3  374 ? 63.082 42.099  132.343 1.00 42.78  ? 374  ASN C OD1 1 
ATOM   9584  N  ND2 . ASN C  3  374 ? 65.111 41.196  132.331 1.00 33.83  ? 374  ASN C ND2 1 
ATOM   9585  N  N   . LYS C  3  375 ? 61.586 37.396  131.272 1.00 28.86  ? 375  LYS C N   1 
ATOM   9586  C  CA  . LYS C  3  375 ? 61.256 36.145  130.602 1.00 29.34  ? 375  LYS C CA  1 
ATOM   9587  C  C   . LYS C  3  375 ? 59.798 36.005  130.209 1.00 29.61  ? 375  LYS C C   1 
ATOM   9588  O  O   . LYS C  3  375 ? 59.517 35.560  129.118 1.00 29.52  ? 375  LYS C O   1 
ATOM   9589  C  CB  . LYS C  3  375 ? 61.762 34.915  131.386 1.00 29.44  ? 375  LYS C CB  1 
ATOM   9590  C  CG  . LYS C  3  375 ? 63.256 34.632  131.172 1.00 44.31  ? 375  LYS C CG  1 
ATOM   9591  C  CD  . LYS C  3  375 ? 63.762 33.405  131.943 1.00 53.35  ? 375  LYS C CD  1 
ATOM   9592  C  CE  . LYS C  3  375 ? 65.322 33.332  131.899 1.00 60.35  ? 375  LYS C CE  1 
ATOM   9593  N  NZ  . LYS C  3  375 ? 65.923 32.265  132.788 1.00 60.60  ? 375  LYS C NZ  1 
ATOM   9594  N  N   . LEU C  3  376 ? 58.874 36.463  131.074 1.00 30.25  ? 376  LEU C N   1 
ATOM   9595  C  CA  . LEU C  3  376 ? 57.433 36.371  130.793 1.00 30.74  ? 376  LEU C CA  1 
ATOM   9596  C  C   . LEU C  3  376 ? 57.051 37.234  129.626 1.00 31.93  ? 376  LEU C C   1 
ATOM   9597  O  O   . LEU C  3  376 ? 56.141 36.886  128.857 1.00 31.69  ? 376  LEU C O   1 
ATOM   9598  C  CB  . LEU C  3  376 ? 56.604 36.715  132.018 1.00 30.55  ? 376  LEU C CB  1 
ATOM   9599  C  CG  . LEU C  3  376 ? 56.398 35.517  132.984 1.00 38.56  ? 376  LEU C CG  1 
ATOM   9600  C  CD1 . LEU C  3  376 ? 56.041 35.939  134.415 1.00 30.50  ? 376  LEU C CD1 1 
ATOM   9601  C  CD2 . LEU C  3  376 ? 55.374 34.530  132.434 1.00 28.82  ? 376  LEU C CD2 1 
ATOM   9602  N  N   . LEU C  3  377 ? 57.806 38.334  129.452 1.00 33.02  ? 377  LEU C N   1 
ATOM   9603  C  CA  . LEU C  3  377 ? 57.607 39.256  128.359 1.00 34.35  ? 377  LEU C CA  1 
ATOM   9604  C  C   . LEU C  3  377 ? 58.368 38.833  127.048 1.00 35.93  ? 377  LEU C C   1 
ATOM   9605  O  O   . LEU C  3  377 ? 58.254 39.494  126.018 1.00 35.45  ? 377  LEU C O   1 
ATOM   9606  C  CB  . LEU C  3  377 ? 58.030 40.644  128.787 1.00 34.24  ? 377  LEU C CB  1 
ATOM   9607  C  CG  . LEU C  3  377 ? 56.989 41.464  129.540 1.00 35.67  ? 377  LEU C CG  1 
ATOM   9608  C  CD1 . LEU C  3  377 ? 57.523 42.879  129.830 1.00 30.05  ? 377  LEU C CD1 1 
ATOM   9609  C  CD2 . LEU C  3  377 ? 55.693 41.541  128.738 1.00 34.57  ? 377  LEU C CD2 1 
ATOM   9610  N  N   . LYS C  3  378 ? 59.083 37.696  127.124 1.00 37.85  ? 378  LYS C N   1 
ATOM   9611  C  CA  . LYS C  3  378 ? 59.910 37.131  126.038 1.00 39.66  ? 378  LYS C CA  1 
ATOM   9612  C  C   . LYS C  3  378 ? 61.148 37.989  125.716 1.00 41.79  ? 378  LYS C C   1 
ATOM   9613  O  O   . LYS C  3  378 ? 61.733 37.877  124.627 1.00 42.02  ? 378  LYS C O   1 
ATOM   9614  C  CB  . LYS C  3  378 ? 59.106 36.834  124.782 1.00 39.86  ? 378  LYS C CB  1 
ATOM   9615  C  CG  . LYS C  3  378 ? 57.780 36.142  125.025 1.00 47.42  ? 378  LYS C CG  1 
ATOM   9616  C  CD  . LYS C  3  378 ? 57.146 35.712  123.723 1.00 45.95  ? 378  LYS C CD  1 
ATOM   9617  C  CE  . LYS C  3  378 ? 55.652 35.665  123.853 1.00 47.95  ? 378  LYS C CE  1 
ATOM   9618  N  NZ  . LYS C  3  378 ? 55.016 35.068  122.646 1.00 55.20  ? 378  LYS C NZ  1 
ATOM   9619  N  N   . TRP C  3  379 ? 61.559 38.801  126.702 1.00 43.11  ? 379  TRP C N   1 
ATOM   9620  C  CA  . TRP C  3  379 ? 62.728 39.710  126.621 1.00 44.20  ? 379  TRP C CA  1 
ATOM   9621  C  C   . TRP C  3  379 ? 63.939 39.094  127.295 1.00 45.23  ? 379  TRP C C   1 
ATOM   9622  O  O   . TRP C  3  379 ? 63.779 38.254  128.191 1.00 45.33  ? 379  TRP C O   1 
ATOM   9623  C  CB  . TRP C  3  379 ? 62.421 40.966  127.420 1.00 44.18  ? 379  TRP C CB  1 
ATOM   9624  C  CG  . TRP C  3  379 ? 62.187 42.068  126.691 1.00 30.87  ? 379  TRP C CG  1 
ATOM   9625  C  CD1 . TRP C  3  379 ? 62.627 42.323  125.431 1.00 47.55  ? 379  TRP C CD1 1 
ATOM   9626  C  CD2 . TRP C  3  379 ? 61.513 43.232  127.129 1.00 34.29  ? 379  TRP C CD2 1 
ATOM   9627  N  NE1 . TRP C  3  379 ? 62.270 43.603  125.046 1.00 47.33  ? 379  TRP C NE1 1 
ATOM   9628  C  CE2 . TRP C  3  379 ? 61.586 44.191  126.070 1.00 33.75  ? 379  TRP C CE2 1 
ATOM   9629  C  CE3 . TRP C  3  379 ? 60.865 43.584  128.298 1.00 29.28  ? 379  TRP C CE3 1 
ATOM   9630  C  CZ2 . TRP C  3  379 ? 61.000 45.447  126.148 1.00 25.03  ? 379  TRP C CZ2 1 
ATOM   9631  C  CZ3 . TRP C  3  379 ? 60.300 44.870  128.389 1.00 31.22  ? 379  TRP C CZ3 1 
ATOM   9632  C  CH2 . TRP C  3  379 ? 60.371 45.778  127.313 1.00 26.11  ? 379  TRP C CH2 1 
ATOM   9633  O  OXT . TRP C  3  379 ? 65.076 39.539  127.050 1.00 45.70  ? 379  TRP C OXT 1 
ATOM   9634  N  N   . SER D  4  1   ? 57.007 42.734  190.002 1.00 66.51  ? 1    SER D N   1 
ATOM   9635  C  CA  . SER D  4  1   ? 58.378 42.396  189.510 1.00 66.39  ? 1    SER D CA  1 
ATOM   9636  C  C   . SER D  4  1   ? 58.281 41.786  188.081 1.00 66.28  ? 1    SER D C   1 
ATOM   9637  O  O   . SER D  4  1   ? 57.886 40.624  187.928 1.00 66.49  ? 1    SER D O   1 
ATOM   9638  C  CB  . SER D  4  1   ? 59.046 41.415  190.487 1.00 66.25  ? 1    SER D CB  1 
ATOM   9639  O  OG  . SER D  4  1   ? 60.444 41.628  190.566 1.00 64.03  ? 1    SER D OG  1 
ATOM   9640  N  N   . ASP D  4  2   ? 58.597 42.604  187.056 1.00 65.85  ? 2    ASP D N   1 
ATOM   9641  C  CA  . ASP D  4  2   ? 58.531 42.212  185.608 1.00 65.57  ? 2    ASP D CA  1 
ATOM   9642  C  C   . ASP D  4  2   ? 57.110 42.000  185.052 1.00 64.89  ? 2    ASP D C   1 
ATOM   9643  O  O   . ASP D  4  2   ? 56.926 41.582  183.899 1.00 64.92  ? 2    ASP D O   1 
ATOM   9644  C  CB  . ASP D  4  2   ? 59.441 41.020  185.270 1.00 65.90  ? 2    ASP D CB  1 
ATOM   9645  C  CG  . ASP D  4  2   ? 60.914 41.387  185.282 1.00 72.43  ? 2    ASP D CG  1 
ATOM   9646  O  OD1 . ASP D  4  2   ? 61.276 42.397  185.920 1.00 72.64  ? 2    ASP D OD1 1 
ATOM   9647  O  OD2 . ASP D  4  2   ? 61.783 40.719  184.680 1.00 75.87  ? 2    ASP D OD2 1 
ATOM   9648  N  N   . LEU D  4  3   ? 56.125 42.275  185.888 1.00 64.10  ? 3    LEU D N   1 
ATOM   9649  C  CA  . LEU D  4  3   ? 54.727 42.179  185.525 1.00 63.33  ? 3    LEU D CA  1 
ATOM   9650  C  C   . LEU D  4  3   ? 54.173 43.538  185.816 1.00 62.34  ? 3    LEU D C   1 
ATOM   9651  O  O   . LEU D  4  3   ? 54.587 44.172  186.791 1.00 62.51  ? 3    LEU D O   1 
ATOM   9652  C  CB  . LEU D  4  3   ? 54.032 41.144  186.399 1.00 63.56  ? 3    LEU D CB  1 
ATOM   9653  C  CG  . LEU D  4  3   ? 54.124 39.711  185.895 1.00 68.16  ? 3    LEU D CG  1 
ATOM   9654  C  CD1 . LEU D  4  3   ? 53.578 38.724  186.940 1.00 65.16  ? 3    LEU D CD1 1 
ATOM   9655  C  CD2 . LEU D  4  3   ? 53.355 39.604  184.575 1.00 68.43  ? 3    LEU D CD2 1 
ATOM   9656  N  N   . GLU D  4  4   ? 53.241 44.010  184.998 1.00 61.19  ? 4    GLU D N   1 
ATOM   9657  C  CA  . GLU D  4  4   ? 52.723 45.357  185.212 1.00 60.24  ? 4    GLU D CA  1 
ATOM   9658  C  C   . GLU D  4  4   ? 51.291 45.568  184.721 1.00 58.86  ? 4    GLU D C   1 
ATOM   9659  O  O   . GLU D  4  4   ? 50.734 44.733  184.023 1.00 59.05  ? 4    GLU D O   1 
ATOM   9660  C  CB  . GLU D  4  4   ? 53.670 46.393  184.577 1.00 60.57  ? 4    GLU D CB  1 
ATOM   9661  C  CG  . GLU D  4  4   ? 54.050 47.535  185.512 1.00 69.78  ? 4    GLU D CG  1 
ATOM   9662  C  CD  . GLU D  4  4   ? 54.871 48.615  184.825 1.00 76.89  ? 4    GLU D CD  1 
ATOM   9663  O  OE1 . GLU D  4  4   ? 55.132 49.650  185.466 1.00 79.26  ? 4    GLU D OE1 1 
ATOM   9664  O  OE2 . GLU D  4  4   ? 55.243 48.436  183.641 1.00 79.92  ? 4    GLU D OE2 1 
ATOM   9665  N  N   . LEU D  4  5   ? 50.713 46.707  185.094 1.00 57.33  ? 5    LEU D N   1 
ATOM   9666  C  CA  . LEU D  4  5   ? 49.343 47.053  184.730 1.00 55.90  ? 5    LEU D CA  1 
ATOM   9667  C  C   . LEU D  4  5   ? 49.311 48.483  184.196 1.00 54.57  ? 5    LEU D C   1 
ATOM   9668  O  O   . LEU D  4  5   ? 49.997 49.353  184.730 1.00 54.44  ? 5    LEU D O   1 
ATOM   9669  C  CB  . LEU D  4  5   ? 48.444 46.956  185.970 1.00 55.79  ? 5    LEU D CB  1 
ATOM   9670  C  CG  . LEU D  4  5   ? 46.984 47.331  185.755 1.00 54.04  ? 5    LEU D CG  1 
ATOM   9671  C  CD1 . LEU D  4  5   ? 46.250 46.178  185.076 1.00 54.68  ? 5    LEU D CD1 1 
ATOM   9672  C  CD2 . LEU D  4  5   ? 46.323 47.735  187.047 1.00 47.13  ? 5    LEU D CD2 1 
ATOM   9673  N  N   . HIS D  4  6   ? 48.494 48.730  183.162 1.00 53.45  ? 6    HIS D N   1 
ATOM   9674  C  CA  . HIS D  4  6   ? 48.393 50.077  182.543 1.00 52.21  ? 6    HIS D CA  1 
ATOM   9675  C  C   . HIS D  4  6   ? 47.127 50.880  182.971 1.00 50.85  ? 6    HIS D C   1 
ATOM   9676  O  O   . HIS D  4  6   ? 46.046 50.302  183.137 1.00 50.83  ? 6    HIS D O   1 
ATOM   9677  C  CB  . HIS D  4  6   ? 48.561 49.984  181.016 1.00 52.17  ? 6    HIS D CB  1 
ATOM   9678  C  CG  . HIS D  4  6   ? 49.924 49.521  180.598 1.00 55.85  ? 6    HIS D CG  1 
ATOM   9679  N  ND1 . HIS D  4  6   ? 50.212 48.198  180.320 1.00 56.83  ? 6    HIS D ND1 1 
ATOM   9680  C  CD2 . HIS D  4  6   ? 51.093 50.194  180.472 1.00 58.88  ? 6    HIS D CD2 1 
ATOM   9681  C  CE1 . HIS D  4  6   ? 51.493 48.083  180.016 1.00 57.02  ? 6    HIS D CE1 1 
ATOM   9682  N  NE2 . HIS D  4  6   ? 52.050 49.279  180.100 1.00 60.13  ? 6    HIS D NE2 1 
ATOM   9683  N  N   . PRO D  4  7   ? 47.294 52.202  183.182 1.00 49.45  ? 7    PRO D N   1 
ATOM   9684  C  CA  . PRO D  4  7   ? 46.208 53.082  183.679 1.00 48.17  ? 7    PRO D CA  1 
ATOM   9685  C  C   . PRO D  4  7   ? 45.021 53.242  182.729 1.00 46.99  ? 7    PRO D C   1 
ATOM   9686  O  O   . PRO D  4  7   ? 45.197 53.091  181.539 1.00 46.99  ? 7    PRO D O   1 
ATOM   9687  C  CB  . PRO D  4  7   ? 46.923 54.426  183.887 1.00 47.96  ? 7    PRO D CB  1 
ATOM   9688  C  CG  . PRO D  4  7   ? 48.386 54.064  183.948 1.00 46.28  ? 7    PRO D CG  1 
ATOM   9689  C  CD  . PRO D  4  7   ? 48.555 52.948  182.994 1.00 49.23  ? 7    PRO D CD  1 
ATOM   9690  N  N   . PRO D  4  8   ? 43.826 53.523  183.260 1.00 45.84  ? 8    PRO D N   1 
ATOM   9691  C  CA  . PRO D  4  8   ? 42.632 53.692  182.429 1.00 44.57  ? 8    PRO D CA  1 
ATOM   9692  C  C   . PRO D  4  8   ? 42.656 55.012  181.718 1.00 43.39  ? 8    PRO D C   1 
ATOM   9693  O  O   . PRO D  4  8   ? 43.647 55.705  181.759 1.00 43.02  ? 8    PRO D O   1 
ATOM   9694  C  CB  . PRO D  4  8   ? 41.485 53.706  183.458 1.00 44.47  ? 8    PRO D CB  1 
ATOM   9695  C  CG  . PRO D  4  8   ? 42.091 53.278  184.735 1.00 43.73  ? 8    PRO D CG  1 
ATOM   9696  C  CD  . PRO D  4  8   ? 43.515 53.663  184.689 1.00 45.84  ? 8    PRO D CD  1 
ATOM   9697  N  N   . SER D  4  9   ? 41.537 55.380  181.124 1.00 42.92  ? 9    SER D N   1 
ATOM   9698  C  CA  . SER D  4  9   ? 41.446 56.622  180.393 1.00 42.72  ? 9    SER D CA  1 
ATOM   9699  C  C   . SER D  4  9   ? 40.448 57.563  181.090 1.00 42.40  ? 9    SER D C   1 
ATOM   9700  O  O   . SER D  4  9   ? 39.236 57.528  180.819 1.00 42.41  ? 9    SER D O   1 
ATOM   9701  C  CB  . SER D  4  9   ? 41.009 56.334  178.962 1.00 42.63  ? 9    SER D CB  1 
ATOM   9702  O  OG  . SER D  4  9   ? 41.759 57.093  178.065 1.00 42.03  ? 9    SER D OG  1 
ATOM   9703  N  N   . TYR D  4  10  ? 40.956 58.391  181.994 1.00 41.88  ? 10   TYR D N   1 
ATOM   9704  C  CA  . TYR D  4  10  ? 40.093 59.301  182.743 1.00 41.39  ? 10   TYR D CA  1 
ATOM   9705  C  C   . TYR D  4  10  ? 39.704 60.511  181.870 1.00 40.47  ? 10   TYR D C   1 
ATOM   9706  O  O   . TYR D  4  10  ? 40.522 61.003  181.124 1.00 40.53  ? 10   TYR D O   1 
ATOM   9707  C  CB  . TYR D  4  10  ? 40.767 59.715  184.084 1.00 41.63  ? 10   TYR D CB  1 
ATOM   9708  C  CG  . TYR D  4  10  ? 40.918 58.548  185.118 1.00 42.78  ? 10   TYR D CG  1 
ATOM   9709  C  CD1 . TYR D  4  10  ? 39.861 58.184  185.962 1.00 44.48  ? 10   TYR D CD1 1 
ATOM   9710  C  CD2 . TYR D  4  10  ? 42.113 57.835  185.231 1.00 40.44  ? 10   TYR D CD2 1 
ATOM   9711  C  CE1 . TYR D  4  10  ? 39.998 57.124  186.892 1.00 42.23  ? 10   TYR D CE1 1 
ATOM   9712  C  CE2 . TYR D  4  10  ? 42.251 56.783  186.141 1.00 36.49  ? 10   TYR D CE2 1 
ATOM   9713  C  CZ  . TYR D  4  10  ? 41.198 56.434  186.970 1.00 41.67  ? 10   TYR D CZ  1 
ATOM   9714  O  OH  . TYR D  4  10  ? 41.352 55.398  187.893 1.00 32.11  ? 10   TYR D OH  1 
ATOM   9715  N  N   . PRO D  4  11  ? 38.434 60.932  181.925 1.00 39.68  ? 11   PRO D N   1 
ATOM   9716  C  CA  . PRO D  4  11  ? 37.936 62.043  181.105 1.00 39.30  ? 11   PRO D CA  1 
ATOM   9717  C  C   . PRO D  4  11  ? 38.352 63.413  181.587 1.00 39.09  ? 11   PRO D C   1 
ATOM   9718  O  O   . PRO D  4  11  ? 37.468 64.201  181.903 1.00 39.23  ? 11   PRO D O   1 
ATOM   9719  C  CB  . PRO D  4  11  ? 36.401 61.929  181.262 1.00 39.20  ? 11   PRO D CB  1 
ATOM   9720  C  CG  . PRO D  4  11  ? 36.171 60.639  181.882 1.00 38.97  ? 11   PRO D CG  1 
ATOM   9721  C  CD  . PRO D  4  11  ? 37.362 60.348  182.731 1.00 39.62  ? 11   PRO D CD  1 
ATOM   9722  N  N   . TRP D  4  12  ? 39.653 63.713  181.600 1.00 38.78  ? 12   TRP D N   1 
ATOM   9723  C  CA  . TRP D  4  12  ? 40.146 65.020  182.034 1.00 38.21  ? 12   TRP D CA  1 
ATOM   9724  C  C   . TRP D  4  12  ? 39.449 66.102  181.250 1.00 38.07  ? 12   TRP D C   1 
ATOM   9725  O  O   . TRP D  4  12  ? 39.033 65.885  180.123 1.00 37.97  ? 12   TRP D O   1 
ATOM   9726  C  CB  . TRP D  4  12  ? 41.649 65.117  181.832 1.00 37.98  ? 12   TRP D CB  1 
ATOM   9727  C  CG  . TRP D  4  12  ? 42.401 64.013  182.481 1.00 32.37  ? 12   TRP D CG  1 
ATOM   9728  C  CD1 . TRP D  4  12  ? 42.836 62.867  181.893 1.00 31.13  ? 12   TRP D CD1 1 
ATOM   9729  C  CD2 . TRP D  4  12  ? 42.816 63.944  183.843 1.00 32.01  ? 12   TRP D CD2 1 
ATOM   9730  N  NE1 . TRP D  4  12  ? 43.482 62.075  182.810 1.00 29.70  ? 12   TRP D NE1 1 
ATOM   9731  C  CE2 . TRP D  4  12  ? 43.498 62.719  184.013 1.00 30.31  ? 12   TRP D CE2 1 
ATOM   9732  C  CE3 . TRP D  4  12  ? 42.676 64.793  184.950 1.00 33.82  ? 12   TRP D CE3 1 
ATOM   9733  C  CZ2 . TRP D  4  12  ? 44.029 62.318  185.235 1.00 31.52  ? 12   TRP D CZ2 1 
ATOM   9734  C  CZ3 . TRP D  4  12  ? 43.208 64.398  186.164 1.00 35.74  ? 12   TRP D CZ3 1 
ATOM   9735  C  CH2 . TRP D  4  12  ? 43.877 63.166  186.297 1.00 34.32  ? 12   TRP D CH2 1 
ATOM   9736  N  N   . SER D  4  13  ? 39.316 67.271  181.844 1.00 38.29  ? 13   SER D N   1 
ATOM   9737  C  CA  . SER D  4  13  ? 38.623 68.358  181.186 1.00 38.81  ? 13   SER D CA  1 
ATOM   9738  C  C   . SER D  4  13  ? 39.490 69.037  180.091 1.00 39.89  ? 13   SER D C   1 
ATOM   9739  O  O   . SER D  4  13  ? 39.051 69.986  179.423 1.00 39.52  ? 13   SER D O   1 
ATOM   9740  C  CB  . SER D  4  13  ? 38.165 69.371  182.205 1.00 38.28  ? 13   SER D CB  1 
ATOM   9741  O  OG  . SER D  4  13  ? 36.953 69.936  181.796 1.00 34.46  ? 13   SER D OG  1 
ATOM   9742  N  N   . HIS D  4  14  ? 40.710 68.522  179.924 1.00 41.22  ? 14   HIS D N   1 
ATOM   9743  C  CA  . HIS D  4  14  ? 41.677 69.026  178.953 1.00 42.55  ? 14   HIS D CA  1 
ATOM   9744  C  C   . HIS D  4  14  ? 42.148 67.872  178.031 1.00 43.57  ? 14   HIS D C   1 
ATOM   9745  O  O   . HIS D  4  14  ? 43.262 67.900  177.483 1.00 43.67  ? 14   HIS D O   1 
ATOM   9746  C  CB  . HIS D  4  14  ? 42.881 69.645  179.693 1.00 42.54  ? 14   HIS D CB  1 
ATOM   9747  C  CG  . HIS D  4  14  ? 43.489 68.742  180.722 1.00 43.49  ? 14   HIS D CG  1 
ATOM   9748  N  ND1 . HIS D  4  14  ? 43.006 68.644  182.013 1.00 47.47  ? 14   HIS D ND1 1 
ATOM   9749  C  CD2 . HIS D  4  14  ? 44.541 67.895  180.652 1.00 42.25  ? 14   HIS D CD2 1 
ATOM   9750  C  CE1 . HIS D  4  14  ? 43.739 67.781  182.692 1.00 42.80  ? 14   HIS D CE1 1 
ATOM   9751  N  NE2 . HIS D  4  14  ? 44.674 67.307  181.889 1.00 41.75  ? 14   HIS D NE2 1 
ATOM   9752  N  N   . ARG D  4  15  ? 41.285 66.870  177.860 1.00 44.22  ? 15   ARG D N   1 
ATOM   9753  C  CA  . ARG D  4  15  ? 41.622 65.711  177.053 1.00 44.65  ? 15   ARG D CA  1 
ATOM   9754  C  C   . ARG D  4  15  ? 41.354 65.940  175.562 1.00 44.80  ? 15   ARG D C   1 
ATOM   9755  O  O   . ARG D  4  15  ? 42.111 65.473  174.721 1.00 45.13  ? 15   ARG D O   1 
ATOM   9756  C  CB  . ARG D  4  15  ? 40.878 64.469  177.552 1.00 44.77  ? 15   ARG D CB  1 
ATOM   9757  C  CG  . ARG D  4  15  ? 41.428 63.169  176.992 1.00 52.11  ? 15   ARG D CG  1 
ATOM   9758  C  CD  . ARG D  4  15  ? 40.563 61.938  177.243 1.00 51.65  ? 15   ARG D CD  1 
ATOM   9759  N  NE  . ARG D  4  15  ? 40.701 60.987  176.137 1.00 60.05  ? 15   ARG D NE  1 
ATOM   9760  C  CZ  . ARG D  4  15  ? 40.019 59.851  176.014 1.00 65.87  ? 15   ARG D CZ  1 
ATOM   9761  N  NH1 . ARG D  4  15  ? 39.137 59.482  176.955 1.00 71.96  ? 15   ARG D NH1 1 
ATOM   9762  N  NH2 . ARG D  4  15  ? 40.224 59.070  174.951 1.00 59.96  ? 15   ARG D NH2 1 
ATOM   9763  N  N   . GLY D  4  16  ? 40.284 66.672  175.246 1.00 44.56  ? 16   GLY D N   1 
ATOM   9764  C  CA  . GLY D  4  16  ? 39.925 66.957  173.863 1.00 44.49  ? 16   GLY D CA  1 
ATOM   9765  C  C   . GLY D  4  16  ? 40.964 67.793  173.113 1.00 44.76  ? 16   GLY D C   1 
ATOM   9766  O  O   . GLY D  4  16  ? 41.742 68.542  173.733 1.00 45.05  ? 16   GLY D O   1 
ATOM   9767  N  N   . LEU D  4  17  ? 40.980 67.653  171.778 1.00 44.33  ? 17   LEU D N   1 
ATOM   9768  C  CA  . LEU D  4  17  ? 41.923 68.360  170.925 1.00 43.90  ? 17   LEU D CA  1 
ATOM   9769  C  C   . LEU D  4  17  ? 41.918 69.876  171.134 1.00 42.84  ? 17   LEU D C   1 
ATOM   9770  O  O   . LEU D  4  17  ? 42.968 70.491  171.207 1.00 42.67  ? 17   LEU D O   1 
ATOM   9771  C  CB  . LEU D  4  17  ? 41.685 68.027  169.451 1.00 44.43  ? 17   LEU D CB  1 
ATOM   9772  C  CG  . LEU D  4  17  ? 41.852 66.573  168.995 1.00 56.56  ? 17   LEU D CG  1 
ATOM   9773  C  CD1 . LEU D  4  17  ? 41.820 66.526  167.468 1.00 59.82  ? 17   LEU D CD1 1 
ATOM   9774  C  CD2 . LEU D  4  17  ? 43.154 65.939  169.526 1.00 57.97  ? 17   LEU D CD2 1 
ATOM   9775  N  N   . LEU D  4  18  ? 40.731 70.461  171.252 1.00 41.81  ? 18   LEU D N   1 
ATOM   9776  C  CA  . LEU D  4  18  ? 40.610 71.899  171.447 1.00 40.92  ? 18   LEU D CA  1 
ATOM   9777  C  C   . LEU D  4  18  ? 40.155 72.211  172.863 1.00 40.07  ? 18   LEU D C   1 
ATOM   9778  O  O   . LEU D  4  18  ? 39.335 73.110  173.067 1.00 40.07  ? 18   LEU D O   1 
ATOM   9779  C  CB  . LEU D  4  18  ? 39.580 72.458  170.478 1.00 40.93  ? 18   LEU D CB  1 
ATOM   9780  C  CG  . LEU D  4  18  ? 39.659 71.985  169.037 1.00 45.57  ? 18   LEU D CG  1 
ATOM   9781  C  CD1 . LEU D  4  18  ? 38.426 72.460  168.260 1.00 47.20  ? 18   LEU D CD1 1 
ATOM   9782  C  CD2 . LEU D  4  18  ? 40.963 72.481  168.370 1.00 49.41  ? 18   LEU D CD2 1 
ATOM   9783  N  N   . SER D  4  19  ? 40.704 71.500  173.846 1.00 39.25  ? 19   SER D N   1 
ATOM   9784  C  CA  . SER D  4  19  ? 40.250 71.664  175.235 1.00 38.43  ? 19   SER D CA  1 
ATOM   9785  C  C   . SER D  4  19  ? 41.190 72.321  176.229 1.00 37.31  ? 19   SER D C   1 
ATOM   9786  O  O   . SER D  4  19  ? 42.244 71.780  176.557 1.00 37.15  ? 19   SER D O   1 
ATOM   9787  C  CB  . SER D  4  19  ? 39.737 70.348  175.790 1.00 38.42  ? 19   SER D CB  1 
ATOM   9788  O  OG  . SER D  4  19  ? 38.635 69.890  175.031 1.00 41.57  ? 19   SER D OG  1 
ATOM   9789  N  N   . SER D  4  20  ? 40.740 73.458  176.763 1.00 36.33  ? 20   SER D N   1 
ATOM   9790  C  CA  . SER D  4  20  ? 41.483 74.233  177.755 1.00 35.56  ? 20   SER D CA  1 
ATOM   9791  C  C   . SER D  4  20  ? 41.587 73.505  179.092 1.00 35.23  ? 20   SER D C   1 
ATOM   9792  O  O   . SER D  4  20  ? 41.058 72.396  179.272 1.00 35.61  ? 20   SER D O   1 
ATOM   9793  C  CB  . SER D  4  20  ? 40.781 75.570  177.971 1.00 35.42  ? 20   SER D CB  1 
ATOM   9794  O  OG  . SER D  4  20  ? 41.350 76.302  179.019 1.00 34.30  ? 20   SER D OG  1 
ATOM   9795  N  N   . LEU D  4  21  ? 42.273 74.124  180.032 1.00 34.34  ? 21   LEU D N   1 
ATOM   9796  C  CA  . LEU D  4  21  ? 42.403 73.559  181.359 1.00 33.18  ? 21   LEU D CA  1 
ATOM   9797  C  C   . LEU D  4  21  ? 41.357 74.204  182.249 1.00 32.82  ? 21   LEU D C   1 
ATOM   9798  O  O   . LEU D  4  21  ? 40.821 75.266  181.927 1.00 32.80  ? 21   LEU D O   1 
ATOM   9799  C  CB  . LEU D  4  21  ? 43.801 73.839  181.924 1.00 32.56  ? 21   LEU D CB  1 
ATOM   9800  C  CG  . LEU D  4  21  ? 44.998 73.034  181.402 1.00 27.09  ? 21   LEU D CG  1 
ATOM   9801  C  CD1 . LEU D  4  21  ? 46.283 73.805  181.550 1.00 25.77  ? 21   LEU D CD1 1 
ATOM   9802  C  CD2 . LEU D  4  21  ? 45.122 71.685  182.070 1.00 23.70  ? 21   LEU D CD2 1 
ATOM   9803  N  N   . ASP D  4  22  ? 41.011 73.529  183.330 1.00 32.63  ? 22   ASP D N   1 
ATOM   9804  C  CA  . ASP D  4  22  ? 40.116 74.098  184.306 1.00 32.36  ? 22   ASP D CA  1 
ATOM   9805  C  C   . ASP D  4  22  ? 41.095 74.857  185.192 1.00 32.15  ? 22   ASP D C   1 
ATOM   9806  O  O   . ASP D  4  22  ? 41.834 74.246  185.968 1.00 32.14  ? 22   ASP D O   1 
ATOM   9807  C  CB  . ASP D  4  22  ? 39.411 72.976  185.110 1.00 32.35  ? 22   ASP D CB  1 
ATOM   9808  C  CG  . ASP D  4  22  ? 38.172 73.479  185.915 1.00 29.41  ? 22   ASP D CG  1 
ATOM   9809  O  OD1 . ASP D  4  22  ? 37.982 74.714  186.070 1.00 23.35  ? 22   ASP D OD1 1 
ATOM   9810  O  OD2 . ASP D  4  22  ? 37.338 72.692  186.419 1.00 31.32  ? 22   ASP D OD2 1 
ATOM   9811  N  N   . HIS D  4  23  ? 41.154 76.180  185.015 1.00 32.01  ? 23   HIS D N   1 
ATOM   9812  C  CA  . HIS D  4  23  ? 42.065 77.044  185.794 1.00 32.04  ? 23   HIS D CA  1 
ATOM   9813  C  C   . HIS D  4  23  ? 41.743 77.170  187.293 1.00 31.51  ? 23   HIS D C   1 
ATOM   9814  O  O   . HIS D  4  23  ? 42.608 77.543  188.103 1.00 31.06  ? 23   HIS D O   1 
ATOM   9815  C  CB  . HIS D  4  23  ? 42.199 78.396  185.138 1.00 32.50  ? 23   HIS D CB  1 
ATOM   9816  C  CG  . HIS D  4  23  ? 42.884 78.335  183.820 1.00 44.63  ? 23   HIS D CG  1 
ATOM   9817  N  ND1 . HIS D  4  23  ? 44.230 78.579  183.677 1.00 46.41  ? 23   HIS D ND1 1 
ATOM   9818  C  CD2 . HIS D  4  23  ? 42.437 77.957  182.601 1.00 44.78  ? 23   HIS D CD2 1 
ATOM   9819  C  CE1 . HIS D  4  23  ? 44.573 78.401  182.415 1.00 53.81  ? 23   HIS D CE1 1 
ATOM   9820  N  NE2 . HIS D  4  23  ? 43.502 78.020  181.743 1.00 54.49  ? 23   HIS D NE2 1 
ATOM   9821  N  N   . THR D  4  24  ? 40.504 76.854  187.651 1.00 31.32  ? 24   THR D N   1 
ATOM   9822  C  CA  . THR D  4  24  ? 40.105 76.849  189.035 1.00 31.24  ? 24   THR D CA  1 
ATOM   9823  C  C   . THR D  4  24  ? 40.695 75.571  189.626 1.00 31.00  ? 24   THR D C   1 
ATOM   9824  O  O   . THR D  4  24  ? 41.124 75.545  190.777 1.00 30.73  ? 24   THR D O   1 
ATOM   9825  C  CB  . THR D  4  24  ? 38.566 76.813  189.151 1.00 31.30  ? 24   THR D CB  1 
ATOM   9826  O  OG1 . THR D  4  24  ? 37.981 77.487  188.029 1.00 36.65  ? 24   THR D OG1 1 
ATOM   9827  C  CG2 . THR D  4  24  ? 38.090 77.633  190.366 1.00 27.53  ? 24   THR D CG2 1 
ATOM   9828  N  N   . SER D  4  25  ? 40.754 74.519  188.804 1.00 30.82  ? 25   SER D N   1 
ATOM   9829  C  CA  . SER D  4  25  ? 41.291 73.234  189.249 1.00 30.65  ? 25   SER D CA  1 
ATOM   9830  C  C   . SER D  4  25  ? 42.832 73.198  189.345 1.00 30.73  ? 25   SER D C   1 
ATOM   9831  O  O   . SER D  4  25  ? 43.397 72.346  190.055 1.00 30.53  ? 25   SER D O   1 
ATOM   9832  C  CB  . SER D  4  25  ? 40.769 72.089  188.382 1.00 30.33  ? 25   SER D CB  1 
ATOM   9833  O  OG  . SER D  4  25  ? 41.395 70.863  188.726 1.00 22.07  ? 25   SER D OG  1 
ATOM   9834  N  N   . ILE D  4  26  ? 43.501 74.106  188.620 1.00 30.78  ? 26   ILE D N   1 
ATOM   9835  C  CA  . ILE D  4  26  ? 44.970 74.207  188.667 1.00 31.03  ? 26   ILE D CA  1 
ATOM   9836  C  C   . ILE D  4  26  ? 45.350 74.849  190.009 1.00 30.95  ? 26   ILE D C   1 
ATOM   9837  O  O   . ILE D  4  26  ? 46.390 74.518  190.595 1.00 30.74  ? 26   ILE D O   1 
ATOM   9838  C  CB  . ILE D  4  26  ? 45.524 75.072  187.457 1.00 31.33  ? 26   ILE D CB  1 
ATOM   9839  C  CG1 . ILE D  4  26  ? 45.116 74.459  186.119 1.00 35.40  ? 26   ILE D CG1 1 
ATOM   9840  C  CG2 . ILE D  4  26  ? 47.060 75.188  187.505 1.00 28.78  ? 26   ILE D CG2 1 
ATOM   9841  C  CD1 . ILE D  4  26  ? 45.459 75.324  184.939 1.00 33.47  ? 26   ILE D CD1 1 
ATOM   9842  N  N   . ARG D  4  27  ? 44.475 75.754  190.487 1.00 31.13  ? 27   ARG D N   1 
ATOM   9843  C  CA  . ARG D  4  27  ? 44.639 76.454  191.785 1.00 31.37  ? 27   ARG D CA  1 
ATOM   9844  C  C   . ARG D  4  27  ? 44.742 75.499  192.916 1.00 31.32  ? 27   ARG D C   1 
ATOM   9845  O  O   . ARG D  4  27  ? 45.755 75.423  193.592 1.00 30.90  ? 27   ARG D O   1 
ATOM   9846  C  CB  . ARG D  4  27  ? 43.411 77.303  192.098 1.00 31.39  ? 27   ARG D CB  1 
ATOM   9847  C  CG  . ARG D  4  27  ? 43.286 78.538  191.343 1.00 40.08  ? 27   ARG D CG  1 
ATOM   9848  C  CD  . ARG D  4  27  ? 42.532 79.563  192.077 1.00 37.12  ? 27   ARG D CD  1 
ATOM   9849  N  NE  . ARG D  4  27  ? 42.937 79.567  193.467 1.00 35.89  ? 27   ARG D NE  1 
ATOM   9850  C  CZ  . ARG D  4  27  ? 42.621 80.504  194.312 1.00 35.75  ? 27   ARG D CZ  1 
ATOM   9851  N  NH1 . ARG D  4  27  ? 41.930 81.522  193.907 1.00 30.58  ? 27   ARG D NH1 1 
ATOM   9852  N  NH2 . ARG D  4  27  ? 43.008 80.429  195.571 1.00 40.94  ? 27   ARG D NH2 1 
ATOM   9853  N  N   . ARG D  4  28  ? 43.633 74.804  193.153 1.00 31.72  ? 28   ARG D N   1 
ATOM   9854  C  CA  . ARG D  4  28  ? 43.530 73.838  194.224 1.00 32.13  ? 28   ARG D CA  1 
ATOM   9855  C  C   . ARG D  4  28  ? 44.679 72.828  194.142 1.00 32.64  ? 28   ARG D C   1 
ATOM   9856  O  O   . ARG D  4  28  ? 45.195 72.392  195.165 1.00 32.67  ? 28   ARG D O   1 
ATOM   9857  C  CB  . ARG D  4  28  ? 42.186 73.121  194.159 1.00 31.98  ? 28   ARG D CB  1 
ATOM   9858  C  CG  . ARG D  4  28  ? 40.953 74.017  193.836 1.00 31.92  ? 28   ARG D CG  1 
ATOM   9859  C  CD  . ARG D  4  28  ? 39.700 73.185  193.515 1.00 31.55  ? 28   ARG D CD  1 
ATOM   9860  N  NE  . ARG D  4  28  ? 38.525 73.925  193.082 1.00 35.43  ? 28   ARG D NE  1 
ATOM   9861  C  CZ  . ARG D  4  28  ? 37.648 73.455  192.189 1.00 32.07  ? 28   ARG D CZ  1 
ATOM   9862  N  NH1 . ARG D  4  28  ? 37.842 72.259  191.630 1.00 23.82  ? 28   ARG D NH1 1 
ATOM   9863  N  NH2 . ARG D  4  28  ? 36.589 74.178  191.848 1.00 30.96  ? 28   ARG D NH2 1 
ATOM   9864  N  N   . GLY D  4  29  ? 45.091 72.497  192.908 1.00 32.89  ? 29   GLY D N   1 
ATOM   9865  C  CA  . GLY D  4  29  ? 46.192 71.579  192.670 1.00 33.17  ? 29   GLY D CA  1 
ATOM   9866  C  C   . GLY D  4  29  ? 47.515 72.196  193.074 1.00 33.61  ? 29   GLY D C   1 
ATOM   9867  O  O   . GLY D  4  29  ? 48.437 71.481  193.517 1.00 33.62  ? 29   GLY D O   1 
ATOM   9868  N  N   . PHE D  4  30  ? 47.622 73.524  192.903 1.00 33.86  ? 30   PHE D N   1 
ATOM   9869  C  CA  . PHE D  4  30  ? 48.808 74.262  193.338 1.00 34.13  ? 30   PHE D CA  1 
ATOM   9870  C  C   . PHE D  4  30  ? 48.800 74.222  194.846 1.00 33.89  ? 30   PHE D C   1 
ATOM   9871  O  O   . PHE D  4  30  ? 49.844 74.026  195.467 1.00 34.01  ? 30   PHE D O   1 
ATOM   9872  C  CB  . PHE D  4  30  ? 48.791 75.733  192.838 1.00 34.53  ? 30   PHE D CB  1 
ATOM   9873  C  CG  . PHE D  4  30  ? 49.546 76.708  193.750 1.00 40.55  ? 30   PHE D CG  1 
ATOM   9874  C  CD1 . PHE D  4  30  ? 50.952 76.719  193.789 1.00 40.04  ? 30   PHE D CD1 1 
ATOM   9875  C  CD2 . PHE D  4  30  ? 48.847 77.598  194.574 1.00 37.97  ? 30   PHE D CD2 1 
ATOM   9876  C  CE1 . PHE D  4  30  ? 51.631 77.589  194.636 1.00 38.93  ? 30   PHE D CE1 1 
ATOM   9877  C  CE2 . PHE D  4  30  ? 49.518 78.466  195.417 1.00 36.40  ? 30   PHE D CE2 1 
ATOM   9878  C  CZ  . PHE D  4  30  ? 50.911 78.468  195.450 1.00 38.73  ? 30   PHE D CZ  1 
ATOM   9879  N  N   . GLN D  4  31  ? 47.609 74.396  195.437 1.00 33.50  ? 31   GLN D N   1 
ATOM   9880  C  CA  . GLN D  4  31  ? 47.461 74.334  196.894 1.00 32.89  ? 31   GLN D CA  1 
ATOM   9881  C  C   . GLN D  4  31  ? 47.949 72.973  197.383 1.00 32.23  ? 31   GLN D C   1 
ATOM   9882  O  O   . GLN D  4  31  ? 48.725 72.895  198.334 1.00 31.93  ? 31   GLN D O   1 
ATOM   9883  C  CB  . GLN D  4  31  ? 46.009 74.558  197.318 1.00 32.70  ? 31   GLN D CB  1 
ATOM   9884  C  CG  . GLN D  4  31  ? 45.393 75.854  196.845 1.00 34.33  ? 31   GLN D CG  1 
ATOM   9885  C  CD  . GLN D  4  31  ? 43.923 76.003  197.270 1.00 38.54  ? 31   GLN D CD  1 
ATOM   9886  O  OE1 . GLN D  4  31  ? 43.545 75.601  198.370 1.00 38.32  ? 31   GLN D OE1 1 
ATOM   9887  N  NE2 . GLN D  4  31  ? 43.106 76.586  196.400 1.00 39.44  ? 31   GLN D NE2 1 
ATOM   9888  N  N   . VAL D  4  32  ? 47.534 71.910  196.687 1.00 31.99  ? 32   VAL D N   1 
ATOM   9889  C  CA  . VAL D  4  32  ? 47.964 70.560  197.029 1.00 32.00  ? 32   VAL D CA  1 
ATOM   9890  C  C   . VAL D  4  32  ? 49.483 70.465  196.930 1.00 32.87  ? 32   VAL D C   1 
ATOM   9891  O  O   . VAL D  4  32  ? 50.126 69.898  197.815 1.00 32.77  ? 32   VAL D O   1 
ATOM   9892  C  CB  . VAL D  4  32  ? 47.322 69.497  196.131 1.00 31.48  ? 32   VAL D CB  1 
ATOM   9893  C  CG1 . VAL D  4  32  ? 47.807 68.118  196.518 1.00 26.02  ? 32   VAL D CG1 1 
ATOM   9894  C  CG2 . VAL D  4  32  ? 45.841 69.562  196.226 1.00 20.49  ? 32   VAL D CG2 1 
ATOM   9895  N  N   . TYR D  4  33  ? 50.063 71.064  195.875 1.00 33.74  ? 33   TYR D N   1 
ATOM   9896  C  CA  . TYR D  4  33  ? 51.518 71.065  195.732 1.00 34.27  ? 33   TYR D CA  1 
ATOM   9897  C  C   . TYR D  4  33  ? 52.190 71.790  196.906 1.00 35.41  ? 33   TYR D C   1 
ATOM   9898  O  O   . TYR D  4  33  ? 53.093 71.250  197.547 1.00 35.14  ? 33   TYR D O   1 
ATOM   9899  C  CB  . TYR D  4  33  ? 52.000 71.682  194.404 1.00 33.52  ? 33   TYR D CB  1 
ATOM   9900  C  CG  . TYR D  4  33  ? 53.494 71.807  194.423 1.00 22.17  ? 33   TYR D CG  1 
ATOM   9901  C  CD1 . TYR D  4  33  ? 54.301 70.660  194.407 1.00 22.68  ? 33   TYR D CD1 1 
ATOM   9902  C  CD2 . TYR D  4  33  ? 54.108 73.035  194.611 1.00 21.51  ? 33   TYR D CD2 1 
ATOM   9903  C  CE1 . TYR D  4  33  ? 55.676 70.741  194.510 1.00 22.93  ? 33   TYR D CE1 1 
ATOM   9904  C  CE2 . TYR D  4  33  ? 55.491 73.127  194.719 1.00 30.47  ? 33   TYR D CE2 1 
ATOM   9905  C  CZ  . TYR D  4  33  ? 56.268 71.968  194.656 1.00 29.36  ? 33   TYR D CZ  1 
ATOM   9906  O  OH  . TYR D  4  33  ? 57.638 72.046  194.746 1.00 37.89  ? 33   TYR D OH  1 
ATOM   9907  N  N   . LYS D  4  34  ? 51.712 73.007  197.168 1.00 36.76  ? 34   LYS D N   1 
ATOM   9908  C  CA  . LYS D  4  34  ? 52.249 73.903  198.190 1.00 38.18  ? 34   LYS D CA  1 
ATOM   9909  C  C   . LYS D  4  34  ? 52.543 73.296  199.561 1.00 39.43  ? 34   LYS D C   1 
ATOM   9910  O  O   . LYS D  4  34  ? 53.648 73.445  200.085 1.00 39.57  ? 34   LYS D O   1 
ATOM   9911  C  CB  . LYS D  4  34  ? 51.335 75.131  198.345 1.00 38.35  ? 34   LYS D CB  1 
ATOM   9912  C  CG  . LYS D  4  34  ? 51.775 76.110  199.433 1.00 42.72  ? 34   LYS D CG  1 
ATOM   9913  C  CD  . LYS D  4  34  ? 50.702 77.135  199.732 1.00 44.87  ? 34   LYS D CD  1 
ATOM   9914  C  CE  . LYS D  4  34  ? 51.081 77.960  200.941 1.00 48.11  ? 34   LYS D CE  1 
ATOM   9915  N  NZ  . LYS D  4  34  ? 50.006 78.925  201.314 1.00 51.75  ? 34   LYS D NZ  1 
ATOM   9916  N  N   . GLN D  4  35  ? 51.558 72.620  200.143 1.00 40.47  ? 35   GLN D N   1 
ATOM   9917  C  CA  . GLN D  4  35  ? 51.718 72.043  201.491 1.00 41.37  ? 35   GLN D CA  1 
ATOM   9918  C  C   . GLN D  4  35  ? 52.254 70.619  201.472 1.00 42.22  ? 35   GLN D C   1 
ATOM   9919  O  O   . GLN D  4  35  ? 53.372 70.347  201.949 1.00 42.39  ? 35   GLN D O   1 
ATOM   9920  C  CB  . GLN D  4  35  ? 50.378 72.034  202.235 1.00 41.07  ? 35   GLN D CB  1 
ATOM   9921  C  CG  . GLN D  4  35  ? 49.473 73.176  201.903 1.00 32.64  ? 35   GLN D CG  1 
ATOM   9922  C  CD  . GLN D  4  35  ? 48.037 72.781  201.999 1.00 29.93  ? 35   GLN D CD  1 
ATOM   9923  O  OE1 . GLN D  4  35  ? 47.577 71.923  201.251 1.00 22.13  ? 35   GLN D OE1 1 
ATOM   9924  N  NE2 . GLN D  4  35  ? 47.324 73.364  202.945 1.00 37.54  ? 35   GLN D NE2 1 
ATOM   9925  N  N   . VAL D  4  36  ? 51.425 69.713  200.944 1.00 42.66  ? 36   VAL D N   1 
ATOM   9926  C  CA  . VAL D  4  36  ? 51.713 68.280  200.894 1.00 42.95  ? 36   VAL D CA  1 
ATOM   9927  C  C   . VAL D  4  36  ? 53.009 67.896  200.145 1.00 43.55  ? 36   VAL D C   1 
ATOM   9928  O  O   . VAL D  4  36  ? 54.047 67.619  200.774 1.00 43.76  ? 36   VAL D O   1 
ATOM   9929  C  CB  . VAL D  4  36  ? 50.525 67.515  200.265 1.00 42.71  ? 36   VAL D CB  1 
ATOM   9930  C  CG1 . VAL D  4  36  ? 50.568 66.056  200.657 1.00 43.47  ? 36   VAL D CG1 1 
ATOM   9931  C  CG2 . VAL D  4  36  ? 49.194 68.151  200.686 1.00 34.29  ? 36   VAL D CG2 1 
ATOM   9932  N  N   . CYS D  4  37  ? 52.924 67.902  198.808 1.00 43.73  ? 37   CYS D N   1 
ATOM   9933  C  CA  . CYS D  4  37  ? 54.011 67.519  197.886 1.00 43.58  ? 37   CYS D CA  1 
ATOM   9934  C  C   . CYS D  4  37  ? 55.339 68.229  198.110 1.00 43.42  ? 37   CYS D C   1 
ATOM   9935  O  O   . CYS D  4  37  ? 56.376 67.574  198.246 1.00 43.18  ? 37   CYS D O   1 
ATOM   9936  C  CB  . CYS D  4  37  ? 53.550 67.761  196.476 1.00 43.68  ? 37   CYS D CB  1 
ATOM   9937  S  SG  . CYS D  4  37  ? 51.750 67.627  196.309 1.00 50.50  ? 37   CYS D SG  1 
ATOM   9938  N  N   . SER D  4  38  ? 55.276 69.568  198.193 1.00 43.55  ? 38   SER D N   1 
ATOM   9939  C  CA  . SER D  4  38  ? 56.452 70.461  198.355 1.00 43.75  ? 38   SER D CA  1 
ATOM   9940  C  C   . SER D  4  38  ? 57.510 70.065  199.360 1.00 43.98  ? 38   SER D C   1 
ATOM   9941  O  O   . SER D  4  38  ? 58.700 70.275  199.123 1.00 44.17  ? 38   SER D O   1 
ATOM   9942  C  CB  . SER D  4  38  ? 56.006 71.863  198.686 1.00 43.70  ? 38   SER D CB  1 
ATOM   9943  O  OG  . SER D  4  38  ? 55.403 71.885  199.960 1.00 40.95  ? 38   SER D OG  1 
ATOM   9944  N  N   . SER D  4  39  ? 57.086 69.544  200.503 1.00 43.99  ? 39   SER D N   1 
ATOM   9945  C  CA  . SER D  4  39  ? 58.030 69.130  201.532 1.00 43.91  ? 39   SER D CA  1 
ATOM   9946  C  C   . SER D  4  39  ? 59.025 68.068  201.017 1.00 44.03  ? 39   SER D C   1 
ATOM   9947  O  O   . SER D  4  39  ? 60.149 67.966  201.508 1.00 44.14  ? 39   SER D O   1 
ATOM   9948  C  CB  . SER D  4  39  ? 57.297 68.668  202.810 1.00 43.76  ? 39   SER D CB  1 
ATOM   9949  O  OG  . SER D  4  39  ? 56.103 67.960  202.505 1.00 31.67  ? 39   SER D OG  1 
ATOM   9950  N  N   . CYS D  4  40  ? 58.631 67.336  199.984 1.00 44.02  ? 40   CYS D N   1 
ATOM   9951  C  CA  . CYS D  4  40  ? 59.498 66.331  199.420 1.00 44.22  ? 40   CYS D CA  1 
ATOM   9952  C  C   . CYS D  4  40  ? 59.765 66.499  197.934 1.00 44.08  ? 40   CYS D C   1 
ATOM   9953  O  O   . CYS D  4  40  ? 60.784 66.029  197.427 1.00 44.30  ? 40   CYS D O   1 
ATOM   9954  C  CB  . CYS D  4  40  ? 58.950 64.950  199.696 1.00 44.54  ? 40   CYS D CB  1 
ATOM   9955  S  SG  . CYS D  4  40  ? 59.255 64.405  201.371 1.00 57.33  ? 40   CYS D SG  1 
ATOM   9956  N  N   . HIS D  4  41  ? 58.864 67.191  197.241 1.00 43.65  ? 41   HIS D N   1 
ATOM   9957  C  CA  . HIS D  4  41  ? 58.970 67.369  195.787 1.00 42.90  ? 41   HIS D CA  1 
ATOM   9958  C  C   . HIS D  4  41  ? 59.473 68.715  195.299 1.00 42.01  ? 41   HIS D C   1 
ATOM   9959  O  O   . HIS D  4  41  ? 58.860 69.756  195.573 1.00 41.76  ? 41   HIS D O   1 
ATOM   9960  C  CB  . HIS D  4  41  ? 57.640 67.050  195.122 1.00 42.90  ? 41   HIS D CB  1 
ATOM   9961  C  CG  . HIS D  4  41  ? 57.389 65.592  194.970 1.00 43.70  ? 41   HIS D CG  1 
ATOM   9962  N  ND1 . HIS D  4  41  ? 58.006 64.831  194.001 1.00 46.26  ? 41   HIS D ND1 1 
ATOM   9963  C  CD2 . HIS D  4  41  ? 56.623 64.742  195.687 1.00 41.67  ? 41   HIS D CD2 1 
ATOM   9964  C  CE1 . HIS D  4  41  ? 57.598 63.581  194.105 1.00 43.55  ? 41   HIS D CE1 1 
ATOM   9965  N  NE2 . HIS D  4  41  ? 56.777 63.497  195.133 1.00 41.62  ? 41   HIS D NE2 1 
ATOM   9966  N  N   . SER D  4  42  ? 60.570 68.683  194.536 1.00 41.34  ? 42   SER D N   1 
ATOM   9967  C  CA  . SER D  4  42  ? 61.145 69.900  193.962 1.00 40.70  ? 42   SER D CA  1 
ATOM   9968  C  C   . SER D  4  42  ? 60.445 70.226  192.656 1.00 40.30  ? 42   SER D C   1 
ATOM   9969  O  O   . SER D  4  42  ? 60.185 69.345  191.849 1.00 40.65  ? 42   SER D O   1 
ATOM   9970  C  CB  . SER D  4  42  ? 62.667 69.754  193.746 1.00 40.46  ? 42   SER D CB  1 
ATOM   9971  O  OG  . SER D  4  42  ? 62.973 68.817  192.731 1.00 39.28  ? 42   SER D OG  1 
ATOM   9972  N  N   . MET D  4  43  ? 60.074 71.483  192.482 1.00 39.46  ? 43   MET D N   1 
ATOM   9973  C  CA  . MET D  4  43  ? 59.439 71.909  191.243 1.00 38.41  ? 43   MET D CA  1 
ATOM   9974  C  C   . MET D  4  43  ? 60.288 73.053  190.727 1.00 37.60  ? 43   MET D C   1 
ATOM   9975  O  O   . MET D  4  43  ? 59.817 74.189  190.573 1.00 37.34  ? 43   MET D O   1 
ATOM   9976  C  CB  . MET D  4  43  ? 58.000 72.341  191.486 1.00 38.13  ? 43   MET D CB  1 
ATOM   9977  C  CG  . MET D  4  43  ? 57.078 71.955  190.375 1.00 33.74  ? 43   MET D CG  1 
ATOM   9978  S  SD  . MET D  4  43  ? 55.378 72.264  190.676 1.00 31.30  ? 43   MET D SD  1 
ATOM   9979  C  CE  . MET D  4  43  ? 55.447 73.935  191.129 1.00 33.40  ? 43   MET D CE  1 
ATOM   9980  N  N   . ASP D  4  44  ? 61.560 72.716  190.474 1.00 37.02  ? 44   ASP D N   1 
ATOM   9981  C  CA  . ASP D  4  44  ? 62.619 73.642  190.037 1.00 36.53  ? 44   ASP D CA  1 
ATOM   9982  C  C   . ASP D  4  44  ? 62.332 74.583  188.854 1.00 35.40  ? 44   ASP D C   1 
ATOM   9983  O  O   . ASP D  4  44  ? 62.949 75.640  188.740 1.00 35.01  ? 44   ASP D O   1 
ATOM   9984  C  CB  . ASP D  4  44  ? 63.898 72.849  189.748 1.00 36.95  ? 44   ASP D CB  1 
ATOM   9985  C  CG  . ASP D  4  44  ? 64.433 72.153  190.967 1.00 41.46  ? 44   ASP D CG  1 
ATOM   9986  O  OD1 . ASP D  4  44  ? 65.400 71.366  190.838 1.00 44.17  ? 44   ASP D OD1 1 
ATOM   9987  O  OD2 . ASP D  4  44  ? 63.964 72.343  192.097 1.00 43.71  ? 44   ASP D OD2 1 
ATOM   9988  N  N   . TYR D  4  45  ? 61.386 74.212  188.002 1.00 34.79  ? 45   TYR D N   1 
ATOM   9989  C  CA  . TYR D  4  45  ? 61.117 74.986  186.805 1.00 34.27  ? 45   TYR D CA  1 
ATOM   9990  C  C   . TYR D  4  45  ? 59.912 75.922  186.802 1.00 34.65  ? 45   TYR D C   1 
ATOM   9991  O  O   . TYR D  4  45  ? 59.680 76.641  185.819 1.00 35.09  ? 45   TYR D O   1 
ATOM   9992  C  CB  . TYR D  4  45  ? 61.146 74.088  185.580 1.00 33.44  ? 45   TYR D CB  1 
ATOM   9993  C  CG  . TYR D  4  45  ? 62.484 73.436  185.399 1.00 17.90  ? 45   TYR D CG  1 
ATOM   9994  C  CD1 . TYR D  4  45  ? 62.604 72.053  185.268 1.00 14.29  ? 45   TYR D CD1 1 
ATOM   9995  C  CD2 . TYR D  4  45  ? 63.640 74.202  185.384 1.00 16.31  ? 45   TYR D CD2 1 
ATOM   9996  C  CE1 . TYR D  4  45  ? 63.851 71.451  185.109 1.00 9.63   ? 45   TYR D CE1 1 
ATOM   9997  C  CE2 . TYR D  4  45  ? 64.888 73.621  185.222 1.00 19.52  ? 45   TYR D CE2 1 
ATOM   9998  C  CZ  . TYR D  4  45  ? 64.992 72.245  185.085 1.00 19.70  ? 45   TYR D CZ  1 
ATOM   9999  O  OH  . TYR D  4  45  ? 66.247 71.683  184.926 1.00 18.28  ? 45   TYR D OH  1 
ATOM   10000 N  N   . VAL D  4  46  ? 59.147 75.931  187.879 1.00 34.57  ? 46   VAL D N   1 
ATOM   10001 C  CA  . VAL D  4  46  ? 58.006 76.835  187.946 1.00 34.70  ? 46   VAL D CA  1 
ATOM   10002 C  C   . VAL D  4  46  ? 58.323 77.985  188.903 1.00 35.63  ? 46   VAL D C   1 
ATOM   10003 O  O   . VAL D  4  46  ? 59.059 77.813  189.863 1.00 35.77  ? 46   VAL D O   1 
ATOM   10004 C  CB  . VAL D  4  46  ? 56.710 76.104  188.354 1.00 34.10  ? 46   VAL D CB  1 
ATOM   10005 C  CG1 . VAL D  4  46  ? 55.475 76.920  187.956 1.00 21.09  ? 46   VAL D CG1 1 
ATOM   10006 C  CG2 . VAL D  4  46  ? 56.654 74.761  187.684 1.00 23.34  ? 46   VAL D CG2 1 
ATOM   10007 N  N   . ALA D  4  47  ? 57.810 79.167  188.593 1.00 36.21  ? 47   ALA D N   1 
ATOM   10008 C  CA  . ALA D  4  47  ? 58.033 80.357  189.405 1.00 36.36  ? 47   ALA D CA  1 
ATOM   10009 C  C   . ALA D  4  47  ? 56.710 80.947  189.804 1.00 36.73  ? 47   ALA D C   1 
ATOM   10010 O  O   . ALA D  4  47  ? 55.665 80.539  189.305 1.00 36.56  ? 47   ALA D O   1 
ATOM   10011 C  CB  . ALA D  4  47  ? 58.836 81.372  188.636 1.00 36.19  ? 47   ALA D CB  1 
ATOM   10012 N  N   . TYR D  4  48  ? 56.757 81.936  190.683 1.00 37.37  ? 48   TYR D N   1 
ATOM   10013 C  CA  . TYR D  4  48  ? 55.550 82.589  191.157 1.00 38.09  ? 48   TYR D CA  1 
ATOM   10014 C  C   . TYR D  4  48  ? 54.874 83.459  190.106 1.00 38.45  ? 48   TYR D C   1 
ATOM   10015 O  O   . TYR D  4  48  ? 53.642 83.467  190.000 1.00 38.28  ? 48   TYR D O   1 
ATOM   10016 C  CB  . TYR D  4  48  ? 55.840 83.367  192.417 1.00 38.54  ? 48   TYR D CB  1 
ATOM   10017 C  CG  . TYR D  4  48  ? 56.161 82.455  193.561 1.00 49.47  ? 48   TYR D CG  1 
ATOM   10018 C  CD1 . TYR D  4  48  ? 57.480 82.139  193.879 1.00 51.81  ? 48   TYR D CD1 1 
ATOM   10019 C  CD2 . TYR D  4  48  ? 55.140 81.850  194.296 1.00 51.18  ? 48   TYR D CD2 1 
ATOM   10020 C  CE1 . TYR D  4  48  ? 57.774 81.272  194.922 1.00 50.16  ? 48   TYR D CE1 1 
ATOM   10021 C  CE2 . TYR D  4  48  ? 55.423 80.990  195.336 1.00 49.59  ? 48   TYR D CE2 1 
ATOM   10022 C  CZ  . TYR D  4  48  ? 56.740 80.702  195.644 1.00 49.79  ? 48   TYR D CZ  1 
ATOM   10023 O  OH  . TYR D  4  48  ? 57.018 79.849  196.676 1.00 49.91  ? 48   TYR D OH  1 
ATOM   10024 N  N   . ARG D  4  49  ? 55.687 84.161  189.305 1.00 38.89  ? 49   ARG D N   1 
ATOM   10025 C  CA  . ARG D  4  49  ? 55.176 85.002  188.222 1.00 39.11  ? 49   ARG D CA  1 
ATOM   10026 C  C   . ARG D  4  49  ? 54.450 84.150  187.145 1.00 39.49  ? 49   ARG D C   1 
ATOM   10027 O  O   . ARG D  4  49  ? 53.542 84.642  186.470 1.00 39.66  ? 49   ARG D O   1 
ATOM   10028 C  CB  . ARG D  4  49  ? 56.302 85.854  187.599 1.00 38.99  ? 49   ARG D CB  1 
ATOM   10029 C  CG  . ARG D  4  49  ? 57.527 85.066  187.203 1.00 35.22  ? 49   ARG D CG  1 
ATOM   10030 C  CD  . ARG D  4  49  ? 58.415 85.741  186.163 1.00 38.77  ? 49   ARG D CD  1 
ATOM   10031 N  NE  . ARG D  4  49  ? 59.103 84.739  185.349 1.00 36.67  ? 49   ARG D NE  1 
ATOM   10032 C  CZ  . ARG D  4  49  ? 60.253 84.165  185.686 1.00 37.09  ? 49   ARG D CZ  1 
ATOM   10033 N  NH1 . ARG D  4  49  ? 60.875 84.520  186.813 1.00 32.37  ? 49   ARG D NH1 1 
ATOM   10034 N  NH2 . ARG D  4  49  ? 60.788 83.240  184.899 1.00 35.09  ? 49   ARG D NH2 1 
ATOM   10035 N  N   . HIS D  4  50  ? 54.835 82.865  187.032 1.00 39.61  ? 50   HIS D N   1 
ATOM   10036 C  CA  . HIS D  4  50  ? 54.211 81.929  186.086 1.00 39.77  ? 50   HIS D CA  1 
ATOM   10037 C  C   . HIS D  4  50  ? 52.732 81.731  186.408 1.00 40.14  ? 50   HIS D C   1 
ATOM   10038 O  O   . HIS D  4  50  ? 51.929 81.492  185.522 1.00 40.42  ? 50   HIS D O   1 
ATOM   10039 C  CB  . HIS D  4  50  ? 54.921 80.553  186.103 1.00 39.61  ? 50   HIS D CB  1 
ATOM   10040 C  CG  . HIS D  4  50  ? 56.225 80.525  185.362 1.00 39.39  ? 50   HIS D CG  1 
ATOM   10041 N  ND1 . HIS D  4  50  ? 57.403 80.123  185.948 1.00 36.90  ? 50   HIS D ND1 1 
ATOM   10042 C  CD2 . HIS D  4  50  ? 56.528 80.813  184.075 1.00 43.91  ? 50   HIS D CD2 1 
ATOM   10043 C  CE1 . HIS D  4  50  ? 58.385 80.200  185.069 1.00 38.09  ? 50   HIS D CE1 1 
ATOM   10044 N  NE2 . HIS D  4  50  ? 57.880 80.606  183.920 1.00 41.16  ? 50   HIS D NE2 1 
ATOM   10045 N  N   . LEU D  4  51  ? 52.379 81.850  187.676 1.00 40.34  ? 51   LEU D N   1 
ATOM   10046 C  CA  . LEU D  4  51  ? 50.996 81.655  188.094 1.00 40.61  ? 51   LEU D CA  1 
ATOM   10047 C  C   . LEU D  4  51  ? 50.089 82.832  187.755 1.00 41.11  ? 51   LEU D C   1 
ATOM   10048 O  O   . LEU D  4  51  ? 48.896 82.650  187.568 1.00 41.01  ? 51   LEU D O   1 
ATOM   10049 C  CB  . LEU D  4  51  ? 50.926 81.354  189.603 1.00 40.25  ? 51   LEU D CB  1 
ATOM   10050 C  CG  . LEU D  4  51  ? 51.716 80.128  190.112 1.00 35.83  ? 51   LEU D CG  1 
ATOM   10051 C  CD1 . LEU D  4  51  ? 52.078 80.221  191.593 1.00 28.14  ? 51   LEU D CD1 1 
ATOM   10052 C  CD2 . LEU D  4  51  ? 50.998 78.820  189.811 1.00 33.92  ? 51   LEU D CD2 1 
ATOM   10053 N  N   . VAL D  4  52  ? 50.675 84.025  187.650 1.00 41.87  ? 52   VAL D N   1 
ATOM   10054 C  CA  . VAL D  4  52  ? 49.919 85.264  187.397 1.00 42.97  ? 52   VAL D CA  1 
ATOM   10055 C  C   . VAL D  4  52  ? 48.919 85.215  186.225 1.00 44.25  ? 52   VAL D C   1 
ATOM   10056 O  O   . VAL D  4  52  ? 47.722 85.443  186.406 1.00 44.23  ? 52   VAL D O   1 
ATOM   10057 C  CB  . VAL D  4  52  ? 50.851 86.493  187.264 1.00 42.89  ? 52   VAL D CB  1 
ATOM   10058 C  CG1 . VAL D  4  52  ? 50.046 87.766  187.026 1.00 43.05  ? 52   VAL D CG1 1 
ATOM   10059 C  CG2 . VAL D  4  52  ? 51.700 86.638  188.492 1.00 37.13  ? 52   VAL D CG2 1 
ATOM   10060 N  N   . GLY D  4  53  ? 49.403 84.901  185.037 1.00 45.64  ? 53   GLY D N   1 
ATOM   10061 C  CA  . GLY D  4  53  ? 48.523 84.814  183.876 1.00 46.81  ? 53   GLY D CA  1 
ATOM   10062 C  C   . GLY D  4  53  ? 47.527 83.658  183.999 1.00 47.54  ? 53   GLY D C   1 
ATOM   10063 O  O   . GLY D  4  53  ? 46.389 83.739  183.541 1.00 47.75  ? 53   GLY D O   1 
ATOM   10064 N  N   . VAL D  4  54  ? 47.944 82.624  184.706 1.00 47.76  ? 54   VAL D N   1 
ATOM   10065 C  CA  . VAL D  4  54  ? 47.167 81.425  184.840 1.00 48.04  ? 54   VAL D CA  1 
ATOM   10066 C  C   . VAL D  4  54  ? 46.013 81.519  185.823 1.00 48.05  ? 54   VAL D C   1 
ATOM   10067 O  O   . VAL D  4  54  ? 44.880 81.840  185.442 1.00 48.10  ? 54   VAL D O   1 
ATOM   10068 C  CB  . VAL D  4  54  ? 48.092 80.246  185.168 1.00 48.25  ? 54   VAL D CB  1 
ATOM   10069 C  CG1 . VAL D  4  54  ? 47.360 78.920  185.068 1.00 52.49  ? 54   VAL D CG1 1 
ATOM   10070 C  CG2 . VAL D  4  54  ? 49.226 80.260  184.217 1.00 51.65  ? 54   VAL D CG2 1 
ATOM   10071 N  N   . CYS D  4  55  ? 46.307 81.285  187.090 1.00 47.96  ? 55   CYS D N   1 
ATOM   10072 C  CA  . CYS D  4  55  ? 45.277 81.259  188.115 1.00 47.84  ? 55   CYS D CA  1 
ATOM   10073 C  C   . CYS D  4  55  ? 45.002 82.570  188.897 1.00 47.66  ? 55   CYS D C   1 
ATOM   10074 O  O   . CYS D  4  55  ? 43.940 83.202  188.736 1.00 47.87  ? 55   CYS D O   1 
ATOM   10075 C  CB  . CYS D  4  55  ? 45.521 80.082  189.082 1.00 47.73  ? 55   CYS D CB  1 
ATOM   10076 S  SG  . CYS D  4  55  ? 47.269 79.686  189.423 1.00 44.01  ? 55   CYS D SG  1 
ATOM   10077 N  N   . TYR D  4  56  ? 45.970 82.972  189.718 1.00 46.95  ? 56   TYR D N   1 
ATOM   10078 C  CA  . TYR D  4  56  ? 45.841 84.128  190.608 1.00 46.03  ? 56   TYR D CA  1 
ATOM   10079 C  C   . TYR D  4  56  ? 45.974 85.480  189.945 1.00 45.00  ? 56   TYR D C   1 
ATOM   10080 O  O   . TYR D  4  56  ? 45.875 85.598  188.737 1.00 45.04  ? 56   TYR D O   1 
ATOM   10081 C  CB  . TYR D  4  56  ? 46.872 84.019  191.717 1.00 46.28  ? 56   TYR D CB  1 
ATOM   10082 C  CG  . TYR D  4  56  ? 46.725 82.775  192.567 1.00 51.27  ? 56   TYR D CG  1 
ATOM   10083 C  CD1 . TYR D  4  56  ? 45.875 82.761  193.670 1.00 51.50  ? 56   TYR D CD1 1 
ATOM   10084 C  CD2 . TYR D  4  56  ? 47.444 81.621  192.279 1.00 49.94  ? 56   TYR D CD2 1 
ATOM   10085 C  CE1 . TYR D  4  56  ? 45.745 81.648  194.447 1.00 47.89  ? 56   TYR D CE1 1 
ATOM   10086 C  CE2 . TYR D  4  56  ? 47.300 80.482  193.049 1.00 50.36  ? 56   TYR D CE2 1 
ATOM   10087 C  CZ  . TYR D  4  56  ? 46.448 80.505  194.134 1.00 47.94  ? 56   TYR D CZ  1 
ATOM   10088 O  OH  . TYR D  4  56  ? 46.303 79.395  194.915 1.00 43.48  ? 56   TYR D OH  1 
ATOM   10089 N  N   . THR D  4  57  ? 46.135 86.517  190.767 1.00 44.19  ? 57   THR D N   1 
ATOM   10090 C  CA  . THR D  4  57  ? 46.359 87.876  190.268 1.00 43.55  ? 57   THR D CA  1 
ATOM   10091 C  C   . THR D  4  57  ? 47.713 88.333  190.766 1.00 43.29  ? 57   THR D C   1 
ATOM   10092 O  O   . THR D  4  57  ? 48.332 87.652  191.590 1.00 42.85  ? 57   THR D O   1 
ATOM   10093 C  CB  . THR D  4  57  ? 45.266 88.866  190.755 1.00 43.25  ? 57   THR D CB  1 
ATOM   10094 O  OG1 . THR D  4  57  ? 45.216 88.868  192.182 1.00 42.85  ? 57   THR D OG1 1 
ATOM   10095 C  CG2 . THR D  4  57  ? 43.886 88.401  190.347 1.00 35.27  ? 57   THR D CG2 1 
ATOM   10096 N  N   . GLU D  4  58  ? 48.176 89.479  190.250 1.00 43.62  ? 58   GLU D N   1 
ATOM   10097 C  CA  . GLU D  4  58  ? 49.470 90.064  190.643 1.00 43.94  ? 58   GLU D CA  1 
ATOM   10098 C  C   . GLU D  4  58  ? 49.653 90.031  192.152 1.00 43.99  ? 58   GLU D C   1 
ATOM   10099 O  O   . GLU D  4  58  ? 50.599 89.418  192.667 1.00 44.13  ? 58   GLU D O   1 
ATOM   10100 C  CB  . GLU D  4  58  ? 49.581 91.526  190.163 1.00 44.04  ? 58   GLU D CB  1 
ATOM   10101 C  CG  . GLU D  4  58  ? 50.331 91.728  188.853 1.00 44.59  ? 58   GLU D CG  1 
ATOM   10102 C  CD  . GLU D  4  58  ? 50.839 93.156  188.695 1.00 43.12  ? 58   GLU D CD  1 
ATOM   10103 O  OE1 . GLU D  4  58  ? 51.280 93.514  187.587 1.00 42.00  ? 58   GLU D OE1 1 
ATOM   10104 O  OE2 . GLU D  4  58  ? 50.798 93.920  189.683 1.00 40.56  ? 58   GLU D OE2 1 
ATOM   10105 N  N   . ASP D  4  59  ? 48.720 90.677  192.844 1.00 43.67  ? 59   ASP D N   1 
ATOM   10106 C  CA  . ASP D  4  59  ? 48.720 90.772  194.291 1.00 43.30  ? 59   ASP D CA  1 
ATOM   10107 C  C   . ASP D  4  59  ? 48.797 89.424  194.998 1.00 43.05  ? 59   ASP D C   1 
ATOM   10108 O  O   . ASP D  4  59  ? 49.663 89.213  195.839 1.00 43.16  ? 59   ASP D O   1 
ATOM   10109 C  CB  . ASP D  4  59  ? 47.465 91.514  194.756 1.00 43.16  ? 59   ASP D CB  1 
ATOM   10110 C  CG  . ASP D  4  59  ? 47.409 92.943  194.247 1.00 41.16  ? 59   ASP D CG  1 
ATOM   10111 O  OD1 . ASP D  4  59  ? 48.483 93.571  194.129 1.00 40.62  ? 59   ASP D OD1 1 
ATOM   10112 O  OD2 . ASP D  4  59  ? 46.339 93.525  193.954 1.00 36.29  ? 59   ASP D OD2 1 
ATOM   10113 N  N   . GLU D  4  60  ? 47.890 88.520  194.650 1.00 42.68  ? 60   GLU D N   1 
ATOM   10114 C  CA  . GLU D  4  60  ? 47.832 87.212  195.290 1.00 42.49  ? 60   GLU D CA  1 
ATOM   10115 C  C   . GLU D  4  60  ? 49.100 86.414  195.110 1.00 42.13  ? 60   GLU D C   1 
ATOM   10116 O  O   . GLU D  4  60  ? 49.602 85.830  196.060 1.00 42.06  ? 60   GLU D O   1 
ATOM   10117 C  CB  . GLU D  4  60  ? 46.619 86.422  194.799 1.00 42.74  ? 60   GLU D CB  1 
ATOM   10118 C  CG  . GLU D  4  60  ? 45.298 87.148  195.019 1.00 48.15  ? 60   GLU D CG  1 
ATOM   10119 C  CD  . GLU D  4  60  ? 44.092 86.364  194.529 1.00 48.84  ? 60   GLU D CD  1 
ATOM   10120 O  OE1 . GLU D  4  60  ? 42.973 86.644  195.013 1.00 46.64  ? 60   GLU D OE1 1 
ATOM   10121 O  OE2 . GLU D  4  60  ? 44.256 85.480  193.658 1.00 48.59  ? 60   GLU D OE2 1 
ATOM   10122 N  N   . ALA D  4  61  ? 49.632 86.425  193.891 1.00 41.92  ? 61   ALA D N   1 
ATOM   10123 C  CA  . ALA D  4  61  ? 50.858 85.713  193.571 1.00 41.68  ? 61   ALA D CA  1 
ATOM   10124 C  C   . ALA D  4  61  ? 52.059 86.238  194.384 1.00 41.58  ? 61   ALA D C   1 
ATOM   10125 O  O   . ALA D  4  61  ? 52.887 85.449  194.842 1.00 41.19  ? 61   ALA D O   1 
ATOM   10126 C  CB  . ALA D  4  61  ? 51.126 85.787  192.111 1.00 41.63  ? 61   ALA D CB  1 
ATOM   10127 N  N   . LYS D  4  62  ? 52.131 87.567  194.563 1.00 42.04  ? 62   LYS D N   1 
ATOM   10128 C  CA  . LYS D  4  62  ? 53.192 88.198  195.383 1.00 42.78  ? 62   LYS D CA  1 
ATOM   10129 C  C   . LYS D  4  62  ? 53.153 87.594  196.776 1.00 43.31  ? 62   LYS D C   1 
ATOM   10130 O  O   . LYS D  4  62  ? 54.160 87.084  197.278 1.00 43.43  ? 62   LYS D O   1 
ATOM   10131 C  CB  . LYS D  4  62  ? 52.953 89.727  195.543 1.00 42.95  ? 62   LYS D CB  1 
ATOM   10132 C  CG  . LYS D  4  62  ? 53.410 90.613  194.406 1.00 49.72  ? 62   LYS D CG  1 
ATOM   10133 C  CD  . LYS D  4  62  ? 53.152 92.100  194.725 1.00 51.14  ? 62   LYS D CD  1 
ATOM   10134 C  CE  . LYS D  4  62  ? 53.420 92.983  193.497 1.00 53.25  ? 62   LYS D CE  1 
ATOM   10135 N  NZ  . LYS D  4  62  ? 53.042 94.407  193.722 1.00 50.86  ? 62   LYS D NZ  1 
ATOM   10136 N  N   . ALA D  4  63  ? 51.963 87.655  197.384 1.00 43.51  ? 63   ALA D N   1 
ATOM   10137 C  CA  . ALA D  4  63  ? 51.721 87.177  198.747 1.00 43.54  ? 63   ALA D CA  1 
ATOM   10138 C  C   . ALA D  4  63  ? 52.157 85.739  199.016 1.00 43.27  ? 63   ALA D C   1 
ATOM   10139 O  O   . ALA D  4  63  ? 52.783 85.466  200.037 1.00 43.43  ? 63   ALA D O   1 
ATOM   10140 C  CB  . ALA D  4  63  ? 50.242 87.378  199.135 1.00 43.59  ? 63   ALA D CB  1 
ATOM   10141 N  N   . LEU D  4  64  ? 51.840 84.834  198.091 1.00 42.69  ? 64   LEU D N   1 
ATOM   10142 C  CA  . LEU D  4  64  ? 52.192 83.422  198.233 1.00 42.21  ? 64   LEU D CA  1 
ATOM   10143 C  C   . LEU D  4  64  ? 53.711 83.214  198.237 1.00 41.76  ? 64   LEU D C   1 
ATOM   10144 O  O   . LEU D  4  64  ? 54.227 82.323  198.917 1.00 41.40  ? 64   LEU D O   1 
ATOM   10145 C  CB  . LEU D  4  64  ? 51.527 82.600  197.132 1.00 42.31  ? 64   LEU D CB  1 
ATOM   10146 C  CG  . LEU D  4  64  ? 50.005 82.753  197.068 1.00 42.80  ? 64   LEU D CG  1 
ATOM   10147 C  CD1 . LEU D  4  64  ? 49.418 82.085  195.822 1.00 42.15  ? 64   LEU D CD1 1 
ATOM   10148 C  CD2 . LEU D  4  64  ? 49.321 82.256  198.355 1.00 42.50  ? 64   LEU D CD2 1 
ATOM   10149 N  N   . ALA D  4  65  ? 54.418 84.057  197.483 1.00 41.70  ? 65   ALA D N   1 
ATOM   10150 C  CA  . ALA D  4  65  ? 55.875 84.019  197.439 1.00 41.45  ? 65   ALA D CA  1 
ATOM   10151 C  C   . ALA D  4  65  ? 56.442 84.567  198.746 1.00 41.21  ? 65   ALA D C   1 
ATOM   10152 O  O   . ALA D  4  65  ? 57.480 84.106  199.225 1.00 41.16  ? 65   ALA D O   1 
ATOM   10153 C  CB  . ALA D  4  65  ? 56.378 84.811  196.283 1.00 41.42  ? 65   ALA D CB  1 
ATOM   10154 N  N   . GLU D  4  66  ? 55.728 85.534  199.333 1.00 40.98  ? 66   GLU D N   1 
ATOM   10155 C  CA  . GLU D  4  66  ? 56.129 86.157  200.606 1.00 40.81  ? 66   GLU D CA  1 
ATOM   10156 C  C   . GLU D  4  66  ? 56.008 85.235  201.855 1.00 40.59  ? 66   GLU D C   1 
ATOM   10157 O  O   . GLU D  4  66  ? 56.571 85.532  202.908 1.00 40.39  ? 66   GLU D O   1 
ATOM   10158 C  CB  . GLU D  4  66  ? 55.400 87.502  200.819 1.00 40.76  ? 66   GLU D CB  1 
ATOM   10159 C  CG  . GLU D  4  66  ? 56.007 88.656  200.016 1.00 40.96  ? 66   GLU D CG  1 
ATOM   10160 C  CD  . GLU D  4  66  ? 55.031 89.797  199.760 1.00 39.83  ? 66   GLU D CD  1 
ATOM   10161 O  OE1 . GLU D  4  66  ? 54.200 90.080  200.633 1.00 37.96  ? 66   GLU D OE1 1 
ATOM   10162 O  OE2 . GLU D  4  66  ? 55.100 90.409  198.670 1.00 41.34  ? 66   GLU D OE2 1 
ATOM   10163 N  N   . GLU D  4  67  ? 55.316 84.101  201.701 1.00 40.45  ? 67   GLU D N   1 
ATOM   10164 C  CA  . GLU D  4  67  ? 55.131 83.131  202.788 1.00 40.03  ? 67   GLU D CA  1 
ATOM   10165 C  C   . GLU D  4  67  ? 56.290 82.129  202.915 1.00 39.90  ? 67   GLU D C   1 
ATOM   10166 O  O   . GLU D  4  67  ? 56.139 81.085  203.527 1.00 39.72  ? 67   GLU D O   1 
ATOM   10167 C  CB  . GLU D  4  67  ? 53.835 82.363  202.597 1.00 39.88  ? 67   GLU D CB  1 
ATOM   10168 C  CG  . GLU D  4  67  ? 52.634 83.226  202.308 1.00 41.05  ? 67   GLU D CG  1 
ATOM   10169 C  CD  . GLU D  4  67  ? 51.447 82.404  201.867 1.00 46.11  ? 67   GLU D CD  1 
ATOM   10170 O  OE1 . GLU D  4  67  ? 51.625 81.186  201.662 1.00 46.17  ? 67   GLU D OE1 1 
ATOM   10171 O  OE2 . GLU D  4  67  ? 50.338 82.966  201.730 1.00 48.84  ? 67   GLU D OE2 1 
ATOM   10172 N  N   . VAL D  4  68  ? 57.417 82.424  202.273 1.00 40.15  ? 68   VAL D N   1 
ATOM   10173 C  CA  . VAL D  4  68  ? 58.613 81.565  202.342 1.00 40.44  ? 68   VAL D CA  1 
ATOM   10174 C  C   . VAL D  4  68  ? 59.820 82.489  202.477 1.00 40.77  ? 68   VAL D C   1 
ATOM   10175 O  O   . VAL D  4  68  ? 59.671 83.695  202.514 1.00 40.73  ? 68   VAL D O   1 
ATOM   10176 C  CB  . VAL D  4  68  ? 58.818 80.707  201.020 1.00 40.41  ? 68   VAL D CB  1 
ATOM   10177 C  CG1 . VAL D  4  68  ? 59.499 79.345  201.339 1.00 34.35  ? 68   VAL D CG1 1 
ATOM   10178 C  CG2 . VAL D  4  68  ? 57.491 80.480  200.287 1.00 44.16  ? 68   VAL D CG2 1 
ATOM   10179 N  N   . GLU D  4  69  ? 61.012 81.907  202.595 1.00 41.10  ? 69   GLU D N   1 
ATOM   10180 C  CA  . GLU D  4  69  ? 62.265 82.668  202.664 1.00 41.26  ? 69   GLU D CA  1 
ATOM   10181 C  C   . GLU D  4  69  ? 63.238 82.028  201.671 1.00 41.42  ? 69   GLU D C   1 
ATOM   10182 O  O   . GLU D  4  69  ? 63.322 80.800  201.580 1.00 41.52  ? 69   GLU D O   1 
ATOM   10183 C  CB  . GLU D  4  69  ? 62.811 82.692  204.084 1.00 41.18  ? 69   GLU D CB  1 
ATOM   10184 C  CG  . GLU D  4  69  ? 61.835 83.339  205.043 1.00 42.01  ? 69   GLU D CG  1 
ATOM   10185 C  CD  . GLU D  4  69  ? 62.414 83.608  206.385 1.00 45.20  ? 69   GLU D CD  1 
ATOM   10186 O  OE1 . GLU D  4  69  ? 62.803 82.641  207.066 1.00 48.88  ? 69   GLU D OE1 1 
ATOM   10187 O  OE2 . GLU D  4  69  ? 62.455 84.790  206.776 1.00 46.43  ? 69   GLU D OE2 1 
ATOM   10188 N  N   . VAL D  4  70  ? 63.981 82.855  200.942 1.00 41.38  ? 70   VAL D N   1 
ATOM   10189 C  CA  . VAL D  4  70  ? 64.789 82.350  199.833 1.00 41.32  ? 70   VAL D CA  1 
ATOM   10190 C  C   . VAL D  4  70  ? 66.297 82.094  200.007 1.00 41.43  ? 70   VAL D C   1 
ATOM   10191 O  O   . VAL D  4  70  ? 66.772 81.016  199.651 1.00 41.81  ? 70   VAL D O   1 
ATOM   10192 C  CB  . VAL D  4  70  ? 64.520 83.185  198.530 1.00 41.27  ? 70   VAL D CB  1 
ATOM   10193 C  CG1 . VAL D  4  70  ? 65.163 82.521  197.290 1.00 40.35  ? 70   VAL D CG1 1 
ATOM   10194 C  CG2 . VAL D  4  70  ? 63.012 83.359  198.317 1.00 36.69  ? 70   VAL D CG2 1 
ATOM   10195 N  N   . GLN D  4  71  ? 67.011 83.069  200.581 1.00 41.06  ? 71   GLN D N   1 
ATOM   10196 C  CA  . GLN D  4  71  ? 68.503 83.092  200.700 1.00 41.06  ? 71   GLN D CA  1 
ATOM   10197 C  C   . GLN D  4  71  ? 68.997 83.907  199.518 1.00 41.39  ? 71   GLN D C   1 
ATOM   10198 O  O   . GLN D  4  71  ? 69.350 83.372  198.466 1.00 41.43  ? 71   GLN D O   1 
ATOM   10199 C  CB  . GLN D  4  71  ? 69.182 81.703  200.744 1.00 40.93  ? 71   GLN D CB  1 
ATOM   10200 C  CG  . GLN D  4  71  ? 70.744 81.769  200.719 1.00 44.50  ? 71   GLN D CG  1 
ATOM   10201 C  CD  . GLN D  4  71  ? 71.400 80.408  200.566 1.00 50.27  ? 71   GLN D CD  1 
ATOM   10202 O  OE1 . GLN D  4  71  ? 70.717 79.388  200.515 1.00 56.85  ? 71   GLN D OE1 1 
ATOM   10203 N  NE2 . GLN D  4  71  ? 72.726 80.391  200.492 1.00 49.13  ? 71   GLN D NE2 1 
ATOM   10204 N  N   . ASP D  4  72  ? 68.971 85.216  199.682 1.00 41.81  ? 72   ASP D N   1 
ATOM   10205 C  CA  . ASP D  4  72  ? 69.332 86.113  198.614 1.00 42.30  ? 72   ASP D CA  1 
ATOM   10206 C  C   . ASP D  4  72  ? 70.836 86.309  198.499 1.00 42.83  ? 72   ASP D C   1 
ATOM   10207 O  O   . ASP D  4  72  ? 71.601 85.816  199.341 1.00 42.63  ? 72   ASP D O   1 
ATOM   10208 C  CB  . ASP D  4  72  ? 68.623 87.449  198.792 1.00 42.23  ? 72   ASP D CB  1 
ATOM   10209 C  CG  . ASP D  4  72  ? 68.063 87.975  197.510 1.00 41.07  ? 72   ASP D CG  1 
ATOM   10210 O  OD1 . ASP D  4  72  ? 68.064 87.229  196.512 1.00 46.81  ? 72   ASP D OD1 1 
ATOM   10211 O  OD2 . ASP D  4  72  ? 67.561 89.103  197.399 1.00 40.42  ? 72   ASP D OD2 1 
ATOM   10212 N  N   . GLY D  4  73  ? 71.245 87.051  197.452 1.00 43.46  ? 73   GLY D N   1 
ATOM   10213 C  CA  . GLY D  4  73  ? 72.652 87.330  197.139 1.00 43.88  ? 73   GLY D CA  1 
ATOM   10214 C  C   . GLY D  4  73  ? 73.478 87.961  198.248 1.00 44.19  ? 73   GLY D C   1 
ATOM   10215 O  O   . GLY D  4  73  ? 72.939 88.423  199.232 1.00 44.08  ? 73   GLY D O   1 
ATOM   10216 N  N   . PRO D  4  74  ? 74.793 88.012  198.058 1.00 44.75  ? 74   PRO D N   1 
ATOM   10217 C  CA  . PRO D  4  74  ? 75.703 88.550  199.075 1.00 45.23  ? 74   PRO D CA  1 
ATOM   10218 C  C   . PRO D  4  74  ? 75.745 90.073  199.086 1.00 45.83  ? 74   PRO D C   1 
ATOM   10219 O  O   . PRO D  4  74  ? 75.511 90.708  198.061 1.00 45.77  ? 74   PRO D O   1 
ATOM   10220 C  CB  . PRO D  4  74  ? 77.076 88.025  198.629 1.00 45.11  ? 74   PRO D CB  1 
ATOM   10221 C  CG  . PRO D  4  74  ? 76.811 87.194  197.396 1.00 45.40  ? 74   PRO D CG  1 
ATOM   10222 C  CD  . PRO D  4  74  ? 75.507 87.606  196.839 1.00 44.82  ? 74   PRO D CD  1 
ATOM   10223 N  N   . ASN D  4  75  ? 76.025 90.651  200.247 1.00 46.54  ? 75   ASN D N   1 
ATOM   10224 C  CA  . ASN D  4  75  ? 76.193 92.101  200.360 1.00 47.16  ? 75   ASN D CA  1 
ATOM   10225 C  C   . ASN D  4  75  ? 77.501 92.385  201.097 1.00 47.43  ? 75   ASN D C   1 
ATOM   10226 O  O   . ASN D  4  75  ? 77.978 91.534  201.831 1.00 47.35  ? 75   ASN D O   1 
ATOM   10227 C  CB  . ASN D  4  75  ? 75.009 92.756  201.081 1.00 47.36  ? 75   ASN D CB  1 
ATOM   10228 C  CG  . ASN D  4  75  ? 74.918 94.265  200.810 1.00 51.06  ? 75   ASN D CG  1 
ATOM   10229 O  OD1 . ASN D  4  75  ? 75.549 95.087  201.505 1.00 45.80  ? 75   ASN D OD1 1 
ATOM   10230 N  ND2 . ASN D  4  75  ? 74.154 94.632  199.780 1.00 52.27  ? 75   ASN D ND2 1 
ATOM   10231 N  N   . GLU D  4  76  ? 78.078 93.574  200.871 1.00 47.75  ? 76   GLU D N   1 
ATOM   10232 C  CA  . GLU D  4  76  ? 79.356 94.018  201.492 1.00 48.06  ? 76   GLU D CA  1 
ATOM   10233 C  C   . GLU D  4  76  ? 80.272 93.026  202.257 1.00 48.10  ? 76   GLU D C   1 
ATOM   10234 O  O   . GLU D  4  76  ? 81.455 92.951  201.968 1.00 48.27  ? 76   GLU D O   1 
ATOM   10235 C  CB  . GLU D  4  76  ? 79.206 95.355  202.238 1.00 48.23  ? 76   GLU D CB  1 
ATOM   10236 C  CG  . GLU D  4  76  ? 79.611 96.578  201.406 1.00 51.62  ? 76   GLU D CG  1 
ATOM   10237 C  CD  . GLU D  4  76  ? 79.294 97.910  202.093 1.00 51.09  ? 76   GLU D CD  1 
ATOM   10238 O  OE1 . GLU D  4  76  ? 78.893 97.902  203.280 1.00 48.29  ? 76   GLU D OE1 1 
ATOM   10239 O  OE2 . GLU D  4  76  ? 79.441 98.965  201.437 1.00 50.46  ? 76   GLU D OE2 1 
ATOM   10240 N  N   . ASP D  4  77  ? 79.717 92.282  203.220 1.00 47.87  ? 77   ASP D N   1 
ATOM   10241 C  CA  . ASP D  4  77  ? 80.506 91.311  204.009 1.00 47.72  ? 77   ASP D CA  1 
ATOM   10242 C  C   . ASP D  4  77  ? 80.734 89.931  203.332 1.00 47.30  ? 77   ASP D C   1 
ATOM   10243 O  O   . ASP D  4  77  ? 81.608 89.164  203.764 1.00 47.24  ? 77   ASP D O   1 
ATOM   10244 C  CB  . ASP D  4  77  ? 79.854 91.075  205.391 1.00 47.88  ? 77   ASP D CB  1 
ATOM   10245 C  CG  . ASP D  4  77  ? 79.737 92.351  206.223 1.00 52.48  ? 77   ASP D CG  1 
ATOM   10246 O  OD1 . ASP D  4  77  ? 79.908 93.454  205.663 1.00 56.15  ? 77   ASP D OD1 1 
ATOM   10247 O  OD2 . ASP D  4  77  ? 79.467 92.340  207.445 1.00 50.20  ? 77   ASP D OD2 1 
ATOM   10248 N  N   . GLY D  4  78  ? 79.979 89.638  202.268 1.00 46.85  ? 78   GLY D N   1 
ATOM   10249 C  CA  . GLY D  4  78  ? 80.021 88.318  201.648 1.00 46.44  ? 78   GLY D CA  1 
ATOM   10250 C  C   . GLY D  4  78  ? 79.195 87.499  202.611 1.00 46.16  ? 78   GLY D C   1 
ATOM   10251 O  O   . GLY D  4  78  ? 79.722 86.720  203.389 1.00 45.98  ? 78   GLY D O   1 
ATOM   10252 N  N   . GLU D  4  79  ? 77.883 87.678  202.537 1.00 46.28  ? 79   GLU D N   1 
ATOM   10253 C  CA  . GLU D  4  79  ? 76.969 87.137  203.542 1.00 46.46  ? 79   GLU D CA  1 
ATOM   10254 C  C   . GLU D  4  79  ? 76.193 85.862  203.297 1.00 46.44  ? 79   GLU D C   1 
ATOM   10255 O  O   . GLU D  4  79  ? 76.670 84.770  203.614 1.00 46.26  ? 79   GLU D O   1 
ATOM   10256 C  CB  . GLU D  4  79  ? 75.978 88.225  203.935 1.00 46.64  ? 79   GLU D CB  1 
ATOM   10257 C  CG  . GLU D  4  79  ? 76.585 89.611  203.965 1.00 48.66  ? 79   GLU D CG  1 
ATOM   10258 C  CD  . GLU D  4  79  ? 75.545 90.699  203.930 1.00 47.99  ? 79   GLU D CD  1 
ATOM   10259 O  OE1 . GLU D  4  79  ? 74.400 90.416  203.543 1.00 54.57  ? 79   GLU D OE1 1 
ATOM   10260 O  OE2 . GLU D  4  79  ? 75.873 91.838  204.273 1.00 46.10  ? 79   GLU D OE2 1 
ATOM   10261 N  N   . MET D  4  80  ? 74.935 86.061  202.846 1.00 46.69  ? 80   MET D N   1 
ATOM   10262 C  CA  . MET D  4  80  ? 73.890 85.020  202.590 1.00 46.89  ? 80   MET D CA  1 
ATOM   10263 C  C   . MET D  4  80  ? 72.750 85.149  203.653 1.00 46.93  ? 80   MET D C   1 
ATOM   10264 O  O   . MET D  4  80  ? 72.674 84.360  204.602 1.00 47.06  ? 80   MET D O   1 
ATOM   10265 C  CB  . MET D  4  80  ? 74.456 83.575  202.540 1.00 46.99  ? 80   MET D CB  1 
ATOM   10266 C  CG  . MET D  4  80  ? 74.776 82.986  201.109 1.00 48.12  ? 80   MET D CG  1 
ATOM   10267 S  SD  . MET D  4  80  ? 75.851 83.945  199.985 1.00 42.97  ? 80   MET D SD  1 
ATOM   10268 C  CE  . MET D  4  80  ? 74.683 84.594  198.928 1.00 42.40  ? 80   MET D CE  1 
ATOM   10269 N  N   . PHE D  4  81  ? 71.888 86.159  203.477 1.00 46.77  ? 81   PHE D N   1 
ATOM   10270 C  CA  . PHE D  4  81  ? 70.766 86.435  204.412 1.00 46.64  ? 81   PHE D CA  1 
ATOM   10271 C  C   . PHE D  4  81  ? 69.432 85.857  203.910 1.00 46.53  ? 81   PHE D C   1 
ATOM   10272 O  O   . PHE D  4  81  ? 69.426 85.028  203.027 1.00 46.71  ? 81   PHE D O   1 
ATOM   10273 C  CB  . PHE D  4  81  ? 70.624 87.943  204.644 1.00 46.61  ? 81   PHE D CB  1 
ATOM   10274 C  CG  . PHE D  4  81  ? 70.432 88.748  203.371 1.00 47.24  ? 81   PHE D CG  1 
ATOM   10275 C  CD1 . PHE D  4  81  ? 69.156 89.047  202.900 1.00 48.51  ? 81   PHE D CD1 1 
ATOM   10276 C  CD2 . PHE D  4  81  ? 71.525 89.235  202.671 1.00 47.26  ? 81   PHE D CD2 1 
ATOM   10277 C  CE1 . PHE D  4  81  ? 68.980 89.787  201.745 1.00 47.43  ? 81   PHE D CE1 1 
ATOM   10278 C  CE2 . PHE D  4  81  ? 71.352 89.984  201.525 1.00 48.75  ? 81   PHE D CE2 1 
ATOM   10279 C  CZ  . PHE D  4  81  ? 70.075 90.257  201.059 1.00 48.16  ? 81   PHE D CZ  1 
ATOM   10280 N  N   . MET D  4  82  ? 68.306 86.304  204.484 1.00 46.15  ? 82   MET D N   1 
ATOM   10281 C  CA  . MET D  4  82  ? 66.980 85.824  204.042 1.00 45.91  ? 82   MET D CA  1 
ATOM   10282 C  C   . MET D  4  82  ? 66.074 86.990  203.564 1.00 45.83  ? 82   MET D C   1 
ATOM   10283 O  O   . MET D  4  82  ? 66.169 88.100  204.068 1.00 45.48  ? 82   MET D O   1 
ATOM   10284 C  CB  . MET D  4  82  ? 66.290 84.987  205.138 1.00 45.83  ? 82   MET D CB  1 
ATOM   10285 C  CG  . MET D  4  82  ? 67.137 83.781  205.706 1.00 43.43  ? 82   MET D CG  1 
ATOM   10286 S  SD  . MET D  4  82  ? 67.173 82.219  204.695 1.00 40.45  ? 82   MET D SD  1 
ATOM   10287 C  CE  . MET D  4  82  ? 68.197 81.129  205.772 1.00 38.75  ? 82   MET D CE  1 
ATOM   10288 N  N   . ARG D  4  83  ? 65.195 86.706  202.596 1.00 46.27  ? 83   ARG D N   1 
ATOM   10289 C  CA  . ARG D  4  83  ? 64.314 87.731  201.979 1.00 46.74  ? 83   ARG D CA  1 
ATOM   10290 C  C   . ARG D  4  83  ? 62.853 87.195  201.895 1.00 47.02  ? 83   ARG D C   1 
ATOM   10291 O  O   . ARG D  4  83  ? 62.656 85.981  201.733 1.00 46.90  ? 83   ARG D O   1 
ATOM   10292 C  CB  . ARG D  4  83  ? 64.848 88.058  200.551 1.00 46.89  ? 83   ARG D CB  1 
ATOM   10293 C  CG  . ARG D  4  83  ? 64.201 89.271  199.841 1.00 47.65  ? 83   ARG D CG  1 
ATOM   10294 C  CD  . ARG D  4  83  ? 64.264 89.214  198.324 1.00 47.29  ? 83   ARG D CD  1 
ATOM   10295 N  NE  . ARG D  4  83  ? 63.781 87.934  197.838 1.00 47.30  ? 83   ARG D NE  1 
ATOM   10296 C  CZ  . ARG D  4  83  ? 64.300 87.285  196.822 1.00 45.86  ? 83   ARG D CZ  1 
ATOM   10297 N  NH1 . ARG D  4  83  ? 65.311 87.797  196.144 1.00 44.74  ? 83   ARG D NH1 1 
ATOM   10298 N  NH2 . ARG D  4  83  ? 63.807 86.126  196.478 1.00 46.30  ? 83   ARG D NH2 1 
ATOM   10299 N  N   . PRO D  4  84  ? 61.847 88.091  202.054 1.00 47.40  ? 84   PRO D N   1 
ATOM   10300 C  CA  . PRO D  4  84  ? 60.417 87.704  202.000 1.00 47.83  ? 84   PRO D CA  1 
ATOM   10301 C  C   . PRO D  4  84  ? 59.965 86.803  200.817 1.00 48.22  ? 84   PRO D C   1 
ATOM   10302 O  O   . PRO D  4  84  ? 59.267 85.832  201.043 1.00 48.23  ? 84   PRO D O   1 
ATOM   10303 C  CB  . PRO D  4  84  ? 59.687 89.058  201.966 1.00 47.79  ? 84   PRO D CB  1 
ATOM   10304 C  CG  . PRO D  4  84  ? 60.597 89.993  202.695 1.00 45.17  ? 84   PRO D CG  1 
ATOM   10305 C  CD  . PRO D  4  84  ? 62.004 89.526  202.397 1.00 47.27  ? 84   PRO D CD  1 
ATOM   10306 N  N   . GLY D  4  85  ? 60.370 87.113  199.598 1.00 48.49  ? 85   GLY D N   1 
ATOM   10307 C  CA  . GLY D  4  85  ? 59.956 86.310  198.454 1.00 48.80  ? 85   GLY D CA  1 
ATOM   10308 C  C   . GLY D  4  85  ? 59.356 87.229  197.431 1.00 48.99  ? 85   GLY D C   1 
ATOM   10309 O  O   . GLY D  4  85  ? 58.418 87.971  197.728 1.00 48.98  ? 85   GLY D O   1 
ATOM   10310 N  N   . LYS D  4  86  ? 59.887 87.188  196.224 1.00 49.16  ? 86   LYS D N   1 
ATOM   10311 C  CA  . LYS D  4  86  ? 59.450 88.106  195.198 1.00 49.51  ? 86   LYS D CA  1 
ATOM   10312 C  C   . LYS D  4  86  ? 58.243 87.653  194.380 1.00 49.58  ? 86   LYS D C   1 
ATOM   10313 O  O   . LYS D  4  86  ? 57.105 87.729  194.820 1.00 49.81  ? 86   LYS D O   1 
ATOM   10314 C  CB  . LYS D  4  86  ? 60.603 88.421  194.251 1.00 49.79  ? 86   LYS D CB  1 
ATOM   10315 C  CG  . LYS D  4  86  ? 61.805 89.147  194.861 1.00 54.04  ? 86   LYS D CG  1 
ATOM   10316 C  CD  . LYS D  4  86  ? 62.803 89.485  193.721 1.00 59.25  ? 86   LYS D CD  1 
ATOM   10317 C  CE  . LYS D  4  86  ? 64.028 90.240  194.189 1.00 59.04  ? 86   LYS D CE  1 
ATOM   10318 N  NZ  . LYS D  4  86  ? 64.829 90.747  193.024 1.00 55.86  ? 86   LYS D NZ  1 
ATOM   10319 N  N   . LEU D  4  87  ? 58.537 87.249  193.159 1.00 49.40  ? 87   LEU D N   1 
ATOM   10320 C  CA  . LEU D  4  87  ? 57.586 86.809  192.162 1.00 49.33  ? 87   LEU D CA  1 
ATOM   10321 C  C   . LEU D  4  87  ? 58.531 86.255  191.158 1.00 50.02  ? 87   LEU D C   1 
ATOM   10322 O  O   . LEU D  4  87  ? 58.192 85.392  190.364 1.00 49.95  ? 87   LEU D O   1 
ATOM   10323 C  CB  . LEU D  4  87  ? 56.893 88.011  191.521 1.00 48.87  ? 87   LEU D CB  1 
ATOM   10324 C  CG  . LEU D  4  87  ? 55.514 88.424  191.983 1.00 40.46  ? 87   LEU D CG  1 
ATOM   10325 C  CD1 . LEU D  4  87  ? 55.020 89.625  191.163 1.00 38.52  ? 87   LEU D CD1 1 
ATOM   10326 C  CD2 . LEU D  4  87  ? 54.586 87.246  191.821 1.00 39.20  ? 87   LEU D CD2 1 
ATOM   10327 N  N   . SER D  4  88  ? 59.762 86.769  191.243 1.00 50.85  ? 88   SER D N   1 
ATOM   10328 C  CA  . SER D  4  88  ? 60.879 86.426  190.364 1.00 51.57  ? 88   SER D CA  1 
ATOM   10329 C  C   . SER D  4  88  ? 61.502 85.059  190.655 1.00 51.88  ? 88   SER D C   1 
ATOM   10330 O  O   . SER D  4  88  ? 62.026 84.401  189.753 1.00 52.01  ? 88   SER D O   1 
ATOM   10331 C  CB  . SER D  4  88  ? 61.973 87.501  190.478 1.00 51.77  ? 88   SER D CB  1 
ATOM   10332 O  OG  . SER D  4  88  ? 61.444 88.807  190.294 1.00 59.22  ? 88   SER D OG  1 
ATOM   10333 N  N   . ASP D  4  89  ? 61.451 84.642  191.908 1.00 52.17  ? 89   ASP D N   1 
ATOM   10334 C  CA  . ASP D  4  89  ? 62.022 83.365  192.317 1.00 52.61  ? 89   ASP D CA  1 
ATOM   10335 C  C   . ASP D  4  89  ? 61.251 82.198  191.757 1.00 53.79  ? 89   ASP D C   1 
ATOM   10336 O  O   . ASP D  4  89  ? 60.180 82.363  191.188 1.00 54.14  ? 89   ASP D O   1 
ATOM   10337 C  CB  . ASP D  4  89  ? 61.966 83.253  193.819 1.00 52.05  ? 89   ASP D CB  1 
ATOM   10338 C  CG  . ASP D  4  89  ? 62.201 84.551  194.495 1.00 39.10  ? 89   ASP D CG  1 
ATOM   10339 O  OD1 . ASP D  4  89  ? 63.332 85.049  194.427 1.00 33.03  ? 89   ASP D OD1 1 
ATOM   10340 O  OD2 . ASP D  4  89  ? 61.324 85.156  195.137 1.00 33.93  ? 89   ASP D OD2 1 
ATOM   10341 N  N   . TYR D  4  90  ? 61.774 81.003  191.966 1.00 54.47  ? 90   TYR D N   1 
ATOM   10342 C  CA  . TYR D  4  90  ? 61.103 79.814  191.503 1.00 55.24  ? 90   TYR D CA  1 
ATOM   10343 C  C   . TYR D  4  90  ? 60.596 79.059  192.727 1.00 55.93  ? 90   TYR D C   1 
ATOM   10344 O  O   . TYR D  4  90  ? 60.505 79.622  193.823 1.00 55.81  ? 90   TYR D O   1 
ATOM   10345 C  CB  . TYR D  4  90  ? 62.072 78.919  190.684 1.00 55.32  ? 90   TYR D CB  1 
ATOM   10346 C  CG  . TYR D  4  90  ? 62.442 79.448  189.309 1.00 58.27  ? 90   TYR D CG  1 
ATOM   10347 C  CD1 . TYR D  4  90  ? 63.607 80.185  189.115 1.00 59.03  ? 90   TYR D CD1 1 
ATOM   10348 C  CD2 . TYR D  4  90  ? 61.644 79.177  188.197 1.00 61.44  ? 90   TYR D CD2 1 
ATOM   10349 C  CE1 . TYR D  4  90  ? 63.951 80.670  187.856 1.00 61.68  ? 90   TYR D CE1 1 
ATOM   10350 C  CE2 . TYR D  4  90  ? 61.979 79.663  186.926 1.00 61.83  ? 90   TYR D CE2 1 
ATOM   10351 C  CZ  . TYR D  4  90  ? 63.132 80.405  186.768 1.00 61.17  ? 90   TYR D CZ  1 
ATOM   10352 O  OH  . TYR D  4  90  ? 63.475 80.881  185.527 1.00 62.48  ? 90   TYR D OH  1 
ATOM   10353 N  N   . PHE D  4  91  ? 60.288 77.776  192.545 1.00 56.62  ? 91   PHE D N   1 
ATOM   10354 C  CA  . PHE D  4  91  ? 59.889 76.917  193.664 1.00 57.08  ? 91   PHE D CA  1 
ATOM   10355 C  C   . PHE D  4  91  ? 60.999 75.859  194.090 1.00 57.68  ? 91   PHE D C   1 
ATOM   10356 O  O   . PHE D  4  91  ? 60.617 74.746  194.452 1.00 57.81  ? 91   PHE D O   1 
ATOM   10357 C  CB  . PHE D  4  91  ? 58.621 76.083  193.310 1.00 57.04  ? 91   PHE D CB  1 
ATOM   10358 C  CG  . PHE D  4  91  ? 57.321 76.873  193.225 1.00 56.84  ? 91   PHE D CG  1 
ATOM   10359 C  CD1 . PHE D  4  91  ? 56.836 77.308  192.002 1.00 60.77  ? 91   PHE D CD1 1 
ATOM   10360 C  CD2 . PHE D  4  91  ? 56.518 77.026  194.325 1.00 60.15  ? 91   PHE D CD2 1 
ATOM   10361 C  CE1 . PHE D  4  91  ? 55.611 77.978  191.899 1.00 55.56  ? 91   PHE D CE1 1 
ATOM   10362 C  CE2 . PHE D  4  91  ? 55.286 77.688  194.218 1.00 60.87  ? 91   PHE D CE2 1 
ATOM   10363 C  CZ  . PHE D  4  91  ? 54.853 78.166  192.989 1.00 51.73  ? 91   PHE D CZ  1 
ATOM   10364 N  N   . PRO D  4  92  ? 62.333 76.150  194.030 1.00 58.06  ? 92   PRO D N   1 
ATOM   10365 C  CA  . PRO D  4  92  ? 63.309 75.135  194.445 1.00 58.03  ? 92   PRO D CA  1 
ATOM   10366 C  C   . PRO D  4  92  ? 63.440 75.232  195.944 1.00 58.01  ? 92   PRO D C   1 
ATOM   10367 O  O   . PRO D  4  92  ? 63.895 76.262  196.466 1.00 58.30  ? 92   PRO D O   1 
ATOM   10368 C  CB  . PRO D  4  92  ? 64.622 75.613  193.787 1.00 57.94  ? 92   PRO D CB  1 
ATOM   10369 C  CG  . PRO D  4  92  ? 64.241 76.805  192.964 1.00 60.16  ? 92   PRO D CG  1 
ATOM   10370 C  CD  . PRO D  4  92  ? 63.034 77.381  193.637 1.00 58.25  ? 92   PRO D CD  1 
ATOM   10371 N  N   . LYS D  4  93  ? 63.004 74.214  196.657 1.00 57.47  ? 93   LYS D N   1 
ATOM   10372 C  CA  . LYS D  4  93  ? 63.046 74.314  198.082 1.00 57.27  ? 93   LYS D CA  1 
ATOM   10373 C  C   . LYS D  4  93  ? 63.456 73.112  198.909 1.00 57.45  ? 93   LYS D C   1 
ATOM   10374 O  O   . LYS D  4  93  ? 64.429 73.212  199.661 1.00 57.54  ? 93   LYS D O   1 
ATOM   10375 C  CB  . LYS D  4  93  ? 61.734 74.894  198.643 1.00 57.10  ? 93   LYS D CB  1 
ATOM   10376 C  CG  . LYS D  4  93  ? 60.836 75.518  197.632 1.00 48.16  ? 93   LYS D CG  1 
ATOM   10377 C  CD  . LYS D  4  93  ? 60.062 76.621  198.227 1.00 47.92  ? 93   LYS D CD  1 
ATOM   10378 C  CE  . LYS D  4