data_1NUS
# 
_entry.id   1NUS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NUS         
RCSB  RCSB018224   
WWPDB D_1000018224 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NUP 'The same protein complexed with NMN'        unspecified 
PDB 1NUQ 'The same protein complexed with NaAD'       unspecified 
PDB 1NUR 'The same protein'                           unspecified 
PDB 1NUT 'The same protein complexed with ATP analog' unspecified 
PDB 1NUU 'The same protein complexed with NAD'        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NUS 
_pdbx_database_status.recvd_initial_deposition_date   2003-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, X.'       1 
'Kurnasov, O.V.'  2 
'Karthikeyan, S.' 3 
'Grishin, N.V.'   4 
'Osterman, A.L.'  5 
'Zhang, H.'       6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN  
ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
;
J.Biol.Chem. 278 13503 13511 2003 JBCHA3 US 0021-9258 0071 ? 12574164 10.1074/jbc.M300073200 
1       
;STRUCTURE OF HUMAN NICOTINAMIDE/NICOTONIC ACID MONONUCLEOTIDE ADENYLYLTRANSFERASE BASIS FOR THE  
DUAL SUBSTRATE SPECIFICITY AND ACTIVATION OF THE ONCOLYTIC AGENT TIAZOFURIN
;
J.Biol.Chem. 277 13148 13154 2002 JBCHA3 US 0021-9258 0071 ? ?        10.1074/jbc.M111469200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'ZHANG, X.'       1  
primary 'KURNASOV, O.V.'  2  
primary 'KARTHIKEYAN, S.' 3  
primary 'GRISHIN, N.V.'   4  
primary 'OSTERMAN, A.L.'  5  
primary 'ZHANG, H.'       6  
1       'ZHOU, T.'        7  
1       'KURNASOV, O.'    8  
1       'TOMCHICK, D.R.'  9  
1       'BINNS, D.D.'     10 
1       'GRISHIN, N.V.'   11 
1       'MARQUEZ, V.E.'   12 
1       'OSTERMAN, A.L.'  13 
1       'ZHANG, H.'       14 
# 
_cell.entry_id           1NUS 
_cell.length_a           79.036 
_cell.length_b           79.036 
_cell.length_c           145.987 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NUS 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man FKSG76                                          28396.768 2   ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                                   96.063    2   ? ? ? ? 
3 non-polymer syn 'BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE'        335.227   2   ? ? ? ? 
4 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' 505.208   2   ? ? ? ? 
5 water       nat water                                           18.015    178 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NMN/NaMN ADENYLYLTRANSFERASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRV
DPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKF
GLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWK
GKSTQSTEGKTS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRV
DPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKF
GLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWK
GKSTQSTEGKTS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   SER n 
1 4   ARG n 
1 5   ILE n 
1 6   PRO n 
1 7   VAL n 
1 8   VAL n 
1 9   LEU n 
1 10  LEU n 
1 11  ALA n 
1 12  CYS n 
1 13  GLY n 
1 14  SER n 
1 15  PHE n 
1 16  ASN n 
1 17  PRO n 
1 18  ILE n 
1 19  THR n 
1 20  ASN n 
1 21  MET n 
1 22  HIS n 
1 23  LEU n 
1 24  ARG n 
1 25  MET n 
1 26  PHE n 
1 27  GLU n 
1 28  VAL n 
1 29  ALA n 
1 30  ARG n 
1 31  ASP n 
1 32  HIS n 
1 33  LEU n 
1 34  HIS n 
1 35  GLN n 
1 36  THR n 
1 37  GLY n 
1 38  MET n 
1 39  TYR n 
1 40  GLN n 
1 41  VAL n 
1 42  ILE n 
1 43  GLN n 
1 44  GLY n 
1 45  ILE n 
1 46  ILE n 
1 47  SER n 
1 48  PRO n 
1 49  VAL n 
1 50  ASN n 
1 51  ASP n 
1 52  THR n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  LYS n 
1 57  ASP n 
1 58  LEU n 
1 59  ALA n 
1 60  ALA n 
1 61  SER n 
1 62  HIS n 
1 63  HIS n 
1 64  ARG n 
1 65  VAL n 
1 66  ALA n 
1 67  MET n 
1 68  ALA n 
1 69  ARG n 
1 70  LEU n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  THR n 
1 75  SER n 
1 76  ASP n 
1 77  TRP n 
1 78  ILE n 
1 79  ARG n 
1 80  VAL n 
1 81  ASP n 
1 82  PRO n 
1 83  TRP n 
1 84  GLU n 
1 85  SER n 
1 86  GLU n 
1 87  GLN n 
1 88  ALA n 
1 89  GLN n 
1 90  TRP n 
1 91  MET n 
1 92  GLU n 
1 93  THR n 
1 94  VAL n 
1 95  LYS n 
1 96  VAL n 
1 97  LEU n 
1 98  ARG n 
1 99  HIS n 
1 100 HIS n 
1 101 HIS n 
1 102 SER n 
1 103 LYS n 
1 104 LEU n 
1 105 LEU n 
1 106 ARG n 
1 107 SER n 
1 108 PRO n 
1 109 PRO n 
1 110 GLN n 
1 111 MET n 
1 112 GLU n 
1 113 GLY n 
1 114 PRO n 
1 115 ASP n 
1 116 HIS n 
1 117 GLY n 
1 118 LYS n 
1 119 ALA n 
1 120 LEU n 
1 121 PHE n 
1 122 SER n 
1 123 THR n 
1 124 PRO n 
1 125 ALA n 
1 126 ALA n 
1 127 VAL n 
1 128 PRO n 
1 129 GLU n 
1 130 LEU n 
1 131 LYS n 
1 132 LEU n 
1 133 LEU n 
1 134 CYS n 
1 135 GLY n 
1 136 ALA n 
1 137 ASP n 
1 138 VAL n 
1 139 LEU n 
1 140 LYS n 
1 141 THR n 
1 142 PHE n 
1 143 GLN n 
1 144 THR n 
1 145 PRO n 
1 146 ASN n 
1 147 LEU n 
1 148 TRP n 
1 149 LYS n 
1 150 ASP n 
1 151 ALA n 
1 152 HIS n 
1 153 ILE n 
1 154 GLN n 
1 155 GLU n 
1 156 ILE n 
1 157 VAL n 
1 158 GLU n 
1 159 LYS n 
1 160 PHE n 
1 161 GLY n 
1 162 LEU n 
1 163 VAL n 
1 164 CYS n 
1 165 VAL n 
1 166 GLY n 
1 167 ARG n 
1 168 VAL n 
1 169 SER n 
1 170 HIS n 
1 171 ASP n 
1 172 PRO n 
1 173 LYS n 
1 174 GLY n 
1 175 TYR n 
1 176 ILE n 
1 177 ALA n 
1 178 GLU n 
1 179 SER n 
1 180 PRO n 
1 181 ILE n 
1 182 LEU n 
1 183 ARG n 
1 184 MET n 
1 185 HIS n 
1 186 GLN n 
1 187 HIS n 
1 188 ASN n 
1 189 ILE n 
1 190 HIS n 
1 191 LEU n 
1 192 ALA n 
1 193 LYS n 
1 194 GLU n 
1 195 PRO n 
1 196 VAL n 
1 197 GLN n 
1 198 ASN n 
1 199 GLU n 
1 200 ILE n 
1 201 SER n 
1 202 ALA n 
1 203 THR n 
1 204 TYR n 
1 205 ILE n 
1 206 ARG n 
1 207 ARG n 
1 208 ALA n 
1 209 LEU n 
1 210 GLY n 
1 211 GLN n 
1 212 GLY n 
1 213 GLN n 
1 214 SER n 
1 215 VAL n 
1 216 LYS n 
1 217 TYR n 
1 218 LEU n 
1 219 ILE n 
1 220 PRO n 
1 221 ASP n 
1 222 ALA n 
1 223 VAL n 
1 224 ILE n 
1 225 THR n 
1 226 TYR n 
1 227 ILE n 
1 228 LYS n 
1 229 ASP n 
1 230 HIS n 
1 231 GLY n 
1 232 LEU n 
1 233 TYR n 
1 234 THR n 
1 235 LYS n 
1 236 GLY n 
1 237 SER n 
1 238 THR n 
1 239 TRP n 
1 240 LYS n 
1 241 GLY n 
1 242 LYS n 
1 243 SER n 
1 244 THR n 
1 245 GLN n 
1 246 SER n 
1 247 THR n 
1 248 GLU n 
1 249 GLY n 
1 250 LYS n 
1 251 THR n 
1 252 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 FKSG76 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH10-beta 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPROEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NMNA3_HUMAN 
_struct_ref.pdbx_db_accession          Q96T66 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRV
DPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKF
GLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWK
GKSTQSTEGKTS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NUS A 1 ? 252 ? Q96T66 1 ? 252 ? 1 252 
2 1 1NUS B 1 ? 252 ? Q96T66 1 ? 252 ? 1 252 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                           ?                                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
NMN non-polymer         . 'BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE'        'NICOTINAMIDE MONONUCLEOTIDE'                   
'C11 H16 N2 O8 P 1' 335.227 
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                   ?                                               
'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1NUS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   43.85 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'NA CADODALYTE, LITHIUM SULPHATE, PEG 400, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-07-12 
_diffrn_detector.details                'OSMIC MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1NUS 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   23460 
_reflns.number_all                   24193 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.051 
_reflns.pdbx_netI_over_sigmaI        43.4 
_reflns.B_iso_Wilson_estimate        28.1 
_reflns.pdbx_redundancy              7.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.24 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.463 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1186 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1NUS 
_refine.ls_number_reflns_obs                     23460 
_refine.ls_number_reflns_all                     24193 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.70 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    96.6 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          0.224 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.248 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1138 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               40.8 
_refine.aniso_B[1][1]                            -4.06 
_refine.aniso_B[2][2]                            -4.06 
_refine.aniso_B[3][3]                            8.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.353071 
_refine.solvent_model_param_bsol                 38.4082 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1KQN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1NUS 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.26 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3394 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             178 
_refine_hist.number_atoms_total               3688 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        36.70 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.98  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.55  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.58  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.16  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.13  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             3474 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.percent_reflns_obs               92.4 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             188 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 SO4.PAR           SO4.TOP     'X-RAY DIFFRACTION' 
4 APC.PAR           APC.TOP     'X-RAY DIFFRACTION' 
5 NMN.PAR           NMN.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1NUS 
_struct.title                     
'CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE COMPLEXED WITH ATP ANALOG AND NMN' 
_struct.pdbx_descriptor           FKSG76 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NUS 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'NAD BIOSYNTHESIS, MITOCHONDRIA, PYRIDINE ADENYLYLTRANSFERASE, ENZYME CATALYSIS, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'Biological assembly is tetramer and is generated by two fold axis : Y,X,-Z' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 19  ? THR A 36  ? THR A 19  THR A 36  1 ? 18 
HELX_P HELX_P2  2  ALA A 60  ? LEU A 72  ? ALA A 60  LEU A 72  1 ? 13 
HELX_P HELX_P3  3  PRO A 82  ? GLN A 87  ? PRO A 82  GLN A 87  1 ? 6  
HELX_P HELX_P4  4  GLU A 92  ? LEU A 105 ? GLU A 92  LEU A 105 1 ? 14 
HELX_P HELX_P5  5  ALA A 136 ? PHE A 142 ? ALA A 136 PHE A 142 1 ? 7  
HELX_P HELX_P6  6  LYS A 149 ? PHE A 160 ? LYS A 149 PHE A 160 1 ? 12 
HELX_P HELX_P7  7  ASP A 171 ? GLU A 178 ? ASP A 171 GLU A 178 1 ? 8  
HELX_P HELX_P8  8  SER A 179 ? HIS A 185 ? SER A 179 HIS A 185 1 ? 7  
HELX_P HELX_P9  9  SER A 201 ? GLN A 211 ? SER A 201 GLN A 211 1 ? 11 
HELX_P HELX_P10 10 PRO A 220 ? HIS A 230 ? PRO A 220 HIS A 230 1 ? 11 
HELX_P HELX_P11 11 THR B 19  ? GLY B 37  ? THR B 19  GLY B 37  1 ? 19 
HELX_P HELX_P12 12 ALA B 60  ? GLN B 73  ? ALA B 60  GLN B 73  1 ? 14 
HELX_P HELX_P13 13 PRO B 82  ? GLN B 87  ? PRO B 82  GLN B 87  1 ? 6  
HELX_P HELX_P14 14 GLU B 92  ? LEU B 104 ? GLU B 92  LEU B 104 1 ? 13 
HELX_P HELX_P15 15 ALA B 136 ? THR B 141 ? ALA B 136 THR B 141 1 ? 6  
HELX_P HELX_P16 16 PHE B 142 ? THR B 144 ? PHE B 142 THR B 144 5 ? 3  
HELX_P HELX_P17 17 LYS B 149 ? LYS B 159 ? LYS B 149 LYS B 159 1 ? 11 
HELX_P HELX_P18 18 ASP B 171 ? SER B 179 ? ASP B 171 SER B 179 1 ? 9  
HELX_P HELX_P19 19 ILE B 181 ? HIS B 187 ? ILE B 181 HIS B 187 5 ? 7  
HELX_P HELX_P20 20 SER B 201 ? GLN B 211 ? SER B 201 GLN B 211 1 ? 11 
HELX_P HELX_P21 21 PRO B 220 ? HIS B 230 ? PRO B 220 HIS B 230 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 16 A . ? ASN 16 A PRO 17 A ? PRO 17 A 1 0.05 
2 ASN 16 B . ? ASN 16 B PRO 17 B ? PRO 17 B 1 0.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 78  ? VAL A 80  ? ILE A 78  VAL A 80  
A 2 TYR A 39  ? PRO A 48  ? TYR A 39  PRO A 48  
A 3 ILE A 5   ? GLY A 13  ? ILE A 5   GLY A 13  
A 4 GLU A 129 ? GLY A 135 ? GLU A 129 GLY A 135 
A 5 LEU A 162 ? VAL A 165 ? LEU A 162 VAL A 165 
A 6 ILE A 189 ? ALA A 192 ? ILE A 189 ALA A 192 
B 1 ILE B 78  ? VAL B 80  ? ILE B 78  VAL B 80  
B 2 TYR B 39  ? PRO B 48  ? TYR B 39  PRO B 48  
B 3 ILE B 5   ? GLY B 13  ? ILE B 5   GLY B 13  
B 4 GLU B 129 ? GLY B 135 ? GLU B 129 GLY B 135 
B 5 LEU B 162 ? VAL B 165 ? LEU B 162 VAL B 165 
B 6 ILE B 189 ? ALA B 192 ? ILE B 189 ALA B 192 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 79  ? O ARG A 79  N GLY A 44  ? N GLY A 44  
A 2 3 O ILE A 45  ? O ILE A 45  N ALA A 11  ? N ALA A 11  
A 3 4 N LEU A 10  ? N LEU A 10  O LYS A 131 ? O LYS A 131 
A 4 5 N LEU A 132 ? N LEU A 132 O VAL A 163 ? O VAL A 163 
A 5 6 N LEU A 162 ? N LEU A 162 O HIS A 190 ? O HIS A 190 
B 1 2 O ARG B 79  ? O ARG B 79  N GLY B 44  ? N GLY B 44  
B 2 3 O SER B 47  ? O SER B 47  N ALA B 11  ? N ALA B 11  
B 3 4 N LEU B 10  ? N LEU B 10  O LEU B 133 ? O LEU B 133 
B 4 5 N LEU B 132 ? N LEU B 132 O VAL B 163 ? O VAL B 163 
B 5 6 N CYS B 164 ? N CYS B 164 O ALA B 192 ? O ALA B 192 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 301' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 302' 
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE NMN A 401' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE NMN B 402' 
AC5 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE APC A 501' 
AC6 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE APC B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  LYS A 95  ? LYS A 95  . ? 1_555 ? 
2  AC1 4  ARG A 98  ? ARG A 98  . ? 1_555 ? 
3  AC1 4  HIS A 152 ? HIS A 152 . ? 1_555 ? 
4  AC1 4  HOH I .   ? HOH A 768 . ? 1_555 ? 
5  AC2 3  LYS B 95  ? LYS B 95  . ? 1_555 ? 
6  AC2 3  ARG B 98  ? ARG B 98  . ? 1_555 ? 
7  AC2 3  HIS B 152 ? HIS B 152 . ? 1_555 ? 
8  AC3 16 CYS A 12  ? CYS A 12  . ? 1_555 ? 
9  AC3 16 GLY A 13  ? GLY A 13  . ? 1_555 ? 
10 AC3 16 TYR A 53  ? TYR A 53  . ? 1_555 ? 
11 AC3 16 LYS A 55  ? LYS A 55  . ? 1_555 ? 
12 AC3 16 TRP A 90  ? TRP A 90  . ? 1_555 ? 
13 AC3 16 GLU A 92  ? GLU A 92  . ? 1_555 ? 
14 AC3 16 THR A 93  ? THR A 93  . ? 1_555 ? 
15 AC3 16 LEU A 147 ? LEU A 147 . ? 1_555 ? 
16 AC3 16 TRP A 148 ? TRP A 148 . ? 1_555 ? 
17 AC3 16 HOH I .   ? HOH A 603 . ? 1_555 ? 
18 AC3 16 HOH I .   ? HOH A 619 . ? 1_555 ? 
19 AC3 16 HOH I .   ? HOH A 643 . ? 1_555 ? 
20 AC3 16 HOH I .   ? HOH A 686 . ? 1_555 ? 
21 AC3 16 HOH I .   ? HOH A 729 . ? 1_555 ? 
22 AC3 16 HOH I .   ? HOH A 734 . ? 1_555 ? 
23 AC3 16 HOH I .   ? HOH A 762 . ? 1_555 ? 
24 AC4 13 CYS B 12  ? CYS B 12  . ? 1_555 ? 
25 AC4 13 GLY B 13  ? GLY B 13  . ? 1_555 ? 
26 AC4 13 VAL B 49  ? VAL B 49  . ? 1_555 ? 
27 AC4 13 TYR B 53  ? TYR B 53  . ? 1_555 ? 
28 AC4 13 LYS B 55  ? LYS B 55  . ? 1_555 ? 
29 AC4 13 TRP B 90  ? TRP B 90  . ? 1_555 ? 
30 AC4 13 GLU B 92  ? GLU B 92  . ? 1_555 ? 
31 AC4 13 THR B 93  ? THR B 93  . ? 1_555 ? 
32 AC4 13 LEU B 147 ? LEU B 147 . ? 1_555 ? 
33 AC4 13 TRP B 148 ? TRP B 148 . ? 1_555 ? 
34 AC4 13 HOH J .   ? HOH B 609 . ? 1_555 ? 
35 AC4 13 HOH J .   ? HOH B 635 . ? 1_555 ? 
36 AC4 13 HOH J .   ? HOH B 675 . ? 1_555 ? 
37 AC5 22 GLY A 13  ? GLY A 13  . ? 1_555 ? 
38 AC5 22 SER A 14  ? SER A 14  . ? 1_555 ? 
39 AC5 22 PHE A 15  ? PHE A 15  . ? 1_555 ? 
40 AC5 22 MET A 21  ? MET A 21  . ? 1_555 ? 
41 AC5 22 HIS A 22  ? HIS A 22  . ? 1_555 ? 
42 AC5 22 MET A 25  ? MET A 25  . ? 1_555 ? 
43 AC5 22 LYS A 56  ? LYS A 56  . ? 1_555 ? 
44 AC5 22 CYS A 134 ? CYS A 134 . ? 1_555 ? 
45 AC5 22 GLY A 135 ? GLY A 135 . ? 1_555 ? 
46 AC5 22 ASP A 137 ? ASP A 137 . ? 1_555 ? 
47 AC5 22 VAL A 138 ? VAL A 138 . ? 1_555 ? 
48 AC5 22 ARG A 167 ? ARG A 167 . ? 1_555 ? 
49 AC5 22 ASN A 198 ? ASN A 198 . ? 1_555 ? 
50 AC5 22 ALA A 202 ? ALA A 202 . ? 1_555 ? 
51 AC5 22 THR A 203 ? THR A 203 . ? 1_555 ? 
52 AC5 22 ARG A 206 ? ARG A 206 . ? 1_555 ? 
53 AC5 22 HOH I .   ? HOH A 602 . ? 1_555 ? 
54 AC5 22 HOH I .   ? HOH A 683 . ? 1_555 ? 
55 AC5 22 HOH I .   ? HOH A 735 . ? 1_555 ? 
56 AC5 22 HOH I .   ? HOH A 754 . ? 1_555 ? 
57 AC5 22 HOH I .   ? HOH A 762 . ? 1_555 ? 
58 AC5 22 LYS B 140 ? LYS B 140 . ? 1_555 ? 
59 AC6 19 LYS A 140 ? LYS A 140 . ? 1_555 ? 
60 AC6 19 GLY B 13  ? GLY B 13  . ? 1_555 ? 
61 AC6 19 SER B 14  ? SER B 14  . ? 1_555 ? 
62 AC6 19 PHE B 15  ? PHE B 15  . ? 1_555 ? 
63 AC6 19 MET B 21  ? MET B 21  . ? 1_555 ? 
64 AC6 19 HIS B 22  ? HIS B 22  . ? 1_555 ? 
65 AC6 19 LYS B 56  ? LYS B 56  . ? 1_555 ? 
66 AC6 19 CYS B 134 ? CYS B 134 . ? 1_555 ? 
67 AC6 19 GLY B 135 ? GLY B 135 . ? 1_555 ? 
68 AC6 19 ASP B 137 ? ASP B 137 . ? 1_555 ? 
69 AC6 19 VAL B 138 ? VAL B 138 . ? 1_555 ? 
70 AC6 19 ARG B 167 ? ARG B 167 . ? 1_555 ? 
71 AC6 19 ASN B 198 ? ASN B 198 . ? 1_555 ? 
72 AC6 19 ILE B 200 ? ILE B 200 . ? 1_555 ? 
73 AC6 19 ALA B 202 ? ALA B 202 . ? 1_555 ? 
74 AC6 19 THR B 203 ? THR B 203 . ? 1_555 ? 
75 AC6 19 ARG B 206 ? ARG B 206 . ? 1_555 ? 
76 AC6 19 HOH J .   ? HOH B 620 . ? 1_555 ? 
77 AC6 19 HOH J .   ? HOH B 760 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1NUS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NUS 
_atom_sites.fract_transf_matrix[1][1]   0.012652 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012652 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006850 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . SER A 1 3   ? -8.118  37.261  14.496 1.00 58.41 ? 3   SER A N     1 
ATOM   2    C CA    . SER A 1 3   ? -6.733  36.829  14.145 1.00 57.19 ? 3   SER A CA    1 
ATOM   3    C C     . SER A 1 3   ? -6.503  35.337  14.432 1.00 56.86 ? 3   SER A C     1 
ATOM   4    O O     . SER A 1 3   ? -7.169  34.735  15.291 1.00 57.10 ? 3   SER A O     1 
ATOM   5    C CB    . SER A 1 3   ? -5.715  37.670  14.914 1.00 56.98 ? 3   SER A CB    1 
ATOM   6    N N     . ARG A 1 4   ? -5.544  34.758  13.712 1.00 54.57 ? 4   ARG A N     1 
ATOM   7    C CA    . ARG A 1 4   ? -5.199  33.344  13.855 1.00 51.55 ? 4   ARG A CA    1 
ATOM   8    C C     . ARG A 1 4   ? -4.402  33.082  15.123 1.00 49.54 ? 4   ARG A C     1 
ATOM   9    O O     . ARG A 1 4   ? -3.533  33.867  15.501 1.00 49.42 ? 4   ARG A O     1 
ATOM   10   C CB    . ARG A 1 4   ? -4.366  32.876  12.657 1.00 50.32 ? 4   ARG A CB    1 
ATOM   11   C CG    . ARG A 1 4   ? -5.068  32.934  11.306 1.00 48.87 ? 4   ARG A CG    1 
ATOM   12   C CD    . ARG A 1 4   ? -4.040  33.079  10.203 1.00 49.30 ? 4   ARG A CD    1 
ATOM   13   N NE    . ARG A 1 4   ? -4.601  32.944  8.860  1.00 51.59 ? 4   ARG A NE    1 
ATOM   14   C CZ    . ARG A 1 4   ? -4.892  31.781  8.274  1.00 52.67 ? 4   ARG A CZ    1 
ATOM   15   N NH1   . ARG A 1 4   ? -4.679  30.631  8.911  1.00 51.85 ? 4   ARG A NH1   1 
ATOM   16   N NH2   . ARG A 1 4   ? -5.386  31.765  7.040  1.00 52.38 ? 4   ARG A NH2   1 
ATOM   17   N N     . ILE A 1 5   ? -4.711  31.969  15.778 1.00 46.91 ? 5   ILE A N     1 
ATOM   18   C CA    . ILE A 1 5   ? -3.997  31.566  16.978 1.00 43.70 ? 5   ILE A CA    1 
ATOM   19   C C     . ILE A 1 5   ? -2.563  31.144  16.572 1.00 41.70 ? 5   ILE A C     1 
ATOM   20   O O     . ILE A 1 5   ? -2.365  30.373  15.622 1.00 41.49 ? 5   ILE A O     1 
ATOM   21   C CB    . ILE A 1 5   ? -4.755  30.409  17.658 1.00 43.88 ? 5   ILE A CB    1 
ATOM   22   C CG1   . ILE A 1 5   ? -6.022  30.972  18.322 1.00 44.77 ? 5   ILE A CG1   1 
ATOM   23   C CG2   . ILE A 1 5   ? -3.854  29.691  18.656 1.00 42.73 ? 5   ILE A CG2   1 
ATOM   24   C CD1   . ILE A 1 5   ? -6.875  29.928  19.055 1.00 47.94 ? 5   ILE A CD1   1 
ATOM   25   N N     . PRO A 1 6   ? -1.542  31.671  17.263 1.00 39.86 ? 6   PRO A N     1 
ATOM   26   C CA    . PRO A 1 6   ? -0.161  31.305  16.913 1.00 37.91 ? 6   PRO A CA    1 
ATOM   27   C C     . PRO A 1 6   ? 0.103   29.884  17.394 1.00 37.81 ? 6   PRO A C     1 
ATOM   28   O O     . PRO A 1 6   ? -0.459  29.456  18.400 1.00 36.58 ? 6   PRO A O     1 
ATOM   29   C CB    . PRO A 1 6   ? 0.690   32.339  17.665 1.00 39.00 ? 6   PRO A CB    1 
ATOM   30   C CG    . PRO A 1 6   ? -0.314  33.441  18.071 1.00 41.51 ? 6   PRO A CG    1 
ATOM   31   C CD    . PRO A 1 6   ? -1.559  32.638  18.372 1.00 39.79 ? 6   PRO A CD    1 
ATOM   32   N N     . VAL A 1 7   ? 0.960   29.150  16.690 1.00 36.71 ? 7   VAL A N     1 
ATOM   33   C CA    . VAL A 1 7   ? 1.230   27.765  17.070 1.00 32.65 ? 7   VAL A CA    1 
ATOM   34   C C     . VAL A 1 7   ? 2.681   27.294  16.897 1.00 32.11 ? 7   VAL A C     1 
ATOM   35   O O     . VAL A 1 7   ? 3.363   27.613  15.909 1.00 29.50 ? 7   VAL A O     1 
ATOM   36   C CB    . VAL A 1 7   ? 0.310   26.810  16.274 1.00 32.68 ? 7   VAL A CB    1 
ATOM   37   C CG1   . VAL A 1 7   ? 0.697   25.366  16.508 1.00 32.31 ? 7   VAL A CG1   1 
ATOM   38   C CG2   . VAL A 1 7   ? -1.120  27.008  16.702 1.00 36.00 ? 7   VAL A CG2   1 
ATOM   39   N N     . VAL A 1 8   ? 3.130   26.521  17.880 1.00 29.54 ? 8   VAL A N     1 
ATOM   40   C CA    . VAL A 1 8   ? 4.451   25.938  17.870 1.00 28.67 ? 8   VAL A CA    1 
ATOM   41   C C     . VAL A 1 8   ? 4.232   24.424  17.820 1.00 27.49 ? 8   VAL A C     1 
ATOM   42   O O     . VAL A 1 8   ? 3.455   23.876  18.604 1.00 26.57 ? 8   VAL A O     1 
ATOM   43   C CB    . VAL A 1 8   ? 5.251   26.289  19.148 1.00 29.21 ? 8   VAL A CB    1 
ATOM   44   C CG1   . VAL A 1 8   ? 6.578   25.567  19.123 1.00 27.56 ? 8   VAL A CG1   1 
ATOM   45   C CG2   . VAL A 1 8   ? 5.477   27.810  19.254 1.00 30.14 ? 8   VAL A CG2   1 
ATOM   46   N N     . LEU A 1 9   ? 4.884   23.762  16.873 1.00 25.11 ? 9   LEU A N     1 
ATOM   47   C CA    . LEU A 1 9   ? 4.786   22.314  16.743 1.00 25.24 ? 9   LEU A CA    1 
ATOM   48   C C     . LEU A 1 9   ? 6.001   21.642  17.399 1.00 25.69 ? 9   LEU A C     1 
ATOM   49   O O     . LEU A 1 9   ? 7.145   21.987  17.107 1.00 25.16 ? 9   LEU A O     1 
ATOM   50   C CB    . LEU A 1 9   ? 4.737   21.929  15.277 1.00 25.14 ? 9   LEU A CB    1 
ATOM   51   C CG    . LEU A 1 9   ? 3.531   22.479  14.513 1.00 27.26 ? 9   LEU A CG    1 
ATOM   52   C CD1   . LEU A 1 9   ? 3.638   22.162  13.023 1.00 27.08 ? 9   LEU A CD1   1 
ATOM   53   C CD2   . LEU A 1 9   ? 2.285   21.843  15.105 1.00 26.57 ? 9   LEU A CD2   1 
ATOM   54   N N     . LEU A 1 10  ? 5.758   20.676  18.273 1.00 24.12 ? 10  LEU A N     1 
ATOM   55   C CA    . LEU A 1 10  ? 6.860   19.989  18.933 1.00 25.24 ? 10  LEU A CA    1 
ATOM   56   C C     . LEU A 1 10  ? 6.877   18.523  18.543 1.00 24.49 ? 10  LEU A C     1 
ATOM   57   O O     . LEU A 1 10  ? 5.896   17.813  18.766 1.00 24.06 ? 10  LEU A O     1 
ATOM   58   C CB    . LEU A 1 10  ? 6.741   20.088  20.460 1.00 25.80 ? 10  LEU A CB    1 
ATOM   59   C CG    . LEU A 1 10  ? 7.715   19.168  21.201 1.00 26.46 ? 10  LEU A CG    1 
ATOM   60   C CD1   . LEU A 1 10  ? 9.143   19.656  20.932 1.00 26.99 ? 10  LEU A CD1   1 
ATOM   61   C CD2   . LEU A 1 10  ? 7.423   19.174  22.705 1.00 28.49 ? 10  LEU A CD2   1 
ATOM   62   N N     . ALA A 1 11  ? 7.987   18.068  17.969 1.00 24.23 ? 11  ALA A N     1 
ATOM   63   C CA    . ALA A 1 11  ? 8.089   16.665  17.584 1.00 25.14 ? 11  ALA A CA    1 
ATOM   64   C C     . ALA A 1 11  ? 9.104   15.929  18.440 1.00 25.31 ? 11  ALA A C     1 
ATOM   65   O O     . ALA A 1 11  ? 10.290  16.245  18.419 1.00 25.49 ? 11  ALA A O     1 
ATOM   66   C CB    . ALA A 1 11  ? 8.458   16.531  16.124 1.00 22.80 ? 11  ALA A CB    1 
ATOM   67   N N     . CYS A 1 12  ? 8.621   14.940  19.185 1.00 28.69 ? 12  CYS A N     1 
ATOM   68   C CA    . CYS A 1 12  ? 9.464   14.118  20.047 1.00 29.37 ? 12  CYS A CA    1 
ATOM   69   C C     . CYS A 1 12  ? 9.751   12.793  19.372 1.00 29.58 ? 12  CYS A C     1 
ATOM   70   O O     . CYS A 1 12  ? 8.929   12.273  18.625 1.00 33.44 ? 12  CYS A O     1 
ATOM   71   C CB    . CYS A 1 12  ? 8.777   13.915  21.402 1.00 30.13 ? 12  CYS A CB    1 
ATOM   72   S SG    . CYS A 1 12  ? 8.967   15.362  22.495 1.00 35.76 ? 12  CYS A SG    1 
ATOM   73   N N     . GLY A 1 13  ? 10.928  12.243  19.612 1.00 29.30 ? 13  GLY A N     1 
ATOM   74   C CA    . GLY A 1 13  ? 11.252  10.982  18.982 1.00 27.89 ? 13  GLY A CA    1 
ATOM   75   C C     . GLY A 1 13  ? 12.746  10.702  18.875 1.00 28.32 ? 13  GLY A C     1 
ATOM   76   O O     . GLY A 1 13  ? 13.595  11.464  19.349 1.00 27.87 ? 13  GLY A O     1 
ATOM   77   N N     . SER A 1 14  ? 13.054  9.581   18.248 1.00 27.27 ? 14  SER A N     1 
ATOM   78   C CA    . SER A 1 14  ? 14.418  9.159   18.071 1.00 29.39 ? 14  SER A CA    1 
ATOM   79   C C     . SER A 1 14  ? 15.267  10.025  17.136 1.00 28.51 ? 14  SER A C     1 
ATOM   80   O O     . SER A 1 14  ? 16.359  10.454  17.539 1.00 28.53 ? 14  SER A O     1 
ATOM   81   C CB    . SER A 1 14  ? 14.439  7.713   17.577 1.00 28.59 ? 14  SER A CB    1 
ATOM   82   O OG    . SER A 1 14  ? 14.284  6.826   18.667 1.00 36.45 ? 14  SER A OG    1 
ATOM   83   N N     . PHE A 1 15  ? 14.773  10.259  15.912 1.00 26.76 ? 15  PHE A N     1 
ATOM   84   C CA    . PHE A 1 15  ? 15.505  11.021  14.883 1.00 26.72 ? 15  PHE A CA    1 
ATOM   85   C C     . PHE A 1 15  ? 16.877  10.376  14.851 1.00 26.73 ? 15  PHE A C     1 
ATOM   86   O O     . PHE A 1 15  ? 17.899  11.012  15.088 1.00 27.46 ? 15  PHE A O     1 
ATOM   87   C CB    . PHE A 1 15  ? 15.577  12.479  15.286 1.00 26.97 ? 15  PHE A CB    1 
ATOM   88   C CG    . PHE A 1 15  ? 14.239  13.094  15.407 1.00 27.72 ? 15  PHE A CG    1 
ATOM   89   C CD1   . PHE A 1 15  ? 13.428  13.212  14.276 1.00 27.01 ? 15  PHE A CD1   1 
ATOM   90   C CD2   . PHE A 1 15  ? 13.726  13.454  16.653 1.00 28.80 ? 15  PHE A CD2   1 
ATOM   91   C CE1   . PHE A 1 15  ? 12.116  13.673  14.386 1.00 30.03 ? 15  PHE A CE1   1 
ATOM   92   C CE2   . PHE A 1 15  ? 12.420  13.915  16.781 1.00 26.37 ? 15  PHE A CE2   1 
ATOM   93   C CZ    . PHE A 1 15  ? 11.607  14.026  15.649 1.00 28.64 ? 15  PHE A CZ    1 
ATOM   94   N N     . ASN A 1 16  ? 16.856  9.086   14.536 1.00 25.98 ? 16  ASN A N     1 
ATOM   95   C CA    . ASN A 1 16  ? 18.034  8.243   14.560 1.00 25.23 ? 16  ASN A CA    1 
ATOM   96   C C     . ASN A 1 16  ? 18.336  7.549   13.246 1.00 24.79 ? 16  ASN A C     1 
ATOM   97   O O     . ASN A 1 16  ? 18.368  6.318   13.204 1.00 25.03 ? 16  ASN A O     1 
ATOM   98   C CB    . ASN A 1 16  ? 17.805  7.201   15.651 1.00 25.67 ? 16  ASN A CB    1 
ATOM   99   C CG    . ASN A 1 16  ? 18.968  6.235   15.827 1.00 28.31 ? 16  ASN A CG    1 
ATOM   100  O OD1   . ASN A 1 16  ? 18.756  5.023   15.935 1.00 28.85 ? 16  ASN A OD1   1 
ATOM   101  N ND2   . ASN A 1 16  ? 20.180  6.758   15.888 1.00 23.79 ? 16  ASN A ND2   1 
ATOM   102  N N     . PRO A 1 17  ? 18.653  8.316   12.179 1.00 23.50 ? 17  PRO A N     1 
ATOM   103  C CA    . PRO A 1 17  ? 18.758  9.780   12.082 1.00 22.42 ? 17  PRO A CA    1 
ATOM   104  C C     . PRO A 1 17  ? 17.472  10.412  11.580 1.00 22.93 ? 17  PRO A C     1 
ATOM   105  O O     . PRO A 1 17  ? 16.549  9.713   11.171 1.00 25.01 ? 17  PRO A O     1 
ATOM   106  C CB    . PRO A 1 17  ? 19.842  9.956   11.045 1.00 22.49 ? 17  PRO A CB    1 
ATOM   107  C CG    . PRO A 1 17  ? 19.426  8.886   10.016 1.00 21.22 ? 17  PRO A CG    1 
ATOM   108  C CD    . PRO A 1 17  ? 19.145  7.681   10.934 1.00 21.90 ? 17  PRO A CD    1 
ATOM   109  N N     . ILE A 1 18  ? 17.436  11.735  11.574 1.00 20.78 ? 18  ILE A N     1 
ATOM   110  C CA    . ILE A 1 18  ? 16.291  12.466  11.058 1.00 19.87 ? 18  ILE A CA    1 
ATOM   111  C C     . ILE A 1 18  ? 16.222  12.158  9.536  1.00 20.79 ? 18  ILE A C     1 
ATOM   112  O O     . ILE A 1 18  ? 17.251  12.069  8.875  1.00 19.92 ? 18  ILE A O     1 
ATOM   113  C CB    . ILE A 1 18  ? 16.485  13.969  11.330 1.00 21.30 ? 18  ILE A CB    1 
ATOM   114  C CG1   . ILE A 1 18  ? 15.203  14.743  11.010 1.00 22.32 ? 18  ILE A CG1   1 
ATOM   115  C CG2   . ILE A 1 18  ? 17.676  14.473  10.558 1.00 21.88 ? 18  ILE A CG2   1 
ATOM   116  C CD1   . ILE A 1 18  ? 15.206  16.175  11.545 1.00 22.47 ? 18  ILE A CD1   1 
ATOM   117  N N     . THR A 1 19  ? 15.019  11.980  8.995  1.00 21.03 ? 19  THR A N     1 
ATOM   118  C CA    . THR A 1 19  ? 14.846  11.625  7.588  1.00 20.93 ? 19  THR A CA    1 
ATOM   119  C C     . THR A 1 19  ? 14.009  12.669  6.865  1.00 22.30 ? 19  THR A C     1 
ATOM   120  O O     . THR A 1 19  ? 13.462  13.577  7.494  1.00 21.93 ? 19  THR A O     1 
ATOM   121  C CB    . THR A 1 19  ? 14.069  10.309  7.450  1.00 21.34 ? 19  THR A CB    1 
ATOM   122  O OG1   . THR A 1 19  ? 12.745  10.534  7.932  1.00 22.40 ? 19  THR A OG1   1 
ATOM   123  C CG2   . THR A 1 19  ? 14.729  9.165   8.262  1.00 19.33 ? 19  THR A CG2   1 
ATOM   124  N N     . ASN A 1 20  ? 13.899  12.523  5.542  1.00 22.26 ? 20  ASN A N     1 
ATOM   125  C CA    . ASN A 1 20  ? 13.079  13.438  4.760  1.00 23.49 ? 20  ASN A CA    1 
ATOM   126  C C     . ASN A 1 20  ? 11.630  13.315  5.187  1.00 23.60 ? 20  ASN A C     1 
ATOM   127  O O     . ASN A 1 20  ? 10.878  14.309  5.152  1.00 23.38 ? 20  ASN A O     1 
ATOM   128  C CB    . ASN A 1 20  ? 13.234  13.163  3.264  1.00 20.46 ? 20  ASN A CB    1 
ATOM   129  C CG    . ASN A 1 20  ? 14.547  13.694  2.751  1.00 22.16 ? 20  ASN A CG    1 
ATOM   130  O OD1   . ASN A 1 20  ? 15.177  14.503  3.445  1.00 23.16 ? 20  ASN A OD1   1 
ATOM   131  N ND2   . ASN A 1 20  ? 14.988  13.250  1.568  1.00 20.00 ? 20  ASN A ND2   1 
ATOM   132  N N     . MET A 1 21  ? 11.230  12.119  5.609  1.00 22.37 ? 21  MET A N     1 
ATOM   133  C CA    . MET A 1 21  ? 9.854   11.957  6.039  1.00 26.32 ? 21  MET A CA    1 
ATOM   134  C C     . MET A 1 21  ? 9.560   12.637  7.375  1.00 25.71 ? 21  MET A C     1 
ATOM   135  O O     . MET A 1 21  ? 8.483   13.222  7.548  1.00 23.67 ? 21  MET A O     1 
ATOM   136  C CB    . MET A 1 21  ? 9.464   10.480  6.033  1.00 32.83 ? 21  MET A CB    1 
ATOM   137  C CG    . MET A 1 21  ? 9.309   9.970   4.559  1.00 43.94 ? 21  MET A CG    1 
ATOM   138  S SD    . MET A 1 21  ? 8.396   11.114  3.337  1.00 54.63 ? 21  MET A SD    1 
ATOM   139  C CE    . MET A 1 21  ? 9.757   12.242  2.617  1.00 51.19 ? 21  MET A CE    1 
ATOM   140  N N     . HIS A 1 22  ? 10.519  12.600  8.306  1.00 23.69 ? 22  HIS A N     1 
ATOM   141  C CA    . HIS A 1 22  ? 10.343  13.286  9.583  1.00 23.79 ? 22  HIS A CA    1 
ATOM   142  C C     . HIS A 1 22  ? 10.133  14.769  9.307  1.00 23.55 ? 22  HIS A C     1 
ATOM   143  O O     . HIS A 1 22  ? 9.292   15.403  9.918  1.00 24.09 ? 22  HIS A O     1 
ATOM   144  C CB    . HIS A 1 22  ? 11.591  13.151  10.465 1.00 23.77 ? 22  HIS A CB    1 
ATOM   145  C CG    . HIS A 1 22  ? 11.784  11.788  11.029 1.00 24.33 ? 22  HIS A CG    1 
ATOM   146  N ND1   . HIS A 1 22  ? 13.030  11.244  11.229 1.00 26.54 ? 22  HIS A ND1   1 
ATOM   147  C CD2   . HIS A 1 22  ? 10.892  10.855  11.439 1.00 26.31 ? 22  HIS A CD2   1 
ATOM   148  C CE1   . HIS A 1 22  ? 12.899  10.030  11.739 1.00 28.59 ? 22  HIS A CE1   1 
ATOM   149  N NE2   . HIS A 1 22  ? 11.610  9.772   11.876 1.00 26.98 ? 22  HIS A NE2   1 
ATOM   150  N N     . LEU A 1 23  ? 10.919  15.312  8.381  1.00 23.33 ? 23  LEU A N     1 
ATOM   151  C CA    . LEU A 1 23  ? 10.850  16.724  8.028  1.00 24.45 ? 23  LEU A CA    1 
ATOM   152  C C     . LEU A 1 23  ? 9.552   17.031  7.264  1.00 23.71 ? 23  LEU A C     1 
ATOM   153  O O     . LEU A 1 23  ? 8.887   18.035  7.506  1.00 23.16 ? 23  LEU A O     1 
ATOM   154  C CB    . LEU A 1 23  ? 12.086  17.095  7.189  1.00 26.19 ? 23  LEU A CB    1 
ATOM   155  C CG    . LEU A 1 23  ? 13.422  16.954  7.956  1.00 26.95 ? 23  LEU A CG    1 
ATOM   156  C CD1   . LEU A 1 23  ? 14.621  16.971  6.991  1.00 23.99 ? 23  LEU A CD1   1 
ATOM   157  C CD2   . LEU A 1 23  ? 13.539  18.081  8.964  1.00 28.25 ? 23  LEU A CD2   1 
ATOM   158  N N     . ARG A 1 24  ? 9.200   16.147  6.347  1.00 23.48 ? 24  ARG A N     1 
ATOM   159  C CA    . ARG A 1 24  ? 7.980   16.290  5.568  1.00 23.07 ? 24  ARG A CA    1 
ATOM   160  C C     . ARG A 1 24  ? 6.785   16.439  6.547  1.00 24.30 ? 24  ARG A C     1 
ATOM   161  O O     . ARG A 1 24  ? 5.864   17.238  6.320  1.00 20.67 ? 24  ARG A O     1 
ATOM   162  C CB    . ARG A 1 24  ? 7.778   15.043  4.688  1.00 21.61 ? 24  ARG A CB    1 
ATOM   163  C CG    . ARG A 1 24  ? 6.540   15.116  3.801  1.00 23.53 ? 24  ARG A CG    1 
ATOM   164  C CD    . ARG A 1 24  ? 6.602   16.424  3.020  1.00 27.57 ? 24  ARG A CD    1 
ATOM   165  N NE    . ARG A 1 24  ? 5.379   16.761  2.301  1.00 31.13 ? 24  ARG A NE    1 
ATOM   166  C CZ    . ARG A 1 24  ? 5.145   17.957  1.758  1.00 31.54 ? 24  ARG A CZ    1 
ATOM   167  N NH1   . ARG A 1 24  ? 6.052   18.954  1.854  1.00 25.78 ? 24  ARG A NH1   1 
ATOM   168  N NH2   . ARG A 1 24  ? 4.011   18.147  1.110  1.00 26.34 ? 24  ARG A NH2   1 
ATOM   169  N N     . MET A 1 25  ? 6.827   15.673  7.635  1.00 23.80 ? 25  MET A N     1 
ATOM   170  C CA    . MET A 1 25  ? 5.766   15.681  8.648  1.00 24.02 ? 25  MET A CA    1 
ATOM   171  C C     . MET A 1 25  ? 5.465   17.116  9.107  1.00 22.22 ? 25  MET A C     1 
ATOM   172  O O     . MET A 1 25  ? 4.305   17.521  9.170  1.00 20.41 ? 25  MET A O     1 
ATOM   173  C CB    . MET A 1 25  ? 6.196   14.772  9.814  1.00 27.40 ? 25  MET A CB    1 
ATOM   174  C CG    . MET A 1 25  ? 5.263   14.744  11.017 1.00 33.91 ? 25  MET A CG    1 
ATOM   175  S SD    . MET A 1 25  ? 5.876   13.620  12.307 1.00 35.91 ? 25  MET A SD    1 
ATOM   176  C CE    . MET A 1 25  ? 7.312   14.526  12.908 1.00 37.16 ? 25  MET A CE    1 
ATOM   177  N N     . PHE A 1 26  ? 6.505   17.896  9.394  1.00 21.72 ? 26  PHE A N     1 
ATOM   178  C CA    . PHE A 1 26  ? 6.308   19.282  9.815  1.00 22.24 ? 26  PHE A CA    1 
ATOM   179  C C     . PHE A 1 26  ? 5.602   20.153  8.755  1.00 24.34 ? 26  PHE A C     1 
ATOM   180  O O     . PHE A 1 26  ? 4.739   20.957  9.088  1.00 22.91 ? 26  PHE A O     1 
ATOM   181  C CB    . PHE A 1 26  ? 7.644   19.948  10.138 1.00 21.91 ? 26  PHE A CB    1 
ATOM   182  C CG    . PHE A 1 26  ? 8.160   19.661  11.525 1.00 23.88 ? 26  PHE A CG    1 
ATOM   183  C CD1   . PHE A 1 26  ? 8.925   18.533  11.775 1.00 23.83 ? 26  PHE A CD1   1 
ATOM   184  C CD2   . PHE A 1 26  ? 7.881   20.525  12.576 1.00 21.01 ? 26  PHE A CD2   1 
ATOM   185  C CE1   . PHE A 1 26  ? 9.409   18.271  13.038 1.00 21.18 ? 26  PHE A CE1   1 
ATOM   186  C CE2   . PHE A 1 26  ? 8.365   20.263  13.838 1.00 21.27 ? 26  PHE A CE2   1 
ATOM   187  C CZ    . PHE A 1 26  ? 9.132   19.133  14.066 1.00 19.70 ? 26  PHE A CZ    1 
ATOM   188  N N     . GLU A 1 27  ? 6.008   20.015  7.491  1.00 23.69 ? 27  GLU A N     1 
ATOM   189  C CA    . GLU A 1 27  ? 5.436   20.810  6.407  1.00 25.85 ? 27  GLU A CA    1 
ATOM   190  C C     . GLU A 1 27  ? 3.957   20.476  6.186  1.00 25.49 ? 27  GLU A C     1 
ATOM   191  O O     . GLU A 1 27  ? 3.133   21.367  5.993  1.00 26.12 ? 27  GLU A O     1 
ATOM   192  C CB    . GLU A 1 27  ? 6.215   20.577  5.096  1.00 25.38 ? 27  GLU A CB    1 
ATOM   193  C CG    . GLU A 1 27  ? 7.697   20.967  5.138  1.00 26.42 ? 27  GLU A CG    1 
ATOM   194  C CD    . GLU A 1 27  ? 7.918   22.464  5.196  1.00 24.95 ? 27  GLU A CD    1 
ATOM   195  O OE1   . GLU A 1 27  ? 7.310   23.174  4.387  1.00 27.29 ? 27  GLU A OE1   1 
ATOM   196  O OE2   . GLU A 1 27  ? 8.702   22.945  6.035  1.00 26.36 ? 27  GLU A OE2   1 
ATOM   197  N N     . VAL A 1 28  ? 3.634   19.192  6.190  1.00 24.68 ? 28  VAL A N     1 
ATOM   198  C CA    . VAL A 1 28  ? 2.244   18.777  6.005  1.00 25.55 ? 28  VAL A CA    1 
ATOM   199  C C     . VAL A 1 28  ? 1.376   19.312  7.147  1.00 26.61 ? 28  VAL A C     1 
ATOM   200  O O     . VAL A 1 28  ? 0.285   19.822  6.911  1.00 24.66 ? 28  VAL A O     1 
ATOM   201  C CB    . VAL A 1 28  ? 2.120   17.254  5.962  1.00 26.25 ? 28  VAL A CB    1 
ATOM   202  C CG1   . VAL A 1 28  ? 0.633   16.853  5.997  1.00 23.74 ? 28  VAL A CG1   1 
ATOM   203  C CG2   . VAL A 1 28  ? 2.817   16.721  4.694  1.00 23.47 ? 28  VAL A CG2   1 
ATOM   204  N N     . ALA A 1 29  ? 1.881   19.220  8.377  1.00 25.89 ? 29  ALA A N     1 
ATOM   205  C CA    . ALA A 1 29  ? 1.138   19.707  9.553  1.00 26.86 ? 29  ALA A CA    1 
ATOM   206  C C     . ALA A 1 29  ? 0.913   21.220  9.487  1.00 27.33 ? 29  ALA A C     1 
ATOM   207  O O     . ALA A 1 29  ? -0.186  21.697  9.768  1.00 28.08 ? 29  ALA A O     1 
ATOM   208  C CB    . ALA A 1 29  ? 1.883   19.357  10.839 1.00 22.37 ? 29  ALA A CB    1 
ATOM   209  N N     . ARG A 1 30  ? 1.947   21.979  9.127  1.00 26.94 ? 30  ARG A N     1 
ATOM   210  C CA    . ARG A 1 30  ? 1.806   23.420  9.047  1.00 26.86 ? 30  ARG A CA    1 
ATOM   211  C C     . ARG A 1 30  ? 0.760   23.827  8.006  1.00 26.99 ? 30  ARG A C     1 
ATOM   212  O O     . ARG A 1 30  ? -0.117  24.638  8.297  1.00 27.03 ? 30  ARG A O     1 
ATOM   213  C CB    . ARG A 1 30  ? 3.141   24.081  8.717  1.00 28.50 ? 30  ARG A CB    1 
ATOM   214  C CG    . ARG A 1 30  ? 3.009   25.580  8.574  1.00 30.64 ? 30  ARG A CG    1 
ATOM   215  C CD    . ARG A 1 30  ? 4.363   26.272  8.473  1.00 32.44 ? 30  ARG A CD    1 
ATOM   216  N NE    . ARG A 1 30  ? 5.034   25.935  7.227  1.00 31.99 ? 30  ARG A NE    1 
ATOM   217  C CZ    . ARG A 1 30  ? 6.068   26.606  6.742  1.00 32.47 ? 30  ARG A CZ    1 
ATOM   218  N NH1   . ARG A 1 30  ? 6.547   27.653  7.407  1.00 34.11 ? 30  ARG A NH1   1 
ATOM   219  N NH2   . ARG A 1 30  ? 6.614   26.241  5.593  1.00 31.73 ? 30  ARG A NH2   1 
ATOM   220  N N     . ASP A 1 31  ? 0.850   23.269  6.801  1.00 25.85 ? 31  ASP A N     1 
ATOM   221  C CA    . ASP A 1 31  ? -0.124  23.590  5.762  1.00 27.11 ? 31  ASP A CA    1 
ATOM   222  C C     . ASP A 1 31  ? -1.550  23.200  6.219  1.00 27.34 ? 31  ASP A C     1 
ATOM   223  O O     . ASP A 1 31  ? -2.508  23.955  5.994  1.00 24.10 ? 31  ASP A O     1 
ATOM   224  C CB    . ASP A 1 31  ? 0.216   22.880  4.447  1.00 27.55 ? 31  ASP A CB    1 
ATOM   225  C CG    . ASP A 1 31  ? 1.399   23.525  3.710  1.00 30.30 ? 31  ASP A CG    1 
ATOM   226  O OD1   . ASP A 1 31  ? 1.830   24.628  4.097  1.00 32.64 ? 31  ASP A OD1   1 
ATOM   227  O OD2   . ASP A 1 31  ? 1.889   22.933  2.728  1.00 31.12 ? 31  ASP A OD2   1 
ATOM   228  N N     . HIS A 1 32  ? -1.688  22.041  6.869  1.00 26.95 ? 32  HIS A N     1 
ATOM   229  C CA    . HIS A 1 32  ? -3.009  21.612  7.339  1.00 27.95 ? 32  HIS A CA    1 
ATOM   230  C C     . HIS A 1 32  ? -3.548  22.629  8.348  1.00 27.66 ? 32  HIS A C     1 
ATOM   231  O O     . HIS A 1 32  ? -4.664  23.082  8.224  1.00 30.24 ? 32  HIS A O     1 
ATOM   232  C CB    . HIS A 1 32  ? -2.977  20.244  8.005  1.00 26.38 ? 32  HIS A CB    1 
ATOM   233  C CG    . HIS A 1 32  ? -4.295  19.864  8.608  1.00 27.46 ? 32  HIS A CG    1 
ATOM   234  N ND1   . HIS A 1 32  ? -5.337  19.356  7.861  1.00 29.88 ? 32  HIS A ND1   1 
ATOM   235  C CD2   . HIS A 1 32  ? -4.783  20.041  9.858  1.00 25.12 ? 32  HIS A CD2   1 
ATOM   236  C CE1   . HIS A 1 32  ? -6.409  19.240  8.626  1.00 30.20 ? 32  HIS A CE1   1 
ATOM   237  N NE2   . HIS A 1 32  ? -6.098  19.650  9.842  1.00 29.21 ? 32  HIS A NE2   1 
ATOM   238  N N     . LEU A 1 33  ? -2.747  22.989  9.341  1.00 29.02 ? 33  LEU A N     1 
ATOM   239  C CA    . LEU A 1 33  ? -3.187  23.972  10.329 1.00 30.91 ? 33  LEU A CA    1 
ATOM   240  C C     . LEU A 1 33  ? -3.536  25.333  9.695  1.00 31.54 ? 33  LEU A C     1 
ATOM   241  O O     . LEU A 1 33  ? -4.485  25.977  10.114 1.00 30.96 ? 33  LEU A O     1 
ATOM   242  C CB    . LEU A 1 33  ? -2.133  24.143  11.420 1.00 28.52 ? 33  LEU A CB    1 
ATOM   243  C CG    . LEU A 1 33  ? -2.046  22.943  12.386 1.00 29.78 ? 33  LEU A CG    1 
ATOM   244  C CD1   . LEU A 1 33  ? -1.069  23.222  13.554 1.00 27.32 ? 33  LEU A CD1   1 
ATOM   245  C CD2   . LEU A 1 33  ? -3.433  22.682  12.940 1.00 29.30 ? 33  LEU A CD2   1 
ATOM   246  N N     . HIS A 1 34  ? -2.785  25.760  8.681  1.00 32.78 ? 34  HIS A N     1 
ATOM   247  C CA    . HIS A 1 34  ? -3.068  27.034  8.010  1.00 35.07 ? 34  HIS A CA    1 
ATOM   248  C C     . HIS A 1 34  ? -4.322  26.956  7.152  1.00 36.95 ? 34  HIS A C     1 
ATOM   249  O O     . HIS A 1 34  ? -5.054  27.930  7.024  1.00 36.36 ? 34  HIS A O     1 
ATOM   250  C CB    . HIS A 1 34  ? -1.899  27.472  7.123  1.00 34.86 ? 34  HIS A CB    1 
ATOM   251  C CG    . HIS A 1 34  ? -0.718  27.983  7.885  1.00 34.94 ? 34  HIS A CG    1 
ATOM   252  N ND1   . HIS A 1 34  ? 0.463   28.336  7.274  1.00 32.66 ? 34  HIS A ND1   1 
ATOM   253  C CD2   . HIS A 1 34  ? -0.548  28.231  9.206  1.00 35.49 ? 34  HIS A CD2   1 
ATOM   254  C CE1   . HIS A 1 34  ? 1.310   28.786  8.183  1.00 35.92 ? 34  HIS A CE1   1 
ATOM   255  N NE2   . HIS A 1 34  ? 0.720   28.734  9.364  1.00 37.41 ? 34  HIS A NE2   1 
ATOM   256  N N     . GLN A 1 35  ? -4.555  25.797  6.551  1.00 39.34 ? 35  GLN A N     1 
ATOM   257  C CA    . GLN A 1 35  ? -5.730  25.610  5.723  1.00 41.98 ? 35  GLN A CA    1 
ATOM   258  C C     . GLN A 1 35  ? -7.001  25.732  6.545  1.00 42.70 ? 35  GLN A C     1 
ATOM   259  O O     . GLN A 1 35  ? -8.061  26.007  5.992  1.00 42.23 ? 35  GLN A O     1 
ATOM   260  C CB    . GLN A 1 35  ? -5.714  24.236  5.061  1.00 44.55 ? 35  GLN A CB    1 
ATOM   261  C CG    . GLN A 1 35  ? -5.268  24.237  3.615  1.00 50.77 ? 35  GLN A CG    1 
ATOM   262  C CD    . GLN A 1 35  ? -3.932  23.534  3.410  1.00 55.51 ? 35  GLN A CD    1 
ATOM   263  O OE1   . GLN A 1 35  ? -3.794  22.324  3.667  1.00 56.94 ? 35  GLN A OE1   1 
ATOM   264  N NE2   . GLN A 1 35  ? -2.931  24.293  2.948  1.00 56.59 ? 35  GLN A NE2   1 
ATOM   265  N N     . THR A 1 36  ? -6.911  25.509  7.857  1.00 42.66 ? 36  THR A N     1 
ATOM   266  C CA    . THR A 1 36  ? -8.108  25.602  8.696  1.00 42.51 ? 36  THR A CA    1 
ATOM   267  C C     . THR A 1 36  ? -8.526  27.056  8.805  1.00 43.48 ? 36  THR A C     1 
ATOM   268  O O     . THR A 1 36  ? -9.672  27.344  9.117  1.00 45.62 ? 36  THR A O     1 
ATOM   269  C CB    . THR A 1 36  ? -7.897  25.090  10.142 1.00 41.30 ? 36  THR A CB    1 
ATOM   270  O OG1   . THR A 1 36  ? -7.083  26.025  10.860 1.00 37.07 ? 36  THR A OG1   1 
ATOM   271  C CG2   . THR A 1 36  ? -7.263  23.701  10.151 1.00 37.99 ? 36  THR A CG2   1 
ATOM   272  N N     . GLY A 1 37  ? -7.584  27.964  8.563  1.00 43.10 ? 37  GLY A N     1 
ATOM   273  C CA    . GLY A 1 37  ? -7.874  29.382  8.632  1.00 42.63 ? 37  GLY A CA    1 
ATOM   274  C C     . GLY A 1 37  ? -7.847  29.960  10.035 1.00 44.08 ? 37  GLY A C     1 
ATOM   275  O O     . GLY A 1 37  ? -8.011  31.175  10.213 1.00 43.56 ? 37  GLY A O     1 
ATOM   276  N N     . MET A 1 38  ? -7.636  29.124  11.048 1.00 43.81 ? 38  MET A N     1 
ATOM   277  C CA    . MET A 1 38  ? -7.618  29.667  12.395 1.00 44.27 ? 38  MET A CA    1 
ATOM   278  C C     . MET A 1 38  ? -6.287  29.564  13.120 1.00 43.01 ? 38  MET A C     1 
ATOM   279  O O     . MET A 1 38  ? -6.171  29.977  14.269 1.00 42.69 ? 38  MET A O     1 
ATOM   280  C CB    . MET A 1 38  ? -8.740  29.047  13.227 1.00 46.53 ? 38  MET A CB    1 
ATOM   281  C CG    . MET A 1 38  ? -8.678  27.553  13.424 1.00 49.26 ? 38  MET A CG    1 
ATOM   282  S SD    . MET A 1 38  ? -10.191 26.972  14.299 1.00 53.52 ? 38  MET A SD    1 
ATOM   283  C CE    . MET A 1 38  ? -9.803  27.432  16.020 1.00 50.16 ? 38  MET A CE    1 
ATOM   284  N N     . TYR A 1 39  ? -5.271  29.045  12.438 1.00 42.07 ? 39  TYR A N     1 
ATOM   285  C CA    . TYR A 1 39  ? -3.943  28.903  13.042 1.00 41.18 ? 39  TYR A CA    1 
ATOM   286  C C     . TYR A 1 39  ? -2.829  29.474  12.174 1.00 39.43 ? 39  TYR A C     1 
ATOM   287  O O     . TYR A 1 39  ? -2.927  29.533  10.946 1.00 38.95 ? 39  TYR A O     1 
ATOM   288  C CB    . TYR A 1 39  ? -3.619  27.424  13.312 1.00 39.92 ? 39  TYR A CB    1 
ATOM   289  C CG    . TYR A 1 39  ? -4.565  26.729  14.266 1.00 41.33 ? 39  TYR A CG    1 
ATOM   290  C CD1   . TYR A 1 39  ? -4.540  27.016  15.629 1.00 39.52 ? 39  TYR A CD1   1 
ATOM   291  C CD2   . TYR A 1 39  ? -5.514  25.818  13.801 1.00 40.45 ? 39  TYR A CD2   1 
ATOM   292  C CE1   . TYR A 1 39  ? -5.434  26.427  16.505 1.00 40.47 ? 39  TYR A CE1   1 
ATOM   293  C CE2   . TYR A 1 39  ? -6.425  25.220  14.685 1.00 41.72 ? 39  TYR A CE2   1 
ATOM   294  C CZ    . TYR A 1 39  ? -6.373  25.538  16.035 1.00 40.88 ? 39  TYR A CZ    1 
ATOM   295  O OH    . TYR A 1 39  ? -7.270  24.999  16.923 1.00 45.28 ? 39  TYR A OH    1 
ATOM   296  N N     . GLN A 1 40  ? -1.767  29.890  12.842 1.00 40.27 ? 40  GLN A N     1 
ATOM   297  C CA    . GLN A 1 40  ? -0.575  30.398  12.182 1.00 40.93 ? 40  GLN A CA    1 
ATOM   298  C C     . GLN A 1 40  ? 0.592   29.690  12.873 1.00 38.41 ? 40  GLN A C     1 
ATOM   299  O O     . GLN A 1 40  ? 0.882   29.946  14.045 1.00 34.38 ? 40  GLN A O     1 
ATOM   300  C CB    . GLN A 1 40  ? -0.447  31.912  12.356 1.00 44.68 ? 40  GLN A CB    1 
ATOM   301  C CG    . GLN A 1 40  ? 0.705   32.521  11.579 1.00 50.18 ? 40  GLN A CG    1 
ATOM   302  C CD    . GLN A 1 40  ? 0.761   34.033  11.722 1.00 55.55 ? 40  GLN A CD    1 
ATOM   303  O OE1   . GLN A 1 40  ? 0.874   34.566  12.833 1.00 57.21 ? 40  GLN A OE1   1 
ATOM   304  N NE2   . GLN A 1 40  ? 0.674   34.735  10.594 1.00 58.61 ? 40  GLN A NE2   1 
ATOM   305  N N     . VAL A 1 41  ? 1.238   28.773  12.159 1.00 37.52 ? 41  VAL A N     1 
ATOM   306  C CA    . VAL A 1 41  ? 2.359   28.050  12.746 1.00 35.76 ? 41  VAL A CA    1 
ATOM   307  C C     . VAL A 1 41  ? 3.573   28.981  12.683 1.00 36.40 ? 41  VAL A C     1 
ATOM   308  O O     . VAL A 1 41  ? 3.961   29.448  11.619 1.00 34.42 ? 41  VAL A O     1 
ATOM   309  C CB    . VAL A 1 41  ? 2.602   26.718  12.009 1.00 34.26 ? 41  VAL A CB    1 
ATOM   310  C CG1   . VAL A 1 41  ? 3.707   25.920  12.703 1.00 33.49 ? 41  VAL A CG1   1 
ATOM   311  C CG2   . VAL A 1 41  ? 1.320   25.892  12.010 1.00 32.95 ? 41  VAL A CG2   1 
ATOM   312  N N     . ILE A 1 42  ? 4.137   29.280  13.848 1.00 35.66 ? 42  ILE A N     1 
ATOM   313  C CA    . ILE A 1 42  ? 5.271   30.183  13.918 1.00 36.28 ? 42  ILE A CA    1 
ATOM   314  C C     . ILE A 1 42  ? 6.598   29.479  14.180 1.00 35.66 ? 42  ILE A C     1 
ATOM   315  O O     . ILE A 1 42  ? 7.657   30.091  14.080 1.00 36.71 ? 42  ILE A O     1 
ATOM   316  C CB    . ILE A 1 42  ? 5.049   31.267  15.014 1.00 37.12 ? 42  ILE A CB    1 
ATOM   317  C CG1   . ILE A 1 42  ? 4.954   30.611  16.393 1.00 37.39 ? 42  ILE A CG1   1 
ATOM   318  C CG2   . ILE A 1 42  ? 3.765   32.043  14.717 1.00 38.17 ? 42  ILE A CG2   1 
ATOM   319  C CD1   . ILE A 1 42  ? 4.945   31.605  17.554 1.00 38.03 ? 42  ILE A CD1   1 
ATOM   320  N N     . GLN A 1 43  ? 6.547   28.201  14.529 1.00 32.72 ? 43  GLN A N     1 
ATOM   321  C CA    . GLN A 1 43  ? 7.773   27.480  14.782 1.00 31.48 ? 43  GLN A CA    1 
ATOM   322  C C     . GLN A 1 43  ? 7.624   25.984  14.986 1.00 28.01 ? 43  GLN A C     1 
ATOM   323  O O     . GLN A 1 43  ? 6.579   25.495  15.432 1.00 28.75 ? 43  GLN A O     1 
ATOM   324  C CB    . GLN A 1 43  ? 8.498   28.072  15.989 1.00 35.65 ? 43  GLN A CB    1 
ATOM   325  C CG    . GLN A 1 43  ? 9.787   27.322  16.292 1.00 41.88 ? 43  GLN A CG    1 
ATOM   326  C CD    . GLN A 1 43  ? 10.630  28.008  17.320 1.00 46.55 ? 43  GLN A CD    1 
ATOM   327  O OE1   . GLN A 1 43  ? 10.338  27.950  18.520 1.00 49.39 ? 43  GLN A OE1   1 
ATOM   328  N NE2   . GLN A 1 43  ? 11.686  28.683  16.860 1.00 47.10 ? 43  GLN A NE2   1 
ATOM   329  N N     . GLY A 1 44  ? 8.691   25.267  14.646 1.00 24.96 ? 44  GLY A N     1 
ATOM   330  C CA    . GLY A 1 44  ? 8.715   23.837  14.806 1.00 23.11 ? 44  GLY A CA    1 
ATOM   331  C C     . GLY A 1 44  ? 9.922   23.436  15.621 1.00 23.68 ? 44  GLY A C     1 
ATOM   332  O O     . GLY A 1 44  ? 11.014  23.993  15.477 1.00 23.49 ? 44  GLY A O     1 
ATOM   333  N N     . ILE A 1 45  ? 9.737   22.443  16.471 1.00 24.21 ? 45  ILE A N     1 
ATOM   334  C CA    . ILE A 1 45  ? 10.816  21.973  17.315 1.00 25.22 ? 45  ILE A CA    1 
ATOM   335  C C     . ILE A 1 45  ? 11.007  20.478  17.205 1.00 24.19 ? 45  ILE A C     1 
ATOM   336  O O     . ILE A 1 45  ? 10.053  19.698  17.363 1.00 24.67 ? 45  ILE A O     1 
ATOM   337  C CB    . ILE A 1 45  ? 10.539  22.312  18.795 1.00 27.06 ? 45  ILE A CB    1 
ATOM   338  C CG1   . ILE A 1 45  ? 10.352  23.831  18.935 1.00 26.61 ? 45  ILE A CG1   1 
ATOM   339  C CG2   . ILE A 1 45  ? 11.672  21.803  19.671 1.00 23.65 ? 45  ILE A CG2   1 
ATOM   340  C CD1   . ILE A 1 45  ? 10.049  24.314  20.338 1.00 27.72 ? 45  ILE A CD1   1 
ATOM   341  N N     . ILE A 1 46  ? 12.244  20.089  16.902 1.00 23.63 ? 46  ILE A N     1 
ATOM   342  C CA    . ILE A 1 46  ? 12.645  18.689  16.801 1.00 22.17 ? 46  ILE A CA    1 
ATOM   343  C C     . ILE A 1 46  ? 13.365  18.470  18.125 1.00 23.86 ? 46  ILE A C     1 
ATOM   344  O O     . ILE A 1 46  ? 14.365  19.149  18.421 1.00 24.39 ? 46  ILE A O     1 
ATOM   345  C CB    . ILE A 1 46  ? 13.648  18.455  15.628 1.00 22.96 ? 46  ILE A CB    1 
ATOM   346  C CG1   . ILE A 1 46  ? 12.925  18.518  14.310 1.00 21.10 ? 46  ILE A CG1   1 
ATOM   347  C CG2   . ILE A 1 46  ? 14.342  17.078  15.745 1.00 14.89 ? 46  ILE A CG2   1 
ATOM   348  C CD1   . ILE A 1 46  ? 12.140  17.276  14.064 1.00 32.95 ? 46  ILE A CD1   1 
ATOM   349  N N     . SER A 1 47  ? 12.865  17.530  18.918 1.00 23.94 ? 47  SER A N     1 
ATOM   350  C CA    . SER A 1 47  ? 13.463  17.240  20.218 1.00 24.59 ? 47  SER A CA    1 
ATOM   351  C C     . SER A 1 47  ? 13.864  15.785  20.339 1.00 22.94 ? 47  SER A C     1 
ATOM   352  O O     . SER A 1 47  ? 13.061  14.937  20.689 1.00 22.96 ? 47  SER A O     1 
ATOM   353  C CB    . SER A 1 47  ? 12.481  17.617  21.347 1.00 26.99 ? 47  SER A CB    1 
ATOM   354  O OG    . SER A 1 47  ? 13.003  17.265  22.624 1.00 27.87 ? 47  SER A OG    1 
ATOM   355  N N     . PRO A 1 48  ? 15.134  15.482  20.055 1.00 23.79 ? 48  PRO A N     1 
ATOM   356  C CA    . PRO A 1 48  ? 15.621  14.110  20.136 1.00 24.91 ? 48  PRO A CA    1 
ATOM   357  C C     . PRO A 1 48  ? 15.515  13.502  21.537 1.00 25.55 ? 48  PRO A C     1 
ATOM   358  O O     . PRO A 1 48  ? 15.803  14.151  22.541 1.00 28.64 ? 48  PRO A O     1 
ATOM   359  C CB    . PRO A 1 48  ? 17.065  14.231  19.636 1.00 23.49 ? 48  PRO A CB    1 
ATOM   360  C CG    . PRO A 1 48  ? 17.007  15.400  18.704 1.00 21.73 ? 48  PRO A CG    1 
ATOM   361  C CD    . PRO A 1 48  ? 16.157  16.369  19.478 1.00 21.07 ? 48  PRO A CD    1 
ATOM   362  N N     . VAL A 1 49  ? 15.118  12.240  21.587 1.00 27.11 ? 49  VAL A N     1 
ATOM   363  C CA    . VAL A 1 49  ? 14.954  11.532  22.842 1.00 27.46 ? 49  VAL A CA    1 
ATOM   364  C C     . VAL A 1 49  ? 16.286  11.325  23.564 1.00 30.36 ? 49  VAL A C     1 
ATOM   365  O O     . VAL A 1 49  ? 17.336  11.122  22.955 1.00 29.30 ? 49  VAL A O     1 
ATOM   366  C CB    . VAL A 1 49  ? 14.294  10.162  22.608 1.00 28.15 ? 49  VAL A CB    1 
ATOM   367  C CG1   . VAL A 1 49  ? 15.337  9.151   22.162 1.00 26.75 ? 49  VAL A CG1   1 
ATOM   368  C CG2   . VAL A 1 49  ? 13.575  9.681   23.879 1.00 28.76 ? 49  VAL A CG2   1 
ATOM   369  N N     . ASN A 1 50  ? 16.219  11.374  24.886 1.00 33.79 ? 50  ASN A N     1 
ATOM   370  C CA    . ASN A 1 50  ? 17.385  11.167  25.745 1.00 33.38 ? 50  ASN A CA    1 
ATOM   371  C C     . ASN A 1 50  ? 17.973  9.779   25.476 1.00 34.38 ? 50  ASN A C     1 
ATOM   372  O O     . ASN A 1 50  ? 17.244  8.834   25.166 1.00 33.58 ? 50  ASN A O     1 
ATOM   373  C CB    . ASN A 1 50  ? 16.936  11.264  27.205 1.00 34.77 ? 50  ASN A CB    1 
ATOM   374  C CG    . ASN A 1 50  ? 18.083  11.319  28.163 1.00 32.46 ? 50  ASN A CG    1 
ATOM   375  O OD1   . ASN A 1 50  ? 18.702  10.308  28.461 1.00 33.41 ? 50  ASN A OD1   1 
ATOM   376  N ND2   . ASN A 1 50  ? 18.384  12.513  28.643 1.00 35.17 ? 50  ASN A ND2   1 
ATOM   377  N N     . ASP A 1 51  ? 19.291  9.647   25.595 1.00 34.99 ? 51  ASP A N     1 
ATOM   378  C CA    . ASP A 1 51  ? 19.914  8.347   25.387 1.00 36.72 ? 51  ASP A CA    1 
ATOM   379  C C     . ASP A 1 51  ? 19.510  7.295   26.424 1.00 37.90 ? 51  ASP A C     1 
ATOM   380  O O     . ASP A 1 51  ? 19.576  6.097   26.144 1.00 37.97 ? 51  ASP A O     1 
ATOM   381  C CB    . ASP A 1 51  ? 21.429  8.474   25.389 1.00 36.07 ? 51  ASP A CB    1 
ATOM   382  C CG    . ASP A 1 51  ? 21.938  9.128   24.151 1.00 36.67 ? 51  ASP A CG    1 
ATOM   383  O OD1   . ASP A 1 51  ? 21.471  8.741   23.058 1.00 37.40 ? 51  ASP A OD1   1 
ATOM   384  O OD2   . ASP A 1 51  ? 22.806  10.012  24.263 1.00 39.75 ? 51  ASP A OD2   1 
ATOM   385  N N     . THR A 1 52  ? 19.093  7.715   27.614 1.00 39.99 ? 52  THR A N     1 
ATOM   386  C CA    . THR A 1 52  ? 18.712  6.725   28.624 1.00 44.35 ? 52  THR A CA    1 
ATOM   387  C C     . THR A 1 52  ? 17.439  5.951   28.275 1.00 46.91 ? 52  THR A C     1 
ATOM   388  O O     . THR A 1 52  ? 17.200  4.873   28.816 1.00 47.06 ? 52  THR A O     1 
ATOM   389  C CB    . THR A 1 52  ? 18.617  7.362   30.046 1.00 43.63 ? 52  THR A CB    1 
ATOM   390  O OG1   . THR A 1 52  ? 17.658  8.418   30.048 1.00 45.87 ? 52  THR A OG1   1 
ATOM   391  C CG2   . THR A 1 52  ? 19.963  7.938   30.458 1.00 42.10 ? 52  THR A CG2   1 
ATOM   392  N N     . TYR A 1 53  ? 16.641  6.482   27.350 1.00 50.04 ? 53  TYR A N     1 
ATOM   393  C CA    . TYR A 1 53  ? 15.424  5.801   26.920 1.00 52.68 ? 53  TYR A CA    1 
ATOM   394  C C     . TYR A 1 53  ? 15.859  4.412   26.451 1.00 55.68 ? 53  TYR A C     1 
ATOM   395  O O     . TYR A 1 53  ? 16.445  4.276   25.381 1.00 57.10 ? 53  TYR A O     1 
ATOM   396  C CB    . TYR A 1 53  ? 14.769  6.585   25.782 1.00 50.32 ? 53  TYR A CB    1 
ATOM   397  C CG    . TYR A 1 53  ? 13.385  6.103   25.369 1.00 49.55 ? 53  TYR A CG    1 
ATOM   398  C CD1   . TYR A 1 53  ? 12.359  5.955   26.306 1.00 49.07 ? 53  TYR A CD1   1 
ATOM   399  C CD2   . TYR A 1 53  ? 13.104  5.819   24.039 1.00 49.08 ? 53  TYR A CD2   1 
ATOM   400  C CE1   . TYR A 1 53  ? 11.070  5.530   25.931 1.00 47.99 ? 53  TYR A CE1   1 
ATOM   401  C CE2   . TYR A 1 53  ? 11.830  5.395   23.630 1.00 49.40 ? 53  TYR A CE2   1 
ATOM   402  C CZ    . TYR A 1 53  ? 10.817  5.251   24.587 1.00 49.37 ? 53  TYR A CZ    1 
ATOM   403  O OH    . TYR A 1 53  ? 9.577   4.821   24.206 1.00 47.75 ? 53  TYR A OH    1 
ATOM   404  N N     . GLY A 1 54  ? 15.600  3.394   27.275 1.00 60.04 ? 54  GLY A N     1 
ATOM   405  C CA    . GLY A 1 54  ? 15.996  2.012   26.970 1.00 63.56 ? 54  GLY A CA    1 
ATOM   406  C C     . GLY A 1 54  ? 15.700  1.583   25.551 1.00 66.14 ? 54  GLY A C     1 
ATOM   407  O O     . GLY A 1 54  ? 14.832  0.746   25.303 1.00 66.07 ? 54  GLY A O     1 
ATOM   408  N N     . LYS A 1 55  ? 16.471  2.128   24.621 1.00 68.38 ? 55  LYS A N     1 
ATOM   409  C CA    . LYS A 1 55  ? 16.251  1.892   23.202 1.00 69.87 ? 55  LYS A CA    1 
ATOM   410  C C     . LYS A 1 55  ? 17.215  0.973   22.471 1.00 70.14 ? 55  LYS A C     1 
ATOM   411  O O     . LYS A 1 55  ? 18.422  1.025   22.695 1.00 68.86 ? 55  LYS A O     1 
ATOM   412  C CB    . LYS A 1 55  ? 16.259  3.230   22.482 1.00 71.35 ? 55  LYS A CB    1 
ATOM   413  C CG    . LYS A 1 55  ? 14.895  3.734   22.086 1.00 73.29 ? 55  LYS A CG    1 
ATOM   414  C CD    . LYS A 1 55  ? 14.362  2.927   20.929 1.00 75.07 ? 55  LYS A CD    1 
ATOM   415  C CE    . LYS A 1 55  ? 12.978  3.399   20.533 1.00 75.92 ? 55  LYS A CE    1 
ATOM   416  N NZ    . LYS A 1 55  ? 12.892  3.606   19.058 1.00 76.76 ? 55  LYS A NZ    1 
ATOM   417  N N     . LYS A 1 56  ? 16.648  0.160   21.574 1.00 70.90 ? 56  LYS A N     1 
ATOM   418  C CA    . LYS A 1 56  ? 17.373  -0.787  20.711 1.00 71.37 ? 56  LYS A CA    1 
ATOM   419  C C     . LYS A 1 56  ? 18.845  -0.444  20.785 1.00 69.95 ? 56  LYS A C     1 
ATOM   420  O O     . LYS A 1 56  ? 19.716  -1.286  21.041 1.00 70.46 ? 56  LYS A O     1 
ATOM   421  C CB    . LYS A 1 56  ? 16.938  -0.600  19.256 1.00 72.31 ? 56  LYS A CB    1 
ATOM   422  C CG    . LYS A 1 56  ? 15.452  -0.657  19.030 1.00 74.26 ? 56  LYS A CG    1 
ATOM   423  C CD    . LYS A 1 56  ? 15.059  0.058   17.739 1.00 75.77 ? 56  LYS A CD    1 
ATOM   424  C CE    . LYS A 1 56  ? 14.990  1.564   17.941 1.00 76.86 ? 56  LYS A CE    1 
ATOM   425  N NZ    . LYS A 1 56  ? 14.163  2.215   16.880 1.00 77.85 ? 56  LYS A NZ    1 
ATOM   426  N N     . ASP A 1 57  ? 19.066  0.831   20.507 1.00 67.37 ? 57  ASP A N     1 
ATOM   427  C CA    . ASP A 1 57  ? 20.340  1.489   20.525 1.00 63.95 ? 57  ASP A CA    1 
ATOM   428  C C     . ASP A 1 57  ? 20.246  2.578   19.478 1.00 59.57 ? 57  ASP A C     1 
ATOM   429  O O     . ASP A 1 57  ? 20.023  2.343   18.281 1.00 59.73 ? 57  ASP A O     1 
ATOM   430  C CB    . ASP A 1 57  ? 21.512  0.555   20.272 1.00 65.78 ? 57  ASP A CB    1 
ATOM   431  C CG    . ASP A 1 57  ? 22.652  0.817   21.261 1.00 69.13 ? 57  ASP A CG    1 
ATOM   432  O OD1   . ASP A 1 57  ? 22.379  0.812   22.495 1.00 69.30 ? 57  ASP A OD1   1 
ATOM   433  O OD2   . ASP A 1 57  ? 23.803  1.017   20.815 1.00 69.77 ? 57  ASP A OD2   1 
ATOM   434  N N     . LEU A 1 58  ? 20.370  3.785   19.996 1.00 52.73 ? 58  LEU A N     1 
ATOM   435  C CA    . LEU A 1 58  ? 20.324  4.995   19.242 1.00 46.88 ? 58  LEU A CA    1 
ATOM   436  C C     . LEU A 1 58  ? 21.755  5.451   19.184 1.00 42.19 ? 58  LEU A C     1 
ATOM   437  O O     . LEU A 1 58  ? 22.561  5.067   20.022 1.00 40.32 ? 58  LEU A O     1 
ATOM   438  C CB    . LEU A 1 58  ? 19.528  6.054   20.019 1.00 47.31 ? 58  LEU A CB    1 
ATOM   439  C CG    . LEU A 1 58  ? 18.083  5.816   20.478 1.00 47.77 ? 58  LEU A CG    1 
ATOM   440  C CD1   . LEU A 1 58  ? 17.852  6.438   21.850 1.00 48.01 ? 58  LEU A CD1   1 
ATOM   441  C CD2   . LEU A 1 58  ? 17.139  6.417   19.461 1.00 48.05 ? 58  LEU A CD2   1 
ATOM   442  N N     . ALA A 1 59  ? 22.066  6.261   18.185 1.00 37.66 ? 59  ALA A N     1 
ATOM   443  C CA    . ALA A 1 59  ? 23.387  6.840   18.107 1.00 35.50 ? 59  ALA A CA    1 
ATOM   444  C C     . ALA A 1 59  ? 23.360  7.836   19.276 1.00 34.19 ? 59  ALA A C     1 
ATOM   445  O O     . ALA A 1 59  ? 22.278  8.205   19.740 1.00 31.00 ? 59  ALA A O     1 
ATOM   446  C CB    . ALA A 1 59  ? 23.580  7.578   16.778 1.00 32.29 ? 59  ALA A CB    1 
ATOM   447  N N     . ALA A 1 60  ? 24.523  8.270   19.758 1.00 34.81 ? 60  ALA A N     1 
ATOM   448  C CA    . ALA A 1 60  ? 24.557  9.219   20.866 1.00 34.33 ? 60  ALA A CA    1 
ATOM   449  C C     . ALA A 1 60  ? 23.696  10.423  20.546 1.00 35.01 ? 60  ALA A C     1 
ATOM   450  O O     . ALA A 1 60  ? 23.662  10.880  19.397 1.00 37.25 ? 60  ALA A O     1 
ATOM   451  C CB    . ALA A 1 60  ? 25.988  9.666   21.141 1.00 32.00 ? 60  ALA A CB    1 
ATOM   452  N N     . SER A 1 61  ? 23.021  10.964  21.554 1.00 32.73 ? 61  SER A N     1 
ATOM   453  C CA    . SER A 1 61  ? 22.174  12.117  21.322 1.00 31.74 ? 61  SER A CA    1 
ATOM   454  C C     . SER A 1 61  ? 22.960  13.309  20.775 1.00 29.44 ? 61  SER A C     1 
ATOM   455  O O     . SER A 1 61  ? 22.420  14.139  20.050 1.00 30.54 ? 61  SER A O     1 
ATOM   456  C CB    . SER A 1 61  ? 21.428  12.492  22.609 1.00 31.93 ? 61  SER A CB    1 
ATOM   457  O OG    . SER A 1 61  ? 22.301  13.052  23.562 1.00 34.75 ? 61  SER A OG    1 
ATOM   458  N N     . HIS A 1 62  ? 24.237  13.390  21.119 1.00 28.19 ? 62  HIS A N     1 
ATOM   459  C CA    . HIS A 1 62  ? 25.079  14.473  20.622 1.00 27.68 ? 62  HIS A CA    1 
ATOM   460  C C     . HIS A 1 62  ? 25.010  14.472  19.087 1.00 25.66 ? 62  HIS A C     1 
ATOM   461  O O     . HIS A 1 62  ? 24.868  15.516  18.466 1.00 27.09 ? 62  HIS A O     1 
ATOM   462  C CB    . HIS A 1 62  ? 26.540  14.270  21.054 1.00 26.21 ? 62  HIS A CB    1 
ATOM   463  C CG    . HIS A 1 62  ? 27.484  15.257  20.448 1.00 28.68 ? 62  HIS A CG    1 
ATOM   464  N ND1   . HIS A 1 62  ? 27.670  16.523  20.962 1.00 28.63 ? 62  HIS A ND1   1 
ATOM   465  C CD2   . HIS A 1 62  ? 28.264  15.183  19.342 1.00 30.03 ? 62  HIS A CD2   1 
ATOM   466  C CE1   . HIS A 1 62  ? 28.520  17.187  20.203 1.00 27.52 ? 62  HIS A CE1   1 
ATOM   467  N NE2   . HIS A 1 62  ? 28.896  16.397  19.212 1.00 29.57 ? 62  HIS A NE2   1 
ATOM   468  N N     . HIS A 1 63  ? 25.108  13.287  18.500 1.00 24.51 ? 63  HIS A N     1 
ATOM   469  C CA    . HIS A 1 63  ? 25.048  13.120  17.047 1.00 26.03 ? 63  HIS A CA    1 
ATOM   470  C C     . HIS A 1 63  ? 23.659  13.343  16.450 1.00 26.01 ? 63  HIS A C     1 
ATOM   471  O O     . HIS A 1 63  ? 23.531  13.876  15.347 1.00 28.88 ? 63  HIS A O     1 
ATOM   472  C CB    . HIS A 1 63  ? 25.503  11.719  16.656 1.00 26.10 ? 63  HIS A CB    1 
ATOM   473  C CG    . HIS A 1 63  ? 26.923  11.426  17.021 1.00 27.09 ? 63  HIS A CG    1 
ATOM   474  N ND1   . HIS A 1 63  ? 27.950  12.321  16.788 1.00 26.79 ? 63  HIS A ND1   1 
ATOM   475  C CD2   . HIS A 1 63  ? 27.492  10.322  17.562 1.00 26.50 ? 63  HIS A CD2   1 
ATOM   476  C CE1   . HIS A 1 63  ? 29.092  11.775  17.169 1.00 29.11 ? 63  HIS A CE1   1 
ATOM   477  N NE2   . HIS A 1 63  ? 28.842  10.564  17.640 1.00 28.77 ? 63  HIS A NE2   1 
ATOM   478  N N     . ARG A 1 64  ? 22.623  12.936  17.172 1.00 24.09 ? 64  ARG A N     1 
ATOM   479  C CA    . ARG A 1 64  ? 21.263  13.077  16.688 1.00 24.16 ? 64  ARG A CA    1 
ATOM   480  C C     . ARG A 1 64  ? 20.842  14.552  16.660 1.00 24.79 ? 64  ARG A C     1 
ATOM   481  O O     . ARG A 1 64  ? 20.191  14.995  15.710 1.00 24.66 ? 64  ARG A O     1 
ATOM   482  C CB    . ARG A 1 64  ? 20.338  12.197  17.529 1.00 23.35 ? 64  ARG A CB    1 
ATOM   483  C CG    . ARG A 1 64  ? 20.524  10.739  17.172 1.00 22.41 ? 64  ARG A CG    1 
ATOM   484  C CD    . ARG A 1 64  ? 19.568  9.795   17.898 1.00 24.16 ? 64  ARG A CD    1 
ATOM   485  N NE    . ARG A 1 64  ? 19.889  9.619   19.315 1.00 24.25 ? 64  ARG A NE    1 
ATOM   486  C CZ    . ARG A 1 64  ? 19.123  10.029  20.326 1.00 26.09 ? 64  ARG A CZ    1 
ATOM   487  N NH1   . ARG A 1 64  ? 17.971  10.663  20.102 1.00 22.43 ? 64  ARG A NH1   1 
ATOM   488  N NH2   . ARG A 1 64  ? 19.491  9.764   21.574 1.00 26.56 ? 64  ARG A NH2   1 
ATOM   489  N N     . VAL A 1 65  ? 21.258  15.306  17.681 1.00 22.64 ? 65  VAL A N     1 
ATOM   490  C CA    . VAL A 1 65  ? 21.008  16.730  17.730 1.00 23.16 ? 65  VAL A CA    1 
ATOM   491  C C     . VAL A 1 65  ? 21.769  17.390  16.555 1.00 24.49 ? 65  VAL A C     1 
ATOM   492  O O     . VAL A 1 65  ? 21.222  18.256  15.845 1.00 23.56 ? 65  VAL A O     1 
ATOM   493  C CB    . VAL A 1 65  ? 21.492  17.330  19.090 1.00 25.73 ? 65  VAL A CB    1 
ATOM   494  C CG1   . VAL A 1 65  ? 21.494  18.865  19.026 1.00 22.15 ? 65  VAL A CG1   1 
ATOM   495  C CG2   . VAL A 1 65  ? 20.563  16.831  20.241 1.00 24.62 ? 65  VAL A CG2   1 
ATOM   496  N N     . ALA A 1 66  ? 23.027  16.979  16.355 1.00 22.27 ? 66  ALA A N     1 
ATOM   497  C CA    . ALA A 1 66  ? 23.856  17.522  15.271 1.00 21.94 ? 66  ALA A CA    1 
ATOM   498  C C     . ALA A 1 66  ? 23.217  17.272  13.898 1.00 20.40 ? 66  ALA A C     1 
ATOM   499  O O     . ALA A 1 66  ? 23.093  18.191  13.094 1.00 21.63 ? 66  ALA A O     1 
ATOM   500  C CB    . ALA A 1 66  ? 25.278  16.896  15.299 1.00 19.32 ? 66  ALA A CB    1 
ATOM   501  N N     . MET A 1 67  ? 22.811  16.032  13.643 1.00 20.68 ? 67  MET A N     1 
ATOM   502  C CA    . MET A 1 67  ? 22.210  15.705  12.354 1.00 21.79 ? 67  MET A CA    1 
ATOM   503  C C     . MET A 1 67  ? 20.939  16.516  12.120 1.00 21.83 ? 67  MET A C     1 
ATOM   504  O O     . MET A 1 67  ? 20.714  17.005  11.009 1.00 21.96 ? 67  MET A O     1 
ATOM   505  C CB    . MET A 1 67  ? 21.959  14.200  12.240 1.00 21.33 ? 67  MET A CB    1 
ATOM   506  C CG    . MET A 1 67  ? 23.281  13.405  12.152 1.00 23.73 ? 67  MET A CG    1 
ATOM   507  S SD    . MET A 1 67  ? 23.072  11.643  11.961 1.00 25.79 ? 67  MET A SD    1 
ATOM   508  C CE    . MET A 1 67  ? 22.492  11.177  13.649 1.00 24.26 ? 67  MET A CE    1 
ATOM   509  N N     . ALA A 1 68  ? 20.136  16.702  13.167 1.00 22.04 ? 68  ALA A N     1 
ATOM   510  C CA    . ALA A 1 68  ? 18.908  17.494  13.047 1.00 22.72 ? 68  ALA A CA    1 
ATOM   511  C C     . ALA A 1 68  ? 19.280  18.941  12.732 1.00 23.42 ? 68  ALA A C     1 
ATOM   512  O O     . ALA A 1 68  ? 18.744  19.536  11.790 1.00 24.47 ? 68  ALA A O     1 
ATOM   513  C CB    . ALA A 1 68  ? 18.055  17.403  14.340 1.00 21.58 ? 68  ALA A CB    1 
ATOM   514  N N     . ARG A 1 69  ? 20.219  19.512  13.491 1.00 22.60 ? 69  ARG A N     1 
ATOM   515  C CA    . ARG A 1 69  ? 20.662  20.884  13.216 1.00 20.83 ? 69  ARG A CA    1 
ATOM   516  C C     . ARG A 1 69  ? 21.073  21.047  11.743 1.00 21.55 ? 69  ARG A C     1 
ATOM   517  O O     . ARG A 1 69  ? 20.664  21.991  11.076 1.00 19.67 ? 69  ARG A O     1 
ATOM   518  C CB    . ARG A 1 69  ? 21.860  21.267  14.096 1.00 21.90 ? 69  ARG A CB    1 
ATOM   519  C CG    . ARG A 1 69  ? 22.499  22.597  13.704 1.00 24.24 ? 69  ARG A CG    1 
ATOM   520  C CD    . ARG A 1 69  ? 23.500  23.114  14.768 1.00 25.73 ? 69  ARG A CD    1 
ATOM   521  N NE    . ARG A 1 69  ? 22.901  23.253  16.104 1.00 24.91 ? 69  ARG A NE    1 
ATOM   522  C CZ    . ARG A 1 69  ? 23.193  22.446  17.121 1.00 26.06 ? 69  ARG A CZ    1 
ATOM   523  N NH1   . ARG A 1 69  ? 24.073  21.466  16.951 1.00 25.09 ? 69  ARG A NH1   1 
ATOM   524  N NH2   . ARG A 1 69  ? 22.587  22.581  18.291 1.00 26.65 ? 69  ARG A NH2   1 
ATOM   525  N N     . LEU A 1 70  ? 21.902  20.127  11.253 1.00 20.72 ? 70  LEU A N     1 
ATOM   526  C CA    . LEU A 1 70  ? 22.378  20.177  9.875  1.00 20.00 ? 70  LEU A CA    1 
ATOM   527  C C     . LEU A 1 70  ? 21.210  20.032  8.879  1.00 21.28 ? 70  LEU A C     1 
ATOM   528  O O     . LEU A 1 70  ? 21.126  20.770  7.882  1.00 22.40 ? 70  LEU A O     1 
ATOM   529  C CB    . LEU A 1 70  ? 23.426  19.077  9.646  1.00 20.00 ? 70  LEU A CB    1 
ATOM   530  C CG    . LEU A 1 70  ? 24.751  19.251  10.426 1.00 20.56 ? 70  LEU A CG    1 
ATOM   531  C CD1   . LEU A 1 70  ? 25.618  18.026  10.270 1.00 18.54 ? 70  LEU A CD1   1 
ATOM   532  C CD2   . LEU A 1 70  ? 25.495  20.472  9.921  1.00 19.91 ? 70  LEU A CD2   1 
ATOM   533  N N     . ALA A 1 71  ? 20.310  19.098  9.154  1.00 18.35 ? 71  ALA A N     1 
ATOM   534  C CA    . ALA A 1 71  ? 19.130  18.897  8.305  1.00 19.59 ? 71  ALA A CA    1 
ATOM   535  C C     . ALA A 1 71  ? 18.235  20.145  8.236  1.00 21.66 ? 71  ALA A C     1 
ATOM   536  O O     . ALA A 1 71  ? 17.606  20.427  7.196  1.00 21.53 ? 71  ALA A O     1 
ATOM   537  C CB    . ALA A 1 71  ? 18.313  17.752  8.830  1.00 15.30 ? 71  ALA A CB    1 
ATOM   538  N N     . LEU A 1 72  ? 18.172  20.879  9.341  1.00 19.09 ? 72  LEU A N     1 
ATOM   539  C CA    . LEU A 1 72  ? 17.315  22.063  9.441  1.00 22.62 ? 72  LEU A CA    1 
ATOM   540  C C     . LEU A 1 72  ? 17.945  23.380  9.011  1.00 24.35 ? 72  LEU A C     1 
ATOM   541  O O     . LEU A 1 72  ? 17.329  24.431  9.120  1.00 24.92 ? 72  LEU A O     1 
ATOM   542  C CB    . LEU A 1 72  ? 16.793  22.190  10.882 1.00 19.54 ? 72  LEU A CB    1 
ATOM   543  C CG    . LEU A 1 72  ? 15.998  20.937  11.247 1.00 22.27 ? 72  LEU A CG    1 
ATOM   544  C CD1   . LEU A 1 72  ? 15.625  20.946  12.724 1.00 20.91 ? 72  LEU A CD1   1 
ATOM   545  C CD2   . LEU A 1 72  ? 14.744  20.878  10.323 1.00 17.62 ? 72  LEU A CD2   1 
ATOM   546  N N     . GLN A 1 73  ? 19.166  23.322  8.500  1.00 27.62 ? 73  GLN A N     1 
ATOM   547  C CA    . GLN A 1 73  ? 19.845  24.533  8.074  1.00 30.56 ? 73  GLN A CA    1 
ATOM   548  C C     . GLN A 1 73  ? 19.052  25.282  6.999  1.00 31.81 ? 73  GLN A C     1 
ATOM   549  O O     . GLN A 1 73  ? 18.987  26.513  7.034  1.00 30.85 ? 73  GLN A O     1 
ATOM   550  C CB    . GLN A 1 73  ? 21.238  24.191  7.559  1.00 33.05 ? 73  GLN A CB    1 
ATOM   551  C CG    . GLN A 1 73  ? 22.215  25.321  7.683  1.00 42.12 ? 73  GLN A CG    1 
ATOM   552  C CD    . GLN A 1 73  ? 22.375  25.820  9.134  1.00 48.56 ? 73  GLN A CD    1 
ATOM   553  O OE1   . GLN A 1 73  ? 22.511  25.022  10.088 1.00 50.78 ? 73  GLN A OE1   1 
ATOM   554  N NE2   . GLN A 1 73  ? 22.373  27.145  9.300  1.00 49.48 ? 73  GLN A NE2   1 
ATOM   555  N N     . THR A 1 74  ? 18.430  24.544  6.075  1.00 31.55 ? 74  THR A N     1 
ATOM   556  C CA    . THR A 1 74  ? 17.643  25.149  4.988  1.00 31.89 ? 74  THR A CA    1 
ATOM   557  C C     . THR A 1 74  ? 16.168  25.372  5.337  1.00 32.97 ? 74  THR A C     1 
ATOM   558  O O     . THR A 1 74  ? 15.326  25.575  4.433  1.00 32.23 ? 74  THR A O     1 
ATOM   559  C CB    . THR A 1 74  ? 17.656  24.288  3.733  1.00 33.74 ? 74  THR A CB    1 
ATOM   560  O OG1   . THR A 1 74  ? 16.963  23.057  4.006  1.00 36.57 ? 74  THR A OG1   1 
ATOM   561  C CG2   . THR A 1 74  ? 19.108  23.990  3.297  1.00 33.59 ? 74  THR A CG2   1 
ATOM   562  N N     . SER A 1 75  ? 15.849  25.307  6.628  1.00 28.37 ? 75  SER A N     1 
ATOM   563  C CA    . SER A 1 75  ? 14.485  25.554  7.062  1.00 28.41 ? 75  SER A CA    1 
ATOM   564  C C     . SER A 1 75  ? 14.486  26.886  7.785  1.00 30.11 ? 75  SER A C     1 
ATOM   565  O O     . SER A 1 75  ? 15.376  27.166  8.587  1.00 31.36 ? 75  SER A O     1 
ATOM   566  C CB    . SER A 1 75  ? 13.989  24.465  8.031  1.00 27.79 ? 75  SER A CB    1 
ATOM   567  O OG    . SER A 1 75  ? 12.696  24.797  8.521  1.00 22.41 ? 75  SER A OG    1 
ATOM   568  N N     . ASP A 1 76  ? 13.502  27.722  7.509  1.00 31.48 ? 76  ASP A N     1 
ATOM   569  C CA    . ASP A 1 76  ? 13.455  29.000  8.198  1.00 33.92 ? 76  ASP A CA    1 
ATOM   570  C C     . ASP A 1 76  ? 12.494  28.998  9.384  1.00 32.32 ? 76  ASP A C     1 
ATOM   571  O O     . ASP A 1 76  ? 12.274  30.048  9.988  1.00 34.10 ? 76  ASP A O     1 
ATOM   572  C CB    . ASP A 1 76  ? 13.072  30.124  7.229  1.00 36.67 ? 76  ASP A CB    1 
ATOM   573  C CG    . ASP A 1 76  ? 11.741  29.886  6.567  1.00 40.64 ? 76  ASP A CG    1 
ATOM   574  O OD1   . ASP A 1 76  ? 10.996  29.013  7.054  1.00 42.97 ? 76  ASP A OD1   1 
ATOM   575  O OD2   . ASP A 1 76  ? 11.430  30.571  5.568  1.00 43.14 ? 76  ASP A OD2   1 
ATOM   576  N N     . TRP A 1 77  ? 11.923  27.840  9.730  1.00 30.48 ? 77  TRP A N     1 
ATOM   577  C CA    . TRP A 1 77  ? 10.988  27.794  10.868 1.00 27.54 ? 77  TRP A CA    1 
ATOM   578  C C     . TRP A 1 77  ? 11.089  26.587  11.788 1.00 26.69 ? 77  TRP A C     1 
ATOM   579  O O     . TRP A 1 77  ? 10.412  26.527  12.810 1.00 29.47 ? 77  TRP A O     1 
ATOM   580  C CB    . TRP A 1 77  ? 9.541   27.924  10.383 1.00 25.95 ? 77  TRP A CB    1 
ATOM   581  C CG    . TRP A 1 77  ? 9.037   26.721  9.643  1.00 26.75 ? 77  TRP A CG    1 
ATOM   582  C CD1   . TRP A 1 77  ? 9.359   26.340  8.354  1.00 25.29 ? 77  TRP A CD1   1 
ATOM   583  C CD2   . TRP A 1 77  ? 8.135   25.725  10.147 1.00 23.40 ? 77  TRP A CD2   1 
ATOM   584  N NE1   . TRP A 1 77  ? 8.706   25.167  8.037  1.00 26.70 ? 77  TRP A NE1   1 
ATOM   585  C CE2   . TRP A 1 77  ? 7.949   24.766  9.115  1.00 25.27 ? 77  TRP A CE2   1 
ATOM   586  C CE3   . TRP A 1 77  ? 7.467   25.544  11.371 1.00 21.36 ? 77  TRP A CE3   1 
ATOM   587  C CZ2   . TRP A 1 77  ? 7.105   23.638  9.273  1.00 22.37 ? 77  TRP A CZ2   1 
ATOM   588  C CZ3   . TRP A 1 77  ? 6.632   24.428  11.530 1.00 19.45 ? 77  TRP A CZ3   1 
ATOM   589  C CH2   . TRP A 1 77  ? 6.458   23.490  10.482 1.00 20.06 ? 77  TRP A CH2   1 
ATOM   590  N N     . ILE A 1 78  ? 11.930  25.625  11.438 1.00 24.84 ? 78  ILE A N     1 
ATOM   591  C CA    . ILE A 1 78  ? 12.100  24.441  12.260 1.00 22.66 ? 78  ILE A CA    1 
ATOM   592  C C     . ILE A 1 78  ? 13.527  24.403  12.820 1.00 24.28 ? 78  ILE A C     1 
ATOM   593  O O     . ILE A 1 78  ? 14.501  24.578  12.079 1.00 23.72 ? 78  ILE A O     1 
ATOM   594  C CB    . ILE A 1 78  ? 11.887  23.138  11.457 1.00 20.73 ? 78  ILE A CB    1 
ATOM   595  C CG1   . ILE A 1 78  ? 10.619  23.229  10.608 1.00 18.79 ? 78  ILE A CG1   1 
ATOM   596  C CG2   . ILE A 1 78  ? 11.773  21.938  12.432 1.00 15.01 ? 78  ILE A CG2   1 
ATOM   597  C CD1   . ILE A 1 78  ? 10.370  21.985  9.784  1.00 18.20 ? 78  ILE A CD1   1 
ATOM   598  N N     . ARG A 1 79  ? 13.634  24.154  14.119 1.00 24.66 ? 79  ARG A N     1 
ATOM   599  C CA    . ARG A 1 79  ? 14.915  24.081  14.790 1.00 26.82 ? 79  ARG A CA    1 
ATOM   600  C C     . ARG A 1 79  ? 14.992  22.884  15.711 1.00 24.99 ? 79  ARG A C     1 
ATOM   601  O O     . ARG A 1 79  ? 13.968  22.343  16.138 1.00 24.26 ? 79  ARG A O     1 
ATOM   602  C CB    . ARG A 1 79  ? 15.167  25.351  15.617 1.00 30.25 ? 79  ARG A CB    1 
ATOM   603  C CG    . ARG A 1 79  ? 14.333  25.449  16.888 1.00 35.10 ? 79  ARG A CG    1 
ATOM   604  C CD    . ARG A 1 79  ? 14.586  26.777  17.638 1.00 40.09 ? 79  ARG A CD    1 
ATOM   605  N NE    . ARG A 1 79  ? 13.670  26.922  18.772 1.00 43.74 ? 79  ARG A NE    1 
ATOM   606  C CZ    . ARG A 1 79  ? 13.817  26.308  19.944 1.00 44.41 ? 79  ARG A CZ    1 
ATOM   607  N NH1   . ARG A 1 79  ? 14.859  25.511  20.159 1.00 45.83 ? 79  ARG A NH1   1 
ATOM   608  N NH2   . ARG A 1 79  ? 12.903  26.462  20.891 1.00 43.43 ? 79  ARG A NH2   1 
ATOM   609  N N     . VAL A 1 80  ? 16.212  22.441  16.005 1.00 25.29 ? 80  VAL A N     1 
ATOM   610  C CA    . VAL A 1 80  ? 16.366  21.335  16.932 1.00 25.53 ? 80  VAL A CA    1 
ATOM   611  C C     . VAL A 1 80  ? 16.560  21.963  18.316 1.00 28.04 ? 80  VAL A C     1 
ATOM   612  O O     . VAL A 1 80  ? 17.044  23.084  18.432 1.00 28.99 ? 80  VAL A O     1 
ATOM   613  C CB    . VAL A 1 80  ? 17.582  20.405  16.580 1.00 22.94 ? 80  VAL A CB    1 
ATOM   614  C CG1   . VAL A 1 80  ? 18.889  21.168  16.583 1.00 23.43 ? 80  VAL A CG1   1 
ATOM   615  C CG2   . VAL A 1 80  ? 17.637  19.275  17.577 1.00 23.43 ? 80  VAL A CG2   1 
ATOM   616  N N     . ASP A 1 81  ? 16.148  21.258  19.359 1.00 29.87 ? 81  ASP A N     1 
ATOM   617  C CA    . ASP A 1 81  ? 16.304  21.755  20.723 1.00 28.75 ? 81  ASP A CA    1 
ATOM   618  C C     . ASP A 1 81  ? 16.806  20.566  21.493 1.00 28.53 ? 81  ASP A C     1 
ATOM   619  O O     . ASP A 1 81  ? 16.085  19.582  21.670 1.00 29.90 ? 81  ASP A O     1 
ATOM   620  C CB    . ASP A 1 81  ? 14.980  22.219  21.300 1.00 28.82 ? 81  ASP A CB    1 
ATOM   621  C CG    . ASP A 1 81  ? 15.152  22.914  22.642 1.00 30.69 ? 81  ASP A CG    1 
ATOM   622  O OD1   . ASP A 1 81  ? 15.841  22.356  23.526 1.00 28.88 ? 81  ASP A OD1   1 
ATOM   623  O OD2   . ASP A 1 81  ? 14.590  24.014  22.803 1.00 32.24 ? 81  ASP A OD2   1 
ATOM   624  N N     . PRO A 1 82  ? 18.059  20.638  21.968 1.00 28.74 ? 82  PRO A N     1 
ATOM   625  C CA    . PRO A 1 82  ? 18.680  19.542  22.717 1.00 29.57 ? 82  PRO A CA    1 
ATOM   626  C C     . PRO A 1 82  ? 18.266  19.358  24.172 1.00 29.14 ? 82  PRO A C     1 
ATOM   627  O O     . PRO A 1 82  ? 18.626  18.353  24.794 1.00 29.90 ? 82  PRO A O     1 
ATOM   628  C CB    . PRO A 1 82  ? 20.167  19.852  22.577 1.00 28.91 ? 82  PRO A CB    1 
ATOM   629  C CG    . PRO A 1 82  ? 20.165  21.369  22.713 1.00 29.49 ? 82  PRO A CG    1 
ATOM   630  C CD    . PRO A 1 82  ? 18.995  21.773  21.816 1.00 28.90 ? 82  PRO A CD    1 
ATOM   631  N N     . TRP A 1 83  ? 17.503  20.305  24.707 1.00 30.54 ? 83  TRP A N     1 
ATOM   632  C CA    . TRP A 1 83  ? 17.083  20.246  26.103 1.00 31.30 ? 83  TRP A CA    1 
ATOM   633  C C     . TRP A 1 83  ? 16.715  18.850  26.608 1.00 31.79 ? 83  TRP A C     1 
ATOM   634  O O     . TRP A 1 83  ? 17.292  18.356  27.586 1.00 31.24 ? 83  TRP A O     1 
ATOM   635  C CB    . TRP A 1 83  ? 15.906  21.193  26.352 1.00 34.39 ? 83  TRP A CB    1 
ATOM   636  C CG    . TRP A 1 83  ? 15.532  21.270  27.813 1.00 37.70 ? 83  TRP A CG    1 
ATOM   637  C CD1   . TRP A 1 83  ? 16.107  22.068  28.766 1.00 37.76 ? 83  TRP A CD1   1 
ATOM   638  C CD2   . TRP A 1 83  ? 14.549  20.482  28.493 1.00 37.49 ? 83  TRP A CD2   1 
ATOM   639  N NE1   . TRP A 1 83  ? 15.542  21.831  29.993 1.00 37.99 ? 83  TRP A NE1   1 
ATOM   640  C CE2   . TRP A 1 83  ? 14.583  20.863  29.861 1.00 39.38 ? 83  TRP A CE2   1 
ATOM   641  C CE3   . TRP A 1 83  ? 13.640  19.493  28.085 1.00 38.21 ? 83  TRP A CE3   1 
ATOM   642  C CZ2   . TRP A 1 83  ? 13.746  20.284  30.825 1.00 35.17 ? 83  TRP A CZ2   1 
ATOM   643  C CZ3   . TRP A 1 83  ? 12.804  18.917  29.045 1.00 37.95 ? 83  TRP A CZ3   1 
ATOM   644  C CH2   . TRP A 1 83  ? 12.866  19.320  30.403 1.00 37.82 ? 83  TRP A CH2   1 
ATOM   645  N N     . GLU A 1 84  ? 15.755  18.209  25.945 1.00 31.59 ? 84  GLU A N     1 
ATOM   646  C CA    . GLU A 1 84  ? 15.315  16.884  26.360 1.00 31.61 ? 84  GLU A CA    1 
ATOM   647  C C     . GLU A 1 84  ? 16.441  15.852  26.434 1.00 33.84 ? 84  GLU A C     1 
ATOM   648  O O     . GLU A 1 84  ? 16.526  15.082  27.399 1.00 35.92 ? 84  GLU A O     1 
ATOM   649  C CB    . GLU A 1 84  ? 14.220  16.373  25.429 1.00 28.37 ? 84  GLU A CB    1 
ATOM   650  C CG    . GLU A 1 84  ? 13.786  14.959  25.730 1.00 27.28 ? 84  GLU A CG    1 
ATOM   651  C CD    . GLU A 1 84  ? 12.649  14.495  24.830 1.00 28.92 ? 84  GLU A CD    1 
ATOM   652  O OE1   . GLU A 1 84  ? 12.165  15.324  24.025 1.00 26.35 ? 84  GLU A OE1   1 
ATOM   653  O OE2   . GLU A 1 84  ? 12.245  13.315  24.933 1.00 27.14 ? 84  GLU A OE2   1 
ATOM   654  N N     . SER A 1 85  ? 17.312  15.845  25.429 1.00 32.99 ? 85  SER A N     1 
ATOM   655  C CA    . SER A 1 85  ? 18.398  14.887  25.388 1.00 32.70 ? 85  SER A CA    1 
ATOM   656  C C     . SER A 1 85  ? 19.542  15.236  26.350 1.00 33.60 ? 85  SER A C     1 
ATOM   657  O O     . SER A 1 85  ? 20.354  14.383  26.663 1.00 33.42 ? 85  SER A O     1 
ATOM   658  C CB    . SER A 1 85  ? 18.942  14.766  23.958 1.00 31.40 ? 85  SER A CB    1 
ATOM   659  O OG    . SER A 1 85  ? 19.505  15.993  23.524 1.00 32.74 ? 85  SER A OG    1 
ATOM   660  N N     . GLU A 1 86  ? 19.605  16.480  26.802 1.00 37.05 ? 86  GLU A N     1 
ATOM   661  C CA    . GLU A 1 86  ? 20.651  16.908  27.722 1.00 41.06 ? 86  GLU A CA    1 
ATOM   662  C C     . GLU A 1 86  ? 20.308  16.626  29.192 1.00 42.70 ? 86  GLU A C     1 
ATOM   663  O O     . GLU A 1 86  ? 21.173  16.718  30.058 1.00 43.82 ? 86  GLU A O     1 
ATOM   664  C CB    . GLU A 1 86  ? 20.946  18.401  27.540 1.00 41.26 ? 86  GLU A CB    1 
ATOM   665  C CG    . GLU A 1 86  ? 21.623  18.757  26.226 1.00 45.39 ? 86  GLU A CG    1 
ATOM   666  C CD    . GLU A 1 86  ? 21.688  20.264  25.986 1.00 49.05 ? 86  GLU A CD    1 
ATOM   667  O OE1   . GLU A 1 86  ? 20.714  20.979  26.338 1.00 50.34 ? 86  GLU A OE1   1 
ATOM   668  O OE2   . GLU A 1 86  ? 22.705  20.735  25.428 1.00 51.64 ? 86  GLU A OE2   1 
ATOM   669  N N     . GLN A 1 87  ? 19.057  16.279  29.477 1.00 44.82 ? 87  GLN A N     1 
ATOM   670  C CA    . GLN A 1 87  ? 18.661  15.980  30.853 1.00 45.77 ? 87  GLN A CA    1 
ATOM   671  C C     . GLN A 1 87  ? 19.356  14.710  31.330 1.00 48.37 ? 87  GLN A C     1 
ATOM   672  O O     . GLN A 1 87  ? 19.702  13.839  30.518 1.00 48.21 ? 87  GLN A O     1 
ATOM   673  C CB    . GLN A 1 87  ? 17.143  15.801  30.953 1.00 45.59 ? 87  GLN A CB    1 
ATOM   674  C CG    . GLN A 1 87  ? 16.361  17.070  30.677 1.00 46.29 ? 87  GLN A CG    1 
ATOM   675  C CD    . GLN A 1 87  ? 17.021  18.294  31.287 1.00 46.68 ? 87  GLN A CD    1 
ATOM   676  O OE1   . GLN A 1 87  ? 17.750  19.022  30.611 1.00 49.05 ? 87  GLN A OE1   1 
ATOM   677  N NE2   . GLN A 1 87  ? 16.783  18.516  32.577 1.00 46.41 ? 87  GLN A NE2   1 
ATOM   678  N N     . ALA A 1 88  ? 19.551  14.595  32.643 1.00 48.38 ? 88  ALA A N     1 
ATOM   679  C CA    . ALA A 1 88  ? 20.219  13.428  33.198 1.00 48.98 ? 88  ALA A CA    1 
ATOM   680  C C     . ALA A 1 88  ? 19.553  12.136  32.734 1.00 49.57 ? 88  ALA A C     1 
ATOM   681  O O     . ALA A 1 88  ? 20.207  11.095  32.647 1.00 49.81 ? 88  ALA A O     1 
ATOM   682  C CB    . ALA A 1 88  ? 20.240  13.503  34.711 1.00 49.74 ? 88  ALA A CB    1 
ATOM   683  N N     . GLN A 1 89  ? 18.258  12.187  32.440 1.00 49.12 ? 89  GLN A N     1 
ATOM   684  C CA    . GLN A 1 89  ? 17.586  10.981  31.953 1.00 49.08 ? 89  GLN A CA    1 
ATOM   685  C C     . GLN A 1 89  ? 16.248  11.166  31.247 1.00 46.68 ? 89  GLN A C     1 
ATOM   686  O O     . GLN A 1 89  ? 15.710  12.272  31.175 1.00 43.92 ? 89  GLN A O     1 
ATOM   687  C CB    . GLN A 1 89  ? 17.427  9.967   33.077 1.00 52.41 ? 89  GLN A CB    1 
ATOM   688  C CG    . GLN A 1 89  ? 16.536  10.396  34.202 1.00 58.34 ? 89  GLN A CG    1 
ATOM   689  C CD    . GLN A 1 89  ? 16.445  9.317   35.258 1.00 62.41 ? 89  GLN A CD    1 
ATOM   690  O OE1   . GLN A 1 89  ? 15.717  9.453   36.243 1.00 65.23 ? 89  GLN A OE1   1 
ATOM   691  N NE2   . GLN A 1 89  ? 17.189  8.226   35.056 1.00 64.08 ? 89  GLN A NE2   1 
ATOM   692  N N     . TRP A 1 90  ? 15.739  10.058  30.714 1.00 45.39 ? 90  TRP A N     1 
ATOM   693  C CA    . TRP A 1 90  ? 14.475  10.040  29.997 1.00 44.72 ? 90  TRP A CA    1 
ATOM   694  C C     . TRP A 1 90  ? 13.354  10.660  30.792 1.00 44.63 ? 90  TRP A C     1 
ATOM   695  O O     . TRP A 1 90  ? 13.181  10.406  31.995 1.00 42.58 ? 90  TRP A O     1 
ATOM   696  C CB    . TRP A 1 90  ? 14.056  8.620   29.612 1.00 45.19 ? 90  TRP A CB    1 
ATOM   697  C CG    . TRP A 1 90  ? 12.745  8.599   28.855 1.00 47.14 ? 90  TRP A CG    1 
ATOM   698  C CD1   . TRP A 1 90  ? 12.546  8.955   27.547 1.00 48.90 ? 90  TRP A CD1   1 
ATOM   699  C CD2   . TRP A 1 90  ? 11.459  8.208   29.362 1.00 47.56 ? 90  TRP A CD2   1 
ATOM   700  N NE1   . TRP A 1 90  ? 11.218  8.802   27.208 1.00 48.05 ? 90  TRP A NE1   1 
ATOM   701  C CE2   . TRP A 1 90  ? 10.530  8.346   28.302 1.00 46.65 ? 90  TRP A CE2   1 
ATOM   702  C CE3   . TRP A 1 90  ? 10.999  7.755   30.610 1.00 47.80 ? 90  TRP A CE3   1 
ATOM   703  C CZ2   . TRP A 1 90  ? 9.172   8.046   28.451 1.00 46.01 ? 90  TRP A CZ2   1 
ATOM   704  C CZ3   . TRP A 1 90  ? 9.644   7.458   30.757 1.00 47.71 ? 90  TRP A CZ3   1 
ATOM   705  C CH2   . TRP A 1 90  ? 8.748   7.605   29.680 1.00 47.49 ? 90  TRP A CH2   1 
ATOM   706  N N     . MET A 1 91  ? 12.563  11.431  30.065 1.00 43.37 ? 91  MET A N     1 
ATOM   707  C CA    . MET A 1 91  ? 11.451  12.161  30.616 1.00 43.66 ? 91  MET A CA    1 
ATOM   708  C C     . MET A 1 91  ? 10.203  11.860  29.789 1.00 43.10 ? 91  MET A C     1 
ATOM   709  O O     . MET A 1 91  ? 10.300  11.747  28.567 1.00 42.24 ? 91  MET A O     1 
ATOM   710  C CB    . MET A 1 91  ? 11.831  13.625  30.523 1.00 47.58 ? 91  MET A CB    1 
ATOM   711  C CG    . MET A 1 91  ? 10.798  14.630  30.835 1.00 50.84 ? 91  MET A CG    1 
ATOM   712  S SD    . MET A 1 91  ? 11.664  16.190  30.652 1.00 55.15 ? 91  MET A SD    1 
ATOM   713  C CE    . MET A 1 91  ? 12.867  16.025  31.957 1.00 55.23 ? 91  MET A CE    1 
ATOM   714  N N     . GLU A 1 92  ? 9.051   11.704  30.447 1.00 39.48 ? 92  GLU A N     1 
ATOM   715  C CA    . GLU A 1 92  ? 7.805   11.454  29.728 1.00 37.33 ? 92  GLU A CA    1 
ATOM   716  C C     . GLU A 1 92  ? 7.485   12.641  28.844 1.00 33.54 ? 92  GLU A C     1 
ATOM   717  O O     . GLU A 1 92  ? 7.790   13.784  29.174 1.00 34.72 ? 92  GLU A O     1 
ATOM   718  C CB    . GLU A 1 92  ? 6.634   11.203  30.680 1.00 39.10 ? 92  GLU A CB    1 
ATOM   719  C CG    . GLU A 1 92  ? 6.679   9.857   31.331 1.00 42.14 ? 92  GLU A CG    1 
ATOM   720  C CD    . GLU A 1 92  ? 7.097   9.959   32.773 1.00 44.64 ? 92  GLU A CD    1 
ATOM   721  O OE1   . GLU A 1 92  ? 8.115   10.658  33.043 1.00 41.44 ? 92  GLU A OE1   1 
ATOM   722  O OE2   . GLU A 1 92  ? 6.403   9.334   33.617 1.00 45.22 ? 92  GLU A OE2   1 
ATOM   723  N N     . THR A 1 93  ? 6.852   12.360  27.721 1.00 31.17 ? 93  THR A N     1 
ATOM   724  C CA    . THR A 1 93  ? 6.539   13.402  26.762 1.00 30.61 ? 93  THR A CA    1 
ATOM   725  C C     . THR A 1 93  ? 5.772   14.566  27.334 1.00 28.41 ? 93  THR A C     1 
ATOM   726  O O     . THR A 1 93  ? 6.094   15.716  27.055 1.00 27.16 ? 93  THR A O     1 
ATOM   727  C CB    . THR A 1 93  ? 5.772   12.824  25.577 1.00 30.36 ? 93  THR A CB    1 
ATOM   728  O OG1   . THR A 1 93  ? 6.551   11.776  24.990 1.00 36.67 ? 93  THR A OG1   1 
ATOM   729  C CG2   . THR A 1 93  ? 5.525   13.899  24.534 1.00 31.79 ? 93  THR A CG2   1 
ATOM   730  N N     . VAL A 1 94  ? 4.769   14.285  28.155 1.00 28.42 ? 94  VAL A N     1 
ATOM   731  C CA    . VAL A 1 94  ? 4.003   15.392  28.708 1.00 30.16 ? 94  VAL A CA    1 
ATOM   732  C C     . VAL A 1 94  ? 4.921   16.401  29.427 1.00 30.30 ? 94  VAL A C     1 
ATOM   733  O O     . VAL A 1 94  ? 4.651   17.612  29.407 1.00 30.41 ? 94  VAL A O     1 
ATOM   734  C CB    . VAL A 1 94  ? 2.870   14.879  29.642 1.00 30.06 ? 94  VAL A CB    1 
ATOM   735  C CG1   . VAL A 1 94  ? 3.456   14.316  30.936 1.00 29.73 ? 94  VAL A CG1   1 
ATOM   736  C CG2   . VAL A 1 94  ? 1.875   15.986  29.893 1.00 30.56 ? 94  VAL A CG2   1 
ATOM   737  N N     . LYS A 1 95  ? 6.024   15.924  30.014 1.00 31.26 ? 95  LYS A N     1 
ATOM   738  C CA    . LYS A 1 95  ? 6.949   16.828  30.709 1.00 33.08 ? 95  LYS A CA    1 
ATOM   739  C C     . LYS A 1 95  ? 7.732   17.706  29.749 1.00 32.85 ? 95  LYS A C     1 
ATOM   740  O O     . LYS A 1 95  ? 8.014   18.860  30.052 1.00 33.97 ? 95  LYS A O     1 
ATOM   741  C CB    . LYS A 1 95  ? 7.935   16.055  31.597 1.00 36.02 ? 95  LYS A CB    1 
ATOM   742  C CG    . LYS A 1 95  ? 7.281   15.296  32.763 1.00 41.37 ? 95  LYS A CG    1 
ATOM   743  C CD    . LYS A 1 95  ? 8.336   14.721  33.713 1.00 45.94 ? 95  LYS A CD    1 
ATOM   744  C CE    . LYS A 1 95  ? 7.732   13.700  34.665 1.00 49.23 ? 95  LYS A CE    1 
ATOM   745  N NZ    . LYS A 1 95  ? 6.578   14.283  35.417 1.00 53.41 ? 95  LYS A NZ    1 
ATOM   746  N N     . VAL A 1 96  ? 8.086   17.172  28.584 1.00 33.01 ? 96  VAL A N     1 
ATOM   747  C CA    . VAL A 1 96  ? 8.824   17.973  27.611 1.00 31.47 ? 96  VAL A CA    1 
ATOM   748  C C     . VAL A 1 96  ? 7.896   19.076  27.108 1.00 30.36 ? 96  VAL A C     1 
ATOM   749  O O     . VAL A 1 96  ? 8.322   20.205  26.886 1.00 32.68 ? 96  VAL A O     1 
ATOM   750  C CB    . VAL A 1 96  ? 9.339   17.084  26.441 1.00 31.85 ? 96  VAL A CB    1 
ATOM   751  C CG1   . VAL A 1 96  ? 10.108  17.926  25.426 1.00 29.73 ? 96  VAL A CG1   1 
ATOM   752  C CG2   . VAL A 1 96  ? 10.246  15.987  27.001 1.00 30.74 ? 96  VAL A CG2   1 
ATOM   753  N N     . LEU A 1 97  ? 6.615   18.758  26.953 1.00 31.17 ? 97  LEU A N     1 
ATOM   754  C CA    . LEU A 1 97  ? 5.655   19.765  26.512 1.00 30.84 ? 97  LEU A CA    1 
ATOM   755  C C     . LEU A 1 97  ? 5.579   20.897  27.553 1.00 32.30 ? 97  LEU A C     1 
ATOM   756  O O     . LEU A 1 97  ? 5.650   22.086  27.203 1.00 30.71 ? 97  LEU A O     1 
ATOM   757  C CB    . LEU A 1 97  ? 4.276   19.123  26.300 1.00 31.61 ? 97  LEU A CB    1 
ATOM   758  C CG    . LEU A 1 97  ? 4.132   18.360  24.965 1.00 32.49 ? 97  LEU A CG    1 
ATOM   759  C CD1   . LEU A 1 97  ? 3.001   17.364  25.003 1.00 28.09 ? 97  LEU A CD1   1 
ATOM   760  C CD2   . LEU A 1 97  ? 3.938   19.374  23.842 1.00 31.86 ? 97  LEU A CD2   1 
ATOM   761  N N     . ARG A 1 98  ? 5.452   20.525  28.830 1.00 31.65 ? 98  ARG A N     1 
ATOM   762  C CA    . ARG A 1 98  ? 5.374   21.518  29.909 1.00 33.57 ? 98  ARG A CA    1 
ATOM   763  C C     . ARG A 1 98  ? 6.590   22.432  29.858 1.00 33.84 ? 98  ARG A C     1 
ATOM   764  O O     . ARG A 1 98  ? 6.451   23.641  29.942 1.00 33.51 ? 98  ARG A O     1 
ATOM   765  C CB    . ARG A 1 98  ? 5.290   20.839  31.291 1.00 32.39 ? 98  ARG A CB    1 
ATOM   766  C CG    . ARG A 1 98  ? 3.993   20.032  31.532 1.00 32.95 ? 98  ARG A CG    1 
ATOM   767  C CD    . ARG A 1 98  ? 4.065   19.193  32.833 1.00 34.98 ? 98  ARG A CD    1 
ATOM   768  N NE    . ARG A 1 98  ? 2.959   18.244  33.003 1.00 34.56 ? 98  ARG A NE    1 
ATOM   769  C CZ    . ARG A 1 98  ? 2.995   17.203  33.830 1.00 33.53 ? 98  ARG A CZ    1 
ATOM   770  N NH1   . ARG A 1 98  ? 4.081   16.976  34.555 1.00 36.30 ? 98  ARG A NH1   1 
ATOM   771  N NH2   . ARG A 1 98  ? 1.958   16.388  33.945 1.00 32.04 ? 98  ARG A NH2   1 
ATOM   772  N N     . HIS A 1 99  ? 7.780   21.846  29.701 1.00 36.91 ? 99  HIS A N     1 
ATOM   773  C CA    . HIS A 1 99  ? 9.016   22.621  29.632 1.00 38.01 ? 99  HIS A CA    1 
ATOM   774  C C     . HIS A 1 99  ? 8.999   23.614  28.483 1.00 37.66 ? 99  HIS A C     1 
ATOM   775  O O     . HIS A 1 99  ? 9.267   24.807  28.653 1.00 37.73 ? 99  HIS A O     1 
ATOM   776  C CB    . HIS A 1 99  ? 10.227  21.708  29.447 1.00 40.93 ? 99  HIS A CB    1 
ATOM   777  C CG    . HIS A 1 99  ? 11.481  22.455  29.102 1.00 43.58 ? 99  HIS A CG    1 
ATOM   778  N ND1   . HIS A 1 99  ? 12.192  23.184  30.033 1.00 44.62 ? 99  HIS A ND1   1 
ATOM   779  C CD2   . HIS A 1 99  ? 12.100  22.657  27.914 1.00 43.62 ? 99  HIS A CD2   1 
ATOM   780  C CE1   . HIS A 1 99  ? 13.193  23.804  29.433 1.00 43.64 ? 99  HIS A CE1   1 
ATOM   781  N NE2   . HIS A 1 99  ? 13.161  23.501  28.147 1.00 45.22 ? 99  HIS A NE2   1 
ATOM   782  N N     . HIS A 1 100 ? 8.715   23.120  27.291 1.00 37.84 ? 100 HIS A N     1 
ATOM   783  C CA    . HIS A 1 100 ? 8.686   24.016  26.147 1.00 37.40 ? 100 HIS A CA    1 
ATOM   784  C C     . HIS A 1 100 ? 7.554   25.013  26.241 1.00 38.06 ? 100 HIS A C     1 
ATOM   785  O O     . HIS A 1 100 ? 7.652   26.119  25.717 1.00 36.88 ? 100 HIS A O     1 
ATOM   786  C CB    . HIS A 1 100 ? 8.643   23.214  24.852 1.00 36.00 ? 100 HIS A CB    1 
ATOM   787  C CG    . HIS A 1 100 ? 9.972   22.628  24.495 1.00 33.43 ? 100 HIS A CG    1 
ATOM   788  N ND1   . HIS A 1 100 ? 11.028  23.404  24.071 1.00 32.32 ? 100 HIS A ND1   1 
ATOM   789  C CD2   . HIS A 1 100 ? 10.452  21.367  24.604 1.00 31.82 ? 100 HIS A CD2   1 
ATOM   790  C CE1   . HIS A 1 100 ? 12.103  22.648  23.940 1.00 32.94 ? 100 HIS A CE1   1 
ATOM   791  N NE2   . HIS A 1 100 ? 11.782  21.406  24.258 1.00 32.82 ? 100 HIS A NE2   1 
ATOM   792  N N     . HIS A 1 101 ? 6.481   24.642  26.927 1.00 41.39 ? 101 HIS A N     1 
ATOM   793  C CA    . HIS A 1 101 ? 5.381   25.583  27.092 1.00 44.32 ? 101 HIS A CA    1 
ATOM   794  C C     . HIS A 1 101 ? 5.891   26.713  28.006 1.00 44.64 ? 101 HIS A C     1 
ATOM   795  O O     . HIS A 1 101 ? 5.720   27.890  27.703 1.00 41.22 ? 101 HIS A O     1 
ATOM   796  C CB    . HIS A 1 101 ? 4.172   24.906  27.736 1.00 46.75 ? 101 HIS A CB    1 
ATOM   797  C CG    . HIS A 1 101 ? 3.021   25.834  27.949 1.00 50.64 ? 101 HIS A CG    1 
ATOM   798  N ND1   . HIS A 1 101 ? 2.241   26.300  26.911 1.00 53.14 ? 101 HIS A ND1   1 
ATOM   799  C CD2   . HIS A 1 101 ? 2.555   26.435  29.071 1.00 52.00 ? 101 HIS A CD2   1 
ATOM   800  C CE1   . HIS A 1 101 ? 1.344   27.148  27.383 1.00 52.53 ? 101 HIS A CE1   1 
ATOM   801  N NE2   . HIS A 1 101 ? 1.514   27.248  28.690 1.00 53.31 ? 101 HIS A NE2   1 
ATOM   802  N N     . SER A 1 102 ? 6.527   26.349  29.118 1.00 46.71 ? 102 SER A N     1 
ATOM   803  C CA    . SER A 1 102 ? 7.058   27.363  30.030 1.00 51.03 ? 102 SER A CA    1 
ATOM   804  C C     . SER A 1 102 ? 8.010   28.271  29.279 1.00 52.56 ? 102 SER A C     1 
ATOM   805  O O     . SER A 1 102 ? 7.994   29.493  29.451 1.00 52.78 ? 102 SER A O     1 
ATOM   806  C CB    . SER A 1 102 ? 7.815   26.724  31.188 1.00 50.99 ? 102 SER A CB    1 
ATOM   807  O OG    . SER A 1 102 ? 6.950   25.934  31.975 1.00 55.23 ? 102 SER A OG    1 
ATOM   808  N N     . LYS A 1 103 ? 8.840   27.667  28.442 1.00 54.28 ? 103 LYS A N     1 
ATOM   809  C CA    . LYS A 1 103 ? 9.807   28.432  27.681 1.00 57.43 ? 103 LYS A CA    1 
ATOM   810  C C     . LYS A 1 103 ? 9.091   29.538  26.921 1.00 59.15 ? 103 LYS A C     1 
ATOM   811  O O     . LYS A 1 103 ? 9.463   30.704  27.037 1.00 60.61 ? 103 LYS A O     1 
ATOM   812  C CB    . LYS A 1 103 ? 10.571  27.515  26.720 1.00 58.07 ? 103 LYS A CB    1 
ATOM   813  C CG    . LYS A 1 103 ? 11.764  28.168  26.065 1.00 58.99 ? 103 LYS A CG    1 
ATOM   814  C CD    . LYS A 1 103 ? 12.648  27.136  25.385 1.00 60.83 ? 103 LYS A CD    1 
ATOM   815  C CE    . LYS A 1 103 ? 13.919  27.766  24.839 1.00 61.99 ? 103 LYS A CE    1 
ATOM   816  N NZ    . LYS A 1 103 ? 14.860  26.737  24.322 1.00 61.95 ? 103 LYS A NZ    1 
ATOM   817  N N     . LEU A 1 104 ? 8.055   29.173  26.166 1.00 60.72 ? 104 LEU A N     1 
ATOM   818  C CA    . LEU A 1 104 ? 7.277   30.138  25.380 1.00 62.48 ? 104 LEU A CA    1 
ATOM   819  C C     . LEU A 1 104 ? 6.760   31.299  26.214 1.00 63.40 ? 104 LEU A C     1 
ATOM   820  O O     . LEU A 1 104 ? 6.712   32.431  25.747 1.00 64.16 ? 104 LEU A O     1 
ATOM   821  C CB    . LEU A 1 104 ? 6.076   29.458  24.715 1.00 62.31 ? 104 LEU A CB    1 
ATOM   822  C CG    . LEU A 1 104 ? 6.329   28.530  23.533 1.00 62.62 ? 104 LEU A CG    1 
ATOM   823  C CD1   . LEU A 1 104 ? 5.044   27.798  23.185 1.00 62.24 ? 104 LEU A CD1   1 
ATOM   824  C CD2   . LEU A 1 104 ? 6.823   29.337  22.351 1.00 62.21 ? 104 LEU A CD2   1 
ATOM   825  N N     . LEU A 1 105 ? 6.352   31.007  27.442 1.00 64.89 ? 105 LEU A N     1 
ATOM   826  C CA    . LEU A 1 105 ? 5.835   32.035  28.335 1.00 66.61 ? 105 LEU A CA    1 
ATOM   827  C C     . LEU A 1 105 ? 6.864   33.148  28.543 1.00 66.91 ? 105 LEU A C     1 
ATOM   828  O O     . LEU A 1 105 ? 7.660   33.106  29.482 1.00 67.36 ? 105 LEU A O     1 
ATOM   829  C CB    . LEU A 1 105 ? 5.453   31.412  29.684 1.00 67.34 ? 105 LEU A CB    1 
ATOM   830  C CG    . LEU A 1 105 ? 4.251   30.459  29.673 1.00 67.47 ? 105 LEU A CG    1 
ATOM   831  C CD1   . LEU A 1 105 ? 4.168   29.689  30.991 1.00 66.86 ? 105 LEU A CD1   1 
ATOM   832  C CD2   . LEU A 1 105 ? 2.979   31.263  29.421 1.00 67.43 ? 105 LEU A CD2   1 
ATOM   833  N N     . ALA A 1 126 ? -1.711  36.253  24.704 1.00 71.28 ? 126 ALA A N     1 
ATOM   834  C CA    . ALA A 1 126 ? -0.475  36.615  24.025 1.00 70.17 ? 126 ALA A CA    1 
ATOM   835  C C     . ALA A 1 126 ? 0.450   35.401  23.910 1.00 69.63 ? 126 ALA A C     1 
ATOM   836  O O     . ALA A 1 126 ? 1.557   35.506  23.374 1.00 70.17 ? 126 ALA A O     1 
ATOM   837  C CB    . ALA A 1 126 ? 0.224   37.744  24.788 1.00 70.67 ? 126 ALA A CB    1 
ATOM   838  N N     . VAL A 1 127 ? -0.012  34.253  24.408 1.00 67.63 ? 127 VAL A N     1 
ATOM   839  C CA    . VAL A 1 127 ? 0.777   33.019  24.374 1.00 65.41 ? 127 VAL A CA    1 
ATOM   840  C C     . VAL A 1 127 ? 0.316   32.033  23.301 1.00 62.53 ? 127 VAL A C     1 
ATOM   841  O O     . VAL A 1 127 ? -0.874  31.717  23.188 1.00 62.86 ? 127 VAL A O     1 
ATOM   842  C CB    . VAL A 1 127 ? 0.744   32.278  25.746 1.00 66.20 ? 127 VAL A CB    1 
ATOM   843  C CG1   . VAL A 1 127 ? 1.610   31.018  25.692 1.00 64.49 ? 127 VAL A CG1   1 
ATOM   844  C CG2   . VAL A 1 127 ? 1.224   33.211  26.852 1.00 67.57 ? 127 VAL A CG2   1 
ATOM   845  N N     . PRO A 1 128 ? 1.263   31.540  22.491 1.00 58.93 ? 128 PRO A N     1 
ATOM   846  C CA    . PRO A 1 128 ? 0.920   30.584  21.440 1.00 55.32 ? 128 PRO A CA    1 
ATOM   847  C C     . PRO A 1 128 ? 0.678   29.191  22.006 1.00 51.56 ? 128 PRO A C     1 
ATOM   848  O O     . PRO A 1 128 ? 1.222   28.821  23.056 1.00 50.31 ? 128 PRO A O     1 
ATOM   849  C CB    . PRO A 1 128 ? 2.136   30.639  20.518 1.00 56.54 ? 128 PRO A CB    1 
ATOM   850  C CG    . PRO A 1 128 ? 3.256   30.962  21.449 1.00 57.65 ? 128 PRO A CG    1 
ATOM   851  C CD    . PRO A 1 128 ? 2.647   32.024  22.331 1.00 58.95 ? 128 PRO A CD    1 
ATOM   852  N N     . GLU A 1 129 ? -0.155  28.428  21.312 1.00 46.54 ? 129 GLU A N     1 
ATOM   853  C CA    . GLU A 1 129 ? -0.455  27.071  21.731 1.00 44.65 ? 129 GLU A CA    1 
ATOM   854  C C     . GLU A 1 129 ? 0.648   26.113  21.263 1.00 42.44 ? 129 GLU A C     1 
ATOM   855  O O     . GLU A 1 129 ? 1.094   26.178  20.120 1.00 41.53 ? 129 GLU A O     1 
ATOM   856  C CB    . GLU A 1 129 ? -1.817  26.643  21.170 1.00 45.70 ? 129 GLU A CB    1 
ATOM   857  C CG    . GLU A 1 129 ? -2.998  27.290  21.883 1.00 47.92 ? 129 GLU A CG    1 
ATOM   858  C CD    . GLU A 1 129 ? -4.327  27.100  21.158 1.00 50.54 ? 129 GLU A CD    1 
ATOM   859  O OE1   . GLU A 1 129 ? -4.648  25.964  20.739 1.00 47.62 ? 129 GLU A OE1   1 
ATOM   860  O OE2   . GLU A 1 129 ? -5.062  28.105  21.023 1.00 54.65 ? 129 GLU A OE2   1 
ATOM   861  N N     . LEU A 1 130 ? 1.101   25.251  22.167 1.00 38.55 ? 130 LEU A N     1 
ATOM   862  C CA    . LEU A 1 130 ? 2.129   24.272  21.848 1.00 35.76 ? 130 LEU A CA    1 
ATOM   863  C C     . LEU A 1 130 ? 1.475   22.920  21.552 1.00 34.23 ? 130 LEU A C     1 
ATOM   864  O O     . LEU A 1 130 ? 0.755   22.366  22.383 1.00 34.68 ? 130 LEU A O     1 
ATOM   865  C CB    . LEU A 1 130 ? 3.113   24.116  23.012 1.00 34.42 ? 130 LEU A CB    1 
ATOM   866  C CG    . LEU A 1 130 ? 4.272   23.146  22.732 1.00 32.40 ? 130 LEU A CG    1 
ATOM   867  C CD1   . LEU A 1 130 ? 5.197   23.720  21.661 1.00 27.90 ? 130 LEU A CD1   1 
ATOM   868  C CD2   . LEU A 1 130 ? 5.032   22.913  24.020 1.00 30.43 ? 130 LEU A CD2   1 
ATOM   869  N N     . LYS A 1 131 ? 1.730   22.372  20.373 1.00 32.12 ? 131 LYS A N     1 
ATOM   870  C CA    . LYS A 1 131 ? 1.121   21.101  20.029 1.00 29.48 ? 131 LYS A CA    1 
ATOM   871  C C     . LYS A 1 131 ? 2.134   20.013  19.711 1.00 27.97 ? 131 LYS A C     1 
ATOM   872  O O     . LYS A 1 131 ? 3.183   20.269  19.129 1.00 27.14 ? 131 LYS A O     1 
ATOM   873  C CB    . LYS A 1 131 ? 0.156   21.296  18.851 1.00 30.06 ? 131 LYS A CB    1 
ATOM   874  C CG    . LYS A 1 131 ? -0.990  22.290  19.132 1.00 30.42 ? 131 LYS A CG    1 
ATOM   875  C CD    . LYS A 1 131 ? -2.095  22.212  18.080 1.00 33.48 ? 131 LYS A CD    1 
ATOM   876  C CE    . LYS A 1 131 ? -3.206  23.280  18.306 1.00 36.09 ? 131 LYS A CE    1 
ATOM   877  N NZ    . LYS A 1 131 ? -3.868  23.180  19.641 1.00 33.95 ? 131 LYS A NZ    1 
ATOM   878  N N     . LEU A 1 132 ? 1.798   18.792  20.092 1.00 25.81 ? 132 LEU A N     1 
ATOM   879  C CA    . LEU A 1 132 ? 2.651   17.654  19.836 1.00 26.29 ? 132 LEU A CA    1 
ATOM   880  C C     . LEU A 1 132 ? 2.399   17.157  18.411 1.00 26.97 ? 132 LEU A C     1 
ATOM   881  O O     . LEU A 1 132 ? 1.274   16.808  18.056 1.00 24.56 ? 132 LEU A O     1 
ATOM   882  C CB    . LEU A 1 132 ? 2.344   16.529  20.817 1.00 24.35 ? 132 LEU A CB    1 
ATOM   883  C CG    . LEU A 1 132 ? 3.378   15.415  20.753 1.00 27.06 ? 132 LEU A CG    1 
ATOM   884  C CD1   . LEU A 1 132 ? 4.672   15.887  21.440 1.00 28.38 ? 132 LEU A CD1   1 
ATOM   885  C CD2   . LEU A 1 132 ? 2.827   14.158  21.418 1.00 27.31 ? 132 LEU A CD2   1 
ATOM   886  N N     . LEU A 1 133 ? 3.456   17.134  17.602 1.00 26.08 ? 133 LEU A N     1 
ATOM   887  C CA    . LEU A 1 133 ? 3.368   16.669  16.230 1.00 25.55 ? 133 LEU A CA    1 
ATOM   888  C C     . LEU A 1 133 ? 3.894   15.234  16.179 1.00 25.87 ? 133 LEU A C     1 
ATOM   889  O O     . LEU A 1 133 ? 5.008   14.958  16.648 1.00 28.08 ? 133 LEU A O     1 
ATOM   890  C CB    . LEU A 1 133 ? 4.211   17.581  15.344 1.00 24.94 ? 133 LEU A CB    1 
ATOM   891  C CG    . LEU A 1 133 ? 4.502   17.102  13.926 1.00 21.60 ? 133 LEU A CG    1 
ATOM   892  C CD1   . LEU A 1 133 ? 3.191   17.037  13.151 1.00 22.29 ? 133 LEU A CD1   1 
ATOM   893  C CD2   . LEU A 1 133 ? 5.487   18.067  13.246 1.00 18.59 ? 133 LEU A CD2   1 
ATOM   894  N N     . CYS A 1 134 ? 3.096   14.318  15.643 1.00 25.51 ? 134 CYS A N     1 
ATOM   895  C CA    . CYS A 1 134 ? 3.504   12.918  15.547 1.00 25.50 ? 134 CYS A CA    1 
ATOM   896  C C     . CYS A 1 134 ? 2.808   12.210  14.401 1.00 25.19 ? 134 CYS A C     1 
ATOM   897  O O     . CYS A 1 134 ? 1.899   12.762  13.808 1.00 25.14 ? 134 CYS A O     1 
ATOM   898  C CB    . CYS A 1 134 ? 3.165   12.173  16.834 1.00 29.83 ? 134 CYS A CB    1 
ATOM   899  S SG    . CYS A 1 134 ? 1.380   12.092  17.224 1.00 35.36 ? 134 CYS A SG    1 
ATOM   900  N N     . GLY A 1 135 ? 3.244   10.988  14.094 1.00 23.25 ? 135 GLY A N     1 
ATOM   901  C CA    . GLY A 1 135 ? 2.602   10.208  13.054 1.00 24.27 ? 135 GLY A CA    1 
ATOM   902  C C     . GLY A 1 135 ? 1.429   9.448   13.668 1.00 27.20 ? 135 GLY A C     1 
ATOM   903  O O     . GLY A 1 135 ? 1.382   9.275   14.880 1.00 27.78 ? 135 GLY A O     1 
ATOM   904  N N     . ALA A 1 136 ? 0.483   8.995   12.852 1.00 28.71 ? 136 ALA A N     1 
ATOM   905  C CA    . ALA A 1 136 ? -0.684  8.265   13.347 1.00 30.35 ? 136 ALA A CA    1 
ATOM   906  C C     . ALA A 1 136 ? -0.321  7.003   14.120 1.00 31.20 ? 136 ALA A C     1 
ATOM   907  O O     . ALA A 1 136 ? -1.121  6.521   14.918 1.00 31.86 ? 136 ALA A O     1 
ATOM   908  C CB    . ALA A 1 136 ? -1.615  7.900   12.195 1.00 27.98 ? 136 ALA A CB    1 
ATOM   909  N N     . ASP A 1 137 ? 0.862   6.453   13.875 1.00 30.73 ? 137 ASP A N     1 
ATOM   910  C CA    . ASP A 1 137 ? 1.270   5.262   14.596 1.00 34.16 ? 137 ASP A CA    1 
ATOM   911  C C     . ASP A 1 137 ? 1.445   5.554   16.087 1.00 35.23 ? 137 ASP A C     1 
ATOM   912  O O     . ASP A 1 137 ? 1.142   4.709   16.922 1.00 35.87 ? 137 ASP A O     1 
ATOM   913  C CB    . ASP A 1 137 ? 2.560   4.692   14.014 1.00 34.16 ? 137 ASP A CB    1 
ATOM   914  C CG    . ASP A 1 137 ? 3.671   5.727   13.909 1.00 38.54 ? 137 ASP A CG    1 
ATOM   915  O OD1   . ASP A 1 137 ? 3.407   6.862   13.437 1.00 33.91 ? 137 ASP A OD1   1 
ATOM   916  O OD2   . ASP A 1 137 ? 4.818   5.384   14.283 1.00 37.60 ? 137 ASP A OD2   1 
ATOM   917  N N     . VAL A 1 138 ? 1.926   6.746   16.424 1.00 34.79 ? 138 VAL A N     1 
ATOM   918  C CA    . VAL A 1 138 ? 2.111   7.108   17.825 1.00 35.02 ? 138 VAL A CA    1 
ATOM   919  C C     . VAL A 1 138 ? 0.755   7.107   18.497 1.00 35.70 ? 138 VAL A C     1 
ATOM   920  O O     . VAL A 1 138 ? 0.594   6.618   19.614 1.00 35.74 ? 138 VAL A O     1 
ATOM   921  C CB    . VAL A 1 138 ? 2.768   8.515   17.980 1.00 35.02 ? 138 VAL A CB    1 
ATOM   922  C CG1   . VAL A 1 138 ? 2.636   9.008   19.424 1.00 34.56 ? 138 VAL A CG1   1 
ATOM   923  C CG2   . VAL A 1 138 ? 4.252   8.439   17.601 1.00 32.04 ? 138 VAL A CG2   1 
ATOM   924  N N     . LEU A 1 139 ? -0.237  7.634   17.793 1.00 37.05 ? 139 LEU A N     1 
ATOM   925  C CA    . LEU A 1 139 ? -1.588  7.682   18.323 1.00 35.97 ? 139 LEU A CA    1 
ATOM   926  C C     . LEU A 1 139 ? -2.081  6.275   18.656 1.00 37.73 ? 139 LEU A C     1 
ATOM   927  O O     . LEU A 1 139 ? -2.796  6.069   19.642 1.00 35.39 ? 139 LEU A O     1 
ATOM   928  C CB    . LEU A 1 139 ? -2.516  8.304   17.298 1.00 37.23 ? 139 LEU A CB    1 
ATOM   929  C CG    . LEU A 1 139 ? -3.657  9.174   17.789 1.00 34.56 ? 139 LEU A CG    1 
ATOM   930  C CD1   . LEU A 1 139 ? -3.124  10.354  18.577 1.00 36.27 ? 139 LEU A CD1   1 
ATOM   931  C CD2   . LEU A 1 139 ? -4.417  9.657   16.578 1.00 37.53 ? 139 LEU A CD2   1 
ATOM   932  N N     . LYS A 1 140 ? -1.709  5.307   17.820 1.00 36.34 ? 140 LYS A N     1 
ATOM   933  C CA    . LYS A 1 140 ? -2.130  3.943   18.061 1.00 36.38 ? 140 LYS A CA    1 
ATOM   934  C C     . LYS A 1 140 ? -1.497  3.412   19.344 1.00 36.32 ? 140 LYS A C     1 
ATOM   935  O O     . LYS A 1 140 ? -2.090  2.591   20.036 1.00 34.89 ? 140 LYS A O     1 
ATOM   936  C CB    . LYS A 1 140 ? -1.751  3.030   16.896 1.00 35.27 ? 140 LYS A CB    1 
ATOM   937  C CG    . LYS A 1 140 ? -2.240  1.609   17.096 1.00 39.35 ? 140 LYS A CG    1 
ATOM   938  C CD    . LYS A 1 140 ? -2.056  0.764   15.856 1.00 41.52 ? 140 LYS A CD    1 
ATOM   939  C CE    . LYS A 1 140 ? -2.700  -0.614  16.029 1.00 44.51 ? 140 LYS A CE    1 
ATOM   940  N NZ    . LYS A 1 140 ? -2.889  -1.328  14.719 1.00 46.71 ? 140 LYS A NZ    1 
ATOM   941  N N     . THR A 1 141 ? -0.300  3.888   19.676 1.00 36.78 ? 141 THR A N     1 
ATOM   942  C CA    . THR A 1 141 ? 0.353   3.396   20.877 1.00 38.08 ? 141 THR A CA    1 
ATOM   943  C C     . THR A 1 141 ? -0.332  3.860   22.152 1.00 39.13 ? 141 THR A C     1 
ATOM   944  O O     . THR A 1 141 ? -0.073  3.302   23.213 1.00 40.82 ? 141 THR A O     1 
ATOM   945  C CB    . THR A 1 141 ? 1.847   3.798   20.973 1.00 36.44 ? 141 THR A CB    1 
ATOM   946  O OG1   . THR A 1 141 ? 1.953   5.203   21.199 1.00 35.91 ? 141 THR A OG1   1 
ATOM   947  C CG2   . THR A 1 141 ? 2.605   3.416   19.703 1.00 36.84 ? 141 THR A CG2   1 
ATOM   948  N N     . PHE A 1 142 ? -1.185  4.878   22.082 1.00 39.08 ? 142 PHE A N     1 
ATOM   949  C CA    . PHE A 1 142 ? -1.848  5.321   23.307 1.00 39.94 ? 142 PHE A CA    1 
ATOM   950  C C     . PHE A 1 142 ? -2.643  4.161   23.915 1.00 42.42 ? 142 PHE A C     1 
ATOM   951  O O     . PHE A 1 142 ? -2.870  4.136   25.119 1.00 42.67 ? 142 PHE A O     1 
ATOM   952  C CB    . PHE A 1 142 ? -2.806  6.502   23.047 1.00 39.46 ? 142 PHE A CB    1 
ATOM   953  C CG    . PHE A 1 142 ? -2.115  7.827   22.837 1.00 36.75 ? 142 PHE A CG    1 
ATOM   954  C CD1   . PHE A 1 142 ? -0.838  8.055   23.330 1.00 38.07 ? 142 PHE A CD1   1 
ATOM   955  C CD2   . PHE A 1 142 ? -2.746  8.848   22.157 1.00 37.37 ? 142 PHE A CD2   1 
ATOM   956  C CE1   . PHE A 1 142 ? -0.202  9.283   23.148 1.00 36.59 ? 142 PHE A CE1   1 
ATOM   957  C CE2   . PHE A 1 142 ? -2.115  10.091  21.969 1.00 37.04 ? 142 PHE A CE2   1 
ATOM   958  C CZ    . PHE A 1 142 ? -0.846  10.306  22.463 1.00 36.92 ? 142 PHE A CZ    1 
ATOM   959  N N     . GLN A 1 143 ? -3.058  3.210   23.074 1.00 44.90 ? 143 GLN A N     1 
ATOM   960  C CA    . GLN A 1 143 ? -3.844  2.035   23.493 1.00 47.96 ? 143 GLN A CA    1 
ATOM   961  C C     . GLN A 1 143 ? -3.036  0.929   24.156 1.00 49.25 ? 143 GLN A C     1 
ATOM   962  O O     . GLN A 1 143 ? -3.608  -0.044  24.645 1.00 51.38 ? 143 GLN A O     1 
ATOM   963  C CB    . GLN A 1 143 ? -4.522  1.375   22.299 1.00 48.87 ? 143 GLN A CB    1 
ATOM   964  C CG    . GLN A 1 143 ? -5.572  2.164   21.612 1.00 50.12 ? 143 GLN A CG    1 
ATOM   965  C CD    . GLN A 1 143 ? -5.671  1.753   20.164 1.00 52.61 ? 143 GLN A CD    1 
ATOM   966  O OE1   . GLN A 1 143 ? -5.382  0.606   19.810 1.00 53.48 ? 143 GLN A OE1   1 
ATOM   967  N NE2   . GLN A 1 143 ? -6.086  2.677   19.320 1.00 53.07 ? 143 GLN A NE2   1 
ATOM   968  N N     . THR A 1 144 ? -1.717  1.041   24.126 1.00 49.48 ? 144 THR A N     1 
ATOM   969  C CA    . THR A 1 144 ? -0.875  0.016   24.716 1.00 50.23 ? 144 THR A CA    1 
ATOM   970  C C     . THR A 1 144 ? -0.863  0.132   26.234 1.00 50.83 ? 144 THR A C     1 
ATOM   971  O O     . THR A 1 144 ? -0.485  1.165   26.787 1.00 50.79 ? 144 THR A O     1 
ATOM   972  C CB    . THR A 1 144 ? 0.546   0.127   24.176 1.00 50.26 ? 144 THR A CB    1 
ATOM   973  O OG1   . THR A 1 144 ? 0.502   0.046   22.747 1.00 50.45 ? 144 THR A OG1   1 
ATOM   974  C CG2   . THR A 1 144 ? 1.422   -0.987  24.731 1.00 50.12 ? 144 THR A CG2   1 
ATOM   975  N N     . PRO A 1 145 ? -1.274  -0.939  26.933 1.00 52.84 ? 145 PRO A N     1 
ATOM   976  C CA    . PRO A 1 145 ? -1.310  -0.939  28.401 1.00 51.49 ? 145 PRO A CA    1 
ATOM   977  C C     . PRO A 1 145 ? 0.021   -0.531  29.043 1.00 51.07 ? 145 PRO A C     1 
ATOM   978  O O     . PRO A 1 145 ? 1.075   -1.059  28.682 1.00 51.77 ? 145 PRO A O     1 
ATOM   979  C CB    . PRO A 1 145 ? -1.696  -2.379  28.731 1.00 51.37 ? 145 PRO A CB    1 
ATOM   980  C CG    . PRO A 1 145 ? -2.503  -2.800  27.550 1.00 52.16 ? 145 PRO A CG    1 
ATOM   981  C CD    . PRO A 1 145 ? -1.686  -2.253  26.404 1.00 52.37 ? 145 PRO A CD    1 
ATOM   982  N N     . ASN A 1 146 ? -0.045  0.415   29.980 1.00 50.41 ? 146 ASN A N     1 
ATOM   983  C CA    . ASN A 1 146 ? 1.120   0.912   30.717 1.00 50.72 ? 146 ASN A CA    1 
ATOM   984  C C     . ASN A 1 146 ? 2.050   1.819   29.940 1.00 49.38 ? 146 ASN A C     1 
ATOM   985  O O     . ASN A 1 146 ? 2.975   2.400   30.513 1.00 49.90 ? 146 ASN A O     1 
ATOM   986  C CB    . ASN A 1 146 ? 1.952   -0.248  31.264 1.00 53.48 ? 146 ASN A CB    1 
ATOM   987  C CG    . ASN A 1 146 ? 1.164   -1.133  32.192 1.00 57.20 ? 146 ASN A CG    1 
ATOM   988  O OD1   . ASN A 1 146 ? 0.733   -0.697  33.266 1.00 58.31 ? 146 ASN A OD1   1 
ATOM   989  N ND2   . ASN A 1 146 ? 0.956   -2.387  31.782 1.00 58.60 ? 146 ASN A ND2   1 
ATOM   990  N N     . LEU A 1 147 ? 1.823   1.947   28.641 1.00 47.18 ? 147 LEU A N     1 
ATOM   991  C CA    . LEU A 1 147 ? 2.711   2.772   27.845 1.00 44.35 ? 147 LEU A CA    1 
ATOM   992  C C     . LEU A 1 147 ? 2.564   4.235   28.207 1.00 42.55 ? 147 LEU A C     1 
ATOM   993  O O     . LEU A 1 147 ? 3.557   4.923   28.484 1.00 40.48 ? 147 LEU A O     1 
ATOM   994  C CB    . LEU A 1 147 ? 2.449   2.553   26.356 1.00 43.73 ? 147 LEU A CB    1 
ATOM   995  C CG    . LEU A 1 147 ? 3.611   3.063   25.504 1.00 43.00 ? 147 LEU A CG    1 
ATOM   996  C CD1   . LEU A 1 147 ? 4.911   2.384   25.972 1.00 43.56 ? 147 LEU A CD1   1 
ATOM   997  C CD2   . LEU A 1 147 ? 3.347   2.772   24.049 1.00 39.36 ? 147 LEU A CD2   1 
ATOM   998  N N     . TRP A 1 148 ? 1.322   4.711   28.210 1.00 41.15 ? 148 TRP A N     1 
ATOM   999  C CA    . TRP A 1 148 ? 1.051   6.100   28.555 1.00 40.15 ? 148 TRP A CA    1 
ATOM   1000 C C     . TRP A 1 148 ? 0.107   6.146   29.751 1.00 41.34 ? 148 TRP A C     1 
ATOM   1001 O O     . TRP A 1 148 ? -0.772  5.288   29.894 1.00 41.49 ? 148 TRP A O     1 
ATOM   1002 C CB    . TRP A 1 148 ? 0.394   6.847   27.387 1.00 39.35 ? 148 TRP A CB    1 
ATOM   1003 C CG    . TRP A 1 148 ? 1.200   6.897   26.122 1.00 37.07 ? 148 TRP A CG    1 
ATOM   1004 C CD1   . TRP A 1 148 ? 1.377   5.885   25.213 1.00 38.78 ? 148 TRP A CD1   1 
ATOM   1005 C CD2   . TRP A 1 148 ? 1.934   8.018   25.619 1.00 37.02 ? 148 TRP A CD2   1 
ATOM   1006 N NE1   . TRP A 1 148 ? 2.178   6.312   24.176 1.00 38.32 ? 148 TRP A NE1   1 
ATOM   1007 C CE2   . TRP A 1 148 ? 2.535   7.616   24.402 1.00 37.06 ? 148 TRP A CE2   1 
ATOM   1008 C CE3   . TRP A 1 148 ? 2.143   9.324   26.076 1.00 36.85 ? 148 TRP A CE3   1 
ATOM   1009 C CZ2   . TRP A 1 148 ? 3.323   8.473   23.640 1.00 36.86 ? 148 TRP A CZ2   1 
ATOM   1010 C CZ3   . TRP A 1 148 ? 2.928   10.179  25.313 1.00 37.30 ? 148 TRP A CZ3   1 
ATOM   1011 C CH2   . TRP A 1 148 ? 3.508   9.749   24.110 1.00 38.68 ? 148 TRP A CH2   1 
ATOM   1012 N N     . LYS A 1 149 ? 0.302   7.124   30.629 1.00 39.74 ? 149 LYS A N     1 
ATOM   1013 C CA    . LYS A 1 149 ? -0.604  7.265   31.755 1.00 40.35 ? 149 LYS A CA    1 
ATOM   1014 C C     . LYS A 1 149 ? -1.802  8.021   31.192 1.00 40.78 ? 149 LYS A C     1 
ATOM   1015 O O     . LYS A 1 149 ? -1.638  9.041   30.512 1.00 39.16 ? 149 LYS A O     1 
ATOM   1016 C CB    . LYS A 1 149 ? 0.039   8.059   32.892 1.00 40.63 ? 149 LYS A CB    1 
ATOM   1017 C CG    . LYS A 1 149 ? 1.151   7.303   33.613 1.00 44.59 ? 149 LYS A CG    1 
ATOM   1018 C CD    . LYS A 1 149 ? 1.922   8.221   34.538 1.00 47.32 ? 149 LYS A CD    1 
ATOM   1019 C CE    . LYS A 1 149 ? 3.178   7.561   35.093 1.00 47.85 ? 149 LYS A CE    1 
ATOM   1020 N NZ    . LYS A 1 149 ? 4.105   8.583   35.684 1.00 49.69 ? 149 LYS A NZ    1 
ATOM   1021 N N     . ASP A 1 150 ? -2.999  7.494   31.449 1.00 40.38 ? 150 ASP A N     1 
ATOM   1022 C CA    . ASP A 1 150 ? -4.229  8.110   30.986 1.00 40.81 ? 150 ASP A CA    1 
ATOM   1023 C C     . ASP A 1 150 ? -4.269  9.587   31.284 1.00 39.58 ? 150 ASP A C     1 
ATOM   1024 O O     . ASP A 1 150 ? -4.753  10.372  30.469 1.00 40.45 ? 150 ASP A O     1 
ATOM   1025 C CB    . ASP A 1 150 ? -5.440  7.442   31.631 1.00 44.46 ? 150 ASP A CB    1 
ATOM   1026 C CG    . ASP A 1 150 ? -5.681  6.060   31.092 1.00 46.85 ? 150 ASP A CG    1 
ATOM   1027 O OD1   . ASP A 1 150 ? -5.296  5.808   29.924 1.00 47.98 ? 150 ASP A OD1   1 
ATOM   1028 O OD2   . ASP A 1 150 ? -6.257  5.230   31.822 1.00 49.79 ? 150 ASP A OD2   1 
ATOM   1029 N N     . ALA A 1 151 ? -3.755  9.966   32.449 1.00 37.40 ? 151 ALA A N     1 
ATOM   1030 C CA    . ALA A 1 151 ? -3.734  11.367  32.852 1.00 36.47 ? 151 ALA A CA    1 
ATOM   1031 C C     . ALA A 1 151 ? -2.807  12.189  31.938 1.00 36.22 ? 151 ALA A C     1 
ATOM   1032 O O     . ALA A 1 151 ? -2.997  13.393  31.772 1.00 34.45 ? 151 ALA A O     1 
ATOM   1033 C CB    . ALA A 1 151 ? -3.278  11.478  34.305 1.00 33.57 ? 151 ALA A CB    1 
ATOM   1034 N N     . HIS A 1 152 ? -1.789  11.535  31.370 1.00 36.39 ? 152 HIS A N     1 
ATOM   1035 C CA    . HIS A 1 152 ? -0.851  12.201  30.452 1.00 34.50 ? 152 HIS A CA    1 
ATOM   1036 C C     . HIS A 1 152 ? -1.488  12.333  29.078 1.00 32.04 ? 152 HIS A C     1 
ATOM   1037 O O     . HIS A 1 152 ? -1.386  13.372  28.431 1.00 33.07 ? 152 HIS A O     1 
ATOM   1038 C CB    . HIS A 1 152 ? 0.446   11.403  30.343 1.00 35.37 ? 152 HIS A CB    1 
ATOM   1039 C CG    . HIS A 1 152 ? 1.337   11.558  31.532 1.00 39.35 ? 152 HIS A CG    1 
ATOM   1040 N ND1   . HIS A 1 152 ? 2.577   10.962  31.621 1.00 38.46 ? 152 HIS A ND1   1 
ATOM   1041 C CD2   . HIS A 1 152 ? 1.168   12.256  32.680 1.00 37.35 ? 152 HIS A CD2   1 
ATOM   1042 C CE1   . HIS A 1 152 ? 3.135   11.290  32.772 1.00 38.87 ? 152 HIS A CE1   1 
ATOM   1043 N NE2   . HIS A 1 152 ? 2.302   12.073  33.431 1.00 40.69 ? 152 HIS A NE2   1 
ATOM   1044 N N     . ILE A 1 153 ? -2.146  11.267  28.645 1.00 31.46 ? 153 ILE A N     1 
ATOM   1045 C CA    . ILE A 1 153 ? -2.839  11.252  27.364 1.00 33.44 ? 153 ILE A CA    1 
ATOM   1046 C C     . ILE A 1 153 ? -3.821  12.416  27.388 1.00 34.20 ? 153 ILE A C     1 
ATOM   1047 O O     . ILE A 1 153 ? -3.900  13.199  26.439 1.00 35.05 ? 153 ILE A O     1 
ATOM   1048 C CB    . ILE A 1 153 ? -3.625  9.934   27.170 1.00 31.74 ? 153 ILE A CB    1 
ATOM   1049 C CG1   . ILE A 1 153 ? -2.660  8.743   27.182 1.00 32.55 ? 153 ILE A CG1   1 
ATOM   1050 C CG2   . ILE A 1 153 ? -4.411  9.987   25.891 1.00 32.27 ? 153 ILE A CG2   1 
ATOM   1051 C CD1   . ILE A 1 153 ? -3.306  7.419   26.853 1.00 27.75 ? 153 ILE A CD1   1 
ATOM   1052 N N     . GLN A 1 154 ? -4.546  12.543  28.494 1.00 34.32 ? 154 GLN A N     1 
ATOM   1053 C CA    . GLN A 1 154 ? -5.530  13.613  28.645 1.00 34.61 ? 154 GLN A CA    1 
ATOM   1054 C C     . GLN A 1 154 ? -4.894  14.981  28.657 1.00 31.66 ? 154 GLN A C     1 
ATOM   1055 O O     . GLN A 1 154 ? -5.329  15.873  27.949 1.00 30.79 ? 154 GLN A O     1 
ATOM   1056 C CB    . GLN A 1 154 ? -6.343  13.436  29.941 1.00 38.82 ? 154 GLN A CB    1 
ATOM   1057 C CG    . GLN A 1 154 ? -7.339  14.565  30.210 1.00 42.96 ? 154 GLN A CG    1 
ATOM   1058 C CD    . GLN A 1 154 ? -8.226  14.300  31.425 1.00 47.49 ? 154 GLN A CD    1 
ATOM   1059 O OE1   . GLN A 1 154 ? -8.800  13.217  31.570 1.00 50.43 ? 154 GLN A OE1   1 
ATOM   1060 N NE2   . GLN A 1 154 ? -8.353  15.295  32.294 1.00 49.21 ? 154 GLN A NE2   1 
ATOM   1061 N N     . GLU A 1 155 ? -3.867  15.161  29.468 1.00 29.43 ? 155 GLU A N     1 
ATOM   1062 C CA    . GLU A 1 155 ? -3.231  16.462  29.518 1.00 31.23 ? 155 GLU A CA    1 
ATOM   1063 C C     . GLU A 1 155 ? -2.614  16.835  28.163 1.00 30.96 ? 155 GLU A C     1 
ATOM   1064 O O     . GLU A 1 155 ? -2.673  17.993  27.744 1.00 30.88 ? 155 GLU A O     1 
ATOM   1065 C CB    . GLU A 1 155 ? -2.156  16.477  30.604 1.00 31.01 ? 155 GLU A CB    1 
ATOM   1066 C CG    . GLU A 1 155 ? -1.552  17.844  30.821 1.00 32.34 ? 155 GLU A CG    1 
ATOM   1067 C CD    . GLU A 1 155 ? -0.395  17.796  31.802 1.00 34.17 ? 155 GLU A CD    1 
ATOM   1068 O OE1   . GLU A 1 155 ? -0.320  16.796  32.542 1.00 35.44 ? 155 GLU A OE1   1 
ATOM   1069 O OE2   . GLU A 1 155 ? 0.420   18.750  31.831 1.00 33.09 ? 155 GLU A OE2   1 
ATOM   1070 N N     . ILE A 1 156 ? -2.015  15.852  27.491 1.00 31.45 ? 156 ILE A N     1 
ATOM   1071 C CA    . ILE A 1 156 ? -1.383  16.085  26.192 1.00 30.93 ? 156 ILE A CA    1 
ATOM   1072 C C     . ILE A 1 156 ? -2.411  16.600  25.191 1.00 31.43 ? 156 ILE A C     1 
ATOM   1073 O O     . ILE A 1 156 ? -2.184  17.616  24.535 1.00 30.03 ? 156 ILE A O     1 
ATOM   1074 C CB    . ILE A 1 156 ? -0.743  14.786  25.624 1.00 29.45 ? 156 ILE A CB    1 
ATOM   1075 C CG1   . ILE A 1 156 ? 0.590   14.494  26.328 1.00 28.37 ? 156 ILE A CG1   1 
ATOM   1076 C CG2   . ILE A 1 156 ? -0.530  14.916  24.121 1.00 31.40 ? 156 ILE A CG2   1 
ATOM   1077 C CD1   . ILE A 1 156 ? 1.151   13.098  25.998 1.00 26.88 ? 156 ILE A CD1   1 
ATOM   1078 N N     . VAL A 1 157 ? -3.551  15.918  25.084 1.00 31.11 ? 157 VAL A N     1 
ATOM   1079 C CA    . VAL A 1 157 ? -4.561  16.362  24.130 1.00 33.96 ? 157 VAL A CA    1 
ATOM   1080 C C     . VAL A 1 157 ? -5.389  17.569  24.578 1.00 33.81 ? 157 VAL A C     1 
ATOM   1081 O O     . VAL A 1 157 ? -5.822  18.362  23.738 1.00 36.21 ? 157 VAL A O     1 
ATOM   1082 C CB    . VAL A 1 157 ? -5.521  15.234  23.734 1.00 33.25 ? 157 VAL A CB    1 
ATOM   1083 C CG1   . VAL A 1 157 ? -6.471  15.748  22.689 1.00 36.35 ? 157 VAL A CG1   1 
ATOM   1084 C CG2   . VAL A 1 157 ? -4.749  14.066  23.158 1.00 34.75 ? 157 VAL A CG2   1 
ATOM   1085 N N     . GLU A 1 158 ? -5.598  17.727  25.881 1.00 32.93 ? 158 GLU A N     1 
ATOM   1086 C CA    . GLU A 1 158 ? -6.380  18.865  26.388 1.00 32.55 ? 158 GLU A CA    1 
ATOM   1087 C C     . GLU A 1 158 ? -5.599  20.169  26.603 1.00 30.41 ? 158 GLU A C     1 
ATOM   1088 O O     . GLU A 1 158 ? -6.021  21.229  26.156 1.00 30.47 ? 158 GLU A O     1 
ATOM   1089 C CB    . GLU A 1 158 ? -7.069  18.481  27.703 1.00 35.35 ? 158 GLU A CB    1 
ATOM   1090 C CG    . GLU A 1 158 ? -7.761  19.631  28.394 1.00 39.15 ? 158 GLU A CG    1 
ATOM   1091 C CD    . GLU A 1 158 ? -8.458  19.205  29.676 1.00 42.63 ? 158 GLU A CD    1 
ATOM   1092 O OE1   . GLU A 1 158 ? -7.845  18.470  30.494 1.00 43.25 ? 158 GLU A OE1   1 
ATOM   1093 O OE2   . GLU A 1 158 ? -9.618  19.618  29.868 1.00 44.06 ? 158 GLU A OE2   1 
ATOM   1094 N N     . LYS A 1 159 ? -4.461  20.089  27.286 1.00 29.51 ? 159 LYS A N     1 
ATOM   1095 C CA    . LYS A 1 159 ? -3.673  21.276  27.578 1.00 29.52 ? 159 LYS A CA    1 
ATOM   1096 C C     . LYS A 1 159 ? -2.740  21.727  26.474 1.00 31.18 ? 159 LYS A C     1 
ATOM   1097 O O     . LYS A 1 159 ? -2.334  22.883  26.443 1.00 30.15 ? 159 LYS A O     1 
ATOM   1098 C CB    . LYS A 1 159 ? -2.864  21.065  28.868 1.00 31.51 ? 159 LYS A CB    1 
ATOM   1099 C CG    . LYS A 1 159 ? -3.744  20.865  30.093 1.00 32.66 ? 159 LYS A CG    1 
ATOM   1100 C CD    . LYS A 1 159 ? -4.575  22.115  30.346 1.00 34.23 ? 159 LYS A CD    1 
ATOM   1101 C CE    . LYS A 1 159 ? -5.637  21.874  31.415 1.00 36.99 ? 159 LYS A CE    1 
ATOM   1102 N NZ    . LYS A 1 159 ? -6.479  23.080  31.572 1.00 37.36 ? 159 LYS A NZ    1 
ATOM   1103 N N     . PHE A 1 160 ? -2.397  20.822  25.566 1.00 31.13 ? 160 PHE A N     1 
ATOM   1104 C CA    . PHE A 1 160 ? -1.489  21.176  24.482 1.00 32.54 ? 160 PHE A CA    1 
ATOM   1105 C C     . PHE A 1 160 ? -2.090  21.010  23.094 1.00 31.29 ? 160 PHE A C     1 
ATOM   1106 O O     . PHE A 1 160 ? -2.230  21.978  22.343 1.00 34.08 ? 160 PHE A O     1 
ATOM   1107 C CB    . PHE A 1 160 ? -0.204  20.355  24.608 1.00 31.62 ? 160 PHE A CB    1 
ATOM   1108 C CG    . PHE A 1 160 ? 0.515   20.580  25.902 1.00 32.03 ? 160 PHE A CG    1 
ATOM   1109 C CD1   . PHE A 1 160 ? 1.177   21.784  26.133 1.00 29.93 ? 160 PHE A CD1   1 
ATOM   1110 C CD2   . PHE A 1 160 ? 0.456   19.632  26.921 1.00 31.07 ? 160 PHE A CD2   1 
ATOM   1111 C CE1   . PHE A 1 160 ? 1.768   22.054  27.376 1.00 34.11 ? 160 PHE A CE1   1 
ATOM   1112 C CE2   . PHE A 1 160 ? 1.043   19.885  28.172 1.00 33.87 ? 160 PHE A CE2   1 
ATOM   1113 C CZ    . PHE A 1 160 ? 1.703   21.104  28.403 1.00 32.02 ? 160 PHE A CZ    1 
ATOM   1114 N N     . GLY A 1 161 ? -2.443  19.781  22.758 1.00 30.51 ? 161 GLY A N     1 
ATOM   1115 C CA    . GLY A 1 161 ? -3.007  19.517  21.453 1.00 30.23 ? 161 GLY A CA    1 
ATOM   1116 C C     . GLY A 1 161 ? -2.163  18.517  20.678 1.00 30.07 ? 161 GLY A C     1 
ATOM   1117 O O     . GLY A 1 161 ? -0.999  18.289  20.997 1.00 29.85 ? 161 GLY A O     1 
ATOM   1118 N N     . LEU A 1 162 ? -2.765  17.926  19.656 1.00 30.58 ? 162 LEU A N     1 
ATOM   1119 C CA    . LEU A 1 162 ? -2.110  16.940  18.830 1.00 31.06 ? 162 LEU A CA    1 
ATOM   1120 C C     . LEU A 1 162 ? -2.312  17.202  17.343 1.00 30.33 ? 162 LEU A C     1 
ATOM   1121 O O     . LEU A 1 162 ? -3.430  17.471  16.889 1.00 29.47 ? 162 LEU A O     1 
ATOM   1122 C CB    . LEU A 1 162 ? -2.660  15.545  19.115 1.00 32.29 ? 162 LEU A CB    1 
ATOM   1123 C CG    . LEU A 1 162 ? -2.122  14.627  20.206 1.00 35.73 ? 162 LEU A CG    1 
ATOM   1124 C CD1   . LEU A 1 162 ? -3.006  13.379  20.243 1.00 37.32 ? 162 LEU A CD1   1 
ATOM   1125 C CD2   . LEU A 1 162 ? -0.674  14.231  19.922 1.00 35.85 ? 162 LEU A CD2   1 
ATOM   1126 N N     . VAL A 1 163 ? -1.221  17.124  16.589 1.00 27.49 ? 163 VAL A N     1 
ATOM   1127 C CA    . VAL A 1 163 ? -1.290  17.263  15.147 1.00 27.70 ? 163 VAL A CA    1 
ATOM   1128 C C     . VAL A 1 163 ? -0.699  15.952  14.685 1.00 27.70 ? 163 VAL A C     1 
ATOM   1129 O O     . VAL A 1 163 ? 0.487   15.697  14.854 1.00 28.02 ? 163 VAL A O     1 
ATOM   1130 C CB    . VAL A 1 163 ? -0.469  18.451  14.620 1.00 29.70 ? 163 VAL A CB    1 
ATOM   1131 C CG1   . VAL A 1 163 ? -0.627  18.567  13.112 1.00 28.30 ? 163 VAL A CG1   1 
ATOM   1132 C CG2   . VAL A 1 163 ? -0.965  19.734  15.262 1.00 29.36 ? 163 VAL A CG2   1 
ATOM   1133 N N     . CYS A 1 164 ? -1.552  15.112  14.126 1.00 26.99 ? 164 CYS A N     1 
ATOM   1134 C CA    . CYS A 1 164 ? -1.167  13.792  13.677 1.00 29.41 ? 164 CYS A CA    1 
ATOM   1135 C C     . CYS A 1 164 ? -1.147  13.676  12.137 1.00 29.21 ? 164 CYS A C     1 
ATOM   1136 O O     . CYS A 1 164 ? -2.084  14.078  11.454 1.00 27.26 ? 164 CYS A O     1 
ATOM   1137 C CB    . CYS A 1 164 ? -2.140  12.815  14.344 1.00 32.61 ? 164 CYS A CB    1 
ATOM   1138 S SG    . CYS A 1 164 ? -2.200  11.175  13.694 1.00 42.41 ? 164 CYS A SG    1 
ATOM   1139 N N     . VAL A 1 165 ? -0.037  13.179  11.595 1.00 29.79 ? 165 VAL A N     1 
ATOM   1140 C CA    . VAL A 1 165 ? 0.108   13.027  10.148 1.00 29.86 ? 165 VAL A CA    1 
ATOM   1141 C C     . VAL A 1 165 ? -0.173  11.576  9.767  1.00 30.26 ? 165 VAL A C     1 
ATOM   1142 O O     . VAL A 1 165 ? 0.346   10.640  10.379 1.00 29.58 ? 165 VAL A O     1 
ATOM   1143 C CB    . VAL A 1 165 ? 1.529   13.444  9.665  1.00 30.78 ? 165 VAL A CB    1 
ATOM   1144 C CG1   . VAL A 1 165 ? 1.646   13.219  8.174  1.00 32.26 ? 165 VAL A CG1   1 
ATOM   1145 C CG2   . VAL A 1 165 ? 1.784   14.913  9.953  1.00 28.33 ? 165 VAL A CG2   1 
ATOM   1146 N N     . GLY A 1 166 ? -1.017  11.390  8.763  1.00 30.67 ? 166 GLY A N     1 
ATOM   1147 C CA    . GLY A 1 166 ? -1.383  10.045  8.352  1.00 30.98 ? 166 GLY A CA    1 
ATOM   1148 C C     . GLY A 1 166 ? -0.221  9.134   7.990  1.00 32.46 ? 166 GLY A C     1 
ATOM   1149 O O     . GLY A 1 166 ? 0.837   9.591   7.565  1.00 29.65 ? 166 GLY A O     1 
ATOM   1150 N N     . ARG A 1 167 ? -0.428  7.836   8.193  1.00 33.93 ? 167 ARG A N     1 
ATOM   1151 C CA    . ARG A 1 167 ? 0.554   6.810   7.865  1.00 37.04 ? 167 ARG A CA    1 
ATOM   1152 C C     . ARG A 1 167 ? -0.179  5.577   7.359  1.00 36.97 ? 167 ARG A C     1 
ATOM   1153 O O     . ARG A 1 167 ? -1.230  5.205   7.885  1.00 38.59 ? 167 ARG A O     1 
ATOM   1154 C CB    . ARG A 1 167 ? 1.400   6.438   9.081  1.00 38.24 ? 167 ARG A CB    1 
ATOM   1155 C CG    . ARG A 1 167 ? 2.178   7.611   9.614  1.00 44.01 ? 167 ARG A CG    1 
ATOM   1156 C CD    . ARG A 1 167 ? 3.449   7.171   10.288 1.00 48.79 ? 167 ARG A CD    1 
ATOM   1157 N NE    . ARG A 1 167 ? 4.324   6.471   9.356  1.00 50.23 ? 167 ARG A NE    1 
ATOM   1158 C CZ    . ARG A 1 167 ? 5.471   5.904   9.711  1.00 49.94 ? 167 ARG A CZ    1 
ATOM   1159 N NH1   . ARG A 1 167 ? 5.876   5.963   10.976 1.00 51.04 ? 167 ARG A NH1   1 
ATOM   1160 N NH2   . ARG A 1 167 ? 6.205   5.267   8.809  1.00 50.34 ? 167 ARG A NH2   1 
ATOM   1161 N N     . VAL A 1 168 ? 0.377   4.946   6.333  1.00 37.29 ? 168 VAL A N     1 
ATOM   1162 C CA    . VAL A 1 168 ? -0.231  3.753   5.763  1.00 37.04 ? 168 VAL A CA    1 
ATOM   1163 C C     . VAL A 1 168 ? -0.473  2.668   6.813  1.00 36.83 ? 168 VAL A C     1 
ATOM   1164 O O     . VAL A 1 168 ? 0.397   2.377   7.647  1.00 34.43 ? 168 VAL A O     1 
ATOM   1165 C CB    . VAL A 1 168 ? 0.650   3.179   4.642  1.00 38.12 ? 168 VAL A CB    1 
ATOM   1166 C CG1   . VAL A 1 168 ? 0.188   1.756   4.282  1.00 38.28 ? 168 VAL A CG1   1 
ATOM   1167 C CG2   . VAL A 1 168 ? 0.565   4.093   3.418  1.00 37.41 ? 168 VAL A CG2   1 
ATOM   1168 N N     . SER A 1 169 ? -1.659  2.070   6.763  1.00 36.55 ? 169 SER A N     1 
ATOM   1169 C CA    . SER A 1 169 ? -1.979  1.030   7.722  1.00 36.73 ? 169 SER A CA    1 
ATOM   1170 C C     . SER A 1 169 ? -2.637  1.500   9.012  1.00 36.11 ? 169 SER A C     1 
ATOM   1171 O O     . SER A 1 169 ? -3.124  0.679   9.780  1.00 38.67 ? 169 SER A O     1 
ATOM   1172 N N     . HIS A 1 170 ? -2.659  2.802   9.270  1.00 33.93 ? 170 HIS A N     1 
ATOM   1173 C CA    . HIS A 1 170 ? -3.267  3.303   10.499 1.00 31.96 ? 170 HIS A CA    1 
ATOM   1174 C C     . HIS A 1 170 ? -4.562  4.056   10.215 1.00 30.60 ? 170 HIS A C     1 
ATOM   1175 O O     . HIS A 1 170 ? -4.686  4.688   9.169  1.00 32.22 ? 170 HIS A O     1 
ATOM   1176 C CB    . HIS A 1 170 ? -2.275  4.219   11.237 1.00 31.94 ? 170 HIS A CB    1 
ATOM   1177 C CG    . HIS A 1 170 ? -1.073  3.503   11.778 1.00 33.22 ? 170 HIS A CG    1 
ATOM   1178 N ND1   . HIS A 1 170 ? 0.036   3.217   11.009 1.00 34.84 ? 170 HIS A ND1   1 
ATOM   1179 C CD2   . HIS A 1 170 ? -0.827  2.971   12.999 1.00 33.36 ? 170 HIS A CD2   1 
ATOM   1180 C CE1   . HIS A 1 170 ? 0.911   2.536   11.728 1.00 33.69 ? 170 HIS A CE1   1 
ATOM   1181 N NE2   . HIS A 1 170 ? 0.412   2.370   12.939 1.00 36.42 ? 170 HIS A NE2   1 
ATOM   1182 N N     . ASP A 1 171 ? -5.528  3.981   11.129 1.00 28.98 ? 171 ASP A N     1 
ATOM   1183 C CA    . ASP A 1 171 ? -6.803  4.692   10.968 1.00 28.36 ? 171 ASP A CA    1 
ATOM   1184 C C     . ASP A 1 171 ? -7.057  5.654   12.162 1.00 28.02 ? 171 ASP A C     1 
ATOM   1185 O O     . ASP A 1 171 ? -7.881  5.373   13.039 1.00 28.06 ? 171 ASP A O     1 
ATOM   1186 C CB    . ASP A 1 171 ? -7.964  3.683   10.844 1.00 29.31 ? 171 ASP A CB    1 
ATOM   1187 C CG    . ASP A 1 171 ? -9.280  4.343   10.472 1.00 29.25 ? 171 ASP A CG    1 
ATOM   1188 O OD1   . ASP A 1 171 ? -9.415  4.837   9.338  1.00 29.06 ? 171 ASP A OD1   1 
ATOM   1189 O OD2   . ASP A 1 171 ? -10.192 4.379   11.313 1.00 31.33 ? 171 ASP A OD2   1 
ATOM   1190 N N     . PRO A 1 172 ? -6.345  6.802   12.188 1.00 26.51 ? 172 PRO A N     1 
ATOM   1191 C CA    . PRO A 1 172 ? -6.382  7.879   13.182 1.00 26.54 ? 172 PRO A CA    1 
ATOM   1192 C C     . PRO A 1 172 ? -7.799  8.200   13.640 1.00 28.68 ? 172 PRO A C     1 
ATOM   1193 O O     . PRO A 1 172 ? -8.050  8.355   14.831 1.00 28.77 ? 172 PRO A O     1 
ATOM   1194 C CB    . PRO A 1 172 ? -5.778  9.066   12.434 1.00 28.59 ? 172 PRO A CB    1 
ATOM   1195 C CG    . PRO A 1 172 ? -4.866  8.455   11.477 1.00 28.01 ? 172 PRO A CG    1 
ATOM   1196 C CD    . PRO A 1 172 ? -5.530  7.194   11.019 1.00 26.86 ? 172 PRO A CD    1 
ATOM   1197 N N     . LYS A 1 173 ? -8.720  8.334   12.684 1.00 28.56 ? 173 LYS A N     1 
ATOM   1198 C CA    . LYS A 1 173 ? -10.105 8.621   13.019 1.00 31.29 ? 173 LYS A CA    1 
ATOM   1199 C C     . LYS A 1 173 ? -10.721 7.529   13.884 1.00 29.73 ? 173 LYS A C     1 
ATOM   1200 O O     . LYS A 1 173 ? -11.529 7.810   14.753 1.00 31.75 ? 173 LYS A O     1 
ATOM   1201 C CB    . LYS A 1 173 ? -10.942 8.779   11.762 1.00 32.29 ? 173 LYS A CB    1 
ATOM   1202 C CG    . LYS A 1 173 ? -10.683 10.034  10.971 1.00 35.54 ? 173 LYS A CG    1 
ATOM   1203 C CD    . LYS A 1 173 ? -11.534 10.013  9.704  1.00 37.26 ? 173 LYS A CD    1 
ATOM   1204 C CE    . LYS A 1 173 ? -11.179 11.142  8.755  1.00 39.29 ? 173 LYS A CE    1 
ATOM   1205 N NZ    . LYS A 1 173 ? -11.928 11.011  7.459  1.00 43.95 ? 173 LYS A NZ    1 
ATOM   1206 N N     . GLY A 1 174 ? -10.336 6.284   13.642 1.00 30.44 ? 174 GLY A N     1 
ATOM   1207 C CA    . GLY A 1 174 ? -10.870 5.180   14.421 1.00 29.68 ? 174 GLY A CA    1 
ATOM   1208 C C     . GLY A 1 174 ? -10.234 5.119   15.799 1.00 31.39 ? 174 GLY A C     1 
ATOM   1209 O O     . GLY A 1 174 ? -10.903 4.790   16.788 1.00 29.84 ? 174 GLY A O     1 
ATOM   1210 N N     . TYR A 1 175 ? -8.941  5.432   15.875 1.00 31.28 ? 175 TYR A N     1 
ATOM   1211 C CA    . TYR A 1 175 ? -8.247  5.422   17.167 1.00 31.48 ? 175 TYR A CA    1 
ATOM   1212 C C     . TYR A 1 175 ? -8.910  6.474   18.040 1.00 31.54 ? 175 TYR A C     1 
ATOM   1213 O O     . TYR A 1 175 ? -9.144  6.272   19.242 1.00 31.24 ? 175 TYR A O     1 
ATOM   1214 C CB    . TYR A 1 175 ? -6.757  5.784   17.030 1.00 29.81 ? 175 TYR A CB    1 
ATOM   1215 C CG    . TYR A 1 175 ? -5.959  4.902   16.095 1.00 29.12 ? 175 TYR A CG    1 
ATOM   1216 C CD1   . TYR A 1 175 ? -6.320  3.572   15.880 1.00 31.63 ? 175 TYR A CD1   1 
ATOM   1217 C CD2   . TYR A 1 175 ? -4.805  5.380   15.468 1.00 28.57 ? 175 TYR A CD2   1 
ATOM   1218 C CE1   . TYR A 1 175 ? -5.553  2.736   15.064 1.00 31.47 ? 175 TYR A CE1   1 
ATOM   1219 C CE2   . TYR A 1 175 ? -4.024  4.551   14.643 1.00 28.58 ? 175 TYR A CE2   1 
ATOM   1220 C CZ    . TYR A 1 175 ? -4.405  3.236   14.445 1.00 30.88 ? 175 TYR A CZ    1 
ATOM   1221 O OH    . TYR A 1 175 ? -3.675  2.424   13.615 1.00 30.09 ? 175 TYR A OH    1 
ATOM   1222 N N     . ILE A 1 176 ? -9.208  7.611   17.431 1.00 29.88 ? 176 ILE A N     1 
ATOM   1223 C CA    . ILE A 1 176 ? -9.835  8.678   18.184 1.00 30.57 ? 176 ILE A CA    1 
ATOM   1224 C C     . ILE A 1 176 ? -11.224 8.306   18.694 1.00 29.65 ? 176 ILE A C     1 
ATOM   1225 O O     . ILE A 1 176 ? -11.519 8.534   19.852 1.00 30.67 ? 176 ILE A O     1 
ATOM   1226 C CB    . ILE A 1 176 ? -9.912  9.964   17.364 1.00 28.34 ? 176 ILE A CB    1 
ATOM   1227 C CG1   . ILE A 1 176 ? -8.499  10.510  17.165 1.00 25.42 ? 176 ILE A CG1   1 
ATOM   1228 C CG2   . ILE A 1 176 ? -10.812 10.973  18.083 1.00 29.95 ? 176 ILE A CG2   1 
ATOM   1229 C CD1   . ILE A 1 176 ? -8.379  11.570  16.071 1.00 23.64 ? 176 ILE A CD1   1 
ATOM   1230 N N     . ALA A 1 177 ? -12.058 7.729   17.836 1.00 28.97 ? 177 ALA A N     1 
ATOM   1231 C CA    . ALA A 1 177 ? -13.414 7.318   18.209 1.00 30.18 ? 177 ALA A CA    1 
ATOM   1232 C C     . ALA A 1 177 ? -13.449 6.232   19.290 1.00 31.54 ? 177 ALA A C     1 
ATOM   1233 O O     . ALA A 1 177 ? -14.333 6.222   20.132 1.00 32.19 ? 177 ALA A O     1 
ATOM   1234 C CB    . ALA A 1 177 ? -14.169 6.812   16.974 1.00 26.81 ? 177 ALA A CB    1 
ATOM   1235 N N     . GLU A 1 178 ? -12.498 5.314   19.249 1.00 32.89 ? 178 GLU A N     1 
ATOM   1236 C CA    . GLU A 1 178 ? -12.447 4.212   20.201 1.00 34.02 ? 178 GLU A CA    1 
ATOM   1237 C C     . GLU A 1 178 ? -11.748 4.552   21.519 1.00 35.70 ? 178 GLU A C     1 
ATOM   1238 O O     . GLU A 1 178 ? -11.642 3.708   22.418 1.00 35.92 ? 178 GLU A O     1 
ATOM   1239 C CB    . GLU A 1 178 ? -11.796 2.991   19.530 1.00 33.97 ? 178 GLU A CB    1 
ATOM   1240 C CG    . GLU A 1 178 ? -12.666 2.405   18.412 1.00 35.57 ? 178 GLU A CG    1 
ATOM   1241 C CD    . GLU A 1 178 ? -12.021 1.234   17.691 1.00 36.60 ? 178 GLU A CD    1 
ATOM   1242 O OE1   . GLU A 1 178 ? -10.840 0.929   17.977 1.00 38.18 ? 178 GLU A OE1   1 
ATOM   1243 O OE2   . GLU A 1 178 ? -12.700 0.627   16.827 1.00 36.53 ? 178 GLU A OE2   1 
ATOM   1244 N N     . SER A 1 179 ? -11.259 5.778   21.631 1.00 34.53 ? 179 SER A N     1 
ATOM   1245 C CA    . SER A 1 179 ? -10.625 6.206   22.867 1.00 34.99 ? 179 SER A CA    1 
ATOM   1246 C C     . SER A 1 179 ? -11.485 7.260   23.558 1.00 34.92 ? 179 SER A C     1 
ATOM   1247 O O     . SER A 1 179 ? -11.662 8.369   23.053 1.00 35.31 ? 179 SER A O     1 
ATOM   1248 C CB    . SER A 1 179 ? -9.253  6.790   22.605 1.00 34.85 ? 179 SER A CB    1 
ATOM   1249 O OG    . SER A 1 179 ? -8.792  7.421   23.776 1.00 34.71 ? 179 SER A OG    1 
ATOM   1250 N N     . PRO A 1 180 ? -12.028 6.928   24.731 1.00 34.90 ? 180 PRO A N     1 
ATOM   1251 C CA    . PRO A 1 180 ? -12.875 7.879   25.463 1.00 35.21 ? 180 PRO A CA    1 
ATOM   1252 C C     . PRO A 1 180 ? -12.197 9.224   25.705 1.00 33.03 ? 180 PRO A C     1 
ATOM   1253 O O     . PRO A 1 180 ? -12.834 10.275  25.628 1.00 32.42 ? 180 PRO A O     1 
ATOM   1254 C CB    . PRO A 1 180 ? -13.182 7.140   26.768 1.00 35.41 ? 180 PRO A CB    1 
ATOM   1255 C CG    . PRO A 1 180 ? -13.108 5.683   26.352 1.00 37.24 ? 180 PRO A CG    1 
ATOM   1256 C CD    . PRO A 1 180 ? -11.896 5.657   25.462 1.00 35.13 ? 180 PRO A CD    1 
ATOM   1257 N N     . ILE A 1 181 ? -10.901 9.176   26.000 1.00 32.65 ? 181 ILE A N     1 
ATOM   1258 C CA    . ILE A 1 181 ? -10.126 10.376  26.266 1.00 31.40 ? 181 ILE A CA    1 
ATOM   1259 C C     . ILE A 1 181 ? -9.923  11.234  25.024 1.00 31.93 ? 181 ILE A C     1 
ATOM   1260 O O     . ILE A 1 181 ? -10.107 12.460  25.061 1.00 29.17 ? 181 ILE A O     1 
ATOM   1261 C CB    . ILE A 1 181 ? -8.731  10.030  26.835 1.00 32.11 ? 181 ILE A CB    1 
ATOM   1262 C CG1   . ILE A 1 181 ? -8.871  9.297   28.178 1.00 34.99 ? 181 ILE A CG1   1 
ATOM   1263 C CG2   . ILE A 1 181 ? -7.915  11.299  27.010 1.00 29.22 ? 181 ILE A CG2   1 
ATOM   1264 C CD1   . ILE A 1 181 ? -7.505  8.906   28.818 1.00 34.24 ? 181 ILE A CD1   1 
ATOM   1265 N N     . LEU A 1 182 ? -9.526  10.588  23.926 1.00 32.90 ? 182 LEU A N     1 
ATOM   1266 C CA    . LEU A 1 182 ? -9.283  11.294  22.666 1.00 31.44 ? 182 LEU A CA    1 
ATOM   1267 C C     . LEU A 1 182 ? -10.593 11.804  22.078 1.00 31.45 ? 182 LEU A C     1 
ATOM   1268 O O     . LEU A 1 182 ? -10.657 12.913  21.542 1.00 29.65 ? 182 LEU A O     1 
ATOM   1269 C CB    . LEU A 1 182 ? -8.576  10.371  21.652 1.00 31.89 ? 182 LEU A CB    1 
ATOM   1270 C CG    . LEU A 1 182 ? -7.209  9.787   22.042 1.00 32.34 ? 182 LEU A CG    1 
ATOM   1271 C CD1   . LEU A 1 182 ? -6.699  8.950   20.904 1.00 34.97 ? 182 LEU A CD1   1 
ATOM   1272 C CD2   . LEU A 1 182 ? -6.208  10.884  22.367 1.00 30.81 ? 182 LEU A CD2   1 
ATOM   1273 N N     . ARG A 1 183 ? -11.638 10.987  22.193 1.00 31.48 ? 183 ARG A N     1 
ATOM   1274 C CA    . ARG A 1 183 ? -12.942 11.350  21.664 1.00 32.65 ? 183 ARG A CA    1 
ATOM   1275 C C     . ARG A 1 183 ? -13.425 12.643  22.330 1.00 32.33 ? 183 ARG A C     1 
ATOM   1276 O O     . ARG A 1 183 ? -13.867 13.587  21.656 1.00 29.67 ? 183 ARG A O     1 
ATOM   1277 C CB    . ARG A 1 183 ? -13.934 10.214  21.913 1.00 35.46 ? 183 ARG A CB    1 
ATOM   1278 C CG    . ARG A 1 183 ? -15.184 10.297  21.069 1.00 40.77 ? 183 ARG A CG    1 
ATOM   1279 C CD    . ARG A 1 183 ? -16.184 9.169   21.385 1.00 46.56 ? 183 ARG A CD    1 
ATOM   1280 N NE    . ARG A 1 183 ? -17.274 9.180   20.412 1.00 53.64 ? 183 ARG A NE    1 
ATOM   1281 C CZ    . ARG A 1 183 ? -18.414 8.497   20.515 1.00 57.88 ? 183 ARG A CZ    1 
ATOM   1282 N NH1   . ARG A 1 183 ? -18.648 7.715   21.569 1.00 58.59 ? 183 ARG A NH1   1 
ATOM   1283 N NH2   . ARG A 1 183 ? -19.333 8.610   19.558 1.00 58.35 ? 183 ARG A NH2   1 
ATOM   1284 N N     . MET A 1 184 ? -13.295 12.690  23.653 1.00 32.07 ? 184 MET A N     1 
ATOM   1285 C CA    . MET A 1 184 ? -13.723 13.848  24.437 1.00 33.50 ? 184 MET A CA    1 
ATOM   1286 C C     . MET A 1 184 ? -12.982 15.128  24.067 1.00 32.42 ? 184 MET A C     1 
ATOM   1287 O O     . MET A 1 184 ? -13.543 16.219  24.139 1.00 32.07 ? 184 MET A O     1 
ATOM   1288 C CB    . MET A 1 184 ? -13.521 13.573  25.930 1.00 37.70 ? 184 MET A CB    1 
ATOM   1289 C CG    . MET A 1 184 ? -13.976 14.718  26.844 1.00 46.06 ? 184 MET A CG    1 
ATOM   1290 S SD    . MET A 1 184 ? -13.523 14.497  28.613 1.00 51.68 ? 184 MET A SD    1 
ATOM   1291 C CE    . MET A 1 184 ? -14.166 12.745  28.944 1.00 50.71 ? 184 MET A CE    1 
ATOM   1292 N N     . HIS A 1 185 ? -11.723 14.998  23.663 1.00 31.02 ? 185 HIS A N     1 
ATOM   1293 C CA    . HIS A 1 185 ? -10.912 16.154  23.314 1.00 30.87 ? 185 HIS A CA    1 
ATOM   1294 C C     . HIS A 1 185 ? -10.515 16.212  21.848 1.00 30.81 ? 185 HIS A C     1 
ATOM   1295 O O     . HIS A 1 185 ? -9.527  16.864  21.482 1.00 30.52 ? 185 HIS A O     1 
ATOM   1296 C CB    . HIS A 1 185 ? -9.668  16.130  24.177 1.00 31.67 ? 185 HIS A CB    1 
ATOM   1297 C CG    . HIS A 1 185 ? -9.969  16.260  25.634 1.00 32.33 ? 185 HIS A CG    1 
ATOM   1298 N ND1   . HIS A 1 185 ? -10.320 17.463  26.211 1.00 31.75 ? 185 HIS A ND1   1 
ATOM   1299 C CD2   . HIS A 1 185 ? -10.034 15.333  26.617 1.00 30.54 ? 185 HIS A CD2   1 
ATOM   1300 C CE1   . HIS A 1 185 ? -10.588 17.267  27.490 1.00 30.80 ? 185 HIS A CE1   1 
ATOM   1301 N NE2   . HIS A 1 185 ? -10.421 15.984  27.760 1.00 30.87 ? 185 HIS A NE2   1 
ATOM   1302 N N     . GLN A 1 186 ? -11.307 15.563  21.011 1.00 30.69 ? 186 GLN A N     1 
ATOM   1303 C CA    . GLN A 1 186 ? -10.997 15.474  19.588 1.00 30.93 ? 186 GLN A CA    1 
ATOM   1304 C C     . GLN A 1 186 ? -10.882 16.786  18.832 1.00 30.95 ? 186 GLN A C     1 
ATOM   1305 O O     . GLN A 1 186 ? -10.240 16.832  17.790 1.00 33.51 ? 186 GLN A O     1 
ATOM   1306 C CB    . GLN A 1 186 ? -11.997 14.554  18.899 1.00 29.11 ? 186 GLN A CB    1 
ATOM   1307 C CG    . GLN A 1 186 ? -13.376 15.126  18.747 1.00 28.09 ? 186 GLN A CG    1 
ATOM   1308 C CD    . GLN A 1 186 ? -14.331 14.122  18.147 1.00 29.74 ? 186 GLN A CD    1 
ATOM   1309 O OE1   . GLN A 1 186 ? -15.029 13.401  18.861 1.00 30.52 ? 186 GLN A OE1   1 
ATOM   1310 N NE2   . GLN A 1 186 ? -14.352 14.051  16.827 1.00 31.93 ? 186 GLN A NE2   1 
ATOM   1311 N N     . HIS A 1 187 ? -11.467 17.857  19.362 1.00 30.71 ? 187 HIS A N     1 
ATOM   1312 C CA    . HIS A 1 187 ? -11.394 19.166  18.706 1.00 28.06 ? 187 HIS A CA    1 
ATOM   1313 C C     . HIS A 1 187 ? -9.945  19.665  18.733 1.00 28.16 ? 187 HIS A C     1 
ATOM   1314 O O     . HIS A 1 187 ? -9.531  20.492  17.913 1.00 25.85 ? 187 HIS A O     1 
ATOM   1315 C CB    . HIS A 1 187 ? -12.294 20.171  19.434 1.00 27.88 ? 187 HIS A CB    1 
ATOM   1316 C CG    . HIS A 1 187 ? -12.265 20.015  20.921 1.00 27.36 ? 187 HIS A CG    1 
ATOM   1317 N ND1   . HIS A 1 187 ? -13.171 19.229  21.601 1.00 26.67 ? 187 HIS A ND1   1 
ATOM   1318 C CD2   . HIS A 1 187 ? -11.369 20.443  21.844 1.00 26.92 ? 187 HIS A CD2   1 
ATOM   1319 C CE1   . HIS A 1 187 ? -12.830 19.174  22.877 1.00 28.44 ? 187 HIS A CE1   1 
ATOM   1320 N NE2   . HIS A 1 187 ? -11.739 19.901  23.050 1.00 28.38 ? 187 HIS A NE2   1 
ATOM   1321 N N     . ASN A 1 188 ? -9.193  19.153  19.697 1.00 27.30 ? 188 ASN A N     1 
ATOM   1322 C CA    . ASN A 1 188 ? -7.794  19.500  19.884 1.00 28.60 ? 188 ASN A CA    1 
ATOM   1323 C C     . ASN A 1 188 ? -6.821  18.550  19.165 1.00 28.95 ? 188 ASN A C     1 
ATOM   1324 O O     . ASN A 1 188 ? -5.593  18.626  19.347 1.00 26.60 ? 188 ASN A O     1 
ATOM   1325 C CB    . ASN A 1 188 ? -7.464  19.500  21.366 1.00 32.25 ? 188 ASN A CB    1 
ATOM   1326 C CG    . ASN A 1 188 ? -7.471  20.876  21.958 1.00 37.96 ? 188 ASN A CG    1 
ATOM   1327 O OD1   . ASN A 1 188 ? -7.098  21.062  23.113 1.00 45.50 ? 188 ASN A OD1   1 
ATOM   1328 N ND2   . ASN A 1 188 ? -7.880  21.854  21.175 1.00 39.26 ? 188 ASN A ND2   1 
ATOM   1329 N N     . ILE A 1 189 ? -7.364  17.640  18.374 1.00 27.64 ? 189 ILE A N     1 
ATOM   1330 C CA    . ILE A 1 189 ? -6.522  16.721  17.629 1.00 28.48 ? 189 ILE A CA    1 
ATOM   1331 C C     . ILE A 1 189 ? -6.760  17.096  16.169 1.00 30.44 ? 189 ILE A C     1 
ATOM   1332 O O     . ILE A 1 189 ? -7.901  17.165  15.712 1.00 32.82 ? 189 ILE A O     1 
ATOM   1333 C CB    . ILE A 1 189 ? -6.932  15.268  17.899 1.00 26.88 ? 189 ILE A CB    1 
ATOM   1334 C CG1   . ILE A 1 189 ? -6.826  14.992  19.403 1.00 26.13 ? 189 ILE A CG1   1 
ATOM   1335 C CG2   . ILE A 1 189 ? -6.044  14.310  17.120 1.00 26.58 ? 189 ILE A CG2   1 
ATOM   1336 C CD1   . ILE A 1 189 ? -7.354  13.652  19.861 1.00 26.48 ? 189 ILE A CD1   1 
ATOM   1337 N N     . HIS A 1 190 ? -5.685  17.383  15.450 1.00 30.32 ? 190 HIS A N     1 
ATOM   1338 C CA    . HIS A 1 190 ? -5.800  17.762  14.047 1.00 29.64 ? 190 HIS A CA    1 
ATOM   1339 C C     . HIS A 1 190 ? -5.183  16.685  13.170 1.00 29.47 ? 190 HIS A C     1 
ATOM   1340 O O     . HIS A 1 190 ? -4.002  16.375  13.285 1.00 31.81 ? 190 HIS A O     1 
ATOM   1341 C CB    . HIS A 1 190 ? -5.099  19.096  13.839 1.00 29.85 ? 190 HIS A CB    1 
ATOM   1342 C CG    . HIS A 1 190 ? -5.503  20.136  14.837 1.00 32.13 ? 190 HIS A CG    1 
ATOM   1343 N ND1   . HIS A 1 190 ? -6.592  20.962  14.654 1.00 33.58 ? 190 HIS A ND1   1 
ATOM   1344 C CD2   . HIS A 1 190 ? -5.032  20.408  16.078 1.00 34.75 ? 190 HIS A CD2   1 
ATOM   1345 C CE1   . HIS A 1 190 ? -6.775  21.693  15.737 1.00 33.51 ? 190 HIS A CE1   1 
ATOM   1346 N NE2   . HIS A 1 190 ? -5.841  21.376  16.617 1.00 35.17 ? 190 HIS A NE2   1 
ATOM   1347 N N     . LEU A 1 191 ? -6.000  16.106  12.305 1.00 29.62 ? 191 LEU A N     1 
ATOM   1348 C CA    . LEU A 1 191 ? -5.571  15.069  11.393 1.00 29.70 ? 191 LEU A CA    1 
ATOM   1349 C C     . LEU A 1 191 ? -5.148  15.638  10.046 1.00 31.55 ? 191 LEU A C     1 
ATOM   1350 O O     . LEU A 1 191 ? -5.929  16.279  9.347  1.00 31.25 ? 191 LEU A O     1 
ATOM   1351 C CB    . LEU A 1 191 ? -6.701  14.058  11.188 1.00 29.78 ? 191 LEU A CB    1 
ATOM   1352 C CG    . LEU A 1 191 ? -7.089  13.365  12.497 1.00 31.45 ? 191 LEU A CG    1 
ATOM   1353 C CD1   . LEU A 1 191 ? -8.072  12.248  12.186 1.00 32.42 ? 191 LEU A CD1   1 
ATOM   1354 C CD2   . LEU A 1 191 ? -5.836  12.795  13.183 1.00 29.82 ? 191 LEU A CD2   1 
ATOM   1355 N N     . ALA A 1 192 ? -3.900  15.397  9.692  1.00 34.31 ? 192 ALA A N     1 
ATOM   1356 C CA    . ALA A 1 192 ? -3.377  15.863  8.425  1.00 39.89 ? 192 ALA A CA    1 
ATOM   1357 C C     . ALA A 1 192 ? -2.859  14.670  7.642  1.00 44.91 ? 192 ALA A C     1 
ATOM   1358 O O     . ALA A 1 192 ? -2.372  13.692  8.214  1.00 44.77 ? 192 ALA A O     1 
ATOM   1359 C CB    . ALA A 1 192 ? -2.265  16.831  8.653  1.00 35.97 ? 192 ALA A CB    1 
ATOM   1360 N N     . LYS A 1 193 ? -2.982  14.746  6.328  1.00 50.80 ? 193 LYS A N     1 
ATOM   1361 C CA    . LYS A 1 193 ? -2.476  13.698  5.462  1.00 56.27 ? 193 LYS A CA    1 
ATOM   1362 C C     . LYS A 1 193 ? -2.394  14.241  4.062  1.00 58.55 ? 193 LYS A C     1 
ATOM   1363 O O     . LYS A 1 193 ? -3.294  14.947  3.598  1.00 59.34 ? 193 LYS A O     1 
ATOM   1364 C CB    . LYS A 1 193 ? -3.364  12.447  5.509  1.00 58.98 ? 193 LYS A CB    1 
ATOM   1365 C CG    . LYS A 1 193 ? -4.867  12.683  5.388  1.00 62.81 ? 193 LYS A CG    1 
ATOM   1366 C CD    . LYS A 1 193 ? -5.330  12.721  3.945  1.00 66.15 ? 193 LYS A CD    1 
ATOM   1367 C CE    . LYS A 1 193 ? -6.814  12.380  3.846  1.00 66.50 ? 193 LYS A CE    1 
ATOM   1368 N NZ    . LYS A 1 193 ? -7.649  13.328  4.629  1.00 68.19 ? 193 LYS A NZ    1 
ATOM   1369 N N     . GLU A 1 194 ? -1.283  13.949  3.404  1.00 60.54 ? 194 GLU A N     1 
ATOM   1370 C CA    . GLU A 1 194 ? -1.102  14.391  2.038  1.00 62.14 ? 194 GLU A CA    1 
ATOM   1371 C C     . GLU A 1 194 ? -1.228  13.137  1.197  1.00 63.82 ? 194 GLU A C     1 
ATOM   1372 O O     . GLU A 1 194 ? -0.770  12.063  1.599  1.00 62.50 ? 194 GLU A O     1 
ATOM   1373 C CB    . GLU A 1 194 ? 0.269   15.051  1.849  1.00 61.96 ? 194 GLU A CB    1 
ATOM   1374 C CG    . GLU A 1 194 ? 1.481   14.135  1.976  1.00 59.32 ? 194 GLU A CG    1 
ATOM   1375 C CD    . GLU A 1 194 ? 2.794   14.908  1.864  1.00 59.19 ? 194 GLU A CD    1 
ATOM   1376 O OE1   . GLU A 1 194 ? 2.797   16.016  1.278  1.00 52.75 ? 194 GLU A OE1   1 
ATOM   1377 O OE2   . GLU A 1 194 ? 3.822   14.398  2.359  1.00 60.46 ? 194 GLU A OE2   1 
ATOM   1378 N N     . PRO A 1 195 ? -1.894  13.251  0.037  1.00 65.78 ? 195 PRO A N     1 
ATOM   1379 C CA    . PRO A 1 195 ? -2.106  12.137  -0.892 1.00 67.36 ? 195 PRO A CA    1 
ATOM   1380 C C     . PRO A 1 195 ? -0.804  11.512  -1.380 1.00 68.12 ? 195 PRO A C     1 
ATOM   1381 O O     . PRO A 1 195 ? -0.702  11.123  -2.549 1.00 68.73 ? 195 PRO A O     1 
ATOM   1382 C CB    . PRO A 1 195 ? -2.901  12.783  -2.031 1.00 68.19 ? 195 PRO A CB    1 
ATOM   1383 C CG    . PRO A 1 195 ? -3.721  13.829  -1.302 1.00 67.96 ? 195 PRO A CG    1 
ATOM   1384 C CD    . PRO A 1 195 ? -2.667  14.435  -0.384 1.00 67.16 ? 195 PRO A CD    1 
ATOM   1385 N N     . VAL A 1 196 ? 0.188   11.435  -0.490 1.00 67.62 ? 196 VAL A N     1 
ATOM   1386 C CA    . VAL A 1 196 ? 1.476   10.848  -0.827 1.00 67.50 ? 196 VAL A CA    1 
ATOM   1387 C C     . VAL A 1 196 ? 1.722   9.586   -0.013 1.00 67.63 ? 196 VAL A C     1 
ATOM   1388 O O     . VAL A 1 196 ? 1.132   9.376   1.046  1.00 67.13 ? 196 VAL A O     1 
ATOM   1389 C CB    . VAL A 1 196 ? 2.648   11.827  -0.587 1.00 67.69 ? 196 VAL A CB    1 
ATOM   1390 C CG1   . VAL A 1 196 ? 3.912   11.278  -1.223 1.00 65.58 ? 196 VAL A CG1   1 
ATOM   1391 C CG2   . VAL A 1 196 ? 2.326   13.181  -1.175 1.00 67.50 ? 196 VAL A CG2   1 
ATOM   1392 N N     . GLN A 1 197 ? 2.614   8.753   -0.523 1.00 67.88 ? 197 GLN A N     1 
ATOM   1393 C CA    . GLN A 1 197 ? 2.932   7.495   0.116  1.00 67.96 ? 197 GLN A CA    1 
ATOM   1394 C C     . GLN A 1 197 ? 4.426   7.411   0.374  1.00 66.88 ? 197 GLN A C     1 
ATOM   1395 O O     . GLN A 1 197 ? 5.183   6.956   -0.479 1.00 68.05 ? 197 GLN A O     1 
ATOM   1396 C CB    . GLN A 1 197 ? 2.487   6.364   -0.804 1.00 69.60 ? 197 GLN A CB    1 
ATOM   1397 C CG    . GLN A 1 197 ? 1.615   5.344   -0.134 1.00 72.23 ? 197 GLN A CG    1 
ATOM   1398 C CD    . GLN A 1 197 ? 2.415   4.456   0.771  1.00 73.06 ? 197 GLN A CD    1 
ATOM   1399 O OE1   . GLN A 1 197 ? 3.123   4.933   1.660  1.00 74.70 ? 197 GLN A OE1   1 
ATOM   1400 N NE2   . GLN A 1 197 ? 2.321   3.151   0.548  1.00 72.03 ? 197 GLN A NE2   1 
ATOM   1401 N N     . ASN A 1 198 ? 4.858   7.855   1.546  1.00 65.03 ? 198 ASN A N     1 
ATOM   1402 C CA    . ASN A 1 198 ? 6.280   7.812   1.853  1.00 63.82 ? 198 ASN A CA    1 
ATOM   1403 C C     . ASN A 1 198 ? 6.573   7.129   3.162  1.00 60.89 ? 198 ASN A C     1 
ATOM   1404 O O     . ASN A 1 198 ? 6.621   7.766   4.207  1.00 60.75 ? 198 ASN A O     1 
ATOM   1405 C CB    . ASN A 1 198 ? 6.856   9.213   1.893  1.00 66.23 ? 198 ASN A CB    1 
ATOM   1406 C CG    . ASN A 1 198 ? 6.790   9.904   0.558  1.00 69.54 ? 198 ASN A CG    1 
ATOM   1407 O OD1   . ASN A 1 198 ? 7.372   9.445   -0.429 1.00 70.59 ? 198 ASN A OD1   1 
ATOM   1408 N ND2   . ASN A 1 198 ? 6.080   11.025  0.516  1.00 72.20 ? 198 ASN A ND2   1 
ATOM   1409 N N     . GLU A 1 199 ? 6.789   5.826   3.094  1.00 57.00 ? 199 GLU A N     1 
ATOM   1410 C CA    . GLU A 1 199 ? 7.066   5.062   4.284  1.00 54.44 ? 199 GLU A CA    1 
ATOM   1411 C C     . GLU A 1 199 ? 8.527   4.601   4.377  1.00 53.17 ? 199 GLU A C     1 
ATOM   1412 O O     . GLU A 1 199 ? 8.827   3.404   4.303  1.00 53.13 ? 199 GLU A O     1 
ATOM   1413 C CB    . GLU A 1 199 ? 6.110   3.871   4.342  1.00 53.96 ? 199 GLU A CB    1 
ATOM   1414 C CG    . GLU A 1 199 ? 4.616   4.254   4.396  1.00 54.03 ? 199 GLU A CG    1 
ATOM   1415 C CD    . GLU A 1 199 ? 4.185   4.879   5.733  1.00 54.13 ? 199 GLU A CD    1 
ATOM   1416 O OE1   . GLU A 1 199 ? 4.774   4.532   6.785  1.00 53.68 ? 199 GLU A OE1   1 
ATOM   1417 O OE2   . GLU A 1 199 ? 3.242   5.703   5.731  1.00 51.82 ? 199 GLU A OE2   1 
ATOM   1418 N N     . ILE A 1 200 ? 9.436   5.563   4.526  1.00 50.46 ? 200 ILE A N     1 
ATOM   1419 C CA    . ILE A 1 200 ? 10.855  5.260   4.666  1.00 46.85 ? 200 ILE A CA    1 
ATOM   1420 C C     . ILE A 1 200 ? 11.029  5.165   6.166  1.00 42.49 ? 200 ILE A C     1 
ATOM   1421 O O     . ILE A 1 200 ? 10.633  6.078   6.876  1.00 43.62 ? 200 ILE A O     1 
ATOM   1422 C CB    . ILE A 1 200 ? 11.788  6.424   4.130  1.00 49.95 ? 200 ILE A CB    1 
ATOM   1423 C CG1   . ILE A 1 200 ? 11.675  7.675   5.026  1.00 51.19 ? 200 ILE A CG1   1 
ATOM   1424 C CG2   . ILE A 1 200 ? 11.404  6.804   2.702  1.00 51.15 ? 200 ILE A CG2   1 
ATOM   1425 C CD1   . ILE A 1 200 ? 12.400  8.939   4.482  1.00 48.98 ? 200 ILE A CD1   1 
ATOM   1426 N N     . SER A 1 201 ? 11.572  4.066   6.675  1.00 38.00 ? 201 SER A N     1 
ATOM   1427 C CA    . SER A 1 201 ? 11.774  3.990   8.118  1.00 33.92 ? 201 SER A CA    1 
ATOM   1428 C C     . SER A 1 201 ? 13.239  4.219   8.427  1.00 32.20 ? 201 SER A C     1 
ATOM   1429 O O     . SER A 1 201 ? 14.116  3.817   7.651  1.00 31.75 ? 201 SER A O     1 
ATOM   1430 C CB    . SER A 1 201 ? 11.323  2.639   8.689  1.00 34.45 ? 201 SER A CB    1 
ATOM   1431 O OG    . SER A 1 201 ? 12.134  1.569   8.252  1.00 36.76 ? 201 SER A OG    1 
ATOM   1432 N N     . ALA A 1 202 ? 13.505  4.887   9.542  1.00 28.52 ? 202 ALA A N     1 
ATOM   1433 C CA    . ALA A 1 202 ? 14.872  5.147   9.941  1.00 27.55 ? 202 ALA A CA    1 
ATOM   1434 C C     . ALA A 1 202 ? 15.578  3.805   10.153 1.00 27.19 ? 202 ALA A C     1 
ATOM   1435 O O     . ALA A 1 202 ? 16.800  3.698   9.966  1.00 27.26 ? 202 ALA A O     1 
ATOM   1436 C CB    . ALA A 1 202 ? 14.903  5.990   11.220 1.00 28.24 ? 202 ALA A CB    1 
ATOM   1437 N N     . THR A 1 203 ? 14.814  2.783   10.523 1.00 25.09 ? 203 THR A N     1 
ATOM   1438 C CA    . THR A 1 203 ? 15.384  1.458   10.720 1.00 27.51 ? 203 THR A CA    1 
ATOM   1439 C C     . THR A 1 203 ? 16.005  1.013   9.398  1.00 27.83 ? 203 THR A C     1 
ATOM   1440 O O     . THR A 1 203 ? 17.154  0.586   9.355  1.00 27.08 ? 203 THR A O     1 
ATOM   1441 C CB    . THR A 1 203 ? 14.312  0.430   11.157 1.00 28.96 ? 203 THR A CB    1 
ATOM   1442 O OG1   . THR A 1 203 ? 13.795  0.806   12.439 1.00 30.18 ? 203 THR A OG1   1 
ATOM   1443 C CG2   . THR A 1 203 ? 14.913  -0.971  11.251 1.00 30.04 ? 203 THR A CG2   1 
ATOM   1444 N N     . TYR A 1 204 ? 15.243  1.140   8.315  1.00 28.45 ? 204 TYR A N     1 
ATOM   1445 C CA    . TYR A 1 204 ? 15.749  0.786   7.007  1.00 27.19 ? 204 TYR A CA    1 
ATOM   1446 C C     . TYR A 1 204 ? 16.980  1.633   6.673  1.00 27.14 ? 204 TYR A C     1 
ATOM   1447 O O     . TYR A 1 204 ? 17.978  1.132   6.142  1.00 25.66 ? 204 TYR A O     1 
ATOM   1448 C CB    . TYR A 1 204 ? 14.682  1.014   5.944  1.00 29.82 ? 204 TYR A CB    1 
ATOM   1449 C CG    . TYR A 1 204 ? 15.230  0.828   4.559  1.00 29.29 ? 204 TYR A CG    1 
ATOM   1450 C CD1   . TYR A 1 204 ? 15.542  -0.443  4.086  1.00 32.44 ? 204 TYR A CD1   1 
ATOM   1451 C CD2   . TYR A 1 204 ? 15.548  1.934   3.760  1.00 29.84 ? 204 TYR A CD2   1 
ATOM   1452 C CE1   . TYR A 1 204 ? 16.173  -0.620  2.847  1.00 32.06 ? 204 TYR A CE1   1 
ATOM   1453 C CE2   . TYR A 1 204 ? 16.176  1.777   2.525  1.00 30.03 ? 204 TYR A CE2   1 
ATOM   1454 C CZ    . TYR A 1 204 ? 16.490  0.498   2.077  1.00 33.01 ? 204 TYR A CZ    1 
ATOM   1455 O OH    . TYR A 1 204 ? 17.151  0.327   0.881  1.00 34.96 ? 204 TYR A OH    1 
ATOM   1456 N N     . ILE A 1 205 ? 16.903  2.926   6.970  1.00 27.06 ? 205 ILE A N     1 
ATOM   1457 C CA    . ILE A 1 205 ? 18.020  3.833   6.694  1.00 27.14 ? 205 ILE A CA    1 
ATOM   1458 C C     . ILE A 1 205 ? 19.307  3.307   7.369  1.00 25.45 ? 205 ILE A C     1 
ATOM   1459 O O     . ILE A 1 205 ? 20.348  3.185   6.723  1.00 27.21 ? 205 ILE A O     1 
ATOM   1460 C CB    . ILE A 1 205 ? 17.699  5.267   7.202  1.00 26.40 ? 205 ILE A CB    1 
ATOM   1461 C CG1   . ILE A 1 205 ? 16.493  5.836   6.440  1.00 27.58 ? 205 ILE A CG1   1 
ATOM   1462 C CG2   . ILE A 1 205 ? 18.914  6.167   7.072  1.00 25.17 ? 205 ILE A CG2   1 
ATOM   1463 C CD1   . ILE A 1 205 ? 16.687  5.899   4.949  1.00 25.89 ? 205 ILE A CD1   1 
ATOM   1464 N N     . ARG A 1 206 ? 19.222  2.975   8.651  1.00 26.11 ? 206 ARG A N     1 
ATOM   1465 C CA    . ARG A 1 206 ? 20.380  2.471   9.402  1.00 26.37 ? 206 ARG A CA    1 
ATOM   1466 C C     . ARG A 1 206 ? 20.964  1.187   8.805  1.00 27.22 ? 206 ARG A C     1 
ATOM   1467 O O     . ARG A 1 206 ? 22.190  1.065   8.643  1.00 28.70 ? 206 ARG A O     1 
ATOM   1468 C CB    . ARG A 1 206 ? 20.004  2.258   10.882 1.00 24.92 ? 206 ARG A CB    1 
ATOM   1469 C CG    . ARG A 1 206 ? 19.658  3.553   11.618 1.00 21.86 ? 206 ARG A CG    1 
ATOM   1470 C CD    . ARG A 1 206 ? 19.707  3.357   13.120 1.00 26.62 ? 206 ARG A CD    1 
ATOM   1471 N NE    . ARG A 1 206 ? 18.676  2.427   13.599 1.00 30.06 ? 206 ARG A NE    1 
ATOM   1472 C CZ    . ARG A 1 206 ? 17.385  2.721   13.722 1.00 29.22 ? 206 ARG A CZ    1 
ATOM   1473 N NH1   . ARG A 1 206 ? 16.934  3.938   13.403 1.00 29.96 ? 206 ARG A NH1   1 
ATOM   1474 N NH2   . ARG A 1 206 ? 16.537  1.798   14.166 1.00 28.82 ? 206 ARG A NH2   1 
ATOM   1475 N N     . ARG A 1 207 ? 20.091  0.245   8.455  1.00 26.09 ? 207 ARG A N     1 
ATOM   1476 C CA    . ARG A 1 207 ? 20.531  -1.011  7.861  1.00 27.01 ? 207 ARG A CA    1 
ATOM   1477 C C     . ARG A 1 207 ? 21.172  -0.744  6.484  1.00 27.13 ? 207 ARG A C     1 
ATOM   1478 O O     . ARG A 1 207 ? 22.224  -1.307  6.154  1.00 26.20 ? 207 ARG A O     1 
ATOM   1479 C CB    . ARG A 1 207 ? 19.342  -1.989  7.731  1.00 27.19 ? 207 ARG A CB    1 
ATOM   1480 C CG    . ARG A 1 207 ? 19.751  -3.363  7.169  1.00 29.44 ? 207 ARG A CG    1 
ATOM   1481 C CD    . ARG A 1 207 ? 18.629  -4.405  7.324  1.00 26.83 ? 207 ARG A CD    1 
ATOM   1482 N NE    . ARG A 1 207 ? 17.447  -4.080  6.536  1.00 26.77 ? 207 ARG A NE    1 
ATOM   1483 C CZ    . ARG A 1 207 ? 17.336  -4.282  5.232  1.00 27.86 ? 207 ARG A CZ    1 
ATOM   1484 N NH1   . ARG A 1 207 ? 18.347  -4.820  4.570  1.00 31.29 ? 207 ARG A NH1   1 
ATOM   1485 N NH2   . ARG A 1 207 ? 16.224  -3.935  4.584  1.00 28.95 ? 207 ARG A NH2   1 
ATOM   1486 N N     . ALA A 1 208 ? 20.543  0.106   5.673  1.00 26.85 ? 208 ALA A N     1 
ATOM   1487 C CA    . ALA A 1 208 ? 21.111  0.417   4.368  1.00 26.24 ? 208 ALA A CA    1 
ATOM   1488 C C     . ALA A 1 208 ? 22.514  1.012   4.568  1.00 26.36 ? 208 ALA A C     1 
ATOM   1489 O O     . ALA A 1 208 ? 23.466  0.610   3.897  1.00 29.15 ? 208 ALA A O     1 
ATOM   1490 C CB    . ALA A 1 208 ? 20.213  1.386   3.618  1.00 24.53 ? 208 ALA A CB    1 
ATOM   1491 N N     . LEU A 1 209 ? 22.651  1.953   5.498  1.00 26.50 ? 209 LEU A N     1 
ATOM   1492 C CA    . LEU A 1 209 ? 23.958  2.563   5.765  1.00 26.97 ? 209 LEU A CA    1 
ATOM   1493 C C     . LEU A 1 209 ? 24.952  1.494   6.226  1.00 28.56 ? 209 LEU A C     1 
ATOM   1494 O O     . LEU A 1 209 ? 26.102  1.474   5.793  1.00 28.60 ? 209 LEU A O     1 
ATOM   1495 C CB    . LEU A 1 209 ? 23.842  3.655   6.841  1.00 26.25 ? 209 LEU A CB    1 
ATOM   1496 C CG    . LEU A 1 209 ? 23.141  4.924   6.340  1.00 25.83 ? 209 LEU A CG    1 
ATOM   1497 C CD1   . LEU A 1 209 ? 22.766  5.839   7.483  1.00 24.35 ? 209 LEU A CD1   1 
ATOM   1498 C CD2   . LEU A 1 209 ? 24.068  5.622   5.343  1.00 27.03 ? 209 LEU A CD2   1 
ATOM   1499 N N     . GLY A 1 210 ? 24.496  0.601   7.100  1.00 29.33 ? 210 GLY A N     1 
ATOM   1500 C CA    . GLY A 1 210 ? 25.362  -0.447  7.593  1.00 30.74 ? 210 GLY A CA    1 
ATOM   1501 C C     . GLY A 1 210 ? 25.823  -1.381  6.493  1.00 32.24 ? 210 GLY A C     1 
ATOM   1502 O O     . GLY A 1 210 ? 26.862  -2.005  6.611  1.00 32.43 ? 210 GLY A O     1 
ATOM   1503 N N     . GLN A 1 211 ? 25.055  -1.480  5.416  1.00 33.16 ? 211 GLN A N     1 
ATOM   1504 C CA    . GLN A 1 211 ? 25.425  -2.361  4.310  1.00 34.75 ? 211 GLN A CA    1 
ATOM   1505 C C     . GLN A 1 211 ? 26.208  -1.634  3.223  1.00 34.50 ? 211 GLN A C     1 
ATOM   1506 O O     . GLN A 1 211 ? 26.465  -2.205  2.161  1.00 34.61 ? 211 GLN A O     1 
ATOM   1507 C CB    . GLN A 1 211 ? 24.175  -2.998  3.687  1.00 35.49 ? 211 GLN A CB    1 
ATOM   1508 C CG    . GLN A 1 211 ? 23.519  -4.054  4.563  1.00 42.05 ? 211 GLN A CG    1 
ATOM   1509 C CD    . GLN A 1 211 ? 22.325  -4.735  3.899  1.00 46.78 ? 211 GLN A CD    1 
ATOM   1510 O OE1   . GLN A 1 211 ? 22.307  -4.947  2.678  1.00 50.58 ? 211 GLN A OE1   1 
ATOM   1511 N NE2   . GLN A 1 211 ? 21.329  -5.106  4.707  1.00 49.69 ? 211 GLN A NE2   1 
ATOM   1512 N N     . GLY A 1 212 ? 26.565  -0.375  3.487  1.00 32.71 ? 212 GLY A N     1 
ATOM   1513 C CA    . GLY A 1 212 ? 27.311  0.413   2.521  1.00 31.87 ? 212 GLY A CA    1 
ATOM   1514 C C     . GLY A 1 212 ? 26.464  0.896   1.352  1.00 32.35 ? 212 GLY A C     1 
ATOM   1515 O O     . GLY A 1 212 ? 26.998  1.307   0.324  1.00 32.93 ? 212 GLY A O     1 
ATOM   1516 N N     . GLN A 1 213 ? 25.145  0.864   1.496  1.00 29.86 ? 213 GLN A N     1 
ATOM   1517 C CA    . GLN A 1 213 ? 24.277  1.309   0.412  1.00 28.84 ? 213 GLN A CA    1 
ATOM   1518 C C     . GLN A 1 213 ? 23.914  2.786   0.522  1.00 28.66 ? 213 GLN A C     1 
ATOM   1519 O O     . GLN A 1 213 ? 24.080  3.398   1.567  1.00 26.81 ? 213 GLN A O     1 
ATOM   1520 C CB    . GLN A 1 213 ? 23.008  0.479   0.399  1.00 31.10 ? 213 GLN A CB    1 
ATOM   1521 C CG    . GLN A 1 213 ? 23.246  -1.003  0.189  1.00 36.54 ? 213 GLN A CG    1 
ATOM   1522 C CD    . GLN A 1 213 ? 21.937  -1.746  0.043  1.00 42.76 ? 213 GLN A CD    1 
ATOM   1523 O OE1   . GLN A 1 213 ? 21.059  -1.659  0.913  1.00 44.04 ? 213 GLN A OE1   1 
ATOM   1524 N NE2   . GLN A 1 213 ? 21.784  -2.472  -1.070 1.00 45.91 ? 213 GLN A NE2   1 
ATOM   1525 N N     . SER A 1 214 ? 23.402  3.363   -0.553 1.00 27.13 ? 214 SER A N     1 
ATOM   1526 C CA    . SER A 1 214 ? 23.024  4.771   -0.518 1.00 25.60 ? 214 SER A CA    1 
ATOM   1527 C C     . SER A 1 214 ? 21.672  5.029   0.119  1.00 24.16 ? 214 SER A C     1 
ATOM   1528 O O     . SER A 1 214 ? 20.759  4.217   0.009  1.00 26.75 ? 214 SER A O     1 
ATOM   1529 C CB    . SER A 1 214 ? 23.007  5.343   -1.940 1.00 26.64 ? 214 SER A CB    1 
ATOM   1530 O OG    . SER A 1 214 ? 22.365  6.607   -1.991 1.00 27.68 ? 214 SER A OG    1 
ATOM   1531 N N     . VAL A 1 215 ? 21.551  6.154   0.818  1.00 22.58 ? 215 VAL A N     1 
ATOM   1532 C CA    . VAL A 1 215 ? 20.270  6.571   1.383  1.00 20.23 ? 215 VAL A CA    1 
ATOM   1533 C C     . VAL A 1 215 ? 20.027  7.984   0.873  1.00 20.18 ? 215 VAL A C     1 
ATOM   1534 O O     . VAL A 1 215 ? 19.166  8.714   1.369  1.00 21.57 ? 215 VAL A O     1 
ATOM   1535 C CB    . VAL A 1 215 ? 20.255  6.555   2.934  1.00 19.60 ? 215 VAL A CB    1 
ATOM   1536 C CG1   . VAL A 1 215 ? 20.381  5.133   3.408  1.00 19.76 ? 215 VAL A CG1   1 
ATOM   1537 C CG2   . VAL A 1 215 ? 21.390  7.426   3.518  1.00 17.09 ? 215 VAL A CG2   1 
ATOM   1538 N N     . LYS A 1 216 ? 20.805  8.377   -0.131 1.00 19.93 ? 216 LYS A N     1 
ATOM   1539 C CA    . LYS A 1 216 ? 20.684  9.715   -0.678 1.00 20.18 ? 216 LYS A CA    1 
ATOM   1540 C C     . LYS A 1 216 ? 19.284  9.924   -1.214 1.00 21.71 ? 216 LYS A C     1 
ATOM   1541 O O     . LYS A 1 216 ? 18.704  9.026   -1.814 1.00 24.01 ? 216 LYS A O     1 
ATOM   1542 C CB    . LYS A 1 216 ? 21.734  9.952   -1.771 1.00 20.85 ? 216 LYS A CB    1 
ATOM   1543 C CG    . LYS A 1 216 ? 21.908  11.417  -2.152 1.00 20.42 ? 216 LYS A CG    1 
ATOM   1544 C CD    . LYS A 1 216 ? 22.975  11.567  -3.209 1.00 21.36 ? 216 LYS A CD    1 
ATOM   1545 C CE    . LYS A 1 216 ? 23.210  13.024  -3.540 1.00 23.72 ? 216 LYS A CE    1 
ATOM   1546 N NZ    . LYS A 1 216 ? 23.839  13.790  -2.411 1.00 24.63 ? 216 LYS A NZ    1 
ATOM   1547 N N     . TYR A 1 217 ? 18.747  11.115  -0.958 1.00 21.55 ? 217 TYR A N     1 
ATOM   1548 C CA    . TYR A 1 217 ? 17.406  11.500  -1.356 1.00 22.82 ? 217 TYR A CA    1 
ATOM   1549 C C     . TYR A 1 217 ? 16.334  10.894  -0.426 1.00 24.18 ? 217 TYR A C     1 
ATOM   1550 O O     . TYR A 1 217 ? 15.149  11.153  -0.631 1.00 24.50 ? 217 TYR A O     1 
ATOM   1551 C CB    . TYR A 1 217 ? 17.130  11.149  -2.829 1.00 23.08 ? 217 TYR A CB    1 
ATOM   1552 C CG    . TYR A 1 217 ? 18.202  11.676  -3.766 1.00 22.23 ? 217 TYR A CG    1 
ATOM   1553 C CD1   . TYR A 1 217 ? 18.451  13.039  -3.875 1.00 20.80 ? 217 TYR A CD1   1 
ATOM   1554 C CD2   . TYR A 1 217 ? 19.002  10.802  -4.501 1.00 22.61 ? 217 TYR A CD2   1 
ATOM   1555 C CE1   . TYR A 1 217 ? 19.470  13.525  -4.694 1.00 21.00 ? 217 TYR A CE1   1 
ATOM   1556 C CE2   . TYR A 1 217 ? 20.036  11.272  -5.322 1.00 21.65 ? 217 TYR A CE2   1 
ATOM   1557 C CZ    . TYR A 1 217 ? 20.263  12.629  -5.416 1.00 22.86 ? 217 TYR A CZ    1 
ATOM   1558 O OH    . TYR A 1 217 ? 21.252  13.086  -6.256 1.00 21.79 ? 217 TYR A OH    1 
ATOM   1559 N N     . LEU A 1 218 ? 16.747  10.091  0.564  1.00 22.03 ? 218 LEU A N     1 
ATOM   1560 C CA    . LEU A 1 218 ? 15.818  9.554   1.574  1.00 24.72 ? 218 LEU A CA    1 
ATOM   1561 C C     . LEU A 1 218 ? 16.011  10.406  2.844  1.00 23.83 ? 218 LEU A C     1 
ATOM   1562 O O     . LEU A 1 218 ? 15.080  10.610  3.621  1.00 23.78 ? 218 LEU A O     1 
ATOM   1563 C CB    . LEU A 1 218 ? 16.082  8.076   1.900  1.00 22.37 ? 218 LEU A CB    1 
ATOM   1564 C CG    . LEU A 1 218 ? 15.898  7.122   0.719  1.00 24.92 ? 218 LEU A CG    1 
ATOM   1565 C CD1   . LEU A 1 218 ? 16.057  5.708   1.234  1.00 20.90 ? 218 LEU A CD1   1 
ATOM   1566 C CD2   . LEU A 1 218 ? 14.515  7.328   0.037  1.00 21.70 ? 218 LEU A CD2   1 
ATOM   1567 N N     . ILE A 1 219 ? 17.237  10.898  3.044  1.00 23.75 ? 219 ILE A N     1 
ATOM   1568 C CA    . ILE A 1 219 ? 17.550  11.774  4.164  1.00 20.57 ? 219 ILE A CA    1 
ATOM   1569 C C     . ILE A 1 219 ? 18.390  12.903  3.598  1.00 21.35 ? 219 ILE A C     1 
ATOM   1570 O O     . ILE A 1 219 ? 18.990  12.761  2.545  1.00 23.23 ? 219 ILE A O     1 
ATOM   1571 C CB    . ILE A 1 219 ? 18.287  11.050  5.315  1.00 20.01 ? 219 ILE A CB    1 
ATOM   1572 C CG1   . ILE A 1 219 ? 19.728  10.714  4.937  1.00 18.76 ? 219 ILE A CG1   1 
ATOM   1573 C CG2   . ILE A 1 219 ? 17.529  9.791   5.688  1.00 16.69 ? 219 ILE A CG2   1 
ATOM   1574 C CD1   . ILE A 1 219 ? 20.541  10.121  6.161  1.00 17.87 ? 219 ILE A CD1   1 
ATOM   1575 N N     . PRO A 1 220 ? 18.445  14.048  4.290  1.00 19.48 ? 220 PRO A N     1 
ATOM   1576 C CA    . PRO A 1 220 ? 19.223  15.177  3.769  1.00 20.40 ? 220 PRO A CA    1 
ATOM   1577 C C     . PRO A 1 220 ? 20.703  14.941  3.478  1.00 20.78 ? 220 PRO A C     1 
ATOM   1578 O O     . PRO A 1 220 ? 21.369  14.212  4.212  1.00 22.26 ? 220 PRO A O     1 
ATOM   1579 C CB    . PRO A 1 220 ? 19.009  16.272  4.825  1.00 20.82 ? 220 PRO A CB    1 
ATOM   1580 C CG    . PRO A 1 220 ? 17.668  15.888  5.489  1.00 20.13 ? 220 PRO A CG    1 
ATOM   1581 C CD    . PRO A 1 220 ? 17.781  14.377  5.565  1.00 18.40 ? 220 PRO A CD    1 
ATOM   1582 N N     . ASP A 1 221 ? 21.205  15.567  2.412  1.00 19.18 ? 221 ASP A N     1 
ATOM   1583 C CA    . ASP A 1 221 ? 22.630  15.460  2.068  1.00 22.03 ? 221 ASP A CA    1 
ATOM   1584 C C     . ASP A 1 221 ? 23.493  15.861  3.276  1.00 20.88 ? 221 ASP A C     1 
ATOM   1585 O O     . ASP A 1 221 ? 24.493  15.222  3.568  1.00 21.70 ? 221 ASP A O     1 
ATOM   1586 C CB    . ASP A 1 221 ? 23.003  16.399  0.897  1.00 23.91 ? 221 ASP A CB    1 
ATOM   1587 C CG    . ASP A 1 221 ? 22.401  15.959  -0.443 1.00 27.49 ? 221 ASP A CG    1 
ATOM   1588 O OD1   . ASP A 1 221 ? 22.108  14.755  -0.587 1.00 23.91 ? 221 ASP A OD1   1 
ATOM   1589 O OD2   . ASP A 1 221 ? 22.242  16.818  -1.347 1.00 29.45 ? 221 ASP A OD2   1 
ATOM   1590 N N     . ALA A 1 222 ? 23.098  16.912  3.984  1.00 20.13 ? 222 ALA A N     1 
ATOM   1591 C CA    . ALA A 1 222 ? 23.902  17.373  5.123  1.00 22.86 ? 222 ALA A CA    1 
ATOM   1592 C C     . ALA A 1 222 ? 24.012  16.306  6.219  1.00 23.42 ? 222 ALA A C     1 
ATOM   1593 O O     . ALA A 1 222 ? 25.009  16.239  6.938  1.00 23.94 ? 222 ALA A O     1 
ATOM   1594 C CB    . ALA A 1 222 ? 23.310  18.664  5.700  1.00 20.96 ? 222 ALA A CB    1 
ATOM   1595 N N     . VAL A 1 223 ? 22.993  15.460  6.326  1.00 23.75 ? 223 VAL A N     1 
ATOM   1596 C CA    . VAL A 1 223 ? 22.983  14.400  7.334  1.00 23.02 ? 223 VAL A CA    1 
ATOM   1597 C C     . VAL A 1 223 ? 23.864  13.216  6.886  1.00 24.84 ? 223 VAL A C     1 
ATOM   1598 O O     . VAL A 1 223 ? 24.567  12.611  7.706  1.00 23.43 ? 223 VAL A O     1 
ATOM   1599 C CB    . VAL A 1 223 ? 21.525  13.935  7.625  1.00 21.82 ? 223 VAL A CB    1 
ATOM   1600 C CG1   . VAL A 1 223 ? 21.518  12.791  8.637  1.00 19.24 ? 223 VAL A CG1   1 
ATOM   1601 C CG2   . VAL A 1 223 ? 20.694  15.137  8.146  1.00 19.72 ? 223 VAL A CG2   1 
ATOM   1602 N N     . ILE A 1 224 ? 23.838  12.908  5.588  1.00 23.92 ? 224 ILE A N     1 
ATOM   1603 C CA    . ILE A 1 224 ? 24.664  11.840  5.020  1.00 23.50 ? 224 ILE A CA    1 
ATOM   1604 C C     . ILE A 1 224 ? 26.147  12.205  5.224  1.00 23.38 ? 224 ILE A C     1 
ATOM   1605 O O     . ILE A 1 224 ? 26.954  11.369  5.622  1.00 23.00 ? 224 ILE A O     1 
ATOM   1606 C CB    . ILE A 1 224 ? 24.370  11.672  3.509  1.00 24.26 ? 224 ILE A CB    1 
ATOM   1607 C CG1   . ILE A 1 224 ? 22.914  11.214  3.331  1.00 24.19 ? 224 ILE A CG1   1 
ATOM   1608 C CG2   . ILE A 1 224 ? 25.364  10.691  2.865  1.00 21.39 ? 224 ILE A CG2   1 
ATOM   1609 C CD1   . ILE A 1 224 ? 22.464  11.215  1.869  1.00 19.87 ? 224 ILE A CD1   1 
ATOM   1610 N N     . THR A 1 225 ? 26.490  13.461  4.955  1.00 23.41 ? 225 THR A N     1 
ATOM   1611 C CA    . THR A 1 225 ? 27.854  13.959  5.142  1.00 25.56 ? 225 THR A CA    1 
ATOM   1612 C C     . THR A 1 225 ? 28.302  13.773  6.612  1.00 26.20 ? 225 THR A C     1 
ATOM   1613 O O     . THR A 1 225 ? 29.397  13.297  6.890  1.00 27.49 ? 225 THR A O     1 
ATOM   1614 C CB    . THR A 1 225 ? 27.930  15.466  4.781  1.00 26.55 ? 225 THR A CB    1 
ATOM   1615 O OG1   . THR A 1 225 ? 27.630  15.645  3.387  1.00 27.72 ? 225 THR A OG1   1 
ATOM   1616 C CG2   . THR A 1 225 ? 29.324  16.027  5.070  1.00 25.95 ? 225 THR A CG2   1 
ATOM   1617 N N     . TYR A 1 226 ? 27.445  14.127  7.556  1.00 25.98 ? 226 TYR A N     1 
ATOM   1618 C CA    . TYR A 1 226 ? 27.823  13.971  8.949  1.00 26.72 ? 226 TYR A CA    1 
ATOM   1619 C C     . TYR A 1 226 ? 27.999  12.509  9.312  1.00 27.11 ? 226 TYR A C     1 
ATOM   1620 O O     . TYR A 1 226 ? 28.945  12.157  10.009 1.00 29.35 ? 226 TYR A O     1 
ATOM   1621 C CB    . TYR A 1 226 ? 26.794  14.623  9.867  1.00 25.40 ? 226 TYR A CB    1 
ATOM   1622 C CG    . TYR A 1 226 ? 27.160  14.581  11.345 1.00 27.85 ? 226 TYR A CG    1 
ATOM   1623 C CD1   . TYR A 1 226 ? 26.923  13.436  12.113 1.00 28.11 ? 226 TYR A CD1   1 
ATOM   1624 C CD2   . TYR A 1 226 ? 27.707  15.699  11.974 1.00 26.20 ? 226 TYR A CD2   1 
ATOM   1625 C CE1   . TYR A 1 226 ? 27.210  13.406  13.470 1.00 27.45 ? 226 TYR A CE1   1 
ATOM   1626 C CE2   . TYR A 1 226 ? 28.011  15.687  13.336 1.00 28.30 ? 226 TYR A CE2   1 
ATOM   1627 C CZ    . TYR A 1 226 ? 27.760  14.538  14.078 1.00 29.30 ? 226 TYR A CZ    1 
ATOM   1628 O OH    . TYR A 1 226 ? 28.079  14.514  15.409 1.00 27.62 ? 226 TYR A OH    1 
ATOM   1629 N N     . ILE A 1 227 ? 27.094  11.656  8.848  1.00 27.44 ? 227 ILE A N     1 
ATOM   1630 C CA    . ILE A 1 227 ? 27.184  10.237  9.146  1.00 27.52 ? 227 ILE A CA    1 
ATOM   1631 C C     . ILE A 1 227 ? 28.484  9.682   8.576  1.00 28.95 ? 227 ILE A C     1 
ATOM   1632 O O     . ILE A 1 227 ? 29.149  8.874   9.212  1.00 29.12 ? 227 ILE A O     1 
ATOM   1633 C CB    . ILE A 1 227 ? 25.980  9.469   8.564  1.00 27.86 ? 227 ILE A CB    1 
ATOM   1634 C CG1   . ILE A 1 227 ? 24.751  9.713   9.441  1.00 27.71 ? 227 ILE A CG1   1 
ATOM   1635 C CG2   . ILE A 1 227 ? 26.304  7.956   8.436  1.00 26.01 ? 227 ILE A CG2   1 
ATOM   1636 C CD1   . ILE A 1 227 ? 23.446  9.352   8.763  1.00 26.95 ? 227 ILE A CD1   1 
ATOM   1637 N N     . LYS A 1 228 ? 28.844  10.101  7.373  1.00 29.48 ? 228 LYS A N     1 
ATOM   1638 C CA    . LYS A 1 228 ? 30.090  9.628   6.798  1.00 33.86 ? 228 LYS A CA    1 
ATOM   1639 C C     . LYS A 1 228 ? 31.282  10.157  7.621  1.00 34.29 ? 228 LYS A C     1 
ATOM   1640 O O     . LYS A 1 228 ? 32.112  9.383   8.095  1.00 32.72 ? 228 LYS A O     1 
ATOM   1641 C CB    . LYS A 1 228 ? 30.223  10.081  5.340  1.00 37.00 ? 228 LYS A CB    1 
ATOM   1642 C CG    . LYS A 1 228 ? 31.596  9.795   4.738  1.00 41.96 ? 228 LYS A CG    1 
ATOM   1643 C CD    . LYS A 1 228 ? 31.698  10.284  3.292  1.00 48.69 ? 228 LYS A CD    1 
ATOM   1644 C CE    . LYS A 1 228 ? 33.107  10.052  2.722  1.00 50.96 ? 228 LYS A CE    1 
ATOM   1645 N NZ    . LYS A 1 228 ? 33.241  10.556  1.316  1.00 54.35 ? 228 LYS A NZ    1 
ATOM   1646 N N     . ASP A 1 229 ? 31.346  11.471  7.822  1.00 34.88 ? 229 ASP A N     1 
ATOM   1647 C CA    . ASP A 1 229 ? 32.463  12.049  8.571  1.00 35.90 ? 229 ASP A CA    1 
ATOM   1648 C C     . ASP A 1 229 ? 32.678  11.449  9.967  1.00 36.21 ? 229 ASP A C     1 
ATOM   1649 O O     . ASP A 1 229 ? 33.813  11.319  10.401 1.00 38.37 ? 229 ASP A O     1 
ATOM   1650 C CB    . ASP A 1 229 ? 32.316  13.572  8.701  1.00 34.07 ? 229 ASP A CB    1 
ATOM   1651 C CG    . ASP A 1 229 ? 32.489  14.308  7.373  1.00 33.99 ? 229 ASP A CG    1 
ATOM   1652 O OD1   . ASP A 1 229 ? 32.994  13.729  6.389  1.00 36.35 ? 229 ASP A OD1   1 
ATOM   1653 O OD2   . ASP A 1 229 ? 32.120  15.494  7.312  1.00 29.67 ? 229 ASP A OD2   1 
ATOM   1654 N N     . HIS A 1 230 ? 31.611  11.084  10.669 1.00 35.66 ? 230 HIS A N     1 
ATOM   1655 C CA    . HIS A 1 230 ? 31.755  10.519  12.018 1.00 34.63 ? 230 HIS A CA    1 
ATOM   1656 C C     . HIS A 1 230 ? 31.578  9.018   12.114 1.00 34.26 ? 230 HIS A C     1 
ATOM   1657 O O     . HIS A 1 230 ? 31.432  8.475   13.194 1.00 34.96 ? 230 HIS A O     1 
ATOM   1658 C CB    . HIS A 1 230 ? 30.806  11.222  12.967 1.00 30.77 ? 230 HIS A CB    1 
ATOM   1659 C CG    . HIS A 1 230 ? 31.027  12.693  13.012 1.00 31.24 ? 230 HIS A CG    1 
ATOM   1660 N ND1   . HIS A 1 230 ? 31.933  13.281  13.869 1.00 31.51 ? 230 HIS A ND1   1 
ATOM   1661 C CD2   . HIS A 1 230 ? 30.539  13.688  12.239 1.00 30.06 ? 230 HIS A CD2   1 
ATOM   1662 C CE1   . HIS A 1 230 ? 31.994  14.577  13.620 1.00 31.13 ? 230 HIS A CE1   1 
ATOM   1663 N NE2   . HIS A 1 230 ? 31.159  14.850  12.633 1.00 30.79 ? 230 HIS A NE2   1 
ATOM   1664 N N     . GLY A 1 231 ? 31.592  8.351   10.967 1.00 35.90 ? 231 GLY A N     1 
ATOM   1665 C CA    . GLY A 1 231 ? 31.476  6.905   10.945 1.00 35.57 ? 231 GLY A CA    1 
ATOM   1666 C C     . GLY A 1 231 ? 30.308  6.335   11.711 1.00 35.99 ? 231 GLY A C     1 
ATOM   1667 O O     . GLY A 1 231 ? 30.455  5.323   12.392 1.00 38.06 ? 231 GLY A O     1 
ATOM   1668 N N     . LEU A 1 232 ? 29.138  6.954   11.588 1.00 33.47 ? 232 LEU A N     1 
ATOM   1669 C CA    . LEU A 1 232 ? 27.966  6.463   12.297 1.00 31.88 ? 232 LEU A CA    1 
ATOM   1670 C C     . LEU A 1 232 ? 27.254  5.357   11.522 1.00 33.77 ? 232 LEU A C     1 
ATOM   1671 O O     . LEU A 1 232 ? 27.465  5.201   10.307 1.00 32.11 ? 232 LEU A O     1 
ATOM   1672 C CB    . LEU A 1 232 ? 26.995  7.619   12.554 1.00 33.13 ? 232 LEU A CB    1 
ATOM   1673 C CG    . LEU A 1 232 ? 27.603  8.815   13.298 1.00 32.97 ? 232 LEU A CG    1 
ATOM   1674 C CD1   . LEU A 1 232 ? 26.548  9.870   13.540 1.00 33.47 ? 232 LEU A CD1   1 
ATOM   1675 C CD2   . LEU A 1 232 ? 28.195  8.336   14.612 1.00 32.45 ? 232 LEU A CD2   1 
ATOM   1676 N N     . TYR A 1 233 ? 26.434  4.592   12.250 1.00 33.87 ? 233 TYR A N     1 
ATOM   1677 C CA    . TYR A 1 233 ? 25.628  3.501   11.715 1.00 35.97 ? 233 TYR A CA    1 
ATOM   1678 C C     . TYR A 1 233 ? 26.373  2.409   10.985 1.00 39.04 ? 233 TYR A C     1 
ATOM   1679 O O     . TYR A 1 233 ? 25.853  1.817   10.045 1.00 39.14 ? 233 TYR A O     1 
ATOM   1680 C CB    . TYR A 1 233 ? 24.520  4.066   10.819 1.00 32.80 ? 233 TYR A CB    1 
ATOM   1681 C CG    . TYR A 1 233 ? 23.677  5.049   11.586 1.00 30.35 ? 233 TYR A CG    1 
ATOM   1682 C CD1   . TYR A 1 233 ? 22.961  4.642   12.726 1.00 28.86 ? 233 TYR A CD1   1 
ATOM   1683 C CD2   . TYR A 1 233 ? 23.643  6.399   11.230 1.00 27.40 ? 233 TYR A CD2   1 
ATOM   1684 C CE1   . TYR A 1 233 ? 22.240  5.566   13.496 1.00 27.90 ? 233 TYR A CE1   1 
ATOM   1685 C CE2   . TYR A 1 233 ? 22.927  7.323   11.989 1.00 25.66 ? 233 TYR A CE2   1 
ATOM   1686 C CZ    . TYR A 1 233 ? 22.231  6.902   13.121 1.00 25.36 ? 233 TYR A CZ    1 
ATOM   1687 O OH    . TYR A 1 233 ? 21.570  7.830   13.889 1.00 24.21 ? 233 TYR A OH    1 
ATOM   1688 N N     . THR A 1 234 ? 27.592  2.140   11.433 1.00 43.65 ? 234 THR A N     1 
ATOM   1689 C CA    . THR A 1 234 ? 28.410  1.084   10.858 1.00 48.69 ? 234 THR A CA    1 
ATOM   1690 C C     . THR A 1 234 ? 28.038  -0.257  11.510 1.00 50.49 ? 234 THR A C     1 
ATOM   1691 O O     . THR A 1 234 ? 27.388  -0.247  12.579 1.00 52.75 ? 234 THR A O     1 
ATOM   1692 C CB    . THR A 1 234 ? 29.888  1.352   11.115 1.00 50.34 ? 234 THR A CB    1 
ATOM   1693 O OG1   . THR A 1 234 ? 30.212  2.674   10.665 1.00 53.64 ? 234 THR A OG1   1 
ATOM   1694 C CG2   . THR A 1 234 ? 30.746  0.331   10.386 1.00 52.56 ? 234 THR A CG2   1 
ATOM   1695 N N     . SER B 1 3   ? 13.614  -35.567 4.845  1.00 68.13 ? 3   SER B N     1 
ATOM   1696 C CA    . SER B 1 3   ? 12.266  -35.328 5.451  1.00 68.06 ? 3   SER B CA    1 
ATOM   1697 C C     . SER B 1 3   ? 12.124  -33.876 5.916  1.00 67.61 ? 3   SER B C     1 
ATOM   1698 O O     . SER B 1 3   ? 13.113  -33.217 6.255  1.00 67.71 ? 3   SER B O     1 
ATOM   1699 C CB    . SER B 1 3   ? 12.039  -36.285 6.630  1.00 67.70 ? 3   SER B CB    1 
ATOM   1700 N N     . ARG B 1 4   ? 10.888  -33.385 5.935  1.00 66.35 ? 4   ARG B N     1 
ATOM   1701 C CA    . ARG B 1 4   ? 10.616  -32.005 6.339  1.00 64.37 ? 4   ARG B CA    1 
ATOM   1702 C C     . ARG B 1 4   ? 10.122  -31.883 7.775  1.00 62.49 ? 4   ARG B C     1 
ATOM   1703 O O     . ARG B 1 4   ? 9.383   -32.739 8.263  1.00 62.41 ? 4   ARG B O     1 
ATOM   1704 C CB    . ARG B 1 4   ? 9.576   -31.385 5.408  1.00 64.20 ? 4   ARG B CB    1 
ATOM   1705 C CG    . ARG B 1 4   ? 9.969   -31.389 3.957  1.00 64.80 ? 4   ARG B CG    1 
ATOM   1706 C CD    . ARG B 1 4   ? 8.932   -30.681 3.126  1.00 66.70 ? 4   ARG B CD    1 
ATOM   1707 N NE    . ARG B 1 4   ? 9.494   -30.241 1.855  1.00 69.33 ? 4   ARG B NE    1 
ATOM   1708 C CZ    . ARG B 1 4   ? 9.020   -29.226 1.141  1.00 70.57 ? 4   ARG B CZ    1 
ATOM   1709 N NH1   . ARG B 1 4   ? 7.968   -28.541 1.576  1.00 70.84 ? 4   ARG B NH1   1 
ATOM   1710 N NH2   . ARG B 1 4   ? 9.607   -28.889 -0.002 1.00 71.03 ? 4   ARG B NH2   1 
ATOM   1711 N N     . ILE B 1 5   ? 10.531  -30.809 8.442  1.00 59.97 ? 5   ILE B N     1 
ATOM   1712 C CA    . ILE B 1 5   ? 10.109  -30.564 9.813  1.00 57.88 ? 5   ILE B CA    1 
ATOM   1713 C C     . ILE B 1 5   ? 8.658   -30.091 9.838  1.00 56.43 ? 5   ILE B C     1 
ATOM   1714 O O     . ILE B 1 5   ? 8.323   -29.074 9.234  1.00 57.31 ? 5   ILE B O     1 
ATOM   1715 C CB    . ILE B 1 5   ? 10.974  -29.483 10.479 1.00 57.99 ? 5   ILE B CB    1 
ATOM   1716 C CG1   . ILE B 1 5   ? 12.438  -29.929 10.495 1.00 57.93 ? 5   ILE B CG1   1 
ATOM   1717 C CG2   . ILE B 1 5   ? 10.462  -29.210 11.886 1.00 57.17 ? 5   ILE B CG2   1 
ATOM   1718 C CD1   . ILE B 1 5   ? 13.363  -28.989 11.252 1.00 58.33 ? 5   ILE B CD1   1 
ATOM   1719 N N     . PRO B 1 6   ? 7.775   -30.833 10.527 1.00 55.19 ? 6   PRO B N     1 
ATOM   1720 C CA    . PRO B 1 6   ? 6.356   -30.471 10.624 1.00 53.44 ? 6   PRO B CA    1 
ATOM   1721 C C     . PRO B 1 6   ? 6.200   -29.199 11.445 1.00 52.35 ? 6   PRO B C     1 
ATOM   1722 O O     . PRO B 1 6   ? 6.732   -29.097 12.555 1.00 52.03 ? 6   PRO B O     1 
ATOM   1723 C CB    . PRO B 1 6   ? 5.736   -31.674 11.321 1.00 52.72 ? 6   PRO B CB    1 
ATOM   1724 C CG    . PRO B 1 6   ? 6.596   -32.792 10.866 1.00 54.89 ? 6   PRO B CG    1 
ATOM   1725 C CD    . PRO B 1 6   ? 7.983   -32.207 11.010 1.00 54.85 ? 6   PRO B CD    1 
ATOM   1726 N N     . VAL B 1 7   ? 5.469   -28.230 10.902 1.00 49.91 ? 7   VAL B N     1 
ATOM   1727 C CA    . VAL B 1 7   ? 5.280   -26.968 11.594 1.00 46.17 ? 7   VAL B CA    1 
ATOM   1728 C C     . VAL B 1 7   ? 3.820   -26.613 11.829 1.00 44.47 ? 7   VAL B C     1 
ATOM   1729 O O     . VAL B 1 7   ? 2.941   -26.953 11.033 1.00 43.98 ? 7   VAL B O     1 
ATOM   1730 C CB    . VAL B 1 7   ? 5.926   -25.824 10.798 1.00 46.92 ? 7   VAL B CB    1 
ATOM   1731 C CG1   . VAL B 1 7   ? 5.859   -24.524 11.596 1.00 47.36 ? 7   VAL B CG1   1 
ATOM   1732 C CG2   . VAL B 1 7   ? 7.359   -26.172 10.468 1.00 46.62 ? 7   VAL B CG2   1 
ATOM   1733 N N     . VAL B 1 8   ? 3.574   -25.921 12.933 1.00 42.20 ? 8   VAL B N     1 
ATOM   1734 C CA    . VAL B 1 8   ? 2.243   -25.453 13.266 1.00 40.19 ? 8   VAL B CA    1 
ATOM   1735 C C     . VAL B 1 8   ? 2.414   -23.956 13.466 1.00 39.58 ? 8   VAL B C     1 
ATOM   1736 O O     . VAL B 1 8   ? 3.325   -23.527 14.174 1.00 39.70 ? 8   VAL B O     1 
ATOM   1737 C CB    . VAL B 1 8   ? 1.711   -26.072 14.576 1.00 41.48 ? 8   VAL B CB    1 
ATOM   1738 C CG1   . VAL B 1 8   ? 0.359   -25.442 14.938 1.00 41.69 ? 8   VAL B CG1   1 
ATOM   1739 C CG2   . VAL B 1 8   ? 1.554   -27.574 14.420 1.00 42.06 ? 8   VAL B CG2   1 
ATOM   1740 N N     . LEU B 1 9   ? 1.558   -23.160 12.834 1.00 37.67 ? 9   LEU B N     1 
ATOM   1741 C CA    . LEU B 1 9   ? 1.642   -21.710 12.978 1.00 35.97 ? 9   LEU B CA    1 
ATOM   1742 C C     . LEU B 1 9   ? 0.540   -21.187 13.893 1.00 36.63 ? 9   LEU B C     1 
ATOM   1743 O O     . LEU B 1 9   ? -0.643  -21.492 13.706 1.00 37.36 ? 9   LEU B O     1 
ATOM   1744 C CB    . LEU B 1 9   ? 1.528   -21.015 11.620 1.00 34.56 ? 9   LEU B CB    1 
ATOM   1745 C CG    . LEU B 1 9   ? 2.500   -21.432 10.524 1.00 32.81 ? 9   LEU B CG    1 
ATOM   1746 C CD1   . LEU B 1 9   ? 2.059   -20.813 9.226  1.00 30.87 ? 9   LEU B CD1   1 
ATOM   1747 C CD2   . LEU B 1 9   ? 3.920   -21.017 10.902 1.00 33.83 ? 9   LEU B CD2   1 
ATOM   1748 N N     . LEU B 1 10  ? 0.945   -20.392 14.877 1.00 35.40 ? 10  LEU B N     1 
ATOM   1749 C CA    . LEU B 1 10  ? 0.028   -19.800 15.823 1.00 36.51 ? 10  LEU B CA    1 
ATOM   1750 C C     . LEU B 1 10  ? -0.015  -18.270 15.687 1.00 37.53 ? 10  LEU B C     1 
ATOM   1751 O O     . LEU B 1 10  ? 1.019   -17.600 15.758 1.00 39.24 ? 10  LEU B O     1 
ATOM   1752 C CB    . LEU B 1 10  ? 0.463   -20.142 17.243 1.00 36.89 ? 10  LEU B CB    1 
ATOM   1753 C CG    . LEU B 1 10  ? -0.373  -19.488 18.340 1.00 36.65 ? 10  LEU B CG    1 
ATOM   1754 C CD1   . LEU B 1 10  ? -1.765  -20.077 18.301 1.00 35.31 ? 10  LEU B CD1   1 
ATOM   1755 C CD2   . LEU B 1 10  ? 0.271   -19.726 19.694 1.00 37.38 ? 10  LEU B CD2   1 
ATOM   1756 N N     . ALA B 1 11  ? -1.205  -17.718 15.495 1.00 36.68 ? 11  ALA B N     1 
ATOM   1757 C CA    . ALA B 1 11  ? -1.339  -16.277 15.401 1.00 35.35 ? 11  ALA B CA    1 
ATOM   1758 C C     . ALA B 1 11  ? -2.197  -15.811 16.560 1.00 35.95 ? 11  ALA B C     1 
ATOM   1759 O O     . ALA B 1 11  ? -3.303  -16.299 16.764 1.00 34.56 ? 11  ALA B O     1 
ATOM   1760 C CB    . ALA B 1 11  ? -1.979  -15.880 14.093 1.00 33.72 ? 11  ALA B CB    1 
ATOM   1761 N N     . CYS B 1 12  ? -1.659  -14.887 17.336 1.00 36.61 ? 12  CYS B N     1 
ATOM   1762 C CA    . CYS B 1 12  ? -2.372  -14.310 18.451 1.00 38.73 ? 12  CYS B CA    1 
ATOM   1763 C C     . CYS B 1 12  ? -2.686  -12.894 18.008 1.00 39.91 ? 12  CYS B C     1 
ATOM   1764 O O     . CYS B 1 12  ? -1.967  -12.330 17.184 1.00 41.18 ? 12  CYS B O     1 
ATOM   1765 C CB    . CYS B 1 12  ? -1.484  -14.288 19.702 1.00 40.38 ? 12  CYS B CB    1 
ATOM   1766 S SG    . CYS B 1 12  ? -1.198  -15.930 20.434 1.00 42.45 ? 12  CYS B SG    1 
ATOM   1767 N N     . GLY B 1 13  ? -3.748  -12.321 18.557 1.00 39.32 ? 13  GLY B N     1 
ATOM   1768 C CA    . GLY B 1 13  ? -4.150  -10.977 18.197 1.00 38.09 ? 13  GLY B CA    1 
ATOM   1769 C C     . GLY B 1 13  ? -5.614  -10.817 18.564 1.00 37.31 ? 13  GLY B C     1 
ATOM   1770 O O     . GLY B 1 13  ? -6.262  -11.776 18.989 1.00 36.68 ? 13  GLY B O     1 
ATOM   1771 N N     . SER B 1 14  ? -6.158  -9.620  18.418 1.00 36.68 ? 14  SER B N     1 
ATOM   1772 C CA    . SER B 1 14  ? -7.552  -9.455  18.785 1.00 37.09 ? 14  SER B CA    1 
ATOM   1773 C C     . SER B 1 14  ? -8.555  -9.977  17.759 1.00 35.78 ? 14  SER B C     1 
ATOM   1774 O O     . SER B 1 14  ? -9.645  -10.397 18.151 1.00 36.61 ? 14  SER B O     1 
ATOM   1775 C CB    . SER B 1 14  ? -7.854  -7.997  19.162 1.00 37.62 ? 14  SER B CB    1 
ATOM   1776 O OG    . SER B 1 14  ? -7.100  -7.080  18.401 1.00 38.22 ? 14  SER B OG    1 
ATOM   1777 N N     . PHE B 1 15  ? -8.176  -10.011 16.476 1.00 34.06 ? 15  PHE B N     1 
ATOM   1778 C CA    . PHE B 1 15  ? -9.071  -10.476 15.396 1.00 33.10 ? 15  PHE B CA    1 
ATOM   1779 C C     . PHE B 1 15  ? -10.443 -9.861  15.646 1.00 33.25 ? 15  PHE B C     1 
ATOM   1780 O O     . PHE B 1 15  ? -11.457 -10.559 15.795 1.00 32.72 ? 15  PHE B O     1 
ATOM   1781 C CB    . PHE B 1 15  ? -9.137  -12.000 15.417 1.00 32.94 ? 15  PHE B CB    1 
ATOM   1782 C CG    . PHE B 1 15  ? -7.801  -12.645 15.205 1.00 35.37 ? 15  PHE B CG    1 
ATOM   1783 C CD1   . PHE B 1 15  ? -7.167  -12.561 13.965 1.00 36.02 ? 15  PHE B CD1   1 
ATOM   1784 C CD2   . PHE B 1 15  ? -7.123  -13.244 16.264 1.00 35.79 ? 15  PHE B CD2   1 
ATOM   1785 C CE1   . PHE B 1 15  ? -5.872  -13.054 13.783 1.00 35.97 ? 15  PHE B CE1   1 
ATOM   1786 C CE2   . PHE B 1 15  ? -5.827  -13.740 16.097 1.00 36.09 ? 15  PHE B CE2   1 
ATOM   1787 C CZ    . PHE B 1 15  ? -5.196  -13.642 14.849 1.00 36.85 ? 15  PHE B CZ    1 
ATOM   1788 N N     . ASN B 1 16  ? -10.444 -8.529  15.653 1.00 32.50 ? 16  ASN B N     1 
ATOM   1789 C CA    . ASN B 1 16  ? -11.608 -7.727  15.998 1.00 31.63 ? 16  ASN B CA    1 
ATOM   1790 C C     . ASN B 1 16  ? -12.147 -6.754  14.944 1.00 31.74 ? 16  ASN B C     1 
ATOM   1791 O O     . ASN B 1 16  ? -12.167 -5.541  15.173 1.00 30.49 ? 16  ASN B O     1 
ATOM   1792 C CB    . ASN B 1 16  ? -11.235 -6.967  17.269 1.00 31.07 ? 16  ASN B CB    1 
ATOM   1793 C CG    . ASN B 1 16  ? -12.377 -6.185  17.834 1.00 31.31 ? 16  ASN B CG    1 
ATOM   1794 O OD1   . ASN B 1 16  ? -13.515 -6.647  17.838 1.00 36.48 ? 16  ASN B OD1   1 
ATOM   1795 N ND2   . ASN B 1 16  ? -12.089 -4.998  18.325 1.00 31.17 ? 16  ASN B ND2   1 
ATOM   1796 N N     . PRO B 1 17  ? -12.682 -7.268  13.822 1.00 29.86 ? 17  PRO B N     1 
ATOM   1797 C CA    . PRO B 1 17  ? -12.850 -8.665  13.423 1.00 29.57 ? 17  PRO B CA    1 
ATOM   1798 C C     . PRO B 1 17  ? -11.705 -9.198  12.580 1.00 29.62 ? 17  PRO B C     1 
ATOM   1799 O O     . PRO B 1 17  ? -10.808 -8.450  12.177 1.00 29.66 ? 17  PRO B O     1 
ATOM   1800 C CB    . PRO B 1 17  ? -14.127 -8.611  12.609 1.00 29.56 ? 17  PRO B CB    1 
ATOM   1801 C CG    . PRO B 1 17  ? -13.874 -7.364  11.779 1.00 29.84 ? 17  PRO B CG    1 
ATOM   1802 C CD    . PRO B 1 17  ? -13.296 -6.380  12.814 1.00 30.62 ? 17  PRO B CD    1 
ATOM   1803 N N     . ILE B 1 18  ? -11.747 -10.496 12.307 1.00 28.97 ? 18  ILE B N     1 
ATOM   1804 C CA    . ILE B 1 18  ? -10.740 -11.121 11.472 1.00 29.22 ? 18  ILE B CA    1 
ATOM   1805 C C     . ILE B 1 18  ? -10.944 -10.516 10.079 1.00 29.53 ? 18  ILE B C     1 
ATOM   1806 O O     . ILE B 1 18  ? -12.074 -10.228 9.686  1.00 27.89 ? 18  ILE B O     1 
ATOM   1807 C CB    . ILE B 1 18  ? -10.929 -12.653 11.420 1.00 29.95 ? 18  ILE B CB    1 
ATOM   1808 C CG1   . ILE B 1 18  ? -9.865  -13.283 10.527 1.00 31.99 ? 18  ILE B CG1   1 
ATOM   1809 C CG2   . ILE B 1 18  ? -12.334 -12.989 10.921 1.00 30.05 ? 18  ILE B CG2   1 
ATOM   1810 C CD1   . ILE B 1 18  ? -9.534  -14.717 10.888 1.00 33.43 ? 18  ILE B CD1   1 
ATOM   1811 N N     . THR B 1 19  ? -9.855  -10.313 9.343  1.00 30.02 ? 19  THR B N     1 
ATOM   1812 C CA    . THR B 1 19  ? -9.946  -9.729  8.001  1.00 28.63 ? 19  THR B CA    1 
ATOM   1813 C C     . THR B 1 19  ? -9.205  -10.562 6.959  1.00 28.21 ? 19  THR B C     1 
ATOM   1814 O O     . THR B 1 19  ? -8.512  -11.507 7.296  1.00 28.78 ? 19  THR B O     1 
ATOM   1815 C CB    . THR B 1 19  ? -9.317  -8.363  7.980  1.00 30.27 ? 19  THR B CB    1 
ATOM   1816 O OG1   . THR B 1 19  ? -7.891  -8.520  8.001  1.00 29.56 ? 19  THR B OG1   1 
ATOM   1817 C CG2   . THR B 1 19  ? -9.763  -7.542  9.197  1.00 28.33 ? 19  THR B CG2   1 
ATOM   1818 N N     . ASN B 1 20  ? -9.339  -10.187 5.693  1.00 28.12 ? 20  ASN B N     1 
ATOM   1819 C CA    . ASN B 1 20  ? -8.662  -10.882 4.610  1.00 28.09 ? 20  ASN B CA    1 
ATOM   1820 C C     . ASN B 1 20  ? -7.141  -10.785 4.735  1.00 27.84 ? 20  ASN B C     1 
ATOM   1821 O O     . ASN B 1 20  ? -6.423  -11.657 4.263  1.00 25.77 ? 20  ASN B O     1 
ATOM   1822 C CB    . ASN B 1 20  ? -9.104  -10.312 3.255  1.00 28.53 ? 20  ASN B CB    1 
ATOM   1823 C CG    . ASN B 1 20  ? -10.512 -10.751 2.867  1.00 30.36 ? 20  ASN B CG    1 
ATOM   1824 O OD1   . ASN B 1 20  ? -11.136 -11.551 3.564  1.00 30.47 ? 20  ASN B OD1   1 
ATOM   1825 N ND2   . ASN B 1 20  ? -11.017 -10.231 1.753  1.00 30.74 ? 20  ASN B ND2   1 
ATOM   1826 N N     . MET B 1 21  ? -6.630  -9.731  5.360  1.00 28.88 ? 21  MET B N     1 
ATOM   1827 C CA    . MET B 1 21  ? -5.183  -9.626  5.509  1.00 31.01 ? 21  MET B CA    1 
ATOM   1828 C C     . MET B 1 21  ? -4.686  -10.586 6.583  1.00 30.10 ? 21  MET B C     1 
ATOM   1829 O O     . MET B 1 21  ? -3.594  -11.142 6.472  1.00 26.45 ? 21  MET B O     1 
ATOM   1830 C CB    . MET B 1 21  ? -4.780  -8.194  5.851  1.00 36.35 ? 21  MET B CB    1 
ATOM   1831 C CG    . MET B 1 21  ? -5.309  -7.196  4.817  1.00 46.19 ? 21  MET B CG    1 
ATOM   1832 S SD    . MET B 1 21  ? -4.597  -7.211  3.089  1.00 57.62 ? 21  MET B SD    1 
ATOM   1833 C CE    . MET B 1 21  ? -4.652  -8.996  2.491  1.00 50.76 ? 21  MET B CE    1 
ATOM   1834 N N     . HIS B 1 22  ? -5.493  -10.768 7.627  1.00 30.95 ? 22  HIS B N     1 
ATOM   1835 C CA    . HIS B 1 22  ? -5.152  -11.694 8.706  1.00 32.35 ? 22  HIS B CA    1 
ATOM   1836 C C     . HIS B 1 22  ? -4.996  -13.071 8.073  1.00 31.52 ? 22  HIS B C     1 
ATOM   1837 O O     . HIS B 1 22  ? -4.013  -13.782 8.308  1.00 31.74 ? 22  HIS B O     1 
ATOM   1838 C CB    . HIS B 1 22  ? -6.274  -11.757 9.747  1.00 31.21 ? 22  HIS B CB    1 
ATOM   1839 C CG    . HIS B 1 22  ? -6.347  -10.555 10.633 1.00 34.10 ? 22  HIS B CG    1 
ATOM   1840 N ND1   . HIS B 1 22  ? -7.541  -10.044 11.101 1.00 35.02 ? 22  HIS B ND1   1 
ATOM   1841 C CD2   . HIS B 1 22  ? -5.373  -9.780  11.164 1.00 33.28 ? 22  HIS B CD2   1 
ATOM   1842 C CE1   . HIS B 1 22  ? -7.297  -9.006  11.882 1.00 35.55 ? 22  HIS B CE1   1 
ATOM   1843 N NE2   . HIS B 1 22  ? -5.988  -8.825  11.937 1.00 36.12 ? 22  HIS B NE2   1 
ATOM   1844 N N     . LEU B 1 23  ? -5.984  -13.435 7.269  1.00 30.80 ? 23  LEU B N     1 
ATOM   1845 C CA    . LEU B 1 23  ? -6.005  -14.724 6.601  1.00 31.60 ? 23  LEU B CA    1 
ATOM   1846 C C     . LEU B 1 23  ? -4.847  -14.860 5.611  1.00 30.99 ? 23  LEU B C     1 
ATOM   1847 O O     . LEU B 1 23  ? -4.149  -15.874 5.592  1.00 32.01 ? 23  LEU B O     1 
ATOM   1848 C CB    . LEU B 1 23  ? -7.363  -14.893 5.902  1.00 32.44 ? 23  LEU B CB    1 
ATOM   1849 C CG    . LEU B 1 23  ? -8.536  -14.793 6.907  1.00 33.53 ? 23  LEU B CG    1 
ATOM   1850 C CD1   . LEU B 1 23  ? -9.873  -14.618 6.169  1.00 32.65 ? 23  LEU B CD1   1 
ATOM   1851 C CD2   . LEU B 1 23  ? -8.561  -16.045 7.803  1.00 31.86 ? 23  LEU B CD2   1 
ATOM   1852 N N     . ARG B 1 24  ? -4.641  -13.833 4.795  1.00 29.88 ? 24  ARG B N     1 
ATOM   1853 C CA    . ARG B 1 24  ? -3.563  -13.816 3.811  1.00 28.17 ? 24  ARG B CA    1 
ATOM   1854 C C     . ARG B 1 24  ? -2.229  -14.100 4.515  1.00 29.42 ? 24  ARG B C     1 
ATOM   1855 O O     . ARG B 1 24  ? -1.351  -14.779 3.982  1.00 27.36 ? 24  ARG B O     1 
ATOM   1856 C CB    . ARG B 1 24  ? -3.490  -12.433 3.147  1.00 29.77 ? 24  ARG B CB    1 
ATOM   1857 C CG    . ARG B 1 24  ? -2.436  -12.307 2.094  1.00 28.82 ? 24  ARG B CG    1 
ATOM   1858 C CD    . ARG B 1 24  ? -2.767  -13.276 0.996  1.00 34.75 ? 24  ARG B CD    1 
ATOM   1859 N NE    . ARG B 1 24  ? -1.670  -13.507 0.067  1.00 35.80 ? 24  ARG B NE    1 
ATOM   1860 C CZ    . ARG B 1 24  ? -1.592  -14.589 -0.705 1.00 38.66 ? 24  ARG B CZ    1 
ATOM   1861 N NH1   . ARG B 1 24  ? -2.554  -15.533 -0.653 1.00 35.81 ? 24  ARG B NH1   1 
ATOM   1862 N NH2   . ARG B 1 24  ? -0.548  -14.740 -1.508 1.00 35.74 ? 24  ARG B NH2   1 
ATOM   1863 N N     . MET B 1 25  ? -2.084  -13.554 5.716  1.00 28.37 ? 25  MET B N     1 
ATOM   1864 C CA    . MET B 1 25  ? -0.870  -13.738 6.478  1.00 30.89 ? 25  MET B CA    1 
ATOM   1865 C C     . MET B 1 25  ? -0.507  -15.235 6.589  1.00 31.42 ? 25  MET B C     1 
ATOM   1866 O O     . MET B 1 25  ? 0.643   -15.615 6.357  1.00 31.36 ? 25  MET B O     1 
ATOM   1867 C CB    . MET B 1 25  ? -1.034  -13.086 7.859  1.00 30.73 ? 25  MET B CB    1 
ATOM   1868 C CG    . MET B 1 25  ? 0.183   -13.206 8.734  1.00 34.59 ? 25  MET B CG    1 
ATOM   1869 S SD    . MET B 1 25  ? -0.009  -12.369 10.312 1.00 39.95 ? 25  MET B SD    1 
ATOM   1870 C CE    . MET B 1 25  ? -1.484  -13.239 10.991 1.00 36.11 ? 25  MET B CE    1 
ATOM   1871 N N     . PHE B 1 26  ? -1.479  -16.083 6.921  1.00 30.71 ? 26  PHE B N     1 
ATOM   1872 C CA    . PHE B 1 26  ? -1.203  -17.519 7.032  1.00 30.18 ? 26  PHE B CA    1 
ATOM   1873 C C     . PHE B 1 26  ? -0.721  -18.127 5.729  1.00 29.93 ? 26  PHE B C     1 
ATOM   1874 O O     . PHE B 1 26  ? 0.250   -18.878 5.706  1.00 30.75 ? 26  PHE B O     1 
ATOM   1875 C CB    . PHE B 1 26  ? -2.443  -18.290 7.486  1.00 29.01 ? 26  PHE B CB    1 
ATOM   1876 C CG    . PHE B 1 26  ? -2.677  -18.238 8.960  1.00 29.07 ? 26  PHE B CG    1 
ATOM   1877 C CD1   . PHE B 1 26  ? -3.408  -17.201 9.526  1.00 28.52 ? 26  PHE B CD1   1 
ATOM   1878 C CD2   . PHE B 1 26  ? -2.152  -19.228 9.787  1.00 28.12 ? 26  PHE B CD2   1 
ATOM   1879 C CE1   . PHE B 1 26  ? -3.620  -17.146 10.902 1.00 27.76 ? 26  PHE B CE1   1 
ATOM   1880 C CE2   . PHE B 1 26  ? -2.351  -19.185 11.167 1.00 29.75 ? 26  PHE B CE2   1 
ATOM   1881 C CZ    . PHE B 1 26  ? -3.094  -18.136 11.730 1.00 28.74 ? 26  PHE B CZ    1 
ATOM   1882 N N     . GLU B 1 27  ? -1.405  -17.802 4.640  1.00 29.99 ? 27  GLU B N     1 
ATOM   1883 C CA    . GLU B 1 27  ? -1.055  -18.336 3.331  1.00 30.27 ? 27  GLU B CA    1 
ATOM   1884 C C     . GLU B 1 27  ? 0.349   -17.946 2.914  1.00 30.87 ? 27  GLU B C     1 
ATOM   1885 O O     . GLU B 1 27  ? 1.096   -18.769 2.350  1.00 30.39 ? 27  GLU B O     1 
ATOM   1886 C CB    . GLU B 1 27  ? -2.045  -17.840 2.271  1.00 30.20 ? 27  GLU B CB    1 
ATOM   1887 C CG    . GLU B 1 27  ? -3.483  -18.297 2.463  1.00 29.43 ? 27  GLU B CG    1 
ATOM   1888 C CD    . GLU B 1 27  ? -3.672  -19.776 2.193  1.00 34.13 ? 27  GLU B CD    1 
ATOM   1889 O OE1   . GLU B 1 27  ? -3.233  -20.275 1.137  1.00 35.28 ? 27  GLU B OE1   1 
ATOM   1890 O OE2   . GLU B 1 27  ? -4.283  -20.451 3.036  1.00 37.66 ? 27  GLU B OE2   1 
ATOM   1891 N N     . VAL B 1 28  ? 0.700   -16.686 3.154  1.00 29.51 ? 28  VAL B N     1 
ATOM   1892 C CA    . VAL B 1 28  ? 2.027   -16.205 2.782  1.00 30.70 ? 28  VAL B CA    1 
ATOM   1893 C C     . VAL B 1 28  ? 3.108   -16.912 3.616  1.00 30.29 ? 28  VAL B C     1 
ATOM   1894 O O     . VAL B 1 28  ? 4.111   -17.376 3.080  1.00 29.34 ? 28  VAL B O     1 
ATOM   1895 C CB    . VAL B 1 28  ? 2.145   -14.669 2.973  1.00 30.40 ? 28  VAL B CB    1 
ATOM   1896 C CG1   . VAL B 1 28  ? 3.594   -14.223 2.755  1.00 30.63 ? 28  VAL B CG1   1 
ATOM   1897 C CG2   . VAL B 1 28  ? 1.214   -13.948 1.979  1.00 30.62 ? 28  VAL B CG2   1 
ATOM   1898 N N     . ALA B 1 29  ? 2.889   -16.987 4.921  1.00 30.69 ? 29  ALA B N     1 
ATOM   1899 C CA    . ALA B 1 29  ? 3.838   -17.639 5.807  1.00 34.13 ? 29  ALA B CA    1 
ATOM   1900 C C     . ALA B 1 29  ? 4.023   -19.103 5.408  1.00 35.62 ? 29  ALA B C     1 
ATOM   1901 O O     . ALA B 1 29  ? 5.150   -19.591 5.387  1.00 36.65 ? 29  ALA B O     1 
ATOM   1902 C CB    . ALA B 1 29  ? 3.372   -17.529 7.251  1.00 33.60 ? 29  ALA B CB    1 
ATOM   1903 N N     . ARG B 1 30  ? 2.934   -19.797 5.067  1.00 36.65 ? 30  ARG B N     1 
ATOM   1904 C CA    . ARG B 1 30  ? 3.044   -21.200 4.666  1.00 37.76 ? 30  ARG B CA    1 
ATOM   1905 C C     . ARG B 1 30  ? 3.856   -21.354 3.384  1.00 38.32 ? 30  ARG B C     1 
ATOM   1906 O O     . ARG B 1 30  ? 4.804   -22.157 3.334  1.00 36.80 ? 30  ARG B O     1 
ATOM   1907 C CB    . ARG B 1 30  ? 1.669   -21.855 4.466  1.00 38.66 ? 30  ARG B CB    1 
ATOM   1908 C CG    . ARG B 1 30  ? 1.789   -23.324 4.016  1.00 41.08 ? 30  ARG B CG    1 
ATOM   1909 C CD    . ARG B 1 30  ? 0.449   -24.077 3.996  1.00 42.17 ? 30  ARG B CD    1 
ATOM   1910 N NE    . ARG B 1 30  ? -0.419  -23.638 2.906  1.00 42.50 ? 30  ARG B NE    1 
ATOM   1911 C CZ    . ARG B 1 30  ? -1.591  -24.192 2.617  1.00 44.63 ? 30  ARG B CZ    1 
ATOM   1912 N NH1   . ARG B 1 30  ? -2.035  -25.212 3.339  1.00 45.87 ? 30  ARG B NH1   1 
ATOM   1913 N NH2   . ARG B 1 30  ? -2.324  -23.728 1.605  1.00 43.48 ? 30  ARG B NH2   1 
ATOM   1914 N N     . ASP B 1 31  ? 3.492   -20.600 2.347  1.00 36.76 ? 31  ASP B N     1 
ATOM   1915 C CA    . ASP B 1 31  ? 4.239   -20.674 1.093  1.00 37.87 ? 31  ASP B CA    1 
ATOM   1916 C C     . ASP B 1 31  ? 5.724   -20.392 1.327  1.00 37.05 ? 31  ASP B C     1 
ATOM   1917 O O     . ASP B 1 31  ? 6.584   -20.981 0.678  1.00 36.74 ? 31  ASP B O     1 
ATOM   1918 C CB    . ASP B 1 31  ? 3.712   -19.670 0.057  1.00 38.30 ? 31  ASP B CB    1 
ATOM   1919 C CG    . ASP B 1 31  ? 2.449   -20.152 -0.647 1.00 41.56 ? 31  ASP B CG    1 
ATOM   1920 O OD1   . ASP B 1 31  ? 2.001   -21.296 -0.391 1.00 42.48 ? 31  ASP B OD1   1 
ATOM   1921 O OD2   . ASP B 1 31  ? 1.902   -19.378 -1.465 1.00 41.09 ? 31  ASP B OD2   1 
ATOM   1922 N N     . HIS B 1 32  ? 6.025   -19.476 2.234  1.00 36.07 ? 32  HIS B N     1 
ATOM   1923 C CA    . HIS B 1 32  ? 7.419   -19.156 2.507  1.00 37.66 ? 32  HIS B CA    1 
ATOM   1924 C C     . HIS B 1 32  ? 8.125   -20.341 3.168  1.00 37.71 ? 32  HIS B C     1 
ATOM   1925 O O     . HIS B 1 32  ? 9.186   -20.753 2.708  1.00 36.05 ? 32  HIS B O     1 
ATOM   1926 C CB    . HIS B 1 32  ? 7.531   -17.914 3.403  1.00 38.02 ? 32  HIS B CB    1 
ATOM   1927 C CG    . HIS B 1 32  ? 8.937   -17.580 3.802  1.00 38.07 ? 32  HIS B CG    1 
ATOM   1928 N ND1   . HIS B 1 32  ? 9.887   -17.154 2.897  1.00 40.17 ? 32  HIS B ND1   1 
ATOM   1929 C CD2   . HIS B 1 32  ? 9.564   -17.646 5.000  1.00 37.52 ? 32  HIS B CD2   1 
ATOM   1930 C CE1   . HIS B 1 32  ? 11.039  -16.975 3.520  1.00 39.19 ? 32  HIS B CE1   1 
ATOM   1931 N NE2   . HIS B 1 32  ? 10.869  -17.266 4.797  1.00 40.81 ? 32  HIS B NE2   1 
ATOM   1932 N N     . LEU B 1 33  ? 7.543   -20.894 4.236  1.00 38.29 ? 33  LEU B N     1 
ATOM   1933 C CA    . LEU B 1 33  ? 8.170   -22.028 4.919  1.00 38.97 ? 33  LEU B CA    1 
ATOM   1934 C C     . LEU B 1 33  ? 8.372   -23.201 3.971  1.00 41.51 ? 33  LEU B C     1 
ATOM   1935 O O     . LEU B 1 33  ? 9.411   -23.867 3.999  1.00 41.58 ? 33  LEU B O     1 
ATOM   1936 C CB    . LEU B 1 33  ? 7.346   -22.480 6.124  1.00 36.36 ? 33  LEU B CB    1 
ATOM   1937 C CG    . LEU B 1 33  ? 7.338   -21.550 7.337  1.00 37.99 ? 33  LEU B CG    1 
ATOM   1938 C CD1   . LEU B 1 33  ? 6.572   -22.190 8.501  1.00 37.61 ? 33  LEU B CD1   1 
ATOM   1939 C CD2   . LEU B 1 33  ? 8.773   -21.258 7.750  1.00 38.10 ? 33  LEU B CD2   1 
ATOM   1940 N N     . HIS B 1 34  ? 7.392   -23.455 3.118  1.00 43.33 ? 34  HIS B N     1 
ATOM   1941 C CA    . HIS B 1 34  ? 7.532   -24.557 2.186  1.00 45.84 ? 34  HIS B CA    1 
ATOM   1942 C C     . HIS B 1 34  ? 8.657   -24.326 1.188  1.00 48.13 ? 34  HIS B C     1 
ATOM   1943 O O     . HIS B 1 34  ? 9.398   -25.260 0.854  1.00 48.72 ? 34  HIS B O     1 
ATOM   1944 C CB    . HIS B 1 34  ? 6.219   -24.801 1.443  1.00 45.92 ? 34  HIS B CB    1 
ATOM   1945 C CG    . HIS B 1 34  ? 5.173   -25.455 2.287  1.00 46.16 ? 34  HIS B CG    1 
ATOM   1946 N ND1   . HIS B 1 34  ? 3.962   -25.872 1.781  1.00 47.24 ? 34  HIS B ND1   1 
ATOM   1947 C CD2   . HIS B 1 34  ? 5.163   -25.772 3.604  1.00 45.84 ? 34  HIS B CD2   1 
ATOM   1948 C CE1   . HIS B 1 34  ? 3.251   -26.421 2.752  1.00 48.61 ? 34  HIS B CE1   1 
ATOM   1949 N NE2   . HIS B 1 34  ? 3.957   -26.373 3.867  1.00 46.56 ? 34  HIS B NE2   1 
ATOM   1950 N N     . GLN B 1 35  ? 8.799   -23.089 0.719  1.00 49.50 ? 35  GLN B N     1 
ATOM   1951 C CA    . GLN B 1 35  ? 9.830   -22.794 -0.262 1.00 52.30 ? 35  GLN B CA    1 
ATOM   1952 C C     . GLN B 1 35  ? 11.243  -22.958 0.301  1.00 52.91 ? 35  GLN B C     1 
ATOM   1953 O O     . GLN B 1 35  ? 12.196  -23.126 -0.466 1.00 53.75 ? 35  GLN B O     1 
ATOM   1954 C CB    . GLN B 1 35  ? 9.618   -21.393 -0.867 1.00 54.27 ? 35  GLN B CB    1 
ATOM   1955 C CG    . GLN B 1 35  ? 9.741   -20.231 0.101  1.00 59.42 ? 35  GLN B CG    1 
ATOM   1956 C CD    . GLN B 1 35  ? 11.185  -19.783 0.311  1.00 62.23 ? 35  GLN B CD    1 
ATOM   1957 O OE1   . GLN B 1 35  ? 11.497  -19.074 1.274  1.00 62.58 ? 35  GLN B OE1   1 
ATOM   1958 N NE2   . GLN B 1 35  ? 12.071  -20.183 -0.604 1.00 63.40 ? 35  GLN B NE2   1 
ATOM   1959 N N     . THR B 1 36  ? 11.391  -22.928 1.627  1.00 52.44 ? 36  THR B N     1 
ATOM   1960 C CA    . THR B 1 36  ? 12.721  -23.115 2.212  1.00 52.49 ? 36  THR B CA    1 
ATOM   1961 C C     . THR B 1 36  ? 13.085  -24.569 1.965  1.00 53.76 ? 36  THR B C     1 
ATOM   1962 O O     . THR B 1 36  ? 14.250  -24.907 1.768  1.00 52.91 ? 36  THR B O     1 
ATOM   1963 C CB    . THR B 1 36  ? 12.760  -22.880 3.738  1.00 51.43 ? 36  THR B CB    1 
ATOM   1964 O OG1   . THR B 1 36  ? 11.940  -23.854 4.398  1.00 49.45 ? 36  THR B OG1   1 
ATOM   1965 C CG2   . THR B 1 36  ? 12.301  -21.471 4.076  1.00 50.37 ? 36  THR B CG2   1 
ATOM   1966 N N     . GLY B 1 37  ? 12.063  -25.420 1.973  1.00 55.05 ? 37  GLY B N     1 
ATOM   1967 C CA    . GLY B 1 37  ? 12.263  -26.838 1.747  1.00 56.05 ? 37  GLY B CA    1 
ATOM   1968 C C     . GLY B 1 37  ? 12.510  -27.607 3.027  1.00 56.83 ? 37  GLY B C     1 
ATOM   1969 O O     . GLY B 1 37  ? 12.416  -28.828 3.045  1.00 57.14 ? 37  GLY B O     1 
ATOM   1970 N N     . MET B 1 38  ? 12.823  -26.892 4.101  1.00 57.75 ? 38  MET B N     1 
ATOM   1971 C CA    . MET B 1 38  ? 13.096  -27.527 5.382  1.00 58.25 ? 38  MET B CA    1 
ATOM   1972 C C     . MET B 1 38  ? 11.825  -27.808 6.186  1.00 57.50 ? 38  MET B C     1 
ATOM   1973 O O     . MET B 1 38  ? 11.859  -28.575 7.147  1.00 57.06 ? 38  MET B O     1 
ATOM   1974 C CB    . MET B 1 38  ? 14.034  -26.645 6.219  1.00 60.82 ? 38  MET B CB    1 
ATOM   1975 C CG    . MET B 1 38  ? 15.171  -26.011 5.430  1.00 64.93 ? 38  MET B CG    1 
ATOM   1976 S SD    . MET B 1 38  ? 16.457  -25.218 6.455  1.00 71.91 ? 38  MET B SD    1 
ATOM   1977 C CE    . MET B 1 38  ? 15.514  -24.012 7.437  1.00 69.52 ? 38  MET B CE    1 
ATOM   1978 N N     . TYR B 1 39  ? 10.701  -27.211 5.794  1.00 56.72 ? 39  TYR B N     1 
ATOM   1979 C CA    . TYR B 1 39  ? 9.470   -27.411 6.556  1.00 55.61 ? 39  TYR B CA    1 
ATOM   1980 C C     . TYR B 1 39  ? 8.233   -27.818 5.767  1.00 55.01 ? 39  TYR B C     1 
ATOM   1981 O O     . TYR B 1 39  ? 8.187   -27.743 4.537  1.00 54.68 ? 39  TYR B O     1 
ATOM   1982 C CB    . TYR B 1 39  ? 9.127   -26.142 7.360  1.00 54.15 ? 39  TYR B CB    1 
ATOM   1983 C CG    . TYR B 1 39  ? 10.275  -25.564 8.165  1.00 53.24 ? 39  TYR B CG    1 
ATOM   1984 C CD1   . TYR B 1 39  ? 11.205  -24.715 7.574  1.00 52.29 ? 39  TYR B CD1   1 
ATOM   1985 C CD2   . TYR B 1 39  ? 10.435  -25.877 9.519  1.00 52.58 ? 39  TYR B CD2   1 
ATOM   1986 C CE1   . TYR B 1 39  ? 12.272  -24.186 8.308  1.00 53.65 ? 39  TYR B CE1   1 
ATOM   1987 C CE2   . TYR B 1 39  ? 11.498  -25.356 10.265 1.00 53.23 ? 39  TYR B CE2   1 
ATOM   1988 C CZ    . TYR B 1 39  ? 12.416  -24.511 9.653  1.00 53.68 ? 39  TYR B CZ    1 
ATOM   1989 O OH    . TYR B 1 39  ? 13.482  -24.002 10.374 1.00 54.95 ? 39  TYR B OH    1 
ATOM   1990 N N     . GLN B 1 40  ? 7.227   -28.242 6.522  1.00 54.41 ? 40  GLN B N     1 
ATOM   1991 C CA    . GLN B 1 40  ? 5.935   -28.645 5.993  1.00 53.00 ? 40  GLN B CA    1 
ATOM   1992 C C     . GLN B 1 40  ? 4.912   -28.205 7.020  1.00 51.03 ? 40  GLN B C     1 
ATOM   1993 O O     . GLN B 1 40  ? 4.776   -28.819 8.077  1.00 49.33 ? 40  GLN B O     1 
ATOM   1994 C CB    . GLN B 1 40  ? 5.871   -30.155 5.814  1.00 56.16 ? 40  GLN B CB    1 
ATOM   1995 C CG    . GLN B 1 40  ? 4.458   -30.703 5.741  1.00 60.23 ? 40  GLN B CG    1 
ATOM   1996 C CD    . GLN B 1 40  ? 4.433   -32.177 5.380  1.00 64.08 ? 40  GLN B CD    1 
ATOM   1997 O OE1   . GLN B 1 40  ? 4.648   -32.548 4.217  1.00 65.16 ? 40  GLN B OE1   1 
ATOM   1998 N NE2   . GLN B 1 40  ? 4.188   -33.033 6.378  1.00 64.24 ? 40  GLN B NE2   1 
ATOM   1999 N N     . VAL B 1 41  ? 4.220   -27.113 6.712  1.00 49.56 ? 41  VAL B N     1 
ATOM   2000 C CA    . VAL B 1 41  ? 3.198   -26.566 7.599  1.00 47.75 ? 41  VAL B CA    1 
ATOM   2001 C C     . VAL B 1 41  ? 2.016   -27.525 7.607  1.00 47.48 ? 41  VAL B C     1 
ATOM   2002 O O     . VAL B 1 41  ? 1.443   -27.826 6.562  1.00 48.13 ? 41  VAL B O     1 
ATOM   2003 C CB    . VAL B 1 41  ? 2.734   -25.175 7.103  1.00 45.87 ? 41  VAL B CB    1 
ATOM   2004 C CG1   . VAL B 1 41  ? 1.758   -24.559 8.096  1.00 42.13 ? 41  VAL B CG1   1 
ATOM   2005 C CG2   . VAL B 1 41  ? 3.945   -24.274 6.901  1.00 44.55 ? 41  VAL B CG2   1 
ATOM   2006 N N     . ILE B 1 42  ? 1.646   -28.011 8.780  1.00 46.64 ? 42  ILE B N     1 
ATOM   2007 C CA    . ILE B 1 42  ? 0.539   -28.946 8.850  1.00 47.09 ? 42  ILE B CA    1 
ATOM   2008 C C     . ILE B 1 42  ? -0.748  -28.324 9.381  1.00 46.70 ? 42  ILE B C     1 
ATOM   2009 O O     . ILE B 1 42  ? -1.828  -28.902 9.241  1.00 44.31 ? 42  ILE B O     1 
ATOM   2010 C CB    . ILE B 1 42  ? 0.913   -30.169 9.703  1.00 48.18 ? 42  ILE B CB    1 
ATOM   2011 C CG1   . ILE B 1 42  ? 1.446   -29.715 11.064 1.00 48.40 ? 42  ILE B CG1   1 
ATOM   2012 C CG2   . ILE B 1 42  ? 1.939   -31.009 8.955  1.00 46.16 ? 42  ILE B CG2   1 
ATOM   2013 C CD1   . ILE B 1 42  ? 1.816   -30.865 11.991 1.00 50.59 ? 42  ILE B CD1   1 
ATOM   2014 N N     . GLN B 1 43  ? -0.639  -27.144 9.983  1.00 46.00 ? 43  GLN B N     1 
ATOM   2015 C CA    . GLN B 1 43  ? -1.824  -26.475 10.494 1.00 44.80 ? 43  GLN B CA    1 
ATOM   2016 C C     . GLN B 1 43  ? -1.592  -25.059 11.008 1.00 43.18 ? 43  GLN B C     1 
ATOM   2017 O O     . GLN B 1 43  ? -0.495  -24.702 11.441 1.00 42.00 ? 43  GLN B O     1 
ATOM   2018 C CB    . GLN B 1 43  ? -2.474  -27.316 11.596 1.00 46.08 ? 43  GLN B CB    1 
ATOM   2019 C CG    . GLN B 1 43  ? -3.557  -26.562 12.344 1.00 50.52 ? 43  GLN B CG    1 
ATOM   2020 C CD    . GLN B 1 43  ? -4.581  -27.459 13.003 1.00 54.32 ? 43  GLN B CD    1 
ATOM   2021 O OE1   . GLN B 1 43  ? -5.432  -28.058 12.331 1.00 56.30 ? 43  GLN B OE1   1 
ATOM   2022 N NE2   . GLN B 1 43  ? -4.510  -27.557 14.330 1.00 54.71 ? 43  GLN B NE2   1 
ATOM   2023 N N     . GLY B 1 44  ? -2.651  -24.257 10.951 1.00 41.82 ? 44  GLY B N     1 
ATOM   2024 C CA    . GLY B 1 44  ? -2.586  -22.888 11.424 1.00 40.14 ? 44  GLY B CA    1 
ATOM   2025 C C     . GLY B 1 44  ? -3.616  -22.679 12.510 1.00 37.72 ? 44  GLY B C     1 
ATOM   2026 O O     . GLY B 1 44  ? -4.706  -23.249 12.456 1.00 36.91 ? 44  GLY B O     1 
ATOM   2027 N N     . ILE B 1 45  ? -3.277  -21.864 13.500 1.00 36.10 ? 45  ILE B N     1 
ATOM   2028 C CA    . ILE B 1 45  ? -4.194  -21.606 14.596 1.00 35.96 ? 45  ILE B CA    1 
ATOM   2029 C C     . ILE B 1 45  ? -4.396  -20.125 14.904 1.00 34.27 ? 45  ILE B C     1 
ATOM   2030 O O     . ILE B 1 45  ? -3.453  -19.415 15.255 1.00 33.59 ? 45  ILE B O     1 
ATOM   2031 C CB    . ILE B 1 45  ? -3.719  -22.313 15.902 1.00 36.44 ? 45  ILE B CB    1 
ATOM   2032 C CG1   . ILE B 1 45  ? -3.697  -23.835 15.701 1.00 38.62 ? 45  ILE B CG1   1 
ATOM   2033 C CG2   . ILE B 1 45  ? -4.621  -21.924 17.064 1.00 34.22 ? 45  ILE B CG2   1 
ATOM   2034 C CD1   . ILE B 1 45  ? -3.209  -24.622 16.927 1.00 41.33 ? 45  ILE B CD1   1 
ATOM   2035 N N     . ILE B 1 46  ? -5.634  -19.669 14.767 1.00 33.40 ? 46  ILE B N     1 
ATOM   2036 C CA    . ILE B 1 46  ? -5.982  -18.289 15.081 1.00 31.98 ? 46  ILE B CA    1 
ATOM   2037 C C     . ILE B 1 46  ? -6.397  -18.294 16.556 1.00 31.65 ? 46  ILE B C     1 
ATOM   2038 O O     . ILE B 1 46  ? -7.364  -18.968 16.943 1.00 31.96 ? 46  ILE B O     1 
ATOM   2039 C CB    . ILE B 1 46  ? -7.195  -17.771 14.223 1.00 30.86 ? 46  ILE B CB    1 
ATOM   2040 C CG1   . ILE B 1 46  ? -6.758  -17.474 12.800 1.00 29.84 ? 46  ILE B CG1   1 
ATOM   2041 C CG2   . ILE B 1 46  ? -7.802  -16.506 14.844 1.00 26.93 ? 46  ILE B CG2   1 
ATOM   2042 C CD1   . ILE B 1 46  ? -6.442  -18.679 12.027 1.00 37.24 ? 46  ILE B CD1   1 
ATOM   2043 N N     . SER B 1 47  ? -5.681  -17.545 17.380 1.00 33.36 ? 47  SER B N     1 
ATOM   2044 C CA    . SER B 1 47  ? -6.017  -17.496 18.798 1.00 34.40 ? 47  SER B CA    1 
ATOM   2045 C C     . SER B 1 47  ? -6.403  -16.104 19.273 1.00 33.94 ? 47  SER B C     1 
ATOM   2046 O O     . SER B 1 47  ? -5.550  -15.308 19.668 1.00 33.72 ? 47  SER B O     1 
ATOM   2047 C CB    . SER B 1 47  ? -4.856  -18.016 19.643 1.00 34.55 ? 47  SER B CB    1 
ATOM   2048 O OG    . SER B 1 47  ? -5.196  -17.991 21.018 1.00 35.58 ? 47  SER B OG    1 
ATOM   2049 N N     . PRO B 1 48  ? -7.708  -15.798 19.248 1.00 35.25 ? 48  PRO B N     1 
ATOM   2050 C CA    . PRO B 1 48  ? -8.226  -14.499 19.678 1.00 35.95 ? 48  PRO B CA    1 
ATOM   2051 C C     . PRO B 1 48  ? -7.857  -14.196 21.119 1.00 37.76 ? 48  PRO B C     1 
ATOM   2052 O O     . PRO B 1 48  ? -7.945  -15.070 21.993 1.00 38.94 ? 48  PRO B O     1 
ATOM   2053 C CB    . PRO B 1 48  ? -9.728  -14.645 19.473 1.00 34.11 ? 48  PRO B CB    1 
ATOM   2054 C CG    . PRO B 1 48  ? -9.801  -15.566 18.271 1.00 33.84 ? 48  PRO B CG    1 
ATOM   2055 C CD    . PRO B 1 48  ? -8.774  -16.607 18.618 1.00 34.64 ? 48  PRO B CD    1 
ATOM   2056 N N     . VAL B 1 49  ? -7.455  -12.952 21.365 1.00 37.68 ? 49  VAL B N     1 
ATOM   2057 C CA    . VAL B 1 49  ? -7.060  -12.537 22.697 1.00 39.59 ? 49  VAL B CA    1 
ATOM   2058 C C     . VAL B 1 49  ? -8.261  -12.541 23.638 1.00 41.80 ? 49  VAL B C     1 
ATOM   2059 O O     . VAL B 1 49  ? -9.407  -12.442 23.197 1.00 40.14 ? 49  VAL B O     1 
ATOM   2060 C CB    . VAL B 1 49  ? -6.407  -11.140 22.664 1.00 39.63 ? 49  VAL B CB    1 
ATOM   2061 C CG1   . VAL B 1 49  ? -7.466  -10.054 22.619 1.00 37.85 ? 49  VAL B CG1   1 
ATOM   2062 C CG2   . VAL B 1 49  ? -5.485  -10.983 23.840 1.00 37.60 ? 49  VAL B CG2   1 
ATOM   2063 N N     . ASN B 1 50  ? -7.977  -12.682 24.931 1.00 44.86 ? 50  ASN B N     1 
ATOM   2064 C CA    . ASN B 1 50  ? -8.985  -12.732 25.992 1.00 47.59 ? 50  ASN B CA    1 
ATOM   2065 C C     . ASN B 1 50  ? -9.641  -11.360 26.163 1.00 49.40 ? 50  ASN B C     1 
ATOM   2066 O O     . ASN B 1 50  ? -9.005  -10.332 25.926 1.00 50.89 ? 50  ASN B O     1 
ATOM   2067 C CB    . ASN B 1 50  ? -8.280  -13.173 27.283 1.00 49.48 ? 50  ASN B CB    1 
ATOM   2068 C CG    . ASN B 1 50  ? -9.211  -13.285 28.464 1.00 49.94 ? 50  ASN B CG    1 
ATOM   2069 O OD1   . ASN B 1 50  ? -9.632  -12.285 29.040 1.00 50.33 ? 50  ASN B OD1   1 
ATOM   2070 N ND2   . ASN B 1 50  ? -9.541  -14.514 28.834 1.00 52.34 ? 50  ASN B ND2   1 
ATOM   2071 N N     . ASP B 1 51  ? -10.906 -11.328 26.572 1.00 50.18 ? 51  ASP B N     1 
ATOM   2072 C CA    . ASP B 1 51  ? -11.592 -10.047 26.748 1.00 50.88 ? 51  ASP B CA    1 
ATOM   2073 C C     . ASP B 1 51  ? -11.004 -9.122  27.806 1.00 50.97 ? 51  ASP B C     1 
ATOM   2074 O O     . ASP B 1 51  ? -11.146 -7.908  27.709 1.00 51.10 ? 51  ASP B O     1 
ATOM   2075 C CB    . ASP B 1 51  ? -13.079 -10.252 27.062 1.00 51.14 ? 51  ASP B CB    1 
ATOM   2076 C CG    . ASP B 1 51  ? -13.912 -10.492 25.818 1.00 53.59 ? 51  ASP B CG    1 
ATOM   2077 O OD1   . ASP B 1 51  ? -13.757 -9.722  24.840 1.00 54.32 ? 51  ASP B OD1   1 
ATOM   2078 O OD2   . ASP B 1 51  ? -14.730 -11.442 25.819 1.00 54.59 ? 51  ASP B OD2   1 
ATOM   2079 N N     . THR B 1 52  ? -10.349 -9.677  28.816 1.00 51.46 ? 52  THR B N     1 
ATOM   2080 C CA    . THR B 1 52  ? -9.785  -8.842  29.874 1.00 52.61 ? 52  THR B CA    1 
ATOM   2081 C C     . THR B 1 52  ? -8.571  -8.052  29.424 1.00 55.60 ? 52  THR B C     1 
ATOM   2082 O O     . THR B 1 52  ? -8.079  -7.207  30.172 1.00 56.00 ? 52  THR B O     1 
ATOM   2083 C CB    . THR B 1 52  ? -9.364  -9.679  31.100 1.00 51.04 ? 52  THR B CB    1 
ATOM   2084 O OG1   . THR B 1 52  ? -8.231  -10.490 30.754 1.00 47.17 ? 52  THR B OG1   1 
ATOM   2085 C CG2   . THR B 1 52  ? -10.511 -10.578 31.550 1.00 48.54 ? 52  THR B CG2   1 
ATOM   2086 N N     . TYR B 1 53  ? -8.080  -8.333  28.217 1.00 58.38 ? 53  TYR B N     1 
ATOM   2087 C CA    . TYR B 1 53  ? -6.912  -7.634  27.685 1.00 61.24 ? 53  TYR B CA    1 
ATOM   2088 C C     . TYR B 1 53  ? -7.214  -6.148  27.679 1.00 64.29 ? 53  TYR B C     1 
ATOM   2089 O O     . TYR B 1 53  ? -7.705  -5.640  26.682 1.00 65.69 ? 53  TYR B O     1 
ATOM   2090 C CB    . TYR B 1 53  ? -6.602  -8.113  26.254 1.00 60.04 ? 53  TYR B CB    1 
ATOM   2091 C CG    . TYR B 1 53  ? -5.318  -7.548  25.675 1.00 57.96 ? 53  TYR B CG    1 
ATOM   2092 C CD1   . TYR B 1 53  ? -4.132  -7.598  26.401 1.00 57.41 ? 53  TYR B CD1   1 
ATOM   2093 C CD2   . TYR B 1 53  ? -5.292  -6.951  24.413 1.00 57.99 ? 53  TYR B CD2   1 
ATOM   2094 C CE1   . TYR B 1 53  ? -2.951  -7.067  25.902 1.00 58.42 ? 53  TYR B CE1   1 
ATOM   2095 C CE2   . TYR B 1 53  ? -4.105  -6.411  23.892 1.00 57.39 ? 53  TYR B CE2   1 
ATOM   2096 C CZ    . TYR B 1 53  ? -2.936  -6.469  24.647 1.00 58.20 ? 53  TYR B CZ    1 
ATOM   2097 O OH    . TYR B 1 53  ? -1.760  -5.908  24.186 1.00 55.33 ? 53  TYR B OH    1 
ATOM   2098 N N     . GLY B 1 54  ? -6.938  -5.466  28.796 1.00 68.42 ? 54  GLY B N     1 
ATOM   2099 C CA    . GLY B 1 54  ? -7.215  -4.033  28.923 1.00 71.85 ? 54  GLY B CA    1 
ATOM   2100 C C     . GLY B 1 54  ? -7.160  -3.375  27.570 1.00 73.70 ? 54  GLY B C     1 
ATOM   2101 O O     . GLY B 1 54  ? -6.076  -3.008  27.107 1.00 74.24 ? 54  GLY B O     1 
ATOM   2102 N N     . LYS B 1 55  ? -8.318  -3.220  26.933 1.00 75.40 ? 55  LYS B N     1 
ATOM   2103 C CA    . LYS B 1 55  ? -8.323  -2.667  25.586 1.00 76.80 ? 55  LYS B CA    1 
ATOM   2104 C C     . LYS B 1 55  ? -9.445  -1.759  25.117 1.00 76.89 ? 55  LYS B C     1 
ATOM   2105 O O     . LYS B 1 55  ? -10.340 -1.361  25.859 1.00 77.97 ? 55  LYS B O     1 
ATOM   2106 C CB    . LYS B 1 55  ? -8.206  -3.807  24.573 1.00 77.38 ? 55  LYS B CB    1 
ATOM   2107 C CG    . LYS B 1 55  ? -6.878  -3.854  23.841 1.00 78.80 ? 55  LYS B CG    1 
ATOM   2108 C CD    . LYS B 1 55  ? -6.859  -2.912  22.643 1.00 78.83 ? 55  LYS B CD    1 
ATOM   2109 C CE    . LYS B 1 55  ? -5.512  -2.952  21.940 1.00 79.06 ? 55  LYS B CE    1 
ATOM   2110 N NZ    . LYS B 1 55  ? -5.667  -2.956  20.458 1.00 79.40 ? 55  LYS B NZ    1 
ATOM   2111 N N     . LYS B 1 56  ? -9.349  -1.465  23.827 1.00 76.49 ? 56  LYS B N     1 
ATOM   2112 C CA    . LYS B 1 56  ? -10.263 -0.599  23.108 1.00 74.88 ? 56  LYS B CA    1 
ATOM   2113 C C     . LYS B 1 56  ? -11.703 -1.125  23.054 1.00 73.86 ? 56  LYS B C     1 
ATOM   2114 O O     . LYS B 1 56  ? -12.285 -1.531  24.060 1.00 74.31 ? 56  LYS B O     1 
ATOM   2115 C CB    . LYS B 1 56  ? -9.706  -0.366  21.681 1.00 74.46 ? 56  LYS B CB    1 
ATOM   2116 C CG    . LYS B 1 56  ? -10.349 -1.241  20.567 1.00 73.29 ? 56  LYS B CG    1 
ATOM   2117 C CD    . LYS B 1 56  ? -9.425  -1.808  19.509 1.00 70.52 ? 56  LYS B CD    1 
ATOM   2118 C CE    . LYS B 1 56  ? -9.437  -3.341  19.574 1.00 70.20 ? 56  LYS B CE    1 
ATOM   2119 N NZ    . LYS B 1 56  ? -8.755  -4.006  18.419 1.00 66.77 ? 56  LYS B NZ    1 
ATOM   2120 N N     . ASP B 1 57  ? -12.248 -1.089  21.846 1.00 71.89 ? 57  ASP B N     1 
ATOM   2121 C CA    . ASP B 1 57  ? -13.583 -1.530  21.500 1.00 68.93 ? 57  ASP B CA    1 
ATOM   2122 C C     . ASP B 1 57  ? -13.504 -2.985  21.044 1.00 65.90 ? 57  ASP B C     1 
ATOM   2123 O O     . ASP B 1 57  ? -13.607 -3.292  19.848 1.00 65.19 ? 57  ASP B O     1 
ATOM   2124 C CB    . ASP B 1 57  ? -14.101 -0.658  20.349 1.00 71.22 ? 57  ASP B CB    1 
ATOM   2125 C CG    . ASP B 1 57  ? -15.508 -0.182  20.567 1.00 73.28 ? 57  ASP B CG    1 
ATOM   2126 O OD1   . ASP B 1 57  ? -16.377 -1.014  20.913 1.00 76.27 ? 57  ASP B OD1   1 
ATOM   2127 O OD2   . ASP B 1 57  ? -15.751 1.029   20.381 1.00 73.84 ? 57  ASP B OD2   1 
ATOM   2128 N N     . LEU B 1 58  ? -13.334 -3.881  22.003 1.00 61.16 ? 58  LEU B N     1 
ATOM   2129 C CA    . LEU B 1 58  ? -13.205 -5.288  21.690 1.00 57.24 ? 58  LEU B CA    1 
ATOM   2130 C C     . LEU B 1 58  ? -14.526 -6.047  21.775 1.00 54.31 ? 58  LEU B C     1 
ATOM   2131 O O     . LEU B 1 58  ? -15.145 -6.114  22.830 1.00 53.91 ? 58  LEU B O     1 
ATOM   2132 C CB    . LEU B 1 58  ? -12.175 -5.892  22.643 1.00 58.56 ? 58  LEU B CB    1 
ATOM   2133 C CG    . LEU B 1 58  ? -11.466 -7.193  22.285 1.00 58.33 ? 58  LEU B CG    1 
ATOM   2134 C CD1   . LEU B 1 58  ? -10.966 -7.163  20.852 1.00 58.53 ? 58  LEU B CD1   1 
ATOM   2135 C CD2   . LEU B 1 58  ? -10.307 -7.378  23.250 1.00 57.75 ? 58  LEU B CD2   1 
ATOM   2136 N N     . ALA B 1 59  ? -14.970 -6.616  20.664 1.00 50.86 ? 59  ALA B N     1 
ATOM   2137 C CA    . ALA B 1 59  ? -16.220 -7.376  20.680 1.00 48.76 ? 59  ALA B CA    1 
ATOM   2138 C C     . ALA B 1 59  ? -16.035 -8.603  21.577 1.00 47.64 ? 59  ALA B C     1 
ATOM   2139 O O     . ALA B 1 59  ? -14.924 -9.125  21.691 1.00 46.39 ? 59  ALA B O     1 
ATOM   2140 C CB    . ALA B 1 59  ? -16.594 -7.814  19.272 1.00 47.17 ? 59  ALA B CB    1 
ATOM   2141 N N     . ALA B 1 60  ? -17.116 -9.058  22.211 1.00 45.25 ? 60  ALA B N     1 
ATOM   2142 C CA    . ALA B 1 60  ? -17.047 -10.227 23.088 1.00 45.23 ? 60  ALA B CA    1 
ATOM   2143 C C     . ALA B 1 60  ? -16.275 -11.353 22.389 1.00 43.30 ? 60  ALA B C     1 
ATOM   2144 O O     . ALA B 1 60  ? -16.491 -11.633 21.201 1.00 44.18 ? 60  ALA B O     1 
ATOM   2145 C CB    . ALA B 1 60  ? -18.463 -10.696 23.468 1.00 43.71 ? 60  ALA B CB    1 
ATOM   2146 N N     . SER B 1 61  ? -15.383 -11.996 23.134 1.00 42.06 ? 61  SER B N     1 
ATOM   2147 C CA    . SER B 1 61  ? -14.544 -13.061 22.593 1.00 41.27 ? 61  SER B CA    1 
ATOM   2148 C C     . SER B 1 61  ? -15.267 -14.152 21.805 1.00 41.39 ? 61  SER B C     1 
ATOM   2149 O O     . SER B 1 61  ? -14.770 -14.575 20.751 1.00 42.00 ? 61  SER B O     1 
ATOM   2150 C CB    . SER B 1 61  ? -13.728 -13.703 23.712 1.00 41.96 ? 61  SER B CB    1 
ATOM   2151 O OG    . SER B 1 61  ? -14.580 -14.389 24.615 1.00 43.96 ? 61  SER B OG    1 
ATOM   2152 N N     . HIS B 1 62  ? -16.426 -14.615 22.288 1.00 39.97 ? 62  HIS B N     1 
ATOM   2153 C CA    . HIS B 1 62  ? -17.133 -15.681 21.570 1.00 38.78 ? 62  HIS B CA    1 
ATOM   2154 C C     . HIS B 1 62  ? -17.568 -15.198 20.181 1.00 37.62 ? 62  HIS B C     1 
ATOM   2155 O O     . HIS B 1 62  ? -17.702 -15.991 19.249 1.00 36.39 ? 62  HIS B O     1 
ATOM   2156 C CB    . HIS B 1 62  ? -18.336 -16.212 22.398 1.00 39.35 ? 62  HIS B CB    1 
ATOM   2157 C CG    . HIS B 1 62  ? -19.524 -15.295 22.424 1.00 39.80 ? 62  HIS B CG    1 
ATOM   2158 N ND1   . HIS B 1 62  ? -20.550 -15.375 21.502 1.00 39.10 ? 62  HIS B ND1   1 
ATOM   2159 C CD2   . HIS B 1 62  ? -19.830 -14.256 23.239 1.00 38.99 ? 62  HIS B CD2   1 
ATOM   2160 C CE1   . HIS B 1 62  ? -21.434 -14.424 21.750 1.00 39.62 ? 62  HIS B CE1   1 
ATOM   2161 N NE2   . HIS B 1 62  ? -21.020 -13.730 22.798 1.00 39.12 ? 62  HIS B NE2   1 
ATOM   2162 N N     . HIS B 1 63  ? -17.781 -13.893 20.050 1.00 37.42 ? 63  HIS B N     1 
ATOM   2163 C CA    . HIS B 1 63  ? -18.146 -13.322 18.753 1.00 38.24 ? 63  HIS B CA    1 
ATOM   2164 C C     . HIS B 1 63  ? -16.917 -13.348 17.823 1.00 36.35 ? 63  HIS B C     1 
ATOM   2165 O O     . HIS B 1 63  ? -17.021 -13.662 16.634 1.00 36.25 ? 63  HIS B O     1 
ATOM   2166 C CB    . HIS B 1 63  ? -18.631 -11.873 18.903 1.00 37.13 ? 63  HIS B CB    1 
ATOM   2167 C CG    . HIS B 1 63  ? -20.068 -11.752 19.305 1.00 39.02 ? 63  HIS B CG    1 
ATOM   2168 N ND1   . HIS B 1 63  ? -21.067 -12.518 18.739 1.00 38.18 ? 63  HIS B ND1   1 
ATOM   2169 C CD2   . HIS B 1 63  ? -20.679 -10.939 20.200 1.00 38.06 ? 63  HIS B CD2   1 
ATOM   2170 C CE1   . HIS B 1 63  ? -22.230 -12.182 19.271 1.00 39.24 ? 63  HIS B CE1   1 
ATOM   2171 N NE2   . HIS B 1 63  ? -22.022 -11.227 20.160 1.00 37.26 ? 63  HIS B NE2   1 
ATOM   2172 N N     . ARG B 1 64  ? -15.758 -13.021 18.378 1.00 36.08 ? 64  ARG B N     1 
ATOM   2173 C CA    . ARG B 1 64  ? -14.518 -13.006 17.596 1.00 36.02 ? 64  ARG B CA    1 
ATOM   2174 C C     . ARG B 1 64  ? -14.082 -14.407 17.211 1.00 36.93 ? 64  ARG B C     1 
ATOM   2175 O O     . ARG B 1 64  ? -13.521 -14.613 16.130 1.00 37.46 ? 64  ARG B O     1 
ATOM   2176 C CB    . ARG B 1 64  ? -13.429 -12.273 18.373 1.00 32.85 ? 64  ARG B CB    1 
ATOM   2177 C CG    . ARG B 1 64  ? -13.756 -10.805 18.465 1.00 31.94 ? 64  ARG B CG    1 
ATOM   2178 C CD    . ARG B 1 64  ? -12.654 -9.978  19.061 1.00 32.77 ? 64  ARG B CD    1 
ATOM   2179 N NE    . ARG B 1 64  ? -12.625 -10.063 20.511 1.00 33.50 ? 64  ARG B NE    1 
ATOM   2180 C CZ    . ARG B 1 64  ? -11.680 -10.684 21.202 1.00 33.56 ? 64  ARG B CZ    1 
ATOM   2181 N NH1   . ARG B 1 64  ? -10.684 -11.282 20.570 1.00 36.47 ? 64  ARG B NH1   1 
ATOM   2182 N NH2   . ARG B 1 64  ? -11.720 -10.688 22.522 1.00 35.15 ? 64  ARG B NH2   1 
ATOM   2183 N N     . VAL B 1 65  ? -14.342 -15.373 18.096 1.00 37.01 ? 65  VAL B N     1 
ATOM   2184 C CA    . VAL B 1 65  ? -14.033 -16.772 17.804 1.00 34.52 ? 65  VAL B CA    1 
ATOM   2185 C C     . VAL B 1 65  ? -14.981 -17.278 16.707 1.00 34.84 ? 65  VAL B C     1 
ATOM   2186 O O     . VAL B 1 65  ? -14.560 -17.981 15.781 1.00 36.72 ? 65  VAL B O     1 
ATOM   2187 C CB    . VAL B 1 65  ? -14.214 -17.652 19.050 1.00 33.99 ? 65  VAL B CB    1 
ATOM   2188 C CG1   . VAL B 1 65  ? -14.169 -19.140 18.664 1.00 32.18 ? 65  VAL B CG1   1 
ATOM   2189 C CG2   . VAL B 1 65  ? -13.142 -17.320 20.046 1.00 34.69 ? 65  VAL B CG2   1 
ATOM   2190 N N     . ALA B 1 66  ? -16.262 -16.924 16.806 1.00 34.85 ? 66  ALA B N     1 
ATOM   2191 C CA    . ALA B 1 66  ? -17.253 -17.354 15.801 1.00 34.13 ? 66  ALA B CA    1 
ATOM   2192 C C     . ALA B 1 66  ? -16.963 -16.805 14.389 1.00 32.43 ? 66  ALA B C     1 
ATOM   2193 O O     . ALA B 1 66  ? -17.115 -17.522 13.389 1.00 32.53 ? 66  ALA B O     1 
ATOM   2194 C CB    . ALA B 1 66  ? -18.677 -16.941 16.253 1.00 34.33 ? 66  ALA B CB    1 
ATOM   2195 N N     . MET B 1 67  ? -16.555 -15.536 14.312 1.00 33.11 ? 67  MET B N     1 
ATOM   2196 C CA    . MET B 1 67  ? -16.241 -14.893 13.023 1.00 31.69 ? 67  MET B CA    1 
ATOM   2197 C C     . MET B 1 67  ? -15.006 -15.542 12.412 1.00 31.26 ? 67  MET B C     1 
ATOM   2198 O O     . MET B 1 67  ? -14.960 -15.817 11.208 1.00 30.84 ? 67  MET B O     1 
ATOM   2199 C CB    . MET B 1 67  ? -16.006 -13.383 13.205 1.00 32.25 ? 67  MET B CB    1 
ATOM   2200 C CG    . MET B 1 67  ? -17.244 -12.586 13.669 1.00 31.34 ? 67  MET B CG    1 
ATOM   2201 S SD    . MET B 1 67  ? -17.050 -10.766 13.725 1.00 31.86 ? 67  MET B SD    1 
ATOM   2202 C CE    . MET B 1 67  ? -16.354 -10.506 15.359 1.00 27.61 ? 67  MET B CE    1 
ATOM   2203 N N     . ALA B 1 68  ? -14.010 -15.804 13.251 1.00 32.74 ? 68  ALA B N     1 
ATOM   2204 C CA    . ALA B 1 68  ? -12.783 -16.442 12.779 1.00 33.25 ? 68  ALA B CA    1 
ATOM   2205 C C     . ALA B 1 68  ? -13.161 -17.811 12.239 1.00 34.15 ? 68  ALA B C     1 
ATOM   2206 O O     . ALA B 1 68  ? -12.680 -18.237 11.181 1.00 35.99 ? 68  ALA B O     1 
ATOM   2207 C CB    . ALA B 1 68  ? -11.781 -16.583 13.926 1.00 31.89 ? 68  ALA B CB    1 
ATOM   2208 N N     . ARG B 1 69  ? -14.050 -18.488 12.962 1.00 35.40 ? 69  ARG B N     1 
ATOM   2209 C CA    . ARG B 1 69  ? -14.503 -19.817 12.571 1.00 36.06 ? 69  ARG B CA    1 
ATOM   2210 C C     . ARG B 1 69  ? -15.244 -19.750 11.230 1.00 35.45 ? 69  ARG B C     1 
ATOM   2211 O O     . ARG B 1 69  ? -15.005 -20.567 10.344 1.00 35.60 ? 69  ARG B O     1 
ATOM   2212 C CB    . ARG B 1 69  ? -15.401 -20.397 13.663 1.00 38.73 ? 69  ARG B CB    1 
ATOM   2213 C CG    . ARG B 1 69  ? -15.620 -21.889 13.527 1.00 45.01 ? 69  ARG B CG    1 
ATOM   2214 C CD    . ARG B 1 69  ? -16.622 -22.400 14.556 1.00 48.92 ? 69  ARG B CD    1 
ATOM   2215 N NE    . ARG B 1 69  ? -16.159 -22.239 15.936 1.00 52.11 ? 69  ARG B NE    1 
ATOM   2216 C CZ    . ARG B 1 69  ? -15.073 -22.823 16.440 1.00 52.57 ? 69  ARG B CZ    1 
ATOM   2217 N NH1   . ARG B 1 69  ? -14.319 -23.607 15.676 1.00 53.78 ? 69  ARG B NH1   1 
ATOM   2218 N NH2   . ARG B 1 69  ? -14.757 -22.652 17.722 1.00 52.29 ? 69  ARG B NH2   1 
ATOM   2219 N N     . LEU B 1 70  ? -16.138 -18.775 11.071 1.00 34.14 ? 70  LEU B N     1 
ATOM   2220 C CA    . LEU B 1 70  ? -16.856 -18.622 9.797  1.00 34.20 ? 70  LEU B CA    1 
ATOM   2221 C C     . LEU B 1 70  ? -15.868 -18.288 8.673  1.00 35.35 ? 70  LEU B C     1 
ATOM   2222 O O     . LEU B 1 70  ? -15.996 -18.750 7.539  1.00 33.88 ? 70  LEU B O     1 
ATOM   2223 C CB    . LEU B 1 70  ? -17.891 -17.498 9.903  1.00 32.66 ? 70  LEU B CB    1 
ATOM   2224 C CG    . LEU B 1 70  ? -19.129 -17.814 10.743 1.00 34.97 ? 70  LEU B CG    1 
ATOM   2225 C CD1   . LEU B 1 70  ? -19.858 -16.537 11.131 1.00 34.28 ? 70  LEU B CD1   1 
ATOM   2226 C CD2   . LEU B 1 70  ? -20.024 -18.745 9.932  1.00 31.85 ? 70  LEU B CD2   1 
ATOM   2227 N N     . ALA B 1 71  ? -14.884 -17.459 9.010  1.00 36.38 ? 71  ALA B N     1 
ATOM   2228 C CA    . ALA B 1 71  ? -13.868 -17.040 8.060  1.00 37.83 ? 71  ALA B CA    1 
ATOM   2229 C C     . ALA B 1 71  ? -13.037 -18.233 7.600  1.00 38.53 ? 71  ALA B C     1 
ATOM   2230 O O     . ALA B 1 71  ? -12.651 -18.333 6.433  1.00 38.12 ? 71  ALA B O     1 
ATOM   2231 C CB    . ALA B 1 71  ? -12.967 -16.014 8.718  1.00 37.94 ? 71  ALA B CB    1 
ATOM   2232 N N     . LEU B 1 72  ? -12.774 -19.143 8.534  1.00 39.25 ? 72  LEU B N     1 
ATOM   2233 C CA    . LEU B 1 72  ? -11.970 -20.320 8.260  1.00 39.32 ? 72  LEU B CA    1 
ATOM   2234 C C     . LEU B 1 72  ? -12.691 -21.548 7.672  1.00 41.42 ? 72  LEU B C     1 
ATOM   2235 O O     . LEU B 1 72  ? -12.056 -22.556 7.369  1.00 40.43 ? 72  LEU B O     1 
ATOM   2236 C CB    . LEU B 1 72  ? -11.219 -20.701 9.537  1.00 36.85 ? 72  LEU B CB    1 
ATOM   2237 C CG    . LEU B 1 72  ? -10.225 -19.618 9.988  1.00 35.47 ? 72  LEU B CG    1 
ATOM   2238 C CD1   . LEU B 1 72  ? -9.474  -20.056 11.259 1.00 33.75 ? 72  LEU B CD1   1 
ATOM   2239 C CD2   . LEU B 1 72  ? -9.238  -19.341 8.848  1.00 30.52 ? 72  LEU B CD2   1 
ATOM   2240 N N     . GLN B 1 73  ? -14.001 -21.472 7.483  1.00 42.88 ? 73  GLN B N     1 
ATOM   2241 C CA    . GLN B 1 73  ? -14.712 -22.621 6.930  1.00 43.98 ? 73  GLN B CA    1 
ATOM   2242 C C     . GLN B 1 73  ? -14.162 -23.083 5.583  1.00 44.22 ? 73  GLN B C     1 
ATOM   2243 O O     . GLN B 1 73  ? -14.190 -24.274 5.286  1.00 44.18 ? 73  GLN B O     1 
ATOM   2244 C CB    . GLN B 1 73  ? -16.208 -22.326 6.795  1.00 44.67 ? 73  GLN B CB    1 
ATOM   2245 C CG    . GLN B 1 73  ? -16.904 -22.033 8.121  1.00 47.28 ? 73  GLN B CG    1 
ATOM   2246 C CD    . GLN B 1 73  ? -18.416 -22.012 7.989  1.00 50.03 ? 73  GLN B CD    1 
ATOM   2247 O OE1   . GLN B 1 73  ? -18.962 -21.413 7.058  1.00 50.14 ? 73  GLN B OE1   1 
ATOM   2248 N NE2   . GLN B 1 73  ? -19.104 -22.666 8.925  1.00 50.33 ? 73  GLN B NE2   1 
ATOM   2249 N N     . THR B 1 74  ? -13.658 -22.162 4.767  1.00 43.88 ? 74  THR B N     1 
ATOM   2250 C CA    . THR B 1 74  ? -13.117 -22.544 3.463  1.00 44.29 ? 74  THR B CA    1 
ATOM   2251 C C     . THR B 1 74  ? -11.630 -22.873 3.516  1.00 44.16 ? 74  THR B C     1 
ATOM   2252 O O     . THR B 1 74  ? -10.980 -23.024 2.479  1.00 45.09 ? 74  THR B O     1 
ATOM   2253 C CB    . THR B 1 74  ? -13.315 -21.433 2.427  1.00 45.50 ? 74  THR B CB    1 
ATOM   2254 O OG1   . THR B 1 74  ? -12.653 -20.248 2.880  1.00 48.02 ? 74  THR B OG1   1 
ATOM   2255 C CG2   . THR B 1 74  ? -14.808 -21.138 2.236  1.00 45.33 ? 74  THR B CG2   1 
ATOM   2256 N N     . SER B 1 75  ? -11.093 -22.982 4.724  1.00 43.55 ? 75  SER B N     1 
ATOM   2257 C CA    . SER B 1 75  ? -9.684  -23.298 4.901  1.00 42.87 ? 75  SER B CA    1 
ATOM   2258 C C     . SER B 1 75  ? -9.526  -24.768 5.269  1.00 43.03 ? 75  SER B C     1 
ATOM   2259 O O     . SER B 1 75  ? -10.184 -25.263 6.192  1.00 41.74 ? 75  SER B O     1 
ATOM   2260 C CB    . SER B 1 75  ? -9.076  -22.431 6.010  1.00 41.49 ? 75  SER B CB    1 
ATOM   2261 O OG    . SER B 1 75  ? -7.713  -22.765 6.196  1.00 40.92 ? 75  SER B OG    1 
ATOM   2262 N N     . ASP B 1 76  ? -8.645  -25.463 4.557  1.00 44.38 ? 76  ASP B N     1 
ATOM   2263 C CA    . ASP B 1 76  ? -8.408  -26.876 4.822  1.00 45.97 ? 76  ASP B CA    1 
ATOM   2264 C C     . ASP B 1 76  ? -7.279  -27.115 5.822  1.00 45.34 ? 76  ASP B C     1 
ATOM   2265 O O     . ASP B 1 76  ? -6.987  -28.264 6.148  1.00 45.10 ? 76  ASP B O     1 
ATOM   2266 C CB    . ASP B 1 76  ? -8.084  -27.616 3.522  1.00 48.33 ? 76  ASP B CB    1 
ATOM   2267 C CG    . ASP B 1 76  ? -6.831  -27.095 2.862  1.00 52.48 ? 76  ASP B CG    1 
ATOM   2268 O OD1   . ASP B 1 76  ? -5.815  -26.947 3.573  1.00 54.93 ? 76  ASP B OD1   1 
ATOM   2269 O OD2   . ASP B 1 76  ? -6.852  -26.840 1.638  1.00 55.72 ? 76  ASP B OD2   1 
ATOM   2270 N N     . TRP B 1 77  ? -6.652  -26.049 6.322  1.00 43.52 ? 77  TRP B N     1 
ATOM   2271 C CA    . TRP B 1 77  ? -5.544  -26.222 7.264  1.00 40.73 ? 77  TRP B CA    1 
ATOM   2272 C C     . TRP B 1 77  ? -5.463  -25.230 8.414  1.00 39.46 ? 77  TRP B C     1 
ATOM   2273 O O     . TRP B 1 77  ? -4.616  -25.361 9.297  1.00 36.22 ? 77  TRP B O     1 
ATOM   2274 C CB    . TRP B 1 77  ? -4.216  -26.194 6.513  1.00 42.28 ? 77  TRP B CB    1 
ATOM   2275 C CG    . TRP B 1 77  ? -3.884  -24.849 5.894  1.00 41.89 ? 77  TRP B CG    1 
ATOM   2276 C CD1   . TRP B 1 77  ? -4.396  -24.318 4.740  1.00 40.17 ? 77  TRP B CD1   1 
ATOM   2277 C CD2   . TRP B 1 77  ? -2.940  -23.894 6.388  1.00 40.74 ? 77  TRP B CD2   1 
ATOM   2278 N NE1   . TRP B 1 77  ? -3.820  -23.094 4.484  1.00 42.39 ? 77  TRP B NE1   1 
ATOM   2279 C CE2   . TRP B 1 77  ? -2.922  -22.811 5.480  1.00 41.13 ? 77  TRP B CE2   1 
ATOM   2280 C CE3   . TRP B 1 77  ? -2.102  -23.850 7.508  1.00 40.53 ? 77  TRP B CE3   1 
ATOM   2281 C CZ2   . TRP B 1 77  ? -2.097  -21.697 5.661  1.00 40.89 ? 77  TRP B CZ2   1 
ATOM   2282 C CZ3   . TRP B 1 77  ? -1.280  -22.744 7.689  1.00 40.70 ? 77  TRP B CZ3   1 
ATOM   2283 C CH2   . TRP B 1 77  ? -1.283  -21.682 6.769  1.00 39.71 ? 77  TRP B CH2   1 
ATOM   2284 N N     . ILE B 1 78  ? -6.341  -24.237 8.413  1.00 38.96 ? 78  ILE B N     1 
ATOM   2285 C CA    . ILE B 1 78  ? -6.319  -23.244 9.470  1.00 38.46 ? 78  ILE B CA    1 
ATOM   2286 C C     . ILE B 1 78  ? -7.563  -23.336 10.344 1.00 39.59 ? 78  ILE B C     1 
ATOM   2287 O O     . ILE B 1 78  ? -8.671  -23.520 9.837  1.00 40.90 ? 78  ILE B O     1 
ATOM   2288 C CB    . ILE B 1 78  ? -6.252  -21.826 8.885  1.00 37.59 ? 78  ILE B CB    1 
ATOM   2289 C CG1   . ILE B 1 78  ? -5.066  -21.697 7.929  1.00 36.91 ? 78  ILE B CG1   1 
ATOM   2290 C CG2   . ILE B 1 78  ? -6.124  -20.830 9.992  1.00 36.22 ? 78  ILE B CG2   1 
ATOM   2291 C CD1   . ILE B 1 78  ? -5.038  -20.379 7.202  1.00 37.58 ? 78  ILE B CD1   1 
ATOM   2292 N N     . ARG B 1 79  ? -7.390  -23.196 11.651 1.00 38.79 ? 79  ARG B N     1 
ATOM   2293 C CA    . ARG B 1 79  ? -8.537  -23.250 12.540 1.00 41.06 ? 79  ARG B CA    1 
ATOM   2294 C C     . ARG B 1 79  ? -8.375  -22.262 13.679 1.00 39.64 ? 79  ARG B C     1 
ATOM   2295 O O     . ARG B 1 79  ? -7.271  -21.805 13.954 1.00 39.98 ? 79  ARG B O     1 
ATOM   2296 C CB    . ARG B 1 79  ? -8.707  -24.663 13.118 1.00 43.40 ? 79  ARG B CB    1 
ATOM   2297 C CG    . ARG B 1 79  ? -7.683  -25.015 14.193 1.00 47.89 ? 79  ARG B CG    1 
ATOM   2298 C CD    . ARG B 1 79  ? -7.850  -26.456 14.726 1.00 51.18 ? 79  ARG B CD    1 
ATOM   2299 N NE    . ARG B 1 79  ? -6.856  -26.745 15.758 1.00 52.88 ? 79  ARG B NE    1 
ATOM   2300 C CZ    . ARG B 1 79  ? -6.892  -26.261 16.998 1.00 54.00 ? 79  ARG B CZ    1 
ATOM   2301 N NH1   . ARG B 1 79  ? -7.886  -25.470 17.384 1.00 55.30 ? 79  ARG B NH1   1 
ATOM   2302 N NH2   . ARG B 1 79  ? -5.905  -26.532 17.842 1.00 54.93 ? 79  ARG B NH2   1 
ATOM   2303 N N     . VAL B 1 80  ? -9.484  -21.926 14.328 1.00 39.36 ? 80  VAL B N     1 
ATOM   2304 C CA    . VAL B 1 80  ? -9.460  -21.022 15.469 1.00 40.14 ? 80  VAL B CA    1 
ATOM   2305 C C     . VAL B 1 80  ? -9.513  -21.873 16.726 1.00 41.84 ? 80  VAL B C     1 
ATOM   2306 O O     . VAL B 1 80  ? -10.246 -22.868 16.781 1.00 42.92 ? 80  VAL B O     1 
ATOM   2307 C CB    . VAL B 1 80  ? -10.676 -20.050 15.468 1.00 39.61 ? 80  VAL B CB    1 
ATOM   2308 C CG1   . VAL B 1 80  ? -11.973 -20.813 15.262 1.00 41.52 ? 80  VAL B CG1   1 
ATOM   2309 C CG2   . VAL B 1 80  ? -10.733 -19.293 16.769 1.00 38.88 ? 80  VAL B CG2   1 
ATOM   2310 N N     . ASP B 1 81  ? -8.719  -21.506 17.724 1.00 42.43 ? 81  ASP B N     1 
ATOM   2311 C CA    . ASP B 1 81  ? -8.715  -22.231 18.986 1.00 41.48 ? 81  ASP B CA    1 
ATOM   2312 C C     . ASP B 1 81  ? -9.086  -21.215 20.048 1.00 41.28 ? 81  ASP B C     1 
ATOM   2313 O O     . ASP B 1 81  ? -8.322  -20.298 20.337 1.00 40.17 ? 81  ASP B O     1 
ATOM   2314 C CB    . ASP B 1 81  ? -7.343  -22.817 19.289 1.00 42.34 ? 81  ASP B CB    1 
ATOM   2315 C CG    . ASP B 1 81  ? -7.371  -23.763 20.481 1.00 44.45 ? 81  ASP B CG    1 
ATOM   2316 O OD1   . ASP B 1 81  ? -7.971  -23.401 21.511 1.00 45.07 ? 81  ASP B OD1   1 
ATOM   2317 O OD2   . ASP B 1 81  ? -6.788  -24.865 20.392 1.00 46.84 ? 81  ASP B OD2   1 
ATOM   2318 N N     . PRO B 1 82  ? -10.276 -21.370 20.645 1.00 40.48 ? 82  PRO B N     1 
ATOM   2319 C CA    . PRO B 1 82  ? -10.809 -20.484 21.681 1.00 40.78 ? 82  PRO B CA    1 
ATOM   2320 C C     . PRO B 1 82  ? -10.181 -20.551 23.069 1.00 40.93 ? 82  PRO B C     1 
ATOM   2321 O O     . PRO B 1 82  ? -10.487 -19.717 23.912 1.00 39.48 ? 82  PRO B O     1 
ATOM   2322 C CB    . PRO B 1 82  ? -12.285 -20.851 21.704 1.00 41.12 ? 82  PRO B CB    1 
ATOM   2323 C CG    . PRO B 1 82  ? -12.245 -22.320 21.431 1.00 42.11 ? 82  PRO B CG    1 
ATOM   2324 C CD    . PRO B 1 82  ? -11.245 -22.429 20.312 1.00 41.13 ? 82  PRO B CD    1 
ATOM   2325 N N     . TRP B 1 83  ? -9.301  -21.523 23.299 1.00 41.75 ? 83  TRP B N     1 
ATOM   2326 C CA    . TRP B 1 83  ? -8.659  -21.679 24.606 1.00 44.08 ? 83  TRP B CA    1 
ATOM   2327 C C     . TRP B 1 83  ? -8.208  -20.374 25.260 1.00 44.24 ? 83  TRP B C     1 
ATOM   2328 O O     . TRP B 1 83  ? -8.590  -20.066 26.389 1.00 43.75 ? 83  TRP B O     1 
ATOM   2329 C CB    . TRP B 1 83  ? -7.446  -22.606 24.496 1.00 45.80 ? 83  TRP B CB    1 
ATOM   2330 C CG    . TRP B 1 83  ? -6.805  -22.911 25.832 1.00 46.59 ? 83  TRP B CG    1 
ATOM   2331 C CD1   . TRP B 1 83  ? -7.199  -23.865 26.729 1.00 46.36 ? 83  TRP B CD1   1 
ATOM   2332 C CD2   . TRP B 1 83  ? -5.688  -22.237 26.430 1.00 46.05 ? 83  TRP B CD2   1 
ATOM   2333 N NE1   . TRP B 1 83  ? -6.399  -23.828 27.845 1.00 45.92 ? 83  TRP B NE1   1 
ATOM   2334 C CE2   . TRP B 1 83  ? -5.465  -22.837 27.693 1.00 47.73 ? 83  TRP B CE2   1 
ATOM   2335 C CE3   . TRP B 1 83  ? -4.858  -21.182 26.025 1.00 46.65 ? 83  TRP B CE3   1 
ATOM   2336 C CZ2   . TRP B 1 83  ? -4.442  -22.422 28.555 1.00 47.54 ? 83  TRP B CZ2   1 
ATOM   2337 C CZ3   . TRP B 1 83  ? -3.835  -20.765 26.881 1.00 47.33 ? 83  TRP B CZ3   1 
ATOM   2338 C CH2   . TRP B 1 83  ? -3.640  -21.386 28.136 1.00 49.45 ? 83  TRP B CH2   1 
ATOM   2339 N N     . GLU B 1 84  ? -7.383  -19.609 24.551 1.00 45.10 ? 84  GLU B N     1 
ATOM   2340 C CA    . GLU B 1 84  ? -6.870  -18.355 25.094 1.00 44.62 ? 84  GLU B CA    1 
ATOM   2341 C C     . GLU B 1 84  ? -7.955  -17.380 25.522 1.00 44.93 ? 84  GLU B C     1 
ATOM   2342 O O     . GLU B 1 84  ? -7.858  -16.771 26.586 1.00 45.27 ? 84  GLU B O     1 
ATOM   2343 C CB    . GLU B 1 84  ? -5.952  -17.663 24.081 1.00 42.71 ? 84  GLU B CB    1 
ATOM   2344 C CG    . GLU B 1 84  ? -5.381  -16.369 24.623 1.00 41.01 ? 84  GLU B CG    1 
ATOM   2345 C CD    . GLU B 1 84  ? -4.493  -15.653 23.636 1.00 39.68 ? 84  GLU B CD    1 
ATOM   2346 O OE1   . GLU B 1 84  ? -4.236  -16.223 22.553 1.00 38.53 ? 84  GLU B OE1   1 
ATOM   2347 O OE2   . GLU B 1 84  ? -4.052  -14.529 23.959 1.00 38.83 ? 84  GLU B OE2   1 
ATOM   2348 N N     . SER B 1 85  ? -8.973  -17.224 24.679 1.00 46.57 ? 85  SER B N     1 
ATOM   2349 C CA    . SER B 1 85  ? -10.078 -16.315 24.961 1.00 47.86 ? 85  SER B CA    1 
ATOM   2350 C C     . SER B 1 85  ? -10.952 -16.886 26.065 1.00 50.19 ? 85  SER B C     1 
ATOM   2351 O O     . SER B 1 85  ? -11.602 -16.138 26.792 1.00 50.60 ? 85  SER B O     1 
ATOM   2352 C CB    . SER B 1 85  ? -10.931 -16.104 23.712 1.00 47.10 ? 85  SER B CB    1 
ATOM   2353 O OG    . SER B 1 85  ? -11.578 -17.306 23.309 1.00 47.44 ? 85  SER B OG    1 
ATOM   2354 N N     . GLU B 1 86  ? -10.968 -18.212 26.180 1.00 51.78 ? 86  GLU B N     1 
ATOM   2355 C CA    . GLU B 1 86  ? -11.775 -18.871 27.208 1.00 54.70 ? 86  GLU B CA    1 
ATOM   2356 C C     . GLU B 1 86  ? -11.092 -18.935 28.561 1.00 55.70 ? 86  GLU B C     1 
ATOM   2357 O O     . GLU B 1 86  ? -11.701 -19.354 29.538 1.00 57.15 ? 86  GLU B O     1 
ATOM   2358 C CB    . GLU B 1 86  ? -12.186 -20.279 26.776 1.00 53.94 ? 86  GLU B CB    1 
ATOM   2359 C CG    . GLU B 1 86  ? -13.328 -20.291 25.775 1.00 53.44 ? 86  GLU B CG    1 
ATOM   2360 C CD    . GLU B 1 86  ? -13.554 -21.658 25.189 1.00 52.43 ? 86  GLU B CD    1 
ATOM   2361 O OE1   . GLU B 1 86  ? -12.692 -22.531 25.393 1.00 53.79 ? 86  GLU B OE1   1 
ATOM   2362 O OE2   . GLU B 1 86  ? -14.581 -21.859 24.509 1.00 54.59 ? 86  GLU B OE2   1 
ATOM   2363 N N     . GLN B 1 87  ? -9.829  -18.535 28.630 1.00 56.70 ? 87  GLN B N     1 
ATOM   2364 C CA    . GLN B 1 87  ? -9.167  -18.528 29.923 1.00 57.57 ? 87  GLN B CA    1 
ATOM   2365 C C     . GLN B 1 87  ? -9.887  -17.479 30.762 1.00 57.67 ? 87  GLN B C     1 
ATOM   2366 O O     . GLN B 1 87  ? -10.731 -16.740 30.261 1.00 57.83 ? 87  GLN B O     1 
ATOM   2367 C CB    . GLN B 1 87  ? -7.682  -18.175 29.796 1.00 57.85 ? 87  GLN B CB    1 
ATOM   2368 C CG    . GLN B 1 87  ? -6.832  -19.321 29.272 1.00 58.06 ? 87  GLN B CG    1 
ATOM   2369 C CD    . GLN B 1 87  ? -7.285  -20.675 29.808 1.00 58.31 ? 87  GLN B CD    1 
ATOM   2370 O OE1   . GLN B 1 87  ? -8.035  -21.396 29.142 1.00 56.17 ? 87  GLN B OE1   1 
ATOM   2371 N NE2   . GLN B 1 87  ? -6.842  -21.018 31.023 1.00 57.29 ? 87  GLN B NE2   1 
ATOM   2372 N N     . ALA B 1 88  ? -9.557  -17.409 32.039 1.00 58.08 ? 88  ALA B N     1 
ATOM   2373 C CA    . ALA B 1 88  ? -10.217 -16.456 32.902 1.00 59.00 ? 88  ALA B CA    1 
ATOM   2374 C C     . ALA B 1 88  ? -9.679  -15.056 32.708 1.00 59.44 ? 88  ALA B C     1 
ATOM   2375 O O     . ALA B 1 88  ? -10.432 -14.088 32.675 1.00 60.03 ? 88  ALA B O     1 
ATOM   2376 C CB    . ALA B 1 88  ? -10.053 -16.880 34.352 1.00 59.47 ? 88  ALA B CB    1 
ATOM   2377 N N     . GLN B 1 89  ? -8.370  -14.946 32.561 1.00 61.07 ? 89  GLN B N     1 
ATOM   2378 C CA    . GLN B 1 89  ? -7.771  -13.636 32.422 1.00 62.63 ? 89  GLN B CA    1 
ATOM   2379 C C     . GLN B 1 89  ? -6.816  -13.563 31.240 1.00 61.87 ? 89  GLN B C     1 
ATOM   2380 O O     . GLN B 1 89  ? -6.609  -14.554 30.542 1.00 62.40 ? 89  GLN B O     1 
ATOM   2381 C CB    . GLN B 1 89  ? -7.036  -13.292 33.720 1.00 65.15 ? 89  GLN B CB    1 
ATOM   2382 C CG    . GLN B 1 89  ? -6.894  -11.813 33.982 1.00 68.90 ? 89  GLN B CG    1 
ATOM   2383 C CD    . GLN B 1 89  ? -6.203  -11.533 35.298 1.00 71.75 ? 89  GLN B CD    1 
ATOM   2384 O OE1   . GLN B 1 89  ? -5.033  -11.885 35.489 1.00 73.44 ? 89  GLN B OE1   1 
ATOM   2385 N NE2   . GLN B 1 89  ? -6.922  -10.895 36.221 1.00 72.81 ? 89  GLN B NE2   1 
ATOM   2386 N N     . TRP B 1 90  ? -6.251  -12.381 31.009 1.00 60.60 ? 90  TRP B N     1 
ATOM   2387 C CA    . TRP B 1 90  ? -5.303  -12.208 29.918 1.00 59.40 ? 90  TRP B CA    1 
ATOM   2388 C C     . TRP B 1 90  ? -4.057  -13.016 30.253 1.00 58.58 ? 90  TRP B C     1 
ATOM   2389 O O     . TRP B 1 90  ? -3.725  -13.210 31.426 1.00 57.82 ? 90  TRP B O     1 
ATOM   2390 C CB    . TRP B 1 90  ? -4.912  -10.739 29.746 1.00 59.16 ? 90  TRP B CB    1 
ATOM   2391 C CG    . TRP B 1 90  ? -3.877  -10.566 28.690 1.00 59.34 ? 90  TRP B CG    1 
ATOM   2392 C CD1   . TRP B 1 90  ? -4.034  -10.782 27.350 1.00 59.62 ? 90  TRP B CD1   1 
ATOM   2393 C CD2   . TRP B 1 90  ? -2.499  -10.226 28.883 1.00 60.06 ? 90  TRP B CD2   1 
ATOM   2394 N NE1   . TRP B 1 90  ? -2.839  -10.602 26.697 1.00 59.16 ? 90  TRP B NE1   1 
ATOM   2395 C CE2   . TRP B 1 90  ? -1.878  -10.261 27.612 1.00 59.81 ? 90  TRP B CE2   1 
ATOM   2396 C CE3   . TRP B 1 90  ? -1.725  -9.899  30.005 1.00 60.08 ? 90  TRP B CE3   1 
ATOM   2397 C CZ2   . TRP B 1 90  ? -0.516  -9.981  27.431 1.00 59.36 ? 90  TRP B CZ2   1 
ATOM   2398 C CZ3   . TRP B 1 90  ? -0.368  -9.621  29.826 1.00 60.44 ? 90  TRP B CZ3   1 
ATOM   2399 C CH2   . TRP B 1 90  ? 0.220   -9.664  28.545 1.00 59.85 ? 90  TRP B CH2   1 
ATOM   2400 N N     . MET B 1 91  ? -3.355  -13.452 29.216 1.00 57.50 ? 91  MET B N     1 
ATOM   2401 C CA    . MET B 1 91  ? -2.157  -14.261 29.373 1.00 56.48 ? 91  MET B CA    1 
ATOM   2402 C C     . MET B 1 91  ? -1.049  -13.801 28.420 1.00 54.05 ? 91  MET B C     1 
ATOM   2403 O O     . MET B 1 91  ? -1.323  -13.516 27.256 1.00 53.34 ? 91  MET B O     1 
ATOM   2404 C CB    . MET B 1 91  ? -2.545  -15.697 29.060 1.00 58.27 ? 91  MET B CB    1 
ATOM   2405 C CG    . MET B 1 91  ? -1.551  -16.759 29.425 1.00 59.75 ? 91  MET B CG    1 
ATOM   2406 S SD    . MET B 1 91  ? -2.354  -18.306 29.019 1.00 60.63 ? 91  MET B SD    1 
ATOM   2407 C CE    . MET B 1 91  ? -3.816  -18.131 30.024 1.00 59.08 ? 91  MET B CE    1 
ATOM   2408 N N     . GLU B 1 92  ? 0.189   -13.714 28.902 1.00 51.82 ? 92  GLU B N     1 
ATOM   2409 C CA    . GLU B 1 92  ? 1.286   -13.325 28.014 1.00 49.69 ? 92  GLU B CA    1 
ATOM   2410 C C     . GLU B 1 92  ? 1.369   -14.364 26.902 1.00 47.15 ? 92  GLU B C     1 
ATOM   2411 O O     . GLU B 1 92  ? 1.109   -15.547 27.118 1.00 45.28 ? 92  GLU B O     1 
ATOM   2412 C CB    . GLU B 1 92  ? 2.628   -13.281 28.739 1.00 51.07 ? 92  GLU B CB    1 
ATOM   2413 C CG    . GLU B 1 92  ? 2.727   -12.233 29.811 1.00 55.46 ? 92  GLU B CG    1 
ATOM   2414 C CD    . GLU B 1 92  ? 2.483   -12.809 31.186 1.00 57.56 ? 92  GLU B CD    1 
ATOM   2415 O OE1   . GLU B 1 92  ? 1.360   -13.309 31.437 1.00 58.60 ? 92  GLU B OE1   1 
ATOM   2416 O OE2   . GLU B 1 92  ? 3.425   -12.769 32.008 1.00 58.32 ? 92  GLU B OE2   1 
ATOM   2417 N N     . THR B 1 93  ? 1.745   -13.916 25.714 1.00 44.60 ? 93  THR B N     1 
ATOM   2418 C CA    . THR B 1 93  ? 1.827   -14.787 24.550 1.00 43.19 ? 93  THR B CA    1 
ATOM   2419 C C     . THR B 1 93  ? 2.697   -16.042 24.695 1.00 42.55 ? 93  THR B C     1 
ATOM   2420 O O     . THR B 1 93  ? 2.334   -17.098 24.167 1.00 42.16 ? 93  THR B O     1 
ATOM   2421 C CB    . THR B 1 93  ? 2.246   -13.947 23.320 1.00 43.24 ? 93  THR B CB    1 
ATOM   2422 O OG1   . THR B 1 93  ? 1.219   -12.978 23.070 1.00 45.23 ? 93  THR B OG1   1 
ATOM   2423 C CG2   . THR B 1 93  ? 2.411   -14.810 22.075 1.00 43.12 ? 93  THR B CG2   1 
ATOM   2424 N N     . VAL B 1 94  ? 3.830   -15.943 25.396 1.00 40.99 ? 94  VAL B N     1 
ATOM   2425 C CA    . VAL B 1 94  ? 4.681   -17.118 25.594 1.00 41.32 ? 94  VAL B CA    1 
ATOM   2426 C C     . VAL B 1 94  ? 3.854   -18.215 26.268 1.00 40.63 ? 94  VAL B C     1 
ATOM   2427 O O     . VAL B 1 94  ? 3.968   -19.392 25.938 1.00 41.14 ? 94  VAL B O     1 
ATOM   2428 C CB    . VAL B 1 94  ? 5.917   -16.822 26.505 1.00 43.55 ? 94  VAL B CB    1 
ATOM   2429 C CG1   . VAL B 1 94  ? 6.900   -15.912 25.787 1.00 45.88 ? 94  VAL B CG1   1 
ATOM   2430 C CG2   . VAL B 1 94  ? 5.468   -16.182 27.816 1.00 43.38 ? 94  VAL B CG2   1 
ATOM   2431 N N     . LYS B 1 95  ? 3.004   -17.822 27.203 1.00 39.83 ? 95  LYS B N     1 
ATOM   2432 C CA    . LYS B 1 95  ? 2.193   -18.798 27.894 1.00 40.98 ? 95  LYS B CA    1 
ATOM   2433 C C     . LYS B 1 95  ? 1.187   -19.434 26.947 1.00 41.94 ? 95  LYS B C     1 
ATOM   2434 O O     . LYS B 1 95  ? 0.828   -20.600 27.115 1.00 42.58 ? 95  LYS B O     1 
ATOM   2435 C CB    . LYS B 1 95  ? 1.529   -18.148 29.101 1.00 42.07 ? 95  LYS B CB    1 
ATOM   2436 C CG    . LYS B 1 95  ? 2.564   -17.669 30.087 1.00 44.13 ? 95  LYS B CG    1 
ATOM   2437 C CD    . LYS B 1 95  ? 1.970   -17.016 31.316 1.00 48.33 ? 95  LYS B CD    1 
ATOM   2438 C CE    . LYS B 1 95  ? 3.090   -16.415 32.166 1.00 47.99 ? 95  LYS B CE    1 
ATOM   2439 N NZ    . LYS B 1 95  ? 2.589   -15.715 33.378 1.00 50.05 ? 95  LYS B NZ    1 
ATOM   2440 N N     . VAL B 1 96  ? 0.737   -18.698 25.929 1.00 41.63 ? 96  VAL B N     1 
ATOM   2441 C CA    . VAL B 1 96  ? -0.196  -19.312 24.988 1.00 38.93 ? 96  VAL B CA    1 
ATOM   2442 C C     . VAL B 1 96  ? 0.590   -20.292 24.137 1.00 37.90 ? 96  VAL B C     1 
ATOM   2443 O O     . VAL B 1 96  ? 0.068   -21.325 23.734 1.00 37.56 ? 96  VAL B O     1 
ATOM   2444 C CB    . VAL B 1 96  ? -0.886  -18.291 24.062 1.00 38.63 ? 96  VAL B CB    1 
ATOM   2445 C CG1   . VAL B 1 96  ? -1.794  -19.033 23.082 1.00 37.92 ? 96  VAL B CG1   1 
ATOM   2446 C CG2   . VAL B 1 96  ? -1.697  -17.292 24.883 1.00 36.09 ? 96  VAL B CG2   1 
ATOM   2447 N N     . LEU B 1 97  ? 1.852   -19.972 23.868 1.00 39.54 ? 97  LEU B N     1 
ATOM   2448 C CA    . LEU B 1 97  ? 2.692   -20.866 23.062 1.00 40.60 ? 97  LEU B CA    1 
ATOM   2449 C C     . LEU B 1 97  ? 3.014   -22.179 23.807 1.00 41.30 ? 97  LEU B C     1 
ATOM   2450 O O     . LEU B 1 97  ? 3.098   -23.252 23.202 1.00 39.06 ? 97  LEU B O     1 
ATOM   2451 C CB    . LEU B 1 97  ? 3.984   -20.157 22.663 1.00 41.58 ? 97  LEU B CB    1 
ATOM   2452 C CG    . LEU B 1 97  ? 3.890   -19.161 21.498 1.00 41.02 ? 97  LEU B CG    1 
ATOM   2453 C CD1   . LEU B 1 97  ? 5.103   -18.263 21.516 1.00 39.53 ? 97  LEU B CD1   1 
ATOM   2454 C CD2   . LEU B 1 97  ? 3.785   -19.904 20.180 1.00 38.33 ? 97  LEU B CD2   1 
ATOM   2455 N N     . ARG B 1 98  ? 3.182   -22.088 25.121 1.00 41.87 ? 98  ARG B N     1 
ATOM   2456 C CA    . ARG B 1 98  ? 3.468   -23.273 25.925 1.00 43.40 ? 98  ARG B CA    1 
ATOM   2457 C C     . ARG B 1 98  ? 2.238   -24.188 25.928 1.00 43.54 ? 98  ARG B C     1 
ATOM   2458 O O     . ARG B 1 98  ? 2.351   -25.385 25.663 1.00 43.29 ? 98  ARG B O     1 
ATOM   2459 C CB    . ARG B 1 98  ? 3.823   -22.860 27.355 1.00 41.99 ? 98  ARG B CB    1 
ATOM   2460 C CG    . ARG B 1 98  ? 5.056   -21.978 27.457 1.00 40.15 ? 98  ARG B CG    1 
ATOM   2461 C CD    . ARG B 1 98  ? 5.193   -21.431 28.862 1.00 40.08 ? 98  ARG B CD    1 
ATOM   2462 N NE    . ARG B 1 98  ? 6.345   -20.545 29.005 1.00 41.99 ? 98  ARG B NE    1 
ATOM   2463 C CZ    . ARG B 1 98  ? 6.557   -19.767 30.060 1.00 40.47 ? 98  ARG B CZ    1 
ATOM   2464 N NH1   . ARG B 1 98  ? 5.693   -19.765 31.068 1.00 40.17 ? 98  ARG B NH1   1 
ATOM   2465 N NH2   . ARG B 1 98  ? 7.620   -18.978 30.101 1.00 40.37 ? 98  ARG B NH2   1 
ATOM   2466 N N     . HIS B 1 99  ? 1.067   -23.623 26.217 1.00 44.96 ? 99  HIS B N     1 
ATOM   2467 C CA    . HIS B 1 99  ? -0.171  -24.404 26.237 1.00 46.89 ? 99  HIS B CA    1 
ATOM   2468 C C     . HIS B 1 99  ? -0.365  -25.222 24.967 1.00 47.68 ? 99  HIS B C     1 
ATOM   2469 O O     . HIS B 1 99  ? -0.592  -26.432 25.031 1.00 47.17 ? 99  HIS B O     1 
ATOM   2470 C CB    . HIS B 1 99  ? -1.399  -23.504 26.420 1.00 47.95 ? 99  HIS B CB    1 
ATOM   2471 C CG    . HIS B 1 99  ? -2.696  -24.193 26.111 1.00 50.50 ? 99  HIS B CG    1 
ATOM   2472 N ND1   . HIS B 1 99  ? -3.298  -25.078 26.979 1.00 53.13 ? 99  HIS B ND1   1 
ATOM   2473 C CD2   . HIS B 1 99  ? -3.469  -24.179 24.998 1.00 51.87 ? 99  HIS B CD2   1 
ATOM   2474 C CE1   . HIS B 1 99  ? -4.384  -25.579 26.416 1.00 52.54 ? 99  HIS B CE1   1 
ATOM   2475 N NE2   . HIS B 1 99  ? -4.511  -25.050 25.213 1.00 53.68 ? 99  HIS B NE2   1 
ATOM   2476 N N     . HIS B 1 100 ? -0.284  -24.557 23.815 1.00 47.88 ? 100 HIS B N     1 
ATOM   2477 C CA    . HIS B 1 100 ? -0.469  -25.235 22.534 1.00 48.37 ? 100 HIS B CA    1 
ATOM   2478 C C     . HIS B 1 100 ? 0.676   -26.175 22.213 1.00 49.75 ? 100 HIS B C     1 
ATOM   2479 O O     . HIS B 1 100 ? 0.531   -27.106 21.413 1.00 47.63 ? 100 HIS B O     1 
ATOM   2480 C CB    . HIS B 1 100 ? -0.666  -24.205 21.421 1.00 47.17 ? 100 HIS B CB    1 
ATOM   2481 C CG    . HIS B 1 100 ? -2.014  -23.559 21.455 1.00 45.97 ? 100 HIS B CG    1 
ATOM   2482 N ND1   . HIS B 1 100 ? -3.161  -24.222 21.078 1.00 46.31 ? 100 HIS B ND1   1 
ATOM   2483 C CD2   . HIS B 1 100 ? -2.410  -22.342 21.897 1.00 45.09 ? 100 HIS B CD2   1 
ATOM   2484 C CE1   . HIS B 1 100 ? -4.207  -23.442 21.286 1.00 46.66 ? 100 HIS B CE1   1 
ATOM   2485 N NE2   . HIS B 1 100 ? -3.779  -22.296 21.783 1.00 45.41 ? 100 HIS B NE2   1 
ATOM   2486 N N     . HIS B 1 101 ? 1.822   -25.929 22.835 1.00 52.60 ? 101 HIS B N     1 
ATOM   2487 C CA    . HIS B 1 101 ? 2.965   -26.808 22.636 1.00 56.76 ? 101 HIS B CA    1 
ATOM   2488 C C     . HIS B 1 101 ? 2.626   -28.113 23.352 1.00 58.20 ? 101 HIS B C     1 
ATOM   2489 O O     . HIS B 1 101 ? 2.926   -29.199 22.861 1.00 58.36 ? 101 HIS B O     1 
ATOM   2490 C CB    . HIS B 1 101 ? 4.233   -26.205 23.243 1.00 57.76 ? 101 HIS B CB    1 
ATOM   2491 C CG    . HIS B 1 101 ? 5.422   -27.111 23.165 1.00 60.00 ? 101 HIS B CG    1 
ATOM   2492 N ND1   . HIS B 1 101 ? 5.773   -27.780 22.010 1.00 60.63 ? 101 HIS B ND1   1 
ATOM   2493 C CD2   . HIS B 1 101 ? 6.350   -27.445 24.092 1.00 60.25 ? 101 HIS B CD2   1 
ATOM   2494 C CE1   . HIS B 1 101 ? 6.866   -28.488 22.231 1.00 60.35 ? 101 HIS B CE1   1 
ATOM   2495 N NE2   . HIS B 1 101 ? 7.237   -28.301 23.486 1.00 60.71 ? 101 HIS B NE2   1 
ATOM   2496 N N     . SER B 1 102 ? 1.991   -27.980 24.516 1.00 60.35 ? 102 SER B N     1 
ATOM   2497 C CA    . SER B 1 102 ? 1.582   -29.121 25.317 1.00 62.33 ? 102 SER B CA    1 
ATOM   2498 C C     . SER B 1 102 ? 0.563   -29.937 24.544 1.00 64.58 ? 102 SER B C     1 
ATOM   2499 O O     . SER B 1 102 ? 0.707   -31.149 24.431 1.00 65.79 ? 102 SER B O     1 
ATOM   2500 C CB    . SER B 1 102 ? 0.965   -28.653 26.632 1.00 62.42 ? 102 SER B CB    1 
ATOM   2501 O OG    . SER B 1 102 ? 1.919   -27.982 27.434 1.00 62.12 ? 102 SER B OG    1 
ATOM   2502 N N     . LYS B 1 103 ? -0.463  -29.279 24.009 1.00 66.66 ? 103 LYS B N     1 
ATOM   2503 C CA    . LYS B 1 103 ? -1.490  -29.980 23.238 1.00 70.06 ? 103 LYS B CA    1 
ATOM   2504 C C     . LYS B 1 103 ? -0.887  -30.822 22.126 1.00 71.45 ? 103 LYS B C     1 
ATOM   2505 O O     . LYS B 1 103 ? -1.331  -31.940 21.876 1.00 71.91 ? 103 LYS B O     1 
ATOM   2506 C CB    . LYS B 1 103 ? -2.473  -29.001 22.603 1.00 71.45 ? 103 LYS B CB    1 
ATOM   2507 C CG    . LYS B 1 103 ? -3.377  -28.289 23.574 1.00 74.03 ? 103 LYS B CG    1 
ATOM   2508 C CD    . LYS B 1 103 ? -4.508  -27.579 22.841 1.00 76.43 ? 103 LYS B CD    1 
ATOM   2509 C CE    . LYS B 1 103 ? -5.416  -28.574 22.128 1.00 76.83 ? 103 LYS B CE    1 
ATOM   2510 N NZ    . LYS B 1 103 ? -6.607  -27.895 21.541 1.00 77.88 ? 103 LYS B NZ    1 
ATOM   2511 N N     . LEU B 1 104 ? 0.118   -30.269 21.454 1.00 73.86 ? 104 LEU B N     1 
ATOM   2512 C CA    . LEU B 1 104 ? 0.795   -30.948 20.356 1.00 76.32 ? 104 LEU B CA    1 
ATOM   2513 C C     . LEU B 1 104 ? 1.382   -32.291 20.768 1.00 78.29 ? 104 LEU B C     1 
ATOM   2514 O O     . LEU B 1 104 ? 1.618   -33.161 19.922 1.00 78.76 ? 104 LEU B O     1 
ATOM   2515 C CB    . LEU B 1 104 ? 1.906   -30.058 19.798 1.00 76.21 ? 104 LEU B CB    1 
ATOM   2516 C CG    . LEU B 1 104 ? 1.453   -28.899 18.914 1.00 76.24 ? 104 LEU B CG    1 
ATOM   2517 C CD1   . LEU B 1 104 ? 2.650   -28.038 18.538 1.00 76.12 ? 104 LEU B CD1   1 
ATOM   2518 C CD2   . LEU B 1 104 ? 0.776   -29.456 17.668 1.00 76.22 ? 104 LEU B CD2   1 
ATOM   2519 N N     . LEU B 1 105 ? 1.622   -32.450 22.066 1.00 79.97 ? 105 LEU B N     1 
ATOM   2520 C CA    . LEU B 1 105 ? 2.180   -33.685 22.607 1.00 81.83 ? 105 LEU B CA    1 
ATOM   2521 C C     . LEU B 1 105 ? 1.067   -34.589 23.150 1.00 83.26 ? 105 LEU B C     1 
ATOM   2522 O O     . LEU B 1 105 ? 1.343   -35.639 23.728 1.00 84.15 ? 105 LEU B O     1 
ATOM   2523 C CB    . LEU B 1 105 ? 3.166   -33.358 23.732 1.00 80.81 ? 105 LEU B CB    1 
ATOM   2524 C CG    . LEU B 1 105 ? 4.221   -32.286 23.450 1.00 80.25 ? 105 LEU B CG    1 
ATOM   2525 C CD1   . LEU B 1 105 ? 4.962   -31.953 24.733 1.00 80.48 ? 105 LEU B CD1   1 
ATOM   2526 C CD2   . LEU B 1 105 ? 5.179   -32.768 22.383 1.00 79.70 ? 105 LEU B CD2   1 
ATOM   2527 N N     . ARG B 1 106 ? -0.185  -34.179 22.957 1.00 84.53 ? 106 ARG B N     1 
ATOM   2528 C CA    . ARG B 1 106 ? -1.345  -34.934 23.440 1.00 85.98 ? 106 ARG B CA    1 
ATOM   2529 C C     . ARG B 1 106 ? -1.220  -35.264 24.924 1.00 86.59 ? 106 ARG B C     1 
ATOM   2530 O O     . ARG B 1 106 ? -1.541  -34.440 25.781 1.00 87.81 ? 106 ARG B O     1 
ATOM   2531 C CB    . ARG B 1 106 ? -1.528  -36.233 22.647 1.00 86.18 ? 106 ARG B CB    1 
ATOM   2532 C CG    . ARG B 1 106 ? -2.032  -36.037 21.229 1.00 87.29 ? 106 ARG B CG    1 
ATOM   2533 C CD    . ARG B 1 106 ? -0.953  -35.461 20.342 1.00 88.11 ? 106 ARG B CD    1 
ATOM   2534 N NE    . ARG B 1 106 ? -1.421  -35.257 18.975 1.00 88.99 ? 106 ARG B NE    1 
ATOM   2535 C CZ    . ARG B 1 106 ? -0.629  -34.926 17.959 1.00 89.68 ? 106 ARG B CZ    1 
ATOM   2536 N NH1   . ARG B 1 106 ? 0.673   -34.763 18.155 1.00 89.65 ? 106 ARG B NH1   1 
ATOM   2537 N NH2   . ARG B 1 106 ? -1.137  -34.757 16.744 1.00 90.18 ? 106 ARG B NH2   1 
ATOM   2538 N N     . VAL B 1 127 ? 7.732   -34.810 16.627 1.00 71.38 ? 127 VAL B N     1 
ATOM   2539 C CA    . VAL B 1 127 ? 6.797   -33.792 17.101 1.00 71.55 ? 127 VAL B CA    1 
ATOM   2540 C C     . VAL B 1 127 ? 6.949   -32.500 16.283 1.00 70.18 ? 127 VAL B C     1 
ATOM   2541 O O     . VAL B 1 127 ? 8.066   -32.069 15.983 1.00 69.60 ? 127 VAL B O     1 
ATOM   2542 C CB    . VAL B 1 127 ? 7.020   -33.479 18.615 1.00 72.39 ? 127 VAL B CB    1 
ATOM   2543 C CG1   . VAL B 1 127 ? 5.846   -32.664 19.163 1.00 72.44 ? 127 VAL B CG1   1 
ATOM   2544 C CG2   . VAL B 1 127 ? 7.178   -34.784 19.402 1.00 72.99 ? 127 VAL B CG2   1 
ATOM   2545 N N     . PRO B 1 128 ? 5.818   -31.875 15.906 1.00 69.28 ? 128 PRO B N     1 
ATOM   2546 C CA    . PRO B 1 128 ? 5.784   -30.632 15.118 1.00 67.27 ? 128 PRO B CA    1 
ATOM   2547 C C     . PRO B 1 128 ? 6.337   -29.403 15.844 1.00 65.07 ? 128 PRO B C     1 
ATOM   2548 O O     . PRO B 1 128 ? 6.158   -29.257 17.057 1.00 64.89 ? 128 PRO B O     1 
ATOM   2549 C CB    . PRO B 1 128 ? 4.293   -30.469 14.791 1.00 68.19 ? 128 PRO B CB    1 
ATOM   2550 C CG    . PRO B 1 128 ? 3.759   -31.871 14.841 1.00 68.93 ? 128 PRO B CG    1 
ATOM   2551 C CD    . PRO B 1 128 ? 4.458   -32.426 16.059 1.00 69.44 ? 128 PRO B CD    1 
ATOM   2552 N N     . GLU B 1 129 ? 7.003   -28.522 15.102 1.00 62.11 ? 129 GLU B N     1 
ATOM   2553 C CA    . GLU B 1 129 ? 7.547   -27.299 15.688 1.00 60.40 ? 129 GLU B CA    1 
ATOM   2554 C C     . GLU B 1 129 ? 6.463   -26.225 15.720 1.00 57.50 ? 129 GLU B C     1 
ATOM   2555 O O     . GLU B 1 129 ? 5.799   -25.978 14.718 1.00 58.28 ? 129 GLU B O     1 
ATOM   2556 C CB    . GLU B 1 129 ? 8.737   -26.778 14.880 1.00 62.08 ? 129 GLU B CB    1 
ATOM   2557 C CG    . GLU B 1 129 ? 9.900   -27.742 14.768 1.00 64.04 ? 129 GLU B CG    1 
ATOM   2558 C CD    . GLU B 1 129 ? 11.220  -27.024 14.561 1.00 65.30 ? 129 GLU B CD    1 
ATOM   2559 O OE1   . GLU B 1 129 ? 11.292  -26.141 13.674 1.00 66.95 ? 129 GLU B OE1   1 
ATOM   2560 O OE2   . GLU B 1 129 ? 12.189  -27.346 15.282 1.00 66.15 ? 129 GLU B OE2   1 
ATOM   2561 N N     . LEU B 1 130 ? 6.293   -25.584 16.868 1.00 54.16 ? 130 LEU B N     1 
ATOM   2562 C CA    . LEU B 1 130 ? 5.280   -24.552 17.021 1.00 51.28 ? 130 LEU B CA    1 
ATOM   2563 C C     . LEU B 1 130 ? 5.889   -23.150 16.911 1.00 50.47 ? 130 LEU B C     1 
ATOM   2564 O O     . LEU B 1 130 ? 6.672   -22.727 17.769 1.00 50.23 ? 130 LEU B O     1 
ATOM   2565 C CB    . LEU B 1 130 ? 4.580   -24.709 18.369 1.00 49.33 ? 130 LEU B CB    1 
ATOM   2566 C CG    . LEU B 1 130 ? 3.490   -23.690 18.725 1.00 47.54 ? 130 LEU B CG    1 
ATOM   2567 C CD1   . LEU B 1 130 ? 2.288   -23.830 17.801 1.00 46.18 ? 130 LEU B CD1   1 
ATOM   2568 C CD2   . LEU B 1 130 ? 3.075   -23.915 20.156 1.00 45.87 ? 130 LEU B CD2   1 
ATOM   2569 N N     . LYS B 1 131 ? 5.515   -22.431 15.855 1.00 48.06 ? 131 LYS B N     1 
ATOM   2570 C CA    . LYS B 1 131 ? 6.030   -21.088 15.635 1.00 45.48 ? 131 LYS B CA    1 
ATOM   2571 C C     . LYS B 1 131 ? 4.952   -20.009 15.728 1.00 42.35 ? 131 LYS B C     1 
ATOM   2572 O O     . LYS B 1 131 ? 3.803   -20.223 15.337 1.00 41.05 ? 131 LYS B O     1 
ATOM   2573 C CB    . LYS B 1 131 ? 6.721   -21.035 14.278 1.00 48.22 ? 131 LYS B CB    1 
ATOM   2574 C CG    . LYS B 1 131 ? 7.927   -21.962 14.195 1.00 50.95 ? 131 LYS B CG    1 
ATOM   2575 C CD    . LYS B 1 131 ? 8.479   -22.031 12.781 1.00 54.80 ? 131 LYS B CD    1 
ATOM   2576 C CE    . LYS B 1 131 ? 9.522   -23.136 12.656 1.00 56.95 ? 131 LYS B CE    1 
ATOM   2577 N NZ    . LYS B 1 131 ? 10.514  -23.115 13.779 1.00 60.78 ? 131 LYS B NZ    1 
ATOM   2578 N N     . LEU B 1 132 ? 5.335   -18.860 16.283 1.00 39.16 ? 132 LEU B N     1 
ATOM   2579 C CA    . LEU B 1 132 ? 4.441   -17.721 16.427 1.00 35.78 ? 132 LEU B CA    1 
ATOM   2580 C C     . LEU B 1 132 ? 4.387   -16.956 15.108 1.00 36.21 ? 132 LEU B C     1 
ATOM   2581 O O     . LEU B 1 132 ? 5.416   -16.583 14.546 1.00 34.29 ? 132 LEU B O     1 
ATOM   2582 C CB    . LEU B 1 132 ? 4.950   -16.782 17.508 1.00 34.84 ? 132 LEU B CB    1 
ATOM   2583 C CG    . LEU B 1 132 ? 4.025   -15.609 17.819 1.00 36.05 ? 132 LEU B CG    1 
ATOM   2584 C CD1   . LEU B 1 132 ? 2.728   -16.139 18.454 1.00 35.75 ? 132 LEU B CD1   1 
ATOM   2585 C CD2   . LEU B 1 132 ? 4.725   -14.628 18.752 1.00 34.24 ? 132 LEU B CD2   1 
ATOM   2586 N N     . LEU B 1 133 ? 3.179   -16.721 14.614 1.00 35.84 ? 133 LEU B N     1 
ATOM   2587 C CA    . LEU B 1 133 ? 3.002   -15.997 13.367 1.00 33.58 ? 133 LEU B CA    1 
ATOM   2588 C C     . LEU B 1 133 ? 2.529   -14.573 13.645 1.00 34.17 ? 133 LEU B C     1 
ATOM   2589 O O     . LEU B 1 133 ? 1.562   -14.351 14.383 1.00 33.27 ? 133 LEU B O     1 
ATOM   2590 C CB    . LEU B 1 133 ? 1.991   -16.727 12.479 1.00 32.43 ? 133 LEU B CB    1 
ATOM   2591 C CG    . LEU B 1 133 ? 1.506   -15.997 11.220 1.00 30.93 ? 133 LEU B CG    1 
ATOM   2592 C CD1   . LEU B 1 133 ? 2.665   -15.750 10.301 1.00 25.80 ? 133 LEU B CD1   1 
ATOM   2593 C CD2   . LEU B 1 133 ? 0.441   -16.836 10.519 1.00 30.20 ? 133 LEU B CD2   1 
ATOM   2594 N N     . CYS B 1 134 ? 3.216   -13.598 13.065 1.00 32.94 ? 134 CYS B N     1 
ATOM   2595 C CA    . CYS B 1 134 ? 2.830   -12.210 13.276 1.00 31.54 ? 134 CYS B CA    1 
ATOM   2596 C C     . CYS B 1 134 ? 3.306   -11.327 12.144 1.00 30.07 ? 134 CYS B C     1 
ATOM   2597 O O     . CYS B 1 134 ? 4.113   -11.743 11.306 1.00 28.69 ? 134 CYS B O     1 
ATOM   2598 C CB    . CYS B 1 134 ? 3.409   -11.680 14.600 1.00 34.63 ? 134 CYS B CB    1 
ATOM   2599 S SG    . CYS B 1 134 ? 5.239   -11.557 14.664 1.00 38.59 ? 134 CYS B SG    1 
ATOM   2600 N N     . GLY B 1 135 ? 2.783   -10.107 12.130 1.00 28.97 ? 135 GLY B N     1 
ATOM   2601 C CA    . GLY B 1 135 ? 3.166   -9.139  11.136 1.00 29.60 ? 135 GLY B CA    1 
ATOM   2602 C C     . GLY B 1 135 ? 4.368   -8.376  11.657 1.00 30.98 ? 135 GLY B C     1 
ATOM   2603 O O     . GLY B 1 135 ? 4.620   -8.338  12.876 1.00 30.99 ? 135 GLY B O     1 
ATOM   2604 N N     . ALA B 1 136 ? 5.109   -7.766  10.735 1.00 31.27 ? 136 ALA B N     1 
ATOM   2605 C CA    . ALA B 1 136 ? 6.301   -7.001  11.077 1.00 33.33 ? 136 ALA B CA    1 
ATOM   2606 C C     . ALA B 1 136 ? 6.068   -5.964  12.173 1.00 34.11 ? 136 ALA B C     1 
ATOM   2607 O O     . ALA B 1 136 ? 6.958   -5.700  12.983 1.00 34.50 ? 136 ALA B O     1 
ATOM   2608 C CB    . ALA B 1 136 ? 6.867   -6.331  9.818  1.00 33.05 ? 136 ALA B CB    1 
ATOM   2609 N N     . ASP B 1 137 ? 4.876   -5.378  12.218 1.00 36.02 ? 137 ASP B N     1 
ATOM   2610 C CA    . ASP B 1 137 ? 4.597   -4.370  13.244 1.00 38.58 ? 137 ASP B CA    1 
ATOM   2611 C C     . ASP B 1 137 ? 4.706   -4.924  14.664 1.00 39.71 ? 137 ASP B C     1 
ATOM   2612 O O     . ASP B 1 137 ? 5.108   -4.207  15.586 1.00 38.51 ? 137 ASP B O     1 
ATOM   2613 C CB    . ASP B 1 137 ? 3.211   -3.754  13.034 1.00 38.50 ? 137 ASP B CB    1 
ATOM   2614 C CG    . ASP B 1 137 ? 2.108   -4.797  12.993 1.00 39.25 ? 137 ASP B CG    1 
ATOM   2615 O OD1   . ASP B 1 137 ? 2.311   -5.842  12.341 1.00 37.05 ? 137 ASP B OD1   1 
ATOM   2616 O OD2   . ASP B 1 137 ? 1.046   -4.558  13.596 1.00 39.84 ? 137 ASP B OD2   1 
ATOM   2617 N N     . VAL B 1 138 ? 4.340   -6.195  14.842 1.00 41.59 ? 138 VAL B N     1 
ATOM   2618 C CA    . VAL B 1 138 ? 4.413   -6.822  16.162 1.00 41.32 ? 138 VAL B CA    1 
ATOM   2619 C C     . VAL B 1 138 ? 5.881   -6.910  16.572 1.00 41.09 ? 138 VAL B C     1 
ATOM   2620 O O     . VAL B 1 138 ? 6.250   -6.620  17.704 1.00 39.56 ? 138 VAL B O     1 
ATOM   2621 C CB    . VAL B 1 138 ? 3.788   -8.247  16.142 1.00 43.01 ? 138 VAL B CB    1 
ATOM   2622 C CG1   . VAL B 1 138 ? 4.086   -8.985  17.466 1.00 41.56 ? 138 VAL B CG1   1 
ATOM   2623 C CG2   . VAL B 1 138 ? 2.270   -8.143  15.912 1.00 39.96 ? 138 VAL B CG2   1 
ATOM   2624 N N     . LEU B 1 139 ? 6.709   -7.287  15.609 1.00 41.53 ? 139 LEU B N     1 
ATOM   2625 C CA    . LEU B 1 139 ? 8.139   -7.441  15.802 1.00 40.60 ? 139 LEU B CA    1 
ATOM   2626 C C     . LEU B 1 139 ? 8.753   -6.132  16.284 1.00 40.09 ? 139 LEU B C     1 
ATOM   2627 O O     . LEU B 1 139 ? 9.641   -6.125  17.131 1.00 40.22 ? 139 LEU B O     1 
ATOM   2628 C CB    . LEU B 1 139 ? 8.769   -7.885  14.488 1.00 41.90 ? 139 LEU B CB    1 
ATOM   2629 C CG    . LEU B 1 139 ? 10.004  -8.774  14.565 1.00 42.85 ? 139 LEU B CG    1 
ATOM   2630 C CD1   . LEU B 1 139 ? 10.356  -9.302  13.184 1.00 41.43 ? 139 LEU B CD1   1 
ATOM   2631 C CD2   . LEU B 1 139 ? 11.144  -7.973  15.149 1.00 44.67 ? 139 LEU B CD2   1 
ATOM   2632 N N     . LYS B 1 140 ? 8.287   -5.013  15.749 1.00 39.18 ? 140 LYS B N     1 
ATOM   2633 C CA    . LYS B 1 140 ? 8.816   -3.742  16.198 1.00 38.27 ? 140 LYS B CA    1 
ATOM   2634 C C     . LYS B 1 140 ? 8.413   -3.437  17.647 1.00 37.09 ? 140 LYS B C     1 
ATOM   2635 O O     . LYS B 1 140 ? 9.074   -2.648  18.312 1.00 36.98 ? 140 LYS B O     1 
ATOM   2636 C CB    . LYS B 1 140 ? 8.348   -2.598  15.298 1.00 40.07 ? 140 LYS B CB    1 
ATOM   2637 C CG    . LYS B 1 140 ? 8.989   -1.273  15.679 1.00 42.17 ? 140 LYS B CG    1 
ATOM   2638 C CD    . LYS B 1 140 ? 8.459   -0.122  14.845 1.00 45.49 ? 140 LYS B CD    1 
ATOM   2639 C CE    . LYS B 1 140 ? 9.301   1.125   15.056 1.00 45.10 ? 140 LYS B CE    1 
ATOM   2640 N NZ    . LYS B 1 140 ? 8.976   2.163   14.038 1.00 46.74 ? 140 LYS B NZ    1 
ATOM   2641 N N     . THR B 1 141 ? 7.337   -4.043  18.141 1.00 35.84 ? 141 THR B N     1 
ATOM   2642 C CA    . THR B 1 141 ? 6.921   -3.768  19.513 1.00 38.54 ? 141 THR B CA    1 
ATOM   2643 C C     . THR B 1 141 ? 7.824   -4.446  20.540 1.00 39.56 ? 141 THR B C     1 
ATOM   2644 O O     . THR B 1 141 ? 7.758   -4.121  21.721 1.00 40.72 ? 141 THR B O     1 
ATOM   2645 C CB    . THR B 1 141 ? 5.442   -4.186  19.812 1.00 37.21 ? 141 THR B CB    1 
ATOM   2646 O OG1   . THR B 1 141 ? 5.332   -5.610  19.856 1.00 37.99 ? 141 THR B OG1   1 
ATOM   2647 C CG2   . THR B 1 141 ? 4.507   -3.642  18.758 1.00 37.97 ? 141 THR B CG2   1 
ATOM   2648 N N     . PHE B 1 142 ? 8.669   -5.377  20.101 1.00 39.64 ? 142 PHE B N     1 
ATOM   2649 C CA    . PHE B 1 142 ? 9.564   -6.046  21.034 1.00 41.40 ? 142 PHE B CA    1 
ATOM   2650 C C     . PHE B 1 142 ? 10.515  -5.009  21.608 1.00 42.77 ? 142 PHE B C     1 
ATOM   2651 O O     . PHE B 1 142 ? 11.190  -5.262  22.599 1.00 43.41 ? 142 PHE B O     1 
ATOM   2652 C CB    . PHE B 1 142 ? 10.397  -7.154  20.354 1.00 39.18 ? 142 PHE B CB    1 
ATOM   2653 C CG    . PHE B 1 142 ? 9.622   -8.416  20.022 1.00 37.48 ? 142 PHE B CG    1 
ATOM   2654 C CD1   . PHE B 1 142 ? 8.381   -8.675  20.593 1.00 36.97 ? 142 PHE B CD1   1 
ATOM   2655 C CD2   . PHE B 1 142 ? 10.152  -9.352  19.135 1.00 35.28 ? 142 PHE B CD2   1 
ATOM   2656 C CE1   . PHE B 1 142 ? 7.671   -9.857  20.278 1.00 35.90 ? 142 PHE B CE1   1 
ATOM   2657 C CE2   . PHE B 1 142 ? 9.457   -10.530 18.818 1.00 36.64 ? 142 PHE B CE2   1 
ATOM   2658 C CZ    . PHE B 1 142 ? 8.211   -10.782 19.391 1.00 35.53 ? 142 PHE B CZ    1 
ATOM   2659 N N     . GLN B 1 143 ? 10.577  -3.839  20.985 1.00 44.32 ? 143 GLN B N     1 
ATOM   2660 C CA    . GLN B 1 143 ? 11.480  -2.795  21.462 1.00 46.22 ? 143 GLN B CA    1 
ATOM   2661 C C     . GLN B 1 143 ? 10.812  -1.875  22.458 1.00 46.95 ? 143 GLN B C     1 
ATOM   2662 O O     . GLN B 1 143 ? 11.482  -1.234  23.256 1.00 48.72 ? 143 GLN B O     1 
ATOM   2663 C CB    . GLN B 1 143 ? 11.991  -1.926  20.308 1.00 47.23 ? 143 GLN B CB    1 
ATOM   2664 C CG    . GLN B 1 143 ? 12.232  -2.635  19.009 1.00 48.94 ? 143 GLN B CG    1 
ATOM   2665 C CD    . GLN B 1 143 ? 12.578  -1.652  17.904 1.00 50.19 ? 143 GLN B CD    1 
ATOM   2666 O OE1   . GLN B 1 143 ? 12.168  -0.481  17.943 1.00 48.43 ? 143 GLN B OE1   1 
ATOM   2667 N NE2   . GLN B 1 143 ? 13.329  -2.120  16.911 1.00 48.35 ? 143 GLN B NE2   1 
ATOM   2668 N N     . THR B 1 144 ? 9.490   -1.803  22.408 1.00 48.12 ? 144 THR B N     1 
ATOM   2669 C CA    . THR B 1 144 ? 8.765   -0.918  23.304 1.00 50.40 ? 144 THR B CA    1 
ATOM   2670 C C     . THR B 1 144 ? 9.087   -1.192  24.764 1.00 52.09 ? 144 THR B C     1 
ATOM   2671 O O     . THR B 1 144 ? 8.848   -2.280  25.271 1.00 51.08 ? 144 THR B O     1 
ATOM   2672 C CB    . THR B 1 144 ? 7.252   -1.036  23.106 1.00 50.03 ? 144 THR B CB    1 
ATOM   2673 O OG1   . THR B 1 144 ? 6.911   -0.655  21.767 1.00 50.46 ? 144 THR B OG1   1 
ATOM   2674 C CG2   . THR B 1 144 ? 6.530   -0.136  24.087 1.00 50.22 ? 144 THR B CG2   1 
ATOM   2675 N N     . PRO B 1 145 ? 9.631   -0.190  25.463 1.00 54.84 ? 145 PRO B N     1 
ATOM   2676 C CA    . PRO B 1 145 ? 9.995   -0.305  26.876 1.00 55.61 ? 145 PRO B CA    1 
ATOM   2677 C C     . PRO B 1 145 ? 8.966   -1.051  27.736 1.00 56.00 ? 145 PRO B C     1 
ATOM   2678 O O     . PRO B 1 145 ? 7.778   -0.715  27.766 1.00 55.72 ? 145 PRO B O     1 
ATOM   2679 C CB    . PRO B 1 145 ? 10.184  1.154   27.286 1.00 57.12 ? 145 PRO B CB    1 
ATOM   2680 C CG    . PRO B 1 145 ? 10.807  1.733   26.051 1.00 57.15 ? 145 PRO B CG    1 
ATOM   2681 C CD    . PRO B 1 145 ? 9.913   1.166   24.959 1.00 55.47 ? 145 PRO B CD    1 
ATOM   2682 N N     . ASN B 1 146 ? 9.429   -2.099  28.402 1.00 55.66 ? 146 ASN B N     1 
ATOM   2683 C CA    . ASN B 1 146 ? 8.572   -2.887  29.276 1.00 55.28 ? 146 ASN B CA    1 
ATOM   2684 C C     . ASN B 1 146 ? 7.415   -3.635  28.620 1.00 54.27 ? 146 ASN B C     1 
ATOM   2685 O O     . ASN B 1 146 ? 6.704   -4.371  29.304 1.00 53.77 ? 146 ASN B O     1 
ATOM   2686 C CB    . ASN B 1 146 ? 8.022   -1.989  30.396 1.00 57.29 ? 146 ASN B CB    1 
ATOM   2687 C CG    . ASN B 1 146 ? 9.127   -1.238  31.140 1.00 60.66 ? 146 ASN B CG    1 
ATOM   2688 O OD1   . ASN B 1 146 ? 10.246  -1.750  31.295 1.00 60.12 ? 146 ASN B OD1   1 
ATOM   2689 N ND2   . ASN B 1 146 ? 8.818   -0.024  31.610 1.00 60.16 ? 146 ASN B ND2   1 
ATOM   2690 N N     . LEU B 1 147 ? 7.206   -3.478  27.317 1.00 51.92 ? 147 LEU B N     1 
ATOM   2691 C CA    . LEU B 1 147 ? 6.074   -4.182  26.706 1.00 51.88 ? 147 LEU B CA    1 
ATOM   2692 C C     . LEU B 1 147 ? 6.237   -5.703  26.732 1.00 50.86 ? 147 LEU B C     1 
ATOM   2693 O O     . LEU B 1 147 ? 5.279   -6.432  26.992 1.00 51.68 ? 147 LEU B O     1 
ATOM   2694 C CB    . LEU B 1 147 ? 5.829   -3.706  25.265 1.00 52.35 ? 147 LEU B CB    1 
ATOM   2695 C CG    . LEU B 1 147 ? 4.498   -4.188  24.657 1.00 51.24 ? 147 LEU B CG    1 
ATOM   2696 C CD1   . LEU B 1 147 ? 3.342   -3.819  25.574 1.00 49.87 ? 147 LEU B CD1   1 
ATOM   2697 C CD2   . LEU B 1 147 ? 4.297   -3.559  23.281 1.00 51.67 ? 147 LEU B CD2   1 
ATOM   2698 N N     . TRP B 1 148 ? 7.445   -6.179  26.452 1.00 49.20 ? 148 TRP B N     1 
ATOM   2699 C CA    . TRP B 1 148 ? 7.714   -7.612  26.477 1.00 48.82 ? 148 TRP B CA    1 
ATOM   2700 C C     . TRP B 1 148 ? 8.888   -7.862  27.401 1.00 49.27 ? 148 TRP B C     1 
ATOM   2701 O O     . TRP B 1 148 ? 9.806   -7.043  27.481 1.00 49.70 ? 148 TRP B O     1 
ATOM   2702 C CB    . TRP B 1 148 ? 8.096   -8.150  25.096 1.00 46.44 ? 148 TRP B CB    1 
ATOM   2703 C CG    . TRP B 1 148 ? 7.079   -7.974  24.032 1.00 44.63 ? 148 TRP B CG    1 
ATOM   2704 C CD1   . TRP B 1 148 ? 6.786   -6.817  23.360 1.00 43.93 ? 148 TRP B CD1   1 
ATOM   2705 C CD2   . TRP B 1 148 ? 6.220   -8.983  23.493 1.00 43.54 ? 148 TRP B CD2   1 
ATOM   2706 N NE1   . TRP B 1 148 ? 5.799   -7.048  22.436 1.00 43.36 ? 148 TRP B NE1   1 
ATOM   2707 C CE2   . TRP B 1 148 ? 5.430   -8.367  22.495 1.00 42.71 ? 148 TRP B CE2   1 
ATOM   2708 C CE3   . TRP B 1 148 ? 6.038   -10.351 23.755 1.00 43.69 ? 148 TRP B CE3   1 
ATOM   2709 C CZ2   . TRP B 1 148 ? 4.471   -9.068  21.757 1.00 43.27 ? 148 TRP B CZ2   1 
ATOM   2710 C CZ3   . TRP B 1 148 ? 5.084   -11.051 23.020 1.00 43.01 ? 148 TRP B CZ3   1 
ATOM   2711 C CH2   . TRP B 1 148 ? 4.310   -10.404 22.030 1.00 43.41 ? 148 TRP B CH2   1 
ATOM   2712 N N     . LYS B 1 149 ? 8.860   -8.989  28.101 1.00 48.54 ? 149 LYS B N     1 
ATOM   2713 C CA    . LYS B 1 149 ? 9.964   -9.342  28.979 1.00 48.55 ? 149 LYS B CA    1 
ATOM   2714 C C     . LYS B 1 149 ? 11.054  -9.898  28.070 1.00 46.85 ? 149 LYS B C     1 
ATOM   2715 O O     . LYS B 1 149 ? 10.770  -10.722 27.201 1.00 47.10 ? 149 LYS B O     1 
ATOM   2716 C CB    . LYS B 1 149 ? 9.535   -10.423 29.986 1.00 49.92 ? 149 LYS B CB    1 
ATOM   2717 C CG    . LYS B 1 149 ? 8.629   -9.937  31.115 1.00 53.16 ? 149 LYS B CG    1 
ATOM   2718 C CD    . LYS B 1 149 ? 8.220   -11.095 32.035 1.00 57.43 ? 149 LYS B CD    1 
ATOM   2719 C CE    . LYS B 1 149 ? 9.449   -11.797 32.644 1.00 60.98 ? 149 LYS B CE    1 
ATOM   2720 N NZ    . LYS B 1 149 ? 9.115   -13.014 33.465 1.00 62.28 ? 149 LYS B NZ    1 
ATOM   2721 N N     . ASP B 1 150 ? 12.292  -9.445  28.249 1.00 46.55 ? 150 ASP B N     1 
ATOM   2722 C CA    . ASP B 1 150 ? 13.388  -9.950  27.426 1.00 44.88 ? 150 ASP B CA    1 
ATOM   2723 C C     . ASP B 1 150 ? 13.386  -11.484 27.488 1.00 44.31 ? 150 ASP B C     1 
ATOM   2724 O O     . ASP B 1 150 ? 13.604  -12.160 26.482 1.00 43.54 ? 150 ASP B O     1 
ATOM   2725 C CB    . ASP B 1 150 ? 14.744  -9.406  27.910 1.00 44.19 ? 150 ASP B CB    1 
ATOM   2726 C CG    . ASP B 1 150 ? 14.978  -7.939  27.517 1.00 47.75 ? 150 ASP B CG    1 
ATOM   2727 O OD1   . ASP B 1 150 ? 14.281  -7.415  26.612 1.00 45.23 ? 150 ASP B OD1   1 
ATOM   2728 O OD2   . ASP B 1 150 ? 15.881  -7.305  28.109 1.00 48.78 ? 150 ASP B OD2   1 
ATOM   2729 N N     . ALA B 1 151 ? 13.108  -12.028 28.669 1.00 42.68 ? 151 ALA B N     1 
ATOM   2730 C CA    . ALA B 1 151 ? 13.080  -13.476 28.851 1.00 42.74 ? 151 ALA B CA    1 
ATOM   2731 C C     . ALA B 1 151 ? 12.040  -14.122 27.941 1.00 41.70 ? 151 ALA B C     1 
ATOM   2732 O O     . ALA B 1 151 ? 12.226  -15.233 27.456 1.00 41.53 ? 151 ALA B O     1 
ATOM   2733 C CB    . ALA B 1 151 ? 12.783  -13.823 30.324 1.00 42.23 ? 151 ALA B CB    1 
ATOM   2734 N N     . HIS B 1 152 ? 10.935  -13.426 27.715 1.00 41.73 ? 152 HIS B N     1 
ATOM   2735 C CA    . HIS B 1 152 ? 9.891   -13.957 26.843 1.00 40.07 ? 152 HIS B CA    1 
ATOM   2736 C C     . HIS B 1 152 ? 10.263  -13.871 25.366 1.00 37.94 ? 152 HIS B C     1 
ATOM   2737 O O     . HIS B 1 152 ? 9.992   -14.789 24.600 1.00 36.99 ? 152 HIS B O     1 
ATOM   2738 C CB    . HIS B 1 152 ? 8.584   -13.229 27.111 1.00 43.14 ? 152 HIS B CB    1 
ATOM   2739 C CG    . HIS B 1 152 ? 8.004   -13.544 28.450 1.00 47.28 ? 152 HIS B CG    1 
ATOM   2740 N ND1   . HIS B 1 152 ? 6.805   -13.030 28.885 1.00 48.30 ? 152 HIS B ND1   1 
ATOM   2741 C CD2   . HIS B 1 152 ? 8.469   -14.322 29.458 1.00 49.23 ? 152 HIS B CD2   1 
ATOM   2742 C CE1   . HIS B 1 152 ? 6.555   -13.474 30.104 1.00 50.67 ? 152 HIS B CE1   1 
ATOM   2743 N NE2   . HIS B 1 152 ? 7.549   -14.261 30.474 1.00 49.58 ? 152 HIS B NE2   1 
ATOM   2744 N N     . ILE B 1 153 ? 10.878  -12.764 24.965 1.00 38.50 ? 153 ILE B N     1 
ATOM   2745 C CA    . ILE B 1 153 ? 11.302  -12.605 23.580 1.00 37.74 ? 153 ILE B CA    1 
ATOM   2746 C C     . ILE B 1 153 ? 12.279  -13.737 23.282 1.00 38.63 ? 153 ILE B C     1 
ATOM   2747 O O     . ILE B 1 153 ? 12.233  -14.346 22.207 1.00 40.25 ? 153 ILE B O     1 
ATOM   2748 C CB    . ILE B 1 153 ? 12.003  -11.265 23.369 1.00 37.15 ? 153 ILE B CB    1 
ATOM   2749 C CG1   . ILE B 1 153 ? 11.017  -10.128 23.669 1.00 38.54 ? 153 ILE B CG1   1 
ATOM   2750 C CG2   . ILE B 1 153 ? 12.555  -11.188 21.954 1.00 37.96 ? 153 ILE B CG2   1 
ATOM   2751 C CD1   . ILE B 1 153 ? 11.665  -8.762  23.841 1.00 37.69 ? 153 ILE B CD1   1 
ATOM   2752 N N     . GLN B 1 154 ? 13.147  -14.042 24.244 1.00 39.49 ? 154 GLN B N     1 
ATOM   2753 C CA    . GLN B 1 154 ? 14.111  -15.116 24.060 1.00 40.73 ? 154 GLN B CA    1 
ATOM   2754 C C     . GLN B 1 154 ? 13.431  -16.466 23.938 1.00 39.70 ? 154 GLN B C     1 
ATOM   2755 O O     . GLN B 1 154 ? 13.729  -17.229 23.028 1.00 41.38 ? 154 GLN B O     1 
ATOM   2756 C CB    . GLN B 1 154 ? 15.126  -15.172 25.211 1.00 44.11 ? 154 GLN B CB    1 
ATOM   2757 C CG    . GLN B 1 154 ? 16.288  -16.145 24.918 1.00 46.42 ? 154 GLN B CG    1 
ATOM   2758 C CD    . GLN B 1 154 ? 17.369  -16.127 25.981 1.00 49.96 ? 154 GLN B CD    1 
ATOM   2759 O OE1   . GLN B 1 154 ? 17.723  -15.067 26.508 1.00 52.08 ? 154 GLN B OE1   1 
ATOM   2760 N NE2   . GLN B 1 154 ? 17.915  -17.303 26.295 1.00 51.28 ? 154 GLN B NE2   1 
ATOM   2761 N N     . GLU B 1 155 ? 12.511  -16.773 24.838 1.00 39.76 ? 155 GLU B N     1 
ATOM   2762 C CA    . GLU B 1 155 ? 11.833  -18.068 24.764 1.00 39.95 ? 155 GLU B CA    1 
ATOM   2763 C C     . GLU B 1 155 ? 11.073  -18.223 23.441 1.00 40.51 ? 155 GLU B C     1 
ATOM   2764 O O     . GLU B 1 155 ? 11.039  -19.297 22.830 1.00 38.93 ? 155 GLU B O     1 
ATOM   2765 C CB    . GLU B 1 155 ? 10.858  -18.226 25.932 1.00 39.58 ? 155 GLU B CB    1 
ATOM   2766 C CG    . GLU B 1 155 ? 10.317  -19.632 26.072 1.00 38.99 ? 155 GLU B CG    1 
ATOM   2767 C CD    . GLU B 1 155 ? 9.401   -19.790 27.264 1.00 40.00 ? 155 GLU B CD    1 
ATOM   2768 O OE1   . GLU B 1 155 ? 9.577   -19.039 28.249 1.00 40.73 ? 155 GLU B OE1   1 
ATOM   2769 O OE2   . GLU B 1 155 ? 8.512   -20.672 27.219 1.00 41.08 ? 155 GLU B OE2   1 
ATOM   2770 N N     . ILE B 1 156 ? 10.460  -17.137 22.996 1.00 40.43 ? 156 ILE B N     1 
ATOM   2771 C CA    . ILE B 1 156 ? 9.712   -17.175 21.759 1.00 39.72 ? 156 ILE B CA    1 
ATOM   2772 C C     . ILE B 1 156 ? 10.560  -17.594 20.556 1.00 38.22 ? 156 ILE B C     1 
ATOM   2773 O O     . ILE B 1 156 ? 10.160  -18.478 19.790 1.00 37.19 ? 156 ILE B O     1 
ATOM   2774 C CB    . ILE B 1 156 ? 9.058   -15.800 21.499 1.00 40.80 ? 156 ILE B CB    1 
ATOM   2775 C CG1   . ILE B 1 156 ? 7.980   -15.552 22.554 1.00 42.45 ? 156 ILE B CG1   1 
ATOM   2776 C CG2   . ILE B 1 156 ? 8.475   -15.749 20.108 1.00 41.19 ? 156 ILE B CG2   1 
ATOM   2777 C CD1   . ILE B 1 156 ? 7.290   -14.207 22.456 1.00 42.19 ? 156 ILE B CD1   1 
ATOM   2778 N N     . VAL B 1 157 ? 11.731  -16.985 20.388 1.00 38.48 ? 157 VAL B N     1 
ATOM   2779 C CA    . VAL B 1 157 ? 12.581  -17.310 19.231 1.00 40.40 ? 157 VAL B CA    1 
ATOM   2780 C C     . VAL B 1 157 ? 13.628  -18.390 19.462 1.00 42.65 ? 157 VAL B C     1 
ATOM   2781 O O     . VAL B 1 157 ? 14.338  -18.779 18.542 1.00 44.46 ? 157 VAL B O     1 
ATOM   2782 C CB    . VAL B 1 157 ? 13.315  -16.056 18.690 1.00 39.75 ? 157 VAL B CB    1 
ATOM   2783 C CG1   . VAL B 1 157 ? 12.295  -15.038 18.211 1.00 41.05 ? 157 VAL B CG1   1 
ATOM   2784 C CG2   . VAL B 1 157 ? 14.205  -15.454 19.769 1.00 35.50 ? 157 VAL B CG2   1 
ATOM   2785 N N     . GLU B 1 158 ? 13.735  -18.871 20.690 1.00 43.94 ? 158 GLU B N     1 
ATOM   2786 C CA    . GLU B 1 158 ? 14.701  -19.916 20.997 1.00 45.23 ? 158 GLU B CA    1 
ATOM   2787 C C     . GLU B 1 158 ? 13.981  -21.265 21.156 1.00 44.68 ? 158 GLU B C     1 
ATOM   2788 O O     . GLU B 1 158 ? 14.338  -22.267 20.523 1.00 43.59 ? 158 GLU B O     1 
ATOM   2789 C CB    . GLU B 1 158 ? 15.454  -19.559 22.278 1.00 46.96 ? 158 GLU B CB    1 
ATOM   2790 C CG    . GLU B 1 158 ? 16.347  -20.666 22.791 1.00 51.35 ? 158 GLU B CG    1 
ATOM   2791 C CD    . GLU B 1 158 ? 16.943  -20.320 24.129 1.00 53.88 ? 158 GLU B CD    1 
ATOM   2792 O OE1   . GLU B 1 158 ? 17.957  -19.594 24.147 1.00 55.41 ? 158 GLU B OE1   1 
ATOM   2793 O OE2   . GLU B 1 158 ? 16.383  -20.753 25.166 1.00 57.41 ? 158 GLU B OE2   1 
ATOM   2794 N N     . LYS B 1 159 ? 12.955  -21.280 21.998 1.00 43.69 ? 159 LYS B N     1 
ATOM   2795 C CA    . LYS B 1 159 ? 12.185  -22.488 22.222 1.00 42.49 ? 159 LYS B CA    1 
ATOM   2796 C C     . LYS B 1 159 ? 11.231  -22.782 21.069 1.00 43.08 ? 159 LYS B C     1 
ATOM   2797 O O     . LYS B 1 159 ? 11.174  -23.906 20.561 1.00 40.88 ? 159 LYS B O     1 
ATOM   2798 C CB    . LYS B 1 159 ? 11.400  -22.363 23.529 1.00 44.29 ? 159 LYS B CB    1 
ATOM   2799 C CG    . LYS B 1 159 ? 10.450  -23.524 23.824 1.00 47.80 ? 159 LYS B CG    1 
ATOM   2800 C CD    . LYS B 1 159 ? 10.148  -23.609 25.318 1.00 49.92 ? 159 LYS B CD    1 
ATOM   2801 C CE    . LYS B 1 159 ? 9.043   -24.620 25.640 1.00 53.27 ? 159 LYS B CE    1 
ATOM   2802 N NZ    . LYS B 1 159 ? 9.359   -26.037 25.274 1.00 54.73 ? 159 LYS B NZ    1 
ATOM   2803 N N     . PHE B 1 160 ? 10.493  -21.764 20.635 1.00 43.85 ? 160 PHE B N     1 
ATOM   2804 C CA    . PHE B 1 160 ? 9.520   -21.971 19.576 1.00 44.27 ? 160 PHE B CA    1 
ATOM   2805 C C     . PHE B 1 160 ? 9.987   -21.538 18.195 1.00 45.17 ? 160 PHE B C     1 
ATOM   2806 O O     . PHE B 1 160 ? 10.546  -22.338 17.441 1.00 46.29 ? 160 PHE B O     1 
ATOM   2807 C CB    . PHE B 1 160 ? 8.212   -21.270 19.952 1.00 43.22 ? 160 PHE B CB    1 
ATOM   2808 C CG    . PHE B 1 160 ? 7.649   -21.722 21.275 1.00 42.36 ? 160 PHE B CG    1 
ATOM   2809 C CD1   . PHE B 1 160 ? 7.065   -22.975 21.402 1.00 41.39 ? 160 PHE B CD1   1 
ATOM   2810 C CD2   . PHE B 1 160 ? 7.748   -20.912 22.404 1.00 41.34 ? 160 PHE B CD2   1 
ATOM   2811 C CE1   . PHE B 1 160 ? 6.582   -23.424 22.639 1.00 41.46 ? 160 PHE B CE1   1 
ATOM   2812 C CE2   . PHE B 1 160 ? 7.274   -21.343 23.643 1.00 41.46 ? 160 PHE B CE2   1 
ATOM   2813 C CZ    . PHE B 1 160 ? 6.685   -22.609 23.761 1.00 40.30 ? 160 PHE B CZ    1 
ATOM   2814 N N     . GLY B 1 161 ? 9.755   -20.277 17.857 1.00 43.72 ? 161 GLY B N     1 
ATOM   2815 C CA    . GLY B 1 161 ? 10.147  -19.800 16.547 1.00 42.34 ? 161 GLY B CA    1 
ATOM   2816 C C     . GLY B 1 161 ? 9.228   -18.675 16.138 1.00 41.62 ? 161 GLY B C     1 
ATOM   2817 O O     . GLY B 1 161 ? 8.115   -18.557 16.654 1.00 42.28 ? 161 GLY B O     1 
ATOM   2818 N N     . LEU B 1 162 ? 9.679   -17.862 15.194 1.00 39.71 ? 162 LEU B N     1 
ATOM   2819 C CA    . LEU B 1 162 ? 8.908   -16.713 14.772 1.00 36.96 ? 162 LEU B CA    1 
ATOM   2820 C C     . LEU B 1 162 ? 8.872   -16.559 13.255 1.00 35.42 ? 162 LEU B C     1 
ATOM   2821 O O     . LEU B 1 162 ? 9.915   -16.557 12.603 1.00 35.30 ? 162 LEU B O     1 
ATOM   2822 C CB    . LEU B 1 162 ? 9.526   -15.475 15.425 1.00 37.40 ? 162 LEU B CB    1 
ATOM   2823 C CG    . LEU B 1 162 ? 8.911   -14.081 15.363 1.00 41.11 ? 162 LEU B CG    1 
ATOM   2824 C CD1   . LEU B 1 162 ? 7.568   -14.041 16.051 1.00 40.52 ? 162 LEU B CD1   1 
ATOM   2825 C CD2   . LEU B 1 162 ? 9.865   -13.122 16.058 1.00 41.78 ? 162 LEU B CD2   1 
ATOM   2826 N N     . VAL B 1 163 ? 7.663   -16.479 12.702 1.00 33.89 ? 163 VAL B N     1 
ATOM   2827 C CA    . VAL B 1 163 ? 7.456   -16.268 11.269 1.00 33.63 ? 163 VAL B CA    1 
ATOM   2828 C C     . VAL B 1 163 ? 6.784   -14.899 11.178 1.00 34.00 ? 163 VAL B C     1 
ATOM   2829 O O     . VAL B 1 163 ? 5.717   -14.659 11.746 1.00 31.19 ? 163 VAL B O     1 
ATOM   2830 C CB    . VAL B 1 163 ? 6.550   -17.329 10.647 1.00 33.81 ? 163 VAL B CB    1 
ATOM   2831 C CG1   . VAL B 1 163 ? 6.392   -17.057 9.170  1.00 32.23 ? 163 VAL B CG1   1 
ATOM   2832 C CG2   . VAL B 1 163 ? 7.159   -18.715 10.855 1.00 33.78 ? 163 VAL B CG2   1 
ATOM   2833 N N     . CYS B 1 164 ? 7.442   -13.999 10.473 1.00 34.73 ? 164 CYS B N     1 
ATOM   2834 C CA    . CYS B 1 164 ? 6.979   -12.637 10.352 1.00 37.46 ? 164 CYS B CA    1 
ATOM   2835 C C     . CYS B 1 164 ? 6.623   -12.254 8.920  1.00 36.33 ? 164 CYS B C     1 
ATOM   2836 O O     . CYS B 1 164 ? 7.403   -12.478 8.004  1.00 36.46 ? 164 CYS B O     1 
ATOM   2837 C CB    . CYS B 1 164 ? 8.080   -11.730 10.905 1.00 40.24 ? 164 CYS B CB    1 
ATOM   2838 S SG    . CYS B 1 164 ? 7.869   -9.992  10.559 1.00 47.53 ? 164 CYS B SG    1 
ATOM   2839 N N     . VAL B 1 165 ? 5.434   -11.690 8.726  1.00 35.11 ? 165 VAL B N     1 
ATOM   2840 C CA    . VAL B 1 165 ? 5.014   -11.281 7.387  1.00 33.79 ? 165 VAL B CA    1 
ATOM   2841 C C     . VAL B 1 165 ? 5.250   -9.780  7.244  1.00 33.04 ? 165 VAL B C     1 
ATOM   2842 O O     . VAL B 1 165 ? 4.964   -9.000  8.146  1.00 33.58 ? 165 VAL B O     1 
ATOM   2843 C CB    . VAL B 1 165 ? 3.529   -11.651 7.128  1.00 32.98 ? 165 VAL B CB    1 
ATOM   2844 C CG1   . VAL B 1 165 ? 3.066   -11.109 5.780  1.00 33.80 ? 165 VAL B CG1   1 
ATOM   2845 C CG2   . VAL B 1 165 ? 3.380   -13.172 7.139  1.00 31.41 ? 165 VAL B CG2   1 
ATOM   2846 N N     . GLY B 1 166 ? 5.804   -9.385  6.111  1.00 34.35 ? 166 GLY B N     1 
ATOM   2847 C CA    . GLY B 1 166 ? 6.100   -7.986  5.897  1.00 35.60 ? 166 GLY B CA    1 
ATOM   2848 C C     . GLY B 1 166 ? 4.907   -7.055  5.935  1.00 36.19 ? 166 GLY B C     1 
ATOM   2849 O O     . GLY B 1 166 ? 3.785   -7.445  5.622  1.00 36.45 ? 166 GLY B O     1 
ATOM   2850 N N     . ARG B 1 167 ? 5.155   -5.821  6.353  1.00 36.43 ? 167 ARG B N     1 
ATOM   2851 C CA    . ARG B 1 167 ? 4.118   -4.801  6.391  1.00 37.21 ? 167 ARG B CA    1 
ATOM   2852 C C     . ARG B 1 167 ? 4.756   -3.478  6.025  1.00 38.11 ? 167 ARG B C     1 
ATOM   2853 O O     . ARG B 1 167 ? 5.910   -3.227  6.370  1.00 35.75 ? 167 ARG B O     1 
ATOM   2854 C CB    . ARG B 1 167 ? 3.467   -4.727  7.765  1.00 38.19 ? 167 ARG B CB    1 
ATOM   2855 C CG    . ARG B 1 167 ? 2.618   -5.941  8.035  1.00 40.37 ? 167 ARG B CG    1 
ATOM   2856 C CD    . ARG B 1 167 ? 1.653   -5.698  9.135  1.00 45.89 ? 167 ARG B CD    1 
ATOM   2857 N NE    . ARG B 1 167 ? 0.636   -4.719  8.761  1.00 47.91 ? 167 ARG B NE    1 
ATOM   2858 C CZ    . ARG B 1 167 ? -0.394  -4.398  9.537  1.00 47.89 ? 167 ARG B CZ    1 
ATOM   2859 N NH1   . ARG B 1 167 ? -0.535  -4.986  10.717 1.00 49.42 ? 167 ARG B NH1   1 
ATOM   2860 N NH2   . ARG B 1 167 ? -1.272  -3.482  9.145  1.00 49.64 ? 167 ARG B NH2   1 
ATOM   2861 N N     . VAL B 1 168 ? 4.002   -2.645  5.307  1.00 39.34 ? 168 VAL B N     1 
ATOM   2862 C CA    . VAL B 1 168 ? 4.478   -1.344  4.842  1.00 39.24 ? 168 VAL B CA    1 
ATOM   2863 C C     . VAL B 1 168 ? 4.954   -0.437  5.956  1.00 38.52 ? 168 VAL B C     1 
ATOM   2864 O O     . VAL B 1 168 ? 4.249   -0.224  6.930  1.00 38.33 ? 168 VAL B O     1 
ATOM   2865 C CB    . VAL B 1 168 ? 3.375   -0.604  4.048  1.00 41.30 ? 168 VAL B CB    1 
ATOM   2866 C CG1   . VAL B 1 168 ? 3.843   0.821   3.686  1.00 40.08 ? 168 VAL B CG1   1 
ATOM   2867 C CG2   . VAL B 1 168 ? 3.046   -1.403  2.780  1.00 42.41 ? 168 VAL B CG2   1 
ATOM   2868 N N     . SER B 1 169 ? 6.153   0.109   5.785  1.00 38.68 ? 169 SER B N     1 
ATOM   2869 C CA    . SER B 1 169 ? 6.722   0.998   6.780  1.00 37.43 ? 169 SER B CA    1 
ATOM   2870 C C     . SER B 1 169 ? 7.575   0.283   7.816  1.00 37.76 ? 169 SER B C     1 
ATOM   2871 O O     . SER B 1 169 ? 8.148   0.920   8.712  1.00 37.22 ? 169 SER B O     1 
ATOM   2872 N N     . HIS B 1 170 ? 7.662   -1.041  7.719  1.00 35.93 ? 170 HIS B N     1 
ATOM   2873 C CA    . HIS B 1 170 ? 8.468   -1.781  8.688  1.00 33.84 ? 170 HIS B CA    1 
ATOM   2874 C C     . HIS B 1 170 ? 9.641   -2.450  8.047  1.00 32.64 ? 170 HIS B C     1 
ATOM   2875 O O     . HIS B 1 170 ? 9.535   -2.949  6.933  1.00 33.96 ? 170 HIS B O     1 
ATOM   2876 C CB    . HIS B 1 170 ? 7.632   -2.825  9.407  1.00 33.09 ? 170 HIS B CB    1 
ATOM   2877 C CG    . HIS B 1 170 ? 6.569   -2.238  10.271 1.00 33.35 ? 170 HIS B CG    1 
ATOM   2878 N ND1   . HIS B 1 170 ? 5.298   -1.968  9.809  1.00 37.19 ? 170 HIS B ND1   1 
ATOM   2879 C CD2   . HIS B 1 170 ? 6.595   -1.835  11.558 1.00 33.59 ? 170 HIS B CD2   1 
ATOM   2880 C CE1   . HIS B 1 170 ? 4.588   -1.426  10.780 1.00 35.48 ? 170 HIS B CE1   1 
ATOM   2881 N NE2   . HIS B 1 170 ? 5.352   -1.336  11.852 1.00 34.18 ? 170 HIS B NE2   1 
ATOM   2882 N N     . ASP B 1 171 ? 10.766  -2.448  8.754  1.00 30.90 ? 171 ASP B N     1 
ATOM   2883 C CA    . ASP B 1 171 ? 11.972  -3.081  8.259  1.00 30.91 ? 171 ASP B CA    1 
ATOM   2884 C C     . ASP B 1 171 ? 12.391  -4.212  9.230  1.00 32.75 ? 171 ASP B C     1 
ATOM   2885 O O     . ASP B 1 171 ? 13.261  -4.027  10.075 1.00 28.16 ? 171 ASP B O     1 
ATOM   2886 C CB    . ASP B 1 171 ? 13.084  -2.045  8.123  1.00 31.05 ? 171 ASP B CB    1 
ATOM   2887 C CG    . ASP B 1 171 ? 14.275  -2.587  7.388  1.00 32.23 ? 171 ASP B CG    1 
ATOM   2888 O OD1   . ASP B 1 171 ? 14.110  -2.976  6.223  1.00 34.88 ? 171 ASP B OD1   1 
ATOM   2889 O OD2   . ASP B 1 171 ? 15.377  -2.647  7.974  1.00 33.23 ? 171 ASP B OD2   1 
ATOM   2890 N N     . PRO B 1 172 ? 11.755  -5.399  9.105  1.00 33.38 ? 172 PRO B N     1 
ATOM   2891 C CA    . PRO B 1 172 ? 11.996  -6.593  9.926  1.00 34.72 ? 172 PRO B CA    1 
ATOM   2892 C C     . PRO B 1 172 ? 13.472  -6.965  10.044 1.00 34.10 ? 172 PRO B C     1 
ATOM   2893 O O     . PRO B 1 172 ? 13.962  -7.207  11.142 1.00 36.58 ? 172 PRO B O     1 
ATOM   2894 C CB    . PRO B 1 172 ? 11.183  -7.677  9.220  1.00 34.12 ? 172 PRO B CB    1 
ATOM   2895 C CG    . PRO B 1 172 ? 10.098  -6.934  8.584  1.00 37.40 ? 172 PRO B CG    1 
ATOM   2896 C CD    . PRO B 1 172 ? 10.760  -5.685  8.061  1.00 35.42 ? 172 PRO B CD    1 
ATOM   2897 N N     . LYS B 1 173 ? 14.182  -7.009  8.921  1.00 33.65 ? 173 LYS B N     1 
ATOM   2898 C CA    . LYS B 1 173 ? 15.604  -7.347  8.953  1.00 34.04 ? 173 LYS B CA    1 
ATOM   2899 C C     . LYS B 1 173 ? 16.361  -6.423  9.918  1.00 33.77 ? 173 LYS B C     1 
ATOM   2900 O O     . LYS B 1 173 ? 17.263  -6.863  10.639 1.00 32.74 ? 173 LYS B O     1 
ATOM   2901 C CB    . LYS B 1 173 ? 16.229  -7.227  7.564  1.00 35.04 ? 173 LYS B CB    1 
ATOM   2902 C CG    . LYS B 1 173 ? 15.772  -8.243  6.521  1.00 37.40 ? 173 LYS B CG    1 
ATOM   2903 C CD    . LYS B 1 173 ? 16.491  -7.951  5.198  1.00 39.12 ? 173 LYS B CD    1 
ATOM   2904 C CE    . LYS B 1 173 ? 16.075  -8.886  4.073  1.00 43.49 ? 173 LYS B CE    1 
ATOM   2905 N NZ    . LYS B 1 173 ? 16.956  -8.675  2.871  1.00 47.60 ? 173 LYS B NZ    1 
ATOM   2906 N N     . GLY B 1 174 ? 15.990  -5.142  9.919  1.00 33.13 ? 174 GLY B N     1 
ATOM   2907 C CA    . GLY B 1 174 ? 16.623  -4.171  10.797 1.00 30.46 ? 174 GLY B CA    1 
ATOM   2908 C C     . GLY B 1 174 ? 16.217  -4.360  12.254 1.00 32.68 ? 174 GLY B C     1 
ATOM   2909 O O     . GLY B 1 174 ? 17.022  -4.144  13.165 1.00 31.47 ? 174 GLY B O     1 
ATOM   2910 N N     . TYR B 1 175 ? 14.966  -4.737  12.495 1.00 31.80 ? 175 TYR B N     1 
ATOM   2911 C CA    . TYR B 1 175 ? 14.538  -4.957  13.871 1.00 33.41 ? 175 TYR B CA    1 
ATOM   2912 C C     . TYR B 1 175 ? 15.360  -6.107  14.416 1.00 33.52 ? 175 TYR B C     1 
ATOM   2913 O O     . TYR B 1 175 ? 15.899  -6.040  15.516 1.00 33.71 ? 175 TYR B O     1 
ATOM   2914 C CB    . TYR B 1 175 ? 13.066  -5.342  13.942 1.00 32.42 ? 175 TYR B CB    1 
ATOM   2915 C CG    . TYR B 1 175 ? 12.100  -4.300  13.417 1.00 34.07 ? 175 TYR B CG    1 
ATOM   2916 C CD1   . TYR B 1 175 ? 12.453  -2.948  13.348 1.00 32.08 ? 175 TYR B CD1   1 
ATOM   2917 C CD2   . TYR B 1 175 ? 10.823  -4.669  13.003 1.00 32.18 ? 175 TYR B CD2   1 
ATOM   2918 C CE1   . TYR B 1 175 ? 11.559  -1.996  12.878 1.00 33.02 ? 175 TYR B CE1   1 
ATOM   2919 C CE2   . TYR B 1 175 ? 9.922   -3.731  12.536 1.00 33.68 ? 175 TYR B CE2   1 
ATOM   2920 C CZ    . TYR B 1 175 ? 10.288  -2.397  12.473 1.00 34.14 ? 175 TYR B CZ    1 
ATOM   2921 O OH    . TYR B 1 175 ? 9.369   -1.476  12.019 1.00 34.83 ? 175 TYR B OH    1 
ATOM   2922 N N     . ILE B 1 176 ? 15.457  -7.170  13.628 1.00 33.83 ? 176 ILE B N     1 
ATOM   2923 C CA    . ILE B 1 176 ? 16.218  -8.341  14.036 1.00 33.84 ? 176 ILE B CA    1 
ATOM   2924 C C     . ILE B 1 176 ? 17.698  -8.021  14.297 1.00 35.07 ? 176 ILE B C     1 
ATOM   2925 O O     . ILE B 1 176 ? 18.251  -8.419  15.326 1.00 35.21 ? 176 ILE B O     1 
ATOM   2926 C CB    . ILE B 1 176 ? 16.099  -9.457  12.978 1.00 33.88 ? 176 ILE B CB    1 
ATOM   2927 C CG1   . ILE B 1 176 ? 14.675  -10.019 12.990 1.00 32.75 ? 176 ILE B CG1   1 
ATOM   2928 C CG2   . ILE B 1 176 ? 17.135  -10.557 13.239 1.00 34.82 ? 176 ILE B CG2   1 
ATOM   2929 C CD1   . ILE B 1 176 ? 14.328  -10.832 11.757 1.00 30.05 ? 176 ILE B CD1   1 
ATOM   2930 N N     . ALA B 1 177 ? 18.340  -7.299  13.384 1.00 34.36 ? 177 ALA B N     1 
ATOM   2931 C CA    . ALA B 1 177 ? 19.752  -6.980  13.560 1.00 36.34 ? 177 ALA B CA    1 
ATOM   2932 C C     . ALA B 1 177 ? 20.025  -6.112  14.781 1.00 37.83 ? 177 ALA B C     1 
ATOM   2933 O O     . ALA B 1 177 ? 21.061  -6.249  15.423 1.00 39.43 ? 177 ALA B O     1 
ATOM   2934 C CB    . ALA B 1 177 ? 20.309  -6.281  12.301 1.00 36.51 ? 177 ALA B CB    1 
ATOM   2935 N N     . GLU B 1 178 ? 19.102  -5.217  15.112 1.00 39.03 ? 178 GLU B N     1 
ATOM   2936 C CA    . GLU B 1 178 ? 19.312  -4.323  16.235 1.00 40.37 ? 178 GLU B CA    1 
ATOM   2937 C C     . GLU B 1 178 ? 18.890  -4.843  17.597 1.00 41.67 ? 178 GLU B C     1 
ATOM   2938 O O     . GLU B 1 178 ? 19.086  -4.161  18.602 1.00 43.78 ? 178 GLU B O     1 
ATOM   2939 C CB    . GLU B 1 178 ? 18.623  -2.997  15.957 1.00 40.28 ? 178 GLU B CB    1 
ATOM   2940 C CG    . GLU B 1 178 ? 19.016  -2.424  14.610 1.00 43.01 ? 178 GLU B CG    1 
ATOM   2941 C CD    . GLU B 1 178 ? 18.471  -1.039  14.387 1.00 42.41 ? 178 GLU B CD    1 
ATOM   2942 O OE1   . GLU B 1 178 ? 17.325  -0.783  14.813 1.00 41.07 ? 178 GLU B OE1   1 
ATOM   2943 O OE2   . GLU B 1 178 ? 19.193  -0.226  13.782 1.00 40.22 ? 178 GLU B OE2   1 
ATOM   2944 N N     . SER B 1 179 ? 18.281  -6.020  17.637 1.00 41.37 ? 179 SER B N     1 
ATOM   2945 C CA    . SER B 1 179 ? 17.883  -6.603  18.912 1.00 42.47 ? 179 SER B CA    1 
ATOM   2946 C C     . SER B 1 179 ? 18.901  -7.673  19.268 1.00 42.10 ? 179 SER B C     1 
ATOM   2947 O O     . SER B 1 179 ? 18.981  -8.709  18.617 1.00 42.77 ? 179 SER B O     1 
ATOM   2948 C CB    . SER B 1 179 ? 16.496  -7.237  18.836 1.00 42.95 ? 179 SER B CB    1 
ATOM   2949 O OG    . SER B 1 179 ? 16.298  -8.130  19.922 1.00 42.06 ? 179 SER B OG    1 
ATOM   2950 N N     . PRO B 1 180 ? 19.703  -7.429  20.307 1.00 43.48 ? 180 PRO B N     1 
ATOM   2951 C CA    . PRO B 1 180 ? 20.704  -8.420  20.702 1.00 44.17 ? 180 PRO B CA    1 
ATOM   2952 C C     . PRO B 1 180 ? 20.095  -9.796  20.929 1.00 43.29 ? 180 PRO B C     1 
ATOM   2953 O O     . PRO B 1 180 ? 20.772  -10.801 20.755 1.00 44.35 ? 180 PRO B O     1 
ATOM   2954 C CB    . PRO B 1 180 ? 21.300  -7.823  21.971 1.00 45.81 ? 180 PRO B CB    1 
ATOM   2955 C CG    . PRO B 1 180 ? 20.153  -7.055  22.548 1.00 47.97 ? 180 PRO B CG    1 
ATOM   2956 C CD    . PRO B 1 180 ? 19.596  -6.364  21.318 1.00 45.94 ? 180 PRO B CD    1 
ATOM   2957 N N     . ILE B 1 181 ? 18.819  -9.853  21.302 1.00 41.22 ? 181 ILE B N     1 
ATOM   2958 C CA    . ILE B 1 181 ? 18.188  -11.146 21.516 1.00 40.43 ? 181 ILE B CA    1 
ATOM   2959 C C     . ILE B 1 181 ? 17.831  -11.827 20.194 1.00 41.71 ? 181 ILE B C     1 
ATOM   2960 O O     . ILE B 1 181 ? 18.216  -12.976 19.939 1.00 41.80 ? 181 ILE B O     1 
ATOM   2961 C CB    . ILE B 1 181 ? 16.912  -11.019 22.368 1.00 39.80 ? 181 ILE B CB    1 
ATOM   2962 C CG1   . ILE B 1 181 ? 17.270  -10.462 23.748 1.00 39.95 ? 181 ILE B CG1   1 
ATOM   2963 C CG2   . ILE B 1 181 ? 16.230  -12.381 22.492 1.00 38.32 ? 181 ILE B CG2   1 
ATOM   2964 C CD1   . ILE B 1 181 ? 16.087  -10.342 24.710 1.00 39.11 ? 181 ILE B CD1   1 
ATOM   2965 N N     . LEU B 1 182 ? 17.105  -11.111 19.344 1.00 41.34 ? 182 LEU B N     1 
ATOM   2966 C CA    . LEU B 1 182 ? 16.686  -11.661 18.067 1.00 41.09 ? 182 LEU B CA    1 
ATOM   2967 C C     . LEU B 1 182 ? 17.810  -12.056 17.131 1.00 40.51 ? 182 LEU B C     1 
ATOM   2968 O O     . LEU B 1 182 ? 17.758  -13.136 16.541 1.00 37.12 ? 182 LEU B O     1 
ATOM   2969 C CB    . LEU B 1 182 ? 15.759  -10.680 17.348 1.00 40.76 ? 182 LEU B CB    1 
ATOM   2970 C CG    . LEU B 1 182 ? 14.491  -10.337 18.131 1.00 41.96 ? 182 LEU B CG    1 
ATOM   2971 C CD1   . LEU B 1 182 ? 13.730  -9.235  17.415 1.00 40.75 ? 182 LEU B CD1   1 
ATOM   2972 C CD2   . LEU B 1 182 ? 13.636  -11.592 18.296 1.00 39.76 ? 182 LEU B CD2   1 
ATOM   2973 N N     . ARG B 1 183 ? 18.833  -11.213 16.994 1.00 41.56 ? 183 ARG B N     1 
ATOM   2974 C CA    . ARG B 1 183 ? 19.888  -11.555 16.053 1.00 45.10 ? 183 ARG B CA    1 
ATOM   2975 C C     . ARG B 1 183 ? 20.662  -12.818 16.399 1.00 44.88 ? 183 ARG B C     1 
ATOM   2976 O O     . ARG B 1 183 ? 21.340  -13.375 15.542 1.00 42.67 ? 183 ARG B O     1 
ATOM   2977 C CB    . ARG B 1 183 ? 20.849  -10.380 15.828 1.00 47.21 ? 183 ARG B CB    1 
ATOM   2978 C CG    . ARG B 1 183 ? 21.736  -9.989  16.971 1.00 51.96 ? 183 ARG B CG    1 
ATOM   2979 C CD    . ARG B 1 183 ? 22.771  -8.989  16.458 1.00 56.33 ? 183 ARG B CD    1 
ATOM   2980 N NE    . ARG B 1 183 ? 23.691  -8.527  17.498 1.00 61.14 ? 183 ARG B NE    1 
ATOM   2981 C CZ    . ARG B 1 183 ? 23.423  -7.558  18.373 1.00 63.74 ? 183 ARG B CZ    1 
ATOM   2982 N NH1   . ARG B 1 183 ? 22.252  -6.925  18.344 1.00 64.64 ? 183 ARG B NH1   1 
ATOM   2983 N NH2   . ARG B 1 183 ? 24.327  -7.225  19.289 1.00 63.61 ? 183 ARG B NH2   1 
ATOM   2984 N N     . MET B 1 184 ? 20.530  -13.284 17.640 1.00 46.46 ? 184 MET B N     1 
ATOM   2985 C CA    . MET B 1 184 ? 21.225  -14.495 18.074 1.00 48.24 ? 184 MET B CA    1 
ATOM   2986 C C     . MET B 1 184 ? 20.448  -15.755 17.714 1.00 46.90 ? 184 MET B C     1 
ATOM   2987 O O     . MET B 1 184 ? 20.999  -16.852 17.715 1.00 46.80 ? 184 MET B O     1 
ATOM   2988 C CB    . MET B 1 184 ? 21.450  -14.468 19.588 1.00 51.16 ? 184 MET B CB    1 
ATOM   2989 C CG    . MET B 1 184 ? 22.167  -13.226 20.087 1.00 54.77 ? 184 MET B CG    1 
ATOM   2990 S SD    . MET B 1 184 ? 22.775  -13.392 21.808 1.00 63.86 ? 184 MET B SD    1 
ATOM   2991 C CE    . MET B 1 184 ? 21.207  -13.094 22.833 1.00 56.62 ? 184 MET B CE    1 
ATOM   2992 N N     . HIS B 1 185 ? 19.173  -15.584 17.385 1.00 44.34 ? 185 HIS B N     1 
ATOM   2993 C CA    . HIS B 1 185 ? 18.309  -16.707 17.068 1.00 43.54 ? 185 HIS B CA    1 
ATOM   2994 C C     . HIS B 1 185 ? 17.753  -16.650 15.634 1.00 43.04 ? 185 HIS B C     1 
ATOM   2995 O O     . HIS B 1 185 ? 16.719  -17.234 15.320 1.00 41.92 ? 185 HIS B O     1 
ATOM   2996 C CB    . HIS B 1 185 ? 17.177  -16.730 18.105 1.00 43.80 ? 185 HIS B CB    1 
ATOM   2997 C CG    . HIS B 1 185 ? 17.662  -16.795 19.529 1.00 45.20 ? 185 HIS B CG    1 
ATOM   2998 N ND1   . HIS B 1 185 ? 18.312  -17.898 20.051 1.00 45.77 ? 185 HIS B ND1   1 
ATOM   2999 C CD2   . HIS B 1 185 ? 17.597  -15.892 20.536 1.00 43.81 ? 185 HIS B CD2   1 
ATOM   3000 C CE1   . HIS B 1 185 ? 18.623  -17.671 21.314 1.00 43.48 ? 185 HIS B CE1   1 
ATOM   3001 N NE2   . HIS B 1 185 ? 18.199  -16.462 21.634 1.00 45.21 ? 185 HIS B NE2   1 
ATOM   3002 N N     . GLN B 1 186 ? 18.460  -15.956 14.758 1.00 43.12 ? 186 GLN B N     1 
ATOM   3003 C CA    . GLN B 1 186 ? 18.010  -15.804 13.379 1.00 44.19 ? 186 GLN B CA    1 
ATOM   3004 C C     . GLN B 1 186 ? 17.580  -17.065 12.647 1.00 44.51 ? 186 GLN B C     1 
ATOM   3005 O O     . GLN B 1 186 ? 16.726  -16.987 11.755 1.00 42.68 ? 186 GLN B O     1 
ATOM   3006 C CB    . GLN B 1 186 ? 19.078  -15.085 12.560 1.00 44.94 ? 186 GLN B CB    1 
ATOM   3007 C CG    . GLN B 1 186 ? 19.276  -13.662 13.006 1.00 45.94 ? 186 GLN B CG    1 
ATOM   3008 C CD    . GLN B 1 186 ? 20.211  -12.901 12.106 1.00 47.87 ? 186 GLN B CD    1 
ATOM   3009 O OE1   . GLN B 1 186 ? 19.928  -12.698 10.923 1.00 49.76 ? 186 GLN B OE1   1 
ATOM   3010 N NE2   . GLN B 1 186 ? 21.338  -12.473 12.658 1.00 47.92 ? 186 GLN B NE2   1 
ATOM   3011 N N     . HIS B 1 187 ? 18.153  -18.217 13.008 1.00 43.87 ? 187 HIS B N     1 
ATOM   3012 C CA    . HIS B 1 187 ? 17.792  -19.468 12.338 1.00 43.42 ? 187 HIS B CA    1 
ATOM   3013 C C     . HIS B 1 187 ? 16.340  -19.850 12.607 1.00 42.18 ? 187 HIS B C     1 
ATOM   3014 O O     . HIS B 1 187 ? 15.730  -20.592 11.834 1.00 42.80 ? 187 HIS B O     1 
ATOM   3015 C CB    . HIS B 1 187 ? 18.719  -20.624 12.760 1.00 44.04 ? 187 HIS B CB    1 
ATOM   3016 C CG    . HIS B 1 187 ? 18.419  -21.921 12.063 1.00 47.48 ? 187 HIS B CG    1 
ATOM   3017 N ND1   . HIS B 1 187 ? 17.391  -22.758 12.453 1.00 48.37 ? 187 HIS B ND1   1 
ATOM   3018 C CD2   . HIS B 1 187 ? 18.951  -22.479 10.947 1.00 47.92 ? 187 HIS B CD2   1 
ATOM   3019 C CE1   . HIS B 1 187 ? 17.300  -23.769 11.605 1.00 48.22 ? 187 HIS B CE1   1 
ATOM   3020 N NE2   . HIS B 1 187 ? 18.234  -23.623 10.681 1.00 47.45 ? 187 HIS B NE2   1 
ATOM   3021 N N     . ASN B 1 188 ? 15.783  -19.334 13.693 1.00 41.49 ? 188 ASN B N     1 
ATOM   3022 C CA    . ASN B 1 188 ? 14.400  -19.637 14.048 1.00 42.35 ? 188 ASN B CA    1 
ATOM   3023 C C     . ASN B 1 188 ? 13.439  -18.526 13.691 1.00 40.87 ? 188 ASN B C     1 
ATOM   3024 O O     . ASN B 1 188 ? 12.262  -18.577 14.054 1.00 40.80 ? 188 ASN B O     1 
ATOM   3025 C CB    . ASN B 1 188 ? 14.277  -19.904 15.540 1.00 45.56 ? 188 ASN B CB    1 
ATOM   3026 C CG    . ASN B 1 188 ? 14.671  -21.302 15.912 1.00 48.10 ? 188 ASN B CG    1 
ATOM   3027 O OD1   . ASN B 1 188 ? 14.726  -21.634 17.090 1.00 54.40 ? 188 ASN B OD1   1 
ATOM   3028 N ND2   . ASN B 1 188 ? 14.942  -22.137 14.917 1.00 48.92 ? 188 ASN B ND2   1 
ATOM   3029 N N     . ILE B 1 189 ? 13.944  -17.501 13.022 1.00 39.84 ? 189 ILE B N     1 
ATOM   3030 C CA    . ILE B 1 189 ? 13.090  -16.400 12.615 1.00 39.60 ? 189 ILE B CA    1 
ATOM   3031 C C     . ILE B 1 189 ? 13.030  -16.438 11.101 1.00 39.21 ? 189 ILE B C     1 
ATOM   3032 O O     . ILE B 1 189 ? 14.051  -16.476 10.431 1.00 39.72 ? 189 ILE B O     1 
ATOM   3033 C CB    . ILE B 1 189 ? 13.634  -15.057 13.103 1.00 38.99 ? 189 ILE B CB    1 
ATOM   3034 C CG1   . ILE B 1 189 ? 13.724  -15.070 14.625 1.00 37.01 ? 189 ILE B CG1   1 
ATOM   3035 C CG2   . ILE B 1 189 ? 12.720  -13.929 12.648 1.00 39.25 ? 189 ILE B CG2   1 
ATOM   3036 C CD1   . ILE B 1 189 ? 14.412  -13.864 15.183 1.00 38.20 ? 189 ILE B CD1   1 
ATOM   3037 N N     . HIS B 1 190 ? 11.820  -16.458 10.568 1.00 39.40 ? 190 HIS B N     1 
ATOM   3038 C CA    . HIS B 1 190 ? 11.626  -16.526 9.131  1.00 38.29 ? 190 HIS B CA    1 
ATOM   3039 C C     . HIS B 1 190 ? 10.890  -15.283 8.652  1.00 38.64 ? 190 HIS B C     1 
ATOM   3040 O O     . HIS B 1 190 ? 9.797   -14.973 9.136  1.00 38.00 ? 190 HIS B O     1 
ATOM   3041 C CB    . HIS B 1 190 ? 10.821  -17.774 8.820  1.00 38.70 ? 190 HIS B CB    1 
ATOM   3042 C CG    . HIS B 1 190 ? 11.355  -18.999 9.494  1.00 42.59 ? 190 HIS B CG    1 
ATOM   3043 N ND1   . HIS B 1 190 ? 12.328  -19.798 8.930  1.00 44.15 ? 190 HIS B ND1   1 
ATOM   3044 C CD2   . HIS B 1 190 ? 11.098  -19.525 10.716 1.00 42.70 ? 190 HIS B CD2   1 
ATOM   3045 C CE1   . HIS B 1 190 ? 12.645  -20.764 9.774  1.00 44.85 ? 190 HIS B CE1   1 
ATOM   3046 N NE2   . HIS B 1 190 ? 11.913  -20.622 10.865 1.00 45.35 ? 190 HIS B NE2   1 
ATOM   3047 N N     . LEU B 1 191 ? 11.486  -14.569 7.708  1.00 36.65 ? 191 LEU B N     1 
ATOM   3048 C CA    . LEU B 1 191 ? 10.858  -13.372 7.199  1.00 38.11 ? 191 LEU B CA    1 
ATOM   3049 C C     . LEU B 1 191 ? 10.150  -13.672 5.891  1.00 39.23 ? 191 LEU B C     1 
ATOM   3050 O O     . LEU B 1 191 ? 10.785  -13.924 4.870  1.00 38.60 ? 191 LEU B O     1 
ATOM   3051 C CB    . LEU B 1 191 ? 11.903  -12.268 7.016  1.00 38.06 ? 191 LEU B CB    1 
ATOM   3052 C CG    . LEU B 1 191 ? 12.718  -12.034 8.295  1.00 38.95 ? 191 LEU B CG    1 
ATOM   3053 C CD1   . LEU B 1 191 ? 13.765  -10.985 8.039  1.00 40.77 ? 191 LEU B CD1   1 
ATOM   3054 C CD2   . LEU B 1 191 ? 11.800  -11.600 9.453  1.00 38.90 ? 191 LEU B CD2   1 
ATOM   3055 N N     . ALA B 1 192 ? 8.825   -13.660 5.938  1.00 40.18 ? 192 ALA B N     1 
ATOM   3056 C CA    . ALA B 1 192 ? 8.033   -13.921 4.754  1.00 44.34 ? 192 ALA B CA    1 
ATOM   3057 C C     . ALA B 1 192 ? 7.695   -12.578 4.109  1.00 47.16 ? 192 ALA B C     1 
ATOM   3058 O O     . ALA B 1 192 ? 7.114   -11.691 4.749  1.00 46.70 ? 192 ALA B O     1 
ATOM   3059 C CB    . ALA B 1 192 ? 6.772   -14.671 5.125  1.00 40.96 ? 192 ALA B CB    1 
ATOM   3060 N N     . LYS B 1 193 ? 8.083   -12.431 2.845  1.00 50.68 ? 193 LYS B N     1 
ATOM   3061 C CA    . LYS B 1 193 ? 7.836   -11.200 2.100  1.00 53.83 ? 193 LYS B CA    1 
ATOM   3062 C C     . LYS B 1 193 ? 6.467   -11.176 1.435  1.00 54.38 ? 193 LYS B C     1 
ATOM   3063 O O     . LYS B 1 193 ? 6.079   -12.122 0.751  1.00 52.65 ? 193 LYS B O     1 
ATOM   3064 C CB    . LYS B 1 193 ? 8.910   -10.994 1.030  1.00 55.59 ? 193 LYS B CB    1 
ATOM   3065 C CG    . LYS B 1 193 ? 9.223   -12.239 0.190  1.00 58.21 ? 193 LYS B CG    1 
ATOM   3066 C CD    . LYS B 1 193 ? 10.116  -13.208 0.958  1.00 59.82 ? 193 LYS B CD    1 
ATOM   3067 C CE    . LYS B 1 193 ? 11.198  -13.801 0.059  1.00 60.95 ? 193 LYS B CE    1 
ATOM   3068 N NZ    . LYS B 1 193 ? 12.252  -14.490 0.866  1.00 63.00 ? 193 LYS B NZ    1 
ATOM   3069 N N     . GLU B 1 194 ? 5.754   -10.070 1.641  1.00 56.17 ? 194 GLU B N     1 
ATOM   3070 C CA    . GLU B 1 194 ? 4.426   -9.862  1.076  1.00 57.47 ? 194 GLU B CA    1 
ATOM   3071 C C     . GLU B 1 194 ? 4.523   -8.939  -0.143 1.00 57.59 ? 194 GLU B C     1 
ATOM   3072 O O     . GLU B 1 194 ? 4.469   -7.716  -0.013 1.00 58.27 ? 194 GLU B O     1 
ATOM   3073 C CB    . GLU B 1 194 ? 3.504   -9.236  2.128  1.00 57.30 ? 194 GLU B CB    1 
ATOM   3074 C CG    . GLU B 1 194 ? 2.136   -8.812  1.604  1.00 58.64 ? 194 GLU B CG    1 
ATOM   3075 C CD    . GLU B 1 194 ? 1.302   -9.978  1.068  1.00 60.95 ? 194 GLU B CD    1 
ATOM   3076 O OE1   . GLU B 1 194 ? 1.682   -10.569 0.023  1.00 59.28 ? 194 GLU B OE1   1 
ATOM   3077 O OE2   . GLU B 1 194 ? 0.263   -10.296 1.700  1.00 59.47 ? 194 GLU B OE2   1 
ATOM   3078 N N     . PRO B 1 195 ? 4.669   -9.518  -1.345 1.00 57.38 ? 195 PRO B N     1 
ATOM   3079 C CA    . PRO B 1 195 ? 4.774   -8.744  -2.585 1.00 57.69 ? 195 PRO B CA    1 
ATOM   3080 C C     . PRO B 1 195 ? 3.512   -7.965  -2.958 1.00 57.97 ? 195 PRO B C     1 
ATOM   3081 O O     . PRO B 1 195 ? 3.508   -7.210  -3.928 1.00 58.53 ? 195 PRO B O     1 
ATOM   3082 C CB    . PRO B 1 195 ? 5.149   -9.801  -3.623 1.00 57.71 ? 195 PRO B CB    1 
ATOM   3083 C CG    . PRO B 1 195 ? 4.502   -11.029 -3.091 1.00 59.01 ? 195 PRO B CG    1 
ATOM   3084 C CD    . PRO B 1 195 ? 4.781   -10.960 -1.614 1.00 57.67 ? 195 PRO B CD    1 
ATOM   3085 N N     . VAL B 1 196 ? 2.446   -8.148  -2.186 1.00 58.25 ? 196 VAL B N     1 
ATOM   3086 C CA    . VAL B 1 196 ? 1.192   -7.435  -2.423 1.00 59.12 ? 196 VAL B CA    1 
ATOM   3087 C C     . VAL B 1 196 ? 0.943   -6.392  -1.328 1.00 60.83 ? 196 VAL B C     1 
ATOM   3088 O O     . VAL B 1 196 ? 0.954   -6.702  -0.132 1.00 61.15 ? 196 VAL B O     1 
ATOM   3089 C CB    . VAL B 1 196 ? -0.024  -8.415  -2.478 1.00 58.21 ? 196 VAL B CB    1 
ATOM   3090 C CG1   . VAL B 1 196 ? -1.335  -7.660  -2.366 1.00 56.02 ? 196 VAL B CG1   1 
ATOM   3091 C CG2   . VAL B 1 196 ? -0.004  -9.186  -3.782 1.00 57.27 ? 196 VAL B CG2   1 
ATOM   3092 N N     . GLN B 1 197 ? 0.739   -5.150  -1.753 1.00 62.24 ? 197 GLN B N     1 
ATOM   3093 C CA    . GLN B 1 197 ? 0.449   -4.049  -0.841 1.00 63.73 ? 197 GLN B CA    1 
ATOM   3094 C C     . GLN B 1 197 ? -0.979  -4.271  -0.356 1.00 64.40 ? 197 GLN B C     1 
ATOM   3095 O O     . GLN B 1 197 ? -1.945  -3.933  -1.042 1.00 64.40 ? 197 GLN B O     1 
ATOM   3096 C CB    . GLN B 1 197 ? 0.512   -2.736  -1.596 1.00 65.16 ? 197 GLN B CB    1 
ATOM   3097 C CG    . GLN B 1 197 ? 0.327   -1.522  -0.735 1.00 66.79 ? 197 GLN B CG    1 
ATOM   3098 C CD    . GLN B 1 197 ? 1.614   -0.747  -0.598 1.00 67.20 ? 197 GLN B CD    1 
ATOM   3099 O OE1   . GLN B 1 197 ? 1.633   0.339   -0.036 1.00 66.51 ? 197 GLN B OE1   1 
ATOM   3100 N NE2   . GLN B 1 197 ? 2.706   -1.307  -1.117 1.00 68.03 ? 197 GLN B NE2   1 
ATOM   3101 N N     . ASN B 1 198 ? -1.117  -4.830  0.833  1.00 64.83 ? 198 ASN B N     1 
ATOM   3102 C CA    . ASN B 1 198 ? -2.436  -5.134  1.352  1.00 65.45 ? 198 ASN B CA    1 
ATOM   3103 C C     . ASN B 1 198 ? -2.539  -4.662  2.799  1.00 64.10 ? 198 ASN B C     1 
ATOM   3104 O O     . ASN B 1 198 ? -2.523  -5.454  3.740  1.00 65.08 ? 198 ASN B O     1 
ATOM   3105 C CB    . ASN B 1 198 ? -2.637  -6.645  1.217  1.00 69.48 ? 198 ASN B CB    1 
ATOM   3106 C CG    . ASN B 1 198 ? -1.581  -7.453  1.982  1.00 72.52 ? 198 ASN B CG    1 
ATOM   3107 O OD1   . ASN B 1 198 ? -0.424  -7.029  2.114  1.00 74.61 ? 198 ASN B OD1   1 
ATOM   3108 N ND2   . ASN B 1 198 ? -1.973  -8.628  2.476  1.00 73.83 ? 198 ASN B ND2   1 
ATOM   3109 N N     . GLU B 1 199 ? -2.659  -3.351  2.965  1.00 61.27 ? 199 GLU B N     1 
ATOM   3110 C CA    . GLU B 1 199 ? -2.708  -2.750  4.286  1.00 58.48 ? 199 GLU B CA    1 
ATOM   3111 C C     . GLU B 1 199 ? -4.119  -2.408  4.784  1.00 56.27 ? 199 GLU B C     1 
ATOM   3112 O O     . GLU B 1 199 ? -4.536  -1.247  4.783  1.00 56.43 ? 199 GLU B O     1 
ATOM   3113 C CB    . GLU B 1 199 ? -1.831  -1.500  4.281  1.00 59.36 ? 199 GLU B CB    1 
ATOM   3114 C CG    . GLU B 1 199 ? -1.022  -1.301  5.553  1.00 62.01 ? 199 GLU B CG    1 
ATOM   3115 C CD    . GLU B 1 199 ? -0.060  -2.446  5.819  1.00 63.29 ? 199 GLU B CD    1 
ATOM   3116 O OE1   . GLU B 1 199 ? 0.865   -2.672  5.000  1.00 61.41 ? 199 GLU B OE1   1 
ATOM   3117 O OE2   . GLU B 1 199 ? -0.238  -3.127  6.854  1.00 64.67 ? 199 GLU B OE2   1 
ATOM   3118 N N     . ILE B 1 200 ? -4.843  -3.430  5.223  1.00 52.75 ? 200 ILE B N     1 
ATOM   3119 C CA    . ILE B 1 200 ? -6.199  -3.259  5.734  1.00 49.01 ? 200 ILE B CA    1 
ATOM   3120 C C     . ILE B 1 200 ? -6.144  -3.156  7.246  1.00 45.72 ? 200 ILE B C     1 
ATOM   3121 O O     . ILE B 1 200 ? -5.566  -4.008  7.912  1.00 47.12 ? 200 ILE B O     1 
ATOM   3122 C CB    . ILE B 1 200 ? -7.101  -4.472  5.374  1.00 49.67 ? 200 ILE B CB    1 
ATOM   3123 C CG1   . ILE B 1 200 ? -7.325  -4.537  3.869  1.00 49.30 ? 200 ILE B CG1   1 
ATOM   3124 C CG2   . ILE B 1 200 ? -8.439  -4.387  6.108  1.00 48.98 ? 200 ILE B CG2   1 
ATOM   3125 C CD1   . ILE B 1 200 ? -8.001  -5.825  3.440  1.00 48.91 ? 200 ILE B CD1   1 
ATOM   3126 N N     . SER B 1 201 ? -6.762  -2.122  7.790  1.00 40.97 ? 201 SER B N     1 
ATOM   3127 C CA    . SER B 1 201 ? -6.779  -1.945  9.229  1.00 37.09 ? 201 SER B CA    1 
ATOM   3128 C C     . SER B 1 201 ? -8.135  -2.352  9.810  1.00 35.55 ? 201 SER B C     1 
ATOM   3129 O O     . SER B 1 201 ? -9.185  -1.905  9.341  1.00 34.17 ? 201 SER B O     1 
ATOM   3130 C CB    . SER B 1 201 ? -6.475  -0.485  9.558  1.00 38.01 ? 201 SER B CB    1 
ATOM   3131 O OG    . SER B 1 201 ? -7.229  -0.022  10.653 1.00 37.38 ? 201 SER B OG    1 
ATOM   3132 N N     . ALA B 1 202 ? -8.112  -3.214  10.821 1.00 31.98 ? 202 ALA B N     1 
ATOM   3133 C CA    . ALA B 1 202 ? -9.344  -3.635  11.461 1.00 30.37 ? 202 ALA B CA    1 
ATOM   3134 C C     . ALA B 1 202 ? -10.021 -2.401  12.068 1.00 28.64 ? 202 ALA B C     1 
ATOM   3135 O O     . ALA B 1 202 ? -11.256 -2.297  12.119 1.00 28.32 ? 202 ALA B O     1 
ATOM   3136 C CB    . ALA B 1 202 ? -9.041  -4.677  12.532 1.00 30.43 ? 202 ALA B CB    1 
ATOM   3137 N N     . THR B 1 203 ? -9.207  -1.451  12.512 1.00 29.09 ? 203 THR B N     1 
ATOM   3138 C CA    . THR B 1 203 ? -9.729  -0.219  13.089 1.00 28.51 ? 203 THR B CA    1 
ATOM   3139 C C     . THR B 1 203 ? -10.577 0.455   12.015 1.00 30.31 ? 203 THR B C     1 
ATOM   3140 O O     . THR B 1 203 ? -11.697 0.936   12.285 1.00 29.30 ? 203 THR B O     1 
ATOM   3141 C CB    . THR B 1 203 ? -8.590  0.707   13.534 1.00 29.36 ? 203 THR B CB    1 
ATOM   3142 O OG1   . THR B 1 203 ? -7.852  0.051   14.569 1.00 29.39 ? 203 THR B OG1   1 
ATOM   3143 C CG2   . THR B 1 203 ? -9.143  2.051   14.074 1.00 28.15 ? 203 THR B CG2   1 
ATOM   3144 N N     . TYR B 1 204 ? -10.056 0.451   10.788 1.00 28.05 ? 204 TYR B N     1 
ATOM   3145 C CA    . TYR B 1 204 ? -10.780 1.034   9.687  1.00 29.60 ? 204 TYR B CA    1 
ATOM   3146 C C     . TYR B 1 204 ? -12.053 0.235   9.428  1.00 30.69 ? 204 TYR B C     1 
ATOM   3147 O O     . TYR B 1 204 ? -13.118 0.821   9.213  1.00 30.71 ? 204 TYR B O     1 
ATOM   3148 C CB    . TYR B 1 204 ? -9.966  1.027   8.397  1.00 30.58 ? 204 TYR B CB    1 
ATOM   3149 C CG    . TYR B 1 204 ? -10.826 1.469   7.221  1.00 32.91 ? 204 TYR B CG    1 
ATOM   3150 C CD1   . TYR B 1 204 ? -11.249 2.791   7.104  1.00 32.36 ? 204 TYR B CD1   1 
ATOM   3151 C CD2   . TYR B 1 204 ? -11.297 0.546   6.292  1.00 32.41 ? 204 TYR B CD2   1 
ATOM   3152 C CE1   . TYR B 1 204 ? -12.125 3.184   6.095  1.00 36.22 ? 204 TYR B CE1   1 
ATOM   3153 C CE2   . TYR B 1 204 ? -12.176 0.930   5.279  1.00 35.09 ? 204 TYR B CE2   1 
ATOM   3154 C CZ    . TYR B 1 204 ? -12.584 2.245   5.187  1.00 34.93 ? 204 TYR B CZ    1 
ATOM   3155 O OH    . TYR B 1 204 ? -13.455 2.631   4.195  1.00 39.59 ? 204 TYR B OH    1 
ATOM   3156 N N     . ILE B 1 205 ? -11.929 -1.097  9.416  1.00 29.01 ? 205 ILE B N     1 
ATOM   3157 C CA    . ILE B 1 205 ? -13.071 -1.983  9.169  1.00 27.90 ? 205 ILE B CA    1 
ATOM   3158 C C     . ILE B 1 205 ? -14.228 -1.630  10.119 1.00 28.85 ? 205 ILE B C     1 
ATOM   3159 O O     . ILE B 1 205 ? -15.373 -1.490  9.681  1.00 29.36 ? 205 ILE B O     1 
ATOM   3160 C CB    . ILE B 1 205 ? -12.690 -3.496  9.369  1.00 28.49 ? 205 ILE B CB    1 
ATOM   3161 C CG1   . ILE B 1 205 ? -11.629 -3.921  8.354  1.00 27.58 ? 205 ILE B CG1   1 
ATOM   3162 C CG2   . ILE B 1 205 ? -13.939 -4.393  9.220  1.00 27.25 ? 205 ILE B CG2   1 
ATOM   3163 C CD1   . ILE B 1 205 ? -12.063 -3.794  6.929  1.00 25.79 ? 205 ILE B CD1   1 
ATOM   3164 N N     . ARG B 1 206 ? -13.919 -1.483  11.408 1.00 28.22 ? 206 ARG B N     1 
ATOM   3165 C CA    . ARG B 1 206 ? -14.923 -1.155  12.410 1.00 28.88 ? 206 ARG B CA    1 
ATOM   3166 C C     . ARG B 1 206 ? -15.549 0.225   12.205 1.00 31.34 ? 206 ARG B C     1 
ATOM   3167 O O     . ARG B 1 206 ? -16.769 0.379   12.327 1.00 32.01 ? 206 ARG B O     1 
ATOM   3168 C CB    . ARG B 1 206 ? -14.329 -1.230  13.825 1.00 29.10 ? 206 ARG B CB    1 
ATOM   3169 C CG    . ARG B 1 206 ? -13.824 -2.627  14.236 1.00 29.74 ? 206 ARG B CG    1 
ATOM   3170 C CD    . ARG B 1 206 ? -13.487 -2.698  15.715 1.00 32.81 ? 206 ARG B CD    1 
ATOM   3171 N NE    . ARG B 1 206 ? -12.339 -1.872  16.095 1.00 33.67 ? 206 ARG B NE    1 
ATOM   3172 C CZ    . ARG B 1 206 ? -11.067 -2.225  15.917 1.00 33.22 ? 206 ARG B CZ    1 
ATOM   3173 N NH1   . ARG B 1 206 ? -10.771 -3.395  15.369 1.00 31.28 ? 206 ARG B NH1   1 
ATOM   3174 N NH2   . ARG B 1 206 ? -10.088 -1.396  16.269 1.00 31.25 ? 206 ARG B NH2   1 
ATOM   3175 N N     . ARG B 1 207 ? -14.724 1.226   11.899 1.00 31.13 ? 207 ARG B N     1 
ATOM   3176 C CA    . ARG B 1 207 ? -15.235 2.570   11.688 1.00 30.18 ? 207 ARG B CA    1 
ATOM   3177 C C     . ARG B 1 207 ? -16.157 2.596   10.483 1.00 29.99 ? 207 ARG B C     1 
ATOM   3178 O O     . ARG B 1 207 ? -17.226 3.199   10.536 1.00 29.01 ? 207 ARG B O     1 
ATOM   3179 C CB    . ARG B 1 207 ? -14.093 3.571   11.482 1.00 30.47 ? 207 ARG B CB    1 
ATOM   3180 C CG    . ARG B 1 207 ? -14.558 5.041   11.392 1.00 30.14 ? 207 ARG B CG    1 
ATOM   3181 C CD    . ARG B 1 207 ? -13.373 6.017   11.446 1.00 29.18 ? 207 ARG B CD    1 
ATOM   3182 N NE    . ARG B 1 207 ? -12.424 5.797   10.356 1.00 28.77 ? 207 ARG B NE    1 
ATOM   3183 C CZ    . ARG B 1 207 ? -12.542 6.326   9.141  1.00 28.95 ? 207 ARG B CZ    1 
ATOM   3184 N NH1   . ARG B 1 207 ? -13.570 7.119   8.852  1.00 30.27 ? 207 ARG B NH1   1 
ATOM   3185 N NH2   . ARG B 1 207 ? -11.638 6.067   8.211  1.00 27.39 ? 207 ARG B NH2   1 
ATOM   3186 N N     . ALA B 1 208 ? -15.747 1.949   9.396  1.00 29.61 ? 208 ALA B N     1 
ATOM   3187 C CA    . ALA B 1 208 ? -16.563 1.908   8.180  1.00 30.42 ? 208 ALA B CA    1 
ATOM   3188 C C     . ALA B 1 208 ? -17.931 1.288   8.485  1.00 32.87 ? 208 ALA B C     1 
ATOM   3189 O O     . ALA B 1 208 ? -18.973 1.811   8.081  1.00 35.13 ? 208 ALA B O     1 
ATOM   3190 C CB    . ALA B 1 208 ? -15.858 1.095   7.107  1.00 28.10 ? 208 ALA B CB    1 
ATOM   3191 N N     . LEU B 1 209 ? -17.920 0.171   9.203  1.00 33.25 ? 209 LEU B N     1 
ATOM   3192 C CA    . LEU B 1 209 ? -19.157 -0.514  9.571  1.00 34.75 ? 209 LEU B CA    1 
ATOM   3193 C C     . LEU B 1 209 ? -20.051 0.392   10.403 1.00 35.82 ? 209 LEU B C     1 
ATOM   3194 O O     . LEU B 1 209 ? -21.252 0.494   10.150 1.00 35.86 ? 209 LEU B O     1 
ATOM   3195 C CB    . LEU B 1 209 ? -18.851 -1.787  10.364 1.00 33.81 ? 209 LEU B CB    1 
ATOM   3196 C CG    . LEU B 1 209 ? -18.336 -2.956  9.532  1.00 33.38 ? 209 LEU B CG    1 
ATOM   3197 C CD1   . LEU B 1 209 ? -17.814 -4.021  10.462 1.00 33.74 ? 209 LEU B CD1   1 
ATOM   3198 C CD2   . LEU B 1 209 ? -19.439 -3.483  8.636  1.00 33.28 ? 209 LEU B CD2   1 
ATOM   3199 N N     . GLY B 1 210 ? -19.460 1.047   11.395 1.00 35.92 ? 210 GLY B N     1 
ATOM   3200 C CA    . GLY B 1 210 ? -20.226 1.942   12.240 1.00 37.36 ? 210 GLY B CA    1 
ATOM   3201 C C     . GLY B 1 210 ? -20.846 3.091   11.457 1.00 38.35 ? 210 GLY B C     1 
ATOM   3202 O O     . GLY B 1 210 ? -21.832 3.661   11.906 1.00 40.24 ? 210 GLY B O     1 
ATOM   3203 N N     . GLN B 1 211 ? -20.276 3.430   10.300 1.00 38.75 ? 211 GLN B N     1 
ATOM   3204 C CA    . GLN B 1 211 ? -20.779 4.518   9.455  1.00 39.29 ? 211 GLN B CA    1 
ATOM   3205 C C     . GLN B 1 211 ? -21.735 3.974   8.395  1.00 39.52 ? 211 GLN B C     1 
ATOM   3206 O O     . GLN B 1 211 ? -22.194 4.703   7.514  1.00 40.18 ? 211 GLN B O     1 
ATOM   3207 C CB    . GLN B 1 211 ? -19.616 5.233   8.746  1.00 40.96 ? 211 GLN B CB    1 
ATOM   3208 C CG    . GLN B 1 211 ? -18.556 5.858   9.664  1.00 45.50 ? 211 GLN B CG    1 
ATOM   3209 C CD    . GLN B 1 211 ? -17.404 6.535   8.895  1.00 49.21 ? 211 GLN B CD    1 
ATOM   3210 O OE1   . GLN B 1 211 ? -17.006 6.093   7.808  1.00 50.16 ? 211 GLN B OE1   1 
ATOM   3211 N NE2   . GLN B 1 211 ? -16.848 7.598   9.480  1.00 51.17 ? 211 GLN B NE2   1 
ATOM   3212 N N     . GLY B 1 212 ? -22.004 2.676   8.466  1.00 40.07 ? 212 GLY B N     1 
ATOM   3213 C CA    . GLY B 1 212 ? -22.888 2.045   7.499  1.00 39.38 ? 212 GLY B CA    1 
ATOM   3214 C C     . GLY B 1 212 ? -22.283 1.909   6.112  1.00 40.57 ? 212 GLY B C     1 
ATOM   3215 O O     . GLY B 1 212 ? -23.006 1.809   5.114  1.00 40.90 ? 212 GLY B O     1 
ATOM   3216 N N     . GLN B 1 213 ? -20.956 1.911   6.033  1.00 40.08 ? 213 GLN B N     1 
ATOM   3217 C CA    . GLN B 1 213 ? -20.288 1.771   4.739  1.00 39.83 ? 213 GLN B CA    1 
ATOM   3218 C C     . GLN B 1 213 ? -19.932 0.297   4.516  1.00 38.69 ? 213 GLN B C     1 
ATOM   3219 O O     . GLN B 1 213 ? -19.835 -0.479  5.468  1.00 36.99 ? 213 GLN B O     1 
ATOM   3220 C CB    . GLN B 1 213 ? -19.021 2.644   4.684  1.00 39.15 ? 213 GLN B CB    1 
ATOM   3221 C CG    . GLN B 1 213 ? -19.287 4.171   4.668  1.00 42.11 ? 213 GLN B CG    1 
ATOM   3222 C CD    . GLN B 1 213 ? -17.997 5.000   4.676  1.00 43.65 ? 213 GLN B CD    1 
ATOM   3223 O OE1   . GLN B 1 213 ? -17.100 4.773   5.487  1.00 43.81 ? 213 GLN B OE1   1 
ATOM   3224 N NE2   . GLN B 1 213 ? -17.903 5.958   3.767  1.00 45.61 ? 213 GLN B NE2   1 
ATOM   3225 N N     . SER B 1 214 ? -19.749 -0.085  3.258  1.00 36.04 ? 214 SER B N     1 
ATOM   3226 C CA    . SER B 1 214 ? -19.403 -1.455  2.917  1.00 34.61 ? 214 SER B CA    1 
ATOM   3227 C C     . SER B 1 214 ? -17.959 -1.838  3.245  1.00 33.27 ? 214 SER B C     1 
ATOM   3228 O O     . SER B 1 214 ? -17.065 -1.016  3.154  1.00 32.78 ? 214 SER B O     1 
ATOM   3229 C CB    . SER B 1 214 ? -19.611 -1.682  1.423  1.00 35.20 ? 214 SER B CB    1 
ATOM   3230 O OG    . SER B 1 214 ? -18.974 -2.883  1.002  1.00 32.31 ? 214 SER B OG    1 
ATOM   3231 N N     . VAL B 1 215 ? -17.750 -3.094  3.628  1.00 31.78 ? 215 VAL B N     1 
ATOM   3232 C CA    . VAL B 1 215 ? -16.412 -3.615  3.875  1.00 30.69 ? 215 VAL B CA    1 
ATOM   3233 C C     . VAL B 1 215 ? -16.318 -4.945  3.137  1.00 31.86 ? 215 VAL B C     1 
ATOM   3234 O O     . VAL B 1 215 ? -15.453 -5.776  3.409  1.00 34.82 ? 215 VAL B O     1 
ATOM   3235 C CB    . VAL B 1 215 ? -16.081 -3.820  5.383  1.00 30.75 ? 215 VAL B CB    1 
ATOM   3236 C CG1   . VAL B 1 215 ? -16.063 -2.467  6.094  1.00 28.66 ? 215 VAL B CG1   1 
ATOM   3237 C CG2   . VAL B 1 215 ? -17.051 -4.814  6.041  1.00 26.58 ? 215 VAL B CG2   1 
ATOM   3238 N N     . LYS B 1 216 ? -17.232 -5.147  2.194  1.00 32.21 ? 216 LYS B N     1 
ATOM   3239 C CA    . LYS B 1 216 ? -17.248 -6.367  1.405  1.00 30.01 ? 216 LYS B CA    1 
ATOM   3240 C C     . LYS B 1 216 ? -15.962 -6.450  0.571  1.00 30.40 ? 216 LYS B C     1 
ATOM   3241 O O     . LYS B 1 216 ? -15.475 -5.438  0.048  1.00 29.93 ? 216 LYS B O     1 
ATOM   3242 C CB    . LYS B 1 216 ? -18.491 -6.379  0.516  1.00 30.65 ? 216 LYS B CB    1 
ATOM   3243 C CG    . LYS B 1 216 ? -18.859 -7.736  -0.104 1.00 29.25 ? 216 LYS B CG    1 
ATOM   3244 C CD    . LYS B 1 216 ? -20.183 -7.603  -0.873 1.00 30.28 ? 216 LYS B CD    1 
ATOM   3245 C CE    . LYS B 1 216 ? -20.681 -8.944  -1.416 1.00 31.78 ? 216 LYS B CE    1 
ATOM   3246 N NZ    . LYS B 1 216 ? -20.867 -9.942  -0.328 1.00 31.63 ? 216 LYS B NZ    1 
ATOM   3247 N N     . TYR B 1 217 ? -15.421 -7.666  0.462  1.00 30.03 ? 217 TYR B N     1 
ATOM   3248 C CA    . TYR B 1 217 ? -14.190 -7.943  -0.268 1.00 29.64 ? 217 TYR B CA    1 
ATOM   3249 C C     . TYR B 1 217 ? -12.932 -7.552  0.543  1.00 29.93 ? 217 TYR B C     1 
ATOM   3250 O O     . TYR B 1 217 ? -11.806 -7.747  0.087  1.00 29.46 ? 217 TYR B O     1 
ATOM   3251 C CB    . TYR B 1 217 ? -14.216 -7.261  -1.644 1.00 32.25 ? 217 TYR B CB    1 
ATOM   3252 C CG    . TYR B 1 217 ? -15.481 -7.573  -2.427 1.00 33.61 ? 217 TYR B CG    1 
ATOM   3253 C CD1   . TYR B 1 217 ? -15.829 -8.898  -2.733 1.00 35.74 ? 217 TYR B CD1   1 
ATOM   3254 C CD2   . TYR B 1 217 ? -16.349 -6.552  -2.840 1.00 33.82 ? 217 TYR B CD2   1 
ATOM   3255 C CE1   . TYR B 1 217 ? -17.010 -9.203  -3.432 1.00 35.28 ? 217 TYR B CE1   1 
ATOM   3256 C CE2   . TYR B 1 217 ? -17.546 -6.843  -3.543 1.00 35.63 ? 217 TYR B CE2   1 
ATOM   3257 C CZ    . TYR B 1 217 ? -17.862 -8.173  -3.832 1.00 36.90 ? 217 TYR B CZ    1 
ATOM   3258 O OH    . TYR B 1 217 ? -19.012 -8.483  -4.516 1.00 33.40 ? 217 TYR B OH    1 
ATOM   3259 N N     . LEU B 1 218 ? -13.137 -7.017  1.745  1.00 30.28 ? 218 LEU B N     1 
ATOM   3260 C CA    . LEU B 1 218 ? -12.044 -6.668  2.666  1.00 29.56 ? 218 LEU B CA    1 
ATOM   3261 C C     . LEU B 1 218 ? -12.000 -7.752  3.761  1.00 29.56 ? 218 LEU B C     1 
ATOM   3262 O O     . LEU B 1 218 ? -10.939 -8.085  4.270  1.00 28.54 ? 218 LEU B O     1 
ATOM   3263 C CB    . LEU B 1 218 ? -12.265 -5.294  3.311  1.00 28.99 ? 218 LEU B CB    1 
ATOM   3264 C CG    . LEU B 1 218 ? -12.246 -4.072  2.384  1.00 28.39 ? 218 LEU B CG    1 
ATOM   3265 C CD1   . LEU B 1 218 ? -12.195 -2.807  3.243  1.00 29.23 ? 218 LEU B CD1   1 
ATOM   3266 C CD2   . LEU B 1 218 ? -11.038 -4.136  1.448  1.00 28.05 ? 218 LEU B CD2   1 
ATOM   3267 N N     . ILE B 1 219 ? -13.173 -8.277  4.125  1.00 30.27 ? 219 ILE B N     1 
ATOM   3268 C CA    . ILE B 1 219 ? -13.299 -9.367  5.093  1.00 29.90 ? 219 ILE B CA    1 
ATOM   3269 C C     . ILE B 1 219 ? -14.294 -10.386 4.488  1.00 30.15 ? 219 ILE B C     1 
ATOM   3270 O O     . ILE B 1 219 ? -15.062 -10.063 3.583  1.00 31.26 ? 219 ILE B O     1 
ATOM   3271 C CB    . ILE B 1 219 ? -13.811 -8.898  6.481  1.00 31.19 ? 219 ILE B CB    1 
ATOM   3272 C CG1   . ILE B 1 219 ? -15.301 -8.524  6.413  1.00 28.19 ? 219 ILE B CG1   1 
ATOM   3273 C CG2   . ILE B 1 219 ? -12.971 -7.709  6.984  1.00 28.84 ? 219 ILE B CG2   1 
ATOM   3274 C CD1   . ILE B 1 219 ? -15.818 -8.070  7.768  1.00 27.56 ? 219 ILE B CD1   1 
ATOM   3275 N N     . PRO B 1 220 ? -14.296 -11.625 4.988  1.00 30.42 ? 220 PRO B N     1 
ATOM   3276 C CA    . PRO B 1 220 ? -15.208 -12.652 4.448  1.00 29.51 ? 220 PRO B CA    1 
ATOM   3277 C C     . PRO B 1 220 ? -16.699 -12.346 4.469  1.00 30.27 ? 220 PRO B C     1 
ATOM   3278 O O     . PRO B 1 220 ? -17.207 -11.755 5.422  1.00 29.19 ? 220 PRO B O     1 
ATOM   3279 C CB    . PRO B 1 220 ? -14.871 -13.886 5.276  1.00 29.28 ? 220 PRO B CB    1 
ATOM   3280 C CG    . PRO B 1 220 ? -13.383 -13.634 5.687  1.00 29.54 ? 220 PRO B CG    1 
ATOM   3281 C CD    . PRO B 1 220 ? -13.416 -12.180 6.041  1.00 29.41 ? 220 PRO B CD    1 
ATOM   3282 N N     . ASP B 1 221 ? -17.394 -12.745 3.402  1.00 32.06 ? 221 ASP B N     1 
ATOM   3283 C CA    . ASP B 1 221 ? -18.839 -12.538 3.312  1.00 35.77 ? 221 ASP B CA    1 
ATOM   3284 C C     . ASP B 1 221 ? -19.577 -13.022 4.563  1.00 35.07 ? 221 ASP B C     1 
ATOM   3285 O O     . ASP B 1 221 ? -20.453 -12.335 5.079  1.00 36.56 ? 221 ASP B O     1 
ATOM   3286 C CB    . ASP B 1 221 ? -19.425 -13.281 2.099  1.00 37.50 ? 221 ASP B CB    1 
ATOM   3287 C CG    . ASP B 1 221 ? -19.056 -12.638 0.778  1.00 41.10 ? 221 ASP B CG    1 
ATOM   3288 O OD1   . ASP B 1 221 ? -18.974 -11.399 0.730  1.00 41.16 ? 221 ASP B OD1   1 
ATOM   3289 O OD2   . ASP B 1 221 ? -18.863 -13.367 -0.219 1.00 44.47 ? 221 ASP B OD2   1 
ATOM   3290 N N     . ALA B 1 222 ? -19.228 -14.214 5.040  1.00 35.07 ? 222 ALA B N     1 
ATOM   3291 C CA    . ALA B 1 222 ? -19.896 -14.787 6.199  1.00 33.88 ? 222 ALA B CA    1 
ATOM   3292 C C     . ALA B 1 222 ? -19.627 -14.002 7.469  1.00 34.06 ? 222 ALA B C     1 
ATOM   3293 O O     . ALA B 1 222 ? -20.463 -13.976 8.388  1.00 33.98 ? 222 ALA B O     1 
ATOM   3294 C CB    . ALA B 1 222 ? -19.482 -16.261 6.382  1.00 33.37 ? 222 ALA B CB    1 
ATOM   3295 N N     . VAL B 1 223 ? -18.459 -13.377 7.547  1.00 32.25 ? 223 VAL B N     1 
ATOM   3296 C CA    . VAL B 1 223 ? -18.133 -12.586 8.738  1.00 30.67 ? 223 VAL B CA    1 
ATOM   3297 C C     . VAL B 1 223 ? -18.995 -11.316 8.724  1.00 31.66 ? 223 VAL B C     1 
ATOM   3298 O O     . VAL B 1 223 ? -19.451 -10.823 9.766  1.00 29.40 ? 223 VAL B O     1 
ATOM   3299 C CB    . VAL B 1 223 ? -16.628 -12.216 8.771  1.00 31.65 ? 223 VAL B CB    1 
ATOM   3300 C CG1   . VAL B 1 223 ? -16.326 -11.273 9.961  1.00 30.60 ? 223 VAL B CG1   1 
ATOM   3301 C CG2   . VAL B 1 223 ? -15.785 -13.502 8.880  1.00 30.17 ? 223 VAL B CG2   1 
ATOM   3302 N N     . ILE B 1 224 ? -19.213 -10.786 7.526  1.00 32.18 ? 224 ILE B N     1 
ATOM   3303 C CA    . ILE B 1 224 ? -20.028 -9.595  7.370  1.00 33.44 ? 224 ILE B CA    1 
ATOM   3304 C C     . ILE B 1 224 ? -21.465 -9.925  7.813  1.00 34.78 ? 224 ILE B C     1 
ATOM   3305 O O     . ILE B 1 224 ? -22.084 -9.165  8.571  1.00 33.39 ? 224 ILE B O     1 
ATOM   3306 C CB    . ILE B 1 224 ? -19.986 -9.107  5.886  1.00 32.82 ? 224 ILE B CB    1 
ATOM   3307 C CG1   . ILE B 1 224 ? -18.568 -8.605  5.562  1.00 31.41 ? 224 ILE B CG1   1 
ATOM   3308 C CG2   . ILE B 1 224 ? -21.007 -7.975  5.656  1.00 34.74 ? 224 ILE B CG2   1 
ATOM   3309 C CD1   . ILE B 1 224 ? -18.360 -8.059  4.143  1.00 26.25 ? 224 ILE B CD1   1 
ATOM   3310 N N     . THR B 1 225 ? -21.978 -11.071 7.360  1.00 35.72 ? 225 THR B N     1 
ATOM   3311 C CA    . THR B 1 225 ? -23.332 -11.493 7.708  1.00 38.01 ? 225 THR B CA    1 
ATOM   3312 C C     . THR B 1 225 ? -23.465 -11.646 9.220  1.00 38.64 ? 225 THR B C     1 
ATOM   3313 O O     . THR B 1 225 ? -24.420 -11.172 9.834  1.00 38.01 ? 225 THR B O     1 
ATOM   3314 C CB    . THR B 1 225 ? -23.684 -12.839 7.067  1.00 38.61 ? 225 THR B CB    1 
ATOM   3315 O OG1   . THR B 1 225 ? -23.555 -12.737 5.645  1.00 37.82 ? 225 THR B OG1   1 
ATOM   3316 C CG2   . THR B 1 225 ? -25.129 -13.234 7.422  1.00 39.17 ? 225 THR B CG2   1 
ATOM   3317 N N     . TYR B 1 226 ? -22.483 -12.303 9.819  1.00 40.24 ? 226 TYR B N     1 
ATOM   3318 C CA    . TYR B 1 226 ? -22.504 -12.516 11.260 1.00 40.89 ? 226 TYR B CA    1 
ATOM   3319 C C     . TYR B 1 226 ? -22.513 -11.186 12.012 1.00 39.96 ? 226 TYR B C     1 
ATOM   3320 O O     . TYR B 1 226 ? -23.247 -11.012 12.987 1.00 40.09 ? 226 TYR B O     1 
ATOM   3321 C CB    . TYR B 1 226 ? -21.295 -13.363 11.682 1.00 38.01 ? 226 TYR B CB    1 
ATOM   3322 C CG    . TYR B 1 226 ? -21.276 -13.671 13.160 1.00 39.33 ? 226 TYR B CG    1 
ATOM   3323 C CD1   . TYR B 1 226 ? -20.843 -12.720 14.082 1.00 37.74 ? 226 TYR B CD1   1 
ATOM   3324 C CD2   . TYR B 1 226 ? -21.720 -14.911 13.640 1.00 38.80 ? 226 TYR B CD2   1 
ATOM   3325 C CE1   . TYR B 1 226 ? -20.844 -12.990 15.441 1.00 40.02 ? 226 TYR B CE1   1 
ATOM   3326 C CE2   . TYR B 1 226 ? -21.729 -15.196 14.996 1.00 39.17 ? 226 TYR B CE2   1 
ATOM   3327 C CZ    . TYR B 1 226 ? -21.286 -14.233 15.894 1.00 41.67 ? 226 TYR B CZ    1 
ATOM   3328 O OH    . TYR B 1 226 ? -21.266 -14.518 17.239 1.00 43.78 ? 226 TYR B OH    1 
ATOM   3329 N N     . ILE B 1 227 ? -21.681 -10.255 11.552 1.00 41.15 ? 227 ILE B N     1 
ATOM   3330 C CA    . ILE B 1 227 ? -21.572 -8.931  12.159 1.00 40.75 ? 227 ILE B CA    1 
ATOM   3331 C C     . ILE B 1 227 ? -22.930 -8.245  12.156 1.00 41.90 ? 227 ILE B C     1 
ATOM   3332 O O     . ILE B 1 227 ? -23.366 -7.695  13.178 1.00 43.54 ? 227 ILE B O     1 
ATOM   3333 C CB    . ILE B 1 227 ? -20.543 -8.049  11.386 1.00 39.02 ? 227 ILE B CB    1 
ATOM   3334 C CG1   . ILE B 1 227 ? -19.122 -8.561  11.665 1.00 36.51 ? 227 ILE B CG1   1 
ATOM   3335 C CG2   . ILE B 1 227 ? -20.721 -6.568  11.761 1.00 35.57 ? 227 ILE B CG2   1 
ATOM   3336 C CD1   . ILE B 1 227 ? -18.028 -7.790  10.970 1.00 38.67 ? 227 ILE B CD1   1 
ATOM   3337 N N     . LYS B 1 228 ? -23.579 -8.272  10.997 1.00 43.05 ? 228 LYS B N     1 
ATOM   3338 C CA    . LYS B 1 228 ? -24.898 -7.669  10.820 1.00 45.32 ? 228 LYS B CA    1 
ATOM   3339 C C     . LYS B 1 228 ? -25.935 -8.345  11.721 1.00 44.27 ? 228 LYS B C     1 
ATOM   3340 O O     . LYS B 1 228 ? -26.609 -7.677  12.493 1.00 44.10 ? 228 LYS B O     1 
ATOM   3341 C CB    . LYS B 1 228 ? -25.342 -7.786  9.357  1.00 46.81 ? 228 LYS B CB    1 
ATOM   3342 C CG    . LYS B 1 228 ? -26.725 -7.214  9.070  1.00 53.71 ? 228 LYS B CG    1 
ATOM   3343 C CD    . LYS B 1 228 ? -27.071 -7.279  7.578  1.00 57.54 ? 228 LYS B CD    1 
ATOM   3344 C CE    . LYS B 1 228 ? -28.326 -6.454  7.264  1.00 60.99 ? 228 LYS B CE    1 
ATOM   3345 N NZ    . LYS B 1 228 ? -28.591 -6.235  5.794  1.00 62.42 ? 228 LYS B NZ    1 
ATOM   3346 N N     . ASP B 1 229 ? -26.050 -9.668  11.624 1.00 44.94 ? 229 ASP B N     1 
ATOM   3347 C CA    . ASP B 1 229 ? -27.023 -10.415 12.431 1.00 44.48 ? 229 ASP B CA    1 
ATOM   3348 C C     . ASP B 1 229 ? -26.909 -10.162 13.925 1.00 43.98 ? 229 ASP B C     1 
ATOM   3349 O O     . ASP B 1 229 ? -27.918 -10.130 14.627 1.00 45.23 ? 229 ASP B O     1 
ATOM   3350 C CB    . ASP B 1 229 ? -26.900 -11.921 12.190 1.00 43.47 ? 229 ASP B CB    1 
ATOM   3351 C CG    . ASP B 1 229 ? -27.340 -12.324 10.796 1.00 45.07 ? 229 ASP B CG    1 
ATOM   3352 O OD1   . ASP B 1 229 ? -28.012 -11.507 10.136 1.00 46.52 ? 229 ASP B OD1   1 
ATOM   3353 O OD2   . ASP B 1 229 ? -27.023 -13.455 10.361 1.00 44.77 ? 229 ASP B OD2   1 
ATOM   3354 N N     . HIS B 1 230 ? -25.694 -9.979  14.417 1.00 42.23 ? 230 HIS B N     1 
ATOM   3355 C CA    . HIS B 1 230 ? -25.510 -9.759  15.848 1.00 41.98 ? 230 HIS B CA    1 
ATOM   3356 C C     . HIS B 1 230 ? -25.287 -8.303  16.220 1.00 42.30 ? 230 HIS B C     1 
ATOM   3357 O O     . HIS B 1 230 ? -24.859 -8.005  17.335 1.00 42.45 ? 230 HIS B O     1 
ATOM   3358 C CB    . HIS B 1 230 ? -24.349 -10.617 16.351 1.00 39.01 ? 230 HIS B CB    1 
ATOM   3359 C CG    . HIS B 1 230 ? -24.533 -12.076 16.082 1.00 38.69 ? 230 HIS B CG    1 
ATOM   3360 N ND1   . HIS B 1 230 ? -25.076 -12.943 17.010 1.00 39.07 ? 230 HIS B ND1   1 
ATOM   3361 C CD2   . HIS B 1 230 ? -24.315 -12.807 14.964 1.00 35.48 ? 230 HIS B CD2   1 
ATOM   3362 C CE1   . HIS B 1 230 ? -25.183 -14.145 16.471 1.00 39.27 ? 230 HIS B CE1   1 
ATOM   3363 N NE2   . HIS B 1 230 ? -24.730 -14.090 15.230 1.00 39.77 ? 230 HIS B NE2   1 
ATOM   3364 N N     . GLY B 1 231 ? -25.580 -7.402  15.284 1.00 42.71 ? 231 GLY B N     1 
ATOM   3365 C CA    . GLY B 1 231 ? -25.416 -5.973  15.529 1.00 43.16 ? 231 GLY B CA    1 
ATOM   3366 C C     . GLY B 1 231 ? -24.075 -5.534  16.103 1.00 44.25 ? 231 GLY B C     1 
ATOM   3367 O O     . GLY B 1 231 ? -24.023 -4.698  17.005 1.00 43.53 ? 231 GLY B O     1 
ATOM   3368 N N     . LEU B 1 232 ? -22.981 -6.085  15.582 1.00 44.63 ? 232 LEU B N     1 
ATOM   3369 C CA    . LEU B 1 232 ? -21.662 -5.720  16.074 1.00 44.74 ? 232 LEU B CA    1 
ATOM   3370 C C     . LEU B 1 232 ? -21.118 -4.471  15.386 1.00 45.03 ? 232 LEU B C     1 
ATOM   3371 O O     . LEU B 1 232 ? -21.467 -4.176  14.246 1.00 43.53 ? 232 LEU B O     1 
ATOM   3372 C CB    . LEU B 1 232 ? -20.690 -6.880  15.875 1.00 45.52 ? 232 LEU B CB    1 
ATOM   3373 C CG    . LEU B 1 232 ? -21.044 -8.182  16.593 1.00 46.20 ? 232 LEU B CG    1 
ATOM   3374 C CD1   . LEU B 1 232 ? -19.944 -9.211  16.366 1.00 48.52 ? 232 LEU B CD1   1 
ATOM   3375 C CD2   . LEU B 1 232 ? -21.199 -7.913  18.082 1.00 48.89 ? 232 LEU B CD2   1 
ATOM   3376 N N     . TYR B 1 233 ? -20.285 -3.735  16.117 1.00 46.40 ? 233 TYR B N     1 
ATOM   3377 C CA    . TYR B 1 233 ? -19.624 -2.518  15.644 1.00 47.28 ? 233 TYR B CA    1 
ATOM   3378 C C     . TYR B 1 233 ? -20.533 -1.370  15.198 1.00 50.86 ? 233 TYR B C     1 
ATOM   3379 O O     . TYR B 1 233 ? -20.284 -0.727  14.180 1.00 51.25 ? 233 TYR B O     1 
ATOM   3380 C CB    . TYR B 1 233 ? -18.633 -2.860  14.516 1.00 42.41 ? 233 TYR B CB    1 
ATOM   3381 C CG    . TYR B 1 233 ? -17.682 -3.988  14.864 1.00 38.27 ? 233 TYR B CG    1 
ATOM   3382 C CD1   . TYR B 1 233 ? -16.869 -3.924  16.004 1.00 37.68 ? 233 TYR B CD1   1 
ATOM   3383 C CD2   . TYR B 1 233 ? -17.614 -5.137  14.069 1.00 36.24 ? 233 TYR B CD2   1 
ATOM   3384 C CE1   . TYR B 1 233 ? -16.012 -4.984  16.345 1.00 34.99 ? 233 TYR B CE1   1 
ATOM   3385 C CE2   . TYR B 1 233 ? -16.761 -6.198  14.401 1.00 34.60 ? 233 TYR B CE2   1 
ATOM   3386 C CZ    . TYR B 1 233 ? -15.972 -6.114  15.536 1.00 33.57 ? 233 TYR B CZ    1 
ATOM   3387 O OH    . TYR B 1 233 ? -15.180 -7.175  15.879 1.00 32.20 ? 233 TYR B OH    1 
ATOM   3388 N N     . THR B 1 234 ? -21.580 -1.105  15.969 1.00 54.97 ? 234 THR B N     1 
ATOM   3389 C CA    . THR B 1 234 ? -22.489 -0.004  15.659 1.00 57.96 ? 234 THR B CA    1 
ATOM   3390 C C     . THR B 1 234 ? -22.286 1.077   16.718 1.00 60.30 ? 234 THR B C     1 
ATOM   3391 O O     . THR B 1 234 ? -22.022 0.710   17.889 1.00 60.88 ? 234 THR B O     1 
ATOM   3392 C CB    . THR B 1 234 ? -23.944 -0.444  15.735 1.00 57.87 ? 234 THR B CB    1 
ATOM   3393 O OG1   . THR B 1 234 ? -24.203 -0.944  17.054 1.00 58.56 ? 234 THR B OG1   1 
ATOM   3394 C CG2   . THR B 1 234 ? -24.236 -1.527  14.699 1.00 58.21 ? 234 THR B CG2   1 
HETATM 3395 S S     . SO4 C 2 .   ? 3.159   13.814  36.751 1.00 62.40 ? 301 SO4 A S     1 
HETATM 3396 O O1    . SO4 C 2 .   ? 3.810   12.696  36.056 1.00 62.76 ? 301 SO4 A O1    1 
HETATM 3397 O O2    . SO4 C 2 .   ? 4.041   14.987  36.730 1.00 61.71 ? 301 SO4 A O2    1 
HETATM 3398 O O3    . SO4 C 2 .   ? 1.899   14.185  36.092 1.00 61.01 ? 301 SO4 A O3    1 
HETATM 3399 O O4    . SO4 C 2 .   ? 2.913   13.432  38.193 1.00 64.20 ? 301 SO4 A O4    1 
HETATM 3400 O O3P   . NMN D 3 .   ? 10.633  5.193   20.085 1.00 46.57 ? 401 NMN A O3P   1 
HETATM 3401 P P     . NMN D 3 .   ? 9.226   5.288   20.554 1.00 47.38 ? 401 NMN A P     1 
HETATM 3402 O O1P   . NMN D 3 .   ? 8.144   5.028   19.578 1.00 47.81 ? 401 NMN A O1P   1 
HETATM 3403 O O2P   . NMN D 3 .   ? 9.051   4.262   21.793 1.00 48.12 ? 401 NMN A O2P   1 
HETATM 3404 O O5R   . NMN D 3 .   ? 9.004   6.735   21.237 1.00 43.26 ? 401 NMN A O5R   1 
HETATM 3405 C C5R   . NMN D 3 .   ? 8.958   7.897   20.408 1.00 40.96 ? 401 NMN A C5R   1 
HETATM 3406 C C4R   . NMN D 3 .   ? 8.710   9.176   21.220 1.00 37.05 ? 401 NMN A C4R   1 
HETATM 3407 O O4R   . NMN D 3 .   ? 7.483   8.981   22.008 1.00 37.44 ? 401 NMN A O4R   1 
HETATM 3408 C C3R   . NMN D 3 .   ? 9.839   9.423   22.238 1.00 36.20 ? 401 NMN A C3R   1 
HETATM 3409 O O3R   . NMN D 3 .   ? 10.058  10.842  22.372 1.00 33.66 ? 401 NMN A O3R   1 
HETATM 3410 C C2R   . NMN D 3 .   ? 9.297   8.838   23.529 1.00 35.48 ? 401 NMN A C2R   1 
HETATM 3411 O O2R   . NMN D 3 .   ? 9.843   9.523   24.665 1.00 34.97 ? 401 NMN A O2R   1 
HETATM 3412 C C1R   . NMN D 3 .   ? 7.809   9.130   23.430 1.00 36.10 ? 401 NMN A C1R   1 
HETATM 3413 N N1    . NMN D 3 .   ? 6.991   8.251   24.317 1.00 33.76 ? 401 NMN A N1    1 
HETATM 3414 C C2    . NMN D 3 .   ? 6.437   8.800   25.492 1.00 33.52 ? 401 NMN A C2    1 
HETATM 3415 C C3    . NMN D 3 .   ? 5.694   7.988   26.354 1.00 32.71 ? 401 NMN A C3    1 
HETATM 3416 C C7    . NMN D 3 .   ? 5.137   8.580   27.646 1.00 34.85 ? 401 NMN A C7    1 
HETATM 3417 O O7    . NMN D 3 .   ? 5.334   9.771   27.933 1.00 34.38 ? 401 NMN A O7    1 
HETATM 3418 N N7    . NMN D 3 .   ? 4.453   7.727   28.409 1.00 35.94 ? 401 NMN A N7    1 
HETATM 3419 C C4    . NMN D 3 .   ? 5.500   6.634   26.035 1.00 33.76 ? 401 NMN A C4    1 
HETATM 3420 C C5    . NMN D 3 .   ? 6.057   6.104   24.861 1.00 32.44 ? 401 NMN A C5    1 
HETATM 3421 C C6    . NMN D 3 .   ? 6.802   6.936   24.010 1.00 33.28 ? 401 NMN A C6    1 
HETATM 3422 P PG    . APC E 4 .   ? 12.364  3.975   13.641 1.00 70.93 ? 501 APC A PG    1 
HETATM 3423 O O1G   . APC E 4 .   ? 11.227  3.634   14.528 1.00 71.57 ? 501 APC A O1G   1 
HETATM 3424 O O2G   . APC E 4 .   ? 12.693  3.041   12.532 1.00 69.79 ? 501 APC A O2G   1 
HETATM 3425 O O3G   . APC E 4 .   ? 13.688  4.151   14.559 1.00 68.20 ? 501 APC A O3G   1 
HETATM 3426 P PB    . APC E 4 .   ? 10.711  6.233   13.098 1.00 69.61 ? 501 APC A PB    1 
HETATM 3427 O O1B   . APC E 4 .   ? 10.844  7.497   12.332 1.00 68.29 ? 501 APC A O1B   1 
HETATM 3428 O O2B   . APC E 4 .   ? 9.654   5.281   12.684 1.00 69.78 ? 501 APC A O2B   1 
HETATM 3429 O O3B   . APC E 4 .   ? 12.154  5.473   13.033 1.00 71.07 ? 501 APC A O3B   1 
HETATM 3430 P PA    . APC E 4 .   ? 11.004  8.234   15.309 1.00 63.50 ? 501 APC A PA    1 
HETATM 3431 O O1A   . APC E 4 .   ? 10.919  8.311   16.792 1.00 63.48 ? 501 APC A O1A   1 
HETATM 3432 O O2A   . APC E 4 .   ? 12.296  8.580   14.669 1.00 62.45 ? 501 APC A O2A   1 
HETATM 3433 C C3A   . APC E 4 .   ? 10.522  6.570   14.855 1.00 66.31 ? 501 APC A C3A   1 
HETATM 3434 O "O5'" . APC E 4 .   ? 9.813   9.137   14.672 1.00 62.59 ? 501 APC A "O5'" 1 
HETATM 3435 C "C5'" . APC E 4 .   ? 9.532   10.444  15.210 1.00 60.12 ? 501 APC A "C5'" 1 
HETATM 3436 C "C4'" . APC E 4 .   ? 8.177   11.006  14.713 1.00 60.70 ? 501 APC A "C4'" 1 
HETATM 3437 O "O4'" . APC E 4 .   ? 8.159   11.008  13.241 1.00 59.81 ? 501 APC A "O4'" 1 
HETATM 3438 C "C3'" . APC E 4 .   ? 7.012   10.099  15.142 1.00 59.94 ? 501 APC A "C3'" 1 
HETATM 3439 O "O3'" . APC E 4 .   ? 5.871   10.900  15.459 1.00 57.26 ? 501 APC A "O3'" 1 
HETATM 3440 C "C2'" . APC E 4 .   ? 6.722   9.258   13.928 1.00 60.47 ? 501 APC A "C2'" 1 
HETATM 3441 O "O2'" . APC E 4 .   ? 5.336   8.899   13.912 1.00 60.64 ? 501 APC A "O2'" 1 
HETATM 3442 C "C1'" . APC E 4 .   ? 7.011   10.216  12.789 1.00 61.29 ? 501 APC A "C1'" 1 
HETATM 3443 N N9    . APC E 4 .   ? 7.288   9.529   11.498 1.00 62.25 ? 501 APC A N9    1 
HETATM 3444 C C8    . APC E 4 .   ? 8.370   8.786   11.222 1.00 64.11 ? 501 APC A C8    1 
HETATM 3445 N N7    . APC E 4 .   ? 8.328   8.397   9.942  1.00 64.70 ? 501 APC A N7    1 
HETATM 3446 C C5    . APC E 4 .   ? 7.221   8.883   9.402  1.00 64.34 ? 501 APC A C5    1 
HETATM 3447 C C6    . APC E 4 .   ? 6.674   8.797   8.124  1.00 63.76 ? 501 APC A C6    1 
HETATM 3448 N N6    . APC E 4 .   ? 7.331   8.146   7.161  1.00 61.25 ? 501 APC A N6    1 
HETATM 3449 N N1    . APC E 4 .   ? 5.489   9.405   7.866  1.00 63.45 ? 501 APC A N1    1 
HETATM 3450 C C2    . APC E 4 .   ? 4.818   10.130  8.888  1.00 63.75 ? 501 APC A C2    1 
HETATM 3451 N N3    . APC E 4 .   ? 5.358   10.211  10.109 1.00 64.43 ? 501 APC A N3    1 
HETATM 3452 C C4    . APC E 4 .   ? 6.547   9.605   10.389 1.00 64.37 ? 501 APC A C4    1 
HETATM 3453 S S     . SO4 F 2 .   ? 7.104   -16.766 33.397 1.00 76.67 ? 302 SO4 B S     1 
HETATM 3454 O O1    . SO4 F 2 .   ? 6.353   -15.543 33.084 1.00 76.38 ? 302 SO4 B O1    1 
HETATM 3455 O O2    . SO4 F 2 .   ? 6.233   -17.938 33.280 1.00 75.69 ? 302 SO4 B O2    1 
HETATM 3456 O O3    . SO4 F 2 .   ? 8.215   -16.964 32.464 1.00 77.22 ? 302 SO4 B O3    1 
HETATM 3457 O O4    . SO4 F 2 .   ? 7.614   -16.684 34.807 1.00 77.30 ? 302 SO4 B O4    1 
HETATM 3458 O O3P   . NMN G 3 .   ? -3.640  -5.238  19.651 1.00 67.86 ? 402 NMN B O3P   1 
HETATM 3459 P P     . NMN G 3 .   ? -2.304  -5.643  20.171 1.00 67.46 ? 402 NMN B P     1 
HETATM 3460 O O1P   . NMN G 3 .   ? -1.093  -5.039  19.564 1.00 65.63 ? 402 NMN B O1P   1 
HETATM 3461 O O2P   . NMN G 3 .   ? -2.270  -5.343  21.748 1.00 66.61 ? 402 NMN B O2P   1 
HETATM 3462 O O5R   . NMN G 3 .   ? -2.200  -7.249  20.102 1.00 65.15 ? 402 NMN B O5R   1 
HETATM 3463 C C5R   . NMN G 3 .   ? -0.940  -7.866  20.318 1.00 60.48 ? 402 NMN B C5R   1 
HETATM 3464 C C4R   . NMN G 3 .   ? -1.047  -9.402  20.370 1.00 57.31 ? 402 NMN B C4R   1 
HETATM 3465 O O4R   . NMN G 3 .   ? 0.201   -9.882  20.962 1.00 55.41 ? 402 NMN B O4R   1 
HETATM 3466 C C3R   . NMN G 3 .   ? -2.119  -9.822  21.384 1.00 56.07 ? 402 NMN B C3R   1 
HETATM 3467 O O3R   . NMN G 3 .   ? -2.445  -11.201 21.181 1.00 55.93 ? 402 NMN B O3R   1 
HETATM 3468 C C2R   . NMN G 3 .   ? -1.433  -9.658  22.713 1.00 55.03 ? 402 NMN B C2R   1 
HETATM 3469 O O2R   . NMN G 3 .   ? -1.991  -10.568 23.666 1.00 54.60 ? 402 NMN B O2R   1 
HETATM 3470 C C1R   . NMN G 3 .   ? 0.012   -10.055 22.411 1.00 53.93 ? 402 NMN B C1R   1 
HETATM 3471 N N1    . NMN G 3 .   ? 0.972   -9.250  23.220 1.00 51.96 ? 402 NMN B N1    1 
HETATM 3472 C C2    . NMN G 3 .   ? 1.778   -9.914  24.174 1.00 50.29 ? 402 NMN B C2    1 
HETATM 3473 C C3    . NMN G 3 .   ? 2.661   -9.185  24.969 1.00 47.52 ? 402 NMN B C3    1 
HETATM 3474 C C7    . NMN G 3 .   ? 3.561   -9.925  25.966 1.00 47.83 ? 402 NMN B C7    1 
HETATM 3475 O O7    . NMN G 3 .   ? 3.575   -11.156 25.996 1.00 43.94 ? 402 NMN B O7    1 
HETATM 3476 N N7    . NMN G 3 .   ? 4.312   -9.149  26.757 1.00 46.41 ? 402 NMN B N7    1 
HETATM 3477 C C4    . NMN G 3 .   ? 2.734   -7.797  24.815 1.00 47.77 ? 402 NMN B C4    1 
HETATM 3478 C C5    . NMN G 3 .   ? 1.931   -7.151  23.862 1.00 48.55 ? 402 NMN B C5    1 
HETATM 3479 C C6    . NMN G 3 .   ? 1.050   -7.898  23.067 1.00 49.21 ? 402 NMN B C6    1 
HETATM 3480 P PG    . APC H 4 .   ? -6.378  -3.197  15.104 1.00 89.90 ? 502 APC B PG    1 
HETATM 3481 O O1G   . APC H 4 .   ? -5.344  -3.251  16.162 1.00 89.65 ? 502 APC B O1G   1 
HETATM 3482 O O2G   . APC H 4 .   ? -6.351  -2.059  14.141 1.00 88.00 ? 502 APC B O2G   1 
HETATM 3483 O O3G   . APC H 4 .   ? -7.823  -3.216  15.827 1.00 88.08 ? 502 APC B O3G   1 
HETATM 3484 P PB    . APC H 4 .   ? -5.006  -5.189  13.634 1.00 91.08 ? 502 APC B PB    1 
HETATM 3485 O O1B   . APC H 4 .   ? -5.384  -6.275  12.695 1.00 90.09 ? 502 APC B O1B   1 
HETATM 3486 O O2B   . APC H 4 .   ? -4.200  -4.061  13.100 1.00 91.69 ? 502 APC B O2B   1 
HETATM 3487 O O3B   . APC H 4 .   ? -6.377  -4.588  14.266 1.00 90.91 ? 502 APC B O3B   1 
HETATM 3488 P PA    . APC H 4 .   ? -4.626  -7.587  15.414 1.00 87.19 ? 502 APC B PA    1 
HETATM 3489 O O1A   . APC H 4 .   ? -4.281  -7.855  16.839 1.00 86.44 ? 502 APC B O1A   1 
HETATM 3490 O O2A   . APC H 4 .   ? -6.015  -7.842  14.973 1.00 86.51 ? 502 APC B O2A   1 
HETATM 3491 C C3A   . APC H 4 .   ? -4.181  -5.873  15.086 1.00 89.28 ? 502 APC B C3A   1 
HETATM 3492 O "O5'" . APC H 4 .   ? -3.605  -8.390  14.448 1.00 86.59 ? 502 APC B "O5'" 1 
HETATM 3493 C "C5'" . APC H 4 .   ? -3.232  -9.751  14.723 1.00 84.21 ? 502 APC B "C5'" 1 
HETATM 3494 C "C4'" . APC H 4 .   ? -2.109  -10.231 13.769 1.00 83.17 ? 502 APC B "C4'" 1 
HETATM 3495 O "O4'" . APC H 4 .   ? -2.508  -9.929  12.374 1.00 82.03 ? 502 APC B "O4'" 1 
HETATM 3496 C "C3'" . APC H 4 .   ? -0.813  -9.436  14.001 1.00 82.46 ? 502 APC B "C3'" 1 
HETATM 3497 O "O3'" . APC H 4 .   ? 0.316   -10.300 13.810 1.00 80.13 ? 502 APC B "O3'" 1 
HETATM 3498 C "C2'" . APC H 4 .   ? -0.828  -8.366  12.933 1.00 82.19 ? 502 APC B "C2'" 1 
HETATM 3499 O "O2'" . APC H 4 .   ? 0.514   -8.013  12.579 1.00 81.84 ? 502 APC B "O2'" 1 
HETATM 3500 C "C1'" . APC H 4 .   ? -1.476  -9.084  11.768 1.00 81.89 ? 502 APC B "C1'" 1 
HETATM 3501 N N9    . APC H 4 .   ? -2.028  -8.150  10.737 1.00 82.53 ? 502 APC B N9    1 
HETATM 3502 C C8    . APC H 4 .   ? -3.132  -7.395  10.861 1.00 83.00 ? 502 APC B C8    1 
HETATM 3503 N N7    . APC H 4 .   ? -3.354  -6.742  9.711  1.00 83.04 ? 502 APC B N7    1 
HETATM 3504 C C5    . APC H 4 .   ? -2.397  -7.076  8.855  1.00 82.60 ? 502 APC B C5    1 
HETATM 3505 C C6    . APC H 4 .   ? -2.131  -6.715  7.530  1.00 81.98 ? 502 APC B C6    1 
HETATM 3506 N N6    . APC H 4 .   ? -2.945  -5.888  6.881  1.00 79.29 ? 502 APC B N6    1 
HETATM 3507 N N1    . APC H 4 .   ? -1.047  -7.234  6.905  1.00 83.42 ? 502 APC B N1    1 
HETATM 3508 C C2    . APC H 4 .   ? -0.189  -8.137  7.592  1.00 83.14 ? 502 APC B C2    1 
HETATM 3509 N N3    . APC H 4 .   ? -0.458  -8.476  8.857  1.00 82.40 ? 502 APC B N3    1 
HETATM 3510 C C4    . APC H 4 .   ? -1.542  -7.967  9.505  1.00 83.10 ? 502 APC B C4    1 
HETATM 3511 O O     . HOH I 5 .   ? 21.927  15.582  -6.127 1.00 16.24 ? 601 HOH A O     1 
HETATM 3512 O O     . HOH I 5 .   ? 14.504  7.682   14.081 1.00 25.41 ? 602 HOH A O     1 
HETATM 3513 O O     . HOH I 5 .   ? 11.966  12.587  22.196 1.00 26.33 ? 603 HOH A O     1 
HETATM 3514 O O     . HOH I 5 .   ? 18.904  13.178  13.856 1.00 20.41 ? 604 HOH A O     1 
HETATM 3515 O O     . HOH I 5 .   ? 16.609  17.020  22.722 1.00 31.91 ? 605 HOH A O     1 
HETATM 3516 O O     . HOH I 5 .   ? 13.959  19.286  23.907 1.00 32.08 ? 606 HOH A O     1 
HETATM 3517 O O     . HOH I 5 .   ? 11.325  23.515  6.702  1.00 21.87 ? 607 HOH A O     1 
HETATM 3518 O O     . HOH I 5 .   ? 19.263  17.259  0.723  1.00 21.50 ? 608 HOH A O     1 
HETATM 3519 O O     . HOH I 5 .   ? 19.842  13.522  0.108  1.00 16.50 ? 610 HOH A O     1 
HETATM 3520 O O     . HOH I 5 .   ? 13.967  12.015  26.666 1.00 27.35 ? 611 HOH A O     1 
HETATM 3521 O O     . HOH I 5 .   ? 8.408   25.235  3.090  1.00 29.41 ? 612 HOH A O     1 
HETATM 3522 O O     . HOH I 5 .   ? 22.118  15.493  23.764 1.00 29.31 ? 613 HOH A O     1 
HETATM 3523 O O     . HOH I 5 .   ? 16.294  16.528  2.062  1.00 22.00 ? 614 HOH A O     1 
HETATM 3524 O O     . HOH I 5 .   ? -8.496  20.017  11.964 1.00 39.07 ? 615 HOH A O     1 
HETATM 3525 O O     . HOH I 5 .   ? -10.483 20.078  25.485 1.00 29.28 ? 616 HOH A O     1 
HETATM 3526 O O     . HOH I 5 .   ? 17.042  14.546  0.013  1.00 24.73 ? 617 HOH A O     1 
HETATM 3527 O O     . HOH I 5 .   ? 3.778   11.275  28.907 1.00 41.77 ? 619 HOH A O     1 
HETATM 3528 O O     . HOH I 5 .   ? 4.338   24.031  5.275  1.00 30.34 ? 623 HOH A O     1 
HETATM 3529 O O     . HOH I 5 .   ? 6.176   13.805  18.854 1.00 26.15 ? 624 HOH A O     1 
HETATM 3530 O O     . HOH I 5 .   ? 25.400  12.152  -0.621 1.00 30.11 ? 626 HOH A O     1 
HETATM 3531 O O     . HOH I 5 .   ? -3.149  7.356   8.799  1.00 36.15 ? 629 HOH A O     1 
HETATM 3532 O O     . HOH I 5 .   ? 21.003  18.870  3.192  1.00 34.12 ? 630 HOH A O     1 
HETATM 3533 O O     . HOH I 5 .   ? 31.142  17.386  11.232 1.00 29.26 ? 631 HOH A O     1 
HETATM 3534 O O     . HOH I 5 .   ? 23.879  7.782   1.229  1.00 25.74 ? 633 HOH A O     1 
HETATM 3535 O O     . HOH I 5 .   ? 14.748  13.476  28.770 1.00 31.60 ? 640 HOH A O     1 
HETATM 3536 O O     . HOH I 5 .   ? -9.920  19.078  15.124 1.00 33.84 ? 641 HOH A O     1 
HETATM 3537 O O     . HOH I 5 .   ? 9.706   12.040  25.659 1.00 34.70 ? 643 HOH A O     1 
HETATM 3538 O O     . HOH I 5 .   ? 16.191  26.616  11.198 1.00 39.01 ? 644 HOH A O     1 
HETATM 3539 O O     . HOH I 5 .   ? -8.488  7.651   9.958  1.00 31.60 ? 645 HOH A O     1 
HETATM 3540 O O     . HOH I 5 .   ? -9.909  15.193  15.061 1.00 29.71 ? 646 HOH A O     1 
HETATM 3541 O O     . HOH I 5 .   ? -11.443 17.028  15.426 1.00 82.20 ? 647 HOH A O     1 
HETATM 3542 O O     . HOH I 5 .   ? -8.874  16.806  12.275 1.00 46.69 ? 649 HOH A O     1 
HETATM 3543 O O     . HOH I 5 .   ? 24.820  17.832  19.712 1.00 39.11 ? 651 HOH A O     1 
HETATM 3544 O O     . HOH I 5 .   ? 26.046  14.102  1.231  1.00 27.76 ? 652 HOH A O     1 
HETATM 3545 O O     . HOH I 5 .   ? -0.796  3.591   26.998 1.00 40.61 ? 654 HOH A O     1 
HETATM 3546 O O     . HOH I 5 .   ? -7.494  4.116   7.364  1.00 42.66 ? 657 HOH A O     1 
HETATM 3547 O O     . HOH I 5 .   ? 18.591  -1.306  11.039 1.00 31.38 ? 659 HOH A O     1 
HETATM 3548 O O     . HOH I 5 .   ? -9.504  23.347  19.885 1.00 28.12 ? 664 HOH A O     1 
HETATM 3549 O O     . HOH I 5 .   ? 18.346  24.078  14.719 1.00 30.55 ? 665 HOH A O     1 
HETATM 3550 O O     . HOH I 5 .   ? 19.512  16.567  -2.833 1.00 37.00 ? 670 HOH A O     1 
HETATM 3551 O O     . HOH I 5 .   ? 30.140  16.219  9.047  1.00 36.02 ? 671 HOH A O     1 
HETATM 3552 O O     . HOH I 5 .   ? 18.402  19.804  4.563  1.00 35.88 ? 672 HOH A O     1 
HETATM 3553 O O     . HOH I 5 .   ? 12.753  11.766  0.107  1.00 54.25 ? 674 HOH A O     1 
HETATM 3554 O O     . HOH I 5 .   ? 26.155  4.504   2.529  1.00 35.61 ? 676 HOH A O     1 
HETATM 3555 O O     . HOH I 5 .   ? 25.211  12.177  23.713 1.00 39.82 ? 678 HOH A O     1 
HETATM 3556 O O     . HOH I 5 .   ? 3.237   26.458  2.532  1.00 40.13 ? 679 HOH A O     1 
HETATM 3557 O O     . HOH I 5 .   ? 4.952   5.812   21.307 1.00 41.34 ? 681 HOH A O     1 
HETATM 3558 O O     . HOH I 5 .   ? 26.012  4.927   15.349 1.00 44.05 ? 682 HOH A O     1 
HETATM 3559 O O     . HOH I 5 .   ? 8.397   7.894   17.267 1.00 48.63 ? 683 HOH A O     1 
HETATM 3560 O O     . HOH I 5 .   ? 20.188  24.567  11.916 1.00 50.86 ? 685 HOH A O     1 
HETATM 3561 O O     . HOH I 5 .   ? 12.006  7.749   20.699 1.00 44.71 ? 686 HOH A O     1 
HETATM 3562 O O     . HOH I 5 .   ? 20.993  11.842  25.887 1.00 37.11 ? 691 HOH A O     1 
HETATM 3563 O O     . HOH I 5 .   ? 23.552  0.183   10.870 1.00 39.98 ? 692 HOH A O     1 
HETATM 3564 O O     . HOH I 5 .   ? -0.390  24.969  24.659 1.00 45.68 ? 693 HOH A O     1 
HETATM 3565 O O     . HOH I 5 .   ? -13.042 9.998   14.741 1.00 34.58 ? 694 HOH A O     1 
HETATM 3566 O O     . HOH I 5 .   ? 16.921  29.146  7.227  1.00 46.99 ? 695 HOH A O     1 
HETATM 3567 O O     . HOH I 5 .   ? -3.737  3.419   28.514 1.00 46.46 ? 698 HOH A O     1 
HETATM 3568 O O     . HOH I 5 .   ? 25.933  15.835  -0.905 1.00 33.60 ? 699 HOH A O     1 
HETATM 3569 O O     . HOH I 5 .   ? -7.808  21.884  33.883 1.00 45.59 ? 700 HOH A O     1 
HETATM 3570 O O     . HOH I 5 .   ? -10.880 21.325  28.218 1.00 34.07 ? 701 HOH A O     1 
HETATM 3571 O O     . HOH I 5 .   ? 13.314  0.365   14.871 1.00 43.48 ? 704 HOH A O     1 
HETATM 3572 O O     . HOH I 5 .   ? 20.081  21.568  5.711  1.00 46.88 ? 708 HOH A O     1 
HETATM 3573 O O     . HOH I 5 .   ? 1.585   37.111  10.022 1.00 48.59 ? 709 HOH A O     1 
HETATM 3574 O O     . HOH I 5 .   ? -7.407  22.377  6.796  1.00 46.77 ? 710 HOH A O     1 
HETATM 3575 O O     . HOH I 5 .   ? 26.804  18.341  6.821  1.00 30.22 ? 713 HOH A O     1 
HETATM 3576 O O     . HOH I 5 .   ? 2.232   1.862   16.296 1.00 45.51 ? 714 HOH A O     1 
HETATM 3577 O O     . HOH I 5 .   ? -5.010  18.111  31.702 1.00 47.64 ? 716 HOH A O     1 
HETATM 3578 O O     . HOH I 5 .   ? -12.789 15.138  15.092 1.00 38.94 ? 717 HOH A O     1 
HETATM 3579 O O     . HOH I 5 .   ? 25.162  9.437   -0.430 1.00 32.12 ? 721 HOH A O     1 
HETATM 3580 O O     . HOH I 5 .   ? 11.473  26.114  5.355  1.00 38.42 ? 723 HOH A O     1 
HETATM 3581 O O     . HOH I 5 .   ? 25.170  20.635  19.956 1.00 36.81 ? 724 HOH A O     1 
HETATM 3582 O O     . HOH I 5 .   ? 27.115  6.760   18.496 1.00 37.51 ? 726 HOH A O     1 
HETATM 3583 O O     . HOH I 5 .   ? 29.568  13.750  1.518  1.00 51.59 ? 727 HOH A O     1 
HETATM 3584 O O     . HOH I 5 .   ? 3.023   0.651   13.736 1.00 44.02 ? 728 HOH A O     1 
HETATM 3585 O O     . HOH I 5 .   ? 6.184   3.536   22.208 1.00 56.43 ? 729 HOH A O     1 
HETATM 3586 O O     . HOH I 5 .   ? -4.821  5.179   20.437 1.00 51.83 ? 730 HOH A O     1 
HETATM 3587 O O     . HOH I 5 .   ? 18.210  27.776  9.660  1.00 53.66 ? 733 HOH A O     1 
HETATM 3588 O O     . HOH I 5 .   ? 2.717   8.483   30.795 1.00 42.89 ? 734 HOH A O     1 
HETATM 3589 O O     . HOH I 5 .   ? 15.737  4.280   16.538 1.00 42.32 ? 735 HOH A O     1 
HETATM 3590 O O     . HOH I 5 .   ? 8.746   27.748  4.882  1.00 53.53 ? 736 HOH A O     1 
HETATM 3591 O O     . HOH I 5 .   ? -2.780  5.221   28.758 1.00 62.74 ? 737 HOH A O     1 
HETATM 3592 O O     . HOH I 5 .   ? -8.757  1.801   18.797 1.00 45.36 ? 739 HOH A O     1 
HETATM 3593 O O     . HOH I 5 .   ? -14.942 6.016   22.857 1.00 42.53 ? 740 HOH A O     1 
HETATM 3594 O O     . HOH I 5 .   ? 32.147  13.050  3.495  1.00 55.75 ? 741 HOH A O     1 
HETATM 3595 O O     . HOH I 5 .   ? 0.864   19.820  2.295  1.00 44.98 ? 742 HOH A O     1 
HETATM 3596 O O     . HOH I 5 .   ? 30.283  -0.371  13.231 1.00 61.77 ? 743 HOH A O     1 
HETATM 3597 O O     . HOH I 5 .   ? 26.226  18.665  -0.129 1.00 39.54 ? 748 HOH A O     1 
HETATM 3598 O O     . HOH I 5 .   ? 29.088  5.907   8.256  1.00 50.48 ? 749 HOH A O     1 
HETATM 3599 O O     . HOH I 5 .   ? -9.590  21.423  8.764  1.00 46.36 ? 752 HOH A O     1 
HETATM 3600 O O     . HOH I 5 .   ? 7.199   5.297   13.008 1.00 54.99 ? 754 HOH A O     1 
HETATM 3601 O O     . HOH I 5 .   ? 22.672  6.236   22.340 1.00 42.58 ? 755 HOH A O     1 
HETATM 3602 O O     . HOH I 5 .   ? -2.681  24.333  23.288 1.00 61.74 ? 757 HOH A O     1 
HETATM 3603 O O     . HOH I 5 .   ? 13.206  2.527   24.977 1.00 71.07 ? 761 HOH A O     1 
HETATM 3604 O O     . HOH I 5 .   ? 11.103  6.474   18.134 1.00 45.54 ? 762 HOH A O     1 
HETATM 3605 O O     . HOH I 5 .   ? -0.716  12.258  36.106 1.00 44.86 ? 763 HOH A O     1 
HETATM 3606 O O     . HOH I 5 .   ? -6.870  25.087  19.300 1.00 50.90 ? 764 HOH A O     1 
HETATM 3607 O O     . HOH I 5 .   ? 6.176   11.284  35.002 1.00 57.53 ? 768 HOH A O     1 
HETATM 3608 O O     . HOH I 5 .   ? 10.859  0.638   5.752  1.00 48.67 ? 769 HOH A O     1 
HETATM 3609 O O     . HOH I 5 .   ? 2.883   2.891   8.176  1.00 49.13 ? 770 HOH A O     1 
HETATM 3610 O O     . HOH I 5 .   ? -1.167  19.594  4.389  1.00 37.96 ? 773 HOH A O     1 
HETATM 3611 O O     . HOH I 5 .   ? 5.890   26.636  1.801  1.00 46.36 ? 774 HOH A O     1 
HETATM 3612 O O     . HOH I 5 .   ? -4.621  36.537  12.085 1.00 46.50 ? 775 HOH A O     1 
HETATM 3613 O O     . HOH I 5 .   ? -7.298  27.527  20.534 1.00 67.23 ? 776 HOH A O     1 
HETATM 3614 O O     . HOH I 5 .   ? 15.914  -1.309  23.488 1.00 53.33 ? 777 HOH A O     1 
HETATM 3615 O O     . HOH J 5 .   ? -4.262  -13.517 21.179 1.00 34.95 ? 609 HOH B O     1 
HETATM 3616 O O     . HOH J 5 .   ? -12.720 2.143   14.511 1.00 32.00 ? 618 HOH B O     1 
HETATM 3617 O O     . HOH J 5 .   ? -8.295  -6.971  15.019 1.00 32.00 ? 620 HOH B O     1 
HETATM 3618 O O     . HOH J 5 .   ? -11.160 -19.463 4.735  1.00 31.19 ? 621 HOH B O     1 
HETATM 3619 O O     . HOH J 5 .   ? 13.510  -18.552 6.570  1.00 45.65 ? 622 HOH B O     1 
HETATM 3620 O O     . HOH J 5 .   ? -5.162  -13.428 26.016 1.00 38.25 ? 625 HOH B O     1 
HETATM 3621 O O     . HOH J 5 .   ? 15.010  -6.488  21.883 1.00 42.24 ? 627 HOH B O     1 
HETATM 3622 O O     . HOH J 5 .   ? 0.493   -12.495 -1.042 1.00 40.97 ? 628 HOH B O     1 
HETATM 3623 O O     . HOH J 5 .   ? -5.949  -20.288 22.069 1.00 37.84 ? 632 HOH B O     1 
HETATM 3624 O O     . HOH J 5 .   ? 13.434  -5.746  6.322  1.00 34.16 ? 634 HOH B O     1 
HETATM 3625 O O     . HOH J 5 .   ? 5.119   -13.410 26.227 1.00 33.94 ? 635 HOH B O     1 
HETATM 3626 O O     . HOH J 5 .   ? -13.741 -11.225 0.722  1.00 29.12 ? 636 HOH B O     1 
HETATM 3627 O O     . HOH J 5 .   ? -16.339 -10.345 1.393  1.00 35.39 ? 637 HOH B O     1 
HETATM 3628 O O     . HOH J 5 .   ? -16.173 -13.598 1.062  1.00 38.35 ? 638 HOH B O     1 
HETATM 3629 O O     . HOH J 5 .   ? -12.776 -12.420 14.472 1.00 26.69 ? 639 HOH B O     1 
HETATM 3630 O O     . HOH J 5 .   ? 12.671  -7.092  30.223 1.00 49.13 ? 642 HOH B O     1 
HETATM 3631 O O     . HOH J 5 .   ? 9.211   -5.154  24.857 1.00 32.19 ? 648 HOH B O     1 
HETATM 3632 O O     . HOH J 5 .   ? 18.362  -20.370 18.273 1.00 40.63 ? 650 HOH B O     1 
HETATM 3633 O O     . HOH J 5 .   ? -6.883  -21.031 4.322  1.00 35.26 ? 653 HOH B O     1 
HETATM 3634 O O     . HOH J 5 .   ? -17.887 -18.886 19.737 1.00 46.38 ? 655 HOH B O     1 
HETATM 3635 O O     . HOH J 5 .   ? -20.134 -4.657  4.056  1.00 34.01 ? 656 HOH B O     1 
HETATM 3636 O O     . HOH J 5 .   ? 4.174   -6.028  2.165  1.00 43.73 ? 658 HOH B O     1 
HETATM 3637 O O     . HOH J 5 .   ? -12.550 -13.258 1.848  1.00 35.74 ? 660 HOH B O     1 
HETATM 3638 O O     . HOH J 5 .   ? 7.934   -5.461  6.407  1.00 37.16 ? 661 HOH B O     1 
HETATM 3639 O O     . HOH J 5 .   ? -8.670  -18.053 21.899 1.00 34.21 ? 662 HOH B O     1 
HETATM 3640 O O     . HOH J 5 .   ? 0.914   -13.720 16.964 1.00 29.62 ? 663 HOH B O     1 
HETATM 3641 O O     . HOH J 5 .   ? 20.495  -19.707 22.995 1.00 44.70 ? 666 HOH B O     1 
HETATM 3642 O O     . HOH J 5 .   ? 5.145   -16.583 0.524  1.00 30.93 ? 667 HOH B O     1 
HETATM 3643 O O     . HOH J 5 .   ? 19.177  -14.930 23.485 1.00 44.23 ? 668 HOH B O     1 
HETATM 3644 O O     . HOH J 5 .   ? -20.127 -7.959  21.808 1.00 47.69 ? 669 HOH B O     1 
HETATM 3645 O O     . HOH J 5 .   ? -13.702 -23.002 10.118 1.00 47.39 ? 673 HOH B O     1 
HETATM 3646 O O     . HOH J 5 .   ? 6.144   -10.536 28.460 1.00 38.88 ? 675 HOH B O     1 
HETATM 3647 O O     . HOH J 5 .   ? -17.613 -16.487 3.493  1.00 44.13 ? 677 HOH B O     1 
HETATM 3648 O O     . HOH J 5 .   ? 13.443  -10.744 31.246 1.00 44.83 ? 680 HOH B O     1 
HETATM 3649 O O     . HOH J 5 .   ? -22.568 -15.953 8.695  1.00 47.67 ? 684 HOH B O     1 
HETATM 3650 O O     . HOH J 5 .   ? -7.526  0.503   17.128 1.00 44.24 ? 687 HOH B O     1 
HETATM 3651 O O     . HOH J 5 .   ? -23.565 -4.730  12.605 1.00 44.20 ? 688 HOH B O     1 
HETATM 3652 O O     . HOH J 5 .   ? -1.081  -27.528 4.864  1.00 45.78 ? 689 HOH B O     1 
HETATM 3653 O O     . HOH J 5 .   ? -21.959 -1.835  6.012  1.00 42.90 ? 690 HOH B O     1 
HETATM 3654 O O     . HOH J 5 .   ? 3.753   -34.208 8.743  1.00 53.25 ? 696 HOH B O     1 
HETATM 3655 O O     . HOH J 5 .   ? 16.696  -3.490  19.397 1.00 46.76 ? 697 HOH B O     1 
HETATM 3656 O O     . HOH J 5 .   ? -5.971  -15.763 28.031 1.00 47.45 ? 702 HOH B O     1 
HETATM 3657 O O     . HOH J 5 .   ? -21.917 -8.866  2.089  1.00 44.05 ? 703 HOH B O     1 
HETATM 3658 O O     . HOH J 5 .   ? 2.305   -6.274  20.465 1.00 45.17 ? 705 HOH B O     1 
HETATM 3659 O O     . HOH J 5 .   ? 16.238  -15.217 9.487  1.00 47.07 ? 706 HOH B O     1 
HETATM 3660 O O     . HOH J 5 .   ? 16.637  -22.663 18.501 1.00 45.66 ? 707 HOH B O     1 
HETATM 3661 O O     . HOH J 5 .   ? -14.320 -17.168 24.147 1.00 49.82 ? 711 HOH B O     1 
HETATM 3662 O O     . HOH J 5 .   ? -12.499 -13.640 27.032 1.00 46.61 ? 712 HOH B O     1 
HETATM 3663 O O     . HOH J 5 .   ? -4.359  -22.352 -0.436 1.00 40.57 ? 715 HOH B O     1 
HETATM 3664 O O     . HOH J 5 .   ? -12.318 8.005   5.592  1.00 38.27 ? 718 HOH B O     1 
HETATM 3665 O O     . HOH J 5 .   ? 16.336  -5.965  1.337  1.00 47.44 ? 719 HOH B O     1 
HETATM 3666 O O     . HOH J 5 .   ? 15.223  -1.627  15.331 1.00 39.14 ? 720 HOH B O     1 
HETATM 3667 O O     . HOH J 5 .   ? 14.155  -16.201 6.426  1.00 46.90 ? 722 HOH B O     1 
HETATM 3668 O O     . HOH J 5 .   ? -8.756  -8.756  0.000  0.5  43.88 ? 725 HOH B O     1 
HETATM 3669 O O     . HOH J 5 .   ? -0.088  -21.263 1.450  1.00 40.29 ? 731 HOH B O     1 
HETATM 3670 O O     . HOH J 5 .   ? -7.988  -7.060  5.993  1.00 66.46 ? 732 HOH B O     1 
HETATM 3671 O O     . HOH J 5 .   ? 9.160   -7.731  4.881  1.00 43.28 ? 738 HOH B O     1 
HETATM 3672 O O     . HOH J 5 .   ? -6.798  -9.583  1.289  1.00 57.46 ? 744 HOH B O     1 
HETATM 3673 O O     . HOH J 5 .   ? -12.206 -23.394 12.673 1.00 45.15 ? 745 HOH B O     1 
HETATM 3674 O O     . HOH J 5 .   ? -24.981 -15.319 12.608 1.00 50.01 ? 746 HOH B O     1 
HETATM 3675 O O     . HOH J 5 .   ? -7.210  -1.013  20.345 1.00 60.61 ? 747 HOH B O     1 
HETATM 3676 O O     . HOH J 5 .   ? -12.953 -15.994 1.980  1.00 41.88 ? 750 HOH B O     1 
HETATM 3677 O O     . HOH J 5 .   ? 14.679  -4.425  17.553 1.00 41.85 ? 751 HOH B O     1 
HETATM 3678 O O     . HOH J 5 .   ? -21.575 -6.121  2.407  1.00 41.10 ? 753 HOH B O     1 
HETATM 3679 O O     . HOH J 5 .   ? 9.327   -34.527 2.963  1.00 53.63 ? 756 HOH B O     1 
HETATM 3680 O O     . HOH J 5 .   ? -7.682  -26.904 28.299 1.00 50.46 ? 758 HOH B O     1 
HETATM 3681 O O     . HOH J 5 .   ? -18.875 -6.327  23.445 1.00 55.75 ? 759 HOH B O     1 
HETATM 3682 O O     . HOH J 5 .   ? -3.236  -12.373 12.436 1.00 71.15 ? 760 HOH B O     1 
HETATM 3683 O O     . HOH J 5 .   ? -6.220  1.678   8.122  1.00 55.97 ? 765 HOH B O     1 
HETATM 3684 O O     . HOH J 5 .   ? 1.975   -1.245  7.895  1.00 40.84 ? 766 HOH B O     1 
HETATM 3685 O O     . HOH J 5 .   ? -15.086 -26.112 17.791 1.00 47.26 ? 767 HOH B O     1 
HETATM 3686 O O     . HOH J 5 .   ? -16.307 -16.155 5.532  1.00 57.70 ? 771 HOH B O     1 
HETATM 3687 O O     . HOH J 5 .   ? 8.787   -24.126 17.277 1.00 53.25 ? 772 HOH B O     1 
HETATM 3688 O O     . HOH J 5 .   ? 12.552  -21.993 14.694 1.00 62.14 ? 778 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  CYS 12  12  12  CYS CYS A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  HIS 22  22  22  HIS HIS A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  MET 25  25  25  MET MET A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  HIS 34  34  34  HIS HIS A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  HIS 63  63  63  HIS HIS A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  MET 67  67  67  MET MET A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  TRP 90  90  90  TRP TRP A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  HIS 99  99  99  HIS HIS A . n 
A 1 100 HIS 100 100 100 HIS HIS A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ARG 106 106 ?   ?   ?   A . n 
A 1 107 SER 107 107 ?   ?   ?   A . n 
A 1 108 PRO 108 108 ?   ?   ?   A . n 
A 1 109 PRO 109 109 ?   ?   ?   A . n 
A 1 110 GLN 110 110 ?   ?   ?   A . n 
A 1 111 MET 111 111 ?   ?   ?   A . n 
A 1 112 GLU 112 112 ?   ?   ?   A . n 
A 1 113 GLY 113 113 ?   ?   ?   A . n 
A 1 114 PRO 114 114 ?   ?   ?   A . n 
A 1 115 ASP 115 115 ?   ?   ?   A . n 
A 1 116 HIS 116 116 ?   ?   ?   A . n 
A 1 117 GLY 117 117 ?   ?   ?   A . n 
A 1 118 LYS 118 118 ?   ?   ?   A . n 
A 1 119 ALA 119 119 ?   ?   ?   A . n 
A 1 120 LEU 120 120 ?   ?   ?   A . n 
A 1 121 PHE 121 121 ?   ?   ?   A . n 
A 1 122 SER 122 122 ?   ?   ?   A . n 
A 1 123 THR 123 123 ?   ?   ?   A . n 
A 1 124 PRO 124 124 ?   ?   ?   A . n 
A 1 125 ALA 125 125 ?   ?   ?   A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 CYS 134 134 134 CYS CYS A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 TRP 148 148 148 TRP TRP A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 CYS 164 164 164 CYS CYS A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 SER 169 169 169 SER GLY A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 ILE 181 181 181 ILE ILE A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 HIS 185 185 185 HIS HIS A . n 
A 1 186 GLN 186 186 186 GLN GLN A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 ASN 198 198 198 ASN ASN A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 TYR 226 226 226 TYR TYR A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 TYR 233 233 233 TYR TYR A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 LYS 235 235 ?   ?   ?   A . n 
A 1 236 GLY 236 236 ?   ?   ?   A . n 
A 1 237 SER 237 237 ?   ?   ?   A . n 
A 1 238 THR 238 238 ?   ?   ?   A . n 
A 1 239 TRP 239 239 ?   ?   ?   A . n 
A 1 240 LYS 240 240 ?   ?   ?   A . n 
A 1 241 GLY 241 241 ?   ?   ?   A . n 
A 1 242 LYS 242 242 ?   ?   ?   A . n 
A 1 243 SER 243 243 ?   ?   ?   A . n 
A 1 244 THR 244 244 ?   ?   ?   A . n 
A 1 245 GLN 245 245 ?   ?   ?   A . n 
A 1 246 SER 246 246 ?   ?   ?   A . n 
A 1 247 THR 247 247 ?   ?   ?   A . n 
A 1 248 GLU 248 248 ?   ?   ?   A . n 
A 1 249 GLY 249 249 ?   ?   ?   A . n 
A 1 250 LYS 250 250 ?   ?   ?   A . n 
A 1 251 THR 251 251 ?   ?   ?   A . n 
A 1 252 SER 252 252 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   LYS 2   2   ?   ?   ?   B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   ARG 4   4   4   ARG ARG B . n 
B 1 5   ILE 5   5   5   ILE ILE B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  CYS 12  12  12  CYS CYS B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  SER 14  14  14  SER SER B . n 
B 1 15  PHE 15  15  15  PHE PHE B . n 
B 1 16  ASN 16  16  16  ASN ASN B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  THR 19  19  19  THR THR B . n 
B 1 20  ASN 20  20  20  ASN ASN B . n 
B 1 21  MET 21  21  21  MET MET B . n 
B 1 22  HIS 22  22  22  HIS HIS B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  ARG 24  24  24  ARG ARG B . n 
B 1 25  MET 25  25  25  MET MET B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  VAL 28  28  28  VAL VAL B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  ARG 30  30  30  ARG ARG B . n 
B 1 31  ASP 31  31  31  ASP ASP B . n 
B 1 32  HIS 32  32  32  HIS HIS B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  HIS 34  34  34  HIS HIS B . n 
B 1 35  GLN 35  35  35  GLN GLN B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  GLY 37  37  37  GLY GLY B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  TYR 39  39  39  TYR TYR B . n 
B 1 40  GLN 40  40  40  GLN GLN B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  GLN 43  43  43  GLN GLN B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  ILE 46  46  46  ILE ILE B . n 
B 1 47  SER 47  47  47  SER SER B . n 
B 1 48  PRO 48  48  48  PRO PRO B . n 
B 1 49  VAL 49  49  49  VAL VAL B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  ASP 51  51  51  ASP ASP B . n 
B 1 52  THR 52  52  52  THR THR B . n 
B 1 53  TYR 53  53  53  TYR TYR B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  ASP 57  57  57  ASP ASP B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  ALA 59  59  59  ALA ALA B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  HIS 62  62  62  HIS HIS B . n 
B 1 63  HIS 63  63  63  HIS HIS B . n 
B 1 64  ARG 64  64  64  ARG ARG B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  MET 67  67  67  MET MET B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  ARG 69  69  69  ARG ARG B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  GLN 73  73  73  GLN GLN B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  ASP 76  76  76  ASP ASP B . n 
B 1 77  TRP 77  77  77  TRP TRP B . n 
B 1 78  ILE 78  78  78  ILE ILE B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  ASP 81  81  81  ASP ASP B . n 
B 1 82  PRO 82  82  82  PRO PRO B . n 
B 1 83  TRP 83  83  83  TRP TRP B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  GLN 89  89  89  GLN GLN B . n 
B 1 90  TRP 90  90  90  TRP TRP B . n 
B 1 91  MET 91  91  91  MET MET B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  LYS 95  95  95  LYS LYS B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  ARG 98  98  98  ARG ARG B . n 
B 1 99  HIS 99  99  99  HIS HIS B . n 
B 1 100 HIS 100 100 100 HIS HIS B . n 
B 1 101 HIS 101 101 101 HIS HIS B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 SER 107 107 ?   ?   ?   B . n 
B 1 108 PRO 108 108 ?   ?   ?   B . n 
B 1 109 PRO 109 109 ?   ?   ?   B . n 
B 1 110 GLN 110 110 ?   ?   ?   B . n 
B 1 111 MET 111 111 ?   ?   ?   B . n 
B 1 112 GLU 112 112 ?   ?   ?   B . n 
B 1 113 GLY 113 113 ?   ?   ?   B . n 
B 1 114 PRO 114 114 ?   ?   ?   B . n 
B 1 115 ASP 115 115 ?   ?   ?   B . n 
B 1 116 HIS 116 116 ?   ?   ?   B . n 
B 1 117 GLY 117 117 ?   ?   ?   B . n 
B 1 118 LYS 118 118 ?   ?   ?   B . n 
B 1 119 ALA 119 119 ?   ?   ?   B . n 
B 1 120 LEU 120 120 ?   ?   ?   B . n 
B 1 121 PHE 121 121 ?   ?   ?   B . n 
B 1 122 SER 122 122 ?   ?   ?   B . n 
B 1 123 THR 123 123 ?   ?   ?   B . n 
B 1 124 PRO 124 124 ?   ?   ?   B . n 
B 1 125 ALA 125 125 ?   ?   ?   B . n 
B 1 126 ALA 126 126 ?   ?   ?   B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 PRO 128 128 128 PRO PRO B . n 
B 1 129 GLU 129 129 129 GLU GLU B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 CYS 134 134 134 CYS CYS B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ASP 137 137 137 ASP ASP B . n 
B 1 138 VAL 138 138 138 VAL VAL B . n 
B 1 139 LEU 139 139 139 LEU LEU B . n 
B 1 140 LYS 140 140 140 LYS LYS B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 PHE 142 142 142 PHE PHE B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 THR 144 144 144 THR THR B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 ASN 146 146 146 ASN ASN B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 TRP 148 148 148 TRP TRP B . n 
B 1 149 LYS 149 149 149 LYS LYS B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 HIS 152 152 152 HIS HIS B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 GLN 154 154 154 GLN GLN B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 GLU 158 158 158 GLU GLU B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 PHE 160 160 160 PHE PHE B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 VAL 163 163 163 VAL VAL B . n 
B 1 164 CYS 164 164 164 CYS CYS B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 GLY 166 166 166 GLY GLY B . n 
B 1 167 ARG 167 167 167 ARG ARG B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 SER 169 169 169 SER GLY B . n 
B 1 170 HIS 170 170 170 HIS HIS B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 PRO 172 172 172 PRO PRO B . n 
B 1 173 LYS 173 173 173 LYS LYS B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 TYR 175 175 175 TYR TYR B . n 
B 1 176 ILE 176 176 176 ILE ILE B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 GLU 178 178 178 GLU GLU B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 ILE 181 181 181 ILE ILE B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 ARG 183 183 183 ARG ARG B . n 
B 1 184 MET 184 184 184 MET MET B . n 
B 1 185 HIS 185 185 185 HIS HIS B . n 
B 1 186 GLN 186 186 186 GLN GLN B . n 
B 1 187 HIS 187 187 187 HIS HIS B . n 
B 1 188 ASN 188 188 188 ASN ASN B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 HIS 190 190 190 HIS HIS B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 ALA 192 192 192 ALA ALA B . n 
B 1 193 LYS 193 193 193 LYS LYS B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 PRO 195 195 195 PRO PRO B . n 
B 1 196 VAL 196 196 196 VAL VAL B . n 
B 1 197 GLN 197 197 197 GLN GLN B . n 
B 1 198 ASN 198 198 198 ASN ASN B . n 
B 1 199 GLU 199 199 199 GLU GLU B . n 
B 1 200 ILE 200 200 200 ILE ILE B . n 
B 1 201 SER 201 201 201 SER SER B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 THR 203 203 203 THR THR B . n 
B 1 204 TYR 204 204 204 TYR TYR B . n 
B 1 205 ILE 205 205 205 ILE ILE B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 ARG 207 207 207 ARG ARG B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 GLN 211 211 211 GLN GLN B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 GLN 213 213 213 GLN GLN B . n 
B 1 214 SER 214 214 214 SER SER B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 LYS 216 216 216 LYS LYS B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 PRO 220 220 220 PRO PRO B . n 
B 1 221 ASP 221 221 221 ASP ASP B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 VAL 223 223 223 VAL VAL B . n 
B 1 224 ILE 224 224 224 ILE ILE B . n 
B 1 225 THR 225 225 225 THR THR B . n 
B 1 226 TYR 226 226 226 TYR TYR B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 LYS 228 228 228 LYS LYS B . n 
B 1 229 ASP 229 229 229 ASP ASP B . n 
B 1 230 HIS 230 230 230 HIS HIS B . n 
B 1 231 GLY 231 231 231 GLY GLY B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 TYR 233 233 233 TYR TYR B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 LYS 235 235 ?   ?   ?   B . n 
B 1 236 GLY 236 236 ?   ?   ?   B . n 
B 1 237 SER 237 237 ?   ?   ?   B . n 
B 1 238 THR 238 238 ?   ?   ?   B . n 
B 1 239 TRP 239 239 ?   ?   ?   B . n 
B 1 240 LYS 240 240 ?   ?   ?   B . n 
B 1 241 GLY 241 241 ?   ?   ?   B . n 
B 1 242 LYS 242 242 ?   ?   ?   B . n 
B 1 243 SER 243 243 ?   ?   ?   B . n 
B 1 244 THR 244 244 ?   ?   ?   B . n 
B 1 245 GLN 245 245 ?   ?   ?   B . n 
B 1 246 SER 246 246 ?   ?   ?   B . n 
B 1 247 THR 247 247 ?   ?   ?   B . n 
B 1 248 GLU 248 248 ?   ?   ?   B . n 
B 1 249 GLY 249 249 ?   ?   ?   B . n 
B 1 250 LYS 250 250 ?   ?   ?   B . n 
B 1 251 THR 251 251 ?   ?   ?   B . n 
B 1 252 SER 252 252 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   301 501 SO4 SO4 A . 
D 3 NMN 1   401 301 NMN NMN A . 
E 4 APC 1   501 401 APC APC A . 
F 2 SO4 1   302 502 SO4 SO4 B . 
G 3 NMN 1   402 302 NMN NMN B . 
H 4 APC 1   502 402 APC APC B . 
I 5 HOH 1   601 601 HOH HOH A . 
I 5 HOH 2   602 602 HOH HOH A . 
I 5 HOH 3   603 603 HOH HOH A . 
I 5 HOH 4   604 604 HOH HOH A . 
I 5 HOH 5   605 605 HOH HOH A . 
I 5 HOH 6   606 606 HOH HOH A . 
I 5 HOH 7   607 607 HOH HOH A . 
I 5 HOH 8   608 608 HOH HOH A . 
I 5 HOH 9   610 610 HOH HOH A . 
I 5 HOH 10  611 611 HOH HOH A . 
I 5 HOH 11  612 612 HOH HOH A . 
I 5 HOH 12  613 613 HOH HOH A . 
I 5 HOH 13  614 614 HOH HOH A . 
I 5 HOH 14  615 615 HOH HOH A . 
I 5 HOH 15  616 616 HOH HOH A . 
I 5 HOH 16  617 617 HOH HOH A . 
I 5 HOH 17  619 619 HOH HOH A . 
I 5 HOH 18  623 623 HOH HOH A . 
I 5 HOH 19  624 624 HOH HOH A . 
I 5 HOH 20  626 626 HOH HOH A . 
I 5 HOH 21  629 629 HOH HOH A . 
I 5 HOH 22  630 630 HOH HOH A . 
I 5 HOH 23  631 631 HOH HOH A . 
I 5 HOH 24  633 633 HOH HOH A . 
I 5 HOH 25  640 640 HOH HOH A . 
I 5 HOH 26  641 641 HOH HOH A . 
I 5 HOH 27  643 643 HOH HOH A . 
I 5 HOH 28  644 644 HOH HOH A . 
I 5 HOH 29  645 645 HOH HOH A . 
I 5 HOH 30  646 646 HOH HOH A . 
I 5 HOH 31  647 647 HOH HOH A . 
I 5 HOH 32  649 649 HOH HOH A . 
I 5 HOH 33  651 651 HOH HOH A . 
I 5 HOH 34  652 652 HOH HOH A . 
I 5 HOH 35  654 654 HOH HOH A . 
I 5 HOH 36  657 657 HOH HOH A . 
I 5 HOH 37  659 659 HOH HOH A . 
I 5 HOH 38  664 664 HOH HOH A . 
I 5 HOH 39  665 665 HOH HOH A . 
I 5 HOH 40  670 670 HOH HOH A . 
I 5 HOH 41  671 671 HOH HOH A . 
I 5 HOH 42  672 672 HOH HOH A . 
I 5 HOH 43  674 674 HOH HOH A . 
I 5 HOH 44  676 676 HOH HOH A . 
I 5 HOH 45  678 678 HOH HOH A . 
I 5 HOH 46  679 679 HOH HOH A . 
I 5 HOH 47  681 681 HOH HOH A . 
I 5 HOH 48  682 682 HOH HOH A . 
I 5 HOH 49  683 683 HOH HOH A . 
I 5 HOH 50  685 685 HOH HOH A . 
I 5 HOH 51  686 686 HOH HOH A . 
I 5 HOH 52  691 691 HOH HOH A . 
I 5 HOH 53  692 692 HOH HOH A . 
I 5 HOH 54  693 693 HOH HOH A . 
I 5 HOH 55  694 694 HOH HOH A . 
I 5 HOH 56  695 695 HOH HOH A . 
I 5 HOH 57  698 698 HOH HOH A . 
I 5 HOH 58  699 699 HOH HOH A . 
I 5 HOH 59  700 700 HOH HOH A . 
I 5 HOH 60  701 701 HOH HOH A . 
I 5 HOH 61  704 704 HOH HOH A . 
I 5 HOH 62  708 708 HOH HOH A . 
I 5 HOH 63  709 709 HOH HOH A . 
I 5 HOH 64  710 710 HOH HOH A . 
I 5 HOH 65  713 713 HOH HOH A . 
I 5 HOH 66  714 714 HOH HOH A . 
I 5 HOH 67  716 716 HOH HOH A . 
I 5 HOH 68  717 717 HOH HOH A . 
I 5 HOH 69  721 721 HOH HOH A . 
I 5 HOH 70  723 723 HOH HOH A . 
I 5 HOH 71  724 724 HOH HOH A . 
I 5 HOH 72  726 726 HOH HOH A . 
I 5 HOH 73  727 727 HOH HOH A . 
I 5 HOH 74  728 728 HOH HOH A . 
I 5 HOH 75  729 729 HOH HOH A . 
I 5 HOH 76  730 730 HOH HOH A . 
I 5 HOH 77  733 733 HOH HOH A . 
I 5 HOH 78  734 734 HOH HOH A . 
I 5 HOH 79  735 735 HOH HOH A . 
I 5 HOH 80  736 736 HOH HOH A . 
I 5 HOH 81  737 737 HOH HOH A . 
I 5 HOH 82  739 739 HOH HOH A . 
I 5 HOH 83  740 740 HOH HOH A . 
I 5 HOH 84  741 741 HOH HOH A . 
I 5 HOH 85  742 742 HOH HOH A . 
I 5 HOH 86  743 743 HOH HOH A . 
I 5 HOH 87  748 748 HOH HOH A . 
I 5 HOH 88  749 749 HOH HOH A . 
I 5 HOH 89  752 752 HOH HOH A . 
I 5 HOH 90  754 754 HOH HOH A . 
I 5 HOH 91  755 755 HOH HOH A . 
I 5 HOH 92  757 757 HOH HOH A . 
I 5 HOH 93  761 761 HOH HOH A . 
I 5 HOH 94  762 762 HOH HOH A . 
I 5 HOH 95  763 763 HOH HOH A . 
I 5 HOH 96  764 764 HOH HOH A . 
I 5 HOH 97  768 768 HOH HOH A . 
I 5 HOH 98  769 769 HOH HOH A . 
I 5 HOH 99  770 770 HOH HOH A . 
I 5 HOH 100 773 773 HOH HOH A . 
I 5 HOH 101 774 774 HOH HOH A . 
I 5 HOH 102 775 775 HOH HOH A . 
I 5 HOH 103 776 776 HOH HOH A . 
I 5 HOH 104 777 777 HOH HOH A . 
J 5 HOH 1   609 609 HOH HOH B . 
J 5 HOH 2   618 618 HOH HOH B . 
J 5 HOH 3   620 620 HOH HOH B . 
J 5 HOH 4   621 621 HOH HOH B . 
J 5 HOH 5   622 622 HOH HOH B . 
J 5 HOH 6   625 625 HOH HOH B . 
J 5 HOH 7   627 627 HOH HOH B . 
J 5 HOH 8   628 628 HOH HOH B . 
J 5 HOH 9   632 632 HOH HOH B . 
J 5 HOH 10  634 634 HOH HOH B . 
J 5 HOH 11  635 635 HOH HOH B . 
J 5 HOH 12  636 636 HOH HOH B . 
J 5 HOH 13  637 637 HOH HOH B . 
J 5 HOH 14  638 638 HOH HOH B . 
J 5 HOH 15  639 639 HOH HOH B . 
J 5 HOH 16  642 642 HOH HOH B . 
J 5 HOH 17  648 648 HOH HOH B . 
J 5 HOH 18  650 650 HOH HOH B . 
J 5 HOH 19  653 653 HOH HOH B . 
J 5 HOH 20  655 655 HOH HOH B . 
J 5 HOH 21  656 656 HOH HOH B . 
J 5 HOH 22  658 658 HOH HOH B . 
J 5 HOH 23  660 660 HOH HOH B . 
J 5 HOH 24  661 661 HOH HOH B . 
J 5 HOH 25  662 662 HOH HOH B . 
J 5 HOH 26  663 663 HOH HOH B . 
J 5 HOH 27  666 666 HOH HOH B . 
J 5 HOH 28  667 667 HOH HOH B . 
J 5 HOH 29  668 668 HOH HOH B . 
J 5 HOH 30  669 669 HOH HOH B . 
J 5 HOH 31  673 673 HOH HOH B . 
J 5 HOH 32  675 675 HOH HOH B . 
J 5 HOH 33  677 677 HOH HOH B . 
J 5 HOH 34  680 680 HOH HOH B . 
J 5 HOH 35  684 684 HOH HOH B . 
J 5 HOH 36  687 687 HOH HOH B . 
J 5 HOH 37  688 688 HOH HOH B . 
J 5 HOH 38  689 689 HOH HOH B . 
J 5 HOH 39  690 690 HOH HOH B . 
J 5 HOH 40  696 696 HOH HOH B . 
J 5 HOH 41  697 697 HOH HOH B . 
J 5 HOH 42  702 702 HOH HOH B . 
J 5 HOH 43  703 703 HOH HOH B . 
J 5 HOH 44  705 705 HOH HOH B . 
J 5 HOH 45  706 706 HOH HOH B . 
J 5 HOH 46  707 707 HOH HOH B . 
J 5 HOH 47  711 711 HOH HOH B . 
J 5 HOH 48  712 712 HOH HOH B . 
J 5 HOH 49  715 715 HOH HOH B . 
J 5 HOH 50  718 718 HOH HOH B . 
J 5 HOH 51  719 719 HOH HOH B . 
J 5 HOH 52  720 720 HOH HOH B . 
J 5 HOH 53  722 722 HOH HOH B . 
J 5 HOH 54  725 725 HOH HOH B . 
J 5 HOH 55  731 731 HOH HOH B . 
J 5 HOH 56  732 732 HOH HOH B . 
J 5 HOH 57  738 738 HOH HOH B . 
J 5 HOH 58  744 744 HOH HOH B . 
J 5 HOH 59  745 745 HOH HOH B . 
J 5 HOH 60  746 746 HOH HOH B . 
J 5 HOH 61  747 747 HOH HOH B . 
J 5 HOH 62  750 750 HOH HOH B . 
J 5 HOH 63  751 751 HOH HOH B . 
J 5 HOH 64  753 753 HOH HOH B . 
J 5 HOH 65  756 756 HOH HOH B . 
J 5 HOH 66  758 758 HOH HOH B . 
J 5 HOH 67  759 759 HOH HOH B . 
J 5 HOH 68  760 760 HOH HOH B . 
J 5 HOH 69  765 765 HOH HOH B . 
J 5 HOH 70  766 766 HOH HOH B . 
J 5 HOH 71  767 767 HOH HOH B . 
J 5 HOH 72  771 771 HOH HOH B . 
J 5 HOH 73  772 772 HOH HOH B . 
J 5 HOH 74  778 778 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 16630 ? 
1 MORE         -87   ? 
1 'SSA (A^2)'  32210 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     725 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   J 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-06-03 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    698 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    737 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.05 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 674 ? ? 1_555 O   A HOH 674 ? ? 7_555 1.41 
2 1 NE2 A GLN 197 ? ? 1_555 NE2 A GLN 197 ? ? 7_555 1.61 
3 1 OE1 B GLN 197 ? ? 1_555 OE1 B GLN 197 ? ? 7_555 1.83 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              171 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              172 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              172 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.60 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.30 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 53  ? ? -55.70  104.26  
2  1 LYS A 56  ? ? -13.09  -53.42  
3  1 ASP A 57  ? ? 149.44  117.16  
4  1 ASN A 146 ? ? 74.01   -8.03   
5  1 SER A 169 ? ? 90.01   -11.42  
6  1 PRO A 195 ? ? -58.62  36.80   
7  1 GLU A 199 ? ? -108.26 66.33   
8  1 TYR A 217 ? ? 77.79   -1.92   
9  1 TYR B 53  ? ? -57.18  87.51   
10 1 LYS B 56  ? ? -63.14  -132.31 
11 1 TRP B 77  ? ? -141.43 -4.77   
12 1 ASN B 146 ? ? 64.14   -3.46   
13 1 PHE B 160 ? ? -99.93  -88.66  
14 1 SER B 169 ? ? 91.37   -2.11   
15 1 TYR B 217 ? ? 78.57   -0.93   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A SER 3   ? OG ? A SER 3   OG 
2 1 Y 1 A SER 169 ? CB ? A SER 169 CB 
3 1 Y 1 A SER 169 ? OG ? A SER 169 OG 
4 1 Y 1 B SER 3   ? OG ? B SER 3   OG 
5 1 Y 1 B SER 169 ? CB ? B SER 169 CB 
6 1 Y 1 B SER 169 ? OG ? B SER 169 OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LYS 2   ? A LYS 2   
3  1 Y 1 A ARG 106 ? A ARG 106 
4  1 Y 1 A SER 107 ? A SER 107 
5  1 Y 1 A PRO 108 ? A PRO 108 
6  1 Y 1 A PRO 109 ? A PRO 109 
7  1 Y 1 A GLN 110 ? A GLN 110 
8  1 Y 1 A MET 111 ? A MET 111 
9  1 Y 1 A GLU 112 ? A GLU 112 
10 1 Y 1 A GLY 113 ? A GLY 113 
11 1 Y 1 A PRO 114 ? A PRO 114 
12 1 Y 1 A ASP 115 ? A ASP 115 
13 1 Y 1 A HIS 116 ? A HIS 116 
14 1 Y 1 A GLY 117 ? A GLY 117 
15 1 Y 1 A LYS 118 ? A LYS 118 
16 1 Y 1 A ALA 119 ? A ALA 119 
17 1 Y 1 A LEU 120 ? A LEU 120 
18 1 Y 1 A PHE 121 ? A PHE 121 
19 1 Y 1 A SER 122 ? A SER 122 
20 1 Y 1 A THR 123 ? A THR 123 
21 1 Y 1 A PRO 124 ? A PRO 124 
22 1 Y 1 A ALA 125 ? A ALA 125 
23 1 Y 1 A LYS 235 ? A LYS 235 
24 1 Y 1 A GLY 236 ? A GLY 236 
25 1 Y 1 A SER 237 ? A SER 237 
26 1 Y 1 A THR 238 ? A THR 238 
27 1 Y 1 A TRP 239 ? A TRP 239 
28 1 Y 1 A LYS 240 ? A LYS 240 
29 1 Y 1 A GLY 241 ? A GLY 241 
30 1 Y 1 A LYS 242 ? A LYS 242 
31 1 Y 1 A SER 243 ? A SER 243 
32 1 Y 1 A THR 244 ? A THR 244 
33 1 Y 1 A GLN 245 ? A GLN 245 
34 1 Y 1 A SER 246 ? A SER 246 
35 1 Y 1 A THR 247 ? A THR 247 
36 1 Y 1 A GLU 248 ? A GLU 248 
37 1 Y 1 A GLY 249 ? A GLY 249 
38 1 Y 1 A LYS 250 ? A LYS 250 
39 1 Y 1 A THR 251 ? A THR 251 
40 1 Y 1 A SER 252 ? A SER 252 
41 1 Y 1 B MET 1   ? B MET 1   
42 1 Y 1 B LYS 2   ? B LYS 2   
43 1 Y 1 B SER 107 ? B SER 107 
44 1 Y 1 B PRO 108 ? B PRO 108 
45 1 Y 1 B PRO 109 ? B PRO 109 
46 1 Y 1 B GLN 110 ? B GLN 110 
47 1 Y 1 B MET 111 ? B MET 111 
48 1 Y 1 B GLU 112 ? B GLU 112 
49 1 Y 1 B GLY 113 ? B GLY 113 
50 1 Y 1 B PRO 114 ? B PRO 114 
51 1 Y 1 B ASP 115 ? B ASP 115 
52 1 Y 1 B HIS 116 ? B HIS 116 
53 1 Y 1 B GLY 117 ? B GLY 117 
54 1 Y 1 B LYS 118 ? B LYS 118 
55 1 Y 1 B ALA 119 ? B ALA 119 
56 1 Y 1 B LEU 120 ? B LEU 120 
57 1 Y 1 B PHE 121 ? B PHE 121 
58 1 Y 1 B SER 122 ? B SER 122 
59 1 Y 1 B THR 123 ? B THR 123 
60 1 Y 1 B PRO 124 ? B PRO 124 
61 1 Y 1 B ALA 125 ? B ALA 125 
62 1 Y 1 B ALA 126 ? B ALA 126 
63 1 Y 1 B LYS 235 ? B LYS 235 
64 1 Y 1 B GLY 236 ? B GLY 236 
65 1 Y 1 B SER 237 ? B SER 237 
66 1 Y 1 B THR 238 ? B THR 238 
67 1 Y 1 B TRP 239 ? B TRP 239 
68 1 Y 1 B LYS 240 ? B LYS 240 
69 1 Y 1 B GLY 241 ? B GLY 241 
70 1 Y 1 B LYS 242 ? B LYS 242 
71 1 Y 1 B SER 243 ? B SER 243 
72 1 Y 1 B THR 244 ? B THR 244 
73 1 Y 1 B GLN 245 ? B GLN 245 
74 1 Y 1 B SER 246 ? B SER 246 
75 1 Y 1 B THR 247 ? B THR 247 
76 1 Y 1 B GLU 248 ? B GLU 248 
77 1 Y 1 B GLY 249 ? B GLY 249 
78 1 Y 1 B LYS 250 ? B LYS 250 
79 1 Y 1 B THR 251 ? B THR 251 
80 1 Y 1 B SER 252 ? B SER 252 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                                   SO4 
3 'BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE'        NMN 
4 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' APC 
5 water                                           HOH 
#