data_1NZB
# 
_entry.id   1NZB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NZB         
NDB   PD0392       
RCSB  RCSB018380   
WWPDB D_1000018380 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1OUQ 'covalent intermediate (low resolution)'  unspecified 
PDB 1Q3U 'pre-cleavage complex (high resolution)'  unspecified 
PDB 1Q3V 'covalent intermediate (high resolution)' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NZB 
_pdbx_database_status.recvd_initial_deposition_date   2003-02-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ennifar, E.'   1 
'Meyer, J.E.W.' 2 
'Buchholz, F.'  3 
'Stewart, A.F.' 4 
'Suck, D.'      5 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of a wild-type Cre recombinase-loxP synapse reveals a novel spacer conformation suggesting an alternative mechanism for DNA cleavage activation
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            31 
_citation.page_first                5449 
_citation.page_last                 5460 
_citation.year                      2003 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12954782 
_citation.pdbx_database_id_DOI      10.1093/nar/gkg732 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ennifar, E.'   1 
primary 'Meyer, J.E.W.' 2 
primary 'Buchholz, F.'  3 
primary 'Stewart, A.F.' 4 
primary 'Suck, D.'      5 
# 
_cell.entry_id           1NZB 
_cell.length_a           108.890 
_cell.length_b           163.530 
_cell.length_c           195.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NZB 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'loxP DNA'        11364.330 2  ? ? ? 'First strand of loxP site'  
2 polymer     syn 'loxP DNA'        11387.370 2  ? ? ? 'Second strand of loxP site' 
3 polymer     man 'Cre recombinase' 38595.164 4  ? ? ? ?                            
4 non-polymer syn 'MAGNESIUM ION'   24.305    10 ? ? ? ?                            
5 non-polymer syn 'IODIDE ION'      126.904   2  ? ? ? ?                            
6 water       nat water             18.015    3  ? ? ? ?                            
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'GST-loxP-cre recombinase fusion protein; Retrofitting vector pRetroES' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DT)(DA)(DA)(DC)(UMP)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DT)
(DA)(DT)(DG)(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)(DC)
;
CGATAACUTCGTATAATGTATGCTATACGAAGTTATC C,G     ? 
2 polydeoxyribonucleotide no no  
;(DG)(DG)(DA)(DT)(DA)(DA)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DG)(DC)(DA)(DT)(DA)
(DC)(DA)(DT)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)(DC)
;
GGATAACTTCGTATAGCATACATTATACGAAGTTATC D,H     ? 
3 'polypeptide(L)'        no no  
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
A,B,E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DT  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   UMP n 
1 9   DT  n 
1 10  DC  n 
1 11  DG  n 
1 12  DT  n 
1 13  DA  n 
1 14  DT  n 
1 15  DA  n 
1 16  DA  n 
1 17  DT  n 
1 18  DG  n 
1 19  DT  n 
1 20  DA  n 
1 21  DT  n 
1 22  DG  n 
1 23  DC  n 
1 24  DT  n 
1 25  DA  n 
1 26  DT  n 
1 27  DA  n 
1 28  DC  n 
1 29  DG  n 
1 30  DA  n 
1 31  DA  n 
1 32  DG  n 
1 33  DT  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DC  n 
2 1   DG  n 
2 2   DG  n 
2 3   DA  n 
2 4   DT  n 
2 5   DA  n 
2 6   DA  n 
2 7   DC  n 
2 8   DT  n 
2 9   DT  n 
2 10  DC  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
2 14  DT  n 
2 15  DA  n 
2 16  DG  n 
2 17  DC  n 
2 18  DA  n 
2 19  DT  n 
2 20  DA  n 
2 21  DC  n 
2 22  DA  n 
2 23  DT  n 
2 24  DT  n 
2 25  DA  n 
2 26  DT  n 
2 27  DA  n 
2 28  DC  n 
2 29  DG  n 
2 30  DA  n 
2 31  DA  n 
2 32  DG  n 
2 33  DT  n 
2 34  DT  n 
2 35  DA  n 
2 36  DT  n 
2 37  DC  n 
3 1   MET n 
3 2   SER n 
3 3   ASN n 
3 4   LEU n 
3 5   LEU n 
3 6   THR n 
3 7   VAL n 
3 8   HIS n 
3 9   GLN n 
3 10  ASN n 
3 11  LEU n 
3 12  PRO n 
3 13  ALA n 
3 14  LEU n 
3 15  PRO n 
3 16  VAL n 
3 17  ASP n 
3 18  ALA n 
3 19  THR n 
3 20  SER n 
3 21  ASP n 
3 22  GLU n 
3 23  VAL n 
3 24  ARG n 
3 25  LYS n 
3 26  ASN n 
3 27  LEU n 
3 28  MET n 
3 29  ASP n 
3 30  MET n 
3 31  PHE n 
3 32  ARG n 
3 33  ASP n 
3 34  ARG n 
3 35  GLN n 
3 36  ALA n 
3 37  PHE n 
3 38  SER n 
3 39  GLU n 
3 40  HIS n 
3 41  THR n 
3 42  TRP n 
3 43  LYS n 
3 44  MET n 
3 45  LEU n 
3 46  LEU n 
3 47  SER n 
3 48  VAL n 
3 49  CYS n 
3 50  ARG n 
3 51  SER n 
3 52  TRP n 
3 53  ALA n 
3 54  ALA n 
3 55  TRP n 
3 56  CYS n 
3 57  LYS n 
3 58  LEU n 
3 59  ASN n 
3 60  ASN n 
3 61  ARG n 
3 62  LYS n 
3 63  TRP n 
3 64  PHE n 
3 65  PRO n 
3 66  ALA n 
3 67  GLU n 
3 68  PRO n 
3 69  GLU n 
3 70  ASP n 
3 71  VAL n 
3 72  ARG n 
3 73  ASP n 
3 74  TYR n 
3 75  LEU n 
3 76  LEU n 
3 77  TYR n 
3 78  LEU n 
3 79  GLN n 
3 80  ALA n 
3 81  ARG n 
3 82  GLY n 
3 83  LEU n 
3 84  ALA n 
3 85  VAL n 
3 86  LYS n 
3 87  THR n 
3 88  ILE n 
3 89  GLN n 
3 90  GLN n 
3 91  HIS n 
3 92  LEU n 
3 93  GLY n 
3 94  GLN n 
3 95  LEU n 
3 96  ASN n 
3 97  MET n 
3 98  LEU n 
3 99  HIS n 
3 100 ARG n 
3 101 ARG n 
3 102 SER n 
3 103 GLY n 
3 104 LEU n 
3 105 PRO n 
3 106 ARG n 
3 107 PRO n 
3 108 SER n 
3 109 ASP n 
3 110 SER n 
3 111 ASN n 
3 112 ALA n 
3 113 VAL n 
3 114 SER n 
3 115 LEU n 
3 116 VAL n 
3 117 MET n 
3 118 ARG n 
3 119 ARG n 
3 120 ILE n 
3 121 ARG n 
3 122 LYS n 
3 123 GLU n 
3 124 ASN n 
3 125 VAL n 
3 126 ASP n 
3 127 ALA n 
3 128 GLY n 
3 129 GLU n 
3 130 ARG n 
3 131 ALA n 
3 132 LYS n 
3 133 GLN n 
3 134 ALA n 
3 135 LEU n 
3 136 ALA n 
3 137 PHE n 
3 138 GLU n 
3 139 ARG n 
3 140 THR n 
3 141 ASP n 
3 142 PHE n 
3 143 ASP n 
3 144 GLN n 
3 145 VAL n 
3 146 ARG n 
3 147 SER n 
3 148 LEU n 
3 149 MET n 
3 150 GLU n 
3 151 ASN n 
3 152 SER n 
3 153 ASP n 
3 154 ARG n 
3 155 CYS n 
3 156 GLN n 
3 157 ASP n 
3 158 ILE n 
3 159 ARG n 
3 160 ASN n 
3 161 LEU n 
3 162 ALA n 
3 163 PHE n 
3 164 LEU n 
3 165 GLY n 
3 166 ILE n 
3 167 ALA n 
3 168 TYR n 
3 169 ASN n 
3 170 THR n 
3 171 LEU n 
3 172 LEU n 
3 173 ARG n 
3 174 ILE n 
3 175 ALA n 
3 176 GLU n 
3 177 ILE n 
3 178 ALA n 
3 179 ARG n 
3 180 ILE n 
3 181 ARG n 
3 182 VAL n 
3 183 LYS n 
3 184 ASP n 
3 185 ILE n 
3 186 SER n 
3 187 ARG n 
3 188 THR n 
3 189 ASP n 
3 190 GLY n 
3 191 GLY n 
3 192 ARG n 
3 193 MET n 
3 194 LEU n 
3 195 ILE n 
3 196 HIS n 
3 197 ILE n 
3 198 GLY n 
3 199 ARG n 
3 200 THR n 
3 201 LYS n 
3 202 THR n 
3 203 LEU n 
3 204 VAL n 
3 205 SER n 
3 206 THR n 
3 207 ALA n 
3 208 GLY n 
3 209 VAL n 
3 210 GLU n 
3 211 LYS n 
3 212 ALA n 
3 213 LEU n 
3 214 SER n 
3 215 LEU n 
3 216 GLY n 
3 217 VAL n 
3 218 THR n 
3 219 LYS n 
3 220 LEU n 
3 221 VAL n 
3 222 GLU n 
3 223 ARG n 
3 224 TRP n 
3 225 ILE n 
3 226 SER n 
3 227 VAL n 
3 228 SER n 
3 229 GLY n 
3 230 VAL n 
3 231 ALA n 
3 232 ASP n 
3 233 ASP n 
3 234 PRO n 
3 235 ASN n 
3 236 ASN n 
3 237 TYR n 
3 238 LEU n 
3 239 PHE n 
3 240 CYS n 
3 241 ARG n 
3 242 VAL n 
3 243 ARG n 
3 244 LYS n 
3 245 ASN n 
3 246 GLY n 
3 247 VAL n 
3 248 ALA n 
3 249 ALA n 
3 250 PRO n 
3 251 SER n 
3 252 ALA n 
3 253 THR n 
3 254 SER n 
3 255 GLN n 
3 256 LEU n 
3 257 SER n 
3 258 THR n 
3 259 ARG n 
3 260 ALA n 
3 261 LEU n 
3 262 GLU n 
3 263 GLY n 
3 264 ILE n 
3 265 PHE n 
3 266 GLU n 
3 267 ALA n 
3 268 THR n 
3 269 HIS n 
3 270 ARG n 
3 271 LEU n 
3 272 ILE n 
3 273 TYR n 
3 274 GLY n 
3 275 ALA n 
3 276 LYS n 
3 277 ASP n 
3 278 ASP n 
3 279 SER n 
3 280 GLY n 
3 281 GLN n 
3 282 ARG n 
3 283 TYR n 
3 284 LEU n 
3 285 ALA n 
3 286 TRP n 
3 287 SER n 
3 288 GLY n 
3 289 HIS n 
3 290 SER n 
3 291 ALA n 
3 292 ARG n 
3 293 VAL n 
3 294 GLY n 
3 295 ALA n 
3 296 ALA n 
3 297 ARG n 
3 298 ASP n 
3 299 MET n 
3 300 ALA n 
3 301 ARG n 
3 302 ALA n 
3 303 GLY n 
3 304 VAL n 
3 305 SER n 
3 306 ILE n 
3 307 PRO n 
3 308 GLU n 
3 309 ILE n 
3 310 MET n 
3 311 GLN n 
3 312 ALA n 
3 313 GLY n 
3 314 GLY n 
3 315 TRP n 
3 316 THR n 
3 317 ASN n 
3 318 VAL n 
3 319 ASN n 
3 320 ILE n 
3 321 VAL n 
3 322 MET n 
3 323 ASN n 
3 324 TYR n 
3 325 ILE n 
3 326 ARG n 
3 327 ASN n 
3 328 LEU n 
3 329 ASP n 
3 330 SER n 
3 331 GLU n 
3 332 THR n 
3 333 GLY n 
3 334 ALA n 
3 335 MET n 
3 336 VAL n 
3 337 ARG n 
3 338 LEU n 
3 339 LEU n 
3 340 GLU n 
3 341 ASP n 
3 342 GLY n 
3 343 ASP n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'P1-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage P1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10678 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGem 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP RECR_BPP1 P06956 1 
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
? 
2 1 PDB 1NZB      1NZB   ? ? ? 
3 2 PDB 1NZB      1NZB   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NZB A 1 ? 343 ? P06956 1   ? 343 ? 1   343 
2 1 1NZB B 1 ? 343 ? P06956 1   ? 343 ? 1   343 
3 1 1NZB E 1 ? 343 ? P06956 1   ? 343 ? 1   343 
4 1 1NZB F 1 ? 343 ? P06956 1   ? 343 ? 1   343 
5 2 1NZB C 1 ? 37  ? 1NZB   100 ? 136 ? 100 136 
6 3 1NZB D 1 ? 37  ? 1NZB   100 ? 136 ? 100 136 
7 2 1NZB G 1 ? 37  ? 1NZB   100 ? 136 ? 100 136 
8 3 1NZB H 1 ? 37  ? 1NZB   100 ? 136 ? 100 136 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?    'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?    'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?    'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?    'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?    'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?    'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?    'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?    'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?    'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?    'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?    'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?    'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?    'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?    'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?    'C6 H13 N O2'     131.173 
IOD non-polymer         . 'IODIDE ION'                         ?    'I -1'            126.904 
LEU 'L-peptide linking' y LEUCINE                              ?    'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?    'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?    'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?    'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?    'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?    'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?    'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?    'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?    'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?    'C9 H11 N O3'     181.189 
UMP non-polymer         . 
;2'-DEOXYURIDINE 5'-MONOPHOSPHATE
;
DUMP 'C9 H13 N2 O8 P'  308.182 
VAL 'L-peptide linking' y VALINE                               ?    'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1NZB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   73.5 
_exptl_crystal.density_Matthews      4.68 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pH              7.6 
_exptl_crystal_grow.pdbx_details    
'NaCl, EDTQ, Glycerol, HEPES, MgCl2, PEG 2000, MME, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 MME        ? ? ? 
1 2  1 EDTQ       ? ? ? 
1 3  1 HEPES      ? ? ? 
1 4  1 NaCl       ? ? ? 
1 5  1 MgCl2      ? ? ? 
1 6  1 Glycerol   ? ? ? 
1 7  1 'PEG 2000' ? ? ? 
1 8  2 NaCl       ? ? ? 
1 9  2 MgCl2      ? ? ? 
1 10 2 Glycerol   ? ? ? 
1 11 2 'PEG 2000' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-09-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    crystal 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     1NZB 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             100.0 
_reflns.d_resolution_high            3.10 
_reflns.number_obs                   116497 
_reflns.number_all                   120449 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.095 
_reflns.pdbx_netI_over_sigmaI        5.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.10 
_reflns_shell.d_res_low              3.28 
_reflns_shell.percent_possible_all   91.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.278 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1NZB 
_refine.ls_number_reflns_obs                     111592 
_refine.ls_number_reflns_all                     120449 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            3.10 
_refine.ls_percent_reflns_obs                    96.6 
_refine.ls_R_factor_obs                          0.2121 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.0 
_refine.ls_number_reflns_R_free                  7763 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               63.4 
_refine.aniso_B[1][1]                            -3.20 
_refine.aniso_B[2][2]                            20.04 
_refine.aniso_B[3][3]                            -16.84 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.370259 
_refine.solvent_model_param_bsol                 68.1965 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDBID 1CRX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1NZB 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.46 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10264 
_refine_hist.pdbx_number_atoms_nucleic_acid   3020 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               13299 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 20.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.03  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        2.64  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       4.34  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        6.41  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       9.42  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.10 
_refine_ls_shell.d_res_low                        3.28 
_refine_ls_shell.number_reflns_R_work             16427 
_refine_ls_shell.R_factor_R_work                  0.31 
_refine_ls_shell.percent_reflns_obs               91.8 
_refine_ls_shell.R_factor_R_free                  0.343 
_refine_ls_shell.R_factor_R_free_error            0.010 
_refine_ls_shell.percent_reflns_R_free            7.0 
_refine_ls_shell.number_reflns_R_free             1229 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 DNA-RNA_REP.PARAM ION.TOP     'X-RAY DIFFRACTION' 
4 ION.PARAM         WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1NZB 
_struct.title                     'Crystal structure of wild type Cre recombinase-loxP synapse' 
_struct.pdbx_descriptor           'Cre recombinase/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NZB 
_struct_keywords.pdbx_keywords   REPLICATION/DNA 
_struct_keywords.text            'Cre, recombinase, DNA, REPLICATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 4 ? 
T N N 4 ? 
U N N 6 ? 
V N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'dimeric Cre recombinase bound to a double stranded DNA loxP site' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU E 22  ? ASP E 33  ? GLU A 22  ASP A 33  1 ? 12 
HELX_P HELX_P2  2  ARG E 34  ? PHE E 37  ? ARG A 34  PHE A 37  5 ? 4  
HELX_P HELX_P3  3  SER E 38  ? ASN E 60  ? SER A 38  ASN A 60  1 ? 23 
HELX_P HELX_P4  4  GLU E 67  ? ARG E 81  ? GLU A 67  ARG A 81  1 ? 15 
HELX_P HELX_P5  5  ALA E 84  ? ARG E 101 ? ALA A 84  ARG A 101 1 ? 18 
HELX_P HELX_P6  6  SER E 110 ? ALA E 127 ? SER A 110 ALA A 127 1 ? 18 
HELX_P HELX_P7  7  GLU E 138 ? GLU E 150 ? GLU A 138 GLU A 150 1 ? 13 
HELX_P HELX_P8  8  ARG E 154 ? LEU E 171 ? ARG A 154 LEU A 171 1 ? 18 
HELX_P HELX_P9  9  ARG E 173 ? ALA E 178 ? ARG A 173 ALA A 178 1 ? 6  
HELX_P HELX_P10 10 ARG E 179 ? ILE E 180 ? ARG A 179 ILE A 180 5 ? 2  
HELX_P HELX_P11 11 ARG E 181 ? LYS E 183 ? ARG A 181 LYS A 183 5 ? 3  
HELX_P HELX_P12 12 SER E 214 ? GLY E 229 ? SER A 214 GLY A 229 1 ? 16 
HELX_P HELX_P13 13 SER E 257 ? GLY E 274 ? SER A 257 GLY A 274 1 ? 18 
HELX_P HELX_P14 14 HIS E 289 ? ALA E 302 ? HIS A 289 ALA A 302 1 ? 14 
HELX_P HELX_P15 15 SER E 305 ? GLY E 314 ? SER A 305 GLY A 314 1 ? 10 
HELX_P HELX_P16 16 VAL E 318 ? ILE E 325 ? VAL A 318 ILE A 325 1 ? 8  
HELX_P HELX_P17 17 LEU E 328 ? THR E 332 ? LEU A 328 THR A 332 5 ? 5  
HELX_P HELX_P18 18 GLY E 333 ? ASP E 341 ? GLY A 333 ASP A 341 1 ? 9  
HELX_P HELX_P19 19 SER F 20  ? ASP F 33  ? SER B 20  ASP B 33  1 ? 14 
HELX_P HELX_P20 20 SER F 38  ? ASN F 59  ? SER B 38  ASN B 59  1 ? 22 
HELX_P HELX_P21 21 GLU F 67  ? ARG F 81  ? GLU B 67  ARG B 81  1 ? 15 
HELX_P HELX_P22 22 ALA F 84  ? SER F 102 ? ALA B 84  SER B 102 1 ? 19 
HELX_P HELX_P23 23 ARG F 106 ? ASP F 109 ? ARG B 106 ASP B 109 5 ? 4  
HELX_P HELX_P24 24 SER F 110 ? ALA F 127 ? SER B 110 ALA B 127 1 ? 18 
HELX_P HELX_P25 25 GLU F 138 ? GLU F 150 ? GLU B 138 GLU B 150 1 ? 13 
HELX_P HELX_P26 26 ARG F 154 ? LEU F 171 ? ARG B 154 LEU B 171 1 ? 18 
HELX_P HELX_P27 27 ARG F 173 ? ARG F 179 ? ARG B 173 ARG B 179 1 ? 7  
HELX_P HELX_P28 28 ARG F 181 ? ILE F 185 ? ARG B 181 ILE B 185 5 ? 5  
HELX_P HELX_P29 29 SER F 214 ? GLY F 229 ? SER B 214 GLY B 229 1 ? 16 
HELX_P HELX_P30 30 VAL F 230 ? ASP F 233 ? VAL B 230 ASP B 233 5 ? 4  
HELX_P HELX_P31 31 SER F 257 ? GLY F 274 ? SER B 257 GLY B 274 1 ? 18 
HELX_P HELX_P32 32 HIS F 289 ? GLY F 303 ? HIS B 289 GLY B 303 1 ? 15 
HELX_P HELX_P33 33 SER F 305 ? GLY F 313 ? SER B 305 GLY B 313 1 ? 9  
HELX_P HELX_P34 34 ALA F 334 ? GLU F 340 ? ALA B 334 GLU B 340 1 ? 7  
HELX_P HELX_P35 35 GLU G 22  ? ASP G 33  ? GLU E 22  ASP E 33  1 ? 12 
HELX_P HELX_P36 36 SER G 38  ? LYS G 57  ? SER E 38  LYS E 57  1 ? 20 
HELX_P HELX_P37 37 GLU G 67  ? GLY G 82  ? GLU E 67  GLY E 82  1 ? 16 
HELX_P HELX_P38 38 ALA G 84  ? ARG G 101 ? ALA E 84  ARG E 101 1 ? 18 
HELX_P HELX_P39 39 ARG G 106 ? ASP G 109 ? ARG E 106 ASP E 109 5 ? 4  
HELX_P HELX_P40 40 SER G 110 ? GLY G 128 ? SER E 110 GLY E 128 1 ? 19 
HELX_P HELX_P41 41 ARG G 139 ? ASN G 151 ? ARG E 139 ASN E 151 1 ? 13 
HELX_P HELX_P42 42 ARG G 154 ? ALA G 162 ? ARG E 154 ALA E 162 1 ? 9  
HELX_P HELX_P43 43 ALA G 162 ? ALA G 167 ? ALA E 162 ALA E 167 1 ? 6  
HELX_P HELX_P44 44 TYR G 168 ? THR G 170 ? TYR E 168 THR E 170 5 ? 3  
HELX_P HELX_P45 45 ARG G 173 ? ARG G 179 ? ARG E 173 ARG E 179 1 ? 7  
HELX_P HELX_P46 46 SER G 214 ? SER G 228 ? SER E 214 SER E 228 1 ? 15 
HELX_P HELX_P47 47 SER G 257 ? GLY G 274 ? SER E 257 GLY E 274 1 ? 18 
HELX_P HELX_P48 48 HIS G 289 ? GLY G 303 ? HIS E 289 GLY E 303 1 ? 15 
HELX_P HELX_P49 49 SER G 305 ? GLY G 313 ? SER E 305 GLY E 313 1 ? 9  
HELX_P HELX_P50 50 ASN G 317 ? ILE G 325 ? ASN E 317 ILE E 325 1 ? 9  
HELX_P HELX_P51 51 GLY G 333 ? ASP G 341 ? GLY E 333 ASP E 341 1 ? 9  
HELX_P HELX_P52 52 SER H 20  ? ASP H 33  ? SER F 20  ASP F 33  1 ? 14 
HELX_P HELX_P53 53 ARG H 34  ? PHE H 37  ? ARG F 34  PHE F 37  5 ? 4  
HELX_P HELX_P54 54 SER H 38  ? LEU H 58  ? SER F 38  LEU F 58  1 ? 21 
HELX_P HELX_P55 55 GLU H 67  ? ARG H 81  ? GLU F 67  ARG F 81  1 ? 15 
HELX_P HELX_P56 56 ALA H 84  ? ARG H 101 ? ALA F 84  ARG F 101 1 ? 18 
HELX_P HELX_P57 57 ARG H 106 ? ASP H 109 ? ARG F 106 ASP F 109 5 ? 4  
HELX_P HELX_P58 58 SER H 110 ? ALA H 127 ? SER F 110 ALA F 127 1 ? 18 
HELX_P HELX_P59 59 GLU H 138 ? GLU H 150 ? GLU F 138 GLU F 150 1 ? 13 
HELX_P HELX_P60 60 ARG H 154 ? LEU H 171 ? ARG F 154 LEU F 171 1 ? 18 
HELX_P HELX_P61 61 ARG H 173 ? ALA H 178 ? ARG F 173 ALA F 178 1 ? 6  
HELX_P HELX_P62 62 ARG H 179 ? ILE H 180 ? ARG F 179 ILE F 180 5 ? 2  
HELX_P HELX_P63 63 ARG H 181 ? LYS H 183 ? ARG F 181 LYS F 183 5 ? 3  
HELX_P HELX_P64 64 GLY H 216 ? SER H 228 ? GLY F 216 SER F 228 1 ? 13 
HELX_P HELX_P65 65 SER H 257 ? GLY H 274 ? SER F 257 GLY F 274 1 ? 18 
HELX_P HELX_P66 66 HIS H 289 ? ALA H 302 ? HIS F 289 ALA F 302 1 ? 14 
HELX_P HELX_P67 67 SER H 305 ? GLY H 314 ? SER F 305 GLY F 314 1 ? 10 
HELX_P HELX_P68 68 VAL H 318 ? TYR H 324 ? VAL F 318 TYR F 324 1 ? 7  
HELX_P HELX_P69 69 ALA H 334 ? GLU H 340 ? ALA F 334 GLU F 340 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? N MG  .  MG    ? ? ? 1_555 E HIS 40 ND1 ? ? A MG  5301 A HIS 40  1_555 ? ? ? ? ? ? ?            2.702 ? 
covale1   covale ? ? A DC  7  "O3'" ? ? ? 1_555 A UMP 8  P   ? ? C DC  106  C UMP 107 1_555 ? ? ? ? ? ? ?            1.598 ? 
covale2   covale ? ? A UMP 8  "O3'" ? ? ? 1_555 A DT  9  P   ? ? C UMP 107  C DT  108 1_555 ? ? ? ? ? ? ?            1.603 ? 
metalc2   metalc ? ? L MG  .  MG    ? ? ? 1_555 B DA  6  N7  ? ? D MG  5310 D DA  105 1_555 ? ? ? ? ? ? ?            2.807 ? 
metalc3   metalc ? ? T MG  .  MG    ? ? ? 1_555 C DA  13 OP2 ? ? F MG  5309 G DA  112 1_555 ? ? ? ? ? ? ?            2.829 ? 
metalc4   metalc ? ? T MG  .  MG    ? ? ? 1_555 H HIS 91 NE2 ? ? F MG  5309 F HIS 91  1_555 ? ? ? ? ? ? ?            2.275 ? 
covale3   covale ? ? C DC  7  "O3'" ? ? ? 1_555 C UMP 8  P   ? ? G DC  106  G UMP 107 1_555 ? ? ? ? ? ? ?            1.602 ? 
covale4   covale ? ? C UMP 8  "O3'" ? ? ? 1_555 C DT  9  P   ? ? G UMP 107  G DT  108 1_555 ? ? ? ? ? ? ?            1.606 ? 
hydrog1   hydrog ? ? A DG  2  N1    ? ? ? 1_555 B DC  37 N3  ? ? C DG  101  D DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? A DG  2  N2    ? ? ? 1_555 B DC  37 O2  ? ? C DG  101  D DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? A DG  2  O6    ? ? ? 1_555 B DC  37 N4  ? ? C DG  101  D DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? A DA  3  N1    ? ? ? 1_555 B DT  36 N3  ? ? C DA  102  D DT  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? A DA  3  N6    ? ? ? 1_555 B DT  36 O4  ? ? C DA  102  D DT  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? A DT  4  N3    ? ? ? 1_555 B DA  35 N1  ? ? C DT  103  D DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? A DT  4  O4    ? ? ? 1_555 B DA  35 N6  ? ? C DT  103  D DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? A DA  5  N1    ? ? ? 1_555 B DT  34 N3  ? ? C DA  104  D DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? A DA  5  N6    ? ? ? 1_555 B DT  34 O4  ? ? C DA  104  D DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? A DA  6  N1    ? ? ? 1_555 B DT  33 N3  ? ? C DA  105  D DT  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? A DA  6  N6    ? ? ? 1_555 B DT  33 O4  ? ? C DA  105  D DT  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? A DC  7  N3    ? ? ? 1_555 B DG  32 N1  ? ? C DC  106  D DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? A DC  7  N4    ? ? ? 1_555 B DG  32 O6  ? ? C DC  106  D DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? A DC  7  O2    ? ? ? 1_555 B DG  32 N2  ? ? C DC  106  D DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? A UMP 8  N3    ? ? ? 1_555 B DA  31 N1  ? ? C UMP 107  D DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? A UMP 8  O4    ? ? ? 1_555 B DA  31 N6  ? ? C UMP 107  D DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? A DT  9  N3    ? ? ? 1_555 B DA  30 N1  ? ? C DT  108  D DA  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? A DT  9  O4    ? ? ? 1_555 B DA  30 N6  ? ? C DT  108  D DA  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? A DC  10 N3    ? ? ? 1_555 B DG  29 N1  ? ? C DC  109  D DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? A DC  10 N4    ? ? ? 1_555 B DG  29 O6  ? ? C DC  109  D DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? A DC  10 O2    ? ? ? 1_555 B DG  29 N2  ? ? C DC  109  D DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? A DG  11 N1    ? ? ? 1_555 B DC  28 N3  ? ? C DG  110  D DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? A DG  11 N2    ? ? ? 1_555 B DC  28 O2  ? ? C DG  110  D DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? A DG  11 O6    ? ? ? 1_555 B DC  28 N4  ? ? C DG  110  D DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? A DT  12 N3    ? ? ? 1_555 B DA  27 N1  ? ? C DT  111  D DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? A DT  12 O4    ? ? ? 1_555 B DA  27 N6  ? ? C DT  111  D DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? A DA  13 N1    ? ? ? 1_555 B DT  26 N3  ? ? C DA  112  D DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? A DA  13 N6    ? ? ? 1_555 B DT  26 O4  ? ? C DA  112  D DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? A DT  14 N3    ? ? ? 1_555 B DA  25 N1  ? ? C DT  113  D DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? A DT  14 O4    ? ? ? 1_555 B DA  25 N6  ? ? C DT  113  D DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  24 N3  ? ? C DA  114  D DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  24 O4  ? ? C DA  114  D DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? A DA  16 N1    ? ? ? 1_555 B DT  23 N3  ? ? C DA  115  D DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? A DA  16 N6    ? ? ? 1_555 B DT  23 O4  ? ? C DA  115  D DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  22 N1  ? ? C DT  116  D DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  22 N6  ? ? C DT  116  D DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  21 N3  ? ? C DG  117  D DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  21 O2  ? ? C DG  117  D DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  21 N4  ? ? C DG  117  D DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? A DT  19 N3    ? ? ? 1_555 B DA  20 N1  ? ? C DT  118  D DA  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? A DT  19 O4    ? ? ? 1_555 B DA  20 N6  ? ? C DT  118  D DA  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? A DA  20 N1    ? ? ? 1_555 B DT  19 N3  ? ? C DA  119  D DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? A DA  20 N6    ? ? ? 1_555 B DT  19 O4  ? ? C DA  119  D DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? A DT  21 N3    ? ? ? 1_555 B DA  18 N1  ? ? C DT  120  D DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? A DT  21 O4    ? ? ? 1_555 B DA  18 N6  ? ? C DT  120  D DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? A DG  22 N1    ? ? ? 1_555 B DC  17 N3  ? ? C DG  121  D DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? A DG  22 N2    ? ? ? 1_555 B DC  17 O2  ? ? C DG  121  D DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? A DG  22 O6    ? ? ? 1_555 B DC  17 N4  ? ? C DG  121  D DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? A DC  23 N3    ? ? ? 1_555 B DG  16 N1  ? ? C DC  122  D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? A DC  23 N4    ? ? ? 1_555 B DG  16 O6  ? ? C DC  122  D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? A DC  23 O2    ? ? ? 1_555 B DG  16 N2  ? ? C DC  122  D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? A DT  24 N3    ? ? ? 1_555 B DA  15 N1  ? ? C DT  123  D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? A DT  24 O4    ? ? ? 1_555 B DA  15 N6  ? ? C DT  123  D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? A DA  25 N1    ? ? ? 1_555 B DT  14 N3  ? ? C DA  124  D DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? A DA  25 N6    ? ? ? 1_555 B DT  14 O4  ? ? C DA  124  D DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? A DT  26 N3    ? ? ? 1_555 B DA  13 N1  ? ? C DT  125  D DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? A DT  26 O4    ? ? ? 1_555 B DA  13 N6  ? ? C DT  125  D DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? A DA  27 N1    ? ? ? 1_555 B DT  12 N3  ? ? C DA  126  D DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? A DA  27 N6    ? ? ? 1_555 B DT  12 O4  ? ? C DA  126  D DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? A DC  28 N3    ? ? ? 1_555 B DG  11 N1  ? ? C DC  127  D DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? A DC  28 N4    ? ? ? 1_555 B DG  11 O6  ? ? C DC  127  D DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? A DC  28 O2    ? ? ? 1_555 B DG  11 N2  ? ? C DC  127  D DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? A DG  29 N1    ? ? ? 1_555 B DC  10 N3  ? ? C DG  128  D DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? A DG  29 N2    ? ? ? 1_555 B DC  10 O2  ? ? C DG  128  D DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? A DG  29 O6    ? ? ? 1_555 B DC  10 N4  ? ? C DG  128  D DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? A DA  30 N1    ? ? ? 1_555 B DT  9  N3  ? ? C DA  129  D DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? A DA  30 N6    ? ? ? 1_555 B DT  9  O4  ? ? C DA  129  D DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? A DA  31 N1    ? ? ? 1_555 B DT  8  N3  ? ? C DA  130  D DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? A DA  31 N6    ? ? ? 1_555 B DT  8  O4  ? ? C DA  130  D DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? A DG  32 N1    ? ? ? 1_555 B DC  7  N3  ? ? C DG  131  D DC  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? A DG  32 N2    ? ? ? 1_555 B DC  7  O2  ? ? C DG  131  D DC  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? A DG  32 O6    ? ? ? 1_555 B DC  7  N4  ? ? C DG  131  D DC  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? A DT  33 N3    ? ? ? 1_555 B DA  6  N1  ? ? C DT  132  D DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? A DT  33 O4    ? ? ? 1_555 B DA  6  N6  ? ? C DT  132  D DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? A DT  34 N3    ? ? ? 1_555 B DA  5  N1  ? ? C DT  133  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? A DT  34 O4    ? ? ? 1_555 B DA  5  N6  ? ? C DT  133  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? A DA  35 N1    ? ? ? 1_555 B DT  4  N3  ? ? C DA  134  D DT  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? A DA  35 N6    ? ? ? 1_555 B DT  4  O4  ? ? C DA  134  D DT  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? A DT  36 N3    ? ? ? 1_555 B DA  3  N1  ? ? C DT  135  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? A DT  36 O4    ? ? ? 1_555 B DA  3  N6  ? ? C DT  135  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? A DC  37 N3    ? ? ? 1_555 B DG  2  N1  ? ? C DC  136  D DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? A DC  37 N4    ? ? ? 1_555 B DG  2  O6  ? ? C DC  136  D DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? A DC  37 O2    ? ? ? 1_555 B DG  2  N2  ? ? C DC  136  D DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? C DG  2  N1    ? ? ? 1_555 D DC  37 N3  ? ? G DG  101  H DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? C DG  2  N2    ? ? ? 1_555 D DC  37 O2  ? ? G DG  101  H DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? C DG  2  O6    ? ? ? 1_555 D DC  37 N4  ? ? G DG  101  H DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? C DA  3  N1    ? ? ? 1_555 D DT  36 N3  ? ? G DA  102  H DT  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? C DA  3  N6    ? ? ? 1_555 D DT  36 O4  ? ? G DA  102  H DT  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? C DT  4  N3    ? ? ? 1_555 D DA  35 N1  ? ? G DT  103  H DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? C DT  4  O4    ? ? ? 1_555 D DA  35 N6  ? ? G DT  103  H DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? C DA  5  N1    ? ? ? 1_555 D DT  34 N3  ? ? G DA  104  H DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? C DA  5  N6    ? ? ? 1_555 D DT  34 O4  ? ? G DA  104  H DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? C DA  6  N1    ? ? ? 1_555 D DT  33 N3  ? ? G DA  105  H DT  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? C DA  6  N6    ? ? ? 1_555 D DT  33 O4  ? ? G DA  105  H DT  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? C DC  7  N3    ? ? ? 1_555 D DG  32 N1  ? ? G DC  106  H DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? C DC  7  N4    ? ? ? 1_555 D DG  32 O6  ? ? G DC  106  H DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? C DC  7  O2    ? ? ? 1_555 D DG  32 N2  ? ? G DC  106  H DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? C UMP 8  N3    ? ? ? 1_555 D DA  31 N1  ? ? G UMP 107  H DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? C UMP 8  O4    ? ? ? 1_555 D DA  31 N6  ? ? G UMP 107  H DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? C DT  9  N3    ? ? ? 1_555 D DA  30 N1  ? ? G DT  108  H DA  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? C DT  9  O4    ? ? ? 1_555 D DA  30 N6  ? ? G DT  108  H DA  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? C DC  10 N3    ? ? ? 1_555 D DG  29 N1  ? ? G DC  109  H DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? C DC  10 N4    ? ? ? 1_555 D DG  29 O6  ? ? G DC  109  H DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? C DC  10 O2    ? ? ? 1_555 D DG  29 N2  ? ? G DC  109  H DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? C DG  11 N1    ? ? ? 1_555 D DC  28 N3  ? ? G DG  110  H DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? C DG  11 N2    ? ? ? 1_555 D DC  28 O2  ? ? G DG  110  H DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? C DG  11 O6    ? ? ? 1_555 D DC  28 N4  ? ? G DG  110  H DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? C DT  12 N3    ? ? ? 1_555 D DA  27 N1  ? ? G DT  111  H DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? C DT  12 O4    ? ? ? 1_555 D DA  27 N6  ? ? G DT  111  H DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? C DA  13 N1    ? ? ? 1_555 D DT  26 N3  ? ? G DA  112  H DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? C DA  13 N6    ? ? ? 1_555 D DT  26 O4  ? ? G DA  112  H DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? C DT  14 N3    ? ? ? 1_555 D DA  25 N1  ? ? G DT  113  H DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? C DT  14 O4    ? ? ? 1_555 D DA  25 N6  ? ? G DT  113  H DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? C DA  15 N1    ? ? ? 1_555 D DT  24 N3  ? ? G DA  114  H DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? C DA  15 N6    ? ? ? 1_555 D DT  24 O4  ? ? G DA  114  H DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? C DA  16 N1    ? ? ? 1_555 D DT  23 N3  ? ? G DA  115  H DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? C DA  16 N6    ? ? ? 1_555 D DT  23 O4  ? ? G DA  115  H DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? C DT  17 N3    ? ? ? 1_555 D DA  22 N1  ? ? G DT  116  H DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? C DT  17 O4    ? ? ? 1_555 D DA  22 N6  ? ? G DT  116  H DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? C DG  18 N1    ? ? ? 1_555 D DC  21 N3  ? ? G DG  117  H DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? C DG  18 N2    ? ? ? 1_555 D DC  21 O2  ? ? G DG  117  H DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? C DG  18 O6    ? ? ? 1_555 D DC  21 N4  ? ? G DG  117  H DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? C DT  19 N3    ? ? ? 1_555 D DA  20 N1  ? ? G DT  118  H DA  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? C DT  19 O4    ? ? ? 1_555 D DA  20 N6  ? ? G DT  118  H DA  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? C DA  20 N1    ? ? ? 1_555 D DT  19 N3  ? ? G DA  119  H DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? C DA  20 N6    ? ? ? 1_555 D DT  19 O4  ? ? G DA  119  H DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? C DT  21 N3    ? ? ? 1_555 D DA  18 N1  ? ? G DT  120  H DA  117 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog128 hydrog ? ? C DG  22 N1    ? ? ? 1_555 D DC  17 N3  ? ? G DG  121  H DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? C DG  22 N2    ? ? ? 1_555 D DC  17 O2  ? ? G DG  121  H DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? C DG  22 O6    ? ? ? 1_555 D DC  17 N4  ? ? G DG  121  H DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? C DC  23 N3    ? ? ? 1_555 D DG  16 N1  ? ? G DC  122  H DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? C DC  23 N4    ? ? ? 1_555 D DG  16 O6  ? ? G DC  122  H DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? C DC  23 O2    ? ? ? 1_555 D DG  16 N2  ? ? G DC  122  H DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? C DT  24 N3    ? ? ? 1_555 D DA  15 N1  ? ? G DT  123  H DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? C DT  24 O4    ? ? ? 1_555 D DA  15 N6  ? ? G DT  123  H DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? C DA  25 N1    ? ? ? 1_555 D DT  14 N3  ? ? G DA  124  H DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? C DA  25 N6    ? ? ? 1_555 D DT  14 O4  ? ? G DA  124  H DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? C DT  26 N3    ? ? ? 1_555 D DA  13 N1  ? ? G DT  125  H DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? C DT  26 O4    ? ? ? 1_555 D DA  13 N6  ? ? G DT  125  H DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? C DA  27 N1    ? ? ? 1_555 D DT  12 N3  ? ? G DA  126  H DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? C DA  27 N6    ? ? ? 1_555 D DT  12 O4  ? ? G DA  126  H DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? C DC  28 N3    ? ? ? 1_555 D DG  11 N1  ? ? G DC  127  H DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? C DC  28 N4    ? ? ? 1_555 D DG  11 O6  ? ? G DC  127  H DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? C DC  28 O2    ? ? ? 1_555 D DG  11 N2  ? ? G DC  127  H DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? C DG  29 N1    ? ? ? 1_555 D DC  10 N3  ? ? G DG  128  H DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? C DG  29 N2    ? ? ? 1_555 D DC  10 O2  ? ? G DG  128  H DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? C DG  29 O6    ? ? ? 1_555 D DC  10 N4  ? ? G DG  128  H DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? C DA  30 N1    ? ? ? 1_555 D DT  9  N3  ? ? G DA  129  H DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? C DA  30 N6    ? ? ? 1_555 D DT  9  O4  ? ? G DA  129  H DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ? ? C DA  31 N1    ? ? ? 1_555 D DT  8  N3  ? ? G DA  130  H DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? C DA  31 N6    ? ? ? 1_555 D DT  8  O4  ? ? G DA  130  H DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? C DG  32 N1    ? ? ? 1_555 D DC  7  N3  ? ? G DG  131  H DC  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? C DG  32 N2    ? ? ? 1_555 D DC  7  O2  ? ? G DG  131  H DC  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? C DG  32 O6    ? ? ? 1_555 D DC  7  N4  ? ? G DG  131  H DC  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? C DT  33 N3    ? ? ? 1_555 D DA  6  N1  ? ? G DT  132  H DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? C DT  33 O4    ? ? ? 1_555 D DA  6  N6  ? ? G DT  132  H DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ? ? C DT  34 N3    ? ? ? 1_555 D DA  5  N1  ? ? G DT  133  H DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ? ? C DT  34 O4    ? ? ? 1_555 D DA  5  N6  ? ? G DT  133  H DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ? ? C DA  35 N1    ? ? ? 1_555 D DT  4  N3  ? ? G DA  134  H DT  103 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog160 hydrog ? ? C DT  36 N3    ? ? ? 1_555 D DA  3  N1  ? ? G DT  135  H DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ? ? C DT  36 O4    ? ? ? 1_555 D DA  3  N6  ? ? G DT  135  H DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ? ? C DC  37 N3    ? ? ? 1_555 D DG  2  N1  ? ? G DC  136  H DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ? ? C DC  37 N4    ? ? ? 1_555 D DG  2  O6  ? ? G DC  136  H DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ? ? C DC  37 O2    ? ? ? 1_555 D DG  2  N2  ? ? G DC  136  H DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 64 E . ? PHE 64 A PRO 65 E ? PRO 65 A 1 -0.27 
2 PHE 64 F . ? PHE 64 B PRO 65 F ? PRO 65 B 1 0.46  
3 PHE 64 G . ? PHE 64 E PRO 65 G ? PRO 65 E 1 -0.59 
4 PHE 64 H . ? PHE 64 F PRO 65 H ? PRO 65 F 1 -0.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 185 ? THR E 188 ? ILE A 185 THR A 188 
A 2 ARG E 192 ? HIS E 196 ? ARG A 192 HIS A 196 
A 3 GLU E 210 ? ALA E 212 ? GLU A 210 ALA A 212 
B 1 ARG E 241 ? VAL E 242 ? ARG A 241 VAL A 242 
B 2 ALA E 248 ? ALA E 249 ? ALA A 248 ALA A 249 
C 1 LEU F 194 ? ARG F 199 ? LEU B 194 ARG B 199 
C 2 VAL F 204 ? ALA F 212 ? VAL B 204 ALA B 212 
D 1 VAL F 242 ? ARG F 243 ? VAL B 242 ARG B 243 
D 2 VAL F 247 ? ALA F 248 ? VAL B 247 ALA B 248 
E 1 LEU G 194 ? HIS G 196 ? LEU E 194 HIS E 196 
E 2 GLU G 210 ? ALA G 212 ? GLU E 210 ALA E 212 
F 1 ILE H 185 ? ARG H 187 ? ILE F 185 ARG F 187 
F 2 MET H 193 ? THR H 200 ? MET F 193 THR F 200 
F 3 LEU H 203 ? ALA H 212 ? LEU F 203 ALA F 212 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR E 188 ? N THR A 188 O ARG E 192 ? O ARG A 192 
A 2 3 N ILE E 195 ? N ILE A 195 O LYS E 211 ? O LYS A 211 
B 1 2 N ARG E 241 ? N ARG A 241 O ALA E 249 ? O ALA A 249 
C 1 2 N ILE F 195 ? N ILE B 195 O LYS F 211 ? O LYS B 211 
D 1 2 N ARG F 243 ? N ARG B 243 O VAL F 247 ? O VAL B 247 
E 1 2 N ILE G 195 ? N ILE E 195 O LYS G 211 ? O LYS E 211 
F 1 2 N SER H 186 ? N SER F 186 O LEU H 194 ? O LEU F 194 
F 2 3 N ILE H 195 ? N ILE F 195 O LYS H 211 ? O LYS F 211 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 5301' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG A 5302' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG D 5304' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG D 5305' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG G 5306' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG C 5308' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG F 5309' 
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG D 5310' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 HIS E 40  ? HIS A 40  . ? 1_555 ? 
2  AC1 2 DT  A 26  ? DT  C 125 . ? 1_555 ? 
3  AC2 1 HIS E 269 ? HIS A 269 . ? 1_555 ? 
4  AC3 4 GLN E 156 ? GLN A 156 . ? 1_555 ? 
5  AC3 4 ARG E 159 ? ARG A 159 . ? 1_555 ? 
6  AC3 4 ASN E 160 ? ASN A 160 . ? 1_555 ? 
7  AC3 4 DC  B 7   ? DC  D 106 . ? 1_555 ? 
8  AC4 1 DT  B 8   ? DT  D 107 . ? 1_555 ? 
9  AC5 1 DG  C 18  ? DG  G 117 . ? 1_555 ? 
10 AC6 1 DG  A 18  ? DG  C 117 . ? 1_555 ? 
11 AC7 3 THR H 87  ? THR F 87  . ? 1_555 ? 
12 AC7 3 HIS H 91  ? HIS F 91  . ? 1_555 ? 
13 AC7 3 DA  C 13  ? DA  G 112 . ? 1_555 ? 
14 AC8 1 DA  B 6   ? DA  D 105 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1NZB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NZB 
_atom_sites.fract_transf_matrix[1][1]   0.009184 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006115 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005108 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
I  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DC  A 1 1   ? 36.017 94.139  28.347  1.00 95.62  ? 100  DC  C "O5'" 1 
ATOM   2     C  "C5'" . DC  A 1 1   ? 35.621 95.517  28.200  1.00 99.55  ? 100  DC  C "C5'" 1 
ATOM   3     C  "C4'" . DC  A 1 1   ? 35.052 96.064  29.487  1.00 97.99  ? 100  DC  C "C4'" 1 
ATOM   4     O  "O4'" . DC  A 1 1   ? 33.624 95.817  29.532  1.00 91.48  ? 100  DC  C "O4'" 1 
ATOM   5     C  "C3'" . DC  A 1 1   ? 35.645 95.390  30.721  1.00 104.69 ? 100  DC  C "C3'" 1 
ATOM   6     O  "O3'" . DC  A 1 1   ? 35.869 96.317  31.779  1.00 111.77 ? 100  DC  C "O3'" 1 
ATOM   7     C  "C2'" . DC  A 1 1   ? 34.598 94.371  31.116  1.00 98.40  ? 100  DC  C "C2'" 1 
ATOM   8     C  "C1'" . DC  A 1 1   ? 33.294 94.991  30.637  1.00 82.52  ? 100  DC  C "C1'" 1 
ATOM   9     N  N1    . DC  A 1 1   ? 32.302 93.993  30.185  1.00 67.07  ? 100  DC  C N1    1 
ATOM   10    C  C2    . DC  A 1 1   ? 32.728 92.928  29.357  1.00 61.43  ? 100  DC  C C2    1 
ATOM   11    O  O2    . DC  A 1 1   ? 33.918 92.879  28.988  1.00 57.09  ? 100  DC  C O2    1 
ATOM   12    N  N3    . DC  A 1 1   ? 31.835 91.986  28.983  1.00 53.18  ? 100  DC  C N3    1 
ATOM   13    C  C4    . DC  A 1 1   ? 30.566 92.075  29.385  1.00 54.69  ? 100  DC  C C4    1 
ATOM   14    N  N4    . DC  A 1 1   ? 29.725 91.121  28.988  1.00 52.04  ? 100  DC  C N4    1 
ATOM   15    C  C5    . DC  A 1 1   ? 30.104 93.150  30.209  1.00 44.60  ? 100  DC  C C5    1 
ATOM   16    C  C6    . DC  A 1 1   ? 30.995 94.078  30.578  1.00 54.63  ? 100  DC  C C6    1 
ATOM   17    P  P     . DG  A 1 2   ? 36.793 95.884  33.020  1.00 114.41 ? 101  DG  C P     1 
ATOM   18    O  OP1   . DG  A 1 2   ? 37.863 96.905  33.193  1.00 110.95 ? 101  DG  C OP1   1 
ATOM   19    O  OP2   . DG  A 1 2   ? 37.162 94.452  32.826  1.00 111.97 ? 101  DG  C OP2   1 
ATOM   20    O  "O5'" . DG  A 1 2   ? 35.800 95.979  34.258  1.00 110.25 ? 101  DG  C "O5'" 1 
ATOM   21    C  "C5'" . DG  A 1 2   ? 34.789 96.977  34.290  1.00 101.20 ? 101  DG  C "C5'" 1 
ATOM   22    C  "C4'" . DG  A 1 2   ? 33.565 96.455  35.005  1.00 100.28 ? 101  DG  C "C4'" 1 
ATOM   23    O  "O4'" . DG  A 1 2   ? 32.895 95.443  34.209  1.00 94.94  ? 101  DG  C "O4'" 1 
ATOM   24    C  "C3'" . DG  A 1 2   ? 33.851 95.809  36.361  1.00 102.51 ? 101  DG  C "C3'" 1 
ATOM   25    O  "O3'" . DG  A 1 2   ? 32.846 96.214  37.291  1.00 107.07 ? 101  DG  C "O3'" 1 
ATOM   26    C  "C2'" . DG  A 1 2   ? 33.740 94.320  36.073  1.00 93.50  ? 101  DG  C "C2'" 1 
ATOM   27    C  "C1'" . DG  A 1 2   ? 32.661 94.290  35.004  1.00 84.43  ? 101  DG  C "C1'" 1 
ATOM   28    N  N9    . DG  A 1 2   ? 32.668 93.117  34.129  1.00 73.48  ? 101  DG  C N9    1 
ATOM   29    C  C8    . DG  A 1 2   ? 33.740 92.586  33.453  1.00 65.70  ? 101  DG  C C8    1 
ATOM   30    N  N7    . DG  A 1 2   ? 33.429 91.538  32.739  1.00 54.87  ? 101  DG  C N7    1 
ATOM   31    C  C5    . DG  A 1 2   ? 32.071 91.362  32.961  1.00 57.72  ? 101  DG  C C5    1 
ATOM   32    C  C6    . DG  A 1 2   ? 31.174 90.380  32.452  1.00 58.30  ? 101  DG  C C6    1 
ATOM   33    O  O6    . DG  A 1 2   ? 31.414 89.449  31.661  1.00 57.39  ? 101  DG  C O6    1 
ATOM   34    N  N1    . DG  A 1 2   ? 29.883 90.561  32.946  1.00 49.53  ? 101  DG  C N1    1 
ATOM   35    C  C2    . DG  A 1 2   ? 29.506 91.562  33.810  1.00 59.97  ? 101  DG  C C2    1 
ATOM   36    N  N2    . DG  A 1 2   ? 28.219 91.570  34.183  1.00 57.26  ? 101  DG  C N2    1 
ATOM   37    N  N3    . DG  A 1 2   ? 30.330 92.487  34.279  1.00 62.07  ? 101  DG  C N3    1 
ATOM   38    C  C4    . DG  A 1 2   ? 31.586 92.326  33.819  1.00 63.13  ? 101  DG  C C4    1 
ATOM   39    P  P     . DA  A 1 3   ? 33.093 96.023  38.864  1.00 109.32 ? 102  DA  C P     1 
ATOM   40    O  OP1   . DA  A 1 3   ? 33.073 97.357  39.524  1.00 106.89 ? 102  DA  C OP1   1 
ATOM   41    O  OP2   . DA  A 1 3   ? 34.288 95.148  39.009  1.00 107.27 ? 102  DA  C OP2   1 
ATOM   42    O  "O5'" . DA  A 1 3   ? 31.794 95.221  39.318  1.00 102.80 ? 102  DA  C "O5'" 1 
ATOM   43    C  "C5'" . DA  A 1 3   ? 30.496 95.699  38.973  1.00 96.50  ? 102  DA  C "C5'" 1 
ATOM   44    C  "C4'" . DA  A 1 3   ? 29.476 94.588  39.074  1.00 95.54  ? 102  DA  C "C4'" 1 
ATOM   45    O  "O4'" . DA  A 1 3   ? 29.693 93.604  38.028  1.00 92.49  ? 102  DA  C "O4'" 1 
ATOM   46    C  "C3'" . DA  A 1 3   ? 29.483 93.815  40.397  1.00 97.96  ? 102  DA  C "C3'" 1 
ATOM   47    O  "O3'" . DA  A 1 3   ? 28.133 93.540  40.803  1.00 99.47  ? 102  DA  C "O3'" 1 
ATOM   48    C  "C2'" . DA  A 1 3   ? 30.210 92.530  40.039  1.00 91.69  ? 102  DA  C "C2'" 1 
ATOM   49    C  "C1'" . DA  A 1 3   ? 29.752 92.307  38.606  1.00 80.98  ? 102  DA  C "C1'" 1 
ATOM   50    N  N9    . DA  A 1 3   ? 30.641 91.479  37.787  1.00 66.82  ? 102  DA  C N9    1 
ATOM   51    C  C8    . DA  A 1 3   ? 32.004 91.585  37.641  1.00 64.02  ? 102  DA  C C8    1 
ATOM   52    N  N7    . DA  A 1 3   ? 32.519 90.705  36.814  1.00 55.64  ? 102  DA  C N7    1 
ATOM   53    C  C5    . DA  A 1 3   ? 31.425 89.969  36.390  1.00 50.76  ? 102  DA  C C5    1 
ATOM   54    C  C6    . DA  A 1 3   ? 31.307 88.899  35.494  1.00 49.62  ? 102  DA  C C6    1 
ATOM   55    N  N6    . DA  A 1 3   ? 32.338 88.385  34.832  1.00 36.99  ? 102  DA  C N6    1 
ATOM   56    N  N1    . DA  A 1 3   ? 30.080 88.375  35.292  1.00 47.49  ? 102  DA  C N1    1 
ATOM   57    C  C2    . DA  A 1 3   ? 29.040 88.915  35.952  1.00 53.25  ? 102  DA  C C2    1 
ATOM   58    N  N3    . DA  A 1 3   ? 29.022 89.937  36.815  1.00 46.13  ? 102  DA  C N3    1 
ATOM   59    C  C4    . DA  A 1 3   ? 30.263 90.424  36.990  1.00 54.60  ? 102  DA  C C4    1 
ATOM   60    P  P     . DT  A 1 4   ? 27.823 93.076  42.313  1.00 102.40 ? 103  DT  C P     1 
ATOM   61    O  OP1   . DT  A 1 4   ? 26.672 93.872  42.811  1.00 101.24 ? 103  DT  C OP1   1 
ATOM   62    O  OP2   . DT  A 1 4   ? 29.105 93.074  43.074  1.00 95.98  ? 103  DT  C OP2   1 
ATOM   63    O  "O5'" . DT  A 1 4   ? 27.325 91.576  42.134  1.00 95.03  ? 103  DT  C "O5'" 1 
ATOM   64    C  "C5'" . DT  A 1 4   ? 27.851 90.765  41.091  1.00 87.46  ? 103  DT  C "C5'" 1 
ATOM   65    C  "C4'" . DT  A 1 4   ? 26.947 89.585  40.832  1.00 85.19  ? 103  DT  C "C4'" 1 
ATOM   66    O  "O4'" . DT  A 1 4   ? 27.472 88.860  39.692  1.00 80.04  ? 103  DT  C "O4'" 1 
ATOM   67    C  "C3'" . DT  A 1 4   ? 26.898 88.585  41.984  1.00 86.91  ? 103  DT  C "C3'" 1 
ATOM   68    O  "O3'" . DT  A 1 4   ? 25.594 87.999  42.100  1.00 88.74  ? 103  DT  C "O3'" 1 
ATOM   69    C  "C2'" . DT  A 1 4   ? 27.951 87.560  41.602  1.00 78.35  ? 103  DT  C "C2'" 1 
ATOM   70    C  "C1'" . DT  A 1 4   ? 27.950 87.580  40.079  1.00 62.28  ? 103  DT  C "C1'" 1 
ATOM   71    N  N1    . DT  A 1 4   ? 29.295 87.421  39.499  1.00 43.88  ? 103  DT  C N1    1 
ATOM   72    C  C2    . DT  A 1 4   ? 29.491 86.467  38.520  1.00 48.24  ? 103  DT  C C2    1 
ATOM   73    O  O2    . DT  A 1 4   ? 28.601 85.745  38.100  1.00 53.09  ? 103  DT  C O2    1 
ATOM   74    N  N3    . DT  A 1 4   ? 30.777 86.389  38.044  1.00 32.99  ? 103  DT  C N3    1 
ATOM   75    C  C4    . DT  A 1 4   ? 31.858 87.149  38.439  1.00 34.34  ? 103  DT  C C4    1 
ATOM   76    O  O4    . DT  A 1 4   ? 32.952 86.966  37.920  1.00 40.63  ? 103  DT  C O4    1 
ATOM   77    C  C5    . DT  A 1 4   ? 31.585 88.128  39.471  1.00 32.91  ? 103  DT  C C5    1 
ATOM   78    C  C7    . DT  A 1 4   ? 32.706 88.987  39.971  1.00 57.12  ? 103  DT  C C7    1 
ATOM   79    C  C6    . DT  A 1 4   ? 30.331 88.216  39.940  1.00 29.62  ? 103  DT  C C6    1 
ATOM   80    P  P     . DA  A 1 5   ? 25.165 87.270  43.469  1.00 90.16  ? 104  DA  C P     1 
ATOM   81    O  OP1   . DA  A 1 5   ? 23.874 87.848  43.923  1.00 80.99  ? 104  DA  C OP1   1 
ATOM   82    O  OP2   . DA  A 1 5   ? 26.335 87.275  44.384  1.00 87.27  ? 104  DA  C OP2   1 
ATOM   83    O  "O5'" . DA  A 1 5   ? 24.892 85.774  43.006  1.00 82.72  ? 104  DA  C "O5'" 1 
ATOM   84    C  "C5'" . DA  A 1 5   ? 23.918 85.517  42.006  1.00 75.35  ? 104  DA  C "C5'" 1 
ATOM   85    C  "C4'" . DA  A 1 5   ? 24.181 84.194  41.325  1.00 75.06  ? 104  DA  C "C4'" 1 
ATOM   86    O  "O4'" . DA  A 1 5   ? 25.480 84.190  40.680  1.00 67.97  ? 104  DA  C "O4'" 1 
ATOM   87    C  "C3'" . DA  A 1 5   ? 24.147 82.966  42.228  1.00 76.98  ? 104  DA  C "C3'" 1 
ATOM   88    O  "O3'" . DA  A 1 5   ? 23.420 81.936  41.557  1.00 82.04  ? 104  DA  C "O3'" 1 
ATOM   89    C  "C2'" . DA  A 1 5   ? 25.614 82.602  42.398  1.00 69.25  ? 104  DA  C "C2'" 1 
ATOM   90    C  "C1'" . DA  A 1 5   ? 26.235 83.058  41.087  1.00 59.73  ? 104  DA  C "C1'" 1 
ATOM   91    N  N9    . DA  A 1 5   ? 27.628 83.489  41.190  1.00 48.28  ? 104  DA  C N9    1 
ATOM   92    C  C8    . DA  A 1 5   ? 28.129 84.445  42.038  1.00 43.40  ? 104  DA  C C8    1 
ATOM   93    N  N7    . DA  A 1 5   ? 29.406 84.698  41.857  1.00 35.61  ? 104  DA  C N7    1 
ATOM   94    C  C5    . DA  A 1 5   ? 29.771 83.841  40.831  1.00 34.68  ? 104  DA  C C5    1 
ATOM   95    C  C6    . DA  A 1 5   ? 30.986 83.649  40.161  1.00 41.96  ? 104  DA  C C6    1 
ATOM   96    N  N6    . DA  A 1 5   ? 32.082 84.360  40.426  1.00 36.46  ? 104  DA  C N6    1 
ATOM   97    N  N1    . DA  A 1 5   ? 31.035 82.701  39.194  1.00 44.39  ? 104  DA  C N1    1 
ATOM   98    C  C2    . DA  A 1 5   ? 29.915 82.009  38.924  1.00 56.35  ? 104  DA  C C2    1 
ATOM   99    N  N3    . DA  A 1 5   ? 28.697 82.116  39.478  1.00 49.40  ? 104  DA  C N3    1 
ATOM   100   C  C4    . DA  A 1 5   ? 28.695 83.064  40.432  1.00 37.92  ? 104  DA  C C4    1 
ATOM   101   P  P     . DA  A 1 6   ? 22.961 80.638  42.365  1.00 82.23  ? 105  DA  C P     1 
ATOM   102   O  OP1   . DA  A 1 6   ? 21.908 79.928  41.588  1.00 78.36  ? 105  DA  C OP1   1 
ATOM   103   O  OP2   . DA  A 1 6   ? 22.661 81.114  43.738  1.00 78.40  ? 105  DA  C OP2   1 
ATOM   104   O  "O5'" . DA  A 1 6   ? 24.287 79.754  42.345  1.00 75.26  ? 105  DA  C "O5'" 1 
ATOM   105   C  "C5'" . DA  A 1 6   ? 24.766 79.233  41.110  1.00 67.66  ? 105  DA  C "C5'" 1 
ATOM   106   C  "C4'" . DA  A 1 6   ? 26.089 78.524  41.287  1.00 73.70  ? 105  DA  C "C4'" 1 
ATOM   107   O  "O4'" . DA  A 1 6   ? 27.203 79.456  41.310  1.00 72.23  ? 105  DA  C "O4'" 1 
ATOM   108   C  "C3'" . DA  A 1 6   ? 26.244 77.622  42.519  1.00 75.98  ? 105  DA  C "C3'" 1 
ATOM   109   O  "O3'" . DA  A 1 6   ? 26.779 76.343  42.127  1.00 76.16  ? 105  DA  C "O3'" 1 
ATOM   110   C  "C2'" . DA  A 1 6   ? 27.277 78.368  43.350  1.00 67.98  ? 105  DA  C "C2'" 1 
ATOM   111   C  "C1'" . DA  A 1 6   ? 28.131 78.985  42.259  1.00 60.42  ? 105  DA  C "C1'" 1 
ATOM   112   N  N9    . DA  A 1 6   ? 29.012 80.084  42.658  1.00 52.88  ? 105  DA  C N9    1 
ATOM   113   C  C8    . DA  A 1 6   ? 28.801 81.076  43.589  1.00 49.60  ? 105  DA  C C8    1 
ATOM   114   N  N7    . DA  A 1 6   ? 29.834 81.869  43.761  1.00 37.46  ? 105  DA  C N7    1 
ATOM   115   C  C5    . DA  A 1 6   ? 30.780 81.380  42.871  1.00 36.58  ? 105  DA  C C5    1 
ATOM   116   C  C6    . DA  A 1 6   ? 32.100 81.777  42.579  1.00 38.22  ? 105  DA  C C6    1 
ATOM   117   N  N6    . DA  A 1 6   ? 32.715 82.803  43.179  1.00 33.48  ? 105  DA  C N6    1 
ATOM   118   N  N1    . DA  A 1 6   ? 32.778 81.072  41.639  1.00 37.58  ? 105  DA  C N1    1 
ATOM   119   C  C2    . DA  A 1 6   ? 32.158 80.040  41.043  1.00 39.13  ? 105  DA  C C2    1 
ATOM   120   N  N3    . DA  A 1 6   ? 30.920 79.571  41.237  1.00 39.46  ? 105  DA  C N3    1 
ATOM   121   C  C4    . DA  A 1 6   ? 30.281 80.291  42.174  1.00 41.92  ? 105  DA  C C4    1 
ATOM   122   P  P     . DC  A 1 7   ? 26.379 75.016  42.947  1.00 76.49  ? 106  DC  C P     1 
ATOM   123   O  OP1   . DC  A 1 7   ? 25.992 73.970  41.973  1.00 77.29  ? 106  DC  C OP1   1 
ATOM   124   O  OP2   . DC  A 1 7   ? 25.434 75.402  44.025  1.00 71.90  ? 106  DC  C OP2   1 
ATOM   125   O  "O5'" . DC  A 1 7   ? 27.747 74.560  43.617  1.00 62.98  ? 106  DC  C "O5'" 1 
ATOM   126   C  "C5'" . DC  A 1 7   ? 28.799 75.491  43.788  1.00 41.25  ? 106  DC  C "C5'" 1 
ATOM   127   C  "C4'" . DC  A 1 7   ? 29.888 75.208  42.784  1.00 53.76  ? 106  DC  C "C4'" 1 
ATOM   128   O  "O4'" . DC  A 1 7   ? 30.567 76.439  42.450  1.00 57.59  ? 106  DC  C "O4'" 1 
ATOM   129   C  "C3'" . DC  A 1 7   ? 30.957 74.239  43.269  1.00 60.13  ? 106  DC  C "C3'" 1 
ATOM   130   O  "O3'" . DC  A 1 7   ? 31.366 73.355  42.234  1.00 69.37  ? 106  DC  C "O3'" 1 
ATOM   131   C  "C2'" . DC  A 1 7   ? 32.102 75.145  43.690  1.00 53.00  ? 106  DC  C "C2'" 1 
ATOM   132   C  "C1'" . DC  A 1 7   ? 31.913 76.428  42.884  1.00 45.74  ? 106  DC  C "C1'" 1 
ATOM   133   N  N1    . DC  A 1 7   ? 32.093 77.628  43.708  1.00 36.44  ? 106  DC  C N1    1 
ATOM   134   C  C2    . DC  A 1 7   ? 33.328 78.269  43.710  1.00 36.46  ? 106  DC  C C2    1 
ATOM   135   O  O2    . DC  A 1 7   ? 34.227 77.836  42.966  1.00 37.92  ? 106  DC  C O2    1 
ATOM   136   N  N3    . DC  A 1 7   ? 33.515 79.339  44.519  1.00 29.53  ? 106  DC  C N3    1 
ATOM   137   C  C4    . DC  A 1 7   ? 32.512 79.770  45.295  1.00 36.20  ? 106  DC  C C4    1 
ATOM   138   N  N4    . DC  A 1 7   ? 32.739 80.817  46.094  1.00 43.15  ? 106  DC  C N4    1 
ATOM   139   C  C5    . DC  A 1 7   ? 31.234 79.146  45.289  1.00 21.41  ? 106  DC  C C5    1 
ATOM   140   C  C6    . DC  A 1 7   ? 31.069 78.093  44.485  1.00 22.54  ? 106  DC  C C6    1 
HETATM 141   N  N1    . UMP A 1 8   ? 36.227 75.670  44.894  1.00 49.94  ? 107  UMP C N1    1 
HETATM 142   C  C2    . UMP A 1 8   ? 36.915 76.659  45.568  1.00 46.55  ? 107  UMP C C2    1 
HETATM 143   N  N3    . UMP A 1 8   ? 36.172 77.366  46.482  1.00 46.91  ? 107  UMP C N3    1 
HETATM 144   C  C4    . UMP A 1 8   ? 34.848 77.168  46.801  1.00 49.55  ? 107  UMP C C4    1 
HETATM 145   C  C5    . UMP A 1 8   ? 34.213 76.100  46.089  1.00 44.84  ? 107  UMP C C5    1 
HETATM 146   C  C6    . UMP A 1 8   ? 34.908 75.408  45.179  1.00 46.04  ? 107  UMP C C6    1 
HETATM 147   O  O2    . UMP A 1 8   ? 38.100 76.882  45.379  1.00 43.07  ? 107  UMP C O2    1 
HETATM 148   O  O4    . UMP A 1 8   ? 34.311 77.900  47.631  1.00 53.35  ? 107  UMP C O4    1 
HETATM 149   C  "C1'" . UMP A 1 8   ? 36.946 74.920  43.851  1.00 57.32  ? 107  UMP C "C1'" 1 
HETATM 150   C  "C2'" . UMP A 1 8   ? 37.689 73.692  44.353  1.00 61.11  ? 107  UMP C "C2'" 1 
HETATM 151   C  "C3'" . UMP A 1 8   ? 37.447 72.638  43.285  1.00 67.19  ? 107  UMP C "C3'" 1 
HETATM 152   C  "C4'" . UMP A 1 8   ? 36.140 73.062  42.633  1.00 65.54  ? 107  UMP C "C4'" 1 
HETATM 153   O  "O3'" . UMP A 1 8   ? 38.490 72.569  42.323  1.00 74.44  ? 107  UMP C "O3'" 1 
HETATM 154   O  "O4'" . UMP A 1 8   ? 35.976 74.466  42.921  1.00 63.94  ? 107  UMP C "O4'" 1 
HETATM 155   C  "C5'" . UMP A 1 8   ? 34.941 72.332  43.177  1.00 64.93  ? 107  UMP C "C5'" 1 
HETATM 156   O  "O5'" . UMP A 1 8   ? 33.768 73.006  42.788  1.00 67.21  ? 107  UMP C "O5'" 1 
HETATM 157   P  P     . UMP A 1 8   ? 32.421 72.204  42.573  1.00 71.72  ? 107  UMP C P     1 
HETATM 158   O  OP1   . UMP A 1 8   ? 32.592 71.289  41.405  1.00 69.23  ? 107  UMP C OP1   1 
HETATM 159   O  OP2   . UMP A 1 8   ? 32.032 71.655  43.892  1.00 72.26  ? 107  UMP C OP2   1 
ATOM   160   P  P     . DT  A 1 9   ? 39.764 71.642  42.620  1.00 82.70  ? 108  DT  C P     1 
ATOM   161   O  OP1   . DT  A 1 9   ? 40.557 71.521  41.365  1.00 80.36  ? 108  DT  C OP1   1 
ATOM   162   O  OP2   . DT  A 1 9   ? 39.296 70.413  43.319  1.00 79.14  ? 108  DT  C OP2   1 
ATOM   163   O  "O5'" . DT  A 1 9   ? 40.583 72.534  43.647  1.00 80.17  ? 108  DT  C "O5'" 1 
ATOM   164   C  "C5'" . DT  A 1 9   ? 40.944 73.853  43.281  1.00 76.29  ? 108  DT  C "C5'" 1 
ATOM   165   C  "C4'" . DT  A 1 9   ? 41.596 74.564  44.439  1.00 70.77  ? 108  DT  C "C4'" 1 
ATOM   166   O  "O4'" . DT  A 1 9   ? 40.614 75.203  45.290  1.00 65.56  ? 108  DT  C "O4'" 1 
ATOM   167   C  "C3'" . DT  A 1 9   ? 42.462 73.691  45.338  1.00 71.45  ? 108  DT  C "C3'" 1 
ATOM   168   O  "O3'" . DT  A 1 9   ? 43.722 74.336  45.499  1.00 83.93  ? 108  DT  C "O3'" 1 
ATOM   169   C  "C2'" . DT  A 1 9   ? 41.678 73.649  46.643  1.00 61.48  ? 108  DT  C "C2'" 1 
ATOM   170   C  "C1'" . DT  A 1 9   ? 40.953 74.986  46.642  1.00 55.39  ? 108  DT  C "C1'" 1 
ATOM   171   N  N1    . DT  A 1 9   ? 39.704 75.092  47.434  1.00 45.42  ? 108  DT  C N1    1 
ATOM   172   C  C2    . DT  A 1 9   ? 39.571 76.160  48.287  1.00 45.13  ? 108  DT  C C2    1 
ATOM   173   O  O2    . DT  A 1 9   ? 40.461 76.959  48.492  1.00 49.70  ? 108  DT  C O2    1 
ATOM   174   N  N3    . DT  A 1 9   ? 38.353 76.255  48.903  1.00 38.86  ? 108  DT  C N3    1 
ATOM   175   C  C4    . DT  A 1 9   ? 37.283 75.396  48.771  1.00 42.11  ? 108  DT  C C4    1 
ATOM   176   O  O4    . DT  A 1 9   ? 36.234 75.631  49.360  1.00 40.03  ? 108  DT  C O4    1 
ATOM   177   C  C5    . DT  A 1 9   ? 37.509 74.265  47.907  1.00 39.43  ? 108  DT  C C5    1 
ATOM   178   C  C7    . DT  A 1 9   ? 36.419 73.256  47.735  1.00 57.12  ? 108  DT  C C7    1 
ATOM   179   C  C6    . DT  A 1 9   ? 38.694 74.171  47.292  1.00 44.93  ? 108  DT  C C6    1 
ATOM   180   P  P     . DC  A 1 10  ? 44.996 73.499  46.004  1.00 88.48  ? 109  DC  C P     1 
ATOM   181   O  OP1   . DC  A 1 10  ? 46.076 73.598  44.989  1.00 86.80  ? 109  DC  C OP1   1 
ATOM   182   O  OP2   . DC  A 1 10  ? 44.532 72.155  46.448  1.00 86.30  ? 109  DC  C OP2   1 
ATOM   183   O  "O5'" . DC  A 1 10  ? 45.417 74.349  47.277  1.00 85.43  ? 109  DC  C "O5'" 1 
ATOM   184   C  "C5'" . DC  A 1 10  ? 44.423 75.108  47.955  1.00 88.33  ? 109  DC  C "C5'" 1 
ATOM   185   C  "C4'" . DC  A 1 10  ? 45.030 75.869  49.104  1.00 92.71  ? 109  DC  C "C4'" 1 
ATOM   186   O  "O4'" . DC  A 1 10  ? 43.948 76.476  49.847  1.00 90.82  ? 109  DC  C "O4'" 1 
ATOM   187   C  "C3'" . DC  A 1 10  ? 45.769 74.979  50.095  1.00 96.10  ? 109  DC  C "C3'" 1 
ATOM   188   O  "O3'" . DC  A 1 10  ? 46.896 75.686  50.626  1.00 99.08  ? 109  DC  C "O3'" 1 
ATOM   189   C  "C2'" . DC  A 1 10  ? 44.716 74.654  51.141  1.00 88.43  ? 109  DC  C "C2'" 1 
ATOM   190   C  "C1'" . DC  A 1 10  ? 43.785 75.860  51.117  1.00 79.55  ? 109  DC  C "C1'" 1 
ATOM   191   N  N1    . DC  A 1 10  ? 42.355 75.525  51.265  1.00 66.87  ? 109  DC  C N1    1 
ATOM   192   C  C2    . DC  A 1 10  ? 41.543 76.344  52.060  1.00 58.70  ? 109  DC  C C2    1 
ATOM   193   O  O2    . DC  A 1 10  ? 42.038 77.342  52.599  1.00 60.14  ? 109  DC  C O2    1 
ATOM   194   N  N3    . DC  A 1 10  ? 40.241 76.034  52.217  1.00 52.91  ? 109  DC  C N3    1 
ATOM   195   C  C4    . DC  A 1 10  ? 39.735 74.960  51.611  1.00 58.53  ? 109  DC  C C4    1 
ATOM   196   N  N4    . DC  A 1 10  ? 38.435 74.687  51.810  1.00 41.69  ? 109  DC  C N4    1 
ATOM   197   C  C5    . DC  A 1 10  ? 40.533 74.116  50.782  1.00 59.04  ? 109  DC  C C5    1 
ATOM   198   C  C6    . DC  A 1 10  ? 41.825 74.432  50.641  1.00 61.08  ? 109  DC  C C6    1 
ATOM   199   P  P     . DG  A 1 11  ? 47.934 74.923  51.583  1.00 99.81  ? 110  DG  C P     1 
ATOM   200   O  OP1   . DG  A 1 11  ? 49.298 75.491  51.395  1.00 99.39  ? 110  DG  C OP1   1 
ATOM   201   O  OP2   . DG  A 1 11  ? 47.715 73.459  51.396  1.00 89.93  ? 110  DG  C OP2   1 
ATOM   202   O  "O5'" . DG  A 1 11  ? 47.423 75.348  53.027  1.00 93.83  ? 110  DG  C "O5'" 1 
ATOM   203   C  "C5'" . DG  A 1 11  ? 47.271 76.726  53.360  1.00 84.49  ? 110  DG  C "C5'" 1 
ATOM   204   C  "C4'" . DG  A 1 11  ? 46.744 76.860  54.768  1.00 81.69  ? 110  DG  C "C4'" 1 
ATOM   205   O  "O4'" . DG  A 1 11  ? 45.318 76.610  54.777  1.00 77.37  ? 110  DG  C "O4'" 1 
ATOM   206   C  "C3'" . DG  A 1 11  ? 47.367 75.841  55.721  1.00 88.64  ? 110  DG  C "C3'" 1 
ATOM   207   O  "O3'" . DG  A 1 11  ? 47.667 76.420  56.985  1.00 92.32  ? 110  DG  C "O3'" 1 
ATOM   208   C  "C2'" . DG  A 1 11  ? 46.291 74.782  55.869  1.00 82.34  ? 110  DG  C "C2'" 1 
ATOM   209   C  "C1'" . DG  A 1 11  ? 45.014 75.583  55.708  1.00 72.29  ? 110  DG  C "C1'" 1 
ATOM   210   N  N9    . DG  A 1 11  ? 43.910 74.788  55.177  1.00 58.25  ? 110  DG  C N9    1 
ATOM   211   C  C8    . DG  A 1 11  ? 44.004 73.719  54.318  1.00 51.22  ? 110  DG  C C8    1 
ATOM   212   N  N7    . DG  A 1 11  ? 42.851 73.166  54.062  1.00 46.03  ? 110  DG  C N7    1 
ATOM   213   C  C5    . DG  A 1 11  ? 41.940 73.923  54.782  1.00 42.15  ? 110  DG  C C5    1 
ATOM   214   C  C6    . DG  A 1 11  ? 40.549 73.788  54.898  1.00 42.54  ? 110  DG  C C6    1 
ATOM   215   O  O6    . DG  A 1 11  ? 39.823 72.953  54.368  1.00 45.97  ? 110  DG  C O6    1 
ATOM   216   N  N1    . DG  A 1 11  ? 40.004 74.756  55.733  1.00 40.19  ? 110  DG  C N1    1 
ATOM   217   C  C2    . DG  A 1 11  ? 40.722 75.733  56.374  1.00 43.89  ? 110  DG  C C2    1 
ATOM   218   N  N2    . DG  A 1 11  ? 40.012 76.575  57.142  1.00 41.47  ? 110  DG  C N2    1 
ATOM   219   N  N3    . DG  A 1 11  ? 42.036 75.871  56.272  1.00 37.37  ? 110  DG  C N3    1 
ATOM   220   C  C4    . DG  A 1 11  ? 42.575 74.936  55.466  1.00 44.98  ? 110  DG  C C4    1 
ATOM   221   P  P     . DT  A 1 12  ? 48.508 75.574  58.065  1.00 92.36  ? 111  DT  C P     1 
ATOM   222   O  OP1   . DT  A 1 12  ? 49.750 76.338  58.351  1.00 89.21  ? 111  DT  C OP1   1 
ATOM   223   O  OP2   . DT  A 1 12  ? 48.608 74.157  57.618  1.00 91.07  ? 111  DT  C OP2   1 
ATOM   224   O  "O5'" . DT  A 1 12  ? 47.565 75.654  59.342  1.00 91.27  ? 111  DT  C "O5'" 1 
ATOM   225   C  "C5'" . DT  A 1 12  ? 46.985 76.901  59.702  1.00 82.45  ? 111  DT  C "C5'" 1 
ATOM   226   C  "C4'" . DT  A 1 12  ? 45.721 76.693  60.499  1.00 75.51  ? 111  DT  C "C4'" 1 
ATOM   227   O  "O4'" . DT  A 1 12  ? 44.714 76.031  59.693  1.00 74.81  ? 111  DT  C "O4'" 1 
ATOM   228   C  "C3'" . DT  A 1 12  ? 45.874 75.856  61.768  1.00 72.16  ? 111  DT  C "C3'" 1 
ATOM   229   O  "O3'" . DT  A 1 12  ? 45.155 76.496  62.821  1.00 71.30  ? 111  DT  C "O3'" 1 
ATOM   230   C  "C2'" . DT  A 1 12  ? 45.218 74.534  61.407  1.00 69.30  ? 111  DT  C "C2'" 1 
ATOM   231   C  "C1'" . DT  A 1 12  ? 44.132 74.979  60.446  1.00 68.68  ? 111  DT  C "C1'" 1 
ATOM   232   N  N1    . DT  A 1 12  ? 43.649 73.944  59.503  1.00 59.01  ? 111  DT  C N1    1 
ATOM   233   C  C2    . DT  A 1 12  ? 42.283 73.843  59.292  1.00 51.54  ? 111  DT  C C2    1 
ATOM   234   O  O2    . DT  A 1 12  ? 41.461 74.556  59.853  1.00 44.02  ? 111  DT  C O2    1 
ATOM   235   N  N3    . DT  A 1 12  ? 41.912 72.870  58.398  1.00 38.42  ? 111  DT  C N3    1 
ATOM   236   C  C4    . DT  A 1 12  ? 42.743 72.011  57.714  1.00 40.40  ? 111  DT  C C4    1 
ATOM   237   O  O4    . DT  A 1 12  ? 42.264 71.202  56.925  1.00 39.83  ? 111  DT  C O4    1 
ATOM   238   C  C5    . DT  A 1 12  ? 44.156 72.160  57.996  1.00 44.14  ? 111  DT  C C5    1 
ATOM   239   C  C7    . DT  A 1 12  ? 45.127 71.251  57.317  1.00 57.12  ? 111  DT  C C7    1 
ATOM   240   C  C6    . DT  A 1 12  ? 44.534 73.109  58.859  1.00 45.85  ? 111  DT  C C6    1 
ATOM   241   P  P     . DA  A 1 13  ? 45.396 76.045  64.339  1.00 72.72  ? 112  DA  C P     1 
ATOM   242   O  OP1   . DA  A 1 13  ? 45.521 77.266  65.178  1.00 66.75  ? 112  DA  C OP1   1 
ATOM   243   O  OP2   . DA  A 1 13  ? 46.489 75.033  64.333  1.00 66.24  ? 112  DA  C OP2   1 
ATOM   244   O  "O5'" . DA  A 1 13  ? 44.018 75.347  64.708  1.00 65.55  ? 112  DA  C "O5'" 1 
ATOM   245   C  "C5'" . DA  A 1 13  ? 42.806 76.062  64.537  1.00 55.09  ? 112  DA  C "C5'" 1 
ATOM   246   C  "C4'" . DA  A 1 13  ? 41.620 75.130  64.598  1.00 52.32  ? 112  DA  C "C4'" 1 
ATOM   247   O  "O4'" . DA  A 1 13  ? 41.506 74.317  63.401  1.00 52.70  ? 112  DA  C "O4'" 1 
ATOM   248   C  "C3'" . DA  A 1 13  ? 41.584 74.159  65.776  1.00 49.79  ? 112  DA  C "C3'" 1 
ATOM   249   O  "O3'" . DA  A 1 13  ? 40.308 74.248  66.400  1.00 49.61  ? 112  DA  C "O3'" 1 
ATOM   250   C  "C2'" . DA  A 1 13  ? 41.741 72.795  65.125  1.00 47.67  ? 112  DA  C "C2'" 1 
ATOM   251   C  "C1'" . DA  A 1 13  ? 41.076 73.030  63.785  1.00 45.09  ? 112  DA  C "C1'" 1 
ATOM   252   N  N9    . DA  A 1 13  ? 41.412 72.084  62.719  1.00 39.90  ? 112  DA  C N9    1 
ATOM   253   C  C8    . DA  A 1 13  ? 42.651 71.707  62.262  1.00 34.65  ? 112  DA  C C8    1 
ATOM   254   N  N7    . DA  A 1 13  ? 42.612 70.797  61.314  1.00 29.97  ? 112  DA  C N7    1 
ATOM   255   C  C5    . DA  A 1 13  ? 41.257 70.574  61.125  1.00 30.01  ? 112  DA  C C5    1 
ATOM   256   C  C6    . DA  A 1 13  ? 40.556 69.726  60.257  1.00 25.67  ? 112  DA  C C6    1 
ATOM   257   N  N6    . DA  A 1 13  ? 41.150 68.911  59.390  1.00 24.88  ? 112  DA  C N6    1 
ATOM   258   N  N1    . DA  A 1 13  ? 39.206 69.737  60.315  1.00 27.17  ? 112  DA  C N1    1 
ATOM   259   C  C2    . DA  A 1 13  ? 38.613 70.552  61.201  1.00 35.54  ? 112  DA  C C2    1 
ATOM   260   N  N3    . DA  A 1 13  ? 39.167 71.399  62.069  1.00 34.15  ? 112  DA  C N3    1 
ATOM   261   C  C4    . DA  A 1 13  ? 40.507 71.362  61.978  1.00 35.63  ? 112  DA  C C4    1 
ATOM   262   P  P     . DT  A 1 14  ? 40.023 73.413  67.733  1.00 52.37  ? 113  DT  C P     1 
ATOM   263   O  OP1   . DT  A 1 14  ? 39.044 74.164  68.567  1.00 36.89  ? 113  DT  C OP1   1 
ATOM   264   O  OP2   . DT  A 1 14  ? 41.348 73.026  68.302  1.00 46.36  ? 113  DT  C OP2   1 
ATOM   265   O  "O5'" . DT  A 1 14  ? 39.279 72.129  67.171  1.00 47.53  ? 113  DT  C "O5'" 1 
ATOM   266   C  "C5'" . DT  A 1 14  ? 38.011 72.276  66.564  1.00 45.26  ? 113  DT  C "C5'" 1 
ATOM   267   C  "C4'" . DT  A 1 14  ? 37.463 70.931  66.160  1.00 46.23  ? 113  DT  C "C4'" 1 
ATOM   268   O  "O4'" . DT  A 1 14  ? 38.200 70.409  65.028  1.00 44.90  ? 113  DT  C "O4'" 1 
ATOM   269   C  "C3'" . DT  A 1 14  ? 37.538 69.856  67.243  1.00 42.39  ? 113  DT  C "C3'" 1 
ATOM   270   O  "O3'" . DT  A 1 14  ? 36.348 69.074  67.183  1.00 46.38  ? 113  DT  C "O3'" 1 
ATOM   271   C  "C2'" . DT  A 1 14  ? 38.701 69.005  66.775  1.00 30.57  ? 113  DT  C "C2'" 1 
ATOM   272   C  "C1'" . DT  A 1 14  ? 38.471 69.057  65.288  1.00 31.67  ? 113  DT  C "C1'" 1 
ATOM   273   N  N1    . DT  A 1 14  ? 39.576 68.615  64.431  1.00 29.12  ? 113  DT  C N1    1 
ATOM   274   C  C2    . DT  A 1 14  ? 39.254 67.770  63.398  1.00 31.11  ? 113  DT  C C2    1 
ATOM   275   O  O2    . DT  A 1 14  ? 38.105 67.444  63.133  1.00 35.91  ? 113  DT  C O2    1 
ATOM   276   N  N3    . DT  A 1 14  ? 40.322 67.314  62.683  1.00 22.69  ? 113  DT  C N3    1 
ATOM   277   C  C4    . DT  A 1 14  ? 41.647 67.616  62.890  1.00 31.01  ? 113  DT  C C4    1 
ATOM   278   O  O4    . DT  A 1 14  ? 42.509 67.101  62.178  1.00 33.93  ? 113  DT  C O4    1 
ATOM   279   C  C5    . DT  A 1 14  ? 41.907 68.536  63.966  1.00 23.09  ? 113  DT  C C5    1 
ATOM   280   C  C7    . DT  A 1 14  ? 43.319 68.928  64.255  1.00 57.12  ? 113  DT  C C7    1 
ATOM   281   C  C6    . DT  A 1 14  ? 40.871 68.993  64.668  1.00 17.17  ? 113  DT  C C6    1 
ATOM   282   P  P     . DA  A 1 15  ? 35.736 68.437  68.518  1.00 47.00  ? 114  DA  C P     1 
ATOM   283   O  OP1   . DA  A 1 15  ? 34.736 69.378  69.067  1.00 44.65  ? 114  DA  C OP1   1 
ATOM   284   O  OP2   . DA  A 1 15  ? 36.827 67.933  69.392  1.00 48.53  ? 114  DA  C OP2   1 
ATOM   285   O  "O5'" . DA  A 1 15  ? 34.937 67.193  67.949  1.00 40.41  ? 114  DA  C "O5'" 1 
ATOM   286   C  "C5'" . DA  A 1 15  ? 33.828 67.406  67.098  1.00 21.08  ? 114  DA  C "C5'" 1 
ATOM   287   C  "C4'" . DA  A 1 15  ? 33.807 66.379  65.997  1.00 25.42  ? 114  DA  C "C4'" 1 
ATOM   288   O  "O4'" . DA  A 1 15  ? 35.121 66.292  65.394  1.00 34.94  ? 114  DA  C "O4'" 1 
ATOM   289   C  "C3'" . DA  A 1 15  ? 33.463 64.962  66.434  1.00 34.16  ? 114  DA  C "C3'" 1 
ATOM   290   O  "O3'" . DA  A 1 15  ? 32.481 64.449  65.554  1.00 39.42  ? 114  DA  C "O3'" 1 
ATOM   291   C  "C2'" . DA  A 1 15  ? 34.763 64.189  66.254  1.00 33.29  ? 114  DA  C "C2'" 1 
ATOM   292   C  "C1'" . DA  A 1 15  ? 35.417 64.939  65.126  1.00 34.20  ? 114  DA  C "C1'" 1 
ATOM   293   N  N9    . DA  A 1 15  ? 36.868 64.804  65.014  1.00 31.84  ? 114  DA  C N9    1 
ATOM   294   C  C8    . DA  A 1 15  ? 37.832 65.477  65.711  1.00 32.27  ? 114  DA  C C8    1 
ATOM   295   N  N7    . DA  A 1 15  ? 39.059 65.162  65.358  1.00 26.80  ? 114  DA  C N7    1 
ATOM   296   C  C5    . DA  A 1 15  ? 38.883 64.212  64.367  1.00 30.06  ? 114  DA  C C5    1 
ATOM   297   C  C6    . DA  A 1 15  ? 39.796 63.485  63.585  1.00 32.73  ? 114  DA  C C6    1 
ATOM   298   N  N6    . DA  A 1 15  ? 41.119 63.633  63.661  1.00 31.10  ? 114  DA  C N6    1 
ATOM   299   N  N1    . DA  A 1 15  ? 39.299 62.598  62.700  1.00 27.11  ? 114  DA  C N1    1 
ATOM   300   C  C2    . DA  A 1 15  ? 37.973 62.479  62.599  1.00 32.60  ? 114  DA  C C2    1 
ATOM   301   N  N3    . DA  A 1 15  ? 37.012 63.121  63.267  1.00 28.45  ? 114  DA  C N3    1 
ATOM   302   C  C4    . DA  A 1 15  ? 37.541 63.977  64.151  1.00 28.61  ? 114  DA  C C4    1 
ATOM   303   P  P     . DA  A 1 16  ? 31.490 63.314  66.065  1.00 43.73  ? 115  DA  C P     1 
ATOM   304   O  OP1   . DA  A 1 16  ? 30.158 63.565  65.476  1.00 36.42  ? 115  DA  C OP1   1 
ATOM   305   O  OP2   . DA  A 1 16  ? 31.648 63.217  67.541  1.00 37.68  ? 115  DA  C OP2   1 
ATOM   306   O  "O5'" . DA  A 1 16  ? 32.076 62.028  65.355  1.00 39.82  ? 115  DA  C "O5'" 1 
ATOM   307   C  "C5'" . DA  A 1 16  ? 32.129 61.988  63.944  1.00 33.47  ? 115  DA  C "C5'" 1 
ATOM   308   C  "C4'" . DA  A 1 16  ? 33.032 60.874  63.475  1.00 43.67  ? 115  DA  C "C4'" 1 
ATOM   309   O  "O4'" . DA  A 1 16  ? 34.425 61.125  63.789  1.00 45.71  ? 115  DA  C "O4'" 1 
ATOM   310   C  "C3'" . DA  A 1 16  ? 32.736 59.473  64.008  1.00 46.56  ? 115  DA  C "C3'" 1 
ATOM   311   O  "O3'" . DA  A 1 16  ? 32.964 58.599  62.911  1.00 56.32  ? 115  DA  C "O3'" 1 
ATOM   312   C  "C2'" . DA  A 1 16  ? 33.853 59.254  65.016  1.00 35.39  ? 115  DA  C "C2'" 1 
ATOM   313   C  "C1'" . DA  A 1 16  ? 34.981 59.912  64.259  1.00 35.35  ? 115  DA  C "C1'" 1 
ATOM   314   N  N9    . DA  A 1 16  ? 36.244 60.206  64.933  1.00 36.31  ? 115  DA  C N9    1 
ATOM   315   C  C8    . DA  A 1 16  ? 36.529 60.987  66.025  1.00 42.21  ? 115  DA  C C8    1 
ATOM   316   N  N7    . DA  A 1 16  ? 37.813 61.081  66.286  1.00 35.98  ? 115  DA  C N7    1 
ATOM   317   C  C5    . DA  A 1 16  ? 38.406 60.296  65.309  1.00 33.99  ? 115  DA  C C5    1 
ATOM   318   C  C6    . DA  A 1 16  ? 39.748 59.988  65.017  1.00 36.30  ? 115  DA  C C6    1 
ATOM   319   N  N6    . DA  A 1 16  ? 40.786 60.474  65.694  1.00 36.87  ? 115  DA  C N6    1 
ATOM   320   N  N1    . DA  A 1 16  ? 39.992 59.156  63.984  1.00 38.19  ? 115  DA  C N1    1 
ATOM   321   C  C2    . DA  A 1 16  ? 38.955 58.681  63.287  1.00 49.52  ? 115  DA  C C2    1 
ATOM   322   N  N3    . DA  A 1 16  ? 37.654 58.910  63.452  1.00 37.46  ? 115  DA  C N3    1 
ATOM   323   C  C4    . DA  A 1 16  ? 37.448 59.732  64.490  1.00 33.07  ? 115  DA  C C4    1 
ATOM   324   P  P     . DT  A 1 17  ? 31.841 57.561  62.467  1.00 59.53  ? 116  DT  C P     1 
ATOM   325   O  OP1   . DT  A 1 17  ? 31.802 57.593  60.987  1.00 63.82  ? 116  DT  C OP1   1 
ATOM   326   O  OP2   . DT  A 1 17  ? 30.610 57.865  63.223  1.00 49.09  ? 116  DT  C OP2   1 
ATOM   327   O  "O5'" . DT  A 1 17  ? 32.492 56.177  62.923  1.00 52.35  ? 116  DT  C "O5'" 1 
ATOM   328   C  "C5'" . DT  A 1 17  ? 33.346 55.469  62.023  1.00 55.27  ? 116  DT  C "C5'" 1 
ATOM   329   C  "C4'" . DT  A 1 17  ? 34.241 54.497  62.758  1.00 60.49  ? 116  DT  C "C4'" 1 
ATOM   330   O  "O4'" . DT  A 1 17  ? 35.490 55.104  63.182  1.00 57.51  ? 116  DT  C "O4'" 1 
ATOM   331   C  "C3'" . DT  A 1 17  ? 33.642 53.824  63.991  1.00 67.51  ? 116  DT  C "C3'" 1 
ATOM   332   O  "O3'" . DT  A 1 17  ? 33.843 52.410  63.936  1.00 76.87  ? 116  DT  C "O3'" 1 
ATOM   333   C  "C2'" . DT  A 1 17  ? 34.472 54.391  65.128  1.00 57.46  ? 116  DT  C "C2'" 1 
ATOM   334   C  "C1'" . DT  A 1 17  ? 35.813 54.578  64.448  1.00 48.59  ? 116  DT  C "C1'" 1 
ATOM   335   N  N1    . DT  A 1 17  ? 36.760 55.490  65.135  1.00 39.60  ? 116  DT  C N1    1 
ATOM   336   C  C2    . DT  A 1 17  ? 38.103 55.421  64.808  1.00 37.24  ? 116  DT  C C2    1 
ATOM   337   O  O2    . DT  A 1 17  ? 38.538 54.748  63.894  1.00 45.84  ? 116  DT  C O2    1 
ATOM   338   N  N3    . DT  A 1 17  ? 38.922 56.184  65.594  1.00 24.03  ? 116  DT  C N3    1 
ATOM   339   C  C4    . DT  A 1 17  ? 38.544 57.005  66.639  1.00 34.20  ? 116  DT  C C4    1 
ATOM   340   O  O4    . DT  A 1 17  ? 39.399 57.582  67.311  1.00 31.65  ? 116  DT  C O4    1 
ATOM   341   C  C5    . DT  A 1 17  ? 37.126 57.095  66.871  1.00 29.03  ? 116  DT  C C5    1 
ATOM   342   C  C7    . DT  A 1 17  ? 36.628 58.012  67.941  1.00 63.49  ? 116  DT  C C7    1 
ATOM   343   C  C6    . DT  A 1 17  ? 36.314 56.346  66.116  1.00 32.69  ? 116  DT  C C6    1 
ATOM   344   P  P     . DG  A 1 18  ? 32.875 51.443  64.774  1.00 77.22  ? 117  DG  C P     1 
ATOM   345   O  OP1   . DG  A 1 18  ? 32.072 50.631  63.824  1.00 85.85  ? 117  DG  C OP1   1 
ATOM   346   O  OP2   . DG  A 1 18  ? 32.189 52.276  65.800  1.00 74.05  ? 117  DG  C OP2   1 
ATOM   347   O  "O5'" . DG  A 1 18  ? 33.873 50.480  65.541  1.00 82.61  ? 117  DG  C "O5'" 1 
ATOM   348   C  "C5'" . DG  A 1 18  ? 34.678 49.546  64.836  1.00 99.57  ? 117  DG  C "C5'" 1 
ATOM   349   C  "C4'" . DG  A 1 18  ? 35.495 48.743  65.818  1.00 105.52 ? 117  DG  C "C4'" 1 
ATOM   350   O  "O4'" . DG  A 1 18  ? 36.467 49.614  66.441  1.00 108.66 ? 117  DG  C "O4'" 1 
ATOM   351   C  "C3'" . DG  A 1 18  ? 34.658 48.164  66.955  1.00 105.36 ? 117  DG  C "C3'" 1 
ATOM   352   O  "O3'" . DG  A 1 18  ? 35.174 46.894  67.348  1.00 104.10 ? 117  DG  C "O3'" 1 
ATOM   353   C  "C2'" . DG  A 1 18  ? 34.802 49.197  68.057  1.00 108.43 ? 117  DG  C "C2'" 1 
ATOM   354   C  "C1'" . DG  A 1 18  ? 36.192 49.766  67.826  1.00 108.73 ? 117  DG  C "C1'" 1 
ATOM   355   N  N9    . DG  A 1 18  ? 36.314 51.185  68.140  1.00 104.38 ? 117  DG  C N9    1 
ATOM   356   C  C8    . DG  A 1 18  ? 35.336 52.145  68.055  1.00 100.84 ? 117  DG  C C8    1 
ATOM   357   N  N7    . DG  A 1 18  ? 35.753 53.333  68.393  1.00 100.14 ? 117  DG  C N7    1 
ATOM   358   C  C5    . DG  A 1 18  ? 37.085 53.142  68.726  1.00 97.73  ? 117  DG  C C5    1 
ATOM   359   C  C6    . DG  A 1 18  ? 38.058 54.065  69.175  1.00 94.61  ? 117  DG  C C6    1 
ATOM   360   O  O6    . DG  A 1 18  ? 37.932 55.275  69.393  1.00 95.75  ? 117  DG  C O6    1 
ATOM   361   N  N1    . DG  A 1 18  ? 39.284 53.448  69.383  1.00 85.17  ? 117  DG  C N1    1 
ATOM   362   C  C2    . DG  A 1 18  ? 39.535 52.114  69.202  1.00 89.28  ? 117  DG  C C2    1 
ATOM   363   N  N2    . DG  A 1 18  ? 40.776 51.701  69.467  1.00 63.49  ? 117  DG  C N2    1 
ATOM   364   N  N3    . DG  A 1 18  ? 38.635 51.244  68.794  1.00 99.07  ? 117  DG  C N3    1 
ATOM   365   C  C4    . DG  A 1 18  ? 37.443 51.822  68.575  1.00 101.19 ? 117  DG  C C4    1 
ATOM   366   P  P     . DT  A 1 19  ? 34.286 45.919  68.260  1.00 104.16 ? 118  DT  C P     1 
ATOM   367   O  OP1   . DT  A 1 19  ? 33.947 44.726  67.449  1.00 108.04 ? 118  DT  C OP1   1 
ATOM   368   O  OP2   . DT  A 1 19  ? 33.202 46.715  68.886  1.00 98.11  ? 118  DT  C OP2   1 
ATOM   369   O  "O5'" . DT  A 1 19  ? 35.317 45.488  69.389  1.00 103.72 ? 118  DT  C "O5'" 1 
ATOM   370   C  "C5'" . DT  A 1 19  ? 36.407 46.350  69.706  1.00 98.29  ? 118  DT  C "C5'" 1 
ATOM   371   C  "C4'" . DT  A 1 19  ? 37.020 45.982  71.036  1.00 98.71  ? 118  DT  C "C4'" 1 
ATOM   372   O  "O4'" . DT  A 1 19  ? 37.676 47.171  71.528  1.00 96.38  ? 118  DT  C "O4'" 1 
ATOM   373   C  "C3'" . DT  A 1 19  ? 36.003 45.615  72.110  1.00 100.53 ? 118  DT  C "C3'" 1 
ATOM   374   O  "O3'" . DT  A 1 19  ? 36.647 44.830  73.117  1.00 103.73 ? 118  DT  C "O3'" 1 
ATOM   375   C  "C2'" . DT  A 1 19  ? 35.633 46.964  72.686  1.00 99.12  ? 118  DT  C "C2'" 1 
ATOM   376   C  "C1'" . DT  A 1 19  ? 36.963 47.698  72.637  1.00 97.91  ? 118  DT  C "C1'" 1 
ATOM   377   N  N1    . DT  A 1 19  ? 36.847 49.156  72.449  1.00 92.93  ? 118  DT  C N1    1 
ATOM   378   C  C2    . DT  A 1 19  ? 37.972 49.922  72.633  1.00 85.65  ? 118  DT  C C2    1 
ATOM   379   O  O2    . DT  A 1 19  ? 39.063 49.449  72.904  1.00 76.29  ? 118  DT  C O2    1 
ATOM   380   N  N3    . DT  A 1 19  ? 37.772 51.268  72.482  1.00 79.19  ? 118  DT  C N3    1 
ATOM   381   C  C4    . DT  A 1 19  ? 36.589 51.906  72.172  1.00 81.97  ? 118  DT  C C4    1 
ATOM   382   O  O4    . DT  A 1 19  ? 36.554 53.126  72.093  1.00 72.72  ? 118  DT  C O4    1 
ATOM   383   C  C5    . DT  A 1 19  ? 35.460 51.045  71.973  1.00 87.06  ? 118  DT  C C5    1 
ATOM   384   C  C7    . DT  A 1 19  ? 34.144 51.655  71.624  1.00 57.12  ? 118  DT  C C7    1 
ATOM   385   C  C6    . DT  A 1 19  ? 35.639 49.730  72.115  1.00 91.19  ? 118  DT  C C6    1 
ATOM   386   P  P     . DA  A 1 20  ? 36.765 43.241  72.944  1.00 103.94 ? 119  DA  C P     1 
ATOM   387   O  OP1   . DA  A 1 20  ? 36.111 42.829  71.680  1.00 105.24 ? 119  DA  C OP1   1 
ATOM   388   O  OP2   . DA  A 1 20  ? 36.314 42.645  74.226  1.00 99.47  ? 119  DA  C OP2   1 
ATOM   389   O  "O5'" . DA  A 1 20  ? 38.334 43.001  72.803  1.00 105.27 ? 119  DA  C "O5'" 1 
ATOM   390   C  "C5'" . DA  A 1 20  ? 39.035 42.271  73.803  1.00 103.66 ? 119  DA  C "C5'" 1 
ATOM   391   C  "C4'" . DA  A 1 20  ? 40.179 43.087  74.358  1.00 100.14 ? 119  DA  C "C4'" 1 
ATOM   392   O  "O4'" . DA  A 1 20  ? 39.805 44.483  74.448  1.00 93.26  ? 119  DA  C "O4'" 1 
ATOM   393   C  "C3'" . DA  A 1 20  ? 40.576 42.666  75.773  1.00 103.68 ? 119  DA  C "C3'" 1 
ATOM   394   O  "O3'" . DA  A 1 20  ? 41.998 42.755  75.949  1.00 106.46 ? 119  DA  C "O3'" 1 
ATOM   395   C  "C2'" . DA  A 1 20  ? 39.819 43.656  76.647  1.00 99.52  ? 119  DA  C "C2'" 1 
ATOM   396   C  "C1'" . DA  A 1 20  ? 39.849 44.921  75.802  1.00 90.88  ? 119  DA  C "C1'" 1 
ATOM   397   N  N9    . DA  A 1 20  ? 38.732 45.849  76.001  1.00 76.81  ? 119  DA  C N9    1 
ATOM   398   C  C8    . DA  A 1 20  ? 37.395 45.554  76.119  1.00 73.12  ? 119  DA  C C8    1 
ATOM   399   N  N7    . DA  A 1 20  ? 36.622 46.613  76.185  1.00 69.41  ? 119  DA  C N7    1 
ATOM   400   C  C5    . DA  A 1 20  ? 37.511 47.677  76.126  1.00 67.76  ? 119  DA  C C5    1 
ATOM   401   C  C6    . DA  A 1 20  ? 37.319 49.070  76.118  1.00 65.97  ? 119  DA  C C6    1 
ATOM   402   N  N6    . DA  A 1 20  ? 36.122 49.649  76.131  1.00 52.59  ? 119  DA  C N6    1 
ATOM   403   N  N1    . DA  A 1 20  ? 38.413 49.857  76.075  1.00 73.08  ? 119  DA  C N1    1 
ATOM   404   C  C2    . DA  A 1 20  ? 39.618 49.273  76.021  1.00 77.95  ? 119  DA  C C2    1 
ATOM   405   N  N3    . DA  A 1 20  ? 39.929 47.974  75.995  1.00 74.79  ? 119  DA  C N3    1 
ATOM   406   C  C4    . DA  A 1 20  ? 38.816 47.221  76.049  1.00 72.59  ? 119  DA  C C4    1 
ATOM   407   P  P     . DT  A 1 21  ? 42.679 42.151  77.276  1.00 107.39 ? 120  DT  C P     1 
ATOM   408   O  OP1   . DT  A 1 21  ? 43.872 41.362  76.881  1.00 107.73 ? 120  DT  C OP1   1 
ATOM   409   O  OP2   . DT  A 1 21  ? 41.597 41.503  78.069  1.00 102.77 ? 120  DT  C OP2   1 
ATOM   410   O  "O5'" . DT  A 1 21  ? 43.164 43.455  78.053  1.00 107.77 ? 120  DT  C "O5'" 1 
ATOM   411   C  "C5'" . DT  A 1 21  ? 42.313 44.588  78.092  1.00 95.76  ? 120  DT  C "C5'" 1 
ATOM   412   C  "C4'" . DT  A 1 21  ? 42.849 45.670  78.997  1.00 82.38  ? 120  DT  C "C4'" 1 
ATOM   413   O  "O4'" . DT  A 1 21  ? 41.766 46.614  79.114  1.00 68.64  ? 120  DT  C "O4'" 1 
ATOM   414   C  "C3'" . DT  A 1 21  ? 43.145 45.255  80.433  1.00 80.05  ? 120  DT  C "C3'" 1 
ATOM   415   O  "O3'" . DT  A 1 21  ? 43.907 46.303  81.050  1.00 74.20  ? 120  DT  C "O3'" 1 
ATOM   416   C  "C2'" . DT  A 1 21  ? 41.759 45.263  81.043  1.00 80.75  ? 120  DT  C "C2'" 1 
ATOM   417   C  "C1'" . DT  A 1 21  ? 41.140 46.485  80.379  1.00 74.23  ? 120  DT  C "C1'" 1 
ATOM   418   N  N1    . DT  A 1 21  ? 39.698 46.388  80.139  1.00 72.09  ? 120  DT  C N1    1 
ATOM   419   C  C2    . DT  A 1 21  ? 39.017 47.541  79.834  1.00 66.57  ? 120  DT  C C2    1 
ATOM   420   O  O2    . DT  A 1 21  ? 39.554 48.639  79.760  1.00 62.48  ? 120  DT  C O2    1 
ATOM   421   N  N3    . DT  A 1 21  ? 37.676 47.364  79.616  1.00 58.71  ? 120  DT  C N3    1 
ATOM   422   C  C4    . DT  A 1 21  ? 36.972 46.178  79.675  1.00 61.40  ? 120  DT  C C4    1 
ATOM   423   O  O4    . DT  A 1 21  ? 35.769 46.167  79.455  1.00 54.39  ? 120  DT  C O4    1 
ATOM   424   C  C5    . DT  A 1 21  ? 37.747 45.018  80.002  1.00 69.46  ? 120  DT  C C5    1 
ATOM   425   C  C7    . DT  A 1 21  ? 37.057 43.693  80.091  1.00 63.49  ? 120  DT  C C7    1 
ATOM   426   C  C6    . DT  A 1 21  ? 39.056 45.175  80.214  1.00 72.99  ? 120  DT  C C6    1 
ATOM   427   P  P     . DG  A 1 22  ? 45.450 46.080  81.416  1.00 75.05  ? 121  DG  C P     1 
ATOM   428   O  OP1   . DG  A 1 22  ? 46.190 45.671  80.190  1.00 72.71  ? 121  DG  C OP1   1 
ATOM   429   O  OP2   . DG  A 1 22  ? 45.518 45.244  82.638  1.00 71.18  ? 121  DG  C OP2   1 
ATOM   430   O  "O5'" . DG  A 1 22  ? 45.927 47.543  81.792  1.00 72.52  ? 121  DG  C "O5'" 1 
ATOM   431   C  "C5'" . DG  A 1 22  ? 45.957 48.559  80.803  1.00 66.63  ? 121  DG  C "C5'" 1 
ATOM   432   C  "C4'" . DG  A 1 22  ? 45.317 49.815  81.341  1.00 63.14  ? 121  DG  C "C4'" 1 
ATOM   433   O  "O4'" . DG  A 1 22  ? 43.887 49.635  81.487  1.00 61.26  ? 121  DG  C "O4'" 1 
ATOM   434   C  "C3'" . DG  A 1 22  ? 45.826 50.236  82.715  1.00 63.97  ? 121  DG  C "C3'" 1 
ATOM   435   O  "O3'" . DG  A 1 22  ? 45.900 51.659  82.753  1.00 66.63  ? 121  DG  C "O3'" 1 
ATOM   436   C  "C2'" . DG  A 1 22  ? 44.738 49.735  83.650  1.00 59.15  ? 121  DG  C "C2'" 1 
ATOM   437   C  "C1'" . DG  A 1 22  ? 43.499 49.961  82.810  1.00 54.65  ? 121  DG  C "C1'" 1 
ATOM   438   N  N9    . DG  A 1 22  ? 42.335 49.148  83.143  1.00 49.98  ? 121  DG  C N9    1 
ATOM   439   C  C8    . DG  A 1 22  ? 42.317 47.872  83.647  1.00 53.03  ? 121  DG  C C8    1 
ATOM   440   N  N7    . DG  A 1 22  ? 41.110 47.389  83.781  1.00 42.74  ? 121  DG  C N7    1 
ATOM   441   C  C5    . DG  A 1 22  ? 40.284 48.413  83.351  1.00 46.19  ? 121  DG  C C5    1 
ATOM   442   C  C6    . DG  A 1 22  ? 38.875 48.471  83.253  1.00 50.56  ? 121  DG  C C6    1 
ATOM   443   O  O6    . DG  A 1 22  ? 38.053 47.592  83.509  1.00 54.00  ? 121  DG  C O6    1 
ATOM   444   N  N1    . DG  A 1 22  ? 38.443 49.709  82.792  1.00 41.88  ? 121  DG  C N1    1 
ATOM   445   C  C2    . DG  A 1 22  ? 39.266 50.757  82.455  1.00 26.76  ? 121  DG  C C2    1 
ATOM   446   N  N2    . DG  A 1 22  ? 38.661 51.883  82.049  1.00 63.49  ? 121  DG  C N2    1 
ATOM   447   N  N3    . DG  A 1 22  ? 40.588 50.707  82.518  1.00 44.19  ? 121  DG  C N3    1 
ATOM   448   C  C4    . DG  A 1 22  ? 41.024 49.514  82.974  1.00 50.55  ? 121  DG  C C4    1 
ATOM   449   P  P     . DC  A 1 23  ? 46.493 52.389  84.046  1.00 68.75  ? 122  DC  C P     1 
ATOM   450   O  OP1   . DC  A 1 23  ? 47.587 53.278  83.580  1.00 73.11  ? 122  DC  C OP1   1 
ATOM   451   O  OP2   . DC  A 1 23  ? 46.757 51.364  85.093  1.00 62.04  ? 122  DC  C OP2   1 
ATOM   452   O  "O5'" . DC  A 1 23  ? 45.295 53.316  84.527  1.00 59.42  ? 122  DC  C "O5'" 1 
ATOM   453   C  "C5'" . DC  A 1 23  ? 44.789 54.303  83.647  1.00 49.21  ? 122  DC  C "C5'" 1 
ATOM   454   C  "C4'" . DC  A 1 23  ? 43.321 54.557  83.901  1.00 47.88  ? 122  DC  C "C4'" 1 
ATOM   455   O  "O4'" . DC  A 1 23  ? 42.617 53.301  84.066  1.00 52.50  ? 122  DC  C "O4'" 1 
ATOM   456   C  "C3'" . DC  A 1 23  ? 42.950 55.413  85.111  1.00 39.10  ? 122  DC  C "C3'" 1 
ATOM   457   O  "O3'" . DC  A 1 23  ? 41.955 56.344  84.683  1.00 34.09  ? 122  DC  C "O3'" 1 
ATOM   458   C  "C2'" . DC  A 1 23  ? 42.330 54.413  86.067  1.00 41.29  ? 122  DC  C "C2'" 1 
ATOM   459   C  "C1'" . DC  A 1 23  ? 41.679 53.446  85.107  1.00 45.01  ? 122  DC  C "C1'" 1 
ATOM   460   N  N1    . DC  A 1 23  ? 41.351 52.107  85.627  1.00 41.88  ? 122  DC  C N1    1 
ATOM   461   C  C2    . DC  A 1 23  ? 40.015 51.715  85.645  1.00 41.84  ? 122  DC  C C2    1 
ATOM   462   O  O2    . DC  A 1 23  ? 39.163 52.502  85.234  1.00 48.77  ? 122  DC  C O2    1 
ATOM   463   N  N3    . DC  A 1 23  ? 39.684 50.493  86.106  1.00 35.60  ? 122  DC  C N3    1 
ATOM   464   C  C4    . DC  A 1 23  ? 40.633 49.671  86.544  1.00 32.06  ? 122  DC  C C4    1 
ATOM   465   N  N4    . DC  A 1 23  ? 40.259 48.473  86.984  1.00 27.71  ? 122  DC  C N4    1 
ATOM   466   C  C5    . DC  A 1 23  ? 42.010 50.042  86.546  1.00 42.30  ? 122  DC  C C5    1 
ATOM   467   C  C6    . DC  A 1 23  ? 42.322 51.261  86.079  1.00 38.53  ? 122  DC  C C6    1 
ATOM   468   P  P     . DT  A 1 24  ? 41.737 57.723  85.483  1.00 38.49  ? 123  DT  C P     1 
ATOM   469   O  OP1   . DT  A 1 24  ? 41.675 58.813  84.470  1.00 34.90  ? 123  DT  C OP1   1 
ATOM   470   O  OP2   . DT  A 1 24  ? 42.697 57.815  86.602  1.00 28.58  ? 123  DT  C OP2   1 
ATOM   471   O  "O5'" . DT  A 1 24  ? 40.301 57.537  86.143  1.00 42.26  ? 123  DT  C "O5'" 1 
ATOM   472   C  "C5'" . DT  A 1 24  ? 39.161 57.240  85.339  1.00 31.02  ? 123  DT  C "C5'" 1 
ATOM   473   C  "C4'" . DT  A 1 24  ? 37.989 56.844  86.206  1.00 28.74  ? 123  DT  C "C4'" 1 
ATOM   474   O  "O4'" . DT  A 1 24  ? 38.065 55.449  86.588  1.00 33.69  ? 123  DT  C "O4'" 1 
ATOM   475   C  "C3'" . DT  A 1 24  ? 37.820 57.641  87.502  1.00 27.61  ? 123  DT  C "C3'" 1 
ATOM   476   O  "O3'" . DT  A 1 24  ? 36.447 57.953  87.679  1.00 37.66  ? 123  DT  C "O3'" 1 
ATOM   477   C  "C2'" . DT  A 1 24  ? 38.228 56.643  88.571  1.00 20.47  ? 123  DT  C "C2'" 1 
ATOM   478   C  "C1'" . DT  A 1 24  ? 37.744 55.345  87.960  1.00 24.34  ? 123  DT  C "C1'" 1 
ATOM   479   N  N1    . DT  A 1 24  ? 38.326 54.095  88.489  1.00 26.43  ? 123  DT  C N1    1 
ATOM   480   C  C2    . DT  A 1 24  ? 37.452 53.071  88.735  1.00 30.38  ? 123  DT  C C2    1 
ATOM   481   O  O2    . DT  A 1 24  ? 36.262 53.167  88.551  1.00 39.73  ? 123  DT  C O2    1 
ATOM   482   N  N3    . DT  A 1 24  ? 38.024 51.927  89.211  1.00 27.01  ? 123  DT  C N3    1 
ATOM   483   C  C4    . DT  A 1 24  ? 39.369 51.706  89.459  1.00 29.89  ? 123  DT  C C4    1 
ATOM   484   O  O4    . DT  A 1 24  ? 39.751 50.608  89.857  1.00 29.15  ? 123  DT  C O4    1 
ATOM   485   C  C5    . DT  A 1 24  ? 40.234 52.824  89.199  1.00 26.42  ? 123  DT  C C5    1 
ATOM   486   C  C7    . DT  A 1 24  ? 41.696 52.673  89.464  1.00 57.12  ? 123  DT  C C7    1 
ATOM   487   C  C6    . DT  A 1 24  ? 39.678 53.953  88.728  1.00 29.32  ? 123  DT  C C6    1 
ATOM   488   P  P     . DA  A 1 25  ? 36.016 59.294  88.455  1.00 47.32  ? 124  DA  C P     1 
ATOM   489   O  OP1   . DA  A 1 25  ? 35.871 60.415  87.488  1.00 47.81  ? 124  DA  C OP1   1 
ATOM   490   O  OP2   . DA  A 1 25  ? 36.862 59.470  89.666  1.00 39.69  ? 124  DA  C OP2   1 
ATOM   491   O  "O5'" . DA  A 1 25  ? 34.572 58.915  88.987  1.00 40.76  ? 124  DA  C "O5'" 1 
ATOM   492   C  "C5'" . DA  A 1 25  ? 34.452 57.932  89.998  1.00 41.30  ? 124  DA  C "C5'" 1 
ATOM   493   C  "C4'" . DA  A 1 25  ? 33.241 57.060  89.769  1.00 36.50  ? 124  DA  C "C4'" 1 
ATOM   494   O  "O4'" . DA  A 1 25  ? 33.718 55.728  89.460  1.00 36.87  ? 124  DA  C "O4'" 1 
ATOM   495   C  "C3'" . DA  A 1 25  ? 32.457 56.942  91.069  1.00 40.05  ? 124  DA  C "C3'" 1 
ATOM   496   O  "O3'" . DA  A 1 25  ? 31.060 57.097  90.944  1.00 35.67  ? 124  DA  C "O3'" 1 
ATOM   497   C  "C2'" . DA  A 1 25  ? 32.854 55.612  91.671  1.00 46.63  ? 124  DA  C "C2'" 1 
ATOM   498   C  "C1'" . DA  A 1 25  ? 33.550 54.841  90.564  1.00 41.26  ? 124  DA  C "C1'" 1 
ATOM   499   N  N9    . DA  A 1 25  ? 34.880 54.422  91.013  1.00 32.12  ? 124  DA  C N9    1 
ATOM   500   C  C8    . DA  A 1 25  ? 36.036 55.146  90.917  1.00 30.52  ? 124  DA  C C8    1 
ATOM   501   N  N7    . DA  A 1 25  ? 37.081 54.545  91.428  1.00 35.42  ? 124  DA  C N7    1 
ATOM   502   C  C5    . DA  A 1 25  ? 36.578 53.341  91.890  1.00 34.94  ? 124  DA  C C5    1 
ATOM   503   C  C6    . DA  A 1 25  ? 37.185 52.262  92.530  1.00 38.45  ? 124  DA  C C6    1 
ATOM   504   N  N6    . DA  A 1 25  ? 38.480 52.220  92.830  1.00 42.80  ? 124  DA  C N6    1 
ATOM   505   N  N1    . DA  A 1 25  ? 36.413 51.212  92.855  1.00 40.20  ? 124  DA  C N1    1 
ATOM   506   C  C2    . DA  A 1 25  ? 35.116 51.258  92.549  1.00 27.80  ? 124  DA  C C2    1 
ATOM   507   N  N3    . DA  A 1 25  ? 34.429 52.217  91.951  1.00 25.54  ? 124  DA  C N3    1 
ATOM   508   C  C4    . DA  A 1 25  ? 35.227 53.247  91.639  1.00 30.25  ? 124  DA  C C4    1 
ATOM   509   P  P     . DT  A 1 26  ? 30.243 57.586  92.224  1.00 41.48  ? 125  DT  C P     1 
ATOM   510   O  OP1   . DT  A 1 26  ? 29.013 58.282  91.787  1.00 34.22  ? 125  DT  C OP1   1 
ATOM   511   O  OP2   . DT  A 1 26  ? 31.205 58.286  93.109  1.00 31.89  ? 125  DT  C OP2   1 
ATOM   512   O  "O5'" . DT  A 1 26  ? 29.867 56.215  92.924  1.00 36.61  ? 125  DT  C "O5'" 1 
ATOM   513   C  "C5'" . DT  A 1 26  ? 29.376 55.147  92.138  1.00 28.26  ? 125  DT  C "C5'" 1 
ATOM   514   C  "C4'" . DT  A 1 26  ? 29.429 53.850  92.904  1.00 31.01  ? 125  DT  C "C4'" 1 
ATOM   515   O  "O4'" . DT  A 1 26  ? 30.803 53.453  93.097  1.00 33.14  ? 125  DT  C "O4'" 1 
ATOM   516   C  "C3'" . DT  A 1 26  ? 28.776 53.822  94.284  1.00 29.40  ? 125  DT  C "C3'" 1 
ATOM   517   O  "O3'" . DT  A 1 26  ? 28.041 52.604  94.392  1.00 30.55  ? 125  DT  C "O3'" 1 
ATOM   518   C  "C2'" . DT  A 1 26  ? 29.969 53.780  95.222  1.00 29.12  ? 125  DT  C "C2'" 1 
ATOM   519   C  "C1'" . DT  A 1 26  ? 30.965 52.984  94.413  1.00 27.80  ? 125  DT  C "C1'" 1 
ATOM   520   N  N1    . DT  A 1 26  ? 32.384 53.142  94.762  1.00 32.28  ? 125  DT  C N1    1 
ATOM   521   C  C2    . DT  A 1 26  ? 33.049 52.055  95.262  1.00 35.81  ? 125  DT  C C2    1 
ATOM   522   O  O2    . DT  A 1 26  ? 32.506 50.985  95.487  1.00 31.21  ? 125  DT  C O2    1 
ATOM   523   N  N3    . DT  A 1 26  ? 34.383 52.264  95.488  1.00 39.20  ? 125  DT  C N3    1 
ATOM   524   C  C4    . DT  A 1 26  ? 35.090 53.425  95.273  1.00 40.97  ? 125  DT  C C4    1 
ATOM   525   O  O4    . DT  A 1 26  ? 36.282 53.461  95.495  1.00 51.82  ? 125  DT  C O4    1 
ATOM   526   C  C5    . DT  A 1 26  ? 34.333 54.523  94.782  1.00 35.22  ? 125  DT  C C5    1 
ATOM   527   C  C7    . DT  A 1 26  ? 35.031 55.823  94.543  1.00 57.12  ? 125  DT  C C7    1 
ATOM   528   C  C6    . DT  A 1 26  ? 33.029 54.337  94.557  1.00 34.86  ? 125  DT  C C6    1 
ATOM   529   P  P     . DA  A 1 27  ? 27.125 52.328  95.675  1.00 36.79  ? 126  DA  C P     1 
ATOM   530   O  OP1   . DA  A 1 27  ? 25.716 52.284  95.254  1.00 38.94  ? 126  DA  C OP1   1 
ATOM   531   O  OP2   . DA  A 1 27  ? 27.525 53.268  96.741  1.00 33.24  ? 126  DA  C OP2   1 
ATOM   532   O  "O5'" . DA  A 1 27  ? 27.565 50.862  96.106  1.00 21.22  ? 126  DA  C "O5'" 1 
ATOM   533   C  "C5'" . DA  A 1 27  ? 28.913 50.618  96.467  1.00 10.77  ? 126  DA  C "C5'" 1 
ATOM   534   C  "C4'" . DA  A 1 27  ? 29.004 49.510  97.484  1.00 23.50  ? 126  DA  C "C4'" 1 
ATOM   535   O  "O4'" . DA  A 1 27  ? 30.360 49.478  97.956  1.00 31.67  ? 126  DA  C "O4'" 1 
ATOM   536   C  "C3'" . DA  A 1 27  ? 28.189 49.778  98.730  1.00 29.65  ? 126  DA  C "C3'" 1 
ATOM   537   O  "O3'" . DA  A 1 27  ? 28.006 48.548  99.415  1.00 32.61  ? 126  DA  C "O3'" 1 
ATOM   538   C  "C2'" . DA  A 1 27  ? 29.090 50.704  99.514  1.00 33.44  ? 126  DA  C "C2'" 1 
ATOM   539   C  "C1'" . DA  A 1 27  ? 30.468 50.175  99.193  1.00 31.83  ? 126  DA  C "C1'" 1 
ATOM   540   N  N9    . DA  A 1 27  ? 31.477 51.216  99.013  1.00 32.31  ? 126  DA  C N9    1 
ATOM   541   C  C8    . DA  A 1 27  ? 31.355 52.420  98.362  1.00 38.36  ? 126  DA  C C8    1 
ATOM   542   N  N7    . DA  A 1 27  ? 32.481 53.086  98.268  1.00 41.78  ? 126  DA  C N7    1 
ATOM   543   C  C5    . DA  A 1 27  ? 33.398 52.278  98.926  1.00 40.43  ? 126  DA  C C5    1 
ATOM   544   C  C6    . DA  A 1 27  ? 34.774 52.401  99.150  1.00 39.45  ? 126  DA  C C6    1 
ATOM   545   N  N6    . DA  A 1 27  ? 35.507 53.430  98.726  1.00 44.53  ? 126  DA  C N6    1 
ATOM   546   N  N1    . DA  A 1 27  ? 35.386 51.415  99.830  1.00 35.26  ? 126  DA  C N1    1 
ATOM   547   C  C2    . DA  A 1 27  ? 34.653 50.382  100.261 1.00 33.20  ? 126  DA  C C2    1 
ATOM   548   N  N3    . DA  A 1 27  ? 33.359 50.152  100.113 1.00 29.19  ? 126  DA  C N3    1 
ATOM   549   C  C4    . DA  A 1 27  ? 32.784 51.143  99.420  1.00 34.60  ? 126  DA  C C4    1 
ATOM   550   P  P     . DC  A 1 28  ? 27.101 48.501  100.727 1.00 36.58  ? 127  DC  C P     1 
ATOM   551   O  OP1   . DC  A 1 28  ? 26.689 47.106  100.983 1.00 36.07  ? 127  DC  C OP1   1 
ATOM   552   O  OP2   . DC  A 1 28  ? 26.067 49.556  100.569 1.00 35.71  ? 127  DC  C OP2   1 
ATOM   553   O  "O5'" . DC  A 1 28  ? 28.110 48.902  101.878 1.00 42.80  ? 127  DC  C "O5'" 1 
ATOM   554   C  "C5'" . DC  A 1 28  ? 29.030 47.950  102.369 1.00 39.64  ? 127  DC  C "C5'" 1 
ATOM   555   C  "C4'" . DC  A 1 28  ? 29.785 48.520  103.544 1.00 42.39  ? 127  DC  C "C4'" 1 
ATOM   556   O  "O4'" . DC  A 1 28  ? 30.824 49.444  103.121 1.00 41.91  ? 127  DC  C "O4'" 1 
ATOM   557   C  "C3'" . DC  A 1 28  ? 28.918 49.283  104.541 1.00 37.35  ? 127  DC  C "C3'" 1 
ATOM   558   O  "O3'" . DC  A 1 28  ? 29.431 49.032  105.844 1.00 40.19  ? 127  DC  C "O3'" 1 
ATOM   559   C  "C2'" . DC  A 1 28  ? 29.211 50.725  104.178 1.00 38.35  ? 127  DC  C "C2'" 1 
ATOM   560   C  "C1'" . DC  A 1 28  ? 30.691 50.626  103.879 1.00 35.74  ? 127  DC  C "C1'" 1 
ATOM   561   N  N1    . DC  A 1 28  ? 31.292 51.732  103.126 1.00 37.01  ? 127  DC  C N1    1 
ATOM   562   C  C2    . DC  A 1 28  ? 32.684 51.858  103.123 1.00 36.60  ? 127  DC  C C2    1 
ATOM   563   O  O2    . DC  A 1 28  ? 33.357 51.044  103.764 1.00 23.00  ? 127  DC  C O2    1 
ATOM   564   N  N3    . DC  A 1 28  ? 33.259 52.865  102.429 1.00 29.67  ? 127  DC  C N3    1 
ATOM   565   C  C4    . DC  A 1 28  ? 32.495 53.727  101.764 1.00 32.41  ? 127  DC  C C4    1 
ATOM   566   N  N4    . DC  A 1 28  ? 33.093 54.696  101.090 1.00 41.04  ? 127  DC  C N4    1 
ATOM   567   C  C5    . DC  A 1 28  ? 31.077 53.630  101.759 1.00 37.01  ? 127  DC  C C5    1 
ATOM   568   C  C6    . DC  A 1 28  ? 30.521 52.624  102.446 1.00 35.14  ? 127  DC  C C6    1 
ATOM   569   P  P     . DG  A 1 29  ? 28.445 48.636  107.036 1.00 44.48  ? 128  DG  C P     1 
ATOM   570   O  OP1   . DG  A 1 29  ? 27.813 47.327  106.734 1.00 28.22  ? 128  DG  C OP1   1 
ATOM   571   O  OP2   . DG  A 1 29  ? 27.609 49.827  107.329 1.00 44.71  ? 128  DG  C OP2   1 
ATOM   572   O  "O5'" . DG  A 1 29  ? 29.439 48.411  108.248 1.00 49.72  ? 128  DG  C "O5'" 1 
ATOM   573   C  "C5'" . DG  A 1 29  ? 30.473 47.444  108.138 1.00 51.43  ? 128  DG  C "C5'" 1 
ATOM   574   C  "C4'" . DG  A 1 29  ? 31.767 47.987  108.695 1.00 53.18  ? 128  DG  C "C4'" 1 
ATOM   575   O  "O4'" . DG  A 1 29  ? 32.283 49.056  107.866 1.00 53.57  ? 128  DG  C "O4'" 1 
ATOM   576   C  "C3'" . DG  A 1 29  ? 31.660 48.554  110.102 1.00 54.16  ? 128  DG  C "C3'" 1 
ATOM   577   O  "O3'" . DG  A 1 29  ? 32.775 48.089  110.858 1.00 60.65  ? 128  DG  C "O3'" 1 
ATOM   578   C  "C2'" . DG  A 1 29  ? 31.689 50.060  109.887 1.00 50.81  ? 128  DG  C "C2'" 1 
ATOM   579   C  "C1'" . DG  A 1 29  ? 32.550 50.213  108.647 1.00 41.18  ? 128  DG  C "C1'" 1 
ATOM   580   N  N9    . DG  A 1 29  ? 32.258 51.383  107.815 1.00 38.52  ? 128  DG  C N9    1 
ATOM   581   C  C8    . DG  A 1 29  ? 31.022 51.788  107.377 1.00 37.31  ? 128  DG  C C8    1 
ATOM   582   N  N7    . DG  A 1 29  ? 31.071 52.827  106.589 1.00 30.55  ? 128  DG  C N7    1 
ATOM   583   C  C5    . DG  A 1 29  ? 32.417 53.138  106.506 1.00 26.00  ? 128  DG  C C5    1 
ATOM   584   C  C6    . DG  A 1 29  ? 33.077 54.162  105.777 1.00 29.28  ? 128  DG  C C6    1 
ATOM   585   O  O6    . DG  A 1 29  ? 32.594 55.003  105.008 1.00 30.85  ? 128  DG  C O6    1 
ATOM   586   N  N1    . DG  A 1 29  ? 34.445 54.148  106.000 1.00 31.30  ? 128  DG  C N1    1 
ATOM   587   C  C2    . DG  A 1 29  ? 35.101 53.259  106.801 1.00 32.92  ? 128  DG  C C2    1 
ATOM   588   N  N2    . DG  A 1 29  ? 36.418 53.443  106.901 1.00 23.79  ? 128  DG  C N2    1 
ATOM   589   N  N3    . DG  A 1 29  ? 34.505 52.272  107.463 1.00 34.87  ? 128  DG  C N3    1 
ATOM   590   C  C4    . DG  A 1 29  ? 33.167 52.276  107.274 1.00 30.66  ? 128  DG  C C4    1 
ATOM   591   P  P     . DA  A 1 30  ? 32.815 48.319  112.441 1.00 66.23  ? 129  DA  C P     1 
ATOM   592   O  OP1   . DA  A 1 30  ? 33.549 47.180  113.050 1.00 63.79  ? 129  DA  C OP1   1 
ATOM   593   O  OP2   . DA  A 1 30  ? 31.439 48.630  112.890 1.00 61.52  ? 129  DA  C OP2   1 
ATOM   594   O  "O5'" . DA  A 1 30  ? 33.720 49.620  112.567 1.00 58.46  ? 129  DA  C "O5'" 1 
ATOM   595   C  "C5'" . DA  A 1 30  ? 35.004 49.639  111.955 1.00 55.22  ? 129  DA  C "C5'" 1 
ATOM   596   C  "C4'" . DA  A 1 30  ? 35.620 51.014  112.043 1.00 60.04  ? 129  DA  C "C4'" 1 
ATOM   597   O  "O4'" . DA  A 1 30  ? 35.203 51.892  110.965 1.00 60.05  ? 129  DA  C "O4'" 1 
ATOM   598   C  "C3'" . DA  A 1 30  ? 35.353 51.766  113.344 1.00 65.80  ? 129  DA  C "C3'" 1 
ATOM   599   O  "O3'" . DA  A 1 30  ? 36.591 52.301  113.816 1.00 70.94  ? 129  DA  C "O3'" 1 
ATOM   600   C  "C2'" . DA  A 1 30  ? 34.418 52.885  112.912 1.00 53.84  ? 129  DA  C "C2'" 1 
ATOM   601   C  "C1'" . DA  A 1 30  ? 34.906 53.171  111.503 1.00 45.37  ? 129  DA  C "C1'" 1 
ATOM   602   N  N9    . DA  A 1 30  ? 33.933 53.834  110.627 1.00 30.98  ? 129  DA  C N9    1 
ATOM   603   C  C8    . DA  A 1 30  ? 32.587 53.577  110.524 1.00 38.00  ? 129  DA  C C8    1 
ATOM   604   N  N7    . DA  A 1 30  ? 31.966 54.340  109.653 1.00 26.16  ? 129  DA  C N7    1 
ATOM   605   C  C5    . DA  A 1 30  ? 32.967 55.154  109.155 1.00 22.84  ? 129  DA  C C5    1 
ATOM   606   C  C6    . DA  A 1 30  ? 32.946 56.168  108.204 1.00 23.93  ? 129  DA  C C6    1 
ATOM   607   N  N6    . DA  A 1 30  ? 31.835 56.560  107.586 1.00 27.86  ? 129  DA  C N6    1 
ATOM   608   N  N1    . DA  A 1 30  ? 34.113 56.779  107.903 1.00 24.81  ? 129  DA  C N1    1 
ATOM   609   C  C2    . DA  A 1 30  ? 35.218 56.384  108.545 1.00 24.12  ? 129  DA  C C2    1 
ATOM   610   N  N3    . DA  A 1 30  ? 35.361 55.441  109.478 1.00 19.92  ? 129  DA  C N3    1 
ATOM   611   C  C4    . DA  A 1 30  ? 34.183 54.854  109.739 1.00 24.13  ? 129  DA  C C4    1 
ATOM   612   P  P     . DA  A 1 31  ? 36.670 53.002  115.254 1.00 70.61  ? 130  DA  C P     1 
ATOM   613   O  OP1   . DA  A 1 31  ? 37.520 52.148  116.109 1.00 68.21  ? 130  DA  C OP1   1 
ATOM   614   O  OP2   . DA  A 1 31  ? 35.306 53.399  115.713 1.00 69.86  ? 130  DA  C OP2   1 
ATOM   615   O  "O5'" . DA  A 1 31  ? 37.480 54.314  114.911 1.00 60.87  ? 130  DA  C "O5'" 1 
ATOM   616   C  "C5'" . DA  A 1 31  ? 38.577 54.245  114.014 1.00 58.98  ? 130  DA  C "C5'" 1 
ATOM   617   C  "C4'" . DA  A 1 31  ? 38.898 55.624  113.500 1.00 61.20  ? 130  DA  C "C4'" 1 
ATOM   618   O  "O4'" . DA  A 1 31  ? 37.897 56.035  112.541 1.00 62.20  ? 130  DA  C "O4'" 1 
ATOM   619   C  "C3'" . DA  A 1 31  ? 38.870 56.668  114.609 1.00 65.66  ? 130  DA  C "C3'" 1 
ATOM   620   O  "O3'" . DA  A 1 31  ? 39.895 57.621  114.376 1.00 67.93  ? 130  DA  C "O3'" 1 
ATOM   621   C  "C2'" . DA  A 1 31  ? 37.492 57.291  114.471 1.00 65.04  ? 130  DA  C "C2'" 1 
ATOM   622   C  "C1'" . DA  A 1 31  ? 37.277 57.237  112.973 1.00 59.82  ? 130  DA  C "C1'" 1 
ATOM   623   N  N9    . DA  A 1 31  ? 35.878 57.201  112.549 1.00 47.16  ? 130  DA  C N9    1 
ATOM   624   C  C8    . DA  A 1 31  ? 34.875 56.359  112.964 1.00 42.62  ? 130  DA  C C8    1 
ATOM   625   N  N7    . DA  A 1 31  ? 33.715 56.596  112.394 1.00 31.60  ? 130  DA  C N7    1 
ATOM   626   C  C5    . DA  A 1 31  ? 33.974 57.666  111.554 1.00 30.15  ? 130  DA  C C5    1 
ATOM   627   C  C6    . DA  A 1 31  ? 33.154 58.401  110.696 1.00 30.96  ? 130  DA  C C6    1 
ATOM   628   N  N6    . DA  A 1 31  ? 31.862 58.154  110.536 1.00 24.46  ? 130  DA  C N6    1 
ATOM   629   N  N1    . DA  A 1 31  ? 33.714 59.415  109.999 1.00 31.33  ? 130  DA  C N1    1 
ATOM   630   C  C2    . DA  A 1 31  ? 35.025 59.654  110.164 1.00 36.62  ? 130  DA  C C2    1 
ATOM   631   N  N3    . DA  A 1 31  ? 35.905 59.028  110.947 1.00 34.27  ? 130  DA  C N3    1 
ATOM   632   C  C4    . DA  A 1 31  ? 35.304 58.040  111.628 1.00 35.53  ? 130  DA  C C4    1 
ATOM   633   P  P     . DG  A 1 32  ? 40.300 58.645  115.535 1.00 71.10  ? 131  DG  C P     1 
ATOM   634   O  OP1   . DG  A 1 32  ? 41.789 58.602  115.610 1.00 67.98  ? 131  DG  C OP1   1 
ATOM   635   O  OP2   . DG  A 1 32  ? 39.480 58.354  116.747 1.00 64.43  ? 131  DG  C OP2   1 
ATOM   636   O  "O5'" . DG  A 1 32  ? 39.842 60.051  114.943 1.00 68.84  ? 131  DG  C "O5'" 1 
ATOM   637   C  "C5'" . DG  A 1 32  ? 40.287 60.456  113.654 1.00 62.03  ? 131  DG  C "C5'" 1 
ATOM   638   C  "C4'" . DG  A 1 32  ? 39.457 61.605  113.138 1.00 60.50  ? 131  DG  C "C4'" 1 
ATOM   639   O  "O4'" . DG  A 1 32  ? 38.116 61.178  112.800 1.00 56.50  ? 131  DG  C "O4'" 1 
ATOM   640   C  "C3'" . DG  A 1 32  ? 39.295 62.786  114.094 1.00 65.04  ? 131  DG  C "C3'" 1 
ATOM   641   O  "O3'" . DG  A 1 32  ? 39.470 63.986  113.352 1.00 69.59  ? 131  DG  C "O3'" 1 
ATOM   642   C  "C2'" . DG  A 1 32  ? 37.846 62.686  114.540 1.00 57.55  ? 131  DG  C "C2'" 1 
ATOM   643   C  "C1'" . DG  A 1 32  ? 37.197 62.147  113.285 1.00 51.05  ? 131  DG  C "C1'" 1 
ATOM   644   N  N9    . DG  A 1 32  ? 35.894 61.506  113.456 1.00 45.83  ? 131  DG  C N9    1 
ATOM   645   C  C8    . DG  A 1 32  ? 35.605 60.416  114.237 1.00 42.62  ? 131  DG  C C8    1 
ATOM   646   N  N7    . DG  A 1 32  ? 34.349 60.062  114.179 1.00 31.81  ? 131  DG  C N7    1 
ATOM   647   C  C5    . DG  A 1 32  ? 33.773 60.974  113.313 1.00 35.37  ? 131  DG  C C5    1 
ATOM   648   C  C6    . DG  A 1 32  ? 32.444 61.088  112.881 1.00 37.58  ? 131  DG  C C6    1 
ATOM   649   O  O6    . DG  A 1 32  ? 31.477 60.377  113.189 1.00 34.97  ? 131  DG  C O6    1 
ATOM   650   N  N1    . DG  A 1 32  ? 32.280 62.156  112.000 1.00 28.74  ? 131  DG  C N1    1 
ATOM   651   C  C2    . DG  A 1 32  ? 33.280 62.993  111.585 1.00 30.95  ? 131  DG  C C2    1 
ATOM   652   N  N2    . DG  A 1 32  ? 32.918 63.943  110.714 1.00 30.33  ? 131  DG  C N2    1 
ATOM   653   N  N3    . DG  A 1 32  ? 34.537 62.898  111.990 1.00 28.41  ? 131  DG  C N3    1 
ATOM   654   C  C4    . DG  A 1 32  ? 34.709 61.874  112.852 1.00 37.43  ? 131  DG  C C4    1 
ATOM   655   P  P     . DT  A 1 33  ? 39.873 65.335  114.105 1.00 72.15  ? 132  DT  C P     1 
ATOM   656   O  OP1   . DT  A 1 33  ? 41.215 65.743  113.615 1.00 70.60  ? 132  DT  C OP1   1 
ATOM   657   O  OP2   . DT  A 1 33  ? 39.632 65.145  115.561 1.00 64.77  ? 132  DT  C OP2   1 
ATOM   658   O  "O5'" . DT  A 1 33  ? 38.800 66.367  113.563 1.00 67.77  ? 132  DT  C "O5'" 1 
ATOM   659   C  "C5'" . DT  A 1 33  ? 37.471 65.941  113.333 1.00 64.33  ? 132  DT  C "C5'" 1 
ATOM   660   C  "C4'" . DT  A 1 33  ? 36.680 67.055  112.699 1.00 59.31  ? 132  DT  C "C4'" 1 
ATOM   661   O  "O4'" . DT  A 1 33  ? 35.359 66.561  112.414 1.00 58.62  ? 132  DT  C "O4'" 1 
ATOM   662   C  "C3'" . DT  A 1 33  ? 36.480 68.253  113.613 1.00 69.72  ? 132  DT  C "C3'" 1 
ATOM   663   O  "O3'" . DT  A 1 33  ? 36.364 69.433  112.816 1.00 78.98  ? 132  DT  C "O3'" 1 
ATOM   664   C  "C2'" . DT  A 1 33  ? 35.188 67.920  114.332 1.00 64.22  ? 132  DT  C "C2'" 1 
ATOM   665   C  "C1'" . DT  A 1 33  ? 34.409 67.122  113.301 1.00 49.66  ? 132  DT  C "C1'" 1 
ATOM   666   N  N1    . DT  A 1 33  ? 33.621 66.008  113.860 1.00 36.15  ? 132  DT  C N1    1 
ATOM   667   C  C2    . DT  A 1 33  ? 32.296 65.945  113.522 1.00 38.03  ? 132  DT  C C2    1 
ATOM   668   O  O2    . DT  A 1 33  ? 31.756 66.761  112.775 1.00 42.03  ? 132  DT  C O2    1 
ATOM   669   N  N3    . DT  A 1 33  ? 31.617 64.888  114.080 1.00 33.17  ? 132  DT  C N3    1 
ATOM   670   C  C4    . DT  A 1 33  ? 32.122 63.922  114.915 1.00 35.85  ? 132  DT  C C4    1 
ATOM   671   O  O4    . DT  A 1 33  ? 31.388 63.051  115.349 1.00 34.46  ? 132  DT  C O4    1 
ATOM   672   C  C5    . DT  A 1 33  ? 33.513 64.039  115.219 1.00 37.21  ? 132  DT  C C5    1 
ATOM   673   C  C7    . DT  A 1 33  ? 34.135 63.016  116.114 1.00 57.12  ? 132  DT  C C7    1 
ATOM   674   C  C6    . DT  A 1 33  ? 34.192 65.064  114.685 1.00 30.79  ? 132  DT  C C6    1 
ATOM   675   P  P     . DT  A 1 34  ? 36.276 70.869  113.522 1.00 83.24  ? 133  DT  C P     1 
ATOM   676   O  OP1   . DT  A 1 34  ? 36.782 71.869  112.537 1.00 73.06  ? 133  DT  C OP1   1 
ATOM   677   O  OP2   . DT  A 1 34  ? 36.893 70.769  114.874 1.00 78.84  ? 133  DT  C OP2   1 
ATOM   678   O  "O5'" . DT  A 1 34  ? 34.714 71.093  113.716 1.00 74.49  ? 133  DT  C "O5'" 1 
ATOM   679   C  "C5'" . DT  A 1 34  ? 33.881 71.336  112.591 1.00 65.70  ? 133  DT  C "C5'" 1 
ATOM   680   C  "C4'" . DT  A 1 34  ? 32.447 71.480  113.032 1.00 62.20  ? 133  DT  C "C4'" 1 
ATOM   681   O  "O4'" . DT  A 1 34  ? 31.902 70.196  113.425 1.00 60.59  ? 133  DT  C "O4'" 1 
ATOM   682   C  "C3'" . DT  A 1 34  ? 32.278 72.392  114.245 1.00 72.83  ? 133  DT  C "C3'" 1 
ATOM   683   O  "O3'" . DT  A 1 34  ? 31.071 73.145  114.110 1.00 77.65  ? 133  DT  C "O3'" 1 
ATOM   684   C  "C2'" . DT  A 1 34  ? 32.116 71.401  115.381 1.00 66.78  ? 133  DT  C "C2'" 1 
ATOM   685   C  "C1'" . DT  A 1 34  ? 31.290 70.349  114.682 1.00 56.29  ? 133  DT  C "C1'" 1 
ATOM   686   N  N1    . DT  A 1 34  ? 31.210 69.038  115.340 1.00 49.75  ? 133  DT  C N1    1 
ATOM   687   C  C2    . DT  A 1 34  ? 30.024 68.373  115.240 1.00 46.92  ? 133  DT  C C2    1 
ATOM   688   O  O2    . DT  A 1 34  ? 29.098 68.771  114.551 1.00 34.13  ? 133  DT  C O2    1 
ATOM   689   N  N3    . DT  A 1 34  ? 29.958 67.217  115.963 1.00 45.04  ? 133  DT  C N3    1 
ATOM   690   C  C4    . DT  A 1 34  ? 30.951 66.662  116.734 1.00 48.14  ? 133  DT  C C4    1 
ATOM   691   O  O4    . DT  A 1 34  ? 30.738 65.634  117.364 1.00 51.92  ? 133  DT  C O4    1 
ATOM   692   C  C5    . DT  A 1 34  ? 32.191 67.373  116.740 1.00 41.74  ? 133  DT  C C5    1 
ATOM   693   C  C7    . DT  A 1 34  ? 33.344 66.800  117.504 1.00 57.12  ? 133  DT  C C7    1 
ATOM   694   C  C6    . DT  A 1 34  ? 32.261 68.518  116.055 1.00 41.72  ? 133  DT  C C6    1 
ATOM   695   P  P     . DA  A 1 35  ? 31.081 74.722  114.397 1.00 77.08  ? 134  DA  C P     1 
ATOM   696   O  OP1   . DA  A 1 35  ? 31.600 75.399  113.170 1.00 68.26  ? 134  DA  C OP1   1 
ATOM   697   O  OP2   . DA  A 1 35  ? 31.744 74.949  115.709 1.00 74.58  ? 134  DA  C OP2   1 
ATOM   698   O  "O5'" . DA  A 1 35  ? 29.537 75.065  114.560 1.00 73.46  ? 134  DA  C "O5'" 1 
ATOM   699   C  "C5'" . DA  A 1 35  ? 28.648 74.928  113.457 1.00 59.67  ? 134  DA  C "C5'" 1 
ATOM   700   C  "C4'" . DA  A 1 35  ? 27.395 74.203  113.885 1.00 52.49  ? 134  DA  C "C4'" 1 
ATOM   701   O  "O4'" . DA  A 1 35  ? 27.784 72.944  114.486 1.00 54.33  ? 134  DA  C "O4'" 1 
ATOM   702   C  "C3'" . DA  A 1 35  ? 26.532 74.909  114.929 1.00 53.10  ? 134  DA  C "C3'" 1 
ATOM   703   O  "O3'" . DA  A 1 35  ? 25.162 74.734  114.584 1.00 55.91  ? 134  DA  C "O3'" 1 
ATOM   704   C  "C2'" . DA  A 1 35  ? 26.853 74.174  116.223 1.00 49.23  ? 134  DA  C "C2'" 1 
ATOM   705   C  "C1'" . DA  A 1 35  ? 27.133 72.771  115.732 1.00 47.26  ? 134  DA  C "C1'" 1 
ATOM   706   N  N9    . DA  A 1 35  ? 28.008 71.953  116.571 1.00 42.22  ? 134  DA  C N9    1 
ATOM   707   C  C8    . DA  A 1 35  ? 29.329 72.179  116.843 1.00 41.32  ? 134  DA  C C8    1 
ATOM   708   N  N7    . DA  A 1 35  ? 29.883 71.252  117.589 1.00 37.46  ? 134  DA  C N7    1 
ATOM   709   C  C5    . DA  A 1 35  ? 28.856 70.361  117.828 1.00 38.36  ? 134  DA  C C5    1 
ATOM   710   C  C6    . DA  A 1 35  ? 28.808 69.159  118.541 1.00 45.34  ? 134  DA  C C6    1 
ATOM   711   N  N6    . DA  A 1 35  ? 29.867 68.623  119.149 1.00 49.30  ? 134  DA  C N6    1 
ATOM   712   N  N1    . DA  A 1 35  ? 27.626 68.508  118.602 1.00 47.29  ? 134  DA  C N1    1 
ATOM   713   C  C2    . DA  A 1 35  ? 26.578 69.035  117.962 1.00 42.12  ? 134  DA  C C2    1 
ATOM   714   N  N3    . DA  A 1 35  ? 26.504 70.156  117.241 1.00 38.42  ? 134  DA  C N3    1 
ATOM   715   C  C4    . DA  A 1 35  ? 27.690 70.783  117.218 1.00 39.39  ? 134  DA  C C4    1 
ATOM   716   P  P     . DT  A 1 36  ? 24.057 75.733  115.177 1.00 61.59  ? 135  DT  C P     1 
ATOM   717   O  OP1   . DT  A 1 36  ? 23.269 76.301  114.042 1.00 55.20  ? 135  DT  C OP1   1 
ATOM   718   O  OP2   . DT  A 1 36  ? 24.748 76.645  116.135 1.00 57.53  ? 135  DT  C OP2   1 
ATOM   719   O  "O5'" . DT  A 1 36  ? 23.100 74.782  116.018 1.00 51.50  ? 135  DT  C "O5'" 1 
ATOM   720   C  "C5'" . DT  A 1 36  ? 23.644 73.745  116.806 1.00 48.21  ? 135  DT  C "C5'" 1 
ATOM   721   C  "C4'" . DT  A 1 36  ? 22.572 72.747  117.158 1.00 55.53  ? 135  DT  C "C4'" 1 
ATOM   722   O  "O4'" . DT  A 1 36  ? 23.219 71.571  117.673 1.00 65.26  ? 135  DT  C "O4'" 1 
ATOM   723   C  "C3'" . DT  A 1 36  ? 21.616 73.200  118.251 1.00 62.80  ? 135  DT  C "C3'" 1 
ATOM   724   O  "O3'" . DT  A 1 36  ? 20.358 72.533  118.088 1.00 70.48  ? 135  DT  C "O3'" 1 
ATOM   725   C  "C2'" . DT  A 1 36  ? 22.323 72.742  119.510 1.00 65.86  ? 135  DT  C "C2'" 1 
ATOM   726   C  "C1'" . DT  A 1 36  ? 23.051 71.482  119.072 1.00 62.95  ? 135  DT  C "C1'" 1 
ATOM   727   N  N1    . DT  A 1 36  ? 24.390 71.351  119.646 1.00 56.36  ? 135  DT  C N1    1 
ATOM   728   C  C2    . DT  A 1 36  ? 24.699 70.191  120.308 1.00 58.60  ? 135  DT  C C2    1 
ATOM   729   O  O2    . DT  A 1 36  ? 23.917 69.267  120.432 1.00 58.95  ? 135  DT  C O2    1 
ATOM   730   N  N3    . DT  A 1 36  ? 25.967 70.145  120.813 1.00 61.73  ? 135  DT  C N3    1 
ATOM   731   C  C4    . DT  A 1 36  ? 26.938 71.116  120.711 1.00 58.53  ? 135  DT  C C4    1 
ATOM   732   O  O4    . DT  A 1 36  ? 28.040 70.927  121.209 1.00 59.01  ? 135  DT  C O4    1 
ATOM   733   C  C5    . DT  A 1 36  ? 26.551 72.305  119.996 1.00 49.62  ? 135  DT  C C5    1 
ATOM   734   C  C7    . DT  A 1 36  ? 27.552 73.403  119.824 1.00 57.12  ? 135  DT  C C7    1 
ATOM   735   C  C6    . DT  A 1 36  ? 25.308 72.366  119.511 1.00 43.95  ? 135  DT  C C6    1 
ATOM   736   P  P     . DC  A 1 37  ? 19.125 72.884  119.057 1.00 72.87  ? 136  DC  C P     1 
ATOM   737   O  OP1   . DC  A 1 37  ? 18.100 73.644  118.292 1.00 76.45  ? 136  DC  C OP1   1 
ATOM   738   O  OP2   . DC  A 1 37  ? 19.676 73.462  120.310 1.00 71.45  ? 136  DC  C OP2   1 
ATOM   739   O  "O5'" . DC  A 1 37  ? 18.537 71.449  119.421 1.00 77.79  ? 136  DC  C "O5'" 1 
ATOM   740   C  "C5'" . DC  A 1 37  ? 18.073 71.166  120.739 1.00 83.90  ? 136  DC  C "C5'" 1 
ATOM   741   C  "C4'" . DC  A 1 37  ? 18.605 69.833  121.212 1.00 87.88  ? 136  DC  C "C4'" 1 
ATOM   742   O  "O4'" . DC  A 1 37  ? 20.053 69.881  121.308 1.00 87.67  ? 136  DC  C "O4'" 1 
ATOM   743   C  "C3'" . DC  A 1 37  ? 18.118 69.427  122.605 1.00 91.92  ? 136  DC  C "C3'" 1 
ATOM   744   O  "O3'" . DC  A 1 37  ? 18.122 68.001  122.704 1.00 92.00  ? 136  DC  C "O3'" 1 
ATOM   745   C  "C2'" . DC  A 1 37  ? 19.256 69.873  123.501 1.00 90.02  ? 136  DC  C "C2'" 1 
ATOM   746   C  "C1'" . DC  A 1 37  ? 20.444 69.524  122.631 1.00 87.81  ? 136  DC  C "C1'" 1 
ATOM   747   N  N1    . DC  A 1 37  ? 21.700 70.224  122.960 1.00 86.18  ? 136  DC  C N1    1 
ATOM   748   C  C2    . DC  A 1 37  ? 22.688 69.528  123.672 1.00 88.65  ? 136  DC  C C2    1 
ATOM   749   O  O2    . DC  A 1 37  ? 22.456 68.367  124.040 1.00 91.82  ? 136  DC  C O2    1 
ATOM   750   N  N3    . DC  A 1 37  ? 23.864 70.139  123.942 1.00 80.17  ? 136  DC  C N3    1 
ATOM   751   C  C4    . DC  A 1 37  ? 24.070 71.394  123.539 1.00 72.79  ? 136  DC  C C4    1 
ATOM   752   N  N4    . DC  A 1 37  ? 25.255 71.948  123.800 1.00 62.37  ? 136  DC  C N4    1 
ATOM   753   C  C5    . DC  A 1 37  ? 23.071 72.136  122.842 1.00 71.73  ? 136  DC  C C5    1 
ATOM   754   C  C6    . DC  A 1 37  ? 21.912 71.518  122.575 1.00 77.18  ? 136  DC  C C6    1 
ATOM   755   O  "O5'" . DG  B 2 1   ? 34.164 73.792  129.858 1.00 103.35 ? 100  DG  D "O5'" 1 
ATOM   756   C  "C5'" . DG  B 2 1   ? 34.573 72.427  129.658 1.00 113.79 ? 100  DG  D "C5'" 1 
ATOM   757   C  "C4'" . DG  B 2 1   ? 33.929 71.464  130.631 1.00 117.62 ? 100  DG  D "C4'" 1 
ATOM   758   O  "O4'" . DG  B 2 1   ? 32.553 71.861  130.832 1.00 115.12 ? 100  DG  D "O4'" 1 
ATOM   759   C  "C3'" . DG  B 2 1   ? 33.876 70.017  130.143 1.00 119.83 ? 100  DG  D "C3'" 1 
ATOM   760   O  "O3'" . DG  B 2 1   ? 33.972 69.093  131.236 1.00 119.39 ? 100  DG  D "O3'" 1 
ATOM   761   C  "C2'" . DG  B 2 1   ? 32.522 69.928  129.461 1.00 117.09 ? 100  DG  D "C2'" 1 
ATOM   762   C  "C1'" . DG  B 2 1   ? 31.663 70.944  130.207 1.00 110.37 ? 100  DG  D "C1'" 1 
ATOM   763   N  N9    . DG  B 2 1   ? 30.821 71.717  129.302 1.00 100.46 ? 100  DG  D N9    1 
ATOM   764   C  C8    . DG  B 2 1   ? 31.217 72.787  128.536 1.00 100.73 ? 100  DG  D C8    1 
ATOM   765   N  N7    . DG  B 2 1   ? 30.261 73.266  127.791 1.00 93.88  ? 100  DG  D N7    1 
ATOM   766   C  C5    . DG  B 2 1   ? 29.167 72.470  128.089 1.00 86.28  ? 100  DG  D C5    1 
ATOM   767   C  C6    . DG  B 2 1   ? 27.855 72.509  127.580 1.00 80.03  ? 100  DG  D C6    1 
ATOM   768   O  O6    . DG  B 2 1   ? 27.383 73.282  126.736 1.00 78.20  ? 100  DG  D O6    1 
ATOM   769   N  N1    . DG  B 2 1   ? 27.056 71.521  128.147 1.00 65.17  ? 100  DG  D N1    1 
ATOM   770   C  C2    . DG  B 2 1   ? 27.474 70.613  129.088 1.00 60.08  ? 100  DG  D C2    1 
ATOM   771   N  N2    . DG  B 2 1   ? 26.544 69.737  129.516 1.00 44.70  ? 100  DG  D N2    1 
ATOM   772   N  N3    . DG  B 2 1   ? 28.709 70.565  129.572 1.00 63.05  ? 100  DG  D N3    1 
ATOM   773   C  C4    . DG  B 2 1   ? 29.494 71.515  129.029 1.00 85.33  ? 100  DG  D C4    1 
ATOM   774   P  P     . DG  B 2 2   ? 33.992 67.510  130.940 1.00 120.07 ? 101  DG  D P     1 
ATOM   775   O  OP1   . DG  B 2 2   ? 34.154 66.775  132.227 1.00 117.48 ? 101  DG  D OP1   1 
ATOM   776   O  OP2   . DG  B 2 2   ? 34.944 67.260  129.821 1.00 116.97 ? 101  DG  D OP2   1 
ATOM   777   O  "O5'" . DG  B 2 2   ? 32.531 67.215  130.385 1.00 114.77 ? 101  DG  D "O5'" 1 
ATOM   778   C  "C5'" . DG  B 2 2   ? 32.311 66.180  129.437 1.00 103.43 ? 101  DG  D "C5'" 1 
ATOM   779   C  "C4'" . DG  B 2 2   ? 30.939 65.582  129.633 1.00 95.07  ? 101  DG  D "C4'" 1 
ATOM   780   O  "O4'" . DG  B 2 2   ? 29.938 66.609  129.431 1.00 86.87  ? 101  DG  D "O4'" 1 
ATOM   781   C  "C3'" . DG  B 2 2   ? 30.626 64.477  128.632 1.00 97.75  ? 101  DG  D "C3'" 1 
ATOM   782   O  "O3'" . DG  B 2 2   ? 29.958 63.383  129.246 1.00 99.57  ? 101  DG  D "O3'" 1 
ATOM   783   C  "C2'" . DG  B 2 2   ? 29.745 65.143  127.594 1.00 89.06  ? 101  DG  D "C2'" 1 
ATOM   784   C  "C1'" . DG  B 2 2   ? 29.099 66.308  128.326 1.00 78.24  ? 101  DG  D "C1'" 1 
ATOM   785   N  N9    . DG  B 2 2   ? 29.083 67.482  127.467 1.00 62.55  ? 101  DG  D N9    1 
ATOM   786   C  C8    . DG  B 2 2   ? 30.170 68.250  127.139 1.00 57.93  ? 101  DG  D C8    1 
ATOM   787   N  N7    . DG  B 2 2   ? 29.889 69.198  126.287 1.00 54.26  ? 101  DG  D N7    1 
ATOM   788   C  C5    . DG  B 2 2   ? 28.529 69.056  126.050 1.00 53.92  ? 101  DG  D C5    1 
ATOM   789   C  C6    . DG  B 2 2   ? 27.678 69.790  125.204 1.00 51.27  ? 101  DG  D C6    1 
ATOM   790   O  O6    . DG  B 2 2   ? 27.963 70.742  124.474 1.00 46.68  ? 101  DG  D O6    1 
ATOM   791   N  N1    . DG  B 2 2   ? 26.374 69.317  125.250 1.00 45.79  ? 101  DG  D N1    1 
ATOM   792   C  C2    . DG  B 2 2   ? 25.945 68.269  126.021 1.00 53.42  ? 101  DG  D C2    1 
ATOM   793   N  N2    . DG  B 2 2   ? 24.636 67.963  125.919 1.00 48.10  ? 101  DG  D N2    1 
ATOM   794   N  N3    . DG  B 2 2   ? 26.736 67.570  126.828 1.00 54.54  ? 101  DG  D N3    1 
ATOM   795   C  C4    . DG  B 2 2   ? 28.010 68.015  126.786 1.00 56.79  ? 101  DG  D C4    1 
ATOM   796   P  P     . DA  B 2 3   ? 29.835 62.006  128.443 1.00 100.00 ? 102  DA  D P     1 
ATOM   797   O  OP1   . DA  B 2 3   ? 29.511 60.930  129.416 1.00 98.09  ? 102  DA  D OP1   1 
ATOM   798   O  OP2   . DA  B 2 3   ? 31.050 61.892  127.588 1.00 92.80  ? 102  DA  D OP2   1 
ATOM   799   O  "O5'" . DA  B 2 3   ? 28.569 62.243  127.509 1.00 95.29  ? 102  DA  D "O5'" 1 
ATOM   800   C  "C5'" . DA  B 2 3   ? 27.271 62.331  128.087 1.00 89.35  ? 102  DA  D "C5'" 1 
ATOM   801   C  "C4'" . DA  B 2 3   ? 26.216 62.460  127.013 1.00 85.29  ? 102  DA  D "C4'" 1 
ATOM   802   O  "O4'" . DA  B 2 3   ? 26.304 63.757  126.376 1.00 77.96  ? 102  DA  D "O4'" 1 
ATOM   803   C  "C3'" . DA  B 2 3   ? 26.287 61.428  125.889 1.00 83.47  ? 102  DA  D "C3'" 1 
ATOM   804   O  "O3'" . DA  B 2 3   ? 24.962 60.994  125.560 1.00 86.86  ? 102  DA  D "O3'" 1 
ATOM   805   C  "C2'" . DA  B 2 3   ? 26.907 62.210  124.744 1.00 73.73  ? 102  DA  D "C2'" 1 
ATOM   806   C  "C1'" . DA  B 2 3   ? 26.335 63.593  124.976 1.00 66.90  ? 102  DA  D "C1'" 1 
ATOM   807   N  N9    . DA  B 2 3   ? 27.101 64.702  124.411 1.00 56.96  ? 102  DA  D N9    1 
ATOM   808   C  C8    . DA  B 2 3   ? 28.441 64.985  124.520 1.00 55.55  ? 102  DA  D C8    1 
ATOM   809   N  N7    . DA  B 2 3   ? 28.806 66.073  123.885 1.00 41.76  ? 102  DA  D N7    1 
ATOM   810   C  C5    . DA  B 2 3   ? 27.627 66.534  123.323 1.00 42.11  ? 102  DA  D C5    1 
ATOM   811   C  C6    . DA  B 2 3   ? 27.338 67.645  122.524 1.00 39.54  ? 102  DA  D C6    1 
ATOM   812   N  N6    . DA  B 2 3   ? 28.252 68.539  122.142 1.00 32.15  ? 102  DA  D N6    1 
ATOM   813   N  N1    . DA  B 2 3   ? 26.059 67.813  122.120 1.00 41.31  ? 102  DA  D N1    1 
ATOM   814   C  C2    . DA  B 2 3   ? 25.138 66.915  122.507 1.00 44.54  ? 102  DA  D C2    1 
ATOM   815   N  N3    . DA  B 2 3   ? 25.289 65.831  123.260 1.00 44.25  ? 102  DA  D N3    1 
ATOM   816   C  C4    . DA  B 2 3   ? 26.572 65.698  123.638 1.00 49.82  ? 102  DA  D C4    1 
ATOM   817   P  P     . DT  B 2 4   ? 24.745 59.905  124.395 1.00 90.10  ? 103  DT  D P     1 
ATOM   818   O  OP1   . DT  B 2 4   ? 23.529 59.112  124.725 1.00 87.06  ? 103  DT  D OP1   1 
ATOM   819   O  OP2   . DT  B 2 4   ? 26.047 59.208  124.161 1.00 80.26  ? 103  DT  D OP2   1 
ATOM   820   O  "O5'" . DT  B 2 4   ? 24.415 60.802  123.121 1.00 80.99  ? 103  DT  D "O5'" 1 
ATOM   821   C  "C5'" . DT  B 2 4   ? 23.334 61.729  123.160 1.00 74.10  ? 103  DT  D "C5'" 1 
ATOM   822   C  "C4'" . DT  B 2 4   ? 23.170 62.416  121.824 1.00 68.05  ? 103  DT  D "C4'" 1 
ATOM   823   O  "O4'" . DT  B 2 4   ? 24.117 63.503  121.646 1.00 63.09  ? 103  DT  D "O4'" 1 
ATOM   824   C  "C3'" . DT  B 2 4   ? 23.329 61.502  120.610 1.00 68.18  ? 103  DT  D "C3'" 1 
ATOM   825   O  "O3'" . DT  B 2 4   ? 22.297 61.780  119.662 1.00 68.44  ? 103  DT  D "O3'" 1 
ATOM   826   C  "C2'" . DT  B 2 4   ? 24.678 61.914  120.046 1.00 57.09  ? 103  DT  D "C2'" 1 
ATOM   827   C  "C1'" . DT  B 2 4   ? 24.697 63.397  120.358 1.00 46.83  ? 103  DT  D "C1'" 1 
ATOM   828   N  N1    . DT  B 2 4   ? 26.037 64.030  120.385 1.00 38.30  ? 103  DT  D N1    1 
ATOM   829   C  C2    . DT  B 2 4   ? 26.162 65.267  119.789 1.00 37.39  ? 103  DT  D C2    1 
ATOM   830   O  O2    . DT  B 2 4   ? 25.229 65.848  119.277 1.00 38.31  ? 103  DT  D O2    1 
ATOM   831   N  N3    . DT  B 2 4   ? 27.421 65.799  119.816 1.00 25.21  ? 103  DT  D N3    1 
ATOM   832   C  C4    . DT  B 2 4   ? 28.549 65.232  120.374 1.00 32.17  ? 103  DT  D C4    1 
ATOM   833   O  O4    . DT  B 2 4   ? 29.633 65.823  120.307 1.00 38.04  ? 103  DT  D O4    1 
ATOM   834   C  C5    . DT  B 2 4   ? 28.347 63.938  121.003 1.00 27.69  ? 103  DT  D C5    1 
ATOM   835   C  C7    . DT  B 2 4   ? 29.514 63.260  121.652 1.00 55.64  ? 103  DT  D C7    1 
ATOM   836   C  C6    . DT  B 2 4   ? 27.118 63.408  120.974 1.00 26.95  ? 103  DT  D C6    1 
ATOM   837   P  P     . DA  B 2 5   ? 21.747 60.608  118.710 1.00 71.39  ? 104  DA  D P     1 
ATOM   838   O  OP1   . DA  B 2 5   ? 20.553 59.992  119.347 1.00 60.47  ? 104  DA  D OP1   1 
ATOM   839   O  OP2   . DA  B 2 5   ? 22.902 59.747  118.338 1.00 67.64  ? 104  DA  D OP2   1 
ATOM   840   O  "O5'" . DA  B 2 5   ? 21.266 61.417  117.423 1.00 62.28  ? 104  DA  D "O5'" 1 
ATOM   841   C  "C5'" . DA  B 2 5   ? 20.286 62.447  117.555 1.00 47.24  ? 104  DA  D "C5'" 1 
ATOM   842   C  "C4'" . DA  B 2 5   ? 20.486 63.527  116.517 1.00 44.32  ? 104  DA  D "C4'" 1 
ATOM   843   O  "O4'" . DA  B 2 5   ? 21.767 64.165  116.692 1.00 44.52  ? 104  DA  D "O4'" 1 
ATOM   844   C  "C3'" . DA  B 2 5   ? 20.427 63.095  115.057 1.00 42.56  ? 104  DA  D "C3'" 1 
ATOM   845   O  "O3'" . DA  B 2 5   ? 19.682 64.067  114.330 1.00 47.55  ? 104  DA  D "O3'" 1 
ATOM   846   C  "C2'" . DA  B 2 5   ? 21.882 63.073  114.626 1.00 38.94  ? 104  DA  D "C2'" 1 
ATOM   847   C  "C1'" . DA  B 2 5   ? 22.528 64.121  115.498 1.00 41.83  ? 104  DA  D "C1'" 1 
ATOM   848   N  N9    . DA  B 2 5   ? 23.903 63.825  115.892 1.00 40.55  ? 104  DA  D N9    1 
ATOM   849   C  C8    . DA  B 2 5   ? 24.355 62.704  116.539 1.00 40.91  ? 104  DA  D C8    1 
ATOM   850   N  N7    . DA  B 2 5   ? 25.626 62.756  116.861 1.00 38.81  ? 104  DA  D N7    1 
ATOM   851   C  C5    . DA  B 2 5   ? 26.039 63.987  116.378 1.00 39.55  ? 104  DA  D C5    1 
ATOM   852   C  C6    . DA  B 2 5   ? 27.262 64.650  116.436 1.00 39.46  ? 104  DA  D C6    1 
ATOM   853   N  N6    . DA  B 2 5   ? 28.329 64.164  117.068 1.00 41.90  ? 104  DA  D N6    1 
ATOM   854   N  N1    . DA  B 2 5   ? 27.356 65.853  115.834 1.00 35.27  ? 104  DA  D N1    1 
ATOM   855   C  C2    . DA  B 2 5   ? 26.273 66.360  115.246 1.00 37.79  ? 104  DA  D C2    1 
ATOM   856   N  N3    . DA  B 2 5   ? 25.051 65.848  115.157 1.00 40.03  ? 104  DA  D N3    1 
ATOM   857   C  C4    . DA  B 2 5   ? 24.999 64.641  115.748 1.00 38.81  ? 104  DA  D C4    1 
ATOM   858   P  P     . DA  B 2 6   ? 19.208 63.755  112.838 1.00 50.42  ? 105  DA  D P     1 
ATOM   859   O  OP1   . DA  B 2 6   ? 18.213 64.783  112.441 1.00 54.81  ? 105  DA  D OP1   1 
ATOM   860   O  OP2   . DA  B 2 6   ? 18.847 62.321  112.749 1.00 52.26  ? 105  DA  D OP2   1 
ATOM   861   O  "O5'" . DA  B 2 6   ? 20.541 64.032  112.026 1.00 48.80  ? 105  DA  D "O5'" 1 
ATOM   862   C  "C5'" . DA  B 2 6   ? 21.066 65.339  112.012 1.00 43.60  ? 105  DA  D "C5'" 1 
ATOM   863   C  "C4'" . DA  B 2 6   ? 22.346 65.407  111.218 1.00 40.83  ? 105  DA  D "C4'" 1 
ATOM   864   O  "O4'" . DA  B 2 6   ? 23.470 64.965  112.012 1.00 42.84  ? 105  DA  D "O4'" 1 
ATOM   865   C  "C3'" . DA  B 2 6   ? 22.403 64.625  109.906 1.00 40.32  ? 105  DA  D "C3'" 1 
ATOM   866   O  "O3'" . DA  B 2 6   ? 22.798 65.497  108.836 1.00 37.01  ? 105  DA  D "O3'" 1 
ATOM   867   C  "C2'" . DA  B 2 6   ? 23.466 63.565  110.173 1.00 36.82  ? 105  DA  D "C2'" 1 
ATOM   868   C  "C1'" . DA  B 2 6   ? 24.364 64.276  111.168 1.00 37.05  ? 105  DA  D "C1'" 1 
ATOM   869   N  N9    . DA  B 2 6   ? 25.232 63.454  112.014 1.00 31.05  ? 105  DA  D N9    1 
ATOM   870   C  C8    . DA  B 2 6   ? 24.995 62.208  112.535 1.00 30.58  ? 105  DA  D C8    1 
ATOM   871   N  N7    . DA  B 2 6   ? 25.974 61.747  113.273 1.00 35.73  ? 105  DA  D N7    1 
ATOM   872   C  C5    . DA  B 2 6   ? 26.916 62.758  113.243 1.00 32.43  ? 105  DA  D C5    1 
ATOM   873   C  C6    . DA  B 2 6   ? 28.168 62.879  113.835 1.00 23.85  ? 105  DA  D C6    1 
ATOM   874   N  N6    . DA  B 2 6   ? 28.693 61.943  114.628 1.00 32.03  ? 105  DA  D N6    1 
ATOM   875   N  N1    . DA  B 2 6   ? 28.872 64.007  113.597 1.00 21.03  ? 105  DA  D N1    1 
ATOM   876   C  C2    . DA  B 2 6   ? 28.326 64.950  112.820 1.00 30.30  ? 105  DA  D C2    1 
ATOM   877   N  N3    . DA  B 2 6   ? 27.144 64.956  112.212 1.00 32.03  ? 105  DA  D N3    1 
ATOM   878   C  C4    . DA  B 2 6   ? 26.480 63.814  112.465 1.00 35.29  ? 105  DA  D C4    1 
ATOM   879   P  P     . DC  B 2 7   ? 22.842 64.934  107.337 1.00 37.73  ? 106  DC  D P     1 
ATOM   880   O  OP1   . DC  B 2 7   ? 23.156 66.045  106.424 1.00 37.49  ? 106  DC  D OP1   1 
ATOM   881   O  OP2   . DC  B 2 7   ? 21.619 64.124  107.102 1.00 34.96  ? 106  DC  D OP2   1 
ATOM   882   O  "O5'" . DC  B 2 7   ? 24.108 63.972  107.395 1.00 33.64  ? 106  DC  D "O5'" 1 
ATOM   883   C  "C5'" . DC  B 2 7   ? 25.207 64.140  106.514 1.00 23.12  ? 106  DC  D "C5'" 1 
ATOM   884   C  "C4'" . DC  B 2 7   ? 26.202 65.122  107.087 1.00 26.59  ? 106  DC  D "C4'" 1 
ATOM   885   O  "O4'" . DC  B 2 7   ? 26.470 64.771  108.466 1.00 37.63  ? 106  DC  D "O4'" 1 
ATOM   886   C  "C3'" . DC  B 2 7   ? 27.542 65.056  106.368 1.00 35.03  ? 106  DC  D "C3'" 1 
ATOM   887   O  "O3'" . DC  B 2 7   ? 27.954 66.249  105.757 1.00 40.16  ? 106  DC  D "O3'" 1 
ATOM   888   C  "C2'" . DC  B 2 7   ? 28.560 64.603  107.397 1.00 33.44  ? 106  DC  D "C2'" 1 
ATOM   889   C  "C1'" . DC  B 2 7   ? 27.867 64.704  108.736 1.00 34.66  ? 106  DC  D "C1'" 1 
ATOM   890   N  N1    . DC  B 2 7   ? 28.103 63.494  109.542 1.00 31.10  ? 106  DC  D N1    1 
ATOM   891   C  C2    . DC  B 2 7   ? 29.304 63.359  110.255 1.00 34.92  ? 106  DC  D C2    1 
ATOM   892   O  O2    . DC  B 2 7   ? 30.137 64.273  110.221 1.00 35.75  ? 106  DC  D O2    1 
ATOM   893   N  N3    . DC  B 2 7   ? 29.527 62.234  110.964 1.00 34.98  ? 106  DC  D N3    1 
ATOM   894   C  C4    . DC  B 2 7   ? 28.613 61.274  110.988 1.00 29.92  ? 106  DC  D C4    1 
ATOM   895   N  N4    . DC  B 2 7   ? 28.874 60.193  111.702 1.00 39.44  ? 106  DC  D N4    1 
ATOM   896   C  C5    . DC  B 2 7   ? 27.390 61.385  110.286 1.00 24.92  ? 106  DC  D C5    1 
ATOM   897   C  C6    . DC  B 2 7   ? 27.173 62.502  109.583 1.00 26.30  ? 106  DC  D C6    1 
ATOM   898   P  P     . DT  B 2 8   ? 28.905 66.133  104.482 1.00 45.65  ? 107  DT  D P     1 
ATOM   899   O  OP1   . DT  B 2 8   ? 28.942 67.430  103.763 1.00 46.81  ? 107  DT  D OP1   1 
ATOM   900   O  OP2   . DT  B 2 8   ? 28.505 64.909  103.764 1.00 50.94  ? 107  DT  D OP2   1 
ATOM   901   O  "O5'" . DT  B 2 8   ? 30.322 65.828  105.128 1.00 44.00  ? 107  DT  D "O5'" 1 
ATOM   902   C  "C5'" . DT  B 2 8   ? 30.862 66.735  106.065 1.00 36.22  ? 107  DT  D "C5'" 1 
ATOM   903   C  "C4'" . DT  B 2 8   ? 32.302 66.404  106.355 1.00 34.85  ? 107  DT  D "C4'" 1 
ATOM   904   O  "O4'" . DT  B 2 8   ? 32.353 65.289  107.261 1.00 34.83  ? 107  DT  D "O4'" 1 
ATOM   905   C  "C3'" . DT  B 2 8   ? 33.171 66.035  105.161 1.00 38.59  ? 107  DT  D "C3'" 1 
ATOM   906   O  "O3'" . DT  B 2 8   ? 34.461 66.621  105.360 1.00 52.13  ? 107  DT  D "O3'" 1 
ATOM   907   C  "C2'" . DT  B 2 8   ? 33.213 64.518  105.235 1.00 33.44  ? 107  DT  D "C2'" 1 
ATOM   908   C  "C1'" . DT  B 2 8   ? 33.143 64.250  106.727 1.00 33.79  ? 107  DT  D "C1'" 1 
ATOM   909   N  N1    . DT  B 2 8   ? 32.515 62.985  107.153 1.00 35.42  ? 107  DT  D N1    1 
ATOM   910   C  C2    . DT  B 2 8   ? 33.229 62.159  107.980 1.00 41.78  ? 107  DT  D C2    1 
ATOM   911   O  O2    . DT  B 2 8   ? 34.386 62.371  108.288 1.00 38.42  ? 107  DT  D O2    1 
ATOM   912   N  N3    . DT  B 2 8   ? 32.539 61.069  108.433 1.00 36.79  ? 107  DT  D N3    1 
ATOM   913   C  C4    . DT  B 2 8   ? 31.243 60.723  108.131 1.00 34.20  ? 107  DT  D C4    1 
ATOM   914   O  O4    . DT  B 2 8   ? 30.738 59.740  108.658 1.00 37.05  ? 107  DT  D O4    1 
ATOM   915   C  C5    . DT  B 2 8   ? 30.571 61.597  107.199 1.00 29.82  ? 107  DT  D C5    1 
ATOM   916   C  C7    . DT  B 2 8   ? 29.181 61.264  106.756 1.00 55.64  ? 107  DT  D C7    1 
ATOM   917   C  C6    . DT  B 2 8   ? 31.233 62.672  106.766 1.00 31.68  ? 107  DT  D C6    1 
ATOM   918   P  P     . DT  B 2 9   ? 35.557 66.596  104.185 1.00 56.40  ? 108  DT  D P     1 
ATOM   919   O  OP1   . DT  B 2 9   ? 36.091 67.967  104.045 1.00 61.37  ? 108  DT  D OP1   1 
ATOM   920   O  OP2   . DT  B 2 9   ? 34.985 65.901  103.000 1.00 56.51  ? 108  DT  D OP2   1 
ATOM   921   O  "O5'" . DT  B 2 9   ? 36.710 65.700  104.812 1.00 53.70  ? 108  DT  D "O5'" 1 
ATOM   922   C  "C5'" . DT  B 2 9   ? 36.348 64.590  105.601 1.00 47.05  ? 108  DT  D "C5'" 1 
ATOM   923   C  "C4'" . DT  B 2 9   ? 37.552 63.956  106.245 1.00 47.53  ? 108  DT  D "C4'" 1 
ATOM   924   O  "O4'" . DT  B 2 9   ? 37.035 62.773  106.884 1.00 52.78  ? 108  DT  D "O4'" 1 
ATOM   925   C  "C3'" . DT  B 2 9   ? 38.613 63.442  105.281 1.00 51.63  ? 108  DT  D "C3'" 1 
ATOM   926   O  "O3'" . DT  B 2 9   ? 39.830 63.270  106.038 1.00 60.37  ? 108  DT  D "O3'" 1 
ATOM   927   C  "C2'" . DT  B 2 9   ? 38.005 62.124  104.834 1.00 50.78  ? 108  DT  D "C2'" 1 
ATOM   928   C  "C1'" . DT  B 2 9   ? 37.333 61.620  106.108 1.00 38.67  ? 108  DT  D "C1'" 1 
ATOM   929   N  N1    . DT  B 2 9   ? 36.068 60.870  105.940 1.00 33.48  ? 108  DT  D N1    1 
ATOM   930   C  C2    . DT  B 2 9   ? 35.907 59.732  106.698 1.00 35.79  ? 108  DT  D C2    1 
ATOM   931   O  O2    . DT  B 2 9   ? 36.791 59.281  107.400 1.00 37.46  ? 108  DT  D O2    1 
ATOM   932   N  N3    . DT  B 2 9   ? 34.672 59.134  106.592 1.00 29.68  ? 108  DT  D N3    1 
ATOM   933   C  C4    . DT  B 2 9   ? 33.615 59.541  105.794 1.00 29.05  ? 108  DT  D C4    1 
ATOM   934   O  O4    . DT  B 2 9   ? 32.556 58.924  105.828 1.00 29.95  ? 108  DT  D O4    1 
ATOM   935   C  C5    . DT  B 2 9   ? 33.875 60.715  104.969 1.00 25.40  ? 108  DT  D C5    1 
ATOM   936   C  C7    . DT  B 2 9   ? 32.812 61.205  104.040 1.00 55.64  ? 108  DT  D C7    1 
ATOM   937   C  C6    . DT  B 2 9   ? 35.071 61.311  105.086 1.00 29.71  ? 108  DT  D C6    1 
ATOM   938   P  P     . DC  B 2 10  ? 41.242 63.036  105.296 1.00 63.21  ? 109  DC  D P     1 
ATOM   939   O  OP1   . DC  B 2 10  ? 42.290 63.682  106.130 1.00 62.65  ? 109  DC  D OP1   1 
ATOM   940   O  OP2   . DC  B 2 10  ? 41.089 63.415  103.862 1.00 64.22  ? 109  DC  D OP2   1 
ATOM   941   O  "O5'" . DC  B 2 10  ? 41.481 61.467  105.424 1.00 59.52  ? 109  DC  D "O5'" 1 
ATOM   942   C  "C5'" . DC  B 2 10  ? 40.397 60.617  105.764 1.00 57.08  ? 109  DC  D "C5'" 1 
ATOM   943   C  "C4'" . DC  B 2 10  ? 40.889 59.289  106.280 1.00 54.25  ? 109  DC  D "C4'" 1 
ATOM   944   O  "O4'" . DC  B 2 10  ? 39.720 58.470  106.518 1.00 60.35  ? 109  DC  D "O4'" 1 
ATOM   945   C  "C3'" . DC  B 2 10  ? 41.732 58.522  105.271 1.00 53.27  ? 109  DC  D "C3'" 1 
ATOM   946   O  "O3'" . DC  B 2 10  ? 42.682 57.710  105.953 1.00 51.14  ? 109  DC  D "O3'" 1 
ATOM   947   C  "C2'" . DC  B 2 10  ? 40.716 57.665  104.543 1.00 53.43  ? 109  DC  D "C2'" 1 
ATOM   948   C  "C1'" . DC  B 2 10  ? 39.674 57.379  105.607 1.00 48.78  ? 109  DC  D "C1'" 1 
ATOM   949   N  N1    . DC  B 2 10  ? 38.302 57.291  105.077 1.00 41.65  ? 109  DC  D N1    1 
ATOM   950   C  C2    . DC  B 2 10  ? 37.516 56.206  105.444 1.00 42.42  ? 109  DC  D C2    1 
ATOM   951   O  O2    . DC  B 2 10  ? 37.993 55.359  106.207 1.00 43.81  ? 109  DC  D O2    1 
ATOM   952   N  N3    . DC  B 2 10  ? 36.259 56.108  104.966 1.00 36.34  ? 109  DC  D N3    1 
ATOM   953   C  C4    . DC  B 2 10  ? 35.780 57.052  104.156 1.00 38.72  ? 109  DC  D C4    1 
ATOM   954   N  N4    . DC  B 2 10  ? 34.524 56.926  103.723 1.00 39.20  ? 109  DC  D N4    1 
ATOM   955   C  C5    . DC  B 2 10  ? 36.565 58.171  103.759 1.00 32.71  ? 109  DC  D C5    1 
ATOM   956   C  C6    . DC  B 2 10  ? 37.808 58.250  104.240 1.00 32.06  ? 109  DC  D C6    1 
ATOM   957   P  P     . DG  B 2 11  ? 43.927 57.109  105.150 1.00 53.45  ? 110  DG  D P     1 
ATOM   958   O  OP1   . DG  B 2 11  ? 45.082 57.150  106.071 1.00 52.74  ? 110  DG  D OP1   1 
ATOM   959   O  OP2   . DG  B 2 11  ? 44.010 57.780  103.828 1.00 41.85  ? 110  DG  D OP2   1 
ATOM   960   O  "O5'" . DG  B 2 11  ? 43.518 55.593  104.942 1.00 51.99  ? 110  DG  D "O5'" 1 
ATOM   961   C  "C5'" . DG  B 2 11  ? 43.303 54.768  106.076 1.00 49.87  ? 110  DG  D "C5'" 1 
ATOM   962   C  "C4'" . DG  B 2 11  ? 42.720 53.444  105.652 1.00 42.89  ? 110  DG  D "C4'" 1 
ATOM   963   O  "O4'" . DG  B 2 11  ? 41.318 53.581  105.297 1.00 43.41  ? 110  DG  D "O4'" 1 
ATOM   964   C  "C3'" . DG  B 2 11  ? 43.421 52.852  104.435 1.00 42.68  ? 110  DG  D "C3'" 1 
ATOM   965   O  "O3'" . DG  B 2 11  ? 43.589 51.447  104.632 1.00 49.70  ? 110  DG  D "O3'" 1 
ATOM   966   C  "C2'" . DG  B 2 11  ? 42.450 53.148  103.307 1.00 36.34  ? 110  DG  D "C2'" 1 
ATOM   967   C  "C1'" . DG  B 2 11  ? 41.103 53.046  104.004 1.00 39.44  ? 110  DG  D "C1'" 1 
ATOM   968   N  N9    . DG  B 2 11  ? 40.037 53.805  103.353 1.00 33.03  ? 110  DG  D N9    1 
ATOM   969   C  C8    . DG  B 2 11  ? 40.187 54.970  102.651 1.00 29.42  ? 110  DG  D C8    1 
ATOM   970   N  N7    . DG  B 2 11  ? 39.073 55.401  102.128 1.00 25.31  ? 110  DG  D N7    1 
ATOM   971   C  C5    . DG  B 2 11  ? 38.125 54.470  102.516 1.00 27.64  ? 110  DG  D C5    1 
ATOM   972   C  C6    . DG  B 2 11  ? 36.740 54.405  102.226 1.00 31.03  ? 110  DG  D C6    1 
ATOM   973   O  O6    . DG  B 2 11  ? 36.065 55.170  101.529 1.00 28.24  ? 110  DG  D O6    1 
ATOM   974   N  N1    . DG  B 2 11  ? 36.142 53.305  102.822 1.00 30.38  ? 110  DG  D N1    1 
ATOM   975   C  C2    . DG  B 2 11  ? 36.797 52.380  103.583 1.00 35.00  ? 110  DG  D C2    1 
ATOM   976   N  N2    . DG  B 2 11  ? 36.038 51.403  104.074 1.00 37.55  ? 110  DG  D N2    1 
ATOM   977   N  N3    . DG  B 2 11  ? 38.099 52.414  103.844 1.00 33.70  ? 110  DG  D N3    1 
ATOM   978   C  C4    . DG  B 2 11  ? 38.695 53.483  103.284 1.00 28.45  ? 110  DG  D C4    1 
ATOM   979   P  P     . DT  B 2 12  ? 44.577 50.617  103.684 1.00 48.75  ? 111  DT  D P     1 
ATOM   980   O  OP1   . DT  B 2 12  ? 45.649 50.045  104.527 1.00 53.77  ? 111  DT  D OP1   1 
ATOM   981   O  OP2   . DT  B 2 12  ? 44.928 51.453  102.498 1.00 47.41  ? 111  DT  D OP2   1 
ATOM   982   O  "O5'" . DT  B 2 12  ? 43.652 49.409  103.252 1.00 55.96  ? 111  DT  D "O5'" 1 
ATOM   983   C  "C5'" . DT  B 2 12  ? 42.894 48.725  104.239 1.00 64.92  ? 111  DT  D "C5'" 1 
ATOM   984   C  "C4'" . DT  B 2 12  ? 41.676 48.084  103.620 1.00 61.49  ? 111  DT  D "C4'" 1 
ATOM   985   O  "O4'" . DT  B 2 12  ? 40.731 49.098  103.201 1.00 49.48  ? 111  DT  D "O4'" 1 
ATOM   986   C  "C3'" . DT  B 2 12  ? 41.982 47.251  102.379 1.00 66.09  ? 111  DT  D "C3'" 1 
ATOM   987   O  "O3'" . DT  B 2 12  ? 41.284 46.013  102.433 1.00 63.86  ? 111  DT  D "O3'" 1 
ATOM   988   C  "C2'" . DT  B 2 12  ? 41.465 48.110  101.237 1.00 58.60  ? 111  DT  D "C2'" 1 
ATOM   989   C  "C1'" . DT  B 2 12  ? 40.295 48.803  101.894 1.00 44.17  ? 111  DT  D "C1'" 1 
ATOM   990   N  N1    . DT  B 2 12  ? 39.858 50.053  101.255 1.00 36.15  ? 111  DT  D N1    1 
ATOM   991   C  C2    . DT  B 2 12  ? 38.510 50.232  101.092 1.00 40.29  ? 111  DT  D C2    1 
ATOM   992   O  O2    . DT  B 2 12  ? 37.682 49.422  101.482 1.00 51.06  ? 111  DT  D O2    1 
ATOM   993   N  N3    . DT  B 2 12  ? 38.162 51.392  100.453 1.00 27.53  ? 111  DT  D N3    1 
ATOM   994   C  C4    . DT  B 2 12  ? 39.011 52.363  99.972  1.00 33.18  ? 111  DT  D C4    1 
ATOM   995   O  O4    . DT  B 2 12  ? 38.556 53.353  99.404  1.00 38.52  ? 111  DT  D O4    1 
ATOM   996   C  C5    . DT  B 2 12  ? 40.408 52.117  100.184 1.00 32.56  ? 111  DT  D C5    1 
ATOM   997   C  C7    . DT  B 2 12  ? 41.397 53.116  99.678  1.00 55.64  ? 111  DT  D C7    1 
ATOM   998   C  C6    . DT  B 2 12  ? 40.761 50.994  100.819 1.00 36.79  ? 111  DT  D C6    1 
ATOM   999   P  P     . DA  B 2 13  ? 41.586 44.889  101.327 1.00 68.55  ? 112  DA  D P     1 
ATOM   1000  O  OP1   . DA  B 2 13  ? 42.118 43.719  102.065 1.00 57.60  ? 112  DA  D OP1   1 
ATOM   1001  O  OP2   . DA  B 2 13  ? 42.338 45.450  100.156 1.00 64.61  ? 112  DA  D OP2   1 
ATOM   1002  O  "O5'" . DA  B 2 13  ? 40.143 44.513  100.793 1.00 64.98  ? 112  DA  D "O5'" 1 
ATOM   1003  C  "C5'" . DA  B 2 13  ? 39.088 44.293  101.706 1.00 50.25  ? 112  DA  D "C5'" 1 
ATOM   1004  C  "C4'" . DA  B 2 13  ? 37.770 44.348  100.980 1.00 34.73  ? 112  DA  D "C4'" 1 
ATOM   1005  O  "O4'" . DA  B 2 13  ? 37.487 45.702  100.560 1.00 25.96  ? 112  DA  D "O4'" 1 
ATOM   1006  C  "C3'" . DA  B 2 13  ? 37.746 43.497  99.721  1.00 33.94  ? 112  DA  D "C3'" 1 
ATOM   1007  O  "O3'" . DA  B 2 13  ? 36.610 42.646  99.745  1.00 41.53  ? 112  DA  D "O3'" 1 
ATOM   1008  C  "C2'" . DA  B 2 13  ? 37.719 44.508  98.586  1.00 22.00  ? 112  DA  D "C2'" 1 
ATOM   1009  C  "C1'" . DA  B 2 13  ? 37.083 45.727  99.212  1.00 25.45  ? 112  DA  D "C1'" 1 
ATOM   1010  N  N9    . DA  B 2 13  ? 37.508 47.010  98.645  1.00 18.42  ? 112  DA  D N9    1 
ATOM   1011  C  C8    . DA  B 2 13  ? 38.769 47.519  98.630  1.00 30.86  ? 112  DA  D C8    1 
ATOM   1012  N  N7    . DA  B 2 13  ? 38.863 48.698  98.061  1.00 25.78  ? 112  DA  D N7    1 
ATOM   1013  C  C5    . DA  B 2 13  ? 37.572 48.981  97.675  1.00 22.06  ? 112  DA  D C5    1 
ATOM   1014  C  C6    . DA  B 2 13  ? 37.013 50.078  97.015  1.00 27.13  ? 112  DA  D C6    1 
ATOM   1015  N  N6    . DA  B 2 13  ? 37.718 51.131  96.607  1.00 21.14  ? 112  DA  D N6    1 
ATOM   1016  N  N1    . DA  B 2 13  ? 35.687 50.058  96.775  1.00 33.39  ? 112  DA  D N1    1 
ATOM   1017  C  C2    . DA  B 2 13  ? 34.984 48.995  97.175  1.00 30.66  ? 112  DA  D C2    1 
ATOM   1018  N  N3    . DA  B 2 13  ? 35.400 47.898  97.806  1.00 25.62  ? 112  DA  D N3    1 
ATOM   1019  C  C4    . DA  B 2 13  ? 36.722 47.953  98.028  1.00 20.25  ? 112  DA  D C4    1 
ATOM   1020  P  P     . DT  B 2 14  ? 36.247 41.786  98.458  1.00 47.96  ? 113  DT  D P     1 
ATOM   1021  O  OP1   . DT  B 2 14  ? 35.405 40.634  98.835  1.00 53.20  ? 113  DT  D OP1   1 
ATOM   1022  O  OP2   . DT  B 2 14  ? 37.474 41.566  97.682  1.00 39.05  ? 113  DT  D OP2   1 
ATOM   1023  O  "O5'" . DT  B 2 14  ? 35.344 42.801  97.662  1.00 28.15  ? 113  DT  D "O5'" 1 
ATOM   1024  C  "C5'" . DT  B 2 14  ? 35.121 42.596  96.306  1.00 31.78  ? 113  DT  D "C5'" 1 
ATOM   1025  C  "C4'" . DT  B 2 14  ? 34.210 43.658  95.760  1.00 24.06  ? 113  DT  D "C4'" 1 
ATOM   1026  O  "O4'" . DT  B 2 14  ? 34.815 44.967  95.908  1.00 25.91  ? 113  DT  D "O4'" 1 
ATOM   1027  C  "C3'" . DT  B 2 14  ? 34.052 43.432  94.262  1.00 34.27  ? 113  DT  D "C3'" 1 
ATOM   1028  O  "O3'" . DT  B 2 14  ? 32.727 43.730  93.875  1.00 43.05  ? 113  DT  D "O3'" 1 
ATOM   1029  C  "C2'" . DT  B 2 14  ? 35.016 44.426  93.653  1.00 18.75  ? 113  DT  D "C2'" 1 
ATOM   1030  C  "C1'" . DT  B 2 14  ? 34.880 45.574  94.628  1.00 22.91  ? 113  DT  D "C1'" 1 
ATOM   1031  N  N1    . DT  B 2 14  ? 36.010 46.535  94.573  1.00 24.46  ? 113  DT  D N1    1 
ATOM   1032  C  C2    . DT  B 2 14  ? 35.744 47.754  93.999  1.00 30.44  ? 113  DT  D C2    1 
ATOM   1033  O  O2    . DT  B 2 14  ? 34.632 48.082  93.624  1.00 26.58  ? 113  DT  D O2    1 
ATOM   1034  N  N3    . DT  B 2 14  ? 36.826 48.575  93.875  1.00 34.33  ? 113  DT  D N3    1 
ATOM   1035  C  C4    . DT  B 2 14  ? 38.114 48.318  94.269  1.00 34.89  ? 113  DT  D C4    1 
ATOM   1036  O  O4    . DT  B 2 14  ? 38.976 49.160  94.082  1.00 39.94  ? 113  DT  D O4    1 
ATOM   1037  C  C5    . DT  B 2 14  ? 38.327 47.032  94.892  1.00 29.68  ? 113  DT  D C5    1 
ATOM   1038  C  C7    . DT  B 2 14  ? 39.701 46.667  95.351  1.00 55.64  ? 113  DT  D C7    1 
ATOM   1039  C  C6    . DT  B 2 14  ? 37.275 46.218  95.023  1.00 23.84  ? 113  DT  D C6    1 
ATOM   1040  P  P     . DA  B 2 15  ? 31.994 42.808  92.806  1.00 46.08  ? 114  DA  D P     1 
ATOM   1041  O  OP1   . DA  B 2 15  ? 31.041 41.994  93.583  1.00 49.30  ? 114  DA  D OP1   1 
ATOM   1042  O  OP2   . DA  B 2 15  ? 32.955 42.131  91.904  1.00 45.68  ? 114  DA  D OP2   1 
ATOM   1043  O  "O5'" . DA  B 2 15  ? 31.221 43.895  91.956  1.00 36.09  ? 114  DA  D "O5'" 1 
ATOM   1044  C  "C5'" . DA  B 2 15  ? 30.270 44.718  92.592  1.00 35.39  ? 114  DA  D "C5'" 1 
ATOM   1045  C  "C4'" . DA  B 2 15  ? 30.166 46.039  91.879  1.00 28.76  ? 114  DA  D "C4'" 1 
ATOM   1046  O  "O4'" . DA  B 2 15  ? 31.447 46.697  91.971  1.00 35.76  ? 114  DA  D "O4'" 1 
ATOM   1047  C  "C3'" . DA  B 2 15  ? 29.823 45.959  90.395  1.00 29.28  ? 114  DA  D "C3'" 1 
ATOM   1048  O  "O3'" . DA  B 2 15  ? 28.860 46.958  90.092  1.00 36.29  ? 114  DA  D "O3'" 1 
ATOM   1049  C  "C2'" . DA  B 2 15  ? 31.132 46.285  89.704  1.00 25.20  ? 114  DA  D "C2'" 1 
ATOM   1050  C  "C1'" . DA  B 2 15  ? 31.830 47.181  90.700  1.00 30.74  ? 114  DA  D "C1'" 1 
ATOM   1051  N  N9    . DA  B 2 15  ? 33.296 47.165  90.641  1.00 30.12  ? 114  DA  D N9    1 
ATOM   1052  C  C8    . DA  B 2 15  ? 34.140 46.168  91.048  1.00 23.64  ? 114  DA  D C8    1 
ATOM   1053  N  N7    . DA  B 2 15  ? 35.410 46.447  90.878  1.00 29.56  ? 114  DA  D N7    1 
ATOM   1054  C  C5    . DA  B 2 15  ? 35.400 47.715  90.322  1.00 35.05  ? 114  DA  D C5    1 
ATOM   1055  C  C6    . DA  B 2 15  ? 36.427 48.568  89.920  1.00 35.63  ? 114  DA  D C6    1 
ATOM   1056  N  N6    . DA  B 2 15  ? 37.719 48.257  90.019  1.00 41.81  ? 114  DA  D N6    1 
ATOM   1057  N  N1    . DA  B 2 15  ? 36.087 49.767  89.409  1.00 29.11  ? 114  DA  D N1    1 
ATOM   1058  C  C2    . DA  B 2 15  ? 34.795 50.076  89.322  1.00 31.81  ? 114  DA  D C2    1 
ATOM   1059  N  N3    . DA  B 2 15  ? 33.733 49.359  89.667  1.00 28.61  ? 114  DA  D N3    1 
ATOM   1060  C  C4    . DA  B 2 15  ? 34.109 48.171  90.167  1.00 34.78  ? 114  DA  D C4    1 
ATOM   1061  P  P     . DG  B 2 16  ? 28.095 46.935  88.682  1.00 36.87  ? 115  DG  D P     1 
ATOM   1062  O  OP1   . DG  B 2 16  ? 26.710 47.434  88.896  1.00 34.13  ? 115  DG  D OP1   1 
ATOM   1063  O  OP2   . DG  B 2 16  ? 28.316 45.595  88.055  1.00 33.20  ? 115  DG  D OP2   1 
ATOM   1064  O  "O5'" . DG  B 2 16  ? 28.865 48.050  87.859  1.00 31.54  ? 115  DG  D "O5'" 1 
ATOM   1065  C  "C5'" . DG  B 2 16  ? 28.848 49.388  88.310  1.00 32.60  ? 115  DG  D "C5'" 1 
ATOM   1066  C  "C4'" . DG  B 2 16  ? 29.737 50.236  87.442  1.00 36.76  ? 115  DG  D "C4'" 1 
ATOM   1067  O  "O4'" . DG  B 2 16  ? 31.120 49.856  87.656  1.00 48.02  ? 115  DG  D "O4'" 1 
ATOM   1068  C  "C3'" . DG  B 2 16  ? 29.473 50.058  85.946  1.00 46.97  ? 115  DG  D "C3'" 1 
ATOM   1069  O  "O3'" . DG  B 2 16  ? 29.656 51.313  85.306  1.00 56.01  ? 115  DG  D "O3'" 1 
ATOM   1070  C  "C2'" . DG  B 2 16  ? 30.608 49.145  85.508  1.00 42.71  ? 115  DG  D "C2'" 1 
ATOM   1071  C  "C1'" . DG  B 2 16  ? 31.722 49.676  86.383  1.00 46.56  ? 115  DG  D "C1'" 1 
ATOM   1072  N  N9    . DG  B 2 16  ? 32.934 48.869  86.532  1.00 42.75  ? 115  DG  D N9    1 
ATOM   1073  C  C8    . DG  B 2 16  ? 33.050 47.543  86.885  1.00 38.76  ? 115  DG  D C8    1 
ATOM   1074  N  N7    . DG  B 2 16  ? 34.290 47.136  86.940  1.00 35.59  ? 115  DG  D N7    1 
ATOM   1075  C  C5    . DG  B 2 16  ? 35.032 48.258  86.597  1.00 36.15  ? 115  DG  D C5    1 
ATOM   1076  C  C6    . DG  B 2 16  ? 36.434 48.442  86.492  1.00 32.25  ? 115  DG  D C6    1 
ATOM   1077  O  O6    . DG  B 2 16  ? 37.338 47.621  86.685  1.00 25.84  ? 115  DG  D O6    1 
ATOM   1078  N  N1    . DG  B 2 16  ? 36.752 49.741  86.122  1.00 40.57  ? 115  DG  D N1    1 
ATOM   1079  C  C2    . DG  B 2 16  ? 35.846 50.737  85.887  1.00 36.14  ? 115  DG  D C2    1 
ATOM   1080  N  N2    . DG  B 2 16  ? 36.350 51.920  85.537  1.00 63.49  ? 115  DG  D N2    1 
ATOM   1081  N  N3    . DG  B 2 16  ? 34.542 50.586  85.986  1.00 39.62  ? 115  DG  D N3    1 
ATOM   1082  C  C4    . DG  B 2 16  ? 34.208 49.330  86.339  1.00 41.14  ? 115  DG  D C4    1 
ATOM   1083  P  P     . DC  B 2 17  ? 28.478 51.962  84.444  1.00 54.71  ? 116  DC  D P     1 
ATOM   1084  O  OP1   . DC  B 2 17  ? 27.492 52.542  85.385  1.00 50.01  ? 116  DC  D OP1   1 
ATOM   1085  O  OP2   . DC  B 2 17  ? 28.036 51.020  83.395  1.00 44.39  ? 116  DC  D OP2   1 
ATOM   1086  O  "O5'" . DC  B 2 17  ? 29.255 53.136  83.721  1.00 57.03  ? 116  DC  D "O5'" 1 
ATOM   1087  C  "C5'" . DC  B 2 17  ? 30.099 53.996  84.482  1.00 44.06  ? 116  DC  D "C5'" 1 
ATOM   1088  C  "C4'" . DC  B 2 17  ? 31.450 54.159  83.823  1.00 45.79  ? 116  DC  D "C4'" 1 
ATOM   1089  O  "O4'" . DC  B 2 17  ? 32.284 52.985  83.976  1.00 59.00  ? 116  DC  D "O4'" 1 
ATOM   1090  C  "C3'" . DC  B 2 17  ? 31.443 54.476  82.330  1.00 56.48  ? 116  DC  D "C3'" 1 
ATOM   1091  O  "O3'" . DC  B 2 17  ? 32.344 55.544  82.120  1.00 68.84  ? 116  DC  D "O3'" 1 
ATOM   1092  C  "C2'" . DC  B 2 17  ? 32.011 53.216  81.691  1.00 53.30  ? 116  DC  D "C2'" 1 
ATOM   1093  C  "C1'" . DC  B 2 17  ? 32.980 52.777  82.759  1.00 50.40  ? 116  DC  D "C1'" 1 
ATOM   1094  N  N1    . DC  B 2 17  ? 33.456 51.382  82.725  1.00 48.74  ? 116  DC  D N1    1 
ATOM   1095  C  C2    . DC  B 2 17  ? 34.805 51.152  82.459  1.00 56.18  ? 116  DC  D C2    1 
ATOM   1096  O  O2    . DC  B 2 17  ? 35.541 52.126  82.229  1.00 51.02  ? 116  DC  D O2    1 
ATOM   1097  N  N3    . DC  B 2 17  ? 35.277 49.887  82.461  1.00 65.97  ? 116  DC  D N3    1 
ATOM   1098  C  C4    . DC  B 2 17  ? 34.455 48.874  82.714  1.00 74.17  ? 116  DC  D C4    1 
ATOM   1099  N  N4    . DC  B 2 17  ? 34.969 47.646  82.729  1.00 81.05  ? 116  DC  D N4    1 
ATOM   1100  C  C5    . DC  B 2 17  ? 33.069 49.076  82.970  1.00 71.36  ? 116  DC  D C5    1 
ATOM   1101  C  C6    . DC  B 2 17  ? 32.614 50.335  82.965  1.00 55.28  ? 116  DC  D C6    1 
ATOM   1102  P  P     . DA  B 2 18  ? 31.809 56.938  81.548  1.00 69.36  ? 117  DA  D P     1 
ATOM   1103  O  OP1   . DA  B 2 18  ? 31.602 57.872  82.689  1.00 69.59  ? 117  DA  D OP1   1 
ATOM   1104  O  OP2   . DA  B 2 18  ? 30.691 56.653  80.609  1.00 63.81  ? 117  DA  D OP2   1 
ATOM   1105  O  "O5'" . DA  B 2 18  ? 33.072 57.438  80.722  1.00 68.39  ? 117  DA  D "O5'" 1 
ATOM   1106  C  "C5'" . DA  B 2 18  ? 34.334 57.576  81.369  1.00 62.25  ? 117  DA  D "C5'" 1 
ATOM   1107  C  "C4'" . DA  B 2 18  ? 35.440 56.985  80.526  1.00 62.14  ? 117  DA  D "C4'" 1 
ATOM   1108  O  "O4'" . DA  B 2 18  ? 35.432 55.539  80.541  1.00 64.53  ? 117  DA  D "O4'" 1 
ATOM   1109  C  "C3'" . DA  B 2 18  ? 35.448 57.383  79.051  1.00 70.41  ? 117  DA  D "C3'" 1 
ATOM   1110  O  "O3'" . DA  B 2 18  ? 36.798 57.587  78.668  1.00 77.20  ? 117  DA  D "O3'" 1 
ATOM   1111  C  "C2'" . DA  B 2 18  ? 34.962 56.127  78.356  1.00 58.94  ? 117  DA  D "C2'" 1 
ATOM   1112  C  "C1'" . DA  B 2 18  ? 35.642 55.091  79.215  1.00 57.39  ? 117  DA  D "C1'" 1 
ATOM   1113  N  N9    . DA  B 2 18  ? 35.132 53.732  79.109  1.00 47.51  ? 117  DA  D N9    1 
ATOM   1114  C  C8    . DA  B 2 18  ? 33.838 53.314  78.990  1.00 41.25  ? 117  DA  D C8    1 
ATOM   1115  N  N7    . DA  B 2 18  ? 33.709 52.012  78.957  1.00 53.83  ? 117  DA  D N7    1 
ATOM   1116  C  C5    . DA  B 2 18  ? 35.012 51.547  79.052  1.00 45.54  ? 117  DA  D C5    1 
ATOM   1117  C  C6    . DA  B 2 18  ? 35.549 50.258  79.090  1.00 47.94  ? 117  DA  D C6    1 
ATOM   1118  N  N6    . DA  B 2 18  ? 34.809 49.149  79.048  1.00 45.65  ? 117  DA  D N6    1 
ATOM   1119  N  N1    . DA  B 2 18  ? 36.890 50.139  79.184  1.00 56.02  ? 117  DA  D N1    1 
ATOM   1120  C  C2    . DA  B 2 18  ? 37.624 51.250  79.245  1.00 57.83  ? 117  DA  D C2    1 
ATOM   1121  N  N3    . DA  B 2 18  ? 37.231 52.517  79.229  1.00 47.06  ? 117  DA  D N3    1 
ATOM   1122  C  C4    . DA  B 2 18  ? 35.897 52.596  79.132  1.00 41.20  ? 117  DA  D C4    1 
ATOM   1123  P  P     . DT  B 2 19  ? 37.323 59.066  78.385  1.00 77.83  ? 118  DT  D P     1 
ATOM   1124  O  OP1   . DT  B 2 19  ? 37.196 59.882  79.628  1.00 68.01  ? 118  DT  D OP1   1 
ATOM   1125  O  OP2   . DT  B 2 19  ? 36.653 59.509  77.133  1.00 73.21  ? 118  DT  D OP2   1 
ATOM   1126  O  "O5'" . DT  B 2 19  ? 38.861 58.829  78.079  1.00 69.89  ? 118  DT  D "O5'" 1 
ATOM   1127  C  "C5'" . DT  B 2 19  ? 39.714 58.273  79.069  1.00 60.00  ? 118  DT  D "C5'" 1 
ATOM   1128  C  "C4'" . DT  B 2 19  ? 40.682 57.313  78.426  1.00 58.72  ? 118  DT  D "C4'" 1 
ATOM   1129  O  "O4'" . DT  B 2 19  ? 40.036 56.051  78.146  1.00 62.09  ? 118  DT  D "O4'" 1 
ATOM   1130  C  "C3'" . DT  B 2 19  ? 41.221 57.810  77.088  1.00 63.24  ? 118  DT  D "C3'" 1 
ATOM   1131  O  "O3'" . DT  B 2 19  ? 42.583 57.431  76.963  1.00 65.33  ? 118  DT  D "O3'" 1 
ATOM   1132  C  "C2'" . DT  B 2 19  ? 40.395 57.039  76.078  1.00 60.28  ? 118  DT  D "C2'" 1 
ATOM   1133  C  "C1'" . DT  B 2 19  ? 40.254 55.713  76.790  1.00 56.97  ? 118  DT  D "C1'" 1 
ATOM   1134  N  N1    . DT  B 2 19  ? 39.136 54.871  76.347  1.00 54.36  ? 118  DT  D N1    1 
ATOM   1135  C  C2    . DT  B 2 19  ? 39.327 53.509  76.342  1.00 54.45  ? 118  DT  D C2    1 
ATOM   1136  O  O2    . DT  B 2 19  ? 40.381 52.984  76.659  1.00 56.66  ? 118  DT  D O2    1 
ATOM   1137  N  N3    . DT  B 2 19  ? 38.238 52.780  75.952  1.00 46.23  ? 118  DT  D N3    1 
ATOM   1138  C  C4    . DT  B 2 19  ? 37.004 53.267  75.578  1.00 50.49  ? 118  DT  D C4    1 
ATOM   1139  O  O4    . DT  B 2 19  ? 36.099 52.481  75.297  1.00 56.35  ? 118  DT  D O4    1 
ATOM   1140  C  C5    . DT  B 2 19  ? 36.885 54.716  75.573  1.00 51.03  ? 118  DT  D C5    1 
ATOM   1141  C  C7    . DT  B 2 19  ? 35.601 55.345  75.131  1.00 55.64  ? 118  DT  D C7    1 
ATOM   1142  C  C6    . DT  B 2 19  ? 37.942 55.432  75.962  1.00 50.82  ? 118  DT  D C6    1 
ATOM   1143  P  P     . DA  B 2 20  ? 43.621 58.441  76.301  1.00 63.64  ? 119  DA  D P     1 
ATOM   1144  O  OP1   . DA  B 2 20  ? 44.283 59.201  77.373  1.00 67.14  ? 119  DA  D OP1   1 
ATOM   1145  O  OP2   . DA  B 2 20  ? 42.940 59.163  75.201  1.00 64.57  ? 119  DA  D OP2   1 
ATOM   1146  O  "O5'" . DA  B 2 20  ? 44.712 57.454  75.729  1.00 57.92  ? 119  DA  D "O5'" 1 
ATOM   1147  C  "C5'" . DA  B 2 20  ? 45.393 56.570  76.600  1.00 46.68  ? 119  DA  D "C5'" 1 
ATOM   1148  C  "C4'" . DA  B 2 20  ? 46.015 55.460  75.794  1.00 55.59  ? 119  DA  D "C4'" 1 
ATOM   1149  O  "O4'" . DA  B 2 20  ? 44.970 54.700  75.160  1.00 52.99  ? 119  DA  D "O4'" 1 
ATOM   1150  C  "C3'" . DA  B 2 20  ? 46.890 55.957  74.658  1.00 65.74  ? 119  DA  D "C3'" 1 
ATOM   1151  O  "O3'" . DA  B 2 20  ? 47.895 54.985  74.418  1.00 68.79  ? 119  DA  D "O3'" 1 
ATOM   1152  C  "C2'" . DA  B 2 20  ? 45.921 56.063  73.493  1.00 64.50  ? 119  DA  D "C2'" 1 
ATOM   1153  C  "C1'" . DA  B 2 20  ? 44.927 54.949  73.766  1.00 54.79  ? 119  DA  D "C1'" 1 
ATOM   1154  N  N9    . DA  B 2 20  ? 43.543 55.280  73.456  1.00 57.43  ? 119  DA  D N9    1 
ATOM   1155  C  C8    . DA  B 2 20  ? 42.955 56.514  73.430  1.00 62.33  ? 119  DA  D C8    1 
ATOM   1156  N  N7    . DA  B 2 20  ? 41.664 56.477  73.205  1.00 66.92  ? 119  DA  D N7    1 
ATOM   1157  C  C5    . DA  B 2 20  ? 41.389 55.125  73.058  1.00 59.08  ? 119  DA  D C5    1 
ATOM   1158  C  C6    . DA  B 2 20  ? 40.199 54.424  72.819  1.00 53.68  ? 119  DA  D C6    1 
ATOM   1159  N  N6    . DA  B 2 20  ? 39.003 55.009  72.703  1.00 55.63  ? 119  DA  D N6    1 
ATOM   1160  N  N1    . DA  B 2 20  ? 40.276 53.083  72.708  1.00 51.56  ? 119  DA  D N1    1 
ATOM   1161  C  C2    . DA  B 2 20  ? 41.467 52.497  72.840  1.00 53.70  ? 119  DA  D C2    1 
ATOM   1162  N  N3    . DA  B 2 20  ? 42.651 53.044  73.079  1.00 62.37  ? 119  DA  D N3    1 
ATOM   1163  C  C4    . DA  B 2 20  ? 42.542 54.379  73.182  1.00 61.36  ? 119  DA  D C4    1 
ATOM   1164  P  P     . DC  B 2 21  ? 49.048 55.297  73.371  1.00 71.34  ? 120  DC  D P     1 
ATOM   1165  O  OP1   . DC  B 2 21  ? 50.244 54.562  73.859  1.00 62.05  ? 120  DC  D OP1   1 
ATOM   1166  O  OP2   . DC  B 2 21  ? 49.094 56.776  73.179  1.00 66.61  ? 120  DC  D OP2   1 
ATOM   1167  O  "O5'" . DC  B 2 21  ? 48.513 54.623  72.036  1.00 70.44  ? 120  DC  D "O5'" 1 
ATOM   1168  C  "C5'" . DC  B 2 21  ? 48.237 53.231  72.004  1.00 67.10  ? 120  DC  D "C5'" 1 
ATOM   1169  C  "C4'" . DC  B 2 21  ? 47.600 52.852  70.690  1.00 65.82  ? 120  DC  D "C4'" 1 
ATOM   1170  O  "O4'" . DC  B 2 21  ? 46.167 53.080  70.716  1.00 63.77  ? 120  DC  D "O4'" 1 
ATOM   1171  C  "C3'" . DC  B 2 21  ? 48.138 53.618  69.482  1.00 64.39  ? 120  DC  D "C3'" 1 
ATOM   1172  O  "O3'" . DC  B 2 21  ? 48.538 52.727  68.448  1.00 66.32  ? 120  DC  D "O3'" 1 
ATOM   1173  C  "C2'" . DC  B 2 21  ? 46.949 54.441  69.015  1.00 63.75  ? 120  DC  D "C2'" 1 
ATOM   1174  C  "C1'" . DC  B 2 21  ? 45.780 53.589  69.461  1.00 62.87  ? 120  DC  D "C1'" 1 
ATOM   1175  N  N1    . DC  B 2 21  ? 44.508 54.305  69.622  1.00 60.79  ? 120  DC  D N1    1 
ATOM   1176  C  C2    . DC  B 2 21  ? 43.330 53.616  69.386  1.00 69.50  ? 120  DC  D C2    1 
ATOM   1177  O  O2    . DC  B 2 21  ? 43.396 52.409  69.109  1.00 74.89  ? 120  DC  D O2    1 
ATOM   1178  N  N3    . DC  B 2 21  ? 42.146 54.276  69.471  1.00 69.45  ? 120  DC  D N3    1 
ATOM   1179  C  C4    . DC  B 2 21  ? 42.127 55.570  69.797  1.00 60.84  ? 120  DC  D C4    1 
ATOM   1180  N  N4    . DC  B 2 21  ? 40.951 56.185  69.864  1.00 66.63  ? 120  DC  D N4    1 
ATOM   1181  C  C5    . DC  B 2 21  ? 43.314 56.288  70.070  1.00 54.26  ? 120  DC  D C5    1 
ATOM   1182  C  C6    . DC  B 2 21  ? 44.475 55.623  69.973  1.00 55.51  ? 120  DC  D C6    1 
ATOM   1183  P  P     . DA  B 2 22  ? 49.817 53.094  67.550  1.00 70.97  ? 121  DA  D P     1 
ATOM   1184  O  OP1   . DA  B 2 22  ? 50.723 51.919  67.542  1.00 72.81  ? 121  DA  D OP1   1 
ATOM   1185  O  OP2   . DA  B 2 22  ? 50.331 54.418  67.995  1.00 65.12  ? 121  DA  D OP2   1 
ATOM   1186  O  "O5'" . DA  B 2 22  ? 49.216 53.273  66.091  1.00 66.29  ? 121  DA  D "O5'" 1 
ATOM   1187  C  "C5'" . DA  B 2 22  ? 48.519 52.209  65.465  1.00 56.97  ? 121  DA  D "C5'" 1 
ATOM   1188  C  "C4'" . DA  B 2 22  ? 47.671 52.737  64.333  1.00 60.07  ? 121  DA  D "C4'" 1 
ATOM   1189  O  "O4'" . DA  B 2 22  ? 46.503 53.435  64.829  1.00 60.25  ? 121  DA  D "O4'" 1 
ATOM   1190  C  "C3'" . DA  B 2 22  ? 48.382 53.720  63.404  1.00 62.52  ? 121  DA  D "C3'" 1 
ATOM   1191  O  "O3'" . DA  B 2 22  ? 48.044 53.406  62.058  1.00 61.96  ? 121  DA  D "O3'" 1 
ATOM   1192  C  "C2'" . DA  B 2 22  ? 47.783 55.066  63.780  1.00 59.24  ? 121  DA  D "C2'" 1 
ATOM   1193  C  "C1'" . DA  B 2 22  ? 46.369 54.662  64.129  1.00 58.69  ? 121  DA  D "C1'" 1 
ATOM   1194  N  N9    . DA  B 2 22  ? 45.609 55.588  64.967  1.00 57.02  ? 121  DA  D N9    1 
ATOM   1195  C  C8    . DA  B 2 22  ? 46.046 56.474  65.921  1.00 53.96  ? 121  DA  D C8    1 
ATOM   1196  N  N7    . DA  B 2 22  ? 45.082 57.143  66.500  1.00 48.11  ? 121  DA  D N7    1 
ATOM   1197  C  C5    . DA  B 2 22  ? 43.935 56.667  65.885  1.00 48.46  ? 121  DA  D C5    1 
ATOM   1198  C  C6    . DA  B 2 22  ? 42.579 56.962  66.064  1.00 47.63  ? 121  DA  D C6    1 
ATOM   1199  N  N6    . DA  B 2 22  ? 42.132 57.847  66.954  1.00 38.07  ? 121  DA  D N6    1 
ATOM   1200  N  N1    . DA  B 2 22  ? 41.683 56.301  65.293  1.00 50.56  ? 121  DA  D N1    1 
ATOM   1201  C  C2    . DA  B 2 22  ? 42.137 55.404  64.410  1.00 55.25  ? 121  DA  D C2    1 
ATOM   1202  N  N3    . DA  B 2 22  ? 43.389 55.041  64.151  1.00 47.13  ? 121  DA  D N3    1 
ATOM   1203  C  C4    . DA  B 2 22  ? 44.247 55.716  64.934  1.00 50.62  ? 121  DA  D C4    1 
ATOM   1204  P  P     . DT  B 2 23  ? 48.928 53.997  60.873  1.00 62.11  ? 122  DT  D P     1 
ATOM   1205  O  OP1   . DT  B 2 23  ? 48.342 53.476  59.613  1.00 61.80  ? 122  DT  D OP1   1 
ATOM   1206  O  OP2   . DT  B 2 23  ? 50.349 53.720  61.203  1.00 60.76  ? 122  DT  D OP2   1 
ATOM   1207  O  "O5'" . DT  B 2 23  ? 48.693 55.568  61.007  1.00 55.06  ? 122  DT  D "O5'" 1 
ATOM   1208  C  "C5'" . DT  B 2 23  ? 47.917 56.272  60.046  1.00 43.60  ? 122  DT  D "C5'" 1 
ATOM   1209  C  "C4'" . DT  B 2 23  ? 46.489 55.782  60.071  1.00 36.48  ? 122  DT  D "C4'" 1 
ATOM   1210  O  "O4'" . DT  B 2 23  ? 45.878 56.156  61.332  1.00 43.03  ? 122  DT  D "O4'" 1 
ATOM   1211  C  "C3'" . DT  B 2 23  ? 45.624 56.398  58.978  1.00 41.55  ? 122  DT  D "C3'" 1 
ATOM   1212  O  "O3'" . DT  B 2 23  ? 44.926 55.405  58.239  1.00 49.72  ? 122  DT  D "O3'" 1 
ATOM   1213  C  "C2'" . DT  B 2 23  ? 44.666 57.319  59.715  1.00 38.16  ? 122  DT  D "C2'" 1 
ATOM   1214  C  "C1'" . DT  B 2 23  ? 44.603 56.728  61.106  1.00 35.81  ? 122  DT  D "C1'" 1 
ATOM   1215  N  N1    . DT  B 2 23  ? 44.346 57.736  62.162  1.00 25.84  ? 122  DT  D N1    1 
ATOM   1216  C  C2    . DT  B 2 23  ? 43.036 57.960  62.529  1.00 26.03  ? 122  DT  D C2    1 
ATOM   1217  O  O2    . DT  B 2 23  ? 42.099 57.351  62.046  1.00 25.14  ? 122  DT  D O2    1 
ATOM   1218  N  N3    . DT  B 2 23  ? 42.854 58.929  63.480  1.00 32.87  ? 122  DT  D N3    1 
ATOM   1219  C  C4    . DT  B 2 23  ? 43.825 59.684  64.093  1.00 42.21  ? 122  DT  D C4    1 
ATOM   1220  O  O4    . DT  B 2 23  ? 43.498 60.543  64.921  1.00 37.47  ? 122  DT  D O4    1 
ATOM   1221  C  C5    . DT  B 2 23  ? 45.191 59.384  63.678  1.00 33.42  ? 122  DT  D C5    1 
ATOM   1222  C  C7    . DT  B 2 23  ? 46.324 60.134  64.306  1.00 63.49  ? 122  DT  D C7    1 
ATOM   1223  C  C6    . DT  B 2 23  ? 45.375 58.436  62.745  1.00 30.15  ? 122  DT  D C6    1 
ATOM   1224  P  P     . DT  B 2 24  ? 44.491 55.722  56.727  1.00 53.41  ? 123  DT  D P     1 
ATOM   1225  O  OP1   . DT  B 2 24  ? 44.198 54.445  56.037  1.00 46.07  ? 123  DT  D OP1   1 
ATOM   1226  O  OP2   . DT  B 2 24  ? 45.491 56.650  56.153  1.00 59.12  ? 123  DT  D OP2   1 
ATOM   1227  O  "O5'" . DT  B 2 24  ? 43.120 56.496  56.907  1.00 46.24  ? 123  DT  D "O5'" 1 
ATOM   1228  C  "C5'" . DT  B 2 24  ? 41.953 55.764  57.206  1.00 45.88  ? 123  DT  D "C5'" 1 
ATOM   1229  C  "C4'" . DT  B 2 24  ? 40.759 56.679  57.293  1.00 46.23  ? 123  DT  D "C4'" 1 
ATOM   1230  O  "O4'" . DT  B 2 24  ? 40.826 57.470  58.502  1.00 41.75  ? 123  DT  D "O4'" 1 
ATOM   1231  C  "C3'" . DT  B 2 24  ? 40.592 57.661  56.137  1.00 48.90  ? 123  DT  D "C3'" 1 
ATOM   1232  O  "O3'" . DT  B 2 24  ? 39.232 57.628  55.714  1.00 53.08  ? 123  DT  D "O3'" 1 
ATOM   1233  C  "C2'" . DT  B 2 24  ? 40.929 59.000  56.770  1.00 43.75  ? 123  DT  D "C2'" 1 
ATOM   1234  C  "C1'" . DT  B 2 24  ? 40.476 58.795  58.202  1.00 36.17  ? 123  DT  D "C1'" 1 
ATOM   1235  N  N1    . DT  B 2 24  ? 41.093 59.662  59.217  1.00 33.57  ? 123  DT  D N1    1 
ATOM   1236  C  C2    . DT  B 2 24  ? 40.244 60.341  60.054  1.00 39.39  ? 123  DT  D C2    1 
ATOM   1237  O  O2    . DT  B 2 24  ? 39.035 60.244  59.981  1.00 50.06  ? 123  DT  D O2    1 
ATOM   1238  N  N3    . DT  B 2 24  ? 40.859 61.144  60.979  1.00 33.73  ? 123  DT  D N3    1 
ATOM   1239  C  C4    . DT  B 2 24  ? 42.217 61.329  61.146  1.00 36.46  ? 123  DT  D C4    1 
ATOM   1240  O  O4    . DT  B 2 24  ? 42.629 62.086  62.025  1.00 37.28  ? 123  DT  D O4    1 
ATOM   1241  C  C5    . DT  B 2 24  ? 43.057 60.577  60.231  1.00 34.85  ? 123  DT  D C5    1 
ATOM   1242  C  C7    . DT  B 2 24  ? 44.545 60.706  60.339  1.00 55.64  ? 123  DT  D C7    1 
ATOM   1243  C  C6    . DT  B 2 24  ? 42.457 59.790  59.325  1.00 32.60  ? 123  DT  D C6    1 
ATOM   1244  P  P     . DA  B 2 25  ? 38.804 58.317  54.333  1.00 57.90  ? 124  DA  D P     1 
ATOM   1245  O  OP1   . DA  B 2 25  ? 38.202 57.286  53.452  1.00 55.74  ? 124  DA  D OP1   1 
ATOM   1246  O  OP2   . DA  B 2 25  ? 39.965 59.110  53.857  1.00 53.66  ? 124  DA  D OP2   1 
ATOM   1247  O  "O5'" . DA  B 2 25  ? 37.667 59.324  54.800  1.00 51.30  ? 124  DA  D "O5'" 1 
ATOM   1248  C  "C5'" . DA  B 2 25  ? 37.811 59.972  56.055  1.00 46.11  ? 124  DA  D "C5'" 1 
ATOM   1249  C  "C4'" . DA  B 2 25  ? 36.491 60.496  56.559  1.00 44.15  ? 124  DA  D "C4'" 1 
ATOM   1250  O  "O4'" . DA  B 2 25  ? 36.789 60.975  57.889  1.00 46.51  ? 124  DA  D "O4'" 1 
ATOM   1251  C  "C3'" . DA  B 2 25  ? 35.990 61.701  55.770  1.00 47.99  ? 124  DA  D "C3'" 1 
ATOM   1252  O  "O3'" . DA  B 2 25  ? 34.575 61.839  55.743  1.00 49.83  ? 124  DA  D "O3'" 1 
ATOM   1253  C  "C2'" . DA  B 2 25  ? 36.596 62.879  56.495  1.00 50.31  ? 124  DA  D "C2'" 1 
ATOM   1254  C  "C1'" . DA  B 2 25  ? 36.860 62.389  57.913  1.00 44.50  ? 124  DA  D "C1'" 1 
ATOM   1255  N  N9    . DA  B 2 25  ? 38.211 62.774  58.322  1.00 33.17  ? 124  DA  D N9    1 
ATOM   1256  C  C8    . DA  B 2 25  ? 39.404 62.317  57.822  1.00 30.92  ? 124  DA  D C8    1 
ATOM   1257  N  N7    . DA  B 2 25  ? 40.455 62.925  58.322  1.00 36.42  ? 124  DA  D N7    1 
ATOM   1258  C  C5    . DA  B 2 25  ? 39.916 63.830  59.223  1.00 37.53  ? 124  DA  D C5    1 
ATOM   1259  C  C6    . DA  B 2 25  ? 40.506 64.789  60.071  1.00 41.24  ? 124  DA  D C6    1 
ATOM   1260  N  N6    . DA  B 2 25  ? 41.823 65.009  60.143  1.00 39.47  ? 124  DA  D N6    1 
ATOM   1261  N  N1    . DA  B 2 25  ? 39.686 65.528  60.850  1.00 35.25  ? 124  DA  D N1    1 
ATOM   1262  C  C2    . DA  B 2 25  ? 38.363 65.309  60.771  1.00 33.60  ? 124  DA  D C2    1 
ATOM   1263  N  N3    . DA  B 2 25  ? 37.689 64.440  60.007  1.00 29.56  ? 124  DA  D N3    1 
ATOM   1264  C  C4    . DA  B 2 25  ? 38.536 63.729  59.250  1.00 34.66  ? 124  DA  D C4    1 
ATOM   1265  P  P     . DT  B 2 26  ? 33.924 63.043  54.897  1.00 54.18  ? 125  DT  D P     1 
ATOM   1266  O  OP1   . DT  B 2 26  ? 32.609 62.580  54.399  1.00 49.47  ? 125  DT  D OP1   1 
ATOM   1267  O  OP2   . DT  B 2 26  ? 34.929 63.552  53.939  1.00 50.86  ? 125  DT  D OP2   1 
ATOM   1268  O  "O5'" . DT  B 2 26  ? 33.676 64.203  55.954  1.00 48.98  ? 125  DT  D "O5'" 1 
ATOM   1269  C  "C5'" . DT  B 2 26  ? 32.668 64.049  56.930  1.00 34.54  ? 125  DT  D "C5'" 1 
ATOM   1270  C  "C4'" . DT  B 2 26  ? 32.799 65.093  58.010  1.00 42.33  ? 125  DT  D "C4'" 1 
ATOM   1271  O  "O4'" . DT  B 2 26  ? 34.180 65.244  58.419  1.00 49.01  ? 125  DT  D "O4'" 1 
ATOM   1272  C  "C3'" . DT  B 2 26  ? 32.302 66.494  57.681  1.00 47.24  ? 125  DT  D "C3'" 1 
ATOM   1273  O  "O3'" . DT  B 2 26  ? 31.608 66.947  58.830  1.00 54.77  ? 125  DT  D "O3'" 1 
ATOM   1274  C  "C2'" . DT  B 2 26  ? 33.573 67.306  57.519  1.00 45.02  ? 125  DT  D "C2'" 1 
ATOM   1275  C  "C1'" . DT  B 2 26  ? 34.511 66.621  58.493  1.00 42.32  ? 125  DT  D "C1'" 1 
ATOM   1276  N  N1    . DT  B 2 26  ? 35.939 66.749  58.173  1.00 33.97  ? 125  DT  D N1    1 
ATOM   1277  C  C2    . DT  B 2 26  ? 36.701 67.610  58.922  1.00 32.64  ? 125  DT  D C2    1 
ATOM   1278  O  O2    . DT  B 2 26  ? 36.241 68.288  59.823  1.00 35.92  ? 125  DT  D O2    1 
ATOM   1279  N  N3    . DT  B 2 26  ? 38.029 67.651  58.575  1.00 29.27  ? 125  DT  D N3    1 
ATOM   1280  C  C4    . DT  B 2 26  ? 38.641 66.935  57.566  1.00 34.62  ? 125  DT  D C4    1 
ATOM   1281  O  O4    . DT  B 2 26  ? 39.836 67.055  57.367  1.00 41.81  ? 125  DT  D O4    1 
ATOM   1282  C  C5    . DT  B 2 26  ? 37.779 66.074  56.807  1.00 34.48  ? 125  DT  D C5    1 
ATOM   1283  C  C7    . DT  B 2 26  ? 38.359 65.300  55.669  1.00 55.64  ? 125  DT  D C7    1 
ATOM   1284  C  C6    . DT  B 2 26  ? 36.489 66.015  57.149  1.00 28.41  ? 125  DT  D C6    1 
ATOM   1285  P  P     . DA  B 2 27  ? 30.757 68.287  58.759  1.00 56.98  ? 126  DA  D P     1 
ATOM   1286  O  OP1   . DA  B 2 27  ? 29.681 68.175  59.772  1.00 53.20  ? 126  DA  D OP1   1 
ATOM   1287  O  OP2   . DA  B 2 27  ? 30.411 68.504  57.327  1.00 53.59  ? 126  DA  D OP2   1 
ATOM   1288  O  "O5'" . DA  B 2 27  ? 31.782 69.403  59.247  1.00 56.78  ? 126  DA  D "O5'" 1 
ATOM   1289  C  "C5'" . DA  B 2 27  ? 31.984 69.612  60.636  1.00 47.27  ? 126  DA  D "C5'" 1 
ATOM   1290  C  "C4'" . DA  B 2 27  ? 32.495 71.008  60.900  1.00 46.28  ? 126  DA  D "C4'" 1 
ATOM   1291  O  "O4'" . DA  B 2 27  ? 33.901 71.128  60.588  1.00 43.77  ? 126  DA  D "O4'" 1 
ATOM   1292  C  "C3'" . DA  B 2 27  ? 31.787 72.118  60.135  1.00 49.58  ? 126  DA  D "C3'" 1 
ATOM   1293  O  "O3'" . DA  B 2 27  ? 31.578 73.218  61.017  1.00 52.33  ? 126  DA  D "O3'" 1 
ATOM   1294  C  "C2'" . DA  B 2 27  ? 32.765 72.461  59.023  1.00 45.57  ? 126  DA  D "C2'" 1 
ATOM   1295  C  "C1'" . DA  B 2 27  ? 34.120 72.181  59.657  1.00 43.69  ? 126  DA  D "C1'" 1 
ATOM   1296  N  N9    . DA  B 2 27  ? 35.171 71.729  58.738  1.00 39.00  ? 126  DA  D N9    1 
ATOM   1297  C  C8    . DA  B 2 27  ? 35.065 70.779  57.750  1.00 39.83  ? 126  DA  D C8    1 
ATOM   1298  N  N7    . DA  B 2 27  ? 36.205 70.502  57.159  1.00 34.87  ? 126  DA  D N7    1 
ATOM   1299  C  C5    . DA  B 2 27  ? 37.115 71.337  57.783  1.00 30.48  ? 126  DA  D C5    1 
ATOM   1300  C  C6    . DA  B 2 27  ? 38.493 71.499  57.622  1.00 30.38  ? 126  DA  D C6    1 
ATOM   1301  N  N6    . DA  B 2 27  ? 39.216 70.775  56.775  1.00 30.11  ? 126  DA  D N6    1 
ATOM   1302  N  N1    . DA  B 2 27  ? 39.114 72.431  58.380  1.00 30.39  ? 126  DA  D N1    1 
ATOM   1303  C  C2    . DA  B 2 27  ? 38.377 73.135  59.256  1.00 25.19  ? 126  DA  D C2    1 
ATOM   1304  N  N3    . DA  B 2 27  ? 37.069 73.054  59.514  1.00 25.02  ? 126  DA  D N3    1 
ATOM   1305  C  C4    . DA  B 2 27  ? 36.491 72.124  58.734  1.00 33.20  ? 126  DA  D C4    1 
ATOM   1306  P  P     . DC  B 2 28  ? 30.633 74.421  60.564  1.00 52.49  ? 127  DC  D P     1 
ATOM   1307  O  OP1   . DC  B 2 28  ? 30.055 75.084  61.754  1.00 46.03  ? 127  DC  D OP1   1 
ATOM   1308  O  OP2   . DC  B 2 28  ? 29.726 73.865  59.535  1.00 54.23  ? 127  DC  D OP2   1 
ATOM   1309  O  "O5'" . DC  B 2 28  ? 31.663 75.416  59.866  1.00 57.97  ? 127  DC  D "O5'" 1 
ATOM   1310  C  "C5'" . DC  B 2 28  ? 32.669 76.070  60.636  1.00 59.88  ? 127  DC  D "C5'" 1 
ATOM   1311  C  "C4'" . DC  B 2 28  ? 33.523 76.954  59.756  1.00 65.20  ? 127  DC  D "C4'" 1 
ATOM   1312  O  "O4'" . DC  B 2 28  ? 34.626 76.229  59.153  1.00 62.32  ? 127  DC  D "O4'" 1 
ATOM   1313  C  "C3'" . DC  B 2 28  ? 32.788 77.652  58.609  1.00 71.66  ? 127  DC  D "C3'" 1 
ATOM   1314  O  "O3'" . DC  B 2 28  ? 33.269 78.996  58.496  1.00 82.71  ? 127  DC  D "O3'" 1 
ATOM   1315  C  "C2'" . DC  B 2 28  ? 33.251 76.864  57.398  1.00 60.97  ? 127  DC  D "C2'" 1 
ATOM   1316  C  "C1'" . DC  B 2 28  ? 34.689 76.586  57.787  1.00 51.53  ? 127  DC  D "C1'" 1 
ATOM   1317  N  N1    . DC  B 2 28  ? 35.376 75.515  57.044  1.00 37.25  ? 127  DC  D N1    1 
ATOM   1318  C  C2    . DC  B 2 28  ? 36.781 75.553  56.939  1.00 39.32  ? 127  DC  D C2    1 
ATOM   1319  O  O2    . DC  B 2 28  ? 37.403 76.454  57.523  1.00 40.56  ? 127  DC  D O2    1 
ATOM   1320  N  N3    . DC  B 2 28  ? 37.418 74.606  56.213  1.00 27.02  ? 127  DC  D N3    1 
ATOM   1321  C  C4    . DC  B 2 28  ? 36.713 73.642  55.619  1.00 33.31  ? 127  DC  D C4    1 
ATOM   1322  N  N4    . DC  B 2 28  ? 37.371 72.738  54.909  1.00 36.92  ? 127  DC  D N4    1 
ATOM   1323  C  C5    . DC  B 2 28  ? 35.294 73.563  55.728  1.00 30.64  ? 127  DC  D C5    1 
ATOM   1324  C  C6    . DC  B 2 28  ? 34.673 74.510  56.445  1.00 30.61  ? 127  DC  D C6    1 
ATOM   1325  P  P     . DG  B 2 29  ? 32.236 80.222  58.339  1.00 86.87  ? 128  DG  D P     1 
ATOM   1326  O  OP1   . DG  B 2 29  ? 31.501 80.409  59.617  1.00 81.19  ? 128  DG  D OP1   1 
ATOM   1327  O  OP2   . DG  B 2 29  ? 31.476 80.030  57.076  1.00 85.17  ? 128  DG  D OP2   1 
ATOM   1328  O  "O5'" . DG  B 2 29  ? 33.214 81.465  58.161  1.00 80.60  ? 128  DG  D "O5'" 1 
ATOM   1329  C  "C5'" . DG  B 2 29  ? 34.144 81.795  59.189  1.00 77.25  ? 128  DG  D "C5'" 1 
ATOM   1330  C  "C4'" . DG  B 2 29  ? 35.520 82.026  58.609  1.00 77.07  ? 128  DG  D "C4'" 1 
ATOM   1331  O  "O4'" . DG  B 2 29  ? 36.024 80.813  57.990  1.00 79.21  ? 128  DG  D "O4'" 1 
ATOM   1332  C  "C3'" . DG  B 2 29  ? 35.593 83.111  57.539  1.00 83.03  ? 128  DG  D "C3'" 1 
ATOM   1333  O  "O3'" . DG  B 2 29  ? 36.804 83.858  57.711  1.00 85.75  ? 128  DG  D "O3'" 1 
ATOM   1334  C  "C2'" . DG  B 2 29  ? 35.613 82.316  56.244  1.00 78.91  ? 128  DG  D "C2'" 1 
ATOM   1335  C  "C1'" . DG  B 2 29  ? 36.374 81.056  56.632  1.00 67.19  ? 128  DG  D "C1'" 1 
ATOM   1336  N  N9    . DG  B 2 29  ? 36.006 79.876  55.848  1.00 55.04  ? 128  DG  D N9    1 
ATOM   1337  C  C8    . DG  B 2 29  ? 34.732 79.399  55.636  1.00 49.60  ? 128  DG  D C8    1 
ATOM   1338  N  N7    . DG  B 2 29  ? 34.701 78.327  54.888  1.00 38.31  ? 128  DG  D N7    1 
ATOM   1339  C  C5    . DG  B 2 29  ? 36.030 78.078  54.588  1.00 34.70  ? 128  DG  D C5    1 
ATOM   1340  C  C6    . DG  B 2 29  ? 36.602 77.047  53.826  1.00 43.42  ? 128  DG  D C6    1 
ATOM   1341  O  O6    . DG  B 2 29  ? 36.036 76.123  53.253  1.00 50.32  ? 128  DG  D O6    1 
ATOM   1342  N  N1    . DG  B 2 29  ? 37.983 77.151  53.768  1.00 39.40  ? 128  DG  D N1    1 
ATOM   1343  C  C2    . DG  B 2 29  ? 38.723 78.122  54.378  1.00 39.23  ? 128  DG  D C2    1 
ATOM   1344  N  N2    . DG  B 2 29  ? 40.061 78.021  54.206  1.00 29.59  ? 128  DG  D N2    1 
ATOM   1345  N  N3    . DG  B 2 29  ? 38.198 79.109  55.105  1.00 38.87  ? 128  DG  D N3    1 
ATOM   1346  C  C4    . DG  B 2 29  ? 36.853 79.022  55.167  1.00 40.22  ? 128  DG  D C4    1 
ATOM   1347  P  P     . DA  B 2 30  ? 36.891 85.384  57.205  1.00 83.89  ? 129  DA  D P     1 
ATOM   1348  O  OP1   . DA  B 2 30  ? 37.603 86.161  58.256  1.00 83.64  ? 129  DA  D OP1   1 
ATOM   1349  O  OP2   . DA  B 2 30  ? 35.531 85.806  56.759  1.00 82.93  ? 129  DA  D OP2   1 
ATOM   1350  O  "O5'" . DA  B 2 30  ? 37.843 85.290  55.935  1.00 76.09  ? 129  DA  D "O5'" 1 
ATOM   1351  C  "C5'" . DA  B 2 30  ? 37.945 84.076  55.219  1.00 80.47  ? 129  DA  D "C5'" 1 
ATOM   1352  C  "C4'" . DA  B 2 30  ? 39.292 83.972  54.551  1.00 87.65  ? 129  DA  D "C4'" 1 
ATOM   1353  O  "O4'" . DA  B 2 30  ? 39.423 82.622  54.053  1.00 85.77  ? 129  DA  D "O4'" 1 
ATOM   1354  C  "C3'" . DA  B 2 30  ? 39.428 84.882  53.336  1.00 98.78  ? 129  DA  D "C3'" 1 
ATOM   1355  O  "O3'" . DA  B 2 30  ? 40.792 85.301  53.161  1.00 106.06 ? 129  DA  D "O3'" 1 
ATOM   1356  C  "C2'" . DA  B 2 30  ? 38.927 84.008  52.198  1.00 93.87  ? 129  DA  D "C2'" 1 
ATOM   1357  C  "C1'" . DA  B 2 30  ? 39.237 82.578  52.647  1.00 81.00  ? 129  DA  D "C1'" 1 
ATOM   1358  N  N9    . DA  B 2 30  ? 38.129 81.661  52.381  1.00 69.75  ? 129  DA  D N9    1 
ATOM   1359  C  C8    . DA  B 2 30  ? 36.802 81.888  52.658  1.00 66.68  ? 129  DA  D C8    1 
ATOM   1360  N  N7    . DA  B 2 30  ? 36.006 80.928  52.262  1.00 59.50  ? 129  DA  D N7    1 
ATOM   1361  C  C5    . DA  B 2 30  ? 36.865 79.997  51.696  1.00 58.78  ? 129  DA  D C5    1 
ATOM   1362  C  C6    . DA  B 2 30  ? 36.633 78.757  51.069  1.00 59.75  ? 129  DA  D C6    1 
ATOM   1363  N  N6    . DA  B 2 30  ? 35.411 78.235  50.889  1.00 59.12  ? 129  DA  D N6    1 
ATOM   1364  N  N1    . DA  B 2 30  ? 37.707 78.071  50.618  1.00 52.28  ? 129  DA  D N1    1 
ATOM   1365  C  C2    . DA  B 2 30  ? 38.921 78.606  50.783  1.00 52.78  ? 129  DA  D C2    1 
ATOM   1366  N  N3    . DA  B 2 30  ? 39.265 79.769  51.344  1.00 52.42  ? 129  DA  D N3    1 
ATOM   1367  C  C4    . DA  B 2 30  ? 38.178 80.425  51.782  1.00 59.94  ? 129  DA  D C4    1 
ATOM   1368  P  P     . DA  B 2 31  ? 41.121 86.638  52.323  1.00 105.48 ? 130  DA  D P     1 
ATOM   1369  O  OP1   . DA  B 2 31  ? 42.157 87.404  53.070  1.00 104.34 ? 130  DA  D OP1   1 
ATOM   1370  O  OP2   . DA  B 2 31  ? 39.817 87.278  51.989  1.00 100.35 ? 130  DA  D OP2   1 
ATOM   1371  O  "O5'" . DA  B 2 31  ? 41.770 86.089  50.977  1.00 101.16 ? 130  DA  D "O5'" 1 
ATOM   1372  C  "C5'" . DA  B 2 31  ? 41.258 84.909  50.384  1.00 95.00  ? 130  DA  D "C5'" 1 
ATOM   1373  C  "C4'" . DA  B 2 31  ? 42.315 84.206  49.567  1.00 92.63  ? 130  DA  D "C4'" 1 
ATOM   1374  O  "O4'" . DA  B 2 31  ? 41.855 82.854  49.378  1.00 91.77  ? 130  DA  D "O4'" 1 
ATOM   1375  C  "C3'" . DA  B 2 31  ? 42.493 84.770  48.161  1.00 96.95  ? 130  DA  D "C3'" 1 
ATOM   1376  O  "O3'" . DA  B 2 31  ? 43.814 84.507  47.664  1.00 95.06  ? 130  DA  D "O3'" 1 
ATOM   1377  C  "C2'" . DA  B 2 31  ? 41.430 84.036  47.359  1.00 94.22  ? 130  DA  D "C2'" 1 
ATOM   1378  C  "C1'" . DA  B 2 31  ? 41.227 82.717  48.106  1.00 87.93  ? 130  DA  D "C1'" 1 
ATOM   1379  N  N9    . DA  B 2 31  ? 39.812 82.422  48.352  1.00 76.34  ? 130  DA  D N9    1 
ATOM   1380  C  C8    . DA  B 2 31  ? 38.914 83.218  49.020  1.00 67.83  ? 130  DA  D C8    1 
ATOM   1381  N  N7    . DA  B 2 31  ? 37.705 82.720  49.078  1.00 68.49  ? 130  DA  D N7    1 
ATOM   1382  C  C5    . DA  B 2 31  ? 37.811 81.513  48.404  1.00 69.66  ? 130  DA  D C5    1 
ATOM   1383  C  C6    . DA  B 2 31  ? 36.870 80.518  48.105  1.00 68.71  ? 130  DA  D C6    1 
ATOM   1384  N  N6    . DA  B 2 31  ? 35.588 80.586  48.458  1.00 66.95  ? 130  DA  D N6    1 
ATOM   1385  N  N1    . DA  B 2 31  ? 37.295 79.439  47.421  1.00 71.55  ? 130  DA  D N1    1 
ATOM   1386  C  C2    . DA  B 2 31  ? 38.584 79.376  47.063  1.00 75.39  ? 130  DA  D C2    1 
ATOM   1387  N  N3    . DA  B 2 31  ? 39.565 80.249  47.279  1.00 73.39  ? 130  DA  D N3    1 
ATOM   1388  C  C4    . DA  B 2 31  ? 39.106 81.310  47.961  1.00 72.74  ? 130  DA  D C4    1 
ATOM   1389  P  P     . DG  B 2 32  ? 44.223 84.991  46.184  1.00 96.02  ? 131  DG  D P     1 
ATOM   1390  O  OP1   . DG  B 2 32  ? 45.704 84.887  46.061  1.00 89.46  ? 131  DG  D OP1   1 
ATOM   1391  O  OP2   . DG  B 2 32  ? 43.546 86.292  45.936  1.00 93.77  ? 131  DG  D OP2   1 
ATOM   1392  O  "O5'" . DG  B 2 32  ? 43.571 83.895  45.229  1.00 91.30  ? 131  DG  D "O5'" 1 
ATOM   1393  C  "C5'" . DG  B 2 32  ? 44.058 82.556  45.237  1.00 80.76  ? 131  DG  D "C5'" 1 
ATOM   1394  C  "C4'" . DG  B 2 32  ? 43.266 81.687  44.288  1.00 77.77  ? 131  DG  D "C4'" 1 
ATOM   1395  O  "O4'" . DG  B 2 32  ? 41.921 81.454  44.779  1.00 71.75  ? 131  DG  D "O4'" 1 
ATOM   1396  C  "C3'" . DG  B 2 32  ? 43.111 82.213  42.862  1.00 85.25  ? 131  DG  D "C3'" 1 
ATOM   1397  O  "O3'" . DG  B 2 32  ? 43.366 81.144  41.953  1.00 95.73  ? 131  DG  D "O3'" 1 
ATOM   1398  C  "C2'" . DG  B 2 32  ? 41.649 82.627  42.786  1.00 71.96  ? 131  DG  D "C2'" 1 
ATOM   1399  C  "C1'" . DG  B 2 32  ? 40.996 81.625  43.717  1.00 58.90  ? 131  DG  D "C1'" 1 
ATOM   1400  N  N9    . DG  B 2 32  ? 39.716 82.030  44.294  1.00 43.03  ? 131  DG  D N9    1 
ATOM   1401  C  C8    . DG  B 2 32  ? 39.471 83.135  45.072  1.00 42.03  ? 131  DG  D C8    1 
ATOM   1402  N  N7    . DG  B 2 32  ? 38.225 83.226  45.461  1.00 34.54  ? 131  DG  D N7    1 
ATOM   1403  C  C5    . DG  B 2 32  ? 37.610 82.114  44.904  1.00 32.25  ? 131  DG  D C5    1 
ATOM   1404  C  C6    . DG  B 2 32  ? 36.271 81.684  44.987  1.00 37.49  ? 131  DG  D C6    1 
ATOM   1405  O  O6    . DG  B 2 32  ? 35.328 82.219  45.597  1.00 37.29  ? 131  DG  D O6    1 
ATOM   1406  N  N1    . DG  B 2 32  ? 36.066 80.504  44.269  1.00 30.26  ? 131  DG  D N1    1 
ATOM   1407  C  C2    . DG  B 2 32  ? 37.038 79.831  43.566  1.00 37.73  ? 131  DG  D C2    1 
ATOM   1408  N  N2    . DG  B 2 32  ? 36.653 78.715  42.921  1.00 40.25  ? 131  DG  D N2    1 
ATOM   1409  N  N3    . DG  B 2 32  ? 38.300 80.223  43.494  1.00 34.69  ? 131  DG  D N3    1 
ATOM   1410  C  C4    . DG  B 2 32  ? 38.512 81.366  44.177  1.00 35.45  ? 131  DG  D C4    1 
ATOM   1411  P  P     . DT  B 2 33  ? 43.298 81.408  40.374  1.00 100.85 ? 132  DT  D P     1 
ATOM   1412  O  OP1   . DT  B 2 33  ? 44.322 80.545  39.721  1.00 97.79  ? 132  DT  D OP1   1 
ATOM   1413  O  OP2   . DT  B 2 33  ? 43.332 82.881  40.171  1.00 101.75 ? 132  DT  D OP2   1 
ATOM   1414  O  "O5'" . DT  B 2 33  ? 41.852 80.869  39.980  1.00 95.69  ? 132  DT  D "O5'" 1 
ATOM   1415  C  "C5'" . DT  B 2 33  ? 41.531 79.495  40.161  1.00 85.65  ? 132  DT  D "C5'" 1 
ATOM   1416  C  "C4'" . DT  B 2 33  ? 40.295 79.130  39.373  1.00 83.74  ? 132  DT  D "C4'" 1 
ATOM   1417  O  "O4'" . DT  B 2 33  ? 39.084 79.490  40.087  1.00 77.55  ? 132  DT  D "O4'" 1 
ATOM   1418  C  "C3'" . DT  B 2 33  ? 40.198 79.783  37.996  1.00 90.15  ? 132  DT  D "C3'" 1 
ATOM   1419  O  "O3'" . DT  B 2 33  ? 39.776 78.806  37.037  1.00 98.88  ? 132  DT  D "O3'" 1 
ATOM   1420  C  "C2'" . DT  B 2 33  ? 39.146 80.865  38.199  1.00 79.37  ? 132  DT  D "C2'" 1 
ATOM   1421  C  "C1'" . DT  B 2 33  ? 38.230 80.238  39.238  1.00 67.34  ? 132  DT  D "C1'" 1 
ATOM   1422  N  N1    . DT  B 2 33  ? 37.462 81.180  40.083  1.00 53.40  ? 132  DT  D N1    1 
ATOM   1423  C  C2    . DT  B 2 33  ? 36.117 80.943  40.232  1.00 51.57  ? 132  DT  D C2    1 
ATOM   1424  O  O2    . DT  B 2 33  ? 35.550 80.003  39.705  1.00 49.87  ? 132  DT  D O2    1 
ATOM   1425  N  N3    . DT  B 2 33  ? 35.455 81.846  41.032  1.00 53.27  ? 132  DT  D N3    1 
ATOM   1426  C  C4    . DT  B 2 33  ? 35.999 82.932  41.689  1.00 54.07  ? 132  DT  D C4    1 
ATOM   1427  O  O4    . DT  B 2 33  ? 35.277 83.660  42.376  1.00 51.69  ? 132  DT  D O4    1 
ATOM   1428  C  C5    . DT  B 2 33  ? 37.424 83.116  41.497  1.00 46.13  ? 132  DT  D C5    1 
ATOM   1429  C  C7    . DT  B 2 33  ? 38.108 84.249  42.193  1.00 55.64  ? 132  DT  D C7    1 
ATOM   1430  C  C6    . DT  B 2 33  ? 38.072 82.249  40.705  1.00 45.36  ? 132  DT  D C6    1 
ATOM   1431  P  P     . DT  B 2 34  ? 40.416 78.804  35.561  1.00 102.07 ? 133  DT  D P     1 
ATOM   1432  O  OP1   . DT  B 2 34  ? 40.321 77.419  35.019  1.00 100.30 ? 133  DT  D OP1   1 
ATOM   1433  O  OP2   . DT  B 2 34  ? 41.740 79.483  35.623  1.00 98.01  ? 133  DT  D OP2   1 
ATOM   1434  O  "O5'" . DT  B 2 34  ? 39.425 79.744  34.747  1.00 99.44  ? 133  DT  D "O5'" 1 
ATOM   1435  C  "C5'" . DT  B 2 34  ? 38.210 80.162  35.347  1.00 96.03  ? 133  DT  D "C5'" 1 
ATOM   1436  C  "C4'" . DT  B 2 34  ? 37.111 79.184  35.015  1.00 91.24  ? 133  DT  D "C4'" 1 
ATOM   1437  O  "O4'" . DT  B 2 34  ? 36.101 79.236  36.044  1.00 83.90  ? 133  DT  D "O4'" 1 
ATOM   1438  C  "C3'" . DT  B 2 34  ? 36.404 79.491  33.705  1.00 96.25  ? 133  DT  D "C3'" 1 
ATOM   1439  O  "O3'" . DT  B 2 34  ? 36.062 78.290  33.014  1.00 102.87 ? 133  DT  D "O3'" 1 
ATOM   1440  C  "C2'" . DT  B 2 34  ? 35.190 80.300  34.137  1.00 89.34  ? 133  DT  D "C2'" 1 
ATOM   1441  C  "C1'" . DT  B 2 34  ? 34.928 79.889  35.588  1.00 77.71  ? 133  DT  D "C1'" 1 
ATOM   1442  N  N1    . DT  B 2 34  ? 34.713 81.037  36.489  1.00 69.36  ? 133  DT  D N1    1 
ATOM   1443  C  C2    . DT  B 2 34  ? 33.495 81.212  37.112  1.00 69.09  ? 133  DT  D C2    1 
ATOM   1444  O  O2    . DT  B 2 34  ? 32.544 80.470  36.951  1.00 71.63  ? 133  DT  D O2    1 
ATOM   1445  N  N3    . DT  B 2 34  ? 33.432 82.301  37.940  1.00 60.44  ? 133  DT  D N3    1 
ATOM   1446  C  C4    . DT  B 2 34  ? 34.440 83.210  38.202  1.00 55.39  ? 133  DT  D C4    1 
ATOM   1447  O  O4    . DT  B 2 34  ? 34.247 84.134  38.993  1.00 48.98  ? 133  DT  D O4    1 
ATOM   1448  C  C5    . DT  B 2 34  ? 35.681 82.972  37.504  1.00 53.73  ? 133  DT  D C5    1 
ATOM   1449  C  C7    . DT  B 2 34  ? 36.830 83.909  37.720  1.00 55.64  ? 133  DT  D C7    1 
ATOM   1450  C  C6    . DT  B 2 34  ? 35.752 81.914  36.694  1.00 59.79  ? 133  DT  D C6    1 
ATOM   1451  P  P     . DA  B 2 35  ? 35.381 78.378  31.560  1.00 105.15 ? 134  DA  D P     1 
ATOM   1452  O  OP1   . DA  B 2 35  ? 35.864 77.238  30.729  1.00 102.69 ? 134  DA  D OP1   1 
ATOM   1453  O  OP2   . DA  B 2 35  ? 35.545 79.773  31.065  1.00 100.77 ? 134  DA  D OP2   1 
ATOM   1454  O  "O5'" . DA  B 2 35  ? 33.840 78.149  31.875  1.00 101.79 ? 134  DA  D "O5'" 1 
ATOM   1455  C  "C5'" . DA  B 2 35  ? 32.838 78.654  31.014  1.00 94.97  ? 134  DA  D "C5'" 1 
ATOM   1456  C  "C4'" . DA  B 2 35  ? 31.504 78.607  31.713  1.00 88.62  ? 134  DA  D "C4'" 1 
ATOM   1457  O  "O4'" . DA  B 2 35  ? 31.592 79.378  32.930  1.00 77.27  ? 134  DA  D "O4'" 1 
ATOM   1458  C  "C3'" . DA  B 2 35  ? 30.362 79.216  30.913  1.00 92.51  ? 134  DA  D "C3'" 1 
ATOM   1459  O  "O3'" . DA  B 2 35  ? 29.167 78.469  31.137  1.00 103.04 ? 134  DA  D "O3'" 1 
ATOM   1460  C  "C2'" . DA  B 2 35  ? 30.267 80.636  31.449  1.00 82.09  ? 134  DA  D "C2'" 1 
ATOM   1461  C  "C1'" . DA  B 2 35  ? 30.710 80.494  32.894  1.00 73.99  ? 134  DA  D "C1'" 1 
ATOM   1462  N  N9    . DA  B 2 35  ? 31.443 81.641  33.435  1.00 62.94  ? 134  DA  D N9    1 
ATOM   1463  C  C8    . DA  B 2 35  ? 32.732 82.004  33.136  1.00 61.93  ? 134  DA  D C8    1 
ATOM   1464  N  N7    . DA  B 2 35  ? 33.171 83.025  33.831  1.00 57.72  ? 134  DA  D N7    1 
ATOM   1465  C  C5    . DA  B 2 35  ? 32.093 83.368  34.632  1.00 56.67  ? 134  DA  D C5    1 
ATOM   1466  C  C6    . DA  B 2 35  ? 31.934 84.349  35.620  1.00 57.67  ? 134  DA  D C6    1 
ATOM   1467  N  N6    . DA  B 2 35  ? 32.916 85.160  36.011  1.00 44.53  ? 134  DA  D N6    1 
ATOM   1468  N  N1    . DA  B 2 35  ? 30.725 84.453  36.219  1.00 55.79  ? 134  DA  D N1    1 
ATOM   1469  C  C2    . DA  B 2 35  ? 29.757 83.593  35.860  1.00 57.81  ? 134  DA  D C2    1 
ATOM   1470  N  N3    . DA  B 2 35  ? 29.799 82.604  34.963  1.00 56.47  ? 134  DA  D N3    1 
ATOM   1471  C  C4    . DA  B 2 35  ? 31.011 82.545  34.378  1.00 55.63  ? 134  DA  D C4    1 
ATOM   1472  P  P     . DT  B 2 36  ? 27.810 78.931  30.428  1.00 105.89 ? 135  DT  D P     1 
ATOM   1473  O  OP1   . DT  B 2 36  ? 26.701 77.996  30.756  1.00 106.13 ? 135  DT  D OP1   1 
ATOM   1474  O  OP2   . DT  B 2 36  ? 28.155 79.192  29.011  1.00 108.52 ? 135  DT  D OP2   1 
ATOM   1475  O  "O5'" . DT  B 2 36  ? 27.517 80.318  31.142  1.00 100.44 ? 135  DT  D "O5'" 1 
ATOM   1476  C  "C5'" . DT  B 2 36  ? 26.479 81.160  30.690  1.00 97.98  ? 135  DT  D "C5'" 1 
ATOM   1477  C  "C4'" . DT  B 2 36  ? 25.802 81.806  31.873  1.00 94.13  ? 135  DT  D "C4'" 1 
ATOM   1478  O  "O4'" . DT  B 2 36  ? 26.823 82.384  32.722  1.00 89.78  ? 135  DT  D "O4'" 1 
ATOM   1479  C  "C3'" . DT  B 2 36  ? 24.869 82.946  31.475  1.00 94.70  ? 135  DT  D "C3'" 1 
ATOM   1480  O  "O3'" . DT  B 2 36  ? 23.679 82.946  32.258  1.00 103.06 ? 135  DT  D "O3'" 1 
ATOM   1481  C  "C2'" . DT  B 2 36  ? 25.698 84.189  31.725  1.00 88.81  ? 135  DT  D "C2'" 1 
ATOM   1482  C  "C1'" . DT  B 2 36  ? 26.609 83.778  32.867  1.00 83.21  ? 135  DT  D "C1'" 1 
ATOM   1483  N  N1    . DT  B 2 36  ? 27.920 84.444  32.838  1.00 68.67  ? 135  DT  D N1    1 
ATOM   1484  C  C2    . DT  B 2 36  ? 28.120 85.504  33.699  1.00 68.96  ? 135  DT  D C2    1 
ATOM   1485  O  O2    . DT  B 2 36  ? 27.264 85.902  34.474  1.00 70.50  ? 135  DT  D O2    1 
ATOM   1486  N  N3    . DT  B 2 36  ? 29.364 86.086  33.619  1.00 61.36  ? 135  DT  D N3    1 
ATOM   1487  C  C4    . DT  B 2 36  ? 30.400 85.725  32.780  1.00 60.73  ? 135  DT  D C4    1 
ATOM   1488  O  O4    . DT  B 2 36  ? 31.463 86.346  32.821  1.00 49.41  ? 135  DT  D O4    1 
ATOM   1489  C  C5    . DT  B 2 36  ? 30.115 84.602  31.896  1.00 60.11  ? 135  DT  D C5    1 
ATOM   1490  C  C7    . DT  B 2 36  ? 31.170 84.147  30.937  1.00 55.64  ? 135  DT  D C7    1 
ATOM   1491  C  C6    . DT  B 2 36  ? 28.908 84.024  31.976  1.00 60.15  ? 135  DT  D C6    1 
ATOM   1492  P  P     . DC  B 2 37  ? 22.393 83.741  31.726  1.00 107.29 ? 136  DC  D P     1 
ATOM   1493  O  OP1   . DC  B 2 37  ? 21.170 83.037  32.195  1.00 103.94 ? 136  DC  D OP1   1 
ATOM   1494  O  OP2   . DC  B 2 37  ? 22.599 83.963  30.272  1.00 109.33 ? 136  DC  D OP2   1 
ATOM   1495  O  "O5'" . DC  B 2 37  ? 22.499 85.149  32.465  1.00 104.57 ? 136  DC  D "O5'" 1 
ATOM   1496  C  "C5'" . DC  B 2 37  ? 22.488 85.207  33.888  1.00 101.96 ? 136  DC  D "C5'" 1 
ATOM   1497  C  "C4'" . DC  B 2 37  ? 22.957 86.558  34.381  1.00 99.82  ? 136  DC  D "C4'" 1 
ATOM   1498  O  "O4'" . DC  B 2 37  ? 24.350 86.782  34.042  1.00 98.32  ? 136  DC  D "O4'" 1 
ATOM   1499  C  "C3'" . DC  B 2 37  ? 22.196 87.773  33.849  1.00 98.37  ? 136  DC  D "C3'" 1 
ATOM   1500  O  "O3'" . DC  B 2 37  ? 22.192 88.738  34.911  1.00 93.99  ? 136  DC  D "O3'" 1 
ATOM   1501  C  "C2'" . DC  B 2 37  ? 23.128 88.303  32.772  1.00 96.73  ? 136  DC  D "C2'" 1 
ATOM   1502  C  "C1'" . DC  B 2 37  ? 24.475 88.053  33.423  1.00 88.51  ? 136  DC  D "C1'" 1 
ATOM   1503  N  N1    . DC  B 2 37  ? 25.644 88.019  32.531  1.00 74.11  ? 136  DC  D N1    1 
ATOM   1504  C  C2    . DC  B 2 37  ? 26.712 88.881  32.798  1.00 68.20  ? 136  DC  D C2    1 
ATOM   1505  O  O2    . DC  B 2 37  ? 26.608 89.680  33.734  1.00 67.67  ? 136  DC  D O2    1 
ATOM   1506  N  N3    . DC  B 2 37  ? 27.824 88.823  32.028  1.00 59.58  ? 136  DC  D N3    1 
ATOM   1507  C  C4    . DC  B 2 37  ? 27.886 87.952  31.014  1.00 62.16  ? 136  DC  D C4    1 
ATOM   1508  N  N4    . DC  B 2 37  ? 29.018 87.896  30.291  1.00 43.31  ? 136  DC  D N4    1 
ATOM   1509  C  C5    . DC  B 2 37  ? 26.793 87.088  30.697  1.00 62.32  ? 136  DC  D C5    1 
ATOM   1510  C  C6    . DC  B 2 37  ? 25.702 87.156  31.476  1.00 67.05  ? 136  DC  D C6    1 
ATOM   1511  O  "O5'" . DC  C 1 1   ? 30.927 -12.887 104.925 1.00 153.54 ? 100  DC  G "O5'" 1 
ATOM   1512  C  "C5'" . DC  C 1 1   ? 30.801 -14.245 105.360 1.00 157.20 ? 100  DC  G "C5'" 1 
ATOM   1513  C  "C4'" . DC  C 1 1   ? 29.866 -15.049 104.485 1.00 159.25 ? 100  DC  G "C4'" 1 
ATOM   1514  O  "O4'" . DC  C 1 1   ? 28.495 -14.641 104.730 1.00 158.92 ? 100  DC  G "O4'" 1 
ATOM   1515  C  "C3'" . DC  C 1 1   ? 30.109 -14.856 102.989 1.00 159.66 ? 100  DC  G "C3'" 1 
ATOM   1516  O  "O3'" . DC  C 1 1   ? 29.980 -16.084 102.268 1.00 158.36 ? 100  DC  G "O3'" 1 
ATOM   1517  C  "C2'" . DC  C 1 1   ? 29.021 -13.885 102.573 1.00 158.45 ? 100  DC  G "C2'" 1 
ATOM   1518  C  "C1'" . DC  C 1 1   ? 27.881 -14.210 103.523 1.00 154.38 ? 100  DC  G "C1'" 1 
ATOM   1519  N  N1    . DC  C 1 1   ? 27.061 -13.027 103.829 1.00 145.96 ? 100  DC  G N1    1 
ATOM   1520  C  C2    . DC  C 1 1   ? 25.702 -13.026 103.488 1.00 139.70 ? 100  DC  G C2    1 
ATOM   1521  O  O2    . DC  C 1 1   ? 25.207 -14.043 102.976 1.00 133.18 ? 100  DC  G O2    1 
ATOM   1522  N  N3    . DC  C 1 1   ? 24.965 -11.914 103.726 1.00 135.36 ? 100  DC  G N3    1 
ATOM   1523  C  C4    . DC  C 1 1   ? 25.537 -10.841 104.285 1.00 133.75 ? 100  DC  G C4    1 
ATOM   1524  N  N4    . DC  C 1 1   ? 24.786 -9.756  104.485 1.00 127.09 ? 100  DC  G N4    1 
ATOM   1525  C  C5    . DC  C 1 1   ? 26.909 -10.828 104.662 1.00 136.03 ? 100  DC  G C5    1 
ATOM   1526  C  C6    . DC  C 1 1   ? 27.625 -11.931 104.421 1.00 141.70 ? 100  DC  G C6    1 
ATOM   1527  P  P     . DG  C 1 2   ? 30.497 -16.160 100.748 1.00 158.58 ? 101  DG  G P     1 
ATOM   1528  O  OP1   . DG  C 1 2   ? 29.672 -17.158 100.018 1.00 157.94 ? 101  DG  G OP1   1 
ATOM   1529  O  OP2   . DG  C 1 2   ? 31.976 -16.308 100.776 1.00 158.13 ? 101  DG  G OP2   1 
ATOM   1530  O  "O5'" . DG  C 1 2   ? 30.163 -14.708 100.184 1.00 149.60 ? 101  DG  G "O5'" 1 
ATOM   1531  C  "C5'" . DG  C 1 2   ? 30.002 -14.477 98.792  1.00 133.83 ? 101  DG  G "C5'" 1 
ATOM   1532  C  "C4'" . DG  C 1 2   ? 28.603 -14.857 98.366  1.00 123.78 ? 101  DG  G "C4'" 1 
ATOM   1533  O  "O4'" . DG  C 1 2   ? 27.636 -14.243 99.251  1.00 116.05 ? 101  DG  G "O4'" 1 
ATOM   1534  C  "C3'" . DG  C 1 2   ? 28.237 -14.407 96.956  1.00 123.31 ? 101  DG  G "C3'" 1 
ATOM   1535  O  "O3'" . DG  C 1 2   ? 27.471 -15.411 96.295  1.00 123.84 ? 101  DG  G "O3'" 1 
ATOM   1536  C  "C2'" . DG  C 1 2   ? 27.400 -13.162 97.183  1.00 117.99 ? 101  DG  G "C2'" 1 
ATOM   1537  C  "C1'" . DG  C 1 2   ? 26.720 -13.448 98.510  1.00 110.95 ? 101  DG  G "C1'" 1 
ATOM   1538  N  N9    . DG  C 1 2   ? 26.437 -12.247 99.291  1.00 102.72 ? 101  DG  G N9    1 
ATOM   1539  C  C8    . DG  C 1 2   ? 27.332 -11.515 100.036 1.00 97.80  ? 101  DG  G C8    1 
ATOM   1540  N  N7    . DG  C 1 2   ? 26.789 -10.480 100.618 1.00 95.06  ? 101  DG  G N7    1 
ATOM   1541  C  C5    . DG  C 1 2   ? 25.455 -10.532 100.237 1.00 98.00  ? 101  DG  G C5    1 
ATOM   1542  C  C6    . DG  C 1 2   ? 24.377 -9.670  100.556 1.00 98.48  ? 101  DG  G C6    1 
ATOM   1543  O  O6    . DG  C 1 2   ? 24.389 -8.655  101.255 1.00 96.89  ? 101  DG  G O6    1 
ATOM   1544  N  N1    . DG  C 1 2   ? 23.192 -10.089 99.961  1.00 98.87  ? 101  DG  G N1    1 
ATOM   1545  C  C2    . DG  C 1 2   ? 23.060 -11.196 99.157  1.00 103.17 ? 101  DG  G C2    1 
ATOM   1546  N  N2    . DG  C 1 2   ? 21.831 -11.437 98.674  1.00 103.00 ? 101  DG  G N2    1 
ATOM   1547  N  N3    . DG  C 1 2   ? 24.061 -12.008 98.849  1.00 101.26 ? 101  DG  G N3    1 
ATOM   1548  C  C4    . DG  C 1 2   ? 25.221 -11.619 99.420  1.00 100.01 ? 101  DG  G C4    1 
ATOM   1549  P  P     . DA  C 1 3   ? 27.281 -15.335 94.705  1.00 123.88 ? 102  DA  G P     1 
ATOM   1550  O  OP1   . DA  C 1 3   ? 26.767 -16.655 94.248  1.00 123.73 ? 102  DA  G OP1   1 
ATOM   1551  O  OP2   . DA  C 1 3   ? 28.549 -14.802 94.140  1.00 122.59 ? 102  DA  G OP2   1 
ATOM   1552  O  "O5'" . DA  C 1 3   ? 26.137 -14.239 94.516  1.00 116.49 ? 102  DA  G "O5'" 1 
ATOM   1553  C  "C5'" . DA  C 1 3   ? 24.783 -14.555 94.829  1.00 102.40 ? 102  DA  G "C5'" 1 
ATOM   1554  C  "C4'" . DA  C 1 3   ? 23.856 -13.425 94.438  1.00 97.39  ? 102  DA  G "C4'" 1 
ATOM   1555  O  "O4'" . DA  C 1 3   ? 23.856 -12.364 95.426  1.00 90.04  ? 102  DA  G "O4'" 1 
ATOM   1556  C  "C3'" . DA  C 1 3   ? 24.115 -12.761 93.085  1.00 98.03  ? 102  DA  G "C3'" 1 
ATOM   1557  O  "O3'" . DA  C 1 3   ? 22.874 -12.626 92.381  1.00 101.23 ? 102  DA  G "O3'" 1 
ATOM   1558  C  "C2'" . DA  C 1 3   ? 24.689 -11.402 93.457  1.00 88.07  ? 102  DA  G "C2'" 1 
ATOM   1559  C  "C1'" . DA  C 1 3   ? 24.028 -11.102 94.797  1.00 76.30  ? 102  DA  G "C1'" 1 
ATOM   1560  N  N9    . DA  C 1 3   ? 24.835 -10.273 95.695  1.00 60.65  ? 102  DA  G N9    1 
ATOM   1561  C  C8    . DA  C 1 3   ? 26.180 -10.399 95.955  1.00 56.57  ? 102  DA  G C8    1 
ATOM   1562  N  N7    . DA  C 1 3   ? 26.635 -9.534  96.831  1.00 45.77  ? 102  DA  G N7    1 
ATOM   1563  C  C5    . DA  C 1 3   ? 25.519 -8.785  97.168  1.00 39.34  ? 102  DA  G C5    1 
ATOM   1564  C  C6    . DA  C 1 3   ? 25.343 -7.712  98.056  1.00 36.79  ? 102  DA  G C6    1 
ATOM   1565  N  N6    . DA  C 1 3   ? 26.329 -7.212  98.801  1.00 38.67  ? 102  DA  G N6    1 
ATOM   1566  N  N1    . DA  C 1 3   ? 24.103 -7.168  98.155  1.00 28.92  ? 102  DA  G N1    1 
ATOM   1567  C  C2    . DA  C 1 3   ? 23.111 -7.690  97.403  1.00 34.53  ? 102  DA  G C2    1 
ATOM   1568  N  N3    . DA  C 1 3   ? 23.155 -8.712  96.537  1.00 37.58  ? 102  DA  G N3    1 
ATOM   1569  C  C4    . DA  C 1 3   ? 24.402 -9.220  96.466  1.00 44.86  ? 102  DA  G C4    1 
ATOM   1570  P  P     . DT  C 1 4   ? 22.843 -11.926 90.938  1.00 101.99 ? 103  DT  G P     1 
ATOM   1571  O  OP1   . DT  C 1 4   ? 21.651 -12.455 90.216  1.00 97.09  ? 103  DT  G OP1   1 
ATOM   1572  O  OP2   . DT  C 1 4   ? 24.198 -12.054 90.330  1.00 98.52  ? 103  DT  G OP2   1 
ATOM   1573  O  "O5'" . DT  C 1 4   ? 22.581 -10.398 91.309  1.00 99.45  ? 103  DT  G "O5'" 1 
ATOM   1574  C  "C5'" . DT  C 1 4   ? 21.435 -10.037 92.082  1.00 92.46  ? 103  DT  G "C5'" 1 
ATOM   1575  C  "C4'" . DT  C 1 4   ? 21.362 -8.539  92.278  1.00 86.37  ? 103  DT  G "C4'" 1 
ATOM   1576  O  "O4'" . DT  C 1 4   ? 22.241 -8.093  93.340  1.00 81.81  ? 103  DT  G "O4'" 1 
ATOM   1577  C  "C3'" . DT  C 1 4   ? 21.710 -7.683  91.058  1.00 84.48  ? 103  DT  G "C3'" 1 
ATOM   1578  O  "O3'" . DT  C 1 4   ? 20.788 -6.598  90.962  1.00 83.39  ? 103  DT  G "O3'" 1 
ATOM   1579  C  "C2'" . DT  C 1 4   ? 23.074 -7.123  91.417  1.00 76.70  ? 103  DT  G "C2'" 1 
ATOM   1580  C  "C1'" . DT  C 1 4   ? 22.879 -6.914  92.900  1.00 69.48  ? 103  DT  G "C1'" 1 
ATOM   1581  N  N1    . DT  C 1 4   ? 24.082 -6.686  93.719  1.00 53.35  ? 103  DT  G N1    1 
ATOM   1582  C  C2    . DT  C 1 4   ? 23.966 -5.766  94.728  1.00 45.91  ? 103  DT  G C2    1 
ATOM   1583  O  O2    . DT  C 1 4   ? 22.926 -5.185  94.976  1.00 38.61  ? 103  DT  G O2    1 
ATOM   1584  N  N3    . DT  C 1 4   ? 25.110 -5.549  95.443  1.00 40.36  ? 103  DT  G N3    1 
ATOM   1585  C  C4    . DT  C 1 4   ? 26.335 -6.153  95.259  1.00 46.30  ? 103  DT  G C4    1 
ATOM   1586  O  O4    . DT  C 1 4   ? 27.281 -5.853  95.984  1.00 52.43  ? 103  DT  G O4    1 
ATOM   1587  C  C5    . DT  C 1 4   ? 26.389 -7.123  94.190  1.00 45.26  ? 103  DT  G C5    1 
ATOM   1588  C  C7    . DT  C 1 4   ? 27.682 -7.831  93.923  1.00 71.90  ? 103  DT  G C7    1 
ATOM   1589  C  C6    . DT  C 1 4   ? 25.269 -7.342  93.482  1.00 47.39  ? 103  DT  G C6    1 
ATOM   1590  P  P     . DA  C 1 5   ? 20.567 -5.866  89.551  1.00 85.21  ? 104  DA  G P     1 
ATOM   1591  O  OP1   . DA  C 1 5   ? 19.334 -6.424  88.935  1.00 82.39  ? 104  DA  G OP1   1 
ATOM   1592  O  OP2   . DA  C 1 5   ? 21.852 -5.904  88.800  1.00 81.76  ? 104  DA  G OP2   1 
ATOM   1593  O  "O5'" . DA  C 1 5   ? 20.255 -4.365  89.966  1.00 78.27  ? 104  DA  G "O5'" 1 
ATOM   1594  C  "C5'" . DA  C 1 5   ? 19.180 -4.088  90.851  1.00 75.46  ? 104  DA  G "C5'" 1 
ATOM   1595  C  "C4'" . DA  C 1 5   ? 19.416 -2.783  91.570  1.00 72.05  ? 104  DA  G "C4'" 1 
ATOM   1596  O  "O4'" . DA  C 1 5   ? 20.629 -2.847  92.357  1.00 67.98  ? 104  DA  G "O4'" 1 
ATOM   1597  C  "C3'" . DA  C 1 5   ? 19.579 -1.584  90.652  1.00 71.10  ? 104  DA  G "C3'" 1 
ATOM   1598  O  "O3'" . DA  C 1 5   ? 18.939 -0.477  91.268  1.00 71.07  ? 104  DA  G "O3'" 1 
ATOM   1599  C  "C2'" . DA  C 1 5   ? 21.083 -1.398  90.573  1.00 65.65  ? 104  DA  G "C2'" 1 
ATOM   1600  C  "C1'" . DA  C 1 5   ? 21.557 -1.858  91.942  1.00 59.06  ? 104  DA  G "C1'" 1 
ATOM   1601  N  N9    . DA  C 1 5   ? 22.882 -2.479  91.939  1.00 49.78  ? 104  DA  G N9    1 
ATOM   1602  C  C8    . DA  C 1 5   ? 23.340 -3.414  91.049  1.00 50.42  ? 104  DA  G C8    1 
ATOM   1603  N  N7    . DA  C 1 5   ? 24.558 -3.835  91.299  1.00 45.67  ? 104  DA  G N7    1 
ATOM   1604  C  C5    . DA  C 1 5   ? 24.929 -3.127  92.427  1.00 36.16  ? 104  DA  G C5    1 
ATOM   1605  C  C6    . DA  C 1 5   ? 26.107 -3.131  93.190  1.00 37.98  ? 104  DA  G C6    1 
ATOM   1606  N  N6    . DA  C 1 5   ? 27.158 -3.924  92.913  1.00 31.27  ? 104  DA  G N6    1 
ATOM   1607  N  N1    . DA  C 1 5   ? 26.173 -2.292  94.256  1.00 36.30  ? 104  DA  G N1    1 
ATOM   1608  C  C2    . DA  C 1 5   ? 25.114 -1.512  94.520  1.00 40.77  ? 104  DA  G C2    1 
ATOM   1609  N  N3    . DA  C 1 5   ? 23.941 -1.427  93.873  1.00 38.53  ? 104  DA  G N3    1 
ATOM   1610  C  C4    . DA  C 1 5   ? 23.914 -2.273  92.827  1.00 38.68  ? 104  DA  G C4    1 
ATOM   1611  P  P     . DA  C 1 6   ? 18.571 0.805   90.395  1.00 70.59  ? 105  DA  G P     1 
ATOM   1612  O  OP1   . DA  C 1 6   ? 17.358 1.425   91.004  1.00 60.35  ? 105  DA  G OP1   1 
ATOM   1613  O  OP2   . DA  C 1 6   ? 18.537 0.367   88.973  1.00 68.06  ? 105  DA  G OP2   1 
ATOM   1614  O  "O5'" . DA  C 1 6   ? 19.842 1.741   90.623  1.00 65.81  ? 105  DA  G "O5'" 1 
ATOM   1615  C  "C5'" . DA  C 1 6   ? 20.141 2.238   91.925  1.00 69.02  ? 105  DA  G "C5'" 1 
ATOM   1616  C  "C4'" . DA  C 1 6   ? 21.513 2.877   91.960  1.00 67.64  ? 105  DA  G "C4'" 1 
ATOM   1617  O  "O4'" . DA  C 1 6   ? 22.566 1.881   92.064  1.00 65.77  ? 105  DA  G "O4'" 1 
ATOM   1618  C  "C3'" . DA  C 1 6   ? 21.882 3.774   90.770  1.00 69.48  ? 105  DA  G "C3'" 1 
ATOM   1619  O  "O3'" . DA  C 1 6   ? 22.455 5.007   91.238  1.00 67.25  ? 105  DA  G "O3'" 1 
ATOM   1620  C  "C2'" . DA  C 1 6   ? 22.948 2.959   90.054  1.00 62.34  ? 105  DA  G "C2'" 1 
ATOM   1621  C  "C1'" . DA  C 1 6   ? 23.626 2.290   91.229  1.00 53.38  ? 105  DA  G "C1'" 1 
ATOM   1622  N  N9    . DA  C 1 6   ? 24.487 1.142   90.934  1.00 51.44  ? 105  DA  G N9    1 
ATOM   1623  C  C8    . DA  C 1 6   ? 24.388 0.211   89.929  1.00 52.71  ? 105  DA  G C8    1 
ATOM   1624  N  N7    . DA  C 1 6   ? 25.401 -0.627  89.886  1.00 50.76  ? 105  DA  G N7    1 
ATOM   1625  C  C5    . DA  C 1 6   ? 26.205 -0.230  90.944  1.00 46.06  ? 105  DA  G C5    1 
ATOM   1626  C  C6    . DA  C 1 6   ? 27.445 -0.686  91.413  1.00 40.60  ? 105  DA  G C6    1 
ATOM   1627  N  N6    . DA  C 1 6   ? 28.139 -1.664  90.834  1.00 33.11  ? 105  DA  G N6    1 
ATOM   1628  N  N1    . DA  C 1 6   ? 27.970 -0.086  92.501  1.00 37.29  ? 105  DA  G N1    1 
ATOM   1629  C  C2    . DA  C 1 6   ? 27.299 0.915   93.057  1.00 37.63  ? 105  DA  G C2    1 
ATOM   1630  N  N3    . DA  C 1 6   ? 26.136 1.453   92.696  1.00 40.78  ? 105  DA  G N3    1 
ATOM   1631  C  C4    . DA  C 1 6   ? 25.637 0.831   91.619  1.00 45.91  ? 105  DA  G C4    1 
ATOM   1632  P  P     . DC  C 1 7   ? 22.178 6.377   90.439  1.00 64.73  ? 106  DC  G P     1 
ATOM   1633  O  OP1   . DC  C 1 7   ? 21.728 7.387   91.420  1.00 64.22  ? 106  DC  G OP1   1 
ATOM   1634  O  OP2   . DC  C 1 7   ? 21.348 6.090   89.247  1.00 67.15  ? 106  DC  G OP2   1 
ATOM   1635  O  "O5'" . DC  C 1 7   ? 23.614 6.793   89.926  1.00 57.83  ? 106  DC  G "O5'" 1 
ATOM   1636  C  "C5'" . DC  C 1 7   ? 24.614 5.813   89.819  1.00 53.53  ? 106  DC  G "C5'" 1 
ATOM   1637  C  "C4'" . DC  C 1 7   ? 25.597 5.969   90.949  1.00 51.21  ? 106  DC  G "C4'" 1 
ATOM   1638  O  "O4'" . DC  C 1 7   ? 26.082 4.652   91.282  1.00 61.74  ? 106  DC  G "O4'" 1 
ATOM   1639  C  "C3'" . DC  C 1 7   ? 26.813 6.810   90.583  1.00 55.94  ? 106  DC  G "C3'" 1 
ATOM   1640  O  "O3'" . DC  C 1 7   ? 27.206 7.704   91.614  1.00 59.03  ? 106  DC  G "O3'" 1 
ATOM   1641  C  "C2'" . DC  C 1 7   ? 27.905 5.791   90.321  1.00 50.14  ? 106  DC  G "C2'" 1 
ATOM   1642  C  "C1'" . DC  C 1 7   ? 27.476 4.548   91.088  1.00 47.11  ? 106  DC  G "C1'" 1 
ATOM   1643  N  N1    . DC  C 1 7   ? 27.712 3.349   90.286  1.00 40.89  ? 106  DC  G N1    1 
ATOM   1644  C  C2    . DC  C 1 7   ? 28.813 2.551   90.575  1.00 44.11  ? 106  DC  G C2    1 
ATOM   1645  O  O2    . DC  C 1 7   ? 29.469 2.792   91.594  1.00 45.95  ? 106  DC  G O2    1 
ATOM   1646  N  N3    . DC  C 1 7   ? 29.128 1.531   89.749  1.00 38.10  ? 106  DC  G N3    1 
ATOM   1647  C  C4    . DC  C 1 7   ? 28.356 1.274   88.688  1.00 35.17  ? 106  DC  G C4    1 
ATOM   1648  N  N4    . DC  C 1 7   ? 28.718 0.275   87.873  1.00 43.16  ? 106  DC  G N4    1 
ATOM   1649  C  C5    . DC  C 1 7   ? 27.178 2.034   88.412  1.00 29.11  ? 106  DC  G C5    1 
ATOM   1650  C  C6    . DC  C 1 7   ? 26.896 3.050   89.233  1.00 30.49  ? 106  DC  G C6    1 
HETATM 1651  N  N1    . UMP C 1 8   ? 32.305 5.254   89.801  1.00 58.57  ? 107  UMP G N1    1 
HETATM 1652  C  C2    . UMP C 1 8   ? 33.085 4.210   89.346  1.00 57.72  ? 107  UMP G C2    1 
HETATM 1653  N  N3    . UMP C 1 8   ? 32.536 3.484   88.322  1.00 58.56  ? 107  UMP G N3    1 
HETATM 1654  C  C4    . UMP C 1 8   ? 31.324 3.698   87.716  1.00 58.69  ? 107  UMP G C4    1 
HETATM 1655  C  C5    . UMP C 1 8   ? 30.595 4.815   88.217  1.00 57.17  ? 107  UMP G C5    1 
HETATM 1656  C  C6    . UMP C 1 8   ? 31.098 5.539   89.220  1.00 56.92  ? 107  UMP G C6    1 
HETATM 1657  O  O2    . UMP C 1 8   ? 34.180 3.947   89.809  1.00 54.59  ? 107  UMP G O2    1 
HETATM 1658  O  O4    . UMP C 1 8   ? 30.928 2.905   86.872  1.00 62.50  ? 107  UMP G O4    1 
HETATM 1659  C  "C1'" . UMP C 1 8   ? 32.791 6.034   90.943  1.00 59.59  ? 107  UMP G "C1'" 1 
HETATM 1660  C  "C2'" . UMP C 1 8   ? 32.805 7.544   90.733  1.00 65.76  ? 107  UMP G "C2'" 1 
HETATM 1661  C  "C3'" . UMP C 1 8   ? 32.403 8.110   92.086  1.00 65.80  ? 107  UMP G "C3'" 1 
HETATM 1662  C  "C4'" . UMP C 1 8   ? 31.522 7.012   92.662  1.00 61.79  ? 107  UMP G "C4'" 1 
HETATM 1663  O  "O3'" . UMP C 1 8   ? 33.504 8.314   92.982  1.00 71.88  ? 107  UMP G "O3'" 1 
HETATM 1664  O  "O4'" . UMP C 1 8   ? 31.888 5.790   91.992  1.00 60.18  ? 107  UMP G "O4'" 1 
HETATM 1665  C  "C5'" . UMP C 1 8   ? 30.033 7.225   92.579  1.00 58.45  ? 107  UMP G "C5'" 1 
HETATM 1666  O  "O5'" . UMP C 1 8   ? 29.684 7.841   91.362  1.00 58.22  ? 107  UMP G "O5'" 1 
HETATM 1667  P  P     . UMP C 1 8   ? 28.384 8.749   91.321  1.00 60.21  ? 107  UMP G P     1 
HETATM 1668  O  OP1   . UMP C 1 8   ? 28.454 9.697   92.460  1.00 55.98  ? 107  UMP G OP1   1 
HETATM 1669  O  OP2   . UMP C 1 8   ? 28.202 9.269   89.946  1.00 59.66  ? 107  UMP G OP2   1 
ATOM   1670  P  P     . DT  C 1 9   ? 34.816 9.101   92.495  1.00 75.76  ? 108  DT  G P     1 
ATOM   1671  O  OP1   . DT  C 1 9   ? 35.405 9.800   93.661  1.00 75.55  ? 108  DT  G OP1   1 
ATOM   1672  O  OP2   . DT  C 1 9   ? 34.549 9.858   91.246  1.00 62.86  ? 108  DT  G OP2   1 
ATOM   1673  O  "O5'" . DT  C 1 9   ? 35.808 7.932   92.105  1.00 71.72  ? 108  DT  G "O5'" 1 
ATOM   1674  C  "C5'" . DT  C 1 9   ? 36.898 8.201   91.258  1.00 73.75  ? 108  DT  G "C5'" 1 
ATOM   1675  C  "C4'" . DT  C 1 9   ? 37.603 6.922   90.894  1.00 67.89  ? 108  DT  G "C4'" 1 
ATOM   1676  O  "O4'" . DT  C 1 9   ? 36.703 6.060   90.159  1.00 65.23  ? 108  DT  G "O4'" 1 
ATOM   1677  C  "C3'" . DT  C 1 9   ? 38.782 7.191   89.973  1.00 73.21  ? 108  DT  G "C3'" 1 
ATOM   1678  O  "O3'" . DT  C 1 9   ? 39.900 6.420   90.365  1.00 78.07  ? 108  DT  G "O3'" 1 
ATOM   1679  C  "C2'" . DT  C 1 9   ? 38.283 6.790   88.602  1.00 73.64  ? 108  DT  G "C2'" 1 
ATOM   1680  C  "C1'" . DT  C 1 9   ? 37.285 5.700   88.918  1.00 69.50  ? 108  DT  G "C1'" 1 
ATOM   1681  N  N1    . DT  C 1 9   ? 36.205 5.583   87.915  1.00 65.60  ? 108  DT  G N1    1 
ATOM   1682  C  C2    . DT  C 1 9   ? 36.293 4.564   87.001  1.00 61.61  ? 108  DT  G C2    1 
ATOM   1683  O  O2    . DT  C 1 9   ? 37.223 3.781   86.971  1.00 59.10  ? 108  DT  G O2    1 
ATOM   1684  N  N3    . DT  C 1 9   ? 35.255 4.499   86.115  1.00 62.18  ? 108  DT  G N3    1 
ATOM   1685  C  C4    . DT  C 1 9   ? 34.166 5.340   86.048  1.00 61.12  ? 108  DT  G C4    1 
ATOM   1686  O  O4    . DT  C 1 9   ? 33.298 5.144   85.207  1.00 62.15  ? 108  DT  G O4    1 
ATOM   1687  C  C5    . DT  C 1 9   ? 34.148 6.405   87.017  1.00 55.88  ? 108  DT  G C5    1 
ATOM   1688  C  C7    . DT  C 1 9   ? 33.021 7.388   86.996  1.00 71.90  ? 108  DT  G C7    1 
ATOM   1689  C  C6    . DT  C 1 9   ? 35.152 6.469   87.897  1.00 59.38  ? 108  DT  G C6    1 
ATOM   1690  P  P     . DC  C 1 10  ? 41.347 6.841   89.846  1.00 83.43  ? 109  DC  G P     1 
ATOM   1691  O  OP1   . DC  C 1 10  ? 42.368 6.115   90.656  1.00 84.09  ? 109  DC  G OP1   1 
ATOM   1692  O  OP2   . DC  C 1 10  ? 41.360 8.328   89.789  1.00 80.78  ? 109  DC  G OP2   1 
ATOM   1693  O  "O5'" . DC  C 1 10  ? 41.357 6.269   88.364  1.00 77.69  ? 109  DC  G "O5'" 1 
ATOM   1694  C  "C5'" . DC  C 1 10  ? 41.238 4.872   88.138  1.00 69.94  ? 109  DC  G "C5'" 1 
ATOM   1695  C  "C4'" . DC  C 1 10  ? 41.365 4.575   86.664  1.00 71.06  ? 109  DC  G "C4'" 1 
ATOM   1696  O  "O4'" . DC  C 1 10  ? 40.068 4.518   86.022  1.00 74.00  ? 109  DC  G "O4'" 1 
ATOM   1697  C  "C3'" . DC  C 1 10  ? 42.188 5.601   85.885  1.00 74.95  ? 109  DC  G "C3'" 1 
ATOM   1698  O  "O3'" . DC  C 1 10  ? 43.092 4.926   85.017  1.00 83.07  ? 109  DC  G "O3'" 1 
ATOM   1699  C  "C2'" . DC  C 1 10  ? 41.144 6.335   85.060  1.00 69.00  ? 109  DC  G "C2'" 1 
ATOM   1700  C  "C1'" . DC  C 1 10  ? 40.131 5.238   84.806  1.00 68.88  ? 109  DC  G "C1'" 1 
ATOM   1701  N  N1    . DC  C 1 10  ? 38.772 5.690   84.470  1.00 62.19  ? 109  DC  G N1    1 
ATOM   1702  C  C2    . DC  C 1 10  ? 38.033 4.960   83.534  1.00 58.88  ? 109  DC  G C2    1 
ATOM   1703  O  O2    . DC  C 1 10  ? 38.537 3.942   83.030  1.00 46.25  ? 109  DC  G O2    1 
ATOM   1704  N  N3    . DC  C 1 10  ? 36.791 5.375   83.205  1.00 58.29  ? 109  DC  G N3    1 
ATOM   1705  C  C4    . DC  C 1 10  ? 36.284 6.467   83.774  1.00 54.96  ? 109  DC  G C4    1 
ATOM   1706  N  N4    . DC  C 1 10  ? 35.055 6.852   83.415  1.00 52.58  ? 109  DC  G N4    1 
ATOM   1707  C  C5    . DC  C 1 10  ? 37.010 7.220   84.736  1.00 56.44  ? 109  DC  G C5    1 
ATOM   1708  C  C6    . DC  C 1 10  ? 38.239 6.800   85.051  1.00 58.48  ? 109  DC  G C6    1 
ATOM   1709  P  P     . DG  C 1 11  ? 44.516 5.586   84.680  1.00 85.58  ? 110  DG  G P     1 
ATOM   1710  O  OP1   . DG  C 1 11  ? 45.548 4.911   85.509  1.00 83.93  ? 110  DG  G OP1   1 
ATOM   1711  O  OP2   . DG  C 1 11  ? 44.395 7.067   84.716  1.00 80.76  ? 110  DG  G OP2   1 
ATOM   1712  O  "O5'" . DG  C 1 11  ? 44.727 5.157   83.168  1.00 88.54  ? 110  DG  G "O5'" 1 
ATOM   1713  C  "C5'" . DG  C 1 11  ? 44.459 3.823   82.750  1.00 90.43  ? 110  DG  G "C5'" 1 
ATOM   1714  C  "C4'" . DG  C 1 11  ? 44.037 3.816   81.302  1.00 89.29  ? 110  DG  G "C4'" 1 
ATOM   1715  O  "O4'" . DG  C 1 11  ? 42.627 4.131   81.184  1.00 87.34  ? 110  DG  G "O4'" 1 
ATOM   1716  C  "C3'" . DG  C 1 11  ? 44.784 4.857   80.468  1.00 91.01  ? 110  DG  G "C3'" 1 
ATOM   1717  O  "O3'" . DG  C 1 11  ? 45.199 4.315   79.220  1.00 89.75  ? 110  DG  G "O3'" 1 
ATOM   1718  C  "C2'" . DG  C 1 11  ? 43.750 5.944   80.247  1.00 88.37  ? 110  DG  G "C2'" 1 
ATOM   1719  C  "C1'" . DG  C 1 11  ? 42.456 5.155   80.221  1.00 84.69  ? 110  DG  G "C1'" 1 
ATOM   1720  N  N9    . DG  C 1 11  ? 41.288 5.943   80.594  1.00 75.80  ? 110  DG  G N9    1 
ATOM   1721  C  C8    . DG  C 1 11  ? 41.251 6.973   81.498  1.00 73.48  ? 110  DG  G C8    1 
ATOM   1722  N  N7    . DG  C 1 11  ? 40.069 7.511   81.613  1.00 70.85  ? 110  DG  G N7    1 
ATOM   1723  C  C5    . DG  C 1 11  ? 39.275 6.788   80.739  1.00 66.17  ? 110  DG  G C5    1 
ATOM   1724  C  C6    . DG  C 1 11  ? 37.907 6.917   80.442  1.00 59.33  ? 110  DG  G C6    1 
ATOM   1725  O  O6    . DG  C 1 11  ? 37.095 7.713   80.909  1.00 54.25  ? 110  DG  G O6    1 
ATOM   1726  N  N1    . DG  C 1 11  ? 37.498 5.987   79.497  1.00 55.14  ? 110  DG  G N1    1 
ATOM   1727  C  C2    . DG  C 1 11  ? 38.305 5.044   78.920  1.00 61.25  ? 110  DG  G C2    1 
ATOM   1728  N  N2    . DG  C 1 11  ? 37.712 4.227   78.043  1.00 61.54  ? 110  DG  G N2    1 
ATOM   1729  N  N3    . DG  C 1 11  ? 39.595 4.911   79.188  1.00 69.30  ? 110  DG  G N3    1 
ATOM   1730  C  C4    . DG  C 1 11  ? 40.009 5.813   80.102  1.00 70.95  ? 110  DG  G C4    1 
ATOM   1731  P  P     . DT  C 1 12  ? 46.218 5.144   78.300  1.00 91.27  ? 111  DT  G P     1 
ATOM   1732  O  OP1   . DT  C 1 12  ? 47.526 4.449   78.316  1.00 93.84  ? 111  DT  G OP1   1 
ATOM   1733  O  OP2   . DT  C 1 12  ? 46.145 6.585   78.664  1.00 88.99  ? 111  DT  G OP2   1 
ATOM   1734  O  "O5'" . DT  C 1 12  ? 45.586 4.943   76.862  1.00 87.19  ? 111  DT  G "O5'" 1 
ATOM   1735  C  "C5'" . DT  C 1 12  ? 44.975 3.708   76.529  1.00 77.75  ? 111  DT  G "C5'" 1 
ATOM   1736  C  "C4'" . DT  C 1 12  ? 43.872 3.927   75.522  1.00 75.66  ? 111  DT  G "C4'" 1 
ATOM   1737  O  "O4'" . DT  C 1 12  ? 42.749 4.590   76.152  1.00 68.69  ? 111  DT  G "O4'" 1 
ATOM   1738  C  "C3'" . DT  C 1 12  ? 44.265 4.790   74.324  1.00 73.68  ? 111  DT  G "C3'" 1 
ATOM   1739  O  "O3'" . DT  C 1 12  ? 43.801 4.177   73.125  1.00 71.59  ? 111  DT  G "O3'" 1 
ATOM   1740  C  "C2'" . DT  C 1 12  ? 43.554 6.109   74.578  1.00 70.29  ? 111  DT  G "C2'" 1 
ATOM   1741  C  "C1'" . DT  C 1 12  ? 42.320 5.669   75.340  1.00 66.75  ? 111  DT  G "C1'" 1 
ATOM   1742  N  N1    . DT  C 1 12  ? 41.715 6.691   76.220  1.00 60.73  ? 111  DT  G N1    1 
ATOM   1743  C  C2    . DT  C 1 12  ? 40.349 6.873   76.160  1.00 58.69  ? 111  DT  G C2    1 
ATOM   1744  O  O2    . DT  C 1 12  ? 39.620 6.236   75.418  1.00 54.65  ? 111  DT  G O2    1 
ATOM   1745  N  N3    . DT  C 1 12  ? 39.862 7.835   77.010  1.00 56.71  ? 111  DT  G N3    1 
ATOM   1746  C  C4    . DT  C 1 12  ? 40.581 8.609   77.894  1.00 54.26  ? 111  DT  G C4    1 
ATOM   1747  O  O4    . DT  C 1 12  ? 40.000 9.422   78.598  1.00 50.47  ? 111  DT  G O4    1 
ATOM   1748  C  C5    . DT  C 1 12  ? 42.007 8.371   77.904  1.00 54.12  ? 111  DT  G C5    1 
ATOM   1749  C  C7    . DT  C 1 12  ? 42.868 9.167   78.829  1.00 71.90  ? 111  DT  G C7    1 
ATOM   1750  C  C6    . DT  C 1 12  ? 42.496 7.438   77.077  1.00 59.02  ? 111  DT  G C6    1 
ATOM   1751  P  P     . DA  C 1 13  ? 44.052 4.896   71.714  1.00 76.61  ? 112  DA  G P     1 
ATOM   1752  O  OP1   . DA  C 1 13  ? 44.281 3.841   70.694  1.00 76.56  ? 112  DA  G OP1   1 
ATOM   1753  O  OP2   . DA  C 1 13  ? 45.055 5.971   71.896  1.00 75.06  ? 112  DA  G OP2   1 
ATOM   1754  O  "O5'" . DA  C 1 13  ? 42.640 5.558   71.421  1.00 68.10  ? 112  DA  G "O5'" 1 
ATOM   1755  C  "C5'" . DA  C 1 13  ? 41.474 4.755   71.443  1.00 54.77  ? 112  DA  G "C5'" 1 
ATOM   1756  C  "C4'" . DA  C 1 13  ? 40.275 5.574   71.045  1.00 53.00  ? 112  DA  G "C4'" 1 
ATOM   1757  O  "O4'" . DA  C 1 13  ? 39.851 6.403   72.151  1.00 54.96  ? 112  DA  G "O4'" 1 
ATOM   1758  C  "C3'" . DA  C 1 13  ? 40.523 6.514   69.870  1.00 44.12  ? 112  DA  G "C3'" 1 
ATOM   1759  O  "O3'" . DA  C 1 13  ? 39.375 6.500   69.026  1.00 42.26  ? 112  DA  G "O3'" 1 
ATOM   1760  C  "C2'" . DA  C 1 13  ? 40.690 7.864   70.544  1.00 46.48  ? 112  DA  G "C2'" 1 
ATOM   1761  C  "C1'" . DA  C 1 13  ? 39.737 7.746   71.721  1.00 49.33  ? 112  DA  G "C1'" 1 
ATOM   1762  N  N9    . DA  C 1 13  ? 40.014 8.617   72.869  1.00 44.86  ? 112  DA  G N9    1 
ATOM   1763  C  C8    . DA  C 1 13  ? 41.193 8.769   73.556  1.00 47.60  ? 112  DA  G C8    1 
ATOM   1764  N  N7    . DA  C 1 13  ? 41.123 9.622   74.548  1.00 45.95  ? 112  DA  G N7    1 
ATOM   1765  C  C5    . DA  C 1 13  ? 39.810 10.062  74.512  1.00 42.06  ? 112  DA  G C5    1 
ATOM   1766  C  C6    . DA  C 1 13  ? 39.100 10.978  75.308  1.00 41.29  ? 112  DA  G C6    1 
ATOM   1767  N  N6    . DA  C 1 13  ? 39.642 11.634  76.340  1.00 34.48  ? 112  DA  G N6    1 
ATOM   1768  N  N1    . DA  C 1 13  ? 37.800 11.199  75.008  1.00 41.71  ? 112  DA  G N1    1 
ATOM   1769  C  C2    . DA  C 1 13  ? 37.266 10.537  73.979  1.00 46.44  ? 112  DA  G C2    1 
ATOM   1770  N  N3    . DA  C 1 13  ? 37.830 9.650   73.159  1.00 45.01  ? 112  DA  G N3    1 
ATOM   1771  C  C4    . DA  C 1 13  ? 39.117 9.456   73.483  1.00 42.69  ? 112  DA  G C4    1 
ATOM   1772  P  P     . DT  C 1 14  ? 39.407 7.265   67.617  1.00 53.06  ? 113  DT  G P     1 
ATOM   1773  O  OP1   . DT  C 1 14  ? 38.593 6.481   66.656  1.00 48.54  ? 113  DT  G OP1   1 
ATOM   1774  O  OP2   . DT  C 1 14  ? 40.820 7.601   67.293  1.00 49.18  ? 113  DT  G OP2   1 
ATOM   1775  O  "O5'" . DT  C 1 14  ? 38.581 8.588   67.915  1.00 47.98  ? 113  DT  G "O5'" 1 
ATOM   1776  C  "C5'" . DT  C 1 14  ? 37.248 8.480   68.390  1.00 44.85  ? 113  DT  G "C5'" 1 
ATOM   1777  C  "C4'" . DT  C 1 14  ? 36.687 9.836   68.747  1.00 45.85  ? 113  DT  G "C4'" 1 
ATOM   1778  O  "O4'" . DT  C 1 14  ? 37.252 10.357  69.972  1.00 44.70  ? 113  DT  G "O4'" 1 
ATOM   1779  C  "C3'" . DT  C 1 14  ? 36.858 10.932  67.699  1.00 44.40  ? 113  DT  G "C3'" 1 
ATOM   1780  O  "O3'" . DT  C 1 14  ? 35.661 11.685  67.690  1.00 46.73  ? 113  DT  G "O3'" 1 
ATOM   1781  C  "C2'" . DT  C 1 14  ? 37.944 11.801  68.298  1.00 41.55  ? 113  DT  G "C2'" 1 
ATOM   1782  C  "C1'" . DT  C 1 14  ? 37.566 11.720  69.759  1.00 40.76  ? 113  DT  G "C1'" 1 
ATOM   1783  N  N1    . DT  C 1 14  ? 38.602 12.129  70.730  1.00 42.72  ? 113  DT  G N1    1 
ATOM   1784  C  C2    . DT  C 1 14  ? 38.248 13.060  71.669  1.00 43.75  ? 113  DT  G C2    1 
ATOM   1785  O  O2    . DT  C 1 14  ? 37.139 13.546  71.731  1.00 40.57  ? 113  DT  G O2    1 
ATOM   1786  N  N3    . DT  C 1 14  ? 39.241 13.403  72.532  1.00 41.49  ? 113  DT  G N3    1 
ATOM   1787  C  C4    . DT  C 1 14  ? 40.528 12.925  72.549  1.00 48.04  ? 113  DT  G C4    1 
ATOM   1788  O  O4    . DT  C 1 14  ? 41.316 13.339  73.381  1.00 53.08  ? 113  DT  G O4    1 
ATOM   1789  C  C5    . DT  C 1 14  ? 40.839 11.953  71.545  1.00 46.28  ? 113  DT  G C5    1 
ATOM   1790  C  C7    . DT  C 1 14  ? 42.220 11.384  71.493  1.00 71.90  ? 113  DT  G C7    1 
ATOM   1791  C  C6    . DT  C 1 14  ? 39.873 11.601  70.694  1.00 44.30  ? 113  DT  G C6    1 
ATOM   1792  P  P     . DA  C 1 15  ? 35.215 12.459  66.372  1.00 53.44  ? 114  DA  G P     1 
ATOM   1793  O  OP1   . DA  C 1 15  ? 34.345 11.531  65.623  1.00 52.99  ? 114  DA  G OP1   1 
ATOM   1794  O  OP2   . DA  C 1 15  ? 36.416 13.025  65.719  1.00 48.75  ? 114  DA  G OP2   1 
ATOM   1795  O  "O5'" . DA  C 1 15  ? 34.309 13.623  66.961  1.00 45.10  ? 114  DA  G "O5'" 1 
ATOM   1796  C  "C5'" . DA  C 1 15  ? 33.248 13.294  67.852  1.00 48.00  ? 114  DA  G "C5'" 1 
ATOM   1797  C  "C4'" . DA  C 1 15  ? 32.947 14.438  68.792  1.00 45.03  ? 114  DA  G "C4'" 1 
ATOM   1798  O  "O4'" . DA  C 1 15  ? 34.043 14.675  69.701  1.00 46.53  ? 114  DA  G "O4'" 1 
ATOM   1799  C  "C3'" . DA  C 1 15  ? 32.664 15.773  68.123  1.00 38.32  ? 114  DA  G "C3'" 1 
ATOM   1800  O  "O3'" . DA  C 1 15  ? 31.628 16.418  68.829  1.00 41.93  ? 114  DA  G "O3'" 1 
ATOM   1801  C  "C2'" . DA  C 1 15  ? 33.952 16.544  68.309  1.00 35.12  ? 114  DA  G "C2'" 1 
ATOM   1802  C  "C1'" . DA  C 1 15  ? 34.425 16.039  69.647  1.00 37.42  ? 114  DA  G "C1'" 1 
ATOM   1803  N  N9    . DA  C 1 15  ? 35.869 16.107  69.865  1.00 30.91  ? 114  DA  G N9    1 
ATOM   1804  C  C8    . DA  C 1 15  ? 36.869 15.440  69.210  1.00 28.10  ? 114  DA  G C8    1 
ATOM   1805  N  N7    . DA  C 1 15  ? 38.064 15.679  69.691  1.00 31.12  ? 114  DA  G N7    1 
ATOM   1806  C  C5    . DA  C 1 15  ? 37.831 16.575  70.722  1.00 35.40  ? 114  DA  G C5    1 
ATOM   1807  C  C6    . DA  C 1 15  ? 38.684 17.210  71.629  1.00 33.54  ? 114  DA  G C6    1 
ATOM   1808  N  N6    . DA  C 1 15  ? 40.005 17.019  71.665  1.00 36.05  ? 114  DA  G N6    1 
ATOM   1809  N  N1    . DA  C 1 15  ? 38.132 18.054  72.518  1.00 28.21  ? 114  DA  G N1    1 
ATOM   1810  C  C2    . DA  C 1 15  ? 36.812 18.229  72.499  1.00 36.61  ? 114  DA  G C2    1 
ATOM   1811  N  N3    . DA  C 1 15  ? 35.907 17.686  71.707  1.00 34.13  ? 114  DA  G N3    1 
ATOM   1812  C  C4    . DA  C 1 15  ? 36.488 16.859  70.828  1.00 35.06  ? 114  DA  G C4    1 
ATOM   1813  P  P     . DA  C 1 16  ? 30.946 17.706  68.198  1.00 46.18  ? 115  DA  G P     1 
ATOM   1814  O  OP1   . DA  C 1 16  ? 29.477 17.632  68.401  1.00 41.78  ? 115  DA  G OP1   1 
ATOM   1815  O  OP2   . DA  C 1 16  ? 31.500 17.881  66.835  1.00 42.88  ? 115  DA  G OP2   1 
ATOM   1816  O  "O5'" . DA  C 1 16  ? 31.489 18.866  69.119  1.00 44.89  ? 115  DA  G "O5'" 1 
ATOM   1817  C  "C5'" . DA  C 1 16  ? 31.259 18.807  70.503  1.00 34.34  ? 115  DA  G "C5'" 1 
ATOM   1818  C  "C4'" . DA  C 1 16  ? 31.977 19.936  71.191  1.00 38.44  ? 115  DA  G "C4'" 1 
ATOM   1819  O  "O4'" . DA  C 1 16  ? 33.410 19.772  71.104  1.00 44.21  ? 115  DA  G "O4'" 1 
ATOM   1820  C  "C3'" . DA  C 1 16  ? 31.690 21.324  70.636  1.00 43.56  ? 115  DA  G "C3'" 1 
ATOM   1821  O  "O3'" . DA  C 1 16  ? 31.646 22.167  71.776  1.00 50.36  ? 115  DA  G "O3'" 1 
ATOM   1822  C  "C2'" . DA  C 1 16  ? 32.921 21.621  69.791  1.00 34.04  ? 115  DA  G "C2'" 1 
ATOM   1823  C  "C1'" . DA  C 1 16  ? 33.976 20.992  70.665  1.00 40.62  ? 115  DA  G "C1'" 1 
ATOM   1824  N  N9    . DA  C 1 16  ? 35.296 20.690  70.129  1.00 40.96  ? 115  DA  G N9    1 
ATOM   1825  C  C8    . DA  C 1 16  ? 35.666 19.934  69.054  1.00 39.65  ? 115  DA  G C8    1 
ATOM   1826  N  N7    . DA  C 1 16  ? 36.961 19.751  68.960  1.00 41.97  ? 115  DA  G N7    1 
ATOM   1827  C  C5    . DA  C 1 16  ? 37.474 20.464  70.030  1.00 45.25  ? 115  DA  G C5    1 
ATOM   1828  C  C6    . DA  C 1 16  ? 38.774 20.656  70.499  1.00 43.98  ? 115  DA  G C6    1 
ATOM   1829  N  N6    . DA  C 1 16  ? 39.849 20.102  69.951  1.00 41.34  ? 115  DA  G N6    1 
ATOM   1830  N  N1    . DA  C 1 16  ? 38.938 21.443  71.580  1.00 49.44  ? 115  DA  G N1    1 
ATOM   1831  C  C2    . DA  C 1 16  ? 37.860 21.984  72.152  1.00 53.54  ? 115  DA  G C2    1 
ATOM   1832  N  N3    . DA  C 1 16  ? 36.588 21.865  71.814  1.00 44.59  ? 115  DA  G N3    1 
ATOM   1833  C  C4    . DA  C 1 16  ? 36.461 21.080  70.732  1.00 46.14  ? 115  DA  G C4    1 
ATOM   1834  P  P     . DT  C 1 17  ? 30.423 23.167  71.980  1.00 51.38  ? 116  DT  G P     1 
ATOM   1835  O  OP1   . DT  C 1 17  ? 30.244 23.275  73.448  1.00 53.21  ? 116  DT  G OP1   1 
ATOM   1836  O  OP2   . DT  C 1 17  ? 29.285 22.718  71.133  1.00 47.79  ? 116  DT  G OP2   1 
ATOM   1837  O  "O5'" . DT  C 1 17  ? 31.051 24.524  71.438  1.00 49.41  ? 116  DT  G "O5'" 1 
ATOM   1838  C  "C5'" . DT  C 1 17  ? 32.448 24.559  71.141  1.00 53.28  ? 116  DT  G "C5'" 1 
ATOM   1839  C  "C4'" . DT  C 1 17  ? 33.078 25.851  71.603  1.00 60.77  ? 116  DT  G "C4'" 1 
ATOM   1840  O  "O4'" . DT  C 1 17  ? 34.499 25.629  71.741  1.00 61.32  ? 116  DT  G "O4'" 1 
ATOM   1841  C  "C3'" . DT  C 1 17  ? 32.924 26.989  70.604  1.00 67.36  ? 116  DT  G "C3'" 1 
ATOM   1842  O  "O3'" . DT  C 1 17  ? 32.724 28.233  71.258  1.00 77.64  ? 116  DT  G "O3'" 1 
ATOM   1843  C  "C2'" . DT  C 1 17  ? 34.220 26.973  69.818  1.00 58.30  ? 116  DT  G "C2'" 1 
ATOM   1844  C  "C1'" . DT  C 1 17  ? 35.233 26.340  70.761  1.00 56.49  ? 116  DT  G "C1'" 1 
ATOM   1845  N  N1    . DT  C 1 17  ? 36.122 25.374  70.076  1.00 53.43  ? 116  DT  G N1    1 
ATOM   1846  C  C2    . DT  C 1 17  ? 37.411 25.210  70.530  1.00 51.98  ? 116  DT  G C2    1 
ATOM   1847  O  O2    . DT  C 1 17  ? 37.848 25.768  71.517  1.00 56.19  ? 116  DT  G O2    1 
ATOM   1848  N  N3    . DT  C 1 17  ? 38.178 24.364  69.775  1.00 48.33  ? 116  DT  G N3    1 
ATOM   1849  C  C4    . DT  C 1 17  ? 37.798 23.686  68.633  1.00 47.87  ? 116  DT  G C4    1 
ATOM   1850  O  O4    . DT  C 1 17  ? 38.618 23.021  68.012  1.00 37.56  ? 116  DT  G O4    1 
ATOM   1851  C  C5    . DT  C 1 17  ? 36.425 23.856  68.245  1.00 41.97  ? 116  DT  G C5    1 
ATOM   1852  C  C7    . DT  C 1 17  ? 35.917 23.122  67.046  1.00 63.49  ? 116  DT  G C7    1 
ATOM   1853  C  C6    . DT  C 1 17  ? 35.663 24.677  68.979  1.00 50.56  ? 116  DT  G C6    1 
ATOM   1854  P  P     . DG  C 1 18  ? 32.052 29.439  70.444  1.00 76.00  ? 117  DG  G P     1 
ATOM   1855  O  OP1   . DG  C 1 18  ? 31.618 30.485  71.410  1.00 73.74  ? 117  DG  G OP1   1 
ATOM   1856  O  OP2   . DG  C 1 18  ? 31.086 28.897  69.457  1.00 76.60  ? 117  DG  G OP2   1 
ATOM   1857  O  "O5'" . DG  C 1 18  ? 33.249 29.996  69.580  1.00 72.55  ? 117  DG  G "O5'" 1 
ATOM   1858  C  "C5'" . DG  C 1 18  ? 32.985 30.811  68.466  1.00 82.89  ? 117  DG  G "C5'" 1 
ATOM   1859  C  "C4'" . DG  C 1 18  ? 34.008 31.913  68.396  1.00 84.92  ? 117  DG  G "C4'" 1 
ATOM   1860  O  "O4'" . DG  C 1 18  ? 35.323 31.331  68.468  1.00 82.85  ? 117  DG  G "O4'" 1 
ATOM   1861  C  "C3'" . DG  C 1 18  ? 33.967 32.666  67.083  1.00 89.32  ? 117  DG  G "C3'" 1 
ATOM   1862  O  "O3'" . DG  C 1 18  ? 34.410 33.991  67.314  1.00 89.94  ? 117  DG  G "O3'" 1 
ATOM   1863  C  "C2'" . DG  C 1 18  ? 34.909 31.869  66.198  1.00 89.82  ? 117  DG  G "C2'" 1 
ATOM   1864  C  "C1'" . DG  C 1 18  ? 35.920 31.293  67.178  1.00 90.69  ? 117  DG  G "C1'" 1 
ATOM   1865  N  N9    . DG  C 1 18  ? 36.288 29.903  66.931  1.00 91.66  ? 117  DG  G N9    1 
ATOM   1866  C  C8    . DG  C 1 18  ? 35.465 28.804  67.002  1.00 87.02  ? 117  DG  G C8    1 
ATOM   1867  N  N7    . DG  C 1 18  ? 36.102 27.679  66.829  1.00 83.34  ? 117  DG  G N7    1 
ATOM   1868  C  C5    . DG  C 1 18  ? 37.418 28.060  66.612  1.00 83.96  ? 117  DG  G C5    1 
ATOM   1869  C  C6    . DG  C 1 18  ? 38.570 27.277  66.388  1.00 78.98  ? 117  DG  G C6    1 
ATOM   1870  O  O6    . DG  C 1 18  ? 38.669 26.049  66.344  1.00 65.39  ? 117  DG  G O6    1 
ATOM   1871  N  N1    . DG  C 1 18  ? 39.697 28.068  66.209  1.00 84.97  ? 117  DG  G N1    1 
ATOM   1872  C  C2    . DG  C 1 18  ? 39.712 29.440  66.241  1.00 87.21  ? 117  DG  G C2    1 
ATOM   1873  N  N2    . DG  C 1 18  ? 40.896 30.025  66.029  1.00 63.49  ? 117  DG  G N2    1 
ATOM   1874  N  N3    . DG  C 1 18  ? 38.645 30.183  66.460  1.00 91.35  ? 117  DG  G N3    1 
ATOM   1875  C  C4    . DG  C 1 18  ? 37.541 29.432  66.640  1.00 91.37  ? 117  DG  G C4    1 
ATOM   1876  P  P     . DT  C 1 19  ? 34.187 35.094  66.188  1.00 91.63  ? 118  DT  G P     1 
ATOM   1877  O  OP1   . DT  C 1 19  ? 34.481 36.416  66.808  1.00 87.43  ? 118  DT  G OP1   1 
ATOM   1878  O  OP2   . DT  C 1 19  ? 32.858 34.846  65.559  1.00 82.94  ? 118  DT  G OP2   1 
ATOM   1879  O  "O5'" . DT  C 1 19  ? 35.324 34.745  65.130  1.00 95.28  ? 118  DT  G "O5'" 1 
ATOM   1880  C  "C5'" . DT  C 1 19  ? 36.696 35.000  65.427  1.00 94.00  ? 118  DT  G "C5'" 1 
ATOM   1881  C  "C4'" . DT  C 1 19  ? 37.534 34.825  64.184  1.00 94.42  ? 118  DT  G "C4'" 1 
ATOM   1882  O  "O4'" . DT  C 1 19  ? 37.894 33.437  63.995  1.00 95.05  ? 118  DT  G "O4'" 1 
ATOM   1883  C  "C3'" . DT  C 1 19  ? 36.831 35.265  62.900  1.00 98.69  ? 118  DT  G "C3'" 1 
ATOM   1884  O  "O3'" . DT  C 1 19  ? 37.762 35.942  62.061  1.00 101.96 ? 118  DT  G "O3'" 1 
ATOM   1885  C  "C2'" . DT  C 1 19  ? 36.393 33.953  62.272  1.00 100.60 ? 118  DT  G "C2'" 1 
ATOM   1886  C  "C1'" . DT  C 1 19  ? 37.511 33.016  62.695  1.00 98.67  ? 118  DT  G "C1'" 1 
ATOM   1887  N  N1    . DT  C 1 19  ? 37.160 31.588  62.776  1.00 94.42  ? 118  DT  G N1    1 
ATOM   1888  C  C2    . DT  C 1 19  ? 38.196 30.686  62.815  1.00 88.19  ? 118  DT  G C2    1 
ATOM   1889  O  O2    . DT  C 1 19  ? 39.367 31.016  62.761  1.00 68.53  ? 118  DT  G O2    1 
ATOM   1890  N  N3    . DT  C 1 19  ? 37.814 29.378  62.921  1.00 90.77  ? 118  DT  G N3    1 
ATOM   1891  C  C4    . DT  C 1 19  ? 36.533 28.889  62.982  1.00 102.87 ? 118  DT  G C4    1 
ATOM   1892  O  O4    . DT  C 1 19  ? 36.351 27.680  63.081  1.00 109.14 ? 118  DT  G O4    1 
ATOM   1893  C  C5    . DT  C 1 19  ? 35.489 29.889  62.921  1.00 105.13 ? 118  DT  G C5    1 
ATOM   1894  C  C7    . DT  C 1 19  ? 34.060 29.453  62.968  1.00 71.90  ? 118  DT  G C7    1 
ATOM   1895  C  C6    . DT  C 1 19  ? 35.851 31.173  62.822  1.00 101.59 ? 118  DT  G C6    1 
ATOM   1896  P  P     . DA  C 1 20  ? 37.770 37.546  62.024  1.00 103.18 ? 119  DA  G P     1 
ATOM   1897  O  OP1   . DA  C 1 20  ? 37.663 38.041  63.422  1.00 103.05 ? 119  DA  G OP1   1 
ATOM   1898  O  OP2   . DA  C 1 20  ? 36.777 37.988  61.005  1.00 101.46 ? 119  DA  G OP2   1 
ATOM   1899  O  "O5'" . DA  C 1 20  ? 39.225 37.900  61.495  1.00 100.34 ? 119  DA  G "O5'" 1 
ATOM   1900  C  "C5'" . DA  C 1 20  ? 40.376 37.603  62.275  1.00 96.08  ? 119  DA  G "C5'" 1 
ATOM   1901  C  "C4'" . DA  C 1 20  ? 41.447 36.997  61.399  1.00 100.89 ? 119  DA  G "C4'" 1 
ATOM   1902  O  "O4'" . DA  C 1 20  ? 41.087 35.643  61.037  1.00 96.37  ? 119  DA  G "O4'" 1 
ATOM   1903  C  "C3'" . DA  C 1 20  ? 41.674 37.737  60.084  1.00 105.99 ? 119  DA  G "C3'" 1 
ATOM   1904  O  "O3'" . DA  C 1 20  ? 43.068 37.709  59.770  1.00 108.28 ? 119  DA  G "O3'" 1 
ATOM   1905  C  "C2'" . DA  C 1 20  ? 40.843 36.945  59.085  1.00 101.13 ? 119  DA  G "C2'" 1 
ATOM   1906  C  "C1'" . DA  C 1 20  ? 40.903 35.524  59.632  1.00 95.54  ? 119  DA  G "C1'" 1 
ATOM   1907  N  N9    . DA  C 1 20  ? 39.686 34.742  59.432  1.00 87.62  ? 119  DA  G N9    1 
ATOM   1908  C  C8    . DA  C 1 20  ? 38.397 35.201  59.313  1.00 83.25  ? 119  DA  G C8    1 
ATOM   1909  N  N7    . DA  C 1 20  ? 37.502 34.247  59.233  1.00 78.90  ? 119  DA  G N7    1 
ATOM   1910  C  C5    . DA  C 1 20  ? 38.253 33.080  59.284  1.00 78.38  ? 119  DA  G C5    1 
ATOM   1911  C  C6    . DA  C 1 20  ? 37.894 31.719  59.258  1.00 72.17  ? 119  DA  G C6    1 
ATOM   1912  N  N6    . DA  C 1 20  ? 36.628 31.289  59.196  1.00 62.34  ? 119  DA  G N6    1 
ATOM   1913  N  N1    . DA  C 1 20  ? 38.889 30.806  59.307  1.00 74.14  ? 119  DA  G N1    1 
ATOM   1914  C  C2    . DA  C 1 20  ? 40.150 31.239  59.387  1.00 83.46  ? 119  DA  G C2    1 
ATOM   1915  N  N3    . DA  C 1 20  ? 40.613 32.487  59.433  1.00 85.86  ? 119  DA  G N3    1 
ATOM   1916  C  C4    . DA  C 1 20  ? 39.602 33.371  59.379  1.00 84.99  ? 119  DA  G C4    1 
ATOM   1917  P  P     . DT  C 1 21  ? 43.620 38.523  58.505  1.00 109.86 ? 120  DT  G P     1 
ATOM   1918  O  OP1   . DT  C 1 21  ? 44.788 39.324  58.960  1.00 105.76 ? 120  DT  G OP1   1 
ATOM   1919  O  OP2   . DT  C 1 21  ? 42.465 39.201  57.854  1.00 108.91 ? 120  DT  G OP2   1 
ATOM   1920  O  "O5'" . DT  C 1 21  ? 44.129 37.361  57.541  1.00 109.85 ? 120  DT  G "O5'" 1 
ATOM   1921  C  "C5'" . DT  C 1 21  ? 44.710 36.174  58.083  1.00 102.65 ? 120  DT  G "C5'" 1 
ATOM   1922  C  "C4'" . DT  C 1 21  ? 44.601 35.033  57.098  1.00 97.97  ? 120  DT  G "C4'" 1 
ATOM   1923  O  "O4'" . DT  C 1 21  ? 43.259 34.488  57.055  1.00 90.56  ? 120  DT  G "O4'" 1 
ATOM   1924  C  "C3'" . DT  C 1 21  ? 44.956 35.406  55.660  1.00 100.23 ? 120  DT  G "C3'" 1 
ATOM   1925  O  "O3'" . DT  C 1 21  ? 45.717 34.350  55.078  1.00 103.25 ? 120  DT  G "O3'" 1 
ATOM   1926  C  "C2'" . DT  C 1 21  ? 43.600 35.488  54.981  1.00 89.92  ? 120  DT  G "C2'" 1 
ATOM   1927  C  "C1'" . DT  C 1 21  ? 42.840 34.395  55.706  1.00 84.77  ? 120  DT  G "C1'" 1 
ATOM   1928  N  N1    . DT  C 1 21  ? 41.367 34.504  55.664  1.00 76.25  ? 120  DT  G N1    1 
ATOM   1929  C  C2    . DT  C 1 21  ? 40.623 33.359  55.868  1.00 67.82  ? 120  DT  G C2    1 
ATOM   1930  O  O2    . DT  C 1 21  ? 41.121 32.278  56.113  1.00 64.39  ? 120  DT  G O2    1 
ATOM   1931  N  N3    . DT  C 1 21  ? 39.262 33.535  55.781  1.00 54.68  ? 120  DT  G N3    1 
ATOM   1932  C  C4    . DT  C 1 21  ? 38.580 34.724  55.539  1.00 66.88  ? 120  DT  G C4    1 
ATOM   1933  O  O4    . DT  C 1 21  ? 37.338 34.743  55.515  1.00 55.74  ? 120  DT  G O4    1 
ATOM   1934  C  C5    . DT  C 1 21  ? 39.425 35.885  55.341  1.00 74.60  ? 120  DT  G C5    1 
ATOM   1935  C  C7    . DT  C 1 21  ? 38.783 37.209  55.059  1.00 63.49  ? 120  DT  G C7    1 
ATOM   1936  C  C6    . DT  C 1 21  ? 40.757 35.718  55.416  1.00 78.01  ? 120  DT  G C6    1 
ATOM   1937  P  P     . DG  C 1 22  ? 47.321 34.436  55.062  1.00 105.11 ? 121  DG  G P     1 
ATOM   1938  O  OP1   . DG  C 1 22  ? 47.789 34.685  56.449  1.00 105.71 ? 121  DG  G OP1   1 
ATOM   1939  O  OP2   . DG  C 1 22  ? 47.730 35.362  53.972  1.00 101.95 ? 121  DG  G OP2   1 
ATOM   1940  O  "O5'" . DG  C 1 22  ? 47.742 32.951  54.679  1.00 99.48  ? 121  DG  G "O5'" 1 
ATOM   1941  C  "C5'" . DG  C 1 22  ? 47.648 31.912  55.646  1.00 94.55  ? 121  DG  G "C5'" 1 
ATOM   1942  C  "C4'" . DG  C 1 22  ? 46.929 30.711  55.076  1.00 93.25  ? 121  DG  G "C4'" 1 
ATOM   1943  O  "O4'" . DG  C 1 22  ? 45.553 31.042  54.770  1.00 89.04  ? 121  DG  G "O4'" 1 
ATOM   1944  C  "C3'" . DG  C 1 22  ? 47.520 30.123  53.795  1.00 90.97  ? 121  DG  G "C3'" 1 
ATOM   1945  O  "O3'" . DG  C 1 22  ? 47.521 28.699  53.893  1.00 90.43  ? 121  DG  G "O3'" 1 
ATOM   1946  C  "C2'" . DG  C 1 22  ? 46.559 30.582  52.713  1.00 81.81  ? 121  DG  G "C2'" 1 
ATOM   1947  C  "C1'" . DG  C 1 22  ? 45.239 30.616  53.455  1.00 81.40  ? 121  DG  G "C1'" 1 
ATOM   1948  N  N9    . DG  C 1 22  ? 44.250 31.541  52.911  1.00 78.70  ? 121  DG  G N9    1 
ATOM   1949  C  C8    . DG  C 1 22  ? 44.476 32.805  52.422  1.00 83.70  ? 121  DG  G C8    1 
ATOM   1950  N  N7    . DG  C 1 22  ? 43.385 33.405  52.026  1.00 80.43  ? 121  DG  G N7    1 
ATOM   1951  C  C5    . DG  C 1 22  ? 42.379 32.479  52.263  1.00 74.41  ? 121  DG  G C5    1 
ATOM   1952  C  C6    . DG  C 1 22  ? 40.980 32.569  52.043  1.00 73.73  ? 121  DG  G C6    1 
ATOM   1953  O  O6    . DG  C 1 22  ? 40.332 33.522  51.587  1.00 73.36  ? 121  DG  G O6    1 
ATOM   1954  N  N1    . DG  C 1 22  ? 40.325 31.397  52.419  1.00 64.94  ? 121  DG  G N1    1 
ATOM   1955  C  C2    . DG  C 1 22  ? 40.938 30.286  52.943  1.00 48.35  ? 121  DG  G C2    1 
ATOM   1956  N  N2    . DG  C 1 22  ? 40.137 29.254  53.239  1.00 63.49  ? 121  DG  G N2    1 
ATOM   1957  N  N3    . DG  C 1 22  ? 42.243 30.193  53.159  1.00 59.74  ? 121  DG  G N3    1 
ATOM   1958  C  C4    . DG  C 1 22  ? 42.896 31.319  52.799  1.00 72.35  ? 121  DG  G C4    1 
ATOM   1959  P  P     . DC  C 1 23  ? 48.329 27.830  52.818  1.00 92.56  ? 122  DC  G P     1 
ATOM   1960  O  OP1   . DC  C 1 23  ? 48.443 26.440  53.319  1.00 88.41  ? 122  DC  G OP1   1 
ATOM   1961  O  OP2   . DC  C 1 23  ? 49.552 28.588  52.466  1.00 91.84  ? 122  DC  G OP2   1 
ATOM   1962  O  "O5'" . DC  C 1 23  ? 47.359 27.831  51.560  1.00 86.27  ? 122  DC  G "O5'" 1 
ATOM   1963  C  "C5'" . DC  C 1 23  ? 46.982 26.614  50.923  1.00 68.58  ? 122  DC  G "C5'" 1 
ATOM   1964  C  "C4'" . DC  C 1 23  ? 45.624 26.162  51.411  1.00 62.29  ? 122  DC  G "C4'" 1 
ATOM   1965  O  "O4'" . DC  C 1 23  ? 44.757 27.313  51.572  1.00 58.35  ? 122  DC  G "O4'" 1 
ATOM   1966  C  "C3'" . DC  C 1 23  ? 44.919 25.232  50.426  1.00 61.44  ? 122  DC  G "C3'" 1 
ATOM   1967  O  "O3'" . DC  C 1 23  ? 44.165 24.227  51.114  1.00 63.11  ? 122  DC  G "O3'" 1 
ATOM   1968  C  "C2'" . DC  C 1 23  ? 44.021 26.181  49.657  1.00 55.90  ? 122  DC  G "C2'" 1 
ATOM   1969  C  "C1'" . DC  C 1 23  ? 43.642 27.216  50.706  1.00 47.81  ? 122  DC  G "C1'" 1 
ATOM   1970  N  N1    . DC  C 1 23  ? 43.373 28.559  50.161  1.00 41.10  ? 122  DC  G N1    1 
ATOM   1971  C  C2    . DC  C 1 23  ? 42.050 28.939  49.929  1.00 47.77  ? 122  DC  G C2    1 
ATOM   1972  O  O2    . DC  C 1 23  ? 41.141 28.137  50.198  1.00 51.26  ? 122  DC  G O2    1 
ATOM   1973  N  N3    . DC  C 1 23  ? 41.792 30.165  49.419  1.00 44.17  ? 122  DC  G N3    1 
ATOM   1974  C  C4    . DC  C 1 23  ? 42.795 30.996  49.145  1.00 44.77  ? 122  DC  G C4    1 
ATOM   1975  N  N4    . DC  C 1 23  ? 42.494 32.193  48.651  1.00 45.27  ? 122  DC  G N4    1 
ATOM   1976  C  C5    . DC  C 1 23  ? 44.151 30.636  49.370  1.00 46.97  ? 122  DC  G C5    1 
ATOM   1977  C  C6    . DC  C 1 23  ? 44.394 29.420  49.878  1.00 38.59  ? 122  DC  G C6    1 
ATOM   1978  P  P     . DT  C 1 24  ? 43.894 22.808  50.405  1.00 64.81  ? 123  DT  G P     1 
ATOM   1979  O  OP1   . DT  C 1 24  ? 44.022 21.728  51.413  1.00 59.65  ? 123  DT  G OP1   1 
ATOM   1980  O  OP2   . DT  C 1 24  ? 44.749 22.781  49.193  1.00 66.98  ? 123  DT  G OP2   1 
ATOM   1981  O  "O5'" . DT  C 1 24  ? 42.368 22.899  49.959  1.00 60.89  ? 123  DT  G "O5'" 1 
ATOM   1982  C  "C5'" . DT  C 1 24  ? 41.828 24.153  49.575  1.00 58.20  ? 123  DT  G "C5'" 1 
ATOM   1983  C  "C4'" . DT  C 1 24  ? 40.434 24.008  49.014  1.00 57.42  ? 123  DT  G "C4'" 1 
ATOM   1984  O  "O4'" . DT  C 1 24  ? 40.008 25.340  48.650  1.00 62.70  ? 123  DT  G "O4'" 1 
ATOM   1985  C  "C3'" . DT  C 1 24  ? 40.322 23.187  47.736  1.00 63.52  ? 123  DT  G "C3'" 1 
ATOM   1986  O  "O3'" . DT  C 1 24  ? 38.997 22.649  47.657  1.00 73.82  ? 123  DT  G "O3'" 1 
ATOM   1987  C  "C2'" . DT  C 1 24  ? 40.568 24.220  46.653  1.00 56.06  ? 123  DT  G "C2'" 1 
ATOM   1988  C  "C1'" . DT  C 1 24  ? 39.977 25.492  47.242  1.00 50.74  ? 123  DT  G "C1'" 1 
ATOM   1989  N  N1    . DT  C 1 24  ? 40.729 26.716  46.915  1.00 41.91  ? 123  DT  G N1    1 
ATOM   1990  C  C2    . DT  C 1 24  ? 40.022 27.860  46.599  1.00 43.19  ? 123  DT  G C2    1 
ATOM   1991  O  O2    . DT  C 1 24  ? 38.806 27.919  46.617  1.00 46.24  ? 123  DT  G O2    1 
ATOM   1992  N  N3    . DT  C 1 24  ? 40.798 28.942  46.266  1.00 29.26  ? 123  DT  G N3    1 
ATOM   1993  C  C4    . DT  C 1 24  ? 42.177 28.999  46.232  1.00 28.19  ? 123  DT  G C4    1 
ATOM   1994  O  O4    . DT  C 1 24  ? 42.735 30.031  45.906  1.00 25.23  ? 123  DT  G O4    1 
ATOM   1995  C  C5    . DT  C 1 24  ? 42.856 27.781  46.597  1.00 28.20  ? 123  DT  G C5    1 
ATOM   1996  C  C7    . DT  C 1 24  ? 44.352 27.761  46.599  1.00 71.90  ? 123  DT  G C7    1 
ATOM   1997  C  C6    . DT  C 1 24  ? 42.106 26.710  46.917  1.00 29.18  ? 123  DT  G C6    1 
ATOM   1998  P  P     . DA  C 1 25  ? 38.614 21.605  46.497  1.00 75.15  ? 124  DA  G P     1 
ATOM   1999  O  OP1   . DA  C 1 25  ? 37.872 20.485  47.123  1.00 73.57  ? 124  DA  G OP1   1 
ATOM   2000  O  OP2   . DA  C 1 25  ? 39.832 21.320  45.703  1.00 78.20  ? 124  DA  G OP2   1 
ATOM   2001  O  "O5'" . DA  C 1 25  ? 37.594 22.423  45.590  1.00 72.09  ? 124  DA  G "O5'" 1 
ATOM   2002  C  "C5'" . DA  C 1 25  ? 36.437 23.008  46.173  1.00 65.90  ? 124  DA  G "C5'" 1 
ATOM   2003  C  "C4'" . DA  C 1 25  ? 35.866 24.079  45.271  1.00 64.35  ? 124  DA  G "C4'" 1 
ATOM   2004  O  "O4'" . DA  C 1 25  ? 36.763 25.223  45.206  1.00 59.92  ? 124  DA  G "O4'" 1 
ATOM   2005  C  "C3'" . DA  C 1 25  ? 35.618 23.639  43.826  1.00 65.27  ? 124  DA  G "C3'" 1 
ATOM   2006  O  "O3'" . DA  C 1 25  ? 34.334 24.091  43.369  1.00 65.07  ? 124  DA  G "O3'" 1 
ATOM   2007  C  "C2'" . DA  C 1 25  ? 36.725 24.340  43.059  1.00 62.30  ? 124  DA  G "C2'" 1 
ATOM   2008  C  "C1'" . DA  C 1 25  ? 36.916 25.617  43.858  1.00 55.61  ? 124  DA  G "C1'" 1 
ATOM   2009  N  N9    . DA  C 1 25  ? 38.227 26.255  43.695  1.00 51.05  ? 124  DA  G N9    1 
ATOM   2010  C  C8    . DA  C 1 25  ? 39.474 25.702  43.868  1.00 50.41  ? 124  DA  G C8    1 
ATOM   2011  N  N7    . DA  C 1 25  ? 40.465 26.520  43.591  1.00 38.82  ? 124  DA  G N7    1 
ATOM   2012  C  C5    . DA  C 1 25  ? 39.829 27.693  43.219  1.00 42.12  ? 124  DA  G C5    1 
ATOM   2013  C  C6    . DA  C 1 25  ? 40.323 28.938  42.797  1.00 43.79  ? 124  DA  G C6    1 
ATOM   2014  N  N6    . DA  C 1 25  ? 41.625 29.207  42.667  1.00 42.17  ? 124  DA  G N6    1 
ATOM   2015  N  N1    . DA  C 1 25  ? 39.426 29.909  42.509  1.00 41.34  ? 124  DA  G N1    1 
ATOM   2016  C  C2    . DA  C 1 25  ? 38.118 29.631  42.638  1.00 42.61  ? 124  DA  G C2    1 
ATOM   2017  N  N3    . DA  C 1 25  ? 37.528 28.495  43.020  1.00 41.06  ? 124  DA  G N3    1 
ATOM   2018  C  C4    . DA  C 1 25  ? 38.450 27.553  43.296  1.00 46.70  ? 124  DA  G C4    1 
ATOM   2019  P  P     . DT  C 1 26  ? 33.660 23.414  42.070  1.00 66.73  ? 125  DT  G P     1 
ATOM   2020  O  OP1   . DT  C 1 26  ? 32.457 22.672  42.506  1.00 68.08  ? 125  DT  G OP1   1 
ATOM   2021  O  OP2   . DT  C 1 26  ? 34.713 22.713  41.288  1.00 58.74  ? 125  DT  G OP2   1 
ATOM   2022  O  "O5'" . DT  C 1 26  ? 33.156 24.672  41.245  1.00 60.07  ? 125  DT  G "O5'" 1 
ATOM   2023  C  "C5'" . DT  C 1 26  ? 32.385 25.673  41.892  1.00 49.37  ? 125  DT  G "C5'" 1 
ATOM   2024  C  "C4'" . DT  C 1 26  ? 32.669 27.031  41.296  1.00 51.06  ? 125  DT  G "C4'" 1 
ATOM   2025  O  "O4'" . DT  C 1 26  ? 34.089 27.306  41.378  1.00 56.17  ? 125  DT  G "O4'" 1 
ATOM   2026  C  "C3'" . DT  C 1 26  ? 32.285 27.222  39.825  1.00 54.92  ? 125  DT  G "C3'" 1 
ATOM   2027  O  "O3'" . DT  C 1 26  ? 31.672 28.500  39.664  1.00 62.82  ? 125  DT  G "O3'" 1 
ATOM   2028  C  "C2'" . DT  C 1 26  ? 33.621 27.230  39.109  1.00 53.51  ? 125  DT  G "C2'" 1 
ATOM   2029  C  "C1'" . DT  C 1 26  ? 34.505 27.873  40.154  1.00 49.23  ? 125  DT  G "C1'" 1 
ATOM   2030  N  N1    . DT  C 1 26  ? 35.954 27.650  40.000  1.00 40.13  ? 125  DT  G N1    1 
ATOM   2031  C  C2    . DT  C 1 26  ? 36.692 28.696  39.509  1.00 44.20  ? 125  DT  G C2    1 
ATOM   2032  O  O2    . DT  C 1 26  ? 36.199 29.771  39.200  1.00 43.39  ? 125  DT  G O2    1 
ATOM   2033  N  N3    . DT  C 1 26  ? 38.034 28.441  39.391  1.00 47.03  ? 125  DT  G N3    1 
ATOM   2034  C  C4    . DT  C 1 26  ? 38.691 27.272  39.707  1.00 48.80  ? 125  DT  G C4    1 
ATOM   2035  O  O4    . DT  C 1 26  ? 39.903 27.193  39.559  1.00 49.17  ? 125  DT  G O4    1 
ATOM   2036  C  C5    . DT  C 1 26  ? 37.858 26.215  40.203  1.00 46.28  ? 125  DT  G C5    1 
ATOM   2037  C  C7    . DT  C 1 26  ? 38.493 24.906  40.544  1.00 71.90  ? 125  DT  G C7    1 
ATOM   2038  C  C6    . DT  C 1 26  ? 36.545 26.453  40.332  1.00 39.94  ? 125  DT  G C6    1 
ATOM   2039  P  P     . DA  C 1 27  ? 30.769 28.797  38.373  1.00 65.92  ? 126  DA  G P     1 
ATOM   2040  O  OP1   . DA  C 1 27  ? 29.364 29.036  38.783  1.00 66.63  ? 126  DA  G OP1   1 
ATOM   2041  O  OP2   . DA  C 1 27  ? 31.078 27.737  37.384  1.00 66.90  ? 126  DA  G OP2   1 
ATOM   2042  O  "O5'" . DA  C 1 27  ? 31.348 30.170  37.836  1.00 61.40  ? 126  DA  G "O5'" 1 
ATOM   2043  C  "C5'" . DA  C 1 27  ? 32.743 30.335  37.696  1.00 57.78  ? 126  DA  G "C5'" 1 
ATOM   2044  C  "C4'" . DA  C 1 27  ? 33.035 31.467  36.747  1.00 63.21  ? 126  DA  G "C4'" 1 
ATOM   2045  O  "O4'" . DA  C 1 27  ? 34.458 31.494  36.537  1.00 64.55  ? 126  DA  G "O4'" 1 
ATOM   2046  C  "C3'" . DA  C 1 27  ? 32.429 31.275  35.365  1.00 69.58  ? 126  DA  G "C3'" 1 
ATOM   2047  O  "O3'" . DA  C 1 27  ? 32.196 32.561  34.780  1.00 71.87  ? 126  DA  G "O3'" 1 
ATOM   2048  C  "C2'" . DA  C 1 27  ? 33.491 30.472  34.632  1.00 66.58  ? 126  DA  G "C2'" 1 
ATOM   2049  C  "C1'" . DA  C 1 27  ? 34.796 30.930  35.275  1.00 60.59  ? 126  DA  G "C1'" 1 
ATOM   2050  N  N9    . DA  C 1 27  ? 35.755 29.860  35.544  1.00 51.10  ? 126  DA  G N9    1 
ATOM   2051  C  C8    . DA  C 1 27  ? 35.500 28.638  36.112  1.00 50.83  ? 126  DA  G C8    1 
ATOM   2052  N  N7    . DA  C 1 27  ? 36.574 27.912  36.309  1.00 47.45  ? 126  DA  G N7    1 
ATOM   2053  C  C5    . DA  C 1 27  ? 37.602 28.705  35.822  1.00 49.84  ? 126  DA  G C5    1 
ATOM   2054  C  C6    . DA  C 1 27  ? 38.989 28.513  35.761  1.00 51.93  ? 126  DA  G C6    1 
ATOM   2055  N  N6    . DA  C 1 27  ? 39.603 27.421  36.222  1.00 51.11  ? 126  DA  G N6    1 
ATOM   2056  N  N1    . DA  C 1 27  ? 39.735 29.493  35.209  1.00 47.54  ? 126  DA  G N1    1 
ATOM   2057  C  C2    . DA  C 1 27  ? 39.116 30.587  34.757  1.00 52.17  ? 126  DA  G C2    1 
ATOM   2058  N  N3    . DA  C 1 27  ? 37.818 30.889  34.770  1.00 48.28  ? 126  DA  G N3    1 
ATOM   2059  C  C4    . DA  C 1 27  ? 37.109 29.896  35.326  1.00 48.00  ? 126  DA  G C4    1 
ATOM   2060  P  P     . DC  C 1 28  ? 31.446 32.670  33.369  1.00 72.89  ? 127  DC  G P     1 
ATOM   2061  O  OP1   . DC  C 1 28  ? 31.074 34.088  33.133  1.00 74.10  ? 127  DC  G OP1   1 
ATOM   2062  O  OP2   . DC  C 1 28  ? 30.391 31.623  33.345  1.00 71.85  ? 127  DC  G OP2   1 
ATOM   2063  O  "O5'" . DC  C 1 28  ? 32.591 32.289  32.333  1.00 69.00  ? 127  DC  G "O5'" 1 
ATOM   2064  C  "C5'" . DC  C 1 28  ? 33.651 33.201  32.084  1.00 67.41  ? 127  DC  G "C5'" 1 
ATOM   2065  C  "C4'" . DC  C 1 28  ? 34.591 32.649  31.039  1.00 71.52  ? 127  DC  G "C4'" 1 
ATOM   2066  O  "O4'" . DC  C 1 28  ? 35.566 31.732  31.604  1.00 67.57  ? 127  DC  G "O4'" 1 
ATOM   2067  C  "C3'" . DC  C 1 28  ? 33.922 31.901  29.883  1.00 74.64  ? 127  DC  G "C3'" 1 
ATOM   2068  O  "O3'" . DC  C 1 28  ? 34.598 32.261  28.674  1.00 83.07  ? 127  DC  G "O3'" 1 
ATOM   2069  C  "C2'" . DC  C 1 28  ? 34.231 30.448  30.208  1.00 67.54  ? 127  DC  G "C2'" 1 
ATOM   2070  C  "C1'" . DC  C 1 28  ? 35.638 30.609  30.750  1.00 62.61  ? 127  DC  G "C1'" 1 
ATOM   2071  N  N1    . DC  C 1 28  ? 36.232 29.481  31.488  1.00 53.43  ? 127  DC  G N1    1 
ATOM   2072  C  C2    . DC  C 1 28  ? 37.633 29.440  31.618  1.00 55.03  ? 127  DC  G C2    1 
ATOM   2073  O  O2    . DC  C 1 28  ? 38.304 30.378  31.159  1.00 53.48  ? 127  DC  G O2    1 
ATOM   2074  N  N3    . DC  C 1 28  ? 38.212 28.388  32.241  1.00 50.97  ? 127  DC  G N3    1 
ATOM   2075  C  C4    . DC  C 1 28  ? 37.450 27.412  32.740  1.00 55.25  ? 127  DC  G C4    1 
ATOM   2076  N  N4    . DC  C 1 28  ? 38.061 26.392  33.345  1.00 49.61  ? 127  DC  G N4    1 
ATOM   2077  C  C5    . DC  C 1 28  ? 36.020 27.439  32.643  1.00 50.03  ? 127  DC  G C5    1 
ATOM   2078  C  C6    . DC  C 1 28  ? 35.460 28.484  32.015  1.00 45.31  ? 127  DC  G C6    1 
ATOM   2079  P  P     . DG  C 1 29  ? 33.767 32.490  27.320  1.00 86.09  ? 128  DG  G P     1 
ATOM   2080  O  OP1   . DG  C 1 29  ? 32.992 33.751  27.430  1.00 84.61  ? 128  DG  G OP1   1 
ATOM   2081  O  OP2   . DG  C 1 29  ? 33.066 31.221  26.988  1.00 85.51  ? 128  DG  G OP2   1 
ATOM   2082  O  "O5'" . DG  C 1 29  ? 34.922 32.725  26.254  1.00 81.32  ? 128  DG  G "O5'" 1 
ATOM   2083  C  "C5'" . DG  C 1 29  ? 35.911 33.720  26.478  1.00 83.91  ? 128  DG  G "C5'" 1 
ATOM   2084  C  "C4'" . DG  C 1 29  ? 37.280 33.172  26.157  1.00 90.09  ? 128  DG  G "C4'" 1 
ATOM   2085  O  "O4'" . DG  C 1 29  ? 37.598 32.104  27.079  1.00 84.55  ? 128  DG  G "O4'" 1 
ATOM   2086  C  "C3'" . DG  C 1 29  ? 37.416 32.573  24.758  1.00 97.53  ? 128  DG  G "C3'" 1 
ATOM   2087  O  "O3'" . DG  C 1 29  ? 38.692 32.925  24.210  1.00 100.04 ? 128  DG  G "O3'" 1 
ATOM   2088  C  "C2'" . DG  C 1 29  ? 37.307 31.075  24.999  1.00 90.05  ? 128  DG  G "C2'" 1 
ATOM   2089  C  "C1'" . DG  C 1 29  ? 37.927 30.919  26.372  1.00 77.62  ? 128  DG  G "C1'" 1 
ATOM   2090  N  N9    . DG  C 1 29  ? 37.418 29.792  27.146  1.00 66.19  ? 128  DG  G N9    1 
ATOM   2091  C  C8    . DG  C 1 29  ? 36.104 29.507  27.425  1.00 62.18  ? 128  DG  G C8    1 
ATOM   2092  N  N7    . DG  C 1 29  ? 35.957 28.448  28.175  1.00 54.58  ? 128  DG  G N7    1 
ATOM   2093  C  C5    . DG  C 1 29  ? 37.252 28.003  28.400  1.00 50.11  ? 128  DG  G C5    1 
ATOM   2094  C  C6    . DG  C 1 29  ? 37.721 26.906  29.153  1.00 49.36  ? 128  DG  G C6    1 
ATOM   2095  O  O6    . DG  C 1 29  ? 37.069 26.080  29.791  1.00 50.16  ? 128  DG  G O6    1 
ATOM   2096  N  N1    . DG  C 1 29  ? 39.105 26.814  29.119  1.00 39.01  ? 128  DG  G N1    1 
ATOM   2097  C  C2    . DG  C 1 29  ? 39.932 27.667  28.439  1.00 43.58  ? 128  DG  G C2    1 
ATOM   2098  N  N2    . DG  C 1 29  ? 41.247 27.397  28.514  1.00 40.65  ? 128  DG  G N2    1 
ATOM   2099  N  N3    . DG  C 1 29  ? 39.508 28.704  27.735  1.00 46.52  ? 128  DG  G N3    1 
ATOM   2100  C  C4    . DG  C 1 29  ? 38.165 28.813  27.761  1.00 54.83  ? 128  DG  G C4    1 
ATOM   2101  P  P     . DA  C 1 30  ? 38.936 32.830  22.625  1.00 101.36 ? 129  DA  G P     1 
ATOM   2102  O  OP1   . DA  C 1 30  ? 39.888 33.912  22.254  1.00 100.57 ? 129  DA  G OP1   1 
ATOM   2103  O  OP2   . DA  C 1 30  ? 37.608 32.746  21.952  1.00 96.09  ? 129  DA  G OP2   1 
ATOM   2104  O  "O5'" . DA  C 1 30  ? 39.681 31.434  22.468  1.00 97.92  ? 129  DA  G "O5'" 1 
ATOM   2105  C  "C5'" . DA  C 1 30  ? 40.963 31.240  23.058  1.00 97.35  ? 129  DA  G "C5'" 1 
ATOM   2106  C  "C4'" . DA  C 1 30  ? 41.340 29.777  23.033  1.00 102.55 ? 129  DA  G "C4'" 1 
ATOM   2107  O  "O4'" . DA  C 1 30  ? 40.724 29.021  24.112  1.00 99.02  ? 129  DA  G "O4'" 1 
ATOM   2108  C  "C3'" . DA  C 1 30  ? 40.977 29.042  21.738  1.00 109.17 ? 129  DA  G "C3'" 1 
ATOM   2109  O  "O3'" . DA  C 1 30  ? 42.025 28.129  21.428  1.00 117.61 ? 129  DA  G "O3'" 1 
ATOM   2110  C  "C2'" . DA  C 1 30  ? 39.782 28.209  22.158  1.00 98.71  ? 129  DA  G "C2'" 1 
ATOM   2111  C  "C1'" . DA  C 1 30  ? 40.242 27.819  23.547  1.00 86.37  ? 129  DA  G "C1'" 1 
ATOM   2112  N  N9    . DA  C 1 30  ? 39.245 27.217  24.433  1.00 72.17  ? 129  DA  G N9    1 
ATOM   2113  C  C8    . DA  C 1 30  ? 37.888 27.437  24.521  1.00 66.67  ? 129  DA  G C8    1 
ATOM   2114  N  N7    . DA  C 1 30  ? 37.276 26.627  25.353  1.00 53.90  ? 129  DA  G N7    1 
ATOM   2115  C  C5    . DA  C 1 30  ? 38.302 25.843  25.865  1.00 53.97  ? 129  DA  G C5    1 
ATOM   2116  C  C6    . DA  C 1 30  ? 38.310 24.783  26.778  1.00 49.98  ? 129  DA  G C6    1 
ATOM   2117  N  N6    . DA  C 1 30  ? 37.206 24.309  27.356  1.00 55.76  ? 129  DA  G N6    1 
ATOM   2118  N  N1    . DA  C 1 30  ? 39.501 24.214  27.080  1.00 44.26  ? 129  DA  G N1    1 
ATOM   2119  C  C2    . DA  C 1 30  ? 40.602 24.693  26.492  1.00 45.57  ? 129  DA  G C2    1 
ATOM   2120  N  N3    . DA  C 1 30  ? 40.723 25.683  25.609  1.00 50.71  ? 129  DA  G N3    1 
ATOM   2121  C  C4    . DA  C 1 30  ? 39.520 26.217  25.331  1.00 59.95  ? 129  DA  G C4    1 
ATOM   2122  P  P     . DA  C 1 31  ? 42.929 28.355  20.128  1.00 119.30 ? 130  DA  G P     1 
ATOM   2123  O  OP1   . DA  C 1 31  ? 43.657 29.643  20.278  1.00 117.23 ? 130  DA  G OP1   1 
ATOM   2124  O  OP2   . DA  C 1 31  ? 42.075 28.125  18.935  1.00 116.98 ? 130  DA  G OP2   1 
ATOM   2125  O  "O5'" . DA  C 1 31  ? 43.977 27.168  20.252  1.00 116.87 ? 130  DA  G "O5'" 1 
ATOM   2126  C  "C5'" . DA  C 1 31  ? 44.711 26.988  21.459  1.00 105.89 ? 130  DA  G "C5'" 1 
ATOM   2127  C  "C4'" . DA  C 1 31  ? 44.589 25.564  21.949  1.00 100.51 ? 130  DA  G "C4'" 1 
ATOM   2128  O  "O4'" . DA  C 1 31  ? 43.323 25.309  22.611  1.00 91.32  ? 130  DA  G "O4'" 1 
ATOM   2129  C  "C3'" . DA  C 1 31  ? 44.727 24.483  20.876  1.00 105.84 ? 130  DA  G "C3'" 1 
ATOM   2130  O  "O3'" . DA  C 1 31  ? 45.563 23.446  21.382  1.00 110.81 ? 130  DA  G "O3'" 1 
ATOM   2131  C  "C2'" . DA  C 1 31  ? 43.311 23.947  20.737  1.00 97.84  ? 130  DA  G "C2'" 1 
ATOM   2132  C  "C1'" . DA  C 1 31  ? 42.849 24.046  22.172  1.00 87.15  ? 130  DA  G "C1'" 1 
ATOM   2133  N  N9    . DA  C 1 31  ? 41.407 23.968  22.414  1.00 74.96  ? 130  DA  G N9    1 
ATOM   2134  C  C8    . DA  C 1 31  ? 40.385 24.705  21.862  1.00 70.95  ? 130  DA  G C8    1 
ATOM   2135  N  N7    . DA  C 1 31  ? 39.193 24.390  22.324  1.00 59.62  ? 130  DA  G N7    1 
ATOM   2136  C  C5    . DA  C 1 31  ? 39.449 23.376  23.236  1.00 59.36  ? 130  DA  G C5    1 
ATOM   2137  C  C6    . DA  C 1 31  ? 38.607 22.618  24.069  1.00 56.75  ? 130  DA  G C6    1 
ATOM   2138  N  N6    . DA  C 1 31  ? 37.293 22.784  24.127  1.00 53.20  ? 130  DA  G N6    1 
ATOM   2139  N  N1    . DA  C 1 31  ? 39.174 21.675  24.853  1.00 52.54  ? 130  DA  G N1    1 
ATOM   2140  C  C2    . DA  C 1 31  ? 40.504 21.517  24.801  1.00 58.05  ? 130  DA  G C2    1 
ATOM   2141  N  N3    . DA  C 1 31  ? 41.407 22.175  24.064  1.00 60.79  ? 130  DA  G N3    1 
ATOM   2142  C  C4    . DA  C 1 31  ? 40.806 23.100  23.296  1.00 65.23  ? 130  DA  G C4    1 
ATOM   2143  P  P     . DG  C 1 32  ? 46.342 22.486  20.365  1.00 112.64 ? 131  DG  G P     1 
ATOM   2144  O  OP1   . DG  C 1 32  ? 47.734 22.985  20.221  1.00 113.42 ? 131  DG  G OP1   1 
ATOM   2145  O  OP2   . DG  C 1 32  ? 45.480 22.329  19.160  1.00 113.06 ? 131  DG  G OP2   1 
ATOM   2146  O  "O5'" . DG  C 1 32  ? 46.394 21.100  21.143  1.00 110.08 ? 131  DG  G "O5'" 1 
ATOM   2147  C  "C5'" . DG  C 1 32  ? 45.914 19.904  20.540  1.00 103.60 ? 131  DG  G "C5'" 1 
ATOM   2148  C  "C4'" . DG  C 1 32  ? 45.245 19.034  21.578  1.00 94.58  ? 131  DG  G "C4'" 1 
ATOM   2149  O  "O4'" . DG  C 1 32  ? 44.041 19.692  22.057  1.00 85.07  ? 131  DG  G "O4'" 1 
ATOM   2150  C  "C3'" . DG  C 1 32  ? 44.803 17.679  21.033  1.00 95.64  ? 131  DG  G "C3'" 1 
ATOM   2151  O  "O3'" . DG  C 1 32  ? 45.116 16.642  21.963  1.00 104.11 ? 131  DG  G "O3'" 1 
ATOM   2152  C  "C2'" . DG  C 1 32  ? 43.304 17.833  20.847  1.00 86.05  ? 131  DG  G "C2'" 1 
ATOM   2153  C  "C1'" . DG  C 1 32  ? 42.925 18.822  21.934  1.00 76.61  ? 131  DG  G "C1'" 1 
ATOM   2154  N  N9    . DG  C 1 32  ? 41.747 19.623  21.600  1.00 67.60  ? 131  DG  G N9    1 
ATOM   2155  C  C8    . DG  C 1 32  ? 41.705 20.766  20.833  1.00 63.82  ? 131  DG  G C8    1 
ATOM   2156  N  N7    . DG  C 1 32  ? 40.492 21.225  20.656  1.00 56.76  ? 131  DG  G N7    1 
ATOM   2157  C  C5    . DG  C 1 32  ? 39.684 20.341  21.363  1.00 58.08  ? 131  DG  G C5    1 
ATOM   2158  C  C6    . DG  C 1 32  ? 38.266 20.319  21.536  1.00 56.14  ? 131  DG  G C6    1 
ATOM   2159  O  O6    . DG  C 1 32  ? 37.417 21.099  21.078  1.00 57.25  ? 131  DG  G O6    1 
ATOM   2160  N  N1    . DG  C 1 32  ? 37.863 19.251  22.331  1.00 42.96  ? 131  DG  G N1    1 
ATOM   2161  C  C2    . DG  C 1 32  ? 38.709 18.321  22.886  1.00 50.40  ? 131  DG  G C2    1 
ATOM   2162  N  N2    . DG  C 1 32  ? 38.126 17.360  23.614  1.00 52.35  ? 131  DG  G N2    1 
ATOM   2163  N  N3    . DG  C 1 32  ? 40.028 18.329  22.737  1.00 54.30  ? 131  DG  G N3    1 
ATOM   2164  C  C4    . DG  C 1 32  ? 40.443 19.357  21.966  1.00 61.59  ? 131  DG  G C4    1 
ATOM   2165  P  P     . DT  C 1 33  ? 45.498 15.179  21.416  1.00 108.26 ? 132  DT  G P     1 
ATOM   2166  O  OP1   . DT  C 1 33  ? 46.610 14.618  22.235  1.00 102.43 ? 132  DT  G OP1   1 
ATOM   2167  O  OP2   . DT  C 1 33  ? 45.656 15.302  19.943  1.00 108.36 ? 132  DT  G OP2   1 
ATOM   2168  O  "O5'" . DT  C 1 33  ? 44.185 14.326  21.698  1.00 109.44 ? 132  DT  G "O5'" 1 
ATOM   2169  C  "C5'" . DT  C 1 33  ? 42.907 14.950  21.672  1.00 106.34 ? 132  DT  G "C5'" 1 
ATOM   2170  C  "C4'" . DT  C 1 33  ? 41.853 14.008  22.197  1.00 101.31 ? 132  DT  G "C4'" 1 
ATOM   2171  O  "O4'" . DT  C 1 33  ? 40.594 14.713  22.305  1.00 95.25  ? 132  DT  G "O4'" 1 
ATOM   2172  C  "C3'" . DT  C 1 33  ? 41.597 12.810  21.291  1.00 104.58 ? 132  DT  G "C3'" 1 
ATOM   2173  O  "O3'" . DT  C 1 33  ? 41.391 11.641  22.086  1.00 107.14 ? 132  DT  G "O3'" 1 
ATOM   2174  C  "C2'" . DT  C 1 33  ? 40.363 13.211  20.497  1.00 97.28  ? 132  DT  G "C2'" 1 
ATOM   2175  C  "C1'" . DT  C 1 33  ? 39.624 14.176  21.416  1.00 86.77  ? 132  DT  G "C1'" 1 
ATOM   2176  N  N1    . DT  C 1 33  ? 39.001 15.318  20.716  1.00 73.22  ? 132  DT  G N1    1 
ATOM   2177  C  C2    . DT  C 1 33  ? 37.640 15.520  20.834  1.00 72.06  ? 132  DT  G C2    1 
ATOM   2178  O  O2    . DT  C 1 33  ? 36.903 14.786  21.478  1.00 73.11  ? 132  DT  G O2    1 
ATOM   2179  N  N3    . DT  C 1 33  ? 37.164 16.620  20.162  1.00 62.70  ? 132  DT  G N3    1 
ATOM   2180  C  C4    . DT  C 1 33  ? 37.893 17.508  19.403  1.00 63.69  ? 132  DT  G C4    1 
ATOM   2181  O  O4    . DT  C 1 33  ? 37.327 18.441  18.850  1.00 58.71  ? 132  DT  G O4    1 
ATOM   2182  C  C5    . DT  C 1 33  ? 39.309 17.238  19.325  1.00 59.80  ? 132  DT  G C5    1 
ATOM   2183  C  C7    . DT  C 1 33  ? 40.179 18.162  18.536  1.00 71.90  ? 132  DT  G C7    1 
ATOM   2184  C  C6    . DT  C 1 33  ? 39.783 16.169  19.971  1.00 58.56  ? 132  DT  G C6    1 
ATOM   2185  P  P     . DT  C 1 34  ? 41.567 10.192  21.423  1.00 109.57 ? 133  DT  G P     1 
ATOM   2186  O  OP1   . DT  C 1 34  ? 41.962 9.227   22.488  1.00 104.33 ? 133  DT  G OP1   1 
ATOM   2187  O  OP2   . DT  C 1 34  ? 42.430 10.356  20.220  1.00 108.60 ? 133  DT  G OP2   1 
ATOM   2188  O  "O5'" . DT  C 1 34  ? 40.086 9.855   20.950  1.00 104.41 ? 133  DT  G "O5'" 1 
ATOM   2189  C  "C5'" . DT  C 1 34  ? 39.017 9.852   21.893  1.00 96.88  ? 133  DT  G "C5'" 1 
ATOM   2190  C  "C4'" . DT  C 1 34  ? 37.690 9.743   21.183  1.00 95.78  ? 133  DT  G "C4'" 1 
ATOM   2191  O  "O4'" . DT  C 1 34  ? 37.203 11.045  20.763  1.00 91.46  ? 133  DT  G "O4'" 1 
ATOM   2192  C  "C3'" . DT  C 1 34  ? 37.734 8.870   19.926  1.00 98.01  ? 133  DT  G "C3'" 1 
ATOM   2193  O  "O3'" . DT  C 1 34  ? 36.603 7.991   19.898  1.00 104.83 ? 133  DT  G "O3'" 1 
ATOM   2194  C  "C2'" . DT  C 1 34  ? 37.640 9.887   18.802  1.00 92.71  ? 133  DT  G "C2'" 1 
ATOM   2195  C  "C1'" . DT  C 1 34  ? 36.733 10.925  19.435  1.00 84.74  ? 133  DT  G "C1'" 1 
ATOM   2196  N  N1    . DT  C 1 34  ? 36.710 12.266  18.799  1.00 75.54  ? 133  DT  G N1    1 
ATOM   2197  C  C2    . DT  C 1 34  ? 35.507 12.964  18.805  1.00 72.09  ? 133  DT  G C2    1 
ATOM   2198  O  O2    . DT  C 1 34  ? 34.495 12.558  19.355  1.00 62.36  ? 133  DT  G O2    1 
ATOM   2199  N  N3    . DT  C 1 34  ? 35.535 14.165  18.140  1.00 64.10  ? 133  DT  G N3    1 
ATOM   2200  C  C4    . DT  C 1 34  ? 36.615 14.740  17.501  1.00 60.97  ? 133  DT  G C4    1 
ATOM   2201  O  O4    . DT  C 1 34  ? 36.480 15.823  16.938  1.00 54.07  ? 133  DT  G O4    1 
ATOM   2202  C  C5    . DT  C 1 34  ? 37.854 13.973  17.560  1.00 56.27  ? 133  DT  G C5    1 
ATOM   2203  C  C7    . DT  C 1 34  ? 39.085 14.532  16.917  1.00 71.90  ? 133  DT  G C7    1 
ATOM   2204  C  C6    . DT  C 1 34  ? 37.837 12.790  18.197  1.00 58.83  ? 133  DT  G C6    1 
ATOM   2205  P  P     . DA  C 1 35  ? 36.832 6.398   19.965  1.00 107.67 ? 134  DA  G P     1 
ATOM   2206  O  OP1   . DA  C 1 35  ? 37.853 6.101   21.005  1.00 106.45 ? 134  DA  G OP1   1 
ATOM   2207  O  OP2   . DA  C 1 35  ? 37.059 5.948   18.565  1.00 107.41 ? 134  DA  G OP2   1 
ATOM   2208  O  "O5'" . DA  C 1 35  ? 35.431 5.823   20.464  1.00 97.12  ? 134  DA  G "O5'" 1 
ATOM   2209  C  "C5'" . DA  C 1 35  ? 34.431 5.434   19.527  1.00 92.14  ? 134  DA  G "C5'" 1 
ATOM   2210  C  "C4'" . DA  C 1 35  ? 33.321 6.458   19.491  1.00 89.26  ? 134  DA  G "C4'" 1 
ATOM   2211  O  "O4'" . DA  C 1 35  ? 33.863 7.753   19.129  1.00 81.28  ? 134  DA  G "O4'" 1 
ATOM   2212  C  "C3'" . DA  C 1 35  ? 32.227 6.160   18.465  1.00 96.11  ? 134  DA  G "C3'" 1 
ATOM   2213  O  "O3'" . DA  C 1 35  ? 30.939 6.418   19.031  1.00 104.17 ? 134  DA  G "O3'" 1 
ATOM   2214  C  "C2'" . DA  C 1 35  ? 32.525 7.119   17.324  1.00 86.02  ? 134  DA  G "C2'" 1 
ATOM   2215  C  "C1'" . DA  C 1 35  ? 33.133 8.304   18.043  1.00 79.01  ? 134  DA  G "C1'" 1 
ATOM   2216  N  N9    . DA  C 1 35  ? 34.066 9.095   17.240  1.00 75.54  ? 134  DA  G N9    1 
ATOM   2217  C  C8    . DA  C 1 35  ? 35.366 8.776   16.940  1.00 73.37  ? 134  DA  G C8    1 
ATOM   2218  N  N7    . DA  C 1 35  ? 35.984 9.688   16.224  1.00 68.16  ? 134  DA  G N7    1 
ATOM   2219  C  C5    . DA  C 1 35  ? 35.023 10.674  16.034  1.00 67.99  ? 134  DA  G C5    1 
ATOM   2220  C  C6    . DA  C 1 35  ? 35.055 11.912  15.356  1.00 63.27  ? 134  DA  G C6    1 
ATOM   2221  N  N6    . DA  C 1 35  ? 36.140 12.385  14.733  1.00 57.06  ? 134  DA  G N6    1 
ATOM   2222  N  N1    . DA  C 1 35  ? 33.923 12.655  15.343  1.00 63.53  ? 134  DA  G N1    1 
ATOM   2223  C  C2    . DA  C 1 35  ? 32.843 12.178  15.974  1.00 68.16  ? 134  DA  G C2    1 
ATOM   2224  N  N3    . DA  C 1 35  ? 32.691 11.033  16.650  1.00 70.07  ? 134  DA  G N3    1 
ATOM   2225  C  C4    . DA  C 1 35  ? 33.832 10.318  16.643  1.00 72.48  ? 134  DA  G C4    1 
ATOM   2226  P  P     . DT  C 1 36  ? 29.616 6.045   18.197  1.00 106.32 ? 135  DT  G P     1 
ATOM   2227  O  OP1   . DT  C 1 36  ? 28.452 5.954   19.120  1.00 103.95 ? 135  DT  G OP1   1 
ATOM   2228  O  OP2   . DT  C 1 36  ? 29.953 4.889   17.324  1.00 105.22 ? 135  DT  G OP2   1 
ATOM   2229  O  "O5'" . DT  C 1 36  ? 29.417 7.315   17.263  1.00 102.50 ? 135  DT  G "O5'" 1 
ATOM   2230  C  "C5'" . DT  C 1 36  ? 28.594 7.244   16.115  1.00 99.44  ? 135  DT  G "C5'" 1 
ATOM   2231  C  "C4'" . DT  C 1 36  ? 28.014 8.604   15.822  1.00 97.66  ? 135  DT  G "C4'" 1 
ATOM   2232  O  "O4'" . DT  C 1 36  ? 29.104 9.544   15.679  1.00 91.20  ? 135  DT  G "O4'" 1 
ATOM   2233  C  "C3'" . DT  C 1 36  ? 27.221 8.662   14.520  1.00 99.89  ? 135  DT  G "C3'" 1 
ATOM   2234  O  "O3'" . DT  C 1 36  ? 26.031 9.425   14.682  1.00 106.47 ? 135  DT  G "O3'" 1 
ATOM   2235  C  "C2'" . DT  C 1 36  ? 28.172 9.317   13.537  1.00 90.05  ? 135  DT  G "C2'" 1 
ATOM   2236  C  "C1'" . DT  C 1 36  ? 29.048 10.186  14.416  1.00 86.14  ? 135  DT  G "C1'" 1 
ATOM   2237  N  N1    . DT  C 1 36  ? 30.428 10.313  13.915  1.00 78.21  ? 135  DT  G N1    1 
ATOM   2238  C  C2    . DT  C 1 36  ? 30.785 11.487  13.288  1.00 82.92  ? 135  DT  G C2    1 
ATOM   2239  O  O2    . DT  C 1 36  ? 30.025 12.435  13.168  1.00 89.45  ? 135  DT  G O2    1 
ATOM   2240  N  N3    . DT  C 1 36  ? 32.072 11.512  12.806  1.00 80.52  ? 135  DT  G N3    1 
ATOM   2241  C  C4    . DT  C 1 36  ? 33.018 10.507  12.896  1.00 73.84  ? 135  DT  G C4    1 
ATOM   2242  O  O4    . DT  C 1 36  ? 34.128 10.663  12.384  1.00 68.54  ? 135  DT  G O4    1 
ATOM   2243  C  C5    . DT  C 1 36  ? 32.585 9.317   13.603  1.00 67.36  ? 135  DT  G C5    1 
ATOM   2244  C  C7    . DT  C 1 36  ? 33.556 8.194   13.795  1.00 71.90  ? 135  DT  G C7    1 
ATOM   2245  C  C6    . DT  C 1 36  ? 31.327 9.279   14.063  1.00 69.15  ? 135  DT  G C6    1 
ATOM   2246  P  P     . DC  C 1 37  ? 24.794 9.164   13.697  1.00 110.03 ? 136  DC  G P     1 
ATOM   2247  O  OP1   . DC  C 1 37  ? 23.533 9.291   14.474  1.00 107.62 ? 136  DC  G OP1   1 
ATOM   2248  O  OP2   . DC  C 1 37  ? 25.079 7.900   12.968  1.00 109.23 ? 136  DC  G OP2   1 
ATOM   2249  O  "O5'" . DC  C 1 37  ? 24.894 10.381  12.674  1.00 111.38 ? 136  DC  G "O5'" 1 
ATOM   2250  C  "C5'" . DC  C 1 37  ? 24.837 11.718  13.158  1.00 109.16 ? 136  DC  G "C5'" 1 
ATOM   2251  C  "C4'" . DC  C 1 37  ? 25.380 12.690  12.136  1.00 106.56 ? 136  DC  G "C4'" 1 
ATOM   2252  O  "O4'" . DC  C 1 37  ? 26.814 12.537  11.964  1.00 103.70 ? 136  DC  G "O4'" 1 
ATOM   2253  C  "C3'" . DC  C 1 37  ? 24.769 12.598  10.737  1.00 104.18 ? 136  DC  G "C3'" 1 
ATOM   2254  O  "O3'" . DC  C 1 37  ? 24.599 13.928  10.243  1.00 99.95  ? 136  DC  G "O3'" 1 
ATOM   2255  C  "C2'" . DC  C 1 37  ? 25.879 11.959  9.921   1.00 101.46 ? 136  DC  G "C2'" 1 
ATOM   2256  C  "C1'" . DC  C 1 37  ? 27.102 12.568  10.578  1.00 96.97  ? 136  DC  G "C1'" 1 
ATOM   2257  N  N1    . DC  C 1 37  ? 28.377 11.867  10.343  1.00 90.52  ? 136  DC  G N1    1 
ATOM   2258  C  C2    . DC  C 1 37  ? 29.438 12.577  9.761   1.00 84.65  ? 136  DC  G C2    1 
ATOM   2259  O  O2    . DC  C 1 37  ? 29.263 13.761  9.441   1.00 78.35  ? 136  DC  G O2    1 
ATOM   2260  N  N3    . DC  C 1 37  ? 30.621 11.954  9.557   1.00 80.07  ? 136  DC  G N3    1 
ATOM   2261  C  C4    . DC  C 1 37  ? 30.766 10.672  9.903   1.00 84.32  ? 136  DC  G C4    1 
ATOM   2262  N  N4    . DC  C 1 37  ? 31.957 10.098  9.701   1.00 75.61  ? 136  DC  G N4    1 
ATOM   2263  C  C5    . DC  C 1 37  ? 29.698 9.919   10.479  1.00 89.11  ? 136  DC  G C5    1 
ATOM   2264  C  C6    . DC  C 1 37  ? 28.533 10.552  10.682  1.00 90.30  ? 136  DC  G C6    1 
ATOM   2265  O  "O5'" . DG  D 2 1   ? 41.231 9.550   3.254   1.00 113.20 ? 100  DG  H "O5'" 1 
ATOM   2266  C  "C5'" . DG  D 2 1   ? 39.812 9.554   3.055   1.00 121.40 ? 100  DG  H "C5'" 1 
ATOM   2267  C  "C4'" . DG  D 2 1   ? 39.283 10.919  2.678   1.00 126.55 ? 100  DG  H "C4'" 1 
ATOM   2268  O  "O4'" . DG  D 2 1   ? 37.836 10.852  2.593   1.00 125.10 ? 100  DG  H "O4'" 1 
ATOM   2269  C  "C3'" . DG  D 2 1   ? 39.598 12.015  3.700   1.00 131.69 ? 100  DG  H "C3'" 1 
ATOM   2270  O  "O3'" . DG  D 2 1   ? 39.897 13.265  3.065   1.00 133.92 ? 100  DG  H "O3'" 1 
ATOM   2271  C  "C2'" . DG  D 2 1   ? 38.316 12.133  4.498   1.00 129.39 ? 100  DG  H "C2'" 1 
ATOM   2272  C  "C1'" . DG  D 2 1   ? 37.248 11.799  3.471   1.00 118.69 ? 100  DG  H "C1'" 1 
ATOM   2273  N  N9    . DG  D 2 1   ? 36.073 11.190  4.082   1.00 105.73 ? 100  DG  H N9    1 
ATOM   2274  C  C8    . DG  D 2 1   ? 36.043 10.064  4.866   1.00 95.90  ? 100  DG  H C8    1 
ATOM   2275  N  N7    . DG  D 2 1   ? 34.855 9.798   5.333   1.00 94.64  ? 100  DG  H N7    1 
ATOM   2276  C  C5    . DG  D 2 1   ? 34.050 10.798  4.811   1.00 102.64 ? 100  DG  H C5    1 
ATOM   2277  C  C6    . DG  D 2 1   ? 32.667 11.038  4.978   1.00 107.30 ? 100  DG  H C6    1 
ATOM   2278  O  O6    . DG  D 2 1   ? 31.853 10.391  5.643   1.00 107.48 ? 100  DG  H O6    1 
ATOM   2279  N  N1    . DG  D 2 1   ? 32.252 12.166  4.276   1.00 112.76 ? 100  DG  H N1    1 
ATOM   2280  C  C2    . DG  D 2 1   ? 33.067 12.963  3.512   1.00 115.46 ? 100  DG  H C2    1 
ATOM   2281  N  N2    . DG  D 2 1   ? 32.478 14.014  2.913   1.00 114.43 ? 100  DG  H N2    1 
ATOM   2282  N  N3    . DG  D 2 1   ? 34.365 12.748  3.347   1.00 109.82 ? 100  DG  H N3    1 
ATOM   2283  C  C4    . DG  D 2 1   ? 34.785 11.657  4.024   1.00 104.88 ? 100  DG  H C4    1 
ATOM   2284  P  P     . DG  D 2 2   ? 40.457 14.492  3.947   1.00 134.10 ? 101  DG  H P     1 
ATOM   2285  O  OP1   . DG  D 2 2   ? 41.397 15.269  3.097   1.00 133.42 ? 101  DG  H OP1   1 
ATOM   2286  O  OP2   . DG  D 2 2   ? 40.926 13.936  5.244   1.00 129.26 ? 101  DG  H OP2   1 
ATOM   2287  O  "O5'" . DG  D 2 2   ? 39.169 15.388  4.238   1.00 129.92 ? 101  DG  H "O5'" 1 
ATOM   2288  C  "C5'" . DG  D 2 2   ? 38.496 16.069  3.178   1.00 120.54 ? 101  DG  H "C5'" 1 
ATOM   2289  C  "C4'" . DG  D 2 2   ? 37.284 16.803  3.706   1.00 113.51 ? 101  DG  H "C4'" 1 
ATOM   2290  O  "O4'" . DG  D 2 2   ? 36.306 15.849  4.195   1.00 106.35 ? 101  DG  H "O4'" 1 
ATOM   2291  C  "C3'" . DG  D 2 2   ? 37.564 17.754  4.870   1.00 114.48 ? 101  DG  H "C3'" 1 
ATOM   2292  O  "O3'" . DG  D 2 2   ? 36.756 18.932  4.753   1.00 119.53 ? 101  DG  H "O3'" 1 
ATOM   2293  C  "C2'" . DG  D 2 2   ? 37.127 16.955  6.082   1.00 104.02 ? 101  DG  H "C2'" 1 
ATOM   2294  C  "C1'" . DG  D 2 2   ? 35.950 16.174  5.530   1.00 94.42  ? 101  DG  H "C1'" 1 
ATOM   2295  N  N9    . DG  D 2 2   ? 35.689 14.936  6.258   1.00 80.21  ? 101  DG  H N9    1 
ATOM   2296  C  C8    . DG  D 2 2   ? 36.608 13.980  6.621   1.00 69.29  ? 101  DG  H C8    1 
ATOM   2297  N  N7    . DG  D 2 2   ? 36.089 13.016  7.333   1.00 63.36  ? 101  DG  H N7    1 
ATOM   2298  C  C5    . DG  D 2 2   ? 34.745 13.349  7.434   1.00 71.10  ? 101  DG  H C5    1 
ATOM   2299  C  C6    . DG  D 2 2   ? 33.685 12.689  8.105   1.00 72.70  ? 101  DG  H C6    1 
ATOM   2300  O  O6    . DG  D 2 2   ? 33.725 11.645  8.766   1.00 72.84  ? 101  DG  H O6    1 
ATOM   2301  N  N1    . DG  D 2 2   ? 32.482 13.367  7.952   1.00 73.85  ? 101  DG  H N1    1 
ATOM   2302  C  C2    . DG  D 2 2   ? 32.316 14.528  7.243   1.00 80.47  ? 101  DG  H C2    1 
ATOM   2303  N  N2    . DG  D 2 2   ? 31.065 15.025  7.208   1.00 81.00  ? 101  DG  H N2    1 
ATOM   2304  N  N3    . DG  D 2 2   ? 33.298 15.158  6.614   1.00 78.10  ? 101  DG  H N3    1 
ATOM   2305  C  C4    . DG  D 2 2   ? 34.477 14.518  6.756   1.00 75.47  ? 101  DG  H C4    1 
ATOM   2306  P  P     . DA  D 2 3   ? 36.750 20.020  5.940   1.00 119.64 ? 102  DA  H P     1 
ATOM   2307  O  OP1   . DA  D 2 3   ? 36.745 21.378  5.333   1.00 115.81 ? 102  DA  H OP1   1 
ATOM   2308  O  OP2   . DA  D 2 3   ? 37.830 19.643  6.892   1.00 115.69 ? 102  DA  H OP2   1 
ATOM   2309  O  "O5'" . DA  D 2 3   ? 35.345 19.789  6.661   1.00 116.46 ? 102  DA  H "O5'" 1 
ATOM   2310  C  "C5'" . DA  D 2 3   ? 34.122 19.928  5.933   1.00 113.16 ? 102  DA  H "C5'" 1 
ATOM   2311  C  "C4'" . DA  D 2 3   ? 32.931 19.782  6.856   1.00 107.45 ? 102  DA  H "C4'" 1 
ATOM   2312  O  "O4'" . DA  D 2 3   ? 32.892 18.435  7.392   1.00 100.63 ? 102  DA  H "O4'" 1 
ATOM   2313  C  "C3'" . DA  D 2 3   ? 32.934 20.717  8.064   1.00 109.53 ? 102  DA  H "C3'" 1 
ATOM   2314  O  "O3'" . DA  D 2 3   ? 31.607 21.191  8.339   1.00 115.86 ? 102  DA  H "O3'" 1 
ATOM   2315  C  "C2'" . DA  D 2 3   ? 33.440 19.832  9.190   1.00 99.67  ? 102  DA  H "C2'" 1 
ATOM   2316  C  "C1'" . DA  D 2 3   ? 32.896 18.466  8.812   1.00 87.93  ? 102  DA  H "C1'" 1 
ATOM   2317  N  N9    . DA  D 2 3   ? 33.726 17.358  9.288   1.00 72.93  ? 102  DA  H N9    1 
ATOM   2318  C  C8    . DA  D 2 3   ? 35.085 17.186  9.125   1.00 67.01  ? 102  DA  H C8    1 
ATOM   2319  N  N7    . DA  D 2 3   ? 35.557 16.104  9.701   1.00 56.68  ? 102  DA  H N7    1 
ATOM   2320  C  C5    . DA  D 2 3   ? 34.437 15.521  10.278  1.00 58.49  ? 102  DA  H C5    1 
ATOM   2321  C  C6    . DA  D 2 3   ? 34.270 14.355  11.049  1.00 61.93  ? 102  DA  H C6    1 
ATOM   2322  N  N6    . DA  D 2 3   ? 35.277 13.550  11.403  1.00 57.67  ? 102  DA  H N6    1 
ATOM   2323  N  N1    . DA  D 2 3   ? 33.018 14.045  11.458  1.00 62.32  ? 102  DA  H N1    1 
ATOM   2324  C  C2    . DA  D 2 3   ? 32.012 14.869  11.120  1.00 67.09  ? 102  DA  H C2    1 
ATOM   2325  N  N3    . DA  D 2 3   ? 32.046 16.005  10.414  1.00 61.48  ? 102  DA  H N3    1 
ATOM   2326  C  C4    . DA  D 2 3   ? 33.300 16.276  10.019  1.00 63.57  ? 102  DA  H C4    1 
ATOM   2327  P  P     . DT  D 2 4   ? 31.364 22.212  9.560   1.00 118.43 ? 103  DT  H P     1 
ATOM   2328  O  OP1   . DT  D 2 4   ? 29.896 22.379  9.754   1.00 118.02 ? 103  DT  H OP1   1 
ATOM   2329  O  OP2   . DT  D 2 4   ? 32.218 23.410  9.336   1.00 114.85 ? 103  DT  H OP2   1 
ATOM   2330  O  "O5'" . DT  D 2 4   ? 31.959 21.423  10.809  1.00 116.05 ? 103  DT  H "O5'" 1 
ATOM   2331  C  "C5'" . DT  D 2 4   ? 31.400 21.568  12.109  1.00 109.06 ? 103  DT  H "C5'" 1 
ATOM   2332  C  "C4'" . DT  D 2 4   ? 30.442 20.434  12.393  1.00 97.89  ? 103  DT  H "C4'" 1 
ATOM   2333  O  "O4'" . DT  D 2 4   ? 31.099 19.166  12.147  1.00 85.63  ? 103  DT  H "O4'" 1 
ATOM   2334  C  "C3'" . DT  D 2 4   ? 29.959 20.394  13.841  1.00 97.95  ? 103  DT  H "C3'" 1 
ATOM   2335  O  "O3'" . DT  D 2 4   ? 28.560 20.120  13.924  1.00 104.84 ? 103  DT  H "O3'" 1 
ATOM   2336  C  "C2'" . DT  D 2 4   ? 30.776 19.282  14.464  1.00 86.13  ? 103  DT  H "C2'" 1 
ATOM   2337  C  "C1'" . DT  D 2 4   ? 31.055 18.350  13.306  1.00 74.57  ? 103  DT  H "C1'" 1 
ATOM   2338  N  N1    . DT  D 2 4   ? 32.355 17.670  13.426  1.00 60.30  ? 103  DT  H N1    1 
ATOM   2339  C  C2    . DT  D 2 4   ? 32.402 16.459  14.096  1.00 60.18  ? 103  DT  H C2    1 
ATOM   2340  O  O2    . DT  D 2 4   ? 31.420 15.927  14.588  1.00 62.74  ? 103  DT  H O2    1 
ATOM   2341  N  N3    . DT  D 2 4   ? 33.650 15.891  14.169  1.00 56.59  ? 103  DT  H N3    1 
ATOM   2342  C  C4    . DT  D 2 4   ? 34.830 16.401  13.653  1.00 55.17  ? 103  DT  H C4    1 
ATOM   2343  O  O4    . DT  D 2 4   ? 35.881 15.777  13.804  1.00 57.00  ? 103  DT  H O4    1 
ATOM   2344  C  C5    . DT  D 2 4   ? 34.707 17.676  12.957  1.00 47.24  ? 103  DT  H C5    1 
ATOM   2345  C  C7    . DT  D 2 4   ? 35.930 18.302  12.359  1.00 70.58  ? 103  DT  H C7    1 
ATOM   2346  C  C6    . DT  D 2 4   ? 33.490 18.236  12.883  1.00 47.19  ? 103  DT  H C6    1 
ATOM   2347  P  P     . DA  D 2 5   ? 27.658 20.952  14.963  1.00 107.30 ? 104  DA  H P     1 
ATOM   2348  O  OP1   . DA  D 2 5   ? 26.426 21.427  14.277  1.00 103.67 ? 104  DA  H OP1   1 
ATOM   2349  O  OP2   . DA  D 2 5   ? 28.561 21.937  15.615  1.00 107.43 ? 104  DA  H OP2   1 
ATOM   2350  O  "O5'" . DA  D 2 5   ? 27.232 19.873  16.052  1.00 106.26 ? 104  DA  H "O5'" 1 
ATOM   2351  C  "C5'" . DA  D 2 5   ? 26.341 18.819  15.714  1.00 96.78  ? 104  DA  H "C5'" 1 
ATOM   2352  C  "C4'" . DA  D 2 5   ? 26.351 17.766  16.794  1.00 92.12  ? 104  DA  H "C4'" 1 
ATOM   2353  O  "O4'" . DA  D 2 5   ? 27.646 17.124  16.838  1.00 87.31  ? 104  DA  H "O4'" 1 
ATOM   2354  C  "C3'" . DA  D 2 5   ? 26.103 18.315  18.193  1.00 89.07  ? 104  DA  H "C3'" 1 
ATOM   2355  O  "O3'" . DA  D 2 5   ? 25.262 17.423  18.913  1.00 92.07  ? 104  DA  H "O3'" 1 
ATOM   2356  C  "C2'" . DA  D 2 5   ? 27.489 18.394  18.811  1.00 80.25  ? 104  DA  H "C2'" 1 
ATOM   2357  C  "C1'" . DA  D 2 5   ? 28.259 17.288  18.110  1.00 74.67  ? 104  DA  H "C1'" 1 
ATOM   2358  N  N9    . DA  D 2 5   ? 29.657 17.625  17.862  1.00 63.01  ? 104  DA  H N9    1 
ATOM   2359  C  C8    . DA  D 2 5   ? 30.127 18.843  17.459  1.00 59.81  ? 104  DA  H C8    1 
ATOM   2360  N  N7    . DA  D 2 5   ? 31.422 18.873  17.263  1.00 56.70  ? 104  DA  H N7    1 
ATOM   2361  C  C5    . DA  D 2 5   ? 31.835 17.587  17.562  1.00 56.58  ? 104  DA  H C5    1 
ATOM   2362  C  C6    . DA  D 2 5   ? 33.099 16.976  17.537  1.00 57.45  ? 104  DA  H C6    1 
ATOM   2363  N  N6    . DA  D 2 5   ? 34.212 17.600  17.147  1.00 55.64  ? 104  DA  H N6    1 
ATOM   2364  N  N1    . DA  D 2 5   ? 33.182 15.684  17.921  1.00 55.37  ? 104  DA  H N1    1 
ATOM   2365  C  C2    . DA  D 2 5   ? 32.053 15.054  18.283  1.00 61.34  ? 104  DA  H C2    1 
ATOM   2366  N  N3    . DA  D 2 5   ? 30.797 15.520  18.327  1.00 60.63  ? 104  DA  H N3    1 
ATOM   2367  C  C4    . DA  D 2 5   ? 30.760 16.808  17.951  1.00 59.02  ? 104  DA  H C4    1 
ATOM   2368  P  P     . DA  D 2 6   ? 24.709 17.859  20.343  1.00 91.12  ? 105  DA  H P     1 
ATOM   2369  O  OP1   . DA  D 2 6   ? 23.537 17.013  20.681  1.00 92.90  ? 105  DA  H OP1   1 
ATOM   2370  O  OP2   . DA  D 2 6   ? 24.555 19.333  20.297  1.00 88.24  ? 105  DA  H OP2   1 
ATOM   2371  O  "O5'" . DA  D 2 6   ? 25.919 17.473  21.301  1.00 91.74  ? 105  DA  H "O5'" 1 
ATOM   2372  C  "C5'" . DA  D 2 6   ? 26.284 16.110  21.467  1.00 86.43  ? 105  DA  H "C5'" 1 
ATOM   2373  C  "C4'" . DA  D 2 6   ? 27.478 15.983  22.383  1.00 87.20  ? 105  DA  H "C4'" 1 
ATOM   2374  O  "O4'" . DA  D 2 6   ? 28.695 16.376  21.696  1.00 85.09  ? 105  DA  H "O4'" 1 
ATOM   2375  C  "C3'" . DA  D 2 6   ? 27.426 16.807  23.676  1.00 90.68  ? 105  DA  H "C3'" 1 
ATOM   2376  O  "O3'" . DA  D 2 6   ? 27.852 15.995  24.787  1.00 91.28  ? 105  DA  H "O3'" 1 
ATOM   2377  C  "C2'" . DA  D 2 6   ? 28.436 17.914  23.413  1.00 85.01  ? 105  DA  H "C2'" 1 
ATOM   2378  C  "C1'" . DA  D 2 6   ? 29.463 17.166  22.581  1.00 78.15  ? 105  DA  H "C1'" 1 
ATOM   2379  N  N9    . DA  D 2 6   ? 30.407 17.977  21.804  1.00 68.47  ? 105  DA  H N9    1 
ATOM   2380  C  C8    . DA  D 2 6   ? 30.245 19.242  21.293  1.00 63.61  ? 105  DA  H C8    1 
ATOM   2381  N  N7    . DA  D 2 6   ? 31.312 19.709  20.685  1.00 56.19  ? 105  DA  H N7    1 
ATOM   2382  C  C5    . DA  D 2 6   ? 32.232 18.680  20.795  1.00 58.17  ? 105  DA  H C5    1 
ATOM   2383  C  C6    . DA  D 2 6   ? 33.556 18.559  20.365  1.00 57.20  ? 105  DA  H C6    1 
ATOM   2384  N  N6    . DA  D 2 6   ? 34.208 19.531  19.728  1.00 58.67  ? 105  DA  H N6    1 
ATOM   2385  N  N1    . DA  D 2 6   ? 34.203 17.397  20.619  1.00 54.24  ? 105  DA  H N1    1 
ATOM   2386  C  C2    . DA  D 2 6   ? 33.544 16.432  21.281  1.00 57.41  ? 105  DA  H C2    1 
ATOM   2387  N  N3    . DA  D 2 6   ? 32.291 16.435  21.750  1.00 59.34  ? 105  DA  H N3    1 
ATOM   2388  C  C4    . DA  D 2 6   ? 31.685 17.602  21.469  1.00 62.85  ? 105  DA  H C4    1 
ATOM   2389  P  P     . DC  D 2 7   ? 27.386 16.369  26.285  1.00 92.66  ? 106  DC  H P     1 
ATOM   2390  O  OP1   . DC  D 2 7   ? 27.095 15.101  27.005  1.00 88.77  ? 106  DC  H OP1   1 
ATOM   2391  O  OP2   . DC  D 2 7   ? 26.349 17.431  26.207  1.00 85.94  ? 106  DC  H OP2   1 
ATOM   2392  O  "O5'" . DC  D 2 7   ? 28.684 17.019  26.935  1.00 85.59  ? 106  DC  H "O5'" 1 
ATOM   2393  C  "C5'" . DC  D 2 7   ? 29.824 17.295  26.135  1.00 67.68  ? 106  DC  H "C5'" 1 
ATOM   2394  C  "C4'" . DC  D 2 7   ? 30.823 16.171  26.256  1.00 69.36  ? 106  DC  H "C4'" 1 
ATOM   2395  O  "O4'" . DC  D 2 7   ? 31.713 16.244  25.122  1.00 75.36  ? 106  DC  H "O4'" 1 
ATOM   2396  C  "C3'" . DC  D 2 7   ? 31.696 16.251  27.501  1.00 71.12  ? 106  DC  H "C3'" 1 
ATOM   2397  O  "O3'" . DC  D 2 7   ? 31.947 14.975  28.084  1.00 73.72  ? 106  DC  H "O3'" 1 
ATOM   2398  C  "C2'" . DC  D 2 7   ? 32.985 16.873  27.005  1.00 68.68  ? 106  DC  H "C2'" 1 
ATOM   2399  C  "C1'" . DC  D 2 7   ? 33.032 16.562  25.516  1.00 66.40  ? 106  DC  H "C1'" 1 
ATOM   2400  N  N1    . DC  D 2 7   ? 33.456 17.734  24.728  1.00 62.90  ? 106  DC  H N1    1 
ATOM   2401  C  C2    . DC  D 2 7   ? 34.771 17.789  24.249  1.00 61.55  ? 106  DC  H C2    1 
ATOM   2402  O  O2    . DC  D 2 7   ? 35.521 16.816  24.442  1.00 59.22  ? 106  DC  H O2    1 
ATOM   2403  N  N3    . DC  D 2 7   ? 35.187 18.893  23.586  1.00 59.31  ? 106  DC  H N3    1 
ATOM   2404  C  C4    . DC  D 2 7   ? 34.338 19.900  23.374  1.00 64.80  ? 106  DC  H C4    1 
ATOM   2405  N  N4    . DC  D 2 7   ? 34.789 20.964  22.710  1.00 66.87  ? 106  DC  H N4    1 
ATOM   2406  C  C5    . DC  D 2 7   ? 32.986 19.859  23.830  1.00 55.43  ? 106  DC  H C5    1 
ATOM   2407  C  C6    . DC  D 2 7   ? 32.591 18.766  24.491  1.00 56.11  ? 106  DC  H C6    1 
ATOM   2408  P  P     . DT  D 2 8   ? 32.886 14.881  29.389  1.00 77.60  ? 107  DT  H P     1 
ATOM   2409  O  OP1   . DT  D 2 8   ? 32.637 13.612  30.125  1.00 75.87  ? 107  DT  H OP1   1 
ATOM   2410  O  OP2   . DT  D 2 8   ? 32.762 16.166  30.108  1.00 78.25  ? 107  DT  H OP2   1 
ATOM   2411  O  "O5'" . DT  D 2 8   ? 34.350 14.825  28.773  1.00 68.07  ? 107  DT  H "O5'" 1 
ATOM   2412  C  "C5'" . DT  D 2 8   ? 35.474 15.018  29.603  1.00 61.26  ? 107  DT  H "C5'" 1 
ATOM   2413  C  "C4'" . DT  D 2 8   ? 36.747 14.844  28.814  1.00 65.62  ? 107  DT  H "C4'" 1 
ATOM   2414  O  "O4'" . DT  D 2 8   ? 36.711 15.723  27.665  1.00 65.70  ? 107  DT  H "O4'" 1 
ATOM   2415  C  "C3'" . DT  D 2 8   ? 37.960 15.258  29.635  1.00 75.22  ? 107  DT  H "C3'" 1 
ATOM   2416  O  "O3'" . DT  D 2 8   ? 39.037 14.345  29.515  1.00 86.74  ? 107  DT  H "O3'" 1 
ATOM   2417  C  "C2'" . DT  D 2 8   ? 38.310 16.648  29.136  1.00 67.23  ? 107  DT  H "C2'" 1 
ATOM   2418  C  "C1'" . DT  D 2 8   ? 37.742 16.703  27.732  1.00 61.64  ? 107  DT  H "C1'" 1 
ATOM   2419  N  N1    . DT  D 2 8   ? 37.140 18.012  27.391  1.00 53.00  ? 107  DT  H N1    1 
ATOM   2420  C  C2    . DT  D 2 8   ? 37.901 18.917  26.680  1.00 51.78  ? 107  DT  H C2    1 
ATOM   2421  O  O2    . DT  D 2 8   ? 39.079 18.731  26.410  1.00 53.43  ? 107  DT  H O2    1 
ATOM   2422  N  N3    . DT  D 2 8   ? 37.236 20.065  26.315  1.00 48.32  ? 107  DT  H N3    1 
ATOM   2423  C  C4    . DT  D 2 8   ? 35.931 20.405  26.619  1.00 53.80  ? 107  DT  H C4    1 
ATOM   2424  O  O4    . DT  D 2 8   ? 35.457 21.458  26.201  1.00 51.71  ? 107  DT  H O4    1 
ATOM   2425  C  C5    . DT  D 2 8   ? 35.214 19.444  27.427  1.00 51.26  ? 107  DT  H C5    1 
ATOM   2426  C  C7    . DT  D 2 8   ? 33.816 19.765  27.859  1.00 70.58  ? 107  DT  H C7    1 
ATOM   2427  C  C6    . DT  D 2 8   ? 35.842 18.305  27.759  1.00 47.78  ? 107  DT  H C6    1 
ATOM   2428  P  P     . DT  D 2 9   ? 40.067 14.205  30.736  1.00 91.79  ? 108  DT  H P     1 
ATOM   2429  O  OP1   . DT  D 2 9   ? 40.723 12.874  30.666  1.00 90.73  ? 108  DT  H OP1   1 
ATOM   2430  O  OP2   . DT  D 2 9   ? 39.318 14.581  31.961  1.00 87.91  ? 108  DT  H OP2   1 
ATOM   2431  O  "O5'" . DT  D 2 9   ? 41.152 15.329  30.417  1.00 84.63  ? 108  DT  H "O5'" 1 
ATOM   2432  C  "C5'" . DT  D 2 9   ? 41.966 15.215  29.256  1.00 79.99  ? 108  DT  H "C5'" 1 
ATOM   2433  C  "C4'" . DT  D 2 9   ? 42.665 16.519  28.941  1.00 82.59  ? 108  DT  H "C4'" 1 
ATOM   2434  O  "O4'" . DT  D 2 9   ? 41.733 17.535  28.484  1.00 77.78  ? 108  DT  H "O4'" 1 
ATOM   2435  C  "C3'" . DT  D 2 9   ? 43.511 17.165  30.045  1.00 83.31  ? 108  DT  H "C3'" 1 
ATOM   2436  O  "O3'" . DT  D 2 9   ? 44.789 17.516  29.480  1.00 88.58  ? 108  DT  H "O3'" 1 
ATOM   2437  C  "C2'" . DT  D 2 9   ? 42.718 18.417  30.397  1.00 78.25  ? 108  DT  H "C2'" 1 
ATOM   2438  C  "C1'" . DT  D 2 9   ? 42.106 18.779  29.053  1.00 71.48  ? 108  DT  H "C1'" 1 
ATOM   2439  N  N1    . DT  D 2 9   ? 40.913 19.661  29.065  1.00 62.39  ? 108  DT  H N1    1 
ATOM   2440  C  C2    . DT  D 2 9   ? 40.940 20.793  28.273  1.00 65.00  ? 108  DT  H C2    1 
ATOM   2441  O  O2    . DT  D 2 9   ? 41.916 21.128  27.632  1.00 67.14  ? 108  DT  H O2    1 
ATOM   2442  N  N3    . DT  D 2 9   ? 39.778 21.527  28.269  1.00 57.37  ? 108  DT  H N3    1 
ATOM   2443  C  C4    . DT  D 2 9   ? 38.623 21.259  28.980  1.00 57.74  ? 108  DT  H C4    1 
ATOM   2444  O  O4    . DT  D 2 9   ? 37.640 21.992  28.857  1.00 49.98  ? 108  DT  H O4    1 
ATOM   2445  C  C5    . DT  D 2 9   ? 38.683 20.084  29.830  1.00 56.39  ? 108  DT  H C5    1 
ATOM   2446  C  C7    . DT  D 2 9   ? 37.496 19.739  30.674  1.00 70.58  ? 108  DT  H C7    1 
ATOM   2447  C  C6    . DT  D 2 9   ? 39.808 19.354  29.825  1.00 51.51  ? 108  DT  H C6    1 
ATOM   2448  P  P     . DC  D 2 10  ? 46.038 17.872  30.437  1.00 90.15  ? 109  DC  H P     1 
ATOM   2449  O  OP1   . DC  D 2 10  ? 47.236 17.117  29.986  1.00 88.40  ? 109  DC  H OP1   1 
ATOM   2450  O  OP2   . DC  D 2 10  ? 45.593 17.759  31.851  1.00 93.37  ? 109  DC  H OP2   1 
ATOM   2451  O  "O5'" . DC  D 2 10  ? 46.289 19.404  30.096  1.00 87.17  ? 109  DC  H "O5'" 1 
ATOM   2452  C  "C5'" . DC  D 2 10  ? 45.201 20.231  29.698  1.00 81.34  ? 109  DC  H "C5'" 1 
ATOM   2453  C  "C4'" . DC  D 2 10  ? 45.682 21.636  29.438  1.00 81.03  ? 109  DC  H "C4'" 1 
ATOM   2454  O  "O4'" . DC  D 2 10  ? 44.539 22.460  29.123  1.00 77.08  ? 109  DC  H "O4'" 1 
ATOM   2455  C  "C3'" . DC  D 2 10  ? 46.348 22.294  30.643  1.00 87.62  ? 109  DC  H "C3'" 1 
ATOM   2456  O  "O3'" . DC  D 2 10  ? 47.397 23.147  30.183  1.00 96.01  ? 109  DC  H "O3'" 1 
ATOM   2457  C  "C2'" . DC  D 2 10  ? 45.222 23.097  31.268  1.00 81.39  ? 109  DC  H "C2'" 1 
ATOM   2458  C  "C1'" . DC  D 2 10  ? 44.429 23.526  30.050  1.00 74.38  ? 109  DC  H "C1'" 1 
ATOM   2459  N  N1    . DC  D 2 10  ? 42.997 23.770  30.281  1.00 66.23  ? 109  DC  H N1    1 
ATOM   2460  C  C2    . DC  D 2 10  ? 42.394 24.872  29.659  1.00 65.71  ? 109  DC  H C2    1 
ATOM   2461  O  O2    . DC  D 2 10  ? 43.089 25.621  28.959  1.00 69.39  ? 109  DC  H O2    1 
ATOM   2462  N  N3    . DC  D 2 10  ? 41.076 25.093  29.836  1.00 58.48  ? 109  DC  H N3    1 
ATOM   2463  C  C4    . DC  D 2 10  ? 40.361 24.269  30.601  1.00 60.26  ? 109  DC  H C4    1 
ATOM   2464  N  N4    . DC  D 2 10  ? 39.058 24.526  30.736  1.00 55.59  ? 109  DC  H N4    1 
ATOM   2465  C  C5    . DC  D 2 10  ? 40.949 23.146  31.259  1.00 52.69  ? 109  DC  H C5    1 
ATOM   2466  C  C6    . DC  D 2 10  ? 42.259 22.938  31.074  1.00 53.69  ? 109  DC  H C6    1 
ATOM   2467  P  P     . DG  D 2 11  ? 48.628 23.494  31.152  1.00 98.28  ? 110  DG  H P     1 
ATOM   2468  O  OP1   . DG  D 2 11  ? 49.888 23.244  30.405  1.00 99.53  ? 110  DG  H OP1   1 
ATOM   2469  O  OP2   . DG  D 2 11  ? 48.395 22.806  32.446  1.00 95.03  ? 110  DG  H OP2   1 
ATOM   2470  O  "O5'" . DG  D 2 11  ? 48.474 25.063  31.361  1.00 96.18  ? 110  DG  H "O5'" 1 
ATOM   2471  C  "C5'" . DG  D 2 11  ? 48.444 25.933  30.232  1.00 86.61  ? 110  DG  H "C5'" 1 
ATOM   2472  C  "C4'" . DG  D 2 11  ? 47.816 27.258  30.596  1.00 83.42  ? 110  DG  H "C4'" 1 
ATOM   2473  O  "O4'" . DG  D 2 11  ? 46.382 27.117  30.750  1.00 76.81  ? 110  DG  H "O4'" 1 
ATOM   2474  C  "C3'" . DG  D 2 11  ? 48.333 27.888  31.891  1.00 84.82  ? 110  DG  H "C3'" 1 
ATOM   2475  O  "O3'" . DG  D 2 11  ? 48.587 29.278  31.692  1.00 86.93  ? 110  DG  H "O3'" 1 
ATOM   2476  C  "C2'" . DG  D 2 11  ? 47.184 27.701  32.865  1.00 74.48  ? 110  DG  H "C2'" 1 
ATOM   2477  C  "C1'" . DG  D 2 11  ? 45.964 27.727  31.960  1.00 67.47  ? 110  DG  H "C1'" 1 
ATOM   2478  N  N9    . DG  D 2 11  ? 44.843 26.956  32.489  1.00 56.01  ? 110  DG  H N9    1 
ATOM   2479  C  C8    . DG  D 2 11  ? 44.925 25.769  33.179  1.00 50.75  ? 110  DG  H C8    1 
ATOM   2480  N  N7    . DG  D 2 11  ? 43.761 25.314  33.559  1.00 46.58  ? 110  DG  H N7    1 
ATOM   2481  C  C5    . DG  D 2 11  ? 42.852 26.252  33.089  1.00 42.31  ? 110  DG  H C5    1 
ATOM   2482  C  C6    . DG  D 2 11  ? 41.444 26.289  33.201  1.00 41.67  ? 110  DG  H C6    1 
ATOM   2483  O  O6    . DG  D 2 11  ? 40.697 25.480  33.769  1.00 50.91  ? 110  DG  H O6    1 
ATOM   2484  N  N1    . DG  D 2 11  ? 40.907 27.405  32.569  1.00 37.93  ? 110  DG  H N1    1 
ATOM   2485  C  C2    . DG  D 2 11  ? 41.636 28.365  31.917  1.00 41.32  ? 110  DG  H C2    1 
ATOM   2486  N  N2    . DG  D 2 11  ? 40.923 29.354  31.362  1.00 34.36  ? 110  DG  H N2    1 
ATOM   2487  N  N3    . DG  D 2 11  ? 42.962 28.353  31.814  1.00 32.77  ? 110  DG  H N3    1 
ATOM   2488  C  C4    . DG  D 2 11  ? 43.499 27.271  32.419  1.00 43.97  ? 110  DG  H C4    1 
ATOM   2489  P  P     . DT  D 2 12  ? 49.467 30.088  32.760  1.00 87.57  ? 111  DT  H P     1 
ATOM   2490  O  OP1   . DT  D 2 12  ? 50.681 30.608  32.078  1.00 82.65  ? 111  DT  H OP1   1 
ATOM   2491  O  OP2   . DT  D 2 12  ? 49.613 29.241  33.970  1.00 80.21  ? 111  DT  H OP2   1 
ATOM   2492  O  "O5'" . DT  D 2 12  ? 48.524 31.322  33.089  1.00 88.80  ? 111  DT  H "O5'" 1 
ATOM   2493  C  "C5'" . DT  D 2 12  ? 47.862 32.000  32.030  1.00 90.02  ? 111  DT  H "C5'" 1 
ATOM   2494  C  "C4'" . DT  D 2 12  ? 46.528 32.541  32.490  1.00 92.67  ? 111  DT  H "C4'" 1 
ATOM   2495  O  "O4'" . DT  D 2 12  ? 45.586 31.475  32.791  1.00 89.05  ? 111  DT  H "O4'" 1 
ATOM   2496  C  "C3'" . DT  D 2 12  ? 46.565 33.436  33.732  1.00 95.77  ? 111  DT  H "C3'" 1 
ATOM   2497  O  "O3'" . DT  D 2 12  ? 45.739 34.580  33.497  1.00 93.15  ? 111  DT  H "O3'" 1 
ATOM   2498  C  "C2'" . DT  D 2 12  ? 45.923 32.571  34.804  1.00 91.83  ? 111  DT  H "C2'" 1 
ATOM   2499  C  "C1'" . DT  D 2 12  ? 44.894 31.835  33.973  1.00 83.40  ? 111  DT  H "C1'" 1 
ATOM   2500  N  N1    . DT  D 2 12  ? 44.300 30.625  34.578  1.00 73.59  ? 111  DT  H N1    1 
ATOM   2501  C  C2    . DT  D 2 12  ? 42.936 30.469  34.448  1.00 69.74  ? 111  DT  H C2    1 
ATOM   2502  O  O2    . DT  D 2 12  ? 42.231 31.265  33.842  1.00 66.50  ? 111  DT  H O2    1 
ATOM   2503  N  N3    . DT  D 2 12  ? 42.426 29.349  35.056  1.00 60.29  ? 111  DT  H N3    1 
ATOM   2504  C  C4    . DT  D 2 12  ? 43.126 28.391  35.757  1.00 62.83  ? 111  DT  H C4    1 
ATOM   2505  O  O4    . DT  D 2 12  ? 42.530 27.442  36.256  1.00 67.58  ? 111  DT  H O4    1 
ATOM   2506  C  C5    . DT  D 2 12  ? 44.553 28.607  35.841  1.00 58.92  ? 111  DT  H C5    1 
ATOM   2507  C  C7    . DT  D 2 12  ? 45.391 27.604  36.568  1.00 70.58  ? 111  DT  H C7    1 
ATOM   2508  C  C6    . DT  D 2 12  ? 45.064 29.701  35.257  1.00 62.81  ? 111  DT  H C6    1 
ATOM   2509  P  P     . DA  D 2 13  ? 45.930 35.908  34.384  1.00 96.10  ? 112  DA  H P     1 
ATOM   2510  O  OP1   . DA  D 2 13  ? 46.368 36.991  33.454  1.00 94.05  ? 112  DA  H OP1   1 
ATOM   2511  O  OP2   . DA  D 2 13  ? 46.746 35.597  35.598  1.00 88.84  ? 112  DA  H OP2   1 
ATOM   2512  O  "O5'" . DA  D 2 13  ? 44.447 36.222  34.866  1.00 87.46  ? 112  DA  H "O5'" 1 
ATOM   2513  C  "C5'" . DA  D 2 13  ? 43.436 36.531  33.915  1.00 76.65  ? 112  DA  H "C5'" 1 
ATOM   2514  C  "C4'" . DA  D 2 13  ? 42.076 36.467  34.563  1.00 66.23  ? 112  DA  H "C4'" 1 
ATOM   2515  O  "O4'" . DA  D 2 13  ? 41.823 35.103  34.974  1.00 69.09  ? 112  DA  H "O4'" 1 
ATOM   2516  C  "C3'" . DA  D 2 13  ? 41.932 37.317  35.825  1.00 67.71  ? 112  DA  H "C3'" 1 
ATOM   2517  O  "O3'" . DA  D 2 13  ? 40.634 37.908  35.860  1.00 67.88  ? 112  DA  H "O3'" 1 
ATOM   2518  C  "C2'" . DA  D 2 13  ? 42.062 36.301  36.944  1.00 65.83  ? 112  DA  H "C2'" 1 
ATOM   2519  C  "C1'" . DA  D 2 13  ? 41.390 35.099  36.317  1.00 62.87  ? 112  DA  H "C1'" 1 
ATOM   2520  N  N9    . DA  D 2 13  ? 41.732 33.806  36.903  1.00 50.62  ? 112  DA  H N9    1 
ATOM   2521  C  C8    . DA  D 2 13  ? 42.975 33.283  37.157  1.00 49.70  ? 112  DA  H C8    1 
ATOM   2522  N  N7    . DA  D 2 13  ? 42.943 32.099  37.730  1.00 43.24  ? 112  DA  H N7    1 
ATOM   2523  C  C5    . DA  D 2 13  ? 41.588 31.824  37.844  1.00 40.76  ? 112  DA  H C5    1 
ATOM   2524  C  C6    . DA  D 2 13  ? 40.891 30.728  38.371  1.00 39.56  ? 112  DA  H C6    1 
ATOM   2525  N  N6    . DA  D 2 13  ? 41.490 29.662  38.915  1.00 35.66  ? 112  DA  H N6    1 
ATOM   2526  N  N1    . DA  D 2 13  ? 39.543 30.764  38.332  1.00 29.26  ? 112  DA  H N1    1 
ATOM   2527  C  C2    . DA  D 2 13  ? 38.947 31.839  37.803  1.00 36.72  ? 112  DA  H C2    1 
ATOM   2528  N  N3    . DA  D 2 13  ? 39.495 32.934  37.280  1.00 38.31  ? 112  DA  H N3    1 
ATOM   2529  C  C4    . DA  D 2 13  ? 40.833 32.862  37.332  1.00 40.52  ? 112  DA  H C4    1 
ATOM   2530  P  P     . DT  D 2 14  ? 40.349 39.126  36.861  1.00 68.87  ? 113  DT  H P     1 
ATOM   2531  O  OP1   . DT  D 2 14  ? 39.836 40.290  36.091  1.00 69.72  ? 113  DT  H OP1   1 
ATOM   2532  O  OP2   . DT  D 2 14  ? 41.583 39.262  37.684  1.00 58.71  ? 113  DT  H OP2   1 
ATOM   2533  O  "O5'" . DT  D 2 14  ? 39.171 38.586  37.777  1.00 63.49  ? 113  DT  H "O5'" 1 
ATOM   2534  C  "C5'" . DT  D 2 14  ? 39.270 37.297  38.344  1.00 64.20  ? 113  DT  H "C5'" 1 
ATOM   2535  C  "C4'" . DT  D 2 14  ? 37.947 36.867  38.922  1.00 59.98  ? 113  DT  H "C4'" 1 
ATOM   2536  O  "O4'" . DT  D 2 14  ? 38.063 35.457  39.179  1.00 56.81  ? 113  DT  H "O4'" 1 
ATOM   2537  C  "C3'" . DT  D 2 14  ? 37.585 37.503  40.260  1.00 62.74  ? 113  DT  H "C3'" 1 
ATOM   2538  O  "O3'" . DT  D 2 14  ? 36.163 37.610  40.386  1.00 66.65  ? 113  DT  H "O3'" 1 
ATOM   2539  C  "C2'" . DT  D 2 14  ? 38.179 36.540  41.274  1.00 50.73  ? 113  DT  H "C2'" 1 
ATOM   2540  C  "C1'" . DT  D 2 14  ? 38.139 35.196  40.566  1.00 45.97  ? 113  DT  H "C1'" 1 
ATOM   2541  N  N1    . DT  D 2 14  ? 39.328 34.372  40.766  1.00 35.21  ? 113  DT  H N1    1 
ATOM   2542  C  C2    . DT  D 2 14  ? 39.147 33.075  41.173  1.00 40.88  ? 113  DT  H C2    1 
ATOM   2543  O  O2    . DT  D 2 14  ? 38.040 32.593  41.386  1.00 41.25  ? 113  DT  H O2    1 
ATOM   2544  N  N3    . DT  D 2 14  ? 40.306 32.356  41.324  1.00 34.78  ? 113  DT  H N3    1 
ATOM   2545  C  C4    . DT  D 2 14  ? 41.591 32.802  41.115  1.00 37.41  ? 113  DT  H C4    1 
ATOM   2546  O  O4    . DT  D 2 14  ? 42.532 32.039  41.280  1.00 38.37  ? 113  DT  H O4    1 
ATOM   2547  C  C5    . DT  D 2 14  ? 41.706 34.180  40.700  1.00 40.15  ? 113  DT  H C5    1 
ATOM   2548  C  C7    . DT  D 2 14  ? 43.065 34.759  40.472  1.00 70.58  ? 113  DT  H C7    1 
ATOM   2549  C  C6    . DT  D 2 14  ? 40.582 34.885  40.544  1.00 33.75  ? 113  DT  H C6    1 
ATOM   2550  P  P     . DA  D 2 15  ? 35.519 38.139  41.759  1.00 69.53  ? 114  DA  H P     1 
ATOM   2551  O  OP1   . DA  D 2 15  ? 34.338 38.968  41.399  1.00 65.09  ? 114  DA  H OP1   1 
ATOM   2552  O  OP2   . DA  D 2 15  ? 36.602 38.724  42.591  1.00 66.75  ? 114  DA  H OP2   1 
ATOM   2553  O  "O5'" . DA  D 2 15  ? 34.984 36.812  42.455  1.00 58.18  ? 114  DA  H "O5'" 1 
ATOM   2554  C  "C5'" . DA  D 2 15  ? 33.899 36.100  41.868  1.00 54.66  ? 114  DA  H "C5'" 1 
ATOM   2555  C  "C4'" . DA  D 2 15  ? 33.632 34.801  42.595  1.00 58.23  ? 114  DA  H "C4'" 1 
ATOM   2556  O  "O4'" . DA  D 2 15  ? 34.840 34.008  42.679  1.00 62.65  ? 114  DA  H "O4'" 1 
ATOM   2557  C  "C3'" . DA  D 2 15  ? 33.096 34.907  44.020  1.00 60.44  ? 114  DA  H "C3'" 1 
ATOM   2558  O  "O3'" . DA  D 2 15  ? 32.055 33.946  44.178  1.00 61.69  ? 114  DA  H "O3'" 1 
ATOM   2559  C  "C2'" . DA  D 2 15  ? 34.293 34.552  44.890  1.00 56.03  ? 114  DA  H "C2'" 1 
ATOM   2560  C  "C1'" . DA  D 2 15  ? 35.060 33.582  44.017  1.00 57.59  ? 114  DA  H "C1'" 1 
ATOM   2561  N  N9    . DA  D 2 15  ? 36.506 33.552  44.231  1.00 49.65  ? 114  DA  H N9    1 
ATOM   2562  C  C8    . DA  D 2 15  ? 37.416 34.521  43.904  1.00 47.54  ? 114  DA  H C8    1 
ATOM   2563  N  N7    . DA  D 2 15  ? 38.657 34.191  44.164  1.00 44.27  ? 114  DA  H N7    1 
ATOM   2564  C  C5    . DA  D 2 15  ? 38.556 32.920  44.706  1.00 47.00  ? 114  DA  H C5    1 
ATOM   2565  C  C6    . DA  D 2 15  ? 39.523 32.010  45.168  1.00 48.17  ? 114  DA  H C6    1 
ATOM   2566  N  N6    . DA  D 2 15  ? 40.839 32.241  45.126  1.00 46.86  ? 114  DA  H N6    1 
ATOM   2567  N  N1    . DA  D 2 15  ? 39.090 30.832  45.668  1.00 41.73  ? 114  DA  H N1    1 
ATOM   2568  C  C2    . DA  D 2 15  ? 37.777 30.587  45.670  1.00 42.55  ? 114  DA  H C2    1 
ATOM   2569  N  N3    . DA  D 2 15  ? 36.773 31.351  45.242  1.00 38.92  ? 114  DA  H N3    1 
ATOM   2570  C  C4    . DA  D 2 15  ? 37.237 32.520  44.770  1.00 46.69  ? 114  DA  H C4    1 
ATOM   2571  P  P     . DG  D 2 16  ? 30.980 34.120  45.352  1.00 63.42  ? 115  DG  H P     1 
ATOM   2572  O  OP1   . DG  D 2 16  ? 29.631 33.853  44.809  1.00 67.02  ? 115  DG  H OP1   1 
ATOM   2573  O  OP2   . DG  D 2 16  ? 31.251 35.411  46.040  1.00 61.15  ? 115  DG  H OP2   1 
ATOM   2574  O  "O5'" . DG  D 2 16  ? 31.347 32.916  46.315  1.00 61.73  ? 115  DG  H "O5'" 1 
ATOM   2575  C  "C5'" . DG  D 2 16  ? 31.578 31.625  45.780  1.00 61.58  ? 115  DG  H "C5'" 1 
ATOM   2576  C  "C4'" . DG  D 2 16  ? 32.308 30.769  46.785  1.00 66.17  ? 115  DG  H "C4'" 1 
ATOM   2577  O  "O4'" . DG  D 2 16  ? 33.729 31.052  46.806  1.00 66.34  ? 115  DG  H "O4'" 1 
ATOM   2578  C  "C3'" . DG  D 2 16  ? 31.824 30.921  48.228  1.00 70.41  ? 115  DG  H "C3'" 1 
ATOM   2579  O  "O3'" . DG  D 2 16  ? 31.808 29.632  48.825  1.00 76.28  ? 115  DG  H "O3'" 1 
ATOM   2580  C  "C2'" . DG  D 2 16  ? 32.940 31.721  48.880  1.00 64.46  ? 115  DG  H "C2'" 1 
ATOM   2581  C  "C1'" . DG  D 2 16  ? 34.142 31.147  48.160  1.00 62.54  ? 115  DG  H "C1'" 1 
ATOM   2582  N  N9    . DG  D 2 16  ? 35.364 31.941  48.212  1.00 53.67  ? 115  DG  H N9    1 
ATOM   2583  C  C8    . DG  D 2 16  ? 35.492 33.284  47.976  1.00 53.55  ? 115  DG  H C8    1 
ATOM   2584  N  N7    . DG  D 2 16  ? 36.723 33.706  48.077  1.00 51.21  ? 115  DG  H N7    1 
ATOM   2585  C  C5    . DG  D 2 16  ? 37.449 32.573  48.402  1.00 53.35  ? 115  DG  H C5    1 
ATOM   2586  C  C6    . DG  D 2 16  ? 38.832 32.413  48.631  1.00 55.69  ? 115  DG  H C6    1 
ATOM   2587  O  O6    . DG  D 2 16  ? 39.726 33.271  48.575  1.00 52.90  ? 115  DG  H O6    1 
ATOM   2588  N  N1    . DG  D 2 16  ? 39.147 31.095  48.947  1.00 55.16  ? 115  DG  H N1    1 
ATOM   2589  C  C2    . DG  D 2 16  ? 38.243 30.066  49.018  1.00 50.94  ? 115  DG  H C2    1 
ATOM   2590  N  N2    . DG  D 2 16  ? 38.734 28.860  49.331  1.00 63.49  ? 115  DG  H N2    1 
ATOM   2591  N  N3    . DG  D 2 16  ? 36.950 30.206  48.798  1.00 51.69  ? 115  DG  H N3    1 
ATOM   2592  C  C4    . DG  D 2 16  ? 36.625 31.477  48.499  1.00 51.87  ? 115  DG  H C4    1 
ATOM   2593  P  P     . DC  D 2 17  ? 30.567 29.179  49.723  1.00 76.95  ? 116  DC  H P     1 
ATOM   2594  O  OP1   . DC  D 2 17  ? 29.547 28.623  48.804  1.00 70.50  ? 116  DC  H OP1   1 
ATOM   2595  O  OP2   . DC  D 2 17  ? 30.210 30.293  50.640  1.00 69.79  ? 116  DC  H OP2   1 
ATOM   2596  O  "O5'" . DC  D 2 17  ? 31.214 27.993  50.558  1.00 78.02  ? 116  DC  H "O5'" 1 
ATOM   2597  C  "C5'" . DC  D 2 17  ? 31.904 26.957  49.871  1.00 77.83  ? 116  DC  H "C5'" 1 
ATOM   2598  C  "C4'" . DC  D 2 17  ? 33.201 26.600  50.561  1.00 88.52  ? 116  DC  H "C4'" 1 
ATOM   2599  O  "O4'" . DC  D 2 17  ? 34.168 27.675  50.508  1.00 93.16  ? 116  DC  H "O4'" 1 
ATOM   2600  C  "C3'" . DC  D 2 17  ? 33.103 26.191  52.027  1.00 92.53  ? 116  DC  H "C3'" 1 
ATOM   2601  O  "O3'" . DC  D 2 17  ? 33.879 25.018  52.210  1.00 95.68  ? 116  DC  H "O3'" 1 
ATOM   2602  C  "C2'" . DC  D 2 17  ? 33.769 27.340  52.764  1.00 90.49  ? 116  DC  H "C2'" 1 
ATOM   2603  C  "C1'" . DC  D 2 17  ? 34.820 27.749  51.764  1.00 90.21  ? 116  DC  H "C1'" 1 
ATOM   2604  N  N1    . DC  D 2 17  ? 35.372 29.104  51.924  1.00 93.48  ? 116  DC  H N1    1 
ATOM   2605  C  C2    . DC  D 2 17  ? 36.728 29.235  52.229  1.00 100.10 ? 116  DC  H C2    1 
ATOM   2606  O  O2    . DC  D 2 17  ? 37.407 28.208  52.387  1.00 95.59  ? 116  DC  H O2    1 
ATOM   2607  N  N3    . DC  D 2 17  ? 37.264 30.471  52.345  1.00 107.72 ? 116  DC  H N3    1 
ATOM   2608  C  C4    . DC  D 2 17  ? 36.496 31.547  52.177  1.00 111.46 ? 116  DC  H C4    1 
ATOM   2609  N  N4    . DC  D 2 17  ? 37.069 32.748  52.293  1.00 115.30 ? 116  DC  H N4    1 
ATOM   2610  C  C5    . DC  D 2 17  ? 35.106 31.442  51.882  1.00 107.68 ? 116  DC  H C5    1 
ATOM   2611  C  C6    . DC  D 2 17  ? 34.589 30.212  51.766  1.00 99.97  ? 116  DC  H C6    1 
ATOM   2612  P  P     . DA  D 2 18  ? 33.306 23.824  53.103  1.00 97.40  ? 117  DA  H P     1 
ATOM   2613  O  OP1   . DA  D 2 18  ? 33.094 22.649  52.220  1.00 95.05  ? 117  DA  H OP1   1 
ATOM   2614  O  OP2   . DA  D 2 18  ? 32.177 24.348  53.919  1.00 88.63  ? 117  DA  H OP2   1 
ATOM   2615  O  "O5'" . DA  D 2 18  ? 34.533 23.504  54.059  1.00 94.26  ? 117  DA  H "O5'" 1 
ATOM   2616  C  "C5'" . DA  D 2 18  ? 35.820 23.243  53.509  1.00 90.64  ? 117  DA  H "C5'" 1 
ATOM   2617  C  "C4'" . DA  D 2 18  ? 36.897 23.656  54.481  1.00 83.07  ? 117  DA  H "C4'" 1 
ATOM   2618  O  "O4'" . DA  D 2 18  ? 36.999 25.099  54.552  1.00 85.45  ? 117  DA  H "O4'" 1 
ATOM   2619  C  "C3'" . DA  D 2 18  ? 36.674 23.175  55.914  1.00 84.58  ? 117  DA  H "C3'" 1 
ATOM   2620  O  "O3'" . DA  D 2 18  ? 37.934 22.847  56.483  1.00 89.83  ? 117  DA  H "O3'" 1 
ATOM   2621  C  "C2'" . DA  D 2 18  ? 36.163 24.421  56.609  1.00 81.99  ? 117  DA  H "C2'" 1 
ATOM   2622  C  "C1'" . DA  D 2 18  ? 36.995 25.478  55.915  1.00 79.39  ? 117  DA  H "C1'" 1 
ATOM   2623  N  N9    . DA  D 2 18  ? 36.497 26.849  56.010  1.00 71.24  ? 117  DA  H N9    1 
ATOM   2624  C  C8    . DA  D 2 18  ? 35.197 27.288  56.078  1.00 68.39  ? 117  DA  H C8    1 
ATOM   2625  N  N7    . DA  D 2 18  ? 35.083 28.593  56.129  1.00 72.81  ? 117  DA  H N7    1 
ATOM   2626  C  C5    . DA  D 2 18  ? 36.396 29.045  56.093  1.00 71.92  ? 117  DA  H C5    1 
ATOM   2627  C  C6    . DA  D 2 18  ? 36.952 30.333  56.090  1.00 76.70  ? 117  DA  H C6    1 
ATOM   2628  N  N6    . DA  D 2 18  ? 36.221 31.447  56.109  1.00 80.70  ? 117  DA  H N6    1 
ATOM   2629  N  N1    . DA  D 2 18  ? 38.299 30.440  56.056  1.00 79.59  ? 117  DA  H N1    1 
ATOM   2630  C  C2    . DA  D 2 18  ? 39.028 29.317  56.017  1.00 82.22  ? 117  DA  H C2    1 
ATOM   2631  N  N3    . DA  D 2 18  ? 38.622 28.049  56.001  1.00 70.46  ? 117  DA  H N3    1 
ATOM   2632  C  C4    . DA  D 2 18  ? 37.278 27.982  56.038  1.00 69.23  ? 117  DA  H C4    1 
ATOM   2633  P  P     . DT  D 2 19  ? 38.263 21.335  56.904  1.00 89.73  ? 118  DT  H P     1 
ATOM   2634  O  OP1   . DT  D 2 19  ? 38.205 20.454  55.707  1.00 92.45  ? 118  DT  H OP1   1 
ATOM   2635  O  OP2   . DT  D 2 19  ? 37.442 21.004  58.099  1.00 87.51  ? 118  DT  H OP2   1 
ATOM   2636  O  "O5'" . DT  D 2 19  ? 39.778 21.471  57.362  1.00 90.15  ? 118  DT  H "O5'" 1 
ATOM   2637  C  "C5'" . DT  D 2 19  ? 40.707 22.181  56.543  1.00 84.99  ? 118  DT  H "C5'" 1 
ATOM   2638  C  "C4'" . DT  D 2 19  ? 41.417 23.252  57.339  1.00 79.44  ? 118  DT  H "C4'" 1 
ATOM   2639  O  "O4'" . DT  D 2 19  ? 40.608 24.445  57.501  1.00 75.56  ? 118  DT  H "O4'" 1 
ATOM   2640  C  "C3'" . DT  D 2 19  ? 41.862 22.843  58.746  1.00 78.32  ? 118  DT  H "C3'" 1 
ATOM   2641  O  "O3'" . DT  D 2 19  ? 43.208 23.266  58.964  1.00 80.83  ? 118  DT  H "O3'" 1 
ATOM   2642  C  "C2'" . DT  D 2 19  ? 40.941 23.645  59.650  1.00 74.91  ? 118  DT  H "C2'" 1 
ATOM   2643  C  "C1'" . DT  D 2 19  ? 40.804 24.905  58.828  1.00 73.30  ? 118  DT  H "C1'" 1 
ATOM   2644  N  N1    . DT  D 2 19  ? 39.708 25.824  59.186  1.00 69.18  ? 118  DT  H N1    1 
ATOM   2645  C  C2    . DT  D 2 19  ? 39.978 27.180  59.124  1.00 68.25  ? 118  DT  H C2    1 
ATOM   2646  O  O2    . DT  D 2 19  ? 41.072 27.634  58.804  1.00 64.10  ? 118  DT  H O2    1 
ATOM   2647  N  N3    . DT  D 2 19  ? 38.915 27.988  59.447  1.00 63.09  ? 118  DT  H N3    1 
ATOM   2648  C  C4    . DT  D 2 19  ? 37.641 27.584  59.807  1.00 59.03  ? 118  DT  H C4    1 
ATOM   2649  O  O4    . DT  D 2 19  ? 36.779 28.415  60.035  1.00 59.35  ? 118  DT  H O4    1 
ATOM   2650  C  C5    . DT  D 2 19  ? 37.433 26.161  59.869  1.00 55.42  ? 118  DT  H C5    1 
ATOM   2651  C  C7    . DT  D 2 19  ? 36.085 25.652  60.271  1.00 70.58  ? 118  DT  H C7    1 
ATOM   2652  C  C6    . DT  D 2 19  ? 38.464 25.357  59.561  1.00 59.43  ? 118  DT  H C6    1 
ATOM   2653  P  P     . DA  D 2 20  ? 44.243 22.269  59.672  1.00 82.20  ? 119  DA  H P     1 
ATOM   2654  O  OP1   . DA  D 2 20  ? 45.039 21.567  58.637  1.00 81.09  ? 119  DA  H OP1   1 
ATOM   2655  O  OP2   . DA  D 2 20  ? 43.475 21.477  60.671  1.00 79.22  ? 119  DA  H OP2   1 
ATOM   2656  O  "O5'" . DA  D 2 20  ? 45.225 23.250  60.440  1.00 81.25  ? 119  DA  H "O5'" 1 
ATOM   2657  C  "C5'" . DA  D 2 20  ? 46.059 24.151  59.723  1.00 73.10  ? 119  DA  H "C5'" 1 
ATOM   2658  C  "C4'" . DA  D 2 20  ? 46.554 25.231  60.652  1.00 66.92  ? 119  DA  H "C4'" 1 
ATOM   2659  O  "O4'" . DA  D 2 20  ? 45.422 26.007  61.098  1.00 70.39  ? 119  DA  H "O4'" 1 
ATOM   2660  C  "C3'" . DA  D 2 20  ? 47.212 24.700  61.921  1.00 65.97  ? 119  DA  H "C3'" 1 
ATOM   2661  O  "O3'" . DA  D 2 20  ? 48.226 25.626  62.329  1.00 71.89  ? 119  DA  H "O3'" 1 
ATOM   2662  C  "C2'" . DA  D 2 20  ? 46.056 24.629  62.906  1.00 60.22  ? 119  DA  H "C2'" 1 
ATOM   2663  C  "C1'" . DA  D 2 20  ? 45.186 25.808  62.486  1.00 63.05  ? 119  DA  H "C1'" 1 
ATOM   2664  N  N9    . DA  D 2 20  ? 43.742 25.632  62.660  1.00 60.18  ? 119  DA  H N9    1 
ATOM   2665  C  C8    . DA  D 2 20  ? 43.022 24.467  62.755  1.00 55.18  ? 119  DA  H C8    1 
ATOM   2666  N  N7    . DA  D 2 20  ? 41.727 24.653  62.849  1.00 58.53  ? 119  DA  H N7    1 
ATOM   2667  C  C5    . DA  D 2 20  ? 41.586 26.033  62.824  1.00 64.46  ? 119  DA  H C5    1 
ATOM   2668  C  C6    . DA  D 2 20  ? 40.459 26.869  62.874  1.00 71.44  ? 119  DA  H C6    1 
ATOM   2669  N  N6    . DA  D 2 20  ? 39.203 26.416  62.944  1.00 68.32  ? 119  DA  H N6    1 
ATOM   2670  N  N1    . DA  D 2 20  ? 40.667 28.204  62.842  1.00 75.47  ? 119  DA  H N1    1 
ATOM   2671  C  C2    . DA  D 2 20  ? 41.923 28.655  62.762  1.00 71.09  ? 119  DA  H C2    1 
ATOM   2672  N  N3    . DA  D 2 20  ? 43.059 27.972  62.700  1.00 64.44  ? 119  DA  H N3    1 
ATOM   2673  C  C4    . DA  D 2 20  ? 42.819 26.649  62.731  1.00 63.66  ? 119  DA  H C4    1 
ATOM   2674  P  P     . DC  D 2 21  ? 49.192 25.268  63.559  1.00 72.71  ? 120  DC  H P     1 
ATOM   2675  O  OP1   . DC  D 2 21  ? 50.520 25.881  63.291  1.00 64.73  ? 120  DC  H OP1   1 
ATOM   2676  O  OP2   . DC  D 2 21  ? 49.087 23.798  63.810  1.00 66.85  ? 120  DC  H OP2   1 
ATOM   2677  O  "O5'" . DC  D 2 21  ? 48.520 26.039  64.779  1.00 74.76  ? 120  DC  H "O5'" 1 
ATOM   2678  C  "C5'" . DC  D 2 21  ? 48.231 27.433  64.690  1.00 72.68  ? 120  DC  H "C5'" 1 
ATOM   2679  C  "C4'" . DC  D 2 21  ? 47.569 27.902  65.963  1.00 73.44  ? 120  DC  H "C4'" 1 
ATOM   2680  O  "O4'" . DC  D 2 21  ? 46.128 27.745  65.890  1.00 75.93  ? 120  DC  H "O4'" 1 
ATOM   2681  C  "C3'" . DC  D 2 21  ? 48.032 27.108  67.185  1.00 74.72  ? 120  DC  H "C3'" 1 
ATOM   2682  O  "O3'" . DC  D 2 21  ? 48.393 27.967  68.264  1.00 72.28  ? 120  DC  H "O3'" 1 
ATOM   2683  C  "C2'" . DC  D 2 21  ? 46.829 26.254  67.547  1.00 73.43  ? 120  DC  H "C2'" 1 
ATOM   2684  C  "C1'" . DC  D 2 21  ? 45.657 27.084  67.056  1.00 70.51  ? 120  DC  H "C1'" 1 
ATOM   2685  N  N1    . DC  D 2 21  ? 44.460 26.295  66.698  1.00 63.15  ? 120  DC  H N1    1 
ATOM   2686  C  C2    . DC  D 2 21  ? 43.243 26.954  66.524  1.00 64.32  ? 120  DC  H C2    1 
ATOM   2687  O  O2    . DC  D 2 21  ? 43.205 28.182  66.640  1.00 68.65  ? 120  DC  H O2    1 
ATOM   2688  N  N3    . DC  D 2 21  ? 42.136 26.237  66.234  1.00 60.77  ? 120  DC  H N3    1 
ATOM   2689  C  C4    . DC  D 2 21  ? 42.214 24.914  66.114  1.00 71.68  ? 120  DC  H C4    1 
ATOM   2690  N  N4    . DC  D 2 21  ? 41.092 24.245  65.844  1.00 81.39  ? 120  DC  H N4    1 
ATOM   2691  C  C5    . DC  D 2 21  ? 43.442 24.217  66.268  1.00 74.60  ? 120  DC  H C5    1 
ATOM   2692  C  C6    . DC  D 2 21  ? 44.531 24.940  66.554  1.00 67.53  ? 120  DC  H C6    1 
ATOM   2693  P  P     . DA  D 2 22  ? 49.453 27.451  69.357  1.00 72.60  ? 121  DA  H P     1 
ATOM   2694  O  OP1   . DA  D 2 22  ? 50.412 28.544  69.642  1.00 69.14  ? 121  DA  H OP1   1 
ATOM   2695  O  OP2   . DA  D 2 22  ? 49.958 26.119  68.917  1.00 65.96  ? 121  DA  H OP2   1 
ATOM   2696  O  "O5'" . DA  D 2 22  ? 48.557 27.234  70.649  1.00 67.85  ? 121  DA  H "O5'" 1 
ATOM   2697  C  "C5'" . DA  D 2 22  ? 47.743 28.288  71.144  1.00 52.68  ? 121  DA  H "C5'" 1 
ATOM   2698  C  "C4'" . DA  D 2 22  ? 46.748 27.749  72.141  1.00 43.58  ? 121  DA  H "C4'" 1 
ATOM   2699  O  "O4'" . DA  D 2 22  ? 45.678 27.041  71.468  1.00 43.62  ? 121  DA  H "O4'" 1 
ATOM   2700  C  "C3'" . DA  D 2 22  ? 47.338 26.765  73.148  1.00 42.62  ? 121  DA  H "C3'" 1 
ATOM   2701  O  "O3'" . DA  D 2 22  ? 46.869 27.094  74.449  1.00 46.16  ? 121  DA  H "O3'" 1 
ATOM   2702  C  "C2'" . DA  D 2 22  ? 46.785 25.422  72.700  1.00 40.66  ? 121  DA  H "C2'" 1 
ATOM   2703  C  "C1'" . DA  D 2 22  ? 45.435 25.833  72.156  1.00 45.62  ? 121  DA  H "C1'" 1 
ATOM   2704  N  N9    . DA  D 2 22  ? 44.766 24.907  71.241  1.00 43.14  ? 121  DA  H N9    1 
ATOM   2705  C  C8    . DA  D 2 22  ? 45.306 23.930  70.443  1.00 47.08  ? 121  DA  H C8    1 
ATOM   2706  N  N7    . DA  D 2 22  ? 44.419 23.277  69.735  1.00 44.54  ? 121  DA  H N7    1 
ATOM   2707  C  C5    . DA  D 2 22  ? 43.215 23.863  70.093  1.00 50.40  ? 121  DA  H C5    1 
ATOM   2708  C  C6    . DA  D 2 22  ? 41.893 23.629  69.683  1.00 53.13  ? 121  DA  H C6    1 
ATOM   2709  N  N6    . DA  D 2 22  ? 41.551 22.707  68.787  1.00 63.97  ? 121  DA  H N6    1 
ATOM   2710  N  N1    . DA  D 2 22  ? 40.921 24.391  70.229  1.00 50.45  ? 121  DA  H N1    1 
ATOM   2711  C  C2    . DA  D 2 22  ? 41.269 25.324  71.123  1.00 54.06  ? 121  DA  H C2    1 
ATOM   2712  N  N3    . DA  D 2 22  ? 42.477 25.639  71.586  1.00 48.92  ? 121  DA  H N3    1 
ATOM   2713  C  C4    . DA  D 2 22  ? 43.415 24.864  71.022  1.00 47.26  ? 121  DA  H C4    1 
ATOM   2714  P  P     . DT  D 2 23  ? 47.620 26.508  75.729  1.00 49.14  ? 122  DT  H P     1 
ATOM   2715  O  OP1   . DT  D 2 23  ? 46.985 27.150  76.899  1.00 45.70  ? 122  DT  H OP1   1 
ATOM   2716  O  OP2   . DT  D 2 23  ? 49.077 26.627  75.520  1.00 47.37  ? 122  DT  H OP2   1 
ATOM   2717  O  "O5'" . DT  D 2 23  ? 47.258 24.960  75.691  1.00 49.84  ? 122  DT  H "O5'" 1 
ATOM   2718  C  "C5'" . DT  D 2 23  ? 46.362 24.381  76.640  1.00 48.47  ? 122  DT  H "C5'" 1 
ATOM   2719  C  "C4'" . DT  D 2 23  ? 44.954 24.893  76.428  1.00 47.96  ? 122  DT  H "C4'" 1 
ATOM   2720  O  "O4'" . DT  D 2 23  ? 44.493 24.602  75.079  1.00 45.57  ? 122  DT  H "O4'" 1 
ATOM   2721  C  "C3'" . DT  D 2 23  ? 43.942 24.250  77.375  1.00 43.37  ? 122  DT  H "C3'" 1 
ATOM   2722  O  "O3'" . DT  D 2 23  ? 43.112 25.224  77.994  1.00 38.49  ? 122  DT  H "O3'" 1 
ATOM   2723  C  "C2'" . DT  D 2 23  ? 43.123 23.335  76.487  1.00 39.98  ? 122  DT  H "C2'" 1 
ATOM   2724  C  "C1'" . DT  D 2 23  ? 43.216 23.984  75.117  1.00 41.57  ? 122  DT  H "C1'" 1 
ATOM   2725  N  N1    . DT  D 2 23  ? 43.124 23.000  74.004  1.00 43.43  ? 122  DT  H N1    1 
ATOM   2726  C  C2    . DT  D 2 23  ? 41.894 22.805  73.423  1.00 40.47  ? 122  DT  H C2    1 
ATOM   2727  O  O2    . DT  D 2 23  ? 40.906 23.423  73.741  1.00 45.02  ? 122  DT  H O2    1 
ATOM   2728  N  N3    . DT  D 2 23  ? 41.860 21.852  72.453  1.00 35.23  ? 122  DT  H N3    1 
ATOM   2729  C  C4    . DT  D 2 23  ? 42.905 21.078  72.001  1.00 38.89  ? 122  DT  H C4    1 
ATOM   2730  O  O4    . DT  D 2 23  ? 42.709 20.232  71.113  1.00 39.01  ? 122  DT  H O4    1 
ATOM   2731  C  C5    . DT  D 2 23  ? 44.180 21.339  72.635  1.00 34.03  ? 122  DT  H C5    1 
ATOM   2732  C  C7    . DT  D 2 23  ? 45.378 20.550  72.204  1.00 63.49  ? 122  DT  H C7    1 
ATOM   2733  C  C6    . DT  D 2 23  ? 44.226 22.283  73.589  1.00 40.14  ? 122  DT  H C6    1 
ATOM   2734  P  P     . DT  D 2 24  ? 42.421 24.881  79.391  1.00 38.55  ? 123  DT  H P     1 
ATOM   2735  O  OP1   . DT  D 2 24  ? 42.058 26.143  80.046  1.00 33.59  ? 123  DT  H OP1   1 
ATOM   2736  O  OP2   . DT  D 2 24  ? 43.245 23.901  80.109  1.00 31.75  ? 123  DT  H OP2   1 
ATOM   2737  O  "O5'" . DT  D 2 24  ? 41.091 24.149  78.947  1.00 42.26  ? 123  DT  H "O5'" 1 
ATOM   2738  C  "C5'" . DT  D 2 24  ? 40.043 24.890  78.348  1.00 37.99  ? 123  DT  H "C5'" 1 
ATOM   2739  C  "C4'" . DT  D 2 24  ? 38.836 24.012  78.140  1.00 41.22  ? 123  DT  H "C4'" 1 
ATOM   2740  O  "O4'" . DT  D 2 24  ? 39.000 23.218  76.945  1.00 46.68  ? 123  DT  H "O4'" 1 
ATOM   2741  C  "C3'" . DT  D 2 24  ? 38.571 23.032  79.276  1.00 38.37  ? 123  DT  H "C3'" 1 
ATOM   2742  O  "O3'" . DT  D 2 24  ? 37.179 23.000  79.548  1.00 41.59  ? 123  DT  H "O3'" 1 
ATOM   2743  C  "C2'" . DT  D 2 24  ? 39.032 21.703  78.708  1.00 34.24  ? 123  DT  H "C2'" 1 
ATOM   2744  C  "C1'" . DT  D 2 24  ? 38.703 21.871  77.240  1.00 36.44  ? 123  DT  H "C1'" 1 
ATOM   2745  N  N1    . DT  D 2 24  ? 39.447 21.027  76.291  1.00 31.01  ? 123  DT  H N1    1 
ATOM   2746  C  C2    . DT  D 2 24  ? 38.734 20.456  75.276  1.00 38.12  ? 123  DT  H C2    1 
ATOM   2747  O  O2    . DT  D 2 24  ? 37.534 20.601  75.148  1.00 38.44  ? 123  DT  H O2    1 
ATOM   2748  N  N3    . DT  D 2 24  ? 39.477 19.709  74.411  1.00 40.88  ? 123  DT  H N3    1 
ATOM   2749  C  C4    . DT  D 2 24  ? 40.833 19.482  74.459  1.00 37.29  ? 123  DT  H C4    1 
ATOM   2750  O  O4    . DT  D 2 24  ? 41.368 18.804  73.593  1.00 32.21  ? 123  DT  H O4    1 
ATOM   2751  C  C5    . DT  D 2 24  ? 41.518 20.091  75.556  1.00 31.58  ? 123  DT  H C5    1 
ATOM   2752  C  C7    . DT  D 2 24  ? 42.990 19.873  75.699  1.00 70.58  ? 123  DT  H C7    1 
ATOM   2753  C  C6    . DT  D 2 24  ? 40.801 20.828  76.409  1.00 29.01  ? 123  DT  H C6    1 
ATOM   2754  P  P     . DA  D 2 25  ? 36.629 22.132  80.772  1.00 45.38  ? 124  DA  H P     1 
ATOM   2755  O  OP1   . DA  D 2 25  ? 35.768 23.036  81.569  1.00 41.54  ? 124  DA  H OP1   1 
ATOM   2756  O  OP2   . DA  D 2 25  ? 37.746 21.424  81.425  1.00 44.08  ? 124  DA  H OP2   1 
ATOM   2757  O  "O5'" . DA  D 2 25  ? 35.722 21.048  80.043  1.00 41.01  ? 124  DA  H "O5'" 1 
ATOM   2758  C  "C5'" . DA  D 2 25  ? 34.704 21.492  79.159  1.00 39.41  ? 124  DA  H "C5'" 1 
ATOM   2759  C  "C4'" . DA  D 2 25  ? 34.188 20.366  78.294  1.00 35.47  ? 124  DA  H "C4'" 1 
ATOM   2760  O  "O4'" . DA  D 2 25  ? 35.184 19.964  77.322  1.00 33.01  ? 124  DA  H "O4'" 1 
ATOM   2761  C  "C3'" . DA  D 2 25  ? 33.748 19.111  79.042  1.00 33.83  ? 124  DA  H "C3'" 1 
ATOM   2762  O  "O3'" . DA  D 2 25  ? 32.458 18.688  78.611  1.00 36.55  ? 124  DA  H "O3'" 1 
ATOM   2763  C  "C2'" . DA  D 2 25  ? 34.765 18.083  78.615  1.00 38.69  ? 124  DA  H "C2'" 1 
ATOM   2764  C  "C1'" . DA  D 2 25  ? 35.206 18.563  77.245  1.00 33.14  ? 124  DA  H "C1'" 1 
ATOM   2765  N  N9    . DA  D 2 25  ? 36.572 18.134  76.950  1.00 37.88  ? 124  DA  H N9    1 
ATOM   2766  C  C8    . DA  D 2 25  ? 37.737 18.513  77.570  1.00 41.29  ? 124  DA  H C8    1 
ATOM   2767  N  N7    . DA  D 2 25  ? 38.791 17.846  77.166  1.00 45.12  ? 124  DA  H N7    1 
ATOM   2768  C  C5    . DA  D 2 25  ? 38.289 16.988  76.201  1.00 45.14  ? 124  DA  H C5    1 
ATOM   2769  C  C6    . DA  D 2 25  ? 38.892 16.008  75.411  1.00 51.63  ? 124  DA  H C6    1 
ATOM   2770  N  N6    . DA  D 2 25  ? 40.187 15.686  75.484  1.00 56.51  ? 124  DA  H N6    1 
ATOM   2771  N  N1    . DA  D 2 25  ? 38.113 15.350  74.531  1.00 46.80  ? 124  DA  H N1    1 
ATOM   2772  C  C2    . DA  D 2 25  ? 36.817 15.660  74.466  1.00 39.24  ? 124  DA  H C2    1 
ATOM   2773  N  N3    . DA  D 2 25  ? 36.132 16.548  75.164  1.00 32.47  ? 124  DA  H N3    1 
ATOM   2774  C  C4    . DA  D 2 25  ? 36.934 17.184  76.029  1.00 38.37  ? 124  DA  H C4    1 
ATOM   2775  P  P     . DT  D 2 26  ? 31.609 17.671  79.517  1.00 37.63  ? 125  DT  H P     1 
ATOM   2776  O  OP1   . DT  D 2 26  ? 30.378 18.362  79.946  1.00 42.19  ? 125  DT  H OP1   1 
ATOM   2777  O  OP2   . DT  D 2 26  ? 32.489 17.044  80.531  1.00 34.55  ? 125  DT  H OP2   1 
ATOM   2778  O  "O5'" . DT  D 2 26  ? 31.201 16.548  78.472  1.00 38.17  ? 125  DT  H "O5'" 1 
ATOM   2779  C  "C5'" . DT  D 2 26  ? 30.674 16.927  77.209  1.00 32.40  ? 125  DT  H "C5'" 1 
ATOM   2780  C  "C4'" . DT  D 2 26  ? 30.972 15.872  76.176  1.00 37.06  ? 125  DT  H "C4'" 1 
ATOM   2781  O  "O4'" . DT  D 2 26  ? 32.401 15.692  76.057  1.00 37.77  ? 125  DT  H "O4'" 1 
ATOM   2782  C  "C3'" . DT  D 2 26  ? 30.399 14.492  76.487  1.00 49.53  ? 125  DT  H "C3'" 1 
ATOM   2783  O  "O3'" . DT  D 2 26  ? 29.963 13.909  75.262  1.00 57.42  ? 125  DT  H "O3'" 1 
ATOM   2784  C  "C2'" . DT  D 2 26  ? 31.606 13.727  76.987  1.00 46.85  ? 125  DT  H "C2'" 1 
ATOM   2785  C  "C1'" . DT  D 2 26  ? 32.681 14.312  76.107  1.00 41.65  ? 125  DT  H "C1'" 1 
ATOM   2786  N  N1    . DT  D 2 26  ? 34.055 14.127  76.580  1.00 40.10  ? 125  DT  H N1    1 
ATOM   2787  C  C2    . DT  D 2 26  ? 34.815 13.243  75.872  1.00 42.37  ? 125  DT  H C2    1 
ATOM   2788  O  O2    . DT  D 2 26  ? 34.390 12.652  74.897  1.00 36.51  ? 125  DT  H O2    1 
ATOM   2789  N  N3    . DT  D 2 26  ? 36.097 13.089  76.337  1.00 40.29  ? 125  DT  H N3    1 
ATOM   2790  C  C4    . DT  D 2 26  ? 36.675 13.742  77.412  1.00 43.35  ? 125  DT  H C4    1 
ATOM   2791  O  O4    . DT  D 2 26  ? 37.844 13.533  77.700  1.00 46.38  ? 125  DT  H O4    1 
ATOM   2792  C  C5    . DT  D 2 26  ? 35.816 14.651  78.115  1.00 42.02  ? 125  DT  H C5    1 
ATOM   2793  C  C7    . DT  D 2 26  ? 36.362 15.372  79.303  1.00 70.58  ? 125  DT  H C7    1 
ATOM   2794  C  C6    . DT  D 2 26  ? 34.561 14.803  77.671  1.00 34.28  ? 125  DT  H C6    1 
ATOM   2795  P  P     . DA  D 2 27  ? 28.871 12.747  75.275  1.00 51.87  ? 126  DA  H P     1 
ATOM   2796  O  OP1   . DA  D 2 27  ? 27.598 13.316  74.776  1.00 52.31  ? 126  DA  H OP1   1 
ATOM   2797  O  OP2   . DA  D 2 27  ? 28.924 12.133  76.616  1.00 49.68  ? 126  DA  H OP2   1 
ATOM   2798  O  "O5'" . DA  D 2 27  ? 29.439 11.728  74.197  1.00 49.64  ? 126  DA  H "O5'" 1 
ATOM   2799  C  "C5'" . DA  D 2 27  ? 30.802 11.334  74.241  1.00 45.36  ? 126  DA  H "C5'" 1 
ATOM   2800  C  "C4'" . DA  D 2 27  ? 30.989 9.998   73.564  1.00 48.08  ? 126  DA  H "C4'" 1 
ATOM   2801  O  "O4'" . DA  D 2 27  ? 32.350 9.566   73.770  1.00 46.47  ? 126  DA  H "O4'" 1 
ATOM   2802  C  "C3'" . DA  D 2 27  ? 30.132 8.903   74.176  1.00 51.79  ? 126  DA  H "C3'" 1 
ATOM   2803  O  "O3'" . DA  D 2 27  ? 29.846 7.906   73.195  1.00 53.96  ? 126  DA  H "O3'" 1 
ATOM   2804  C  "C2'" . DA  D 2 27  ? 31.002 8.376   75.300  1.00 46.80  ? 126  DA  H "C2'" 1 
ATOM   2805  C  "C1'" . DA  D 2 27  ? 32.416 8.583   74.796  1.00 43.08  ? 126  DA  H "C1'" 1 
ATOM   2806  N  N9    . DA  D 2 27  ? 33.317 9.092   75.826  1.00 46.39  ? 126  DA  H N9    1 
ATOM   2807  C  C8    . DA  D 2 27  ? 33.057 10.067  76.756  1.00 46.34  ? 126  DA  H C8    1 
ATOM   2808  N  N7    . DA  D 2 27  ? 34.082 10.357  77.521  1.00 41.00  ? 126  DA  H N7    1 
ATOM   2809  C  C5    . DA  D 2 27  ? 35.078 9.504   77.074  1.00 42.39  ? 126  DA  H C5    1 
ATOM   2810  C  C6    . DA  D 2 27  ? 36.403 9.327   77.468  1.00 45.26  ? 126  DA  H C6    1 
ATOM   2811  N  N6    . DA  D 2 27  ? 36.982 10.028  78.434  1.00 46.35  ? 126  DA  H N6    1 
ATOM   2812  N  N1    . DA  D 2 27  ? 37.132 8.396   76.824  1.00 46.66  ? 126  DA  H N1    1 
ATOM   2813  C  C2    . DA  D 2 27  ? 36.552 7.694   75.842  1.00 44.34  ? 126  DA  H C2    1 
ATOM   2814  N  N3    . DA  D 2 27  ? 35.309 7.773   75.375  1.00 48.20  ? 126  DA  H N3    1 
ATOM   2815  C  C4    . DA  D 2 27  ? 34.617 8.710   76.041  1.00 47.16  ? 126  DA  H C4    1 
ATOM   2816  P  P     . DC  D 2 28  ? 28.813 6.734   73.537  1.00 53.89  ? 127  DC  H P     1 
ATOM   2817  O  OP1   . DC  D 2 28  ? 28.388 6.116   72.256  1.00 53.51  ? 127  DC  H OP1   1 
ATOM   2818  O  OP2   . DC  D 2 28  ? 27.790 7.283   74.462  1.00 47.21  ? 127  DC  H OP2   1 
ATOM   2819  O  "O5'" . DC  D 2 28  ? 29.714 5.693   74.330  1.00 51.63  ? 127  DC  H "O5'" 1 
ATOM   2820  C  "C5'" . DC  D 2 28  ? 30.745 4.987   73.660  1.00 53.76  ? 127  DC  H "C5'" 1 
ATOM   2821  C  "C4'" . DC  D 2 28  ? 31.438 4.050   74.618  1.00 57.66  ? 127  DC  H "C4'" 1 
ATOM   2822  O  "O4'" . DC  D 2 28  ? 32.420 4.755   75.414  1.00 58.58  ? 127  DC  H "O4'" 1 
ATOM   2823  C  "C3'" . DC  D 2 28  ? 30.503 3.357   75.611  1.00 65.39  ? 127  DC  H "C3'" 1 
ATOM   2824  O  "O3'" . DC  D 2 28  ? 30.935 2.005   75.802  1.00 72.60  ? 127  DC  H "O3'" 1 
ATOM   2825  C  "C2'" . DC  D 2 28  ? 30.751 4.130   76.894  1.00 60.62  ? 127  DC  H "C2'" 1 
ATOM   2826  C  "C1'" . DC  D 2 28  ? 32.236 4.388   76.764  1.00 60.23  ? 127  DC  H "C1'" 1 
ATOM   2827  N  N1    . DC  D 2 28  ? 32.801 5.440   77.621  1.00 61.71  ? 127  DC  H N1    1 
ATOM   2828  C  C2    . DC  D 2 28  ? 34.170 5.400   77.905  1.00 59.93  ? 127  DC  H C2    1 
ATOM   2829  O  O2    . DC  D 2 28  ? 34.865 4.514   77.384  1.00 56.76  ? 127  DC  H O2    1 
ATOM   2830  N  N3    . DC  D 2 28  ? 34.700 6.324   78.736  1.00 58.16  ? 127  DC  H N3    1 
ATOM   2831  C  C4    . DC  D 2 28  ? 33.920 7.262   79.271  1.00 58.90  ? 127  DC  H C4    1 
ATOM   2832  N  N4    . DC  D 2 28  ? 34.481 8.129   80.110  1.00 61.38  ? 127  DC  H N4    1 
ATOM   2833  C  C5    . DC  D 2 28  ? 32.528 7.346   78.976  1.00 59.79  ? 127  DC  H C5    1 
ATOM   2834  C  C6    . DC  D 2 28  ? 32.014 6.425   78.153  1.00 60.75  ? 127  DC  H C6    1 
ATOM   2835  P  P     . DG  D 2 29  ? 29.936 0.784   75.495  1.00 72.47  ? 128  DG  H P     1 
ATOM   2836  O  OP1   . DG  D 2 29  ? 29.592 0.811   74.043  1.00 68.04  ? 128  DG  H OP1   1 
ATOM   2837  O  OP2   . DG  D 2 29  ? 28.856 0.766   76.515  1.00 58.31  ? 128  DG  H OP2   1 
ATOM   2838  O  "O5'" . DG  D 2 29  ? 30.859 -0.480  75.756  1.00 73.93  ? 128  DG  H "O5'" 1 
ATOM   2839  C  "C5'" . DG  D 2 29  ? 32.066 -0.644  75.022  1.00 74.97  ? 128  DG  H "C5'" 1 
ATOM   2840  C  "C4'" . DG  D 2 29  ? 33.195 -1.018  75.952  1.00 77.64  ? 128  DG  H "C4'" 1 
ATOM   2841  O  "O4'" . DG  D 2 29  ? 33.571 0.114   76.776  1.00 78.53  ? 128  DG  H "O4'" 1 
ATOM   2842  C  "C3'" . DG  D 2 29  ? 32.880 -2.160  76.914  1.00 82.28  ? 128  DG  H "C3'" 1 
ATOM   2843  O  "O3'" . DG  D 2 29  ? 34.026 -3.018  76.980  1.00 88.17  ? 128  DG  H "O3'" 1 
ATOM   2844  C  "C2'" . DG  D 2 29  ? 32.617 -1.443  78.232  1.00 76.36  ? 128  DG  H "C2'" 1 
ATOM   2845  C  "C1'" . DG  D 2 29  ? 33.559 -0.252  78.148  1.00 74.72  ? 128  DG  H "C1'" 1 
ATOM   2846  N  N9    . DG  D 2 29  ? 33.188 0.934   78.927  1.00 67.03  ? 128  DG  H N9    1 
ATOM   2847  C  C8    . DG  D 2 29  ? 31.940 1.505   79.027  1.00 62.14  ? 128  DG  H C8    1 
ATOM   2848  N  N7    . DG  D 2 29  ? 31.927 2.586   79.763  1.00 51.85  ? 128  DG  H N7    1 
ATOM   2849  C  C5    . DG  D 2 29  ? 33.241 2.735   80.184  1.00 53.74  ? 128  DG  H C5    1 
ATOM   2850  C  C6    . DG  D 2 29  ? 33.837 3.731   81.001  1.00 52.37  ? 128  DG  H C6    1 
ATOM   2851  O  O6    . DG  D 2 29  ? 33.309 4.718   81.523  1.00 53.77  ? 128  DG  H O6    1 
ATOM   2852  N  N1    . DG  D 2 29  ? 35.191 3.498   81.187  1.00 49.07  ? 128  DG  H N1    1 
ATOM   2853  C  C2    . DG  D 2 29  ? 35.889 2.455   80.654  1.00 49.24  ? 128  DG  H C2    1 
ATOM   2854  N  N2    . DG  D 2 29  ? 37.192 2.416   80.959  1.00 42.96  ? 128  DG  H N2    1 
ATOM   2855  N  N3    . DG  D 2 29  ? 35.354 1.521   79.881  1.00 52.91  ? 128  DG  H N3    1 
ATOM   2856  C  C4    . DG  D 2 29  ? 34.033 1.721   79.690  1.00 56.65  ? 128  DG  H C4    1 
ATOM   2857  P  P     . DA  D 2 30  ? 33.915 -4.463  77.671  1.00 88.74  ? 129  DA  H P     1 
ATOM   2858  O  OP1   . DA  D 2 30  ? 34.192 -5.503  76.650  1.00 89.40  ? 129  DA  H OP1   1 
ATOM   2859  O  OP2   . DA  D 2 30  ? 32.640 -4.502  78.432  1.00 83.33  ? 129  DA  H OP2   1 
ATOM   2860  O  "O5'" . DA  D 2 30  ? 35.111 -4.419  78.712  1.00 81.52  ? 129  DA  H "O5'" 1 
ATOM   2861  C  "C5'" . DA  D 2 30  ? 35.397 -3.200  79.372  1.00 84.46  ? 129  DA  H "C5'" 1 
ATOM   2862  C  "C4'" . DA  D 2 30  ? 36.557 -3.355  80.321  1.00 91.35  ? 129  DA  H "C4'" 1 
ATOM   2863  O  "O4'" . DA  D 2 30  ? 36.634 -2.111  81.050  1.00 91.62  ? 129  DA  H "O4'" 1 
ATOM   2864  C  "C3'" . DA  D 2 30  ? 36.341 -4.429  81.380  1.00 100.24 ? 129  DA  H "C3'" 1 
ATOM   2865  O  "O3'" . DA  D 2 30  ? 37.599 -4.916  81.862  1.00 106.50 ? 129  DA  H "O3'" 1 
ATOM   2866  C  "C2'" . DA  D 2 30  ? 35.566 -3.696  82.457  1.00 95.18  ? 129  DA  H "C2'" 1 
ATOM   2867  C  "C1'" . DA  D 2 30  ? 36.055 -2.255  82.340  1.00 90.53  ? 129  DA  H "C1'" 1 
ATOM   2868  N  N9    . DA  D 2 30  ? 34.969 -1.280  82.447  1.00 83.86  ? 129  DA  H N9    1 
ATOM   2869  C  C8    . DA  D 2 30  ? 33.688 -1.400  81.959  1.00 78.69  ? 129  DA  H C8    1 
ATOM   2870  N  N7    . DA  D 2 30  ? 32.919 -0.375  82.230  1.00 70.88  ? 129  DA  H N7    1 
ATOM   2871  C  C5    . DA  D 2 30  ? 33.748 0.481   82.939  1.00 75.24  ? 129  DA  H C5    1 
ATOM   2872  C  C6    . DA  D 2 30  ? 33.528 1.739   83.517  1.00 72.76  ? 129  DA  H C6    1 
ATOM   2873  N  N6    . DA  D 2 30  ? 32.356 2.376   83.473  1.00 69.36  ? 129  DA  H N6    1 
ATOM   2874  N  N1    . DA  D 2 30  ? 34.564 2.328   84.153  1.00 67.28  ? 129  DA  H N1    1 
ATOM   2875  C  C2    . DA  D 2 30  ? 35.738 1.684   84.196  1.00 67.68  ? 129  DA  H C2    1 
ATOM   2876  N  N3    . DA  D 2 30  ? 36.068 0.497   83.692  1.00 70.58  ? 129  DA  H N3    1 
ATOM   2877  C  C4    . DA  D 2 30  ? 35.016 -0.059  83.071  1.00 78.21  ? 129  DA  H C4    1 
ATOM   2878  P  P     . DA  D 2 31  ? 37.634 -5.932  83.106  1.00 107.55 ? 130  DA  H P     1 
ATOM   2879  O  OP1   . DA  D 2 31  ? 38.811 -6.818  82.930  1.00 104.48 ? 130  DA  H OP1   1 
ATOM   2880  O  OP2   . DA  D 2 31  ? 36.278 -6.521  83.250  1.00 103.55 ? 130  DA  H OP2   1 
ATOM   2881  O  "O5'" . DA  D 2 31  ? 37.884 -4.992  84.367  1.00 103.88 ? 130  DA  H "O5'" 1 
ATOM   2882  C  "C5'" . DA  D 2 31  ? 39.110 -4.277  84.500  1.00 101.27 ? 130  DA  H "C5'" 1 
ATOM   2883  C  "C4'" . DA  D 2 31  ? 39.131 -3.481  85.785  1.00 97.77  ? 130  DA  H "C4'" 1 
ATOM   2884  O  "O4'" . DA  D 2 31  ? 38.149 -2.419  85.728  1.00 92.50  ? 130  DA  H "O4'" 1 
ATOM   2885  C  "C3'" . DA  D 2 31  ? 38.832 -4.270  87.059  1.00 98.25  ? 130  DA  H "C3'" 1 
ATOM   2886  O  "O3'" . DA  D 2 31  ? 39.723 -3.861  88.101  1.00 98.82  ? 130  DA  H "O3'" 1 
ATOM   2887  C  "C2'" . DA  D 2 31  ? 37.403 -3.883  87.393  1.00 91.55  ? 130  DA  H "C2'" 1 
ATOM   2888  C  "C1'" . DA  D 2 31  ? 37.319 -2.461  86.873  1.00 87.22  ? 130  DA  H "C1'" 1 
ATOM   2889  N  N9    . DA  D 2 31  ? 35.971 -2.073  86.463  1.00 79.29  ? 130  DA  H N9    1 
ATOM   2890  C  C8    . DA  D 2 31  ? 35.111 -2.758  85.641  1.00 76.60  ? 130  DA  H C8    1 
ATOM   2891  N  N7    . DA  D 2 31  ? 33.943 -2.181  85.496  1.00 70.04  ? 130  DA  H N7    1 
ATOM   2892  C  C5    . DA  D 2 31  ? 34.043 -1.034  86.271  1.00 70.45  ? 130  DA  H C5    1 
ATOM   2893  C  C6    . DA  D 2 31  ? 33.132 -0.001  86.553  1.00 67.62  ? 130  DA  H C6    1 
ATOM   2894  N  N6    . DA  D 2 31  ? 31.882 0.032   86.085  1.00 62.05  ? 130  DA  H N6    1 
ATOM   2895  N  N1    . DA  D 2 31  ? 33.550 1.002   87.353  1.00 65.45  ? 130  DA  H N1    1 
ATOM   2896  C  C2    . DA  D 2 31  ? 34.798 0.956   87.839  1.00 61.40  ? 130  DA  H C2    1 
ATOM   2897  N  N3    . DA  D 2 31  ? 35.742 0.036   87.655  1.00 63.46  ? 130  DA  H N3    1 
ATOM   2898  C  C4    . DA  D 2 31  ? 35.294 -0.944  86.854  1.00 71.61  ? 130  DA  H C4    1 
ATOM   2899  P  P     . DG  D 2 32  ? 39.710 -4.627  89.516  1.00 101.28 ? 131  DG  H P     1 
ATOM   2900  O  OP1   . DG  D 2 32  ? 41.119 -4.951  89.866  1.00 101.19 ? 131  DG  H OP1   1 
ATOM   2901  O  OP2   . DG  D 2 32  ? 38.695 -5.712  89.477  1.00 96.78  ? 131  DG  H OP2   1 
ATOM   2902  O  "O5'" . DG  D 2 32  ? 39.185 -3.503  90.516  1.00 96.46  ? 131  DG  H "O5'" 1 
ATOM   2903  C  "C5'" . DG  D 2 32  ? 39.762 -2.200  90.491  1.00 83.66  ? 131  DG  H "C5'" 1 
ATOM   2904  C  "C4'" . DG  D 2 32  ? 38.906 -1.220  91.258  1.00 78.40  ? 131  DG  H "C4'" 1 
ATOM   2905  O  "O4'" . DG  D 2 32  ? 37.661 -0.965  90.562  1.00 77.44  ? 131  DG  H "O4'" 1 
ATOM   2906  C  "C3'" . DG  D 2 32  ? 38.521 -1.652  92.672  1.00 81.29  ? 131  DG  H "C3'" 1 
ATOM   2907  O  "O3'" . DG  D 2 32  ? 38.699 -0.547  93.558  1.00 87.55  ? 131  DG  H "O3'" 1 
ATOM   2908  C  "C2'" . DG  D 2 32  ? 37.046 -2.005  92.550  1.00 76.84  ? 131  DG  H "C2'" 1 
ATOM   2909  C  "C1'" . DG  D 2 32  ? 36.584 -1.026  91.486  1.00 70.12  ? 131  DG  H "C1'" 1 
ATOM   2910  N  N9    . DG  D 2 32  ? 35.372 -1.397  90.757  1.00 60.18  ? 131  DG  H N9    1 
ATOM   2911  C  C8    . DG  D 2 32  ? 35.189 -2.508  89.978  1.00 54.96  ? 131  DG  H C8    1 
ATOM   2912  N  N7    . DG  D 2 32  ? 33.996 -2.575  89.453  1.00 49.76  ? 131  DG  H N7    1 
ATOM   2913  C  C5    . DG  D 2 32  ? 33.352 -1.438  89.910  1.00 54.22  ? 131  DG  H C5    1 
ATOM   2914  C  C6    . DG  D 2 32  ? 32.027 -0.974  89.671  1.00 56.45  ? 131  DG  H C6    1 
ATOM   2915  O  O6    . DG  D 2 32  ? 31.132 -1.497  88.989  1.00 52.06  ? 131  DG  H O6    1 
ATOM   2916  N  N1    . DG  D 2 32  ? 31.784 0.229   90.326  1.00 61.64  ? 131  DG  H N1    1 
ATOM   2917  C  C2    . DG  D 2 32  ? 32.694 0.899   91.107  1.00 62.74  ? 131  DG  H C2    1 
ATOM   2918  N  N2    . DG  D 2 32  ? 32.266 2.050   91.645  1.00 51.94  ? 131  DG  H N2    1 
ATOM   2919  N  N3    . DG  D 2 32  ? 33.932 0.471   91.341  1.00 64.06  ? 131  DG  H N3    1 
ATOM   2920  C  C4    . DG  D 2 32  ? 34.187 -0.696  90.715  1.00 60.10  ? 131  DG  H C4    1 
ATOM   2921  P  P     . DT  D 2 33  ? 38.535 -0.764  95.138  1.00 91.36  ? 132  DT  H P     1 
ATOM   2922  O  OP1   . DT  D 2 33  ? 39.502 0.149   95.812  1.00 87.74  ? 132  DT  H OP1   1 
ATOM   2923  O  OP2   . DT  D 2 33  ? 38.571 -2.227  95.422  1.00 89.73  ? 132  DT  H OP2   1 
ATOM   2924  O  "O5'" . DT  D 2 33  ? 37.061 -0.241  95.424  1.00 92.61  ? 132  DT  H "O5'" 1 
ATOM   2925  C  "C5'" . DT  D 2 33  ? 36.763 1.140   95.288  1.00 91.28  ? 132  DT  H "C5'" 1 
ATOM   2926  C  "C4'" . DT  D 2 33  ? 35.393 1.450   95.845  1.00 90.35  ? 132  DT  H "C4'" 1 
ATOM   2927  O  "O4'" . DT  D 2 33  ? 34.352 1.046   94.925  1.00 85.59  ? 132  DT  H "O4'" 1 
ATOM   2928  C  "C3'" . DT  D 2 33  ? 35.033 0.837   97.202  1.00 95.02  ? 132  DT  H "C3'" 1 
ATOM   2929  O  "O3'" . DT  D 2 33  ? 34.422 1.858   97.995  1.00 102.61 ? 132  DT  H "O3'" 1 
ATOM   2930  C  "C2'" . DT  D 2 33  ? 33.998 -0.219  96.840  1.00 88.70  ? 132  DT  H "C2'" 1 
ATOM   2931  C  "C1'" . DT  D 2 33  ? 33.309 0.441   95.661  1.00 80.95  ? 132  DT  H "C1'" 1 
ATOM   2932  N  N1    . DT  D 2 33  ? 32.558 -0.433  94.744  1.00 71.03  ? 132  DT  H N1    1 
ATOM   2933  C  C2    . DT  D 2 33  ? 31.230 -0.131  94.527  1.00 69.29  ? 132  DT  H C2    1 
ATOM   2934  O  O2    . DT  D 2 33  ? 30.657 0.794   95.081  1.00 66.26  ? 132  DT  H O2    1 
ATOM   2935  N  N3    . DT  D 2 33  ? 30.590 -0.957  93.637  1.00 68.85  ? 132  DT  H N3    1 
ATOM   2936  C  C4    . DT  D 2 33  ? 31.127 -2.040  92.968  1.00 69.24  ? 132  DT  H C4    1 
ATOM   2937  O  O4    . DT  D 2 33  ? 30.422 -2.693  92.200  1.00 71.94  ? 132  DT  H O4    1 
ATOM   2938  C  C5    . DT  D 2 33  ? 32.527 -2.310  93.254  1.00 63.53  ? 132  DT  H C5    1 
ATOM   2939  C  C7    . DT  D 2 33  ? 33.196 -3.468  92.584  1.00 70.58  ? 132  DT  H C7    1 
ATOM   2940  C  C6    . DT  D 2 33  ? 33.162 -1.500  94.116  1.00 60.83  ? 132  DT  H C6    1 
ATOM   2941  P  P     . DT  D 2 34  ? 34.314 1.693   99.589  1.00 106.05 ? 133  DT  H P     1 
ATOM   2942  O  OP1   . DT  D 2 34  ? 34.935 2.898   100.206 1.00 102.34 ? 133  DT  H OP1   1 
ATOM   2943  O  OP2   . DT  D 2 34  ? 34.787 0.338   99.976  1.00 103.59 ? 133  DT  H OP2   1 
ATOM   2944  O  "O5'" . DT  D 2 34  ? 32.743 1.755   99.836  1.00 102.49 ? 133  DT  H "O5'" 1 
ATOM   2945  C  "C5'" . DT  D 2 34  ? 31.980 2.861   99.354  1.00 95.10  ? 133  DT  H "C5'" 1 
ATOM   2946  C  "C4'" . DT  D 2 34  ? 30.501 2.558   99.422  1.00 91.89  ? 133  DT  H "C4'" 1 
ATOM   2947  O  "O4'" . DT  D 2 34  ? 30.039 1.801   98.274  1.00 86.23  ? 133  DT  H "O4'" 1 
ATOM   2948  C  "C3'" . DT  D 2 34  ? 30.075 1.765   100.655 1.00 93.63  ? 133  DT  H "C3'" 1 
ATOM   2949  O  "O3'" . DT  D 2 34  ? 28.878 2.315   101.188 1.00 98.72  ? 133  DT  H "O3'" 1 
ATOM   2950  C  "C2'" . DT  D 2 34  ? 29.784 0.388   100.095 1.00 90.48  ? 133  DT  H "C2'" 1 
ATOM   2951  C  "C1'" . DT  D 2 34  ? 29.216 0.751   98.741  1.00 80.61  ? 133  DT  H "C1'" 1 
ATOM   2952  N  N1    . DT  D 2 34  ? 29.206 -0.330  97.736  1.00 68.51  ? 133  DT  H N1    1 
ATOM   2953  C  C2    . DT  D 2 34  ? 28.096 -0.413  96.922  1.00 63.50  ? 133  DT  H C2    1 
ATOM   2954  O  O2    . DT  D 2 34  ? 27.175 0.388   96.972  1.00 52.91  ? 133  DT  H O2    1 
ATOM   2955  N  N3    . DT  D 2 34  ? 28.104 -1.468  96.043  1.00 60.39  ? 133  DT  H N3    1 
ATOM   2956  C  C4    . DT  D 2 34  ? 29.095 -2.417  95.893  1.00 54.94  ? 133  DT  H C4    1 
ATOM   2957  O  O4    . DT  D 2 34  ? 28.957 -3.314  95.065  1.00 53.21  ? 133  DT  H O4    1 
ATOM   2958  C  C5    . DT  D 2 34  ? 30.248 -2.255  96.761  1.00 47.21  ? 133  DT  H C5    1 
ATOM   2959  C  C7    . DT  D 2 34  ? 31.379 -3.227  96.652  1.00 70.58  ? 133  DT  H C7    1 
ATOM   2960  C  C6    . DT  D 2 34  ? 30.246 -1.233  97.627  1.00 51.47  ? 133  DT  H C6    1 
ATOM   2961  P  P     . DA  D 2 35  ? 28.791 2.630   102.754 1.00 101.89 ? 134  DA  H P     1 
ATOM   2962  O  OP1   . DA  D 2 35  ? 29.794 3.681   103.079 1.00 98.42  ? 134  DA  H OP1   1 
ATOM   2963  O  OP2   . DA  D 2 35  ? 28.840 1.316   103.454 1.00 97.82  ? 134  DA  H OP2   1 
ATOM   2964  O  "O5'" . DA  D 2 35  ? 27.338 3.245   102.937 1.00 97.39  ? 134  DA  H "O5'" 1 
ATOM   2965  C  "C5'" . DA  D 2 35  ? 26.264 2.433   103.379 1.00 91.30  ? 134  DA  H "C5'" 1 
ATOM   2966  C  "C4'" . DA  D 2 35  ? 25.206 2.342   102.307 1.00 83.51  ? 134  DA  H "C4'" 1 
ATOM   2967  O  "O4'" . DA  D 2 35  ? 25.736 1.628   101.161 1.00 75.92  ? 134  DA  H "O4'" 1 
ATOM   2968  C  "C3'" . DA  D 2 35  ? 23.969 1.569   102.753 1.00 88.70  ? 134  DA  H "C3'" 1 
ATOM   2969  O  "O3'" . DA  D 2 35  ? 22.791 2.232   102.298 1.00 98.23  ? 134  DA  H "O3'" 1 
ATOM   2970  C  "C2'" . DA  D 2 35  ? 24.139 0.204   102.110 1.00 79.97  ? 134  DA  H "C2'" 1 
ATOM   2971  C  "C1'" . DA  D 2 35  ? 24.901 0.519   100.840 1.00 72.41  ? 134  DA  H "C1'" 1 
ATOM   2972  N  N9    . DA  D 2 35  ? 25.759 -0.576  100.378 1.00 58.81  ? 134  DA  H N9    1 
ATOM   2973  C  C8    . DA  D 2 35  ? 27.022 -0.873  100.821 1.00 52.77  ? 134  DA  H C8    1 
ATOM   2974  N  N7    . DA  D 2 35  ? 27.573 -1.900  100.216 1.00 48.08  ? 134  DA  H N7    1 
ATOM   2975  C  C5    . DA  D 2 35  ? 26.601 -2.318  99.321  1.00 56.39  ? 134  DA  H C5    1 
ATOM   2976  C  C6    . DA  D 2 35  ? 26.571 -3.366  98.384  1.00 56.40  ? 134  DA  H C6    1 
ATOM   2977  N  N6    . DA  D 2 35  ? 27.574 -4.215  98.202  1.00 43.61  ? 134  DA  H N6    1 
ATOM   2978  N  N1    . DA  D 2 35  ? 25.459 -3.512  97.635  1.00 55.11  ? 134  DA  H N1    1 
ATOM   2979  C  C2    . DA  D 2 35  ? 24.445 -2.657  97.827  1.00 60.19  ? 134  DA  H C2    1 
ATOM   2980  N  N3    . DA  D 2 35  ? 24.350 -1.629  98.684  1.00 57.11  ? 134  DA  H N3    1 
ATOM   2981  C  C4    . DA  D 2 35  ? 25.475 -1.512  99.409  1.00 55.89  ? 134  DA  H C4    1 
ATOM   2982  P  P     . DT  D 2 36  ? 21.481 2.239   103.224 1.00 103.16 ? 135  DT  H P     1 
ATOM   2983  O  OP1   . DT  D 2 36  ? 20.794 3.550   103.084 1.00 101.99 ? 135  DT  H OP1   1 
ATOM   2984  O  OP2   . DT  D 2 36  ? 21.901 1.769   104.570 1.00 101.61 ? 135  DT  H OP2   1 
ATOM   2985  O  "O5'" . DT  D 2 36  ? 20.577 1.118   102.553 1.00 99.54  ? 135  DT  H "O5'" 1 
ATOM   2986  C  "C5'" . DT  D 2 36  ? 21.181 0.118   101.750 1.00 87.75  ? 135  DT  H "C5'" 1 
ATOM   2987  C  "C4'" . DT  D 2 36  ? 20.174 -0.491  100.810 1.00 88.40  ? 135  DT  H "C4'" 1 
ATOM   2988  O  "O4'" . DT  D 2 36  ? 20.897 -1.398  99.956  1.00 89.00  ? 135  DT  H "O4'" 1 
ATOM   2989  C  "C3'" . DT  D 2 36  ? 19.119 -1.338  101.508 1.00 92.07  ? 135  DT  H "C3'" 1 
ATOM   2990  O  "O3'" . DT  D 2 36  ? 17.917 -1.356  100.736 1.00 99.48  ? 135  DT  H "O3'" 1 
ATOM   2991  C  "C2'" . DT  D 2 36  ? 19.762 -2.709  101.558 1.00 87.40  ? 135  DT  H "C2'" 1 
ATOM   2992  C  "C1'" . DT  D 2 36  ? 20.605 -2.745  100.294 1.00 81.74  ? 135  DT  H "C1'" 1 
ATOM   2993  N  N1    . DT  D 2 36  ? 21.889 -3.434  100.466 1.00 73.17  ? 135  DT  H N1    1 
ATOM   2994  C  C2    . DT  D 2 36  ? 22.223 -4.424  99.572  1.00 72.42  ? 135  DT  H C2    1 
ATOM   2995  O  O2    . DT  D 2 36  ? 21.496 -4.766  98.655  1.00 72.65  ? 135  DT  H O2    1 
ATOM   2996  N  N3    . DT  D 2 36  ? 23.447 -5.002  99.790  1.00 67.54  ? 135  DT  H N3    1 
ATOM   2997  C  C4    . DT  D 2 36  ? 24.347 -4.696  100.788 1.00 68.89  ? 135  DT  H C4    1 
ATOM   2998  O  O4    . DT  D 2 36  ? 25.418 -5.295  100.845 1.00 65.49  ? 135  DT  H O4    1 
ATOM   2999  C  C5    . DT  D 2 36  ? 23.923 -3.650  101.702 1.00 66.86  ? 135  DT  H C5    1 
ATOM   3000  C  C7    . DT  D 2 36  ? 24.827 -3.251  102.825 1.00 70.58  ? 135  DT  H C7    1 
ATOM   3001  C  C6    . DT  D 2 36  ? 22.731 -3.082  101.496 1.00 67.15  ? 135  DT  H C6    1 
ATOM   3002  P  P     . DC  D 2 37  ? 16.684 -2.272  101.205 1.00 101.17 ? 136  DC  H P     1 
ATOM   3003  O  OP1   . DC  D 2 37  ? 15.425 -1.647  100.717 1.00 99.33  ? 136  DC  H OP1   1 
ATOM   3004  O  OP2   . DC  D 2 37  ? 16.858 -2.538  102.659 1.00 99.58  ? 136  DC  H OP2   1 
ATOM   3005  O  "O5'" . DC  D 2 37  ? 16.907 -3.643  100.419 1.00 104.43 ? 136  DC  H "O5'" 1 
ATOM   3006  C  "C5'" . DC  D 2 37  ? 16.798 -3.691  98.996  1.00 112.49 ? 136  DC  H "C5'" 1 
ATOM   3007  C  "C4'" . DC  D 2 37  ? 16.803 -5.122  98.506  1.00 118.32 ? 136  DC  H "C4'" 1 
ATOM   3008  O  "O4'" . DC  D 2 37  ? 18.126 -5.698  98.642  1.00 117.07 ? 136  DC  H "O4'" 1 
ATOM   3009  C  "C3'" . DC  D 2 37  ? 15.853 -6.068  99.242  1.00 122.07 ? 136  DC  H "C3'" 1 
ATOM   3010  O  "O3'" . DC  D 2 37  ? 15.396 -7.091  98.349  1.00 121.95 ? 136  DC  H "O3'" 1 
ATOM   3011  C  "C2'" . DC  D 2 37  ? 16.770 -6.755  100.236 1.00 120.80 ? 136  DC  H "C2'" 1 
ATOM   3012  C  "C1'" . DC  D 2 37  ? 18.056 -6.877  99.432  1.00 117.09 ? 136  DC  H "C1'" 1 
ATOM   3013  N  N1    . DC  D 2 37  ? 19.281 -6.953  100.243 1.00 108.61 ? 136  DC  H N1    1 
ATOM   3014  C  C2    . DC  D 2 37  ? 20.316 -7.809  99.832  1.00 105.24 ? 136  DC  H C2    1 
ATOM   3015  O  O2    . DC  D 2 37  ? 20.171 -8.474  98.792  1.00 100.90 ? 136  DC  H O2    1 
ATOM   3016  N  N3    . DC  D 2 37  ? 21.444 -7.884  100.578 1.00 98.15  ? 136  DC  H N3    1 
ATOM   3017  C  C4    . DC  D 2 37  ? 21.563 -7.143  101.685 1.00 93.26  ? 136  DC  H C4    1 
ATOM   3018  N  N4    . DC  D 2 37  ? 22.694 -7.236  102.385 1.00 86.07  ? 136  DC  H N4    1 
ATOM   3019  C  C5    . DC  D 2 37  ? 20.527 -6.269  102.124 1.00 97.06  ? 136  DC  H C5    1 
ATOM   3020  C  C6    . DC  D 2 37  ? 19.415 -6.206  101.381 1.00 100.86 ? 136  DC  H C6    1 
ATOM   3021  N  N     . ASN E 3 10  ? 53.432 60.201  100.742 1.00 49.59  ? 10   ASN A N     1 
ATOM   3022  C  CA    . ASN E 3 10  ? 53.023 59.480  99.476  1.00 49.67  ? 10   ASN A CA    1 
ATOM   3023  C  C     . ASN E 3 10  ? 53.571 58.023  99.382  1.00 49.08  ? 10   ASN A C     1 
ATOM   3024  O  O     . ASN E 3 10  ? 53.451 57.237  100.339 1.00 49.23  ? 10   ASN A O     1 
ATOM   3025  C  CB    . ASN E 3 10  ? 53.474 60.307  98.242  1.00 50.24  ? 10   ASN A CB    1 
ATOM   3026  C  CG    . ASN E 3 10  ? 52.338 61.161  97.646  1.00 50.72  ? 10   ASN A CG    1 
ATOM   3027  O  OD1   . ASN E 3 10  ? 51.485 61.705  98.374  1.00 50.98  ? 10   ASN A OD1   1 
ATOM   3028  N  ND2   . ASN E 3 10  ? 52.335 61.292  96.317  1.00 50.81  ? 10   ASN A ND2   1 
ATOM   3029  N  N     . LEU E 3 11  ? 54.155 57.667  98.231  1.00 48.11  ? 11   LEU A N     1 
ATOM   3030  C  CA    . LEU E 3 11  ? 54.710 56.326  98.030  1.00 47.00  ? 11   LEU A CA    1 
ATOM   3031  C  C     . LEU E 3 11  ? 55.617 55.845  99.176  1.00 46.35  ? 11   LEU A C     1 
ATOM   3032  O  O     . LEU E 3 11  ? 56.427 56.611  99.723  1.00 46.42  ? 11   LEU A O     1 
ATOM   3033  C  CB    . LEU E 3 11  ? 55.486 56.278  96.717  1.00 46.26  ? 11   LEU A CB    1 
ATOM   3034  C  CG    . LEU E 3 11  ? 54.754 55.570  95.579  1.00 45.18  ? 11   LEU A CG    1 
ATOM   3035  C  CD1   . LEU E 3 11  ? 55.647 55.452  94.335  1.00 44.52  ? 11   LEU A CD1   1 
ATOM   3036  C  CD2   . LEU E 3 11  ? 54.352 54.195  96.076  1.00 45.10  ? 11   LEU A CD2   1 
ATOM   3037  N  N     . PRO E 3 12  ? 55.486 54.560  99.551  1.00 46.41  ? 12   PRO A N     1 
ATOM   3038  C  CA    . PRO E 3 12  ? 56.201 53.819  100.605 1.00 46.71  ? 12   PRO A CA    1 
ATOM   3039  C  C     . PRO E 3 12  ? 57.706 53.949  100.880 1.00 46.57  ? 12   PRO A C     1 
ATOM   3040  O  O     . PRO E 3 12  ? 58.073 53.947  102.069 1.00 47.45  ? 12   PRO A O     1 
ATOM   3041  C  CB    . PRO E 3 12  ? 55.775 52.386  100.347 1.00 46.43  ? 12   PRO A CB    1 
ATOM   3042  C  CG    . PRO E 3 12  ? 54.293 52.615  100.115 1.00 45.90  ? 12   PRO A CG    1 
ATOM   3043  C  CD    . PRO E 3 12  ? 54.289 53.805  99.135  1.00 46.21  ? 12   PRO A CD    1 
ATOM   3044  N  N     . ALA E 3 13  ? 58.571 54.037  99.855  1.00 46.30  ? 13   ALA A N     1 
ATOM   3045  C  CA    . ALA E 3 13  ? 60.032 54.200  100.097 1.00 46.03  ? 13   ALA A CA    1 
ATOM   3046  C  C     . ALA E 3 13  ? 61.039 53.664  99.062  1.00 45.83  ? 13   ALA A C     1 
ATOM   3047  O  O     . ALA E 3 13  ? 61.929 52.862  99.415  1.00 45.48  ? 13   ALA A O     1 
ATOM   3048  C  CB    . ALA E 3 13  ? 60.429 53.630  101.483 1.00 45.36  ? 13   ALA A CB    1 
ATOM   3049  N  N     . LEU E 3 14  ? 60.917 54.094  97.805  1.00 45.73  ? 14   LEU A N     1 
ATOM   3050  C  CA    . LEU E 3 14  ? 61.869 53.677  96.778  1.00 45.25  ? 14   LEU A CA    1 
ATOM   3051  C  C     . LEU E 3 14  ? 63.219 53.738  97.488  1.00 45.08  ? 14   LEU A C     1 
ATOM   3052  O  O     . LEU E 3 14  ? 63.669 54.818  97.879  1.00 45.05  ? 14   LEU A O     1 
ATOM   3053  C  CB    . LEU E 3 14  ? 61.829 54.658  95.608  1.00 44.96  ? 14   LEU A CB    1 
ATOM   3054  C  CG    . LEU E 3 14  ? 60.585 54.495  94.718  1.00 44.73  ? 14   LEU A CG    1 
ATOM   3055  C  CD1   . LEU E 3 14  ? 60.616 53.110  94.082  1.00 44.74  ? 14   LEU A CD1   1 
ATOM   3056  C  CD2   . LEU E 3 14  ? 59.281 54.676  95.521  1.00 44.72  ? 14   LEU A CD2   1 
ATOM   3057  N  N     . PRO E 3 15  ? 63.870 52.572  97.678  1.00 45.39  ? 15   PRO A N     1 
ATOM   3058  C  CA    . PRO E 3 15  ? 65.164 52.435  98.359  1.00 45.30  ? 15   PRO A CA    1 
ATOM   3059  C  C     . PRO E 3 15  ? 66.397 53.151  97.822  1.00 45.34  ? 15   PRO A C     1 
ATOM   3060  O  O     . PRO E 3 15  ? 66.719 53.082  96.624  1.00 44.61  ? 15   PRO A O     1 
ATOM   3061  C  CB    . PRO E 3 15  ? 65.383 50.921  98.396  1.00 44.65  ? 15   PRO A CB    1 
ATOM   3062  C  CG    . PRO E 3 15  ? 63.980 50.346  98.284  1.00 45.00  ? 15   PRO A CG    1 
ATOM   3063  C  CD    . PRO E 3 15  ? 63.403 51.250  97.221  1.00 45.02  ? 15   PRO A CD    1 
ATOM   3064  N  N     . VAL E 3 16  ? 67.077 53.821  98.760  1.00 46.65  ? 16   VAL A N     1 
ATOM   3065  C  CA    . VAL E 3 16  ? 68.328 54.546  98.519  1.00 48.72  ? 16   VAL A CA    1 
ATOM   3066  C  C     . VAL E 3 16  ? 69.143 53.700  97.540  1.00 50.86  ? 16   VAL A C     1 
ATOM   3067  O  O     . VAL E 3 16  ? 69.628 54.195  96.513  1.00 50.53  ? 16   VAL A O     1 
ATOM   3068  C  CB    . VAL E 3 16  ? 69.145 54.683  99.852  1.00 46.63  ? 16   VAL A CB    1 
ATOM   3069  C  CG1   . VAL E 3 16  ? 70.544 55.219  99.573  1.00 45.70  ? 16   VAL A CG1   1 
ATOM   3070  C  CG2   . VAL E 3 16  ? 68.403 55.594  100.835 1.00 46.49  ? 16   VAL A CG2   1 
ATOM   3071  N  N     . ASP E 3 17  ? 69.261 52.415  97.875  1.00 53.38  ? 17   ASP A N     1 
ATOM   3072  C  CA    . ASP E 3 17  ? 70.001 51.461  97.071  1.00 53.36  ? 17   ASP A CA    1 
ATOM   3073  C  C     . ASP E 3 17  ? 69.134 50.831  95.989  1.00 53.84  ? 17   ASP A C     1 
ATOM   3074  O  O     . ASP E 3 17  ? 69.390 51.016  94.786  1.00 56.53  ? 17   ASP A O     1 
ATOM   3075  C  CB    . ASP E 3 17  ? 70.579 50.355  97.969  1.00 55.37  ? 17   ASP A CB    1 
ATOM   3076  C  CG    . ASP E 3 17  ? 70.604 48.985  97.275  1.00 54.78  ? 17   ASP A CG    1 
ATOM   3077  O  OD1   . ASP E 3 17  ? 69.817 48.090  97.702  1.00 54.46  ? 17   ASP A OD1   1 
ATOM   3078  O  OD2   . ASP E 3 17  ? 71.396 48.814  96.300  1.00 54.59  ? 17   ASP A OD2   1 
ATOM   3079  N  N     . ALA E 3 18  ? 68.115 50.084  96.421  1.00 53.99  ? 18   ALA A N     1 
ATOM   3080  C  CA    . ALA E 3 18  ? 67.217 49.383  95.491  1.00 54.46  ? 18   ALA A CA    1 
ATOM   3081  C  C     . ALA E 3 18  ? 66.790 50.288  94.340  1.00 54.11  ? 18   ALA A C     1 
ATOM   3082  O  O     . ALA E 3 18  ? 67.126 50.044  93.169  1.00 52.00  ? 18   ALA A O     1 
ATOM   3083  C  CB    . ALA E 3 18  ? 65.988 48.865  96.242  1.00 54.60  ? 18   ALA A CB    1 
ATOM   3084  N  N     . THR E 3 19  ? 66.034 51.324  94.696  1.00 51.04  ? 19   THR A N     1 
ATOM   3085  C  CA    . THR E 3 19  ? 65.580 52.318  93.728  1.00 47.67  ? 19   THR A CA    1 
ATOM   3086  C  C     . THR E 3 19  ? 66.846 52.906  93.110  1.00 45.74  ? 19   THR A C     1 
ATOM   3087  O  O     . THR E 3 19  ? 67.771 53.309  93.835  1.00 47.04  ? 19   THR A O     1 
ATOM   3088  C  CB    . THR E 3 19  ? 64.779 53.427  94.443  1.00 47.15  ? 19   THR A CB    1 
ATOM   3089  O  OG1   . THR E 3 19  ? 63.598 52.845  95.017  1.00 48.13  ? 19   THR A OG1   1 
ATOM   3090  C  CG2   . THR E 3 19  ? 64.415 54.548  93.465  1.00 48.34  ? 19   THR A CG2   1 
ATOM   3091  N  N     . SER E 3 20  ? 66.907 52.968  91.783  1.00 44.36  ? 20   SER A N     1 
ATOM   3092  C  CA    . SER E 3 20  ? 68.137 53.478  91.190  1.00 41.69  ? 20   SER A CA    1 
ATOM   3093  C  C     . SER E 3 20  ? 68.236 53.766  89.679  1.00 44.47  ? 20   SER A C     1 
ATOM   3094  O  O     . SER E 3 20  ? 67.911 52.919  88.833  1.00 41.91  ? 20   SER A O     1 
ATOM   3095  C  CB    . SER E 3 20  ? 69.289 52.533  91.617  1.00 36.22  ? 20   SER A CB    1 
ATOM   3096  O  OG    . SER E 3 20  ? 68.850 51.166  91.732  1.00 35.84  ? 20   SER A OG    1 
ATOM   3097  N  N     . ASP E 3 21  ? 68.723 54.974  89.382  1.00 90.85  ? 21   ASP A N     1 
ATOM   3098  C  CA    . ASP E 3 21  ? 68.960 55.471  88.024  1.00 93.33  ? 21   ASP A CA    1 
ATOM   3099  C  C     . ASP E 3 21  ? 67.797 56.205  87.358  1.00 89.53  ? 21   ASP A C     1 
ATOM   3100  O  O     . ASP E 3 21  ? 67.455 57.327  87.741  1.00 85.95  ? 21   ASP A O     1 
ATOM   3101  C  CB    . ASP E 3 21  ? 69.438 54.326  87.104  1.00 110.15 ? 21   ASP A CB    1 
ATOM   3102  C  CG    . ASP E 3 21  ? 70.819 54.590  86.491  1.00 118.43 ? 21   ASP A CG    1 
ATOM   3103  O  OD1   . ASP E 3 21  ? 70.978 55.602  85.768  1.00 121.99 ? 21   ASP A OD1   1 
ATOM   3104  O  OD2   . ASP E 3 21  ? 71.745 53.778  86.727  1.00 121.43 ? 21   ASP A OD2   1 
ATOM   3105  N  N     . GLU E 3 22  ? 67.211 55.566  86.348  1.00 86.81  ? 22   GLU A N     1 
ATOM   3106  C  CA    . GLU E 3 22  ? 66.106 56.148  85.602  1.00 84.49  ? 22   GLU A CA    1 
ATOM   3107  C  C     . GLU E 3 22  ? 64.715 55.842  86.159  1.00 80.48  ? 22   GLU A C     1 
ATOM   3108  O  O     . GLU E 3 22  ? 63.726 56.404  85.696  1.00 81.09  ? 22   GLU A O     1 
ATOM   3109  C  CB    . GLU E 3 22  ? 66.194 55.718  84.133  1.00 90.41  ? 22   GLU A CB    1 
ATOM   3110  C  CG    . GLU E 3 22  ? 66.347 54.220  83.909  1.00 99.00  ? 22   GLU A CG    1 
ATOM   3111  C  CD    . GLU E 3 22  ? 66.469 53.852  82.431  1.00 102.20 ? 22   GLU A CD    1 
ATOM   3112  O  OE1   . GLU E 3 22  ? 66.569 52.641  82.126  1.00 99.85  ? 22   GLU A OE1   1 
ATOM   3113  O  OE2   . GLU E 3 22  ? 66.464 54.771  81.576  1.00 102.31 ? 22   GLU A OE2   1 
ATOM   3114  N  N     . VAL E 3 23  ? 64.627 54.959  87.146  1.00 76.35  ? 23   VAL A N     1 
ATOM   3115  C  CA    . VAL E 3 23  ? 63.332 54.648  87.725  1.00 69.00  ? 23   VAL A CA    1 
ATOM   3116  C  C     . VAL E 3 23  ? 63.027 55.752  88.715  1.00 70.82  ? 23   VAL A C     1 
ATOM   3117  O  O     . VAL E 3 23  ? 61.885 55.936  89.130  1.00 69.43  ? 23   VAL A O     1 
ATOM   3118  C  CB    . VAL E 3 23  ? 63.337 53.316  88.464  1.00 55.53  ? 23   VAL A CB    1 
ATOM   3119  C  CG1   . VAL E 3 23  ? 64.101 52.303  87.658  1.00 47.63  ? 23   VAL A CG1   1 
ATOM   3120  C  CG2   . VAL E 3 23  ? 63.921 53.484  89.847  1.00 54.23  ? 23   VAL A CG2   1 
ATOM   3121  N  N     . ARG E 3 24  ? 64.067 56.473  89.112  1.00 70.55  ? 24   ARG A N     1 
ATOM   3122  C  CA    . ARG E 3 24  ? 63.899 57.583  90.030  1.00 72.24  ? 24   ARG A CA    1 
ATOM   3123  C  C     . ARG E 3 24  ? 63.533 58.758  89.128  1.00 71.13  ? 24   ARG A C     1 
ATOM   3124  O  O     . ARG E 3 24  ? 62.837 59.688  89.533  1.00 68.93  ? 24   ARG A O     1 
ATOM   3125  C  CB    . ARG E 3 24  ? 65.204 57.834  90.787  1.00 87.27  ? 24   ARG A CB    1 
ATOM   3126  C  CG    . ARG E 3 24  ? 65.782 56.554  91.402  1.00 96.23  ? 24   ARG A CG    1 
ATOM   3127  C  CD    . ARG E 3 24  ? 67.016 56.792  92.285  1.00 102.75 ? 24   ARG A CD    1 
ATOM   3128  N  NE    . ARG E 3 24  ? 66.715 57.634  93.438  1.00 112.03 ? 24   ARG A NE    1 
ATOM   3129  C  CZ    . ARG E 3 24  ? 67.119 58.894  93.568  1.00 113.47 ? 24   ARG A CZ    1 
ATOM   3130  N  NH1   . ARG E 3 24  ? 67.850 59.461  92.614  1.00 110.74 ? 24   ARG A NH1   1 
ATOM   3131  N  NH2   . ARG E 3 24  ? 66.782 59.593  94.646  1.00 110.35 ? 24   ARG A NH2   1 
ATOM   3132  N  N     . LYS E 3 25  ? 64.001 58.682  87.886  1.00 71.55  ? 25   LYS A N     1 
ATOM   3133  C  CA    . LYS E 3 25  ? 63.723 59.691  86.873  1.00 71.14  ? 25   LYS A CA    1 
ATOM   3134  C  C     . LYS E 3 25  ? 62.256 59.597  86.490  1.00 69.50  ? 25   LYS A C     1 
ATOM   3135  O  O     . LYS E 3 25  ? 61.526 60.576  86.562  1.00 69.48  ? 25   LYS A O     1 
ATOM   3136  C  CB    . LYS E 3 25  ? 64.598 59.449  85.642  1.00 71.84  ? 25   LYS A CB    1 
ATOM   3137  C  CG    . LYS E 3 25  ? 64.058 60.016  84.326  1.00 74.09  ? 25   LYS A CG    1 
ATOM   3138  C  CD    . LYS E 3 25  ? 63.852 61.525  84.378  1.00 76.60  ? 25   LYS A CD    1 
ATOM   3139  C  CE    . LYS E 3 25  ? 64.369 62.204  83.110  1.00 81.58  ? 25   LYS A CE    1 
ATOM   3140  N  NZ    . LYS E 3 25  ? 63.797 61.614  81.866  1.00 85.88  ? 25   LYS A NZ    1 
ATOM   3141  N  N     . ASN E 3 26  ? 61.831 58.410  86.074  1.00 66.27  ? 26   ASN A N     1 
ATOM   3142  C  CA    . ASN E 3 26  ? 60.445 58.198  85.699  1.00 62.70  ? 26   ASN A CA    1 
ATOM   3143  C  C     . ASN E 3 26  ? 59.555 58.498  86.893  1.00 63.00  ? 26   ASN A C     1 
ATOM   3144  O  O     . ASN E 3 26  ? 58.663 59.334  86.813  1.00 67.28  ? 26   ASN A O     1 
ATOM   3145  C  CB    . ASN E 3 26  ? 60.222 56.760  85.236  1.00 54.62  ? 26   ASN A CB    1 
ATOM   3146  C  CG    . ASN E 3 26  ? 61.016 56.420  83.990  1.00 58.33  ? 26   ASN A CG    1 
ATOM   3147  O  OD1   . ASN E 3 26  ? 60.991 57.159  83.017  1.00 55.52  ? 26   ASN A OD1   1 
ATOM   3148  N  ND2   . ASN E 3 26  ? 61.715 55.292  84.011  1.00 60.76  ? 26   ASN A ND2   1 
ATOM   3149  N  N     . LEU E 3 27  ? 59.806 57.827  88.009  1.00 61.89  ? 27   LEU A N     1 
ATOM   3150  C  CA    . LEU E 3 27  ? 59.005 58.046  89.201  1.00 60.23  ? 27   LEU A CA    1 
ATOM   3151  C  C     . LEU E 3 27  ? 58.883 59.523  89.486  1.00 61.69  ? 27   LEU A C     1 
ATOM   3152  O  O     . LEU E 3 27  ? 57.898 59.971  90.060  1.00 60.26  ? 27   LEU A O     1 
ATOM   3153  C  CB    . LEU E 3 27  ? 59.621 57.340  90.401  1.00 51.69  ? 27   LEU A CB    1 
ATOM   3154  C  CG    . LEU E 3 27  ? 58.734 56.257  91.021  1.00 42.77  ? 27   LEU A CG    1 
ATOM   3155  C  CD1   . LEU E 3 27  ? 58.277 55.274  89.965  1.00 30.92  ? 27   LEU A CD1   1 
ATOM   3156  C  CD2   . LEU E 3 27  ? 59.516 55.531  92.081  1.00 42.81  ? 27   LEU A CD2   1 
ATOM   3157  N  N     . MET E 3 28  ? 59.891 60.282  89.082  1.00 65.01  ? 28   MET A N     1 
ATOM   3158  C  CA    . MET E 3 28  ? 59.870 61.724  89.291  1.00 65.55  ? 28   MET A CA    1 
ATOM   3159  C  C     . MET E 3 28  ? 58.921 62.331  88.264  1.00 64.41  ? 28   MET A C     1 
ATOM   3160  O  O     . MET E 3 28  ? 58.085 63.168  88.601  1.00 63.56  ? 28   MET A O     1 
ATOM   3161  C  CB    . MET E 3 28  ? 61.275 62.308  89.114  1.00 74.78  ? 28   MET A CB    1 
ATOM   3162  C  CG    . MET E 3 28  ? 61.779 63.138  90.291  1.00 81.91  ? 28   MET A CG    1 
ATOM   3163  S  SD    . MET E 3 28  ? 63.496 63.711  90.036  1.00 97.58  ? 28   MET A SD    1 
ATOM   3164  C  CE    . MET E 3 28  ? 63.239 65.503  89.781  1.00 93.56  ? 28   MET A CE    1 
ATOM   3165  N  N     . ASP E 3 29  ? 59.049 61.886  87.014  1.00 63.55  ? 29   ASP A N     1 
ATOM   3166  C  CA    . ASP E 3 29  ? 58.214 62.379  85.925  1.00 61.89  ? 29   ASP A CA    1 
ATOM   3167  C  C     . ASP E 3 29  ? 56.750 62.035  86.113  1.00 56.39  ? 29   ASP A C     1 
ATOM   3168  O  O     . ASP E 3 29  ? 55.893 62.664  85.502  1.00 53.75  ? 29   ASP A O     1 
ATOM   3169  C  CB    . ASP E 3 29  ? 58.678 61.819  84.573  1.00 73.10  ? 29   ASP A CB    1 
ATOM   3170  C  CG    . ASP E 3 29  ? 60.026 62.380  84.125  1.00 84.36  ? 29   ASP A CG    1 
ATOM   3171  O  OD1   . ASP E 3 29  ? 60.217 63.620  84.184  1.00 89.89  ? 29   ASP A OD1   1 
ATOM   3172  O  OD2   . ASP E 3 29  ? 60.890 61.579  83.697  1.00 82.49  ? 29   ASP A OD2   1 
ATOM   3173  N  N     . MET E 3 30  ? 56.461 61.044  86.950  1.00 52.94  ? 30   MET A N     1 
ATOM   3174  C  CA    . MET E 3 30  ? 55.079 60.647  87.175  1.00 52.72  ? 30   MET A CA    1 
ATOM   3175  C  C     . MET E 3 30  ? 54.361 61.541  88.154  1.00 54.03  ? 30   MET A C     1 
ATOM   3176  O  O     . MET E 3 30  ? 53.208 61.904  87.938  1.00 55.45  ? 30   MET A O     1 
ATOM   3177  C  CB    . MET E 3 30  ? 54.978 59.209  87.663  1.00 45.31  ? 30   MET A CB    1 
ATOM   3178  C  CG    . MET E 3 30  ? 53.540 58.768  87.865  1.00 42.97  ? 30   MET A CG    1 
ATOM   3179  S  SD    . MET E 3 30  ? 53.312 56.972  87.889  1.00 53.84  ? 30   MET A SD    1 
ATOM   3180  C  CE    . MET E 3 30  ? 53.005 56.659  89.638  1.00 52.77  ? 30   MET A CE    1 
ATOM   3181  N  N     . PHE E 3 31  ? 55.016 61.893  89.245  1.00 52.09  ? 31   PHE A N     1 
ATOM   3182  C  CA    . PHE E 3 31  ? 54.358 62.774  90.196  1.00 53.98  ? 31   PHE A CA    1 
ATOM   3183  C  C     . PHE E 3 31  ? 54.271 64.182  89.610  1.00 54.25  ? 31   PHE A C     1 
ATOM   3184  O  O     . PHE E 3 31  ? 53.450 64.992  90.030  1.00 55.75  ? 31   PHE A O     1 
ATOM   3185  C  CB    . PHE E 3 31  ? 55.101 62.774  91.539  1.00 57.98  ? 31   PHE A CB    1 
ATOM   3186  C  CG    . PHE E 3 31  ? 54.958 61.484  92.300  1.00 69.87  ? 31   PHE A CG    1 
ATOM   3187  C  CD1   . PHE E 3 31  ? 55.615 60.334  91.874  1.00 75.48  ? 31   PHE A CD1   1 
ATOM   3188  C  CD2   . PHE E 3 31  ? 54.119 61.400  93.409  1.00 67.80  ? 31   PHE A CD2   1 
ATOM   3189  C  CE1   . PHE E 3 31  ? 55.436 59.118  92.537  1.00 73.89  ? 31   PHE A CE1   1 
ATOM   3190  C  CE2   . PHE E 3 31  ? 53.934 60.184  94.080  1.00 68.21  ? 31   PHE A CE2   1 
ATOM   3191  C  CZ    . PHE E 3 31  ? 54.593 59.042  93.641  1.00 67.86  ? 31   PHE A CZ    1 
ATOM   3192  N  N     . ARG E 3 32  ? 55.116 64.465  88.626  1.00 51.76  ? 32   ARG A N     1 
ATOM   3193  C  CA    . ARG E 3 32  ? 55.114 65.770  87.990  1.00 50.31  ? 32   ARG A CA    1 
ATOM   3194  C  C     . ARG E 3 32  ? 53.759 65.992  87.359  1.00 52.92  ? 32   ARG A C     1 
ATOM   3195  O  O     . ARG E 3 32  ? 53.175 67.059  87.487  1.00 52.94  ? 32   ARG A O     1 
ATOM   3196  C  CB    . ARG E 3 32  ? 56.204 65.848  86.919  1.00 49.10  ? 32   ARG A CB    1 
ATOM   3197  C  CG    . ARG E 3 32  ? 56.280 67.186  86.198  1.00 45.32  ? 32   ARG A CG    1 
ATOM   3198  C  CD    . ARG E 3 32  ? 57.477 67.261  85.247  1.00 48.39  ? 32   ARG A CD    1 
ATOM   3199  N  NE    . ARG E 3 32  ? 57.475 66.172  84.270  1.00 62.24  ? 32   ARG A NE    1 
ATOM   3200  C  CZ    . ARG E 3 32  ? 58.301 66.096  83.229  1.00 66.88  ? 32   ARG A CZ    1 
ATOM   3201  N  NH1   . ARG E 3 32  ? 59.203 67.046  83.013  1.00 58.90  ? 32   ARG A NH1   1 
ATOM   3202  N  NH2   . ARG E 3 32  ? 58.229 65.060  82.406  1.00 68.14  ? 32   ARG A NH2   1 
ATOM   3203  N  N     . ASP E 3 33  ? 53.255 64.978  86.671  1.00 56.36  ? 33   ASP A N     1 
ATOM   3204  C  CA    . ASP E 3 33  ? 51.952 65.080  86.036  1.00 56.39  ? 33   ASP A CA    1 
ATOM   3205  C  C     . ASP E 3 33  ? 50.933 64.227  86.783  1.00 58.20  ? 33   ASP A C     1 
ATOM   3206  O  O     . ASP E 3 33  ? 50.228 63.419  86.178  1.00 53.43  ? 33   ASP A O     1 
ATOM   3207  C  CB    . ASP E 3 33  ? 52.035 64.620  84.581  1.00 52.51  ? 33   ASP A CB    1 
ATOM   3208  C  CG    . ASP E 3 33  ? 52.743 65.622  83.692  1.00 59.21  ? 33   ASP A CG    1 
ATOM   3209  O  OD1   . ASP E 3 33  ? 52.369 66.820  83.730  1.00 63.06  ? 33   ASP A OD1   1 
ATOM   3210  O  OD2   . ASP E 3 33  ? 53.669 65.213  82.949  1.00 55.74  ? 33   ASP A OD2   1 
ATOM   3211  N  N     . ARG E 3 34  ? 50.844 64.398  88.097  1.00 59.71  ? 34   ARG A N     1 
ATOM   3212  C  CA    . ARG E 3 34  ? 49.900 63.593  88.846  1.00 62.69  ? 34   ARG A CA    1 
ATOM   3213  C  C     . ARG E 3 34  ? 48.487 63.829  88.336  1.00 62.56  ? 34   ARG A C     1 
ATOM   3214  O  O     . ARG E 3 34  ? 47.676 62.907  88.292  1.00 65.08  ? 34   ARG A O     1 
ATOM   3215  C  CB    . ARG E 3 34  ? 50.001 63.866  90.358  1.00 66.84  ? 34   ARG A CB    1 
ATOM   3216  C  CG    . ARG E 3 34  ? 49.626 65.256  90.855  1.00 72.42  ? 34   ARG A CG    1 
ATOM   3217  C  CD    . ARG E 3 34  ? 49.586 65.237  92.390  1.00 86.36  ? 34   ARG A CD    1 
ATOM   3218  N  NE    . ARG E 3 34  ? 49.325 66.536  93.023  1.00 100.50 ? 34   ARG A NE    1 
ATOM   3219  C  CZ    . ARG E 3 34  ? 50.232 67.498  93.206  1.00 102.50 ? 34   ARG A CZ    1 
ATOM   3220  N  NH1   . ARG E 3 34  ? 51.490 67.329  92.800  1.00 102.26 ? 34   ARG A NH1   1 
ATOM   3221  N  NH2   . ARG E 3 34  ? 49.882 68.626  93.820  1.00 101.32 ? 34   ARG A NH2   1 
ATOM   3222  N  N     . GLN E 3 35  ? 48.199 65.055  87.923  1.00 59.49  ? 35   GLN A N     1 
ATOM   3223  C  CA    . GLN E 3 35  ? 46.875 65.380  87.401  1.00 52.29  ? 35   GLN A CA    1 
ATOM   3224  C  C     . GLN E 3 35  ? 46.468 64.438  86.265  1.00 44.61  ? 35   GLN A C     1 
ATOM   3225  O  O     . GLN E 3 35  ? 45.345 64.507  85.780  1.00 39.78  ? 35   GLN A O     1 
ATOM   3226  C  CB    . GLN E 3 35  ? 46.847 66.821  86.890  1.00 59.99  ? 35   GLN A CB    1 
ATOM   3227  C  CG    . GLN E 3 35  ? 46.841 67.888  87.973  1.00 68.63  ? 35   GLN A CG    1 
ATOM   3228  C  CD    . GLN E 3 35  ? 45.431 68.269  88.383  1.00 85.58  ? 35   GLN A CD    1 
ATOM   3229  O  OE1   . GLN E 3 35  ? 44.649 68.776  87.569  1.00 87.28  ? 35   GLN A OE1   1 
ATOM   3230  N  NE2   . GLN E 3 35  ? 45.094 68.024  89.647  1.00 86.69  ? 35   GLN A NE2   1 
ATOM   3231  N  N     . ALA E 3 36  ? 47.372 63.562  85.841  1.00 40.34  ? 36   ALA A N     1 
ATOM   3232  C  CA    . ALA E 3 36  ? 47.060 62.627  84.765  1.00 41.23  ? 36   ALA A CA    1 
ATOM   3233  C  C     . ALA E 3 36  ? 46.158 61.492  85.233  1.00 40.95  ? 36   ALA A C     1 
ATOM   3234  O  O     . ALA E 3 36  ? 45.734 60.663  84.435  1.00 42.07  ? 36   ALA A O     1 
ATOM   3235  C  CB    . ALA E 3 36  ? 48.344 62.043  84.181  1.00 32.75  ? 36   ALA A CB    1 
ATOM   3236  N  N     . PHE E 3 37  ? 45.862 61.442  86.521  1.00 41.40  ? 37   PHE A N     1 
ATOM   3237  C  CA    . PHE E 3 37  ? 45.024 60.377  87.028  1.00 41.14  ? 37   PHE A CA    1 
ATOM   3238  C  C     . PHE E 3 37  ? 43.982 60.876  88.007  1.00 46.54  ? 37   PHE A C     1 
ATOM   3239  O  O     . PHE E 3 37  ? 44.235 61.801  88.782  1.00 42.11  ? 37   PHE A O     1 
ATOM   3240  C  CB    . PHE E 3 37  ? 45.883 59.325  87.718  1.00 28.90  ? 37   PHE A CB    1 
ATOM   3241  C  CG    . PHE E 3 37  ? 46.937 58.743  86.840  1.00 36.87  ? 37   PHE A CG    1 
ATOM   3242  C  CD1   . PHE E 3 37  ? 48.276 58.984  87.091  1.00 37.33  ? 37   PHE A CD1   1 
ATOM   3243  C  CD2   . PHE E 3 37  ? 46.593 57.946  85.756  1.00 34.12  ? 37   PHE A CD2   1 
ATOM   3244  C  CE1   . PHE E 3 37  ? 49.258 58.438  86.271  1.00 35.81  ? 37   PHE A CE1   1 
ATOM   3245  C  CE2   . PHE E 3 37  ? 47.566 57.394  84.928  1.00 33.67  ? 37   PHE A CE2   1 
ATOM   3246  C  CZ    . PHE E 3 37  ? 48.901 57.640  85.187  1.00 40.38  ? 37   PHE A CZ    1 
ATOM   3247  N  N     . SER E 3 38  ? 42.804 60.263  87.975  1.00 49.14  ? 38   SER A N     1 
ATOM   3248  C  CA    . SER E 3 38  ? 41.756 60.643  88.900  1.00 47.07  ? 38   SER A CA    1 
ATOM   3249  C  C     . SER E 3 38  ? 42.301 60.531  90.312  1.00 47.35  ? 38   SER A C     1 
ATOM   3250  O  O     . SER E 3 38  ? 43.154 59.690  90.593  1.00 47.09  ? 38   SER A O     1 
ATOM   3251  C  CB    . SER E 3 38  ? 40.563 59.715  88.762  1.00 50.53  ? 38   SER A CB    1 
ATOM   3252  O  OG    . SER E 3 38  ? 39.668 59.913  89.844  1.00 58.07  ? 38   SER A OG    1 
ATOM   3253  N  N     . GLU E 3 39  ? 41.815 61.380  91.208  1.00 48.56  ? 39   GLU A N     1 
ATOM   3254  C  CA    . GLU E 3 39  ? 42.281 61.328  92.576  1.00 47.06  ? 39   GLU A CA    1 
ATOM   3255  C  C     . GLU E 3 39  ? 42.008 59.922  93.086  1.00 46.57  ? 39   GLU A C     1 
ATOM   3256  O  O     . GLU E 3 39  ? 42.814 59.367  93.816  1.00 48.64  ? 39   GLU A O     1 
ATOM   3257  C  CB    . GLU E 3 39  ? 41.556 62.367  93.423  1.00 55.83  ? 39   GLU A CB    1 
ATOM   3258  C  CG    . GLU E 3 39  ? 42.226 62.647  94.761  1.00 85.47  ? 39   GLU A CG    1 
ATOM   3259  C  CD    . GLU E 3 39  ? 41.480 63.691  95.580  1.00 100.04 ? 39   GLU A CD    1 
ATOM   3260  O  OE1   . GLU E 3 39  ? 41.402 64.859  95.133  1.00 103.97 ? 39   GLU A OE1   1 
ATOM   3261  O  OE2   . GLU E 3 39  ? 40.965 63.344  96.668  1.00 104.13 ? 39   GLU A OE2   1 
ATOM   3262  N  N     . HIS E 3 40  ? 40.890 59.333  92.676  1.00 44.01  ? 40   HIS A N     1 
ATOM   3263  C  CA    . HIS E 3 40  ? 40.552 57.980  93.103  1.00 40.65  ? 40   HIS A CA    1 
ATOM   3264  C  C     . HIS E 3 40  ? 41.593 56.950  92.720  1.00 41.36  ? 40   HIS A C     1 
ATOM   3265  O  O     . HIS E 3 40  ? 41.865 56.033  93.481  1.00 42.50  ? 40   HIS A O     1 
ATOM   3266  C  CB    . HIS E 3 40  ? 39.231 57.532  92.513  1.00 43.44  ? 40   HIS A CB    1 
ATOM   3267  C  CG    . HIS E 3 40  ? 38.046 58.211  93.108  1.00 43.80  ? 40   HIS A CG    1 
ATOM   3268  N  ND1   . HIS E 3 40  ? 37.862 58.315  94.470  1.00 41.87  ? 40   HIS A ND1   1 
ATOM   3269  C  CD2   . HIS E 3 40  ? 36.966 58.791  92.531  1.00 33.45  ? 40   HIS A CD2   1 
ATOM   3270  C  CE1   . HIS E 3 40  ? 36.717 58.930  94.707  1.00 36.77  ? 40   HIS A CE1   1 
ATOM   3271  N  NE2   . HIS E 3 40  ? 36.155 59.229  93.547  1.00 35.82  ? 40   HIS A NE2   1 
ATOM   3272  N  N     . THR E 3 41  ? 42.163 57.077  91.530  1.00 39.81  ? 41   THR A N     1 
ATOM   3273  C  CA    . THR E 3 41  ? 43.169 56.124  91.097  1.00 35.99  ? 41   THR A CA    1 
ATOM   3274  C  C     . THR E 3 41  ? 44.332 56.207  92.023  1.00 35.24  ? 41   THR A C     1 
ATOM   3275  O  O     . THR E 3 41  ? 44.877 55.194  92.435  1.00 36.50  ? 41   THR A O     1 
ATOM   3276  C  CB    . THR E 3 41  ? 43.677 56.444  89.736  1.00 34.61  ? 41   THR A CB    1 
ATOM   3277  O  OG1   . THR E 3 41  ? 43.067 57.658  89.299  1.00 54.44  ? 41   THR A OG1   1 
ATOM   3278  C  CG2   . THR E 3 41  ? 43.344 55.348  88.782  1.00 39.74  ? 41   THR A CG2   1 
ATOM   3279  N  N     . TRP E 3 42  ? 44.725 57.426  92.352  1.00 35.27  ? 42   TRP A N     1 
ATOM   3280  C  CA    . TRP E 3 42  ? 45.839 57.587  93.249  1.00 35.00  ? 42   TRP A CA    1 
ATOM   3281  C  C     . TRP E 3 42  ? 45.557 56.923  94.569  1.00 35.36  ? 42   TRP A C     1 
ATOM   3282  O  O     . TRP E 3 42  ? 46.441 56.285  95.124  1.00 32.55  ? 42   TRP A O     1 
ATOM   3283  C  CB    . TRP E 3 42  ? 46.182 59.055  93.460  1.00 36.82  ? 42   TRP A CB    1 
ATOM   3284  C  CG    . TRP E 3 42  ? 47.004 59.593  92.344  1.00 42.57  ? 42   TRP A CG    1 
ATOM   3285  C  CD1   . TRP E 3 42  ? 46.564 60.311  91.280  1.00 48.66  ? 42   TRP A CD1   1 
ATOM   3286  C  CD2   . TRP E 3 42  ? 48.395 59.360  92.124  1.00 42.98  ? 42   TRP A CD2   1 
ATOM   3287  N  NE1   . TRP E 3 42  ? 47.592 60.535  90.405  1.00 51.79  ? 42   TRP A NE1   1 
ATOM   3288  C  CE2   . TRP E 3 42  ? 48.729 59.958  90.902  1.00 48.32  ? 42   TRP A CE2   1 
ATOM   3289  C  CE3   . TRP E 3 42  ? 49.389 58.697  92.842  1.00 45.17  ? 42   TRP A CE3   1 
ATOM   3290  C  CZ2   . TRP E 3 42  ? 50.015 59.912  90.378  1.00 45.03  ? 42   TRP A CZ2   1 
ATOM   3291  C  CZ3   . TRP E 3 42  ? 50.664 58.651  92.322  1.00 46.52  ? 42   TRP A CZ3   1 
ATOM   3292  C  CH2   . TRP E 3 42  ? 50.966 59.254  91.102  1.00 43.51  ? 42   TRP A CH2   1 
ATOM   3293  N  N     . LYS E 3 43  ? 44.330 57.038  95.071  1.00 37.28  ? 43   LYS A N     1 
ATOM   3294  C  CA    . LYS E 3 43  ? 44.002 56.419  96.351  1.00 38.21  ? 43   LYS A CA    1 
ATOM   3295  C  C     . LYS E 3 43  ? 44.176 54.905  96.324  1.00 40.01  ? 43   LYS A C     1 
ATOM   3296  O  O     . LYS E 3 43  ? 44.608 54.310  97.318  1.00 34.28  ? 43   LYS A O     1 
ATOM   3297  C  CB    . LYS E 3 43  ? 42.581 56.789  96.790  1.00 42.59  ? 43   LYS A CB    1 
ATOM   3298  C  CG    . LYS E 3 43  ? 42.450 58.242  97.264  1.00 63.52  ? 43   LYS A CG    1 
ATOM   3299  C  CD    . LYS E 3 43  ? 41.199 58.464  98.118  1.00 73.20  ? 43   LYS A CD    1 
ATOM   3300  C  CE    . LYS E 3 43  ? 41.097 59.903  98.647  1.00 72.11  ? 43   LYS A CE    1 
ATOM   3301  N  NZ    . LYS E 3 43  ? 40.716 60.896  97.592  1.00 68.16  ? 43   LYS A NZ    1 
ATOM   3302  N  N     . MET E 3 44  ? 43.862 54.284  95.189  1.00 40.99  ? 44   MET A N     1 
ATOM   3303  C  CA    . MET E 3 44  ? 44.009 52.836  95.064  1.00 41.72  ? 44   MET A CA    1 
ATOM   3304  C  C     . MET E 3 44  ? 45.449 52.421  94.819  1.00 39.60  ? 44   MET A C     1 
ATOM   3305  O  O     . MET E 3 44  ? 45.857 51.339  95.240  1.00 35.27  ? 44   MET A O     1 
ATOM   3306  C  CB    . MET E 3 44  ? 43.126 52.266  93.943  1.00 43.11  ? 44   MET A CB    1 
ATOM   3307  C  CG    . MET E 3 44  ? 41.656 52.134  94.304  1.00 40.17  ? 44   MET A CG    1 
ATOM   3308  S  SD    . MET E 3 44  ? 41.377 51.569  95.994  1.00 32.51  ? 44   MET A SD    1 
ATOM   3309  C  CE    . MET E 3 44  ? 42.102 49.891  95.892  1.00 20.44  ? 44   MET A CE    1 
ATOM   3310  N  N     . LEU E 3 45  ? 46.217 53.261  94.129  1.00 38.68  ? 45   LEU A N     1 
ATOM   3311  C  CA    . LEU E 3 45  ? 47.613 52.931  93.880  1.00 36.93  ? 45   LEU A CA    1 
ATOM   3312  C  C     . LEU E 3 45  ? 48.334 52.911  95.222  1.00 37.02  ? 45   LEU A C     1 
ATOM   3313  O  O     . LEU E 3 45  ? 49.017 51.936  95.559  1.00 35.34  ? 45   LEU A O     1 
ATOM   3314  C  CB    . LEU E 3 45  ? 48.274 53.959  92.952  1.00 30.58  ? 45   LEU A CB    1 
ATOM   3315  C  CG    . LEU E 3 45  ? 49.808 53.847  92.837  1.00 25.21  ? 45   LEU A CG    1 
ATOM   3316  C  CD1   . LEU E 3 45  ? 50.214 52.400  92.548  1.00 17.08  ? 45   LEU A CD1   1 
ATOM   3317  C  CD2   . LEU E 3 45  ? 50.317 54.758  91.747  1.00 14.44  ? 45   LEU A CD2   1 
ATOM   3318  N  N     . LEU E 3 46  ? 48.159 53.981  95.992  1.00 33.53  ? 46   LEU A N     1 
ATOM   3319  C  CA    . LEU E 3 46  ? 48.790 54.085  97.294  1.00 36.08  ? 46   LEU A CA    1 
ATOM   3320  C  C     . LEU E 3 46  ? 48.315 53.025  98.251  1.00 36.51  ? 46   LEU A C     1 
ATOM   3321  O  O     . LEU E 3 46  ? 49.062 52.591  99.116  1.00 38.29  ? 46   LEU A O     1 
ATOM   3322  C  CB    . LEU E 3 46  ? 48.521 55.443  97.918  1.00 30.45  ? 46   LEU A CB    1 
ATOM   3323  C  CG    . LEU E 3 46  ? 48.728 56.623  96.983  1.00 37.39  ? 46   LEU A CG    1 
ATOM   3324  C  CD1   . LEU E 3 46  ? 48.640 57.890  97.801  1.00 38.64  ? 46   LEU A CD1   1 
ATOM   3325  C  CD2   . LEU E 3 46  ? 50.065 56.510  96.275  1.00 25.04  ? 46   LEU A CD2   1 
ATOM   3326  N  N     . SER E 3 47  ? 47.067 52.608  98.111  1.00 43.56  ? 47   SER A N     1 
ATOM   3327  C  CA    . SER E 3 47  ? 46.538 51.599  99.015  1.00 43.34  ? 47   SER A CA    1 
ATOM   3328  C  C     . SER E 3 47  ? 47.128 50.230  98.747  1.00 41.73  ? 47   SER A C     1 
ATOM   3329  O  O     . SER E 3 47  ? 47.413 49.485  99.666  1.00 41.85  ? 47   SER A O     1 
ATOM   3330  C  CB    . SER E 3 47  ? 45.017 51.528  98.916  1.00 42.66  ? 47   SER A CB    1 
ATOM   3331  O  OG    . SER E 3 47  ? 44.511 50.682  99.932  1.00 46.93  ? 47   SER A OG    1 
ATOM   3332  N  N     . VAL E 3 48  ? 47.312 49.887  97.486  1.00 40.84  ? 48   VAL A N     1 
ATOM   3333  C  CA    . VAL E 3 48  ? 47.875 48.593  97.191  1.00 37.58  ? 48   VAL A CA    1 
ATOM   3334  C  C     . VAL E 3 48  ? 49.324 48.584  97.656  1.00 40.10  ? 48   VAL A C     1 
ATOM   3335  O  O     . VAL E 3 48  ? 49.733 47.698  98.390  1.00 38.95  ? 48   VAL A O     1 
ATOM   3336  C  CB    . VAL E 3 48  ? 47.763 48.273  95.694  1.00 27.05  ? 48   VAL A CB    1 
ATOM   3337  C  CG1   . VAL E 3 48  ? 48.272 46.888  95.414  1.00 26.32  ? 48   VAL A CG1   1 
ATOM   3338  C  CG2   . VAL E 3 48  ? 46.323 48.368  95.272  1.00 26.56  ? 48   VAL A CG2   1 
ATOM   3339  N  N     . CYS E 3 49  ? 50.099 49.580  97.253  1.00 41.19  ? 49   CYS A N     1 
ATOM   3340  C  CA    . CYS E 3 49  ? 51.494 49.645  97.680  1.00 38.92  ? 49   CYS A CA    1 
ATOM   3341  C  C     . CYS E 3 49  ? 51.581 49.462  99.186  1.00 37.31  ? 49   CYS A C     1 
ATOM   3342  O  O     . CYS E 3 49  ? 52.268 48.578  99.678  1.00 35.90  ? 49   CYS A O     1 
ATOM   3343  C  CB    . CYS E 3 49  ? 52.107 50.984  97.288  1.00 27.39  ? 49   CYS A CB    1 
ATOM   3344  S  SG    . CYS E 3 49  ? 52.323 51.147  95.507  1.00 42.91  ? 49   CYS A SG    1 
ATOM   3345  N  N     . ARG E 3 50  ? 50.867 50.305  99.914  1.00 39.37  ? 50   ARG A N     1 
ATOM   3346  C  CA    . ARG E 3 50  ? 50.843 50.239  101.364 1.00 40.67  ? 50   ARG A CA    1 
ATOM   3347  C  C     . ARG E 3 50  ? 50.633 48.786  101.796 1.00 42.03  ? 50   ARG A C     1 
ATOM   3348  O  O     . ARG E 3 50  ? 51.388 48.251  102.611 1.00 41.71  ? 50   ARG A O     1 
ATOM   3349  C  CB    . ARG E 3 50  ? 49.697 51.107  101.900 1.00 39.64  ? 50   ARG A CB    1 
ATOM   3350  C  CG    . ARG E 3 50  ? 49.970 51.809  103.237 1.00 46.53  ? 50   ARG A CG    1 
ATOM   3351  C  CD    . ARG E 3 50  ? 48.670 52.217  103.963 1.00 50.59  ? 50   ARG A CD    1 
ATOM   3352  N  NE    . ARG E 3 50  ? 47.640 52.773  103.077 1.00 55.52  ? 50   ARG A NE    1 
ATOM   3353  C  CZ    . ARG E 3 50  ? 47.763 53.891  102.364 1.00 52.30  ? 50   ARG A CZ    1 
ATOM   3354  N  NH1   . ARG E 3 50  ? 48.885 54.601  102.415 1.00 48.84  ? 50   ARG A NH1   1 
ATOM   3355  N  NH2   . ARG E 3 50  ? 46.749 54.300  101.606 1.00 46.24  ? 50   ARG A NH2   1 
ATOM   3356  N  N     . SER E 3 51  ? 49.609 48.155  101.229 1.00 43.58  ? 51   SER A N     1 
ATOM   3357  C  CA    . SER E 3 51  ? 49.259 46.776  101.540 1.00 43.17  ? 51   SER A CA    1 
ATOM   3358  C  C     . SER E 3 51  ? 50.276 45.717  101.149 1.00 41.24  ? 51   SER A C     1 
ATOM   3359  O  O     . SER E 3 51  ? 50.404 44.711  101.829 1.00 38.38  ? 51   SER A O     1 
ATOM   3360  C  CB    . SER E 3 51  ? 47.928 46.425  100.897 1.00 45.49  ? 51   SER A CB    1 
ATOM   3361  O  OG    . SER E 3 51  ? 47.719 45.027  100.949 1.00 55.01  ? 51   SER A OG    1 
ATOM   3362  N  N     . TRP E 3 52  ? 50.975 45.932  100.044 1.00 43.19  ? 52   TRP A N     1 
ATOM   3363  C  CA    . TRP E 3 52  ? 51.988 44.995  99.569  1.00 37.81  ? 52   TRP A CA    1 
ATOM   3364  C  C     . TRP E 3 52  ? 53.240 45.221  100.387 1.00 40.21  ? 52   TRP A C     1 
ATOM   3365  O  O     . TRP E 3 52  ? 53.897 44.282  100.833 1.00 41.32  ? 52   TRP A O     1 
ATOM   3366  C  CB    . TRP E 3 52  ? 52.239 45.238  98.070  1.00 30.92  ? 52   TRP A CB    1 
ATOM   3367  C  CG    . TRP E 3 52  ? 53.631 44.980  97.528  1.00 30.61  ? 52   TRP A CG    1 
ATOM   3368  C  CD1   . TRP E 3 52  ? 54.536 45.919  97.123  1.00 30.72  ? 52   TRP A CD1   1 
ATOM   3369  C  CD2   . TRP E 3 52  ? 54.231 43.711  97.254  1.00 28.85  ? 52   TRP A CD2   1 
ATOM   3370  N  NE1   . TRP E 3 52  ? 55.655 45.316  96.612  1.00 26.47  ? 52   TRP A NE1   1 
ATOM   3371  C  CE2   . TRP E 3 52  ? 55.492 43.960  96.679  1.00 27.19  ? 52   TRP A CE2   1 
ATOM   3372  C  CE3   . TRP E 3 52  ? 53.827 42.387  97.437  1.00 27.52  ? 52   TRP A CE3   1 
ATOM   3373  C  CZ2   . TRP E 3 52  ? 56.345 42.936  96.285  1.00 26.97  ? 52   TRP A CZ2   1 
ATOM   3374  C  CZ3   . TRP E 3 52  ? 54.686 41.365  97.044  1.00 26.42  ? 52   TRP A CZ3   1 
ATOM   3375  C  CH2   . TRP E 3 52  ? 55.925 41.649  96.476  1.00 28.45  ? 52   TRP A CH2   1 
ATOM   3376  N  N     . ALA E 3 53  ? 53.547 46.489  100.610 1.00 39.49  ? 53   ALA A N     1 
ATOM   3377  C  CA    . ALA E 3 53  ? 54.719 46.866  101.373 1.00 33.89  ? 53   ALA A CA    1 
ATOM   3378  C  C     . ALA E 3 53  ? 54.646 46.277  102.759 1.00 37.11  ? 53   ALA A C     1 
ATOM   3379  O  O     . ALA E 3 53  ? 55.646 45.837  103.298 1.00 41.50  ? 53   ALA A O     1 
ATOM   3380  C  CB    . ALA E 3 53  ? 54.814 48.364  101.456 1.00 9.56   ? 53   ALA A CB    1 
ATOM   3381  N  N     . ALA E 3 54  ? 53.457 46.269  103.336 1.00 38.95  ? 54   ALA A N     1 
ATOM   3382  C  CA    . ALA E 3 54  ? 53.283 45.726  104.666 1.00 36.39  ? 54   ALA A CA    1 
ATOM   3383  C  C     . ALA E 3 54  ? 53.348 44.214  104.673 1.00 37.40  ? 54   ALA A C     1 
ATOM   3384  O  O     . ALA E 3 54  ? 53.720 43.625  105.670 1.00 38.02  ? 54   ALA A O     1 
ATOM   3385  C  CB    . ALA E 3 54  ? 51.967 46.177  105.236 1.00 23.31  ? 54   ALA A CB    1 
ATOM   3386  N  N     . TRP E 3 55  ? 52.961 43.577  103.575 1.00 38.22  ? 55   TRP A N     1 
ATOM   3387  C  CA    . TRP E 3 55  ? 53.021 42.120  103.512 1.00 41.25  ? 55   TRP A CA    1 
ATOM   3388  C  C     . TRP E 3 55  ? 54.476 41.724  103.352 1.00 44.16  ? 55   TRP A C     1 
ATOM   3389  O  O     . TRP E 3 55  ? 54.914 40.679  103.819 1.00 43.85  ? 55   TRP A O     1 
ATOM   3390  C  CB    . TRP E 3 55  ? 52.241 41.588  102.320 1.00 35.59  ? 55   TRP A CB    1 
ATOM   3391  C  CG    . TRP E 3 55  ? 52.433 40.136  102.138 1.00 27.87  ? 55   TRP A CG    1 
ATOM   3392  C  CD1   . TRP E 3 55  ? 51.803 39.142  102.808 1.00 16.26  ? 55   TRP A CD1   1 
ATOM   3393  C  CD2   . TRP E 3 55  ? 53.377 39.504  101.264 1.00 28.62  ? 55   TRP A CD2   1 
ATOM   3394  N  NE1   . TRP E 3 55  ? 52.294 37.920  102.404 1.00 22.91  ? 55   TRP A NE1   1 
ATOM   3395  C  CE2   . TRP E 3 55  ? 53.262 38.119  101.457 1.00 15.33  ? 55   TRP A CE2   1 
ATOM   3396  C  CE3   . TRP E 3 55  ? 54.313 39.979  100.340 1.00 27.35  ? 55   TRP A CE3   1 
ATOM   3397  C  CZ2   . TRP E 3 55  ? 54.040 37.204  100.762 1.00 13.24  ? 55   TRP A CZ2   1 
ATOM   3398  C  CZ3   . TRP E 3 55  ? 55.089 39.059  99.650  1.00 29.18  ? 55   TRP A CZ3   1 
ATOM   3399  C  CH2   . TRP E 3 55  ? 54.944 37.686  99.868  1.00 20.96  ? 55   TRP A CH2   1 
ATOM   3400  N  N     . CYS E 3 56  ? 55.213 42.576  102.658 1.00 45.92  ? 56   CYS A N     1 
ATOM   3401  C  CA    . CYS E 3 56  ? 56.624 42.363  102.433 1.00 42.58  ? 56   CYS A CA    1 
ATOM   3402  C  C     . CYS E 3 56  ? 57.414 42.427  103.735 1.00 42.98  ? 56   CYS A C     1 
ATOM   3403  O  O     . CYS E 3 56  ? 58.211 41.546  104.018 1.00 44.39  ? 56   CYS A O     1 
ATOM   3404  C  CB    . CYS E 3 56  ? 57.148 43.407  101.452 1.00 31.89  ? 56   CYS A CB    1 
ATOM   3405  S  SG    . CYS E 3 56  ? 56.662 43.105  99.742  1.00 27.66  ? 56   CYS A SG    1 
ATOM   3406  N  N     . LYS E 3 57  ? 57.204 43.464  104.533 1.00 45.37  ? 57   LYS A N     1 
ATOM   3407  C  CA    . LYS E 3 57  ? 57.939 43.572  105.782 1.00 49.37  ? 57   LYS A CA    1 
ATOM   3408  C  C     . LYS E 3 57  ? 57.638 42.411  106.713 1.00 49.71  ? 57   LYS A C     1 
ATOM   3409  O  O     . LYS E 3 57  ? 58.524 41.901  107.392 1.00 50.17  ? 57   LYS A O     1 
ATOM   3410  C  CB    . LYS E 3 57  ? 57.629 44.898  106.485 1.00 51.09  ? 57   LYS A CB    1 
ATOM   3411  C  CG    . LYS E 3 57  ? 58.277 46.091  105.796 1.00 61.54  ? 57   LYS A CG    1 
ATOM   3412  C  CD    . LYS E 3 57  ? 57.672 47.421  106.237 1.00 59.85  ? 57   LYS A CD    1 
ATOM   3413  C  CE    . LYS E 3 57  ? 58.026 48.520  105.224 1.00 58.30  ? 57   LYS A CE    1 
ATOM   3414  N  NZ    . LYS E 3 57  ? 57.167 49.729  105.394 1.00 58.06  ? 57   LYS A NZ    1 
ATOM   3415  N  N     . LEU E 3 58  ? 56.392 41.972  106.724 1.00 48.45  ? 58   LEU A N     1 
ATOM   3416  C  CA    . LEU E 3 58  ? 56.007 40.891  107.599 1.00 44.39  ? 58   LEU A CA    1 
ATOM   3417  C  C     . LEU E 3 58  ? 56.594 39.560  107.181 1.00 45.00  ? 58   LEU A C     1 
ATOM   3418  O  O     . LEU E 3 58  ? 56.760 38.671  108.002 1.00 44.91  ? 58   LEU A O     1 
ATOM   3419  C  CB    . LEU E 3 58  ? 54.500 40.788  107.634 1.00 35.10  ? 58   LEU A CB    1 
ATOM   3420  C  CG    . LEU E 3 58  ? 53.947 40.332  108.968 1.00 33.55  ? 58   LEU A CG    1 
ATOM   3421  C  CD1   . LEU E 3 58  ? 53.314 41.527  109.686 1.00 34.18  ? 58   LEU A CD1   1 
ATOM   3422  C  CD2   . LEU E 3 58  ? 52.938 39.237  108.733 1.00 24.76  ? 58   LEU A CD2   1 
ATOM   3423  N  N     . ASN E 3 59  ? 56.901 39.422  105.899 1.00 50.71  ? 59   ASN A N     1 
ATOM   3424  C  CA    . ASN E 3 59  ? 57.471 38.186  105.373 1.00 52.09  ? 59   ASN A CA    1 
ATOM   3425  C  C     . ASN E 3 59  ? 58.901 38.372  104.891 1.00 55.34  ? 59   ASN A C     1 
ATOM   3426  O  O     . ASN E 3 59  ? 59.479 37.483  104.268 1.00 52.38  ? 59   ASN A O     1 
ATOM   3427  C  CB    . ASN E 3 59  ? 56.605 37.664  104.239 1.00 47.90  ? 59   ASN A CB    1 
ATOM   3428  C  CG    . ASN E 3 59  ? 55.262 37.202  104.719 1.00 47.32  ? 59   ASN A CG    1 
ATOM   3429  O  OD1   . ASN E 3 59  ? 55.119 36.077  105.192 1.00 45.77  ? 59   ASN A OD1   1 
ATOM   3430  N  ND2   . ASN E 3 59  ? 54.263 38.073  104.622 1.00 39.09  ? 59   ASN A ND2   1 
ATOM   3431  N  N     . ASN E 3 60  ? 59.455 39.546  105.172 1.00 57.96  ? 60   ASN A N     1 
ATOM   3432  C  CA    . ASN E 3 60  ? 60.824 39.865  104.811 1.00 57.16  ? 60   ASN A CA    1 
ATOM   3433  C  C     . ASN E 3 60  ? 61.118 39.784  103.313 1.00 58.89  ? 60   ASN A C     1 
ATOM   3434  O  O     . ASN E 3 60  ? 61.821 38.880  102.876 1.00 60.98  ? 60   ASN A O     1 
ATOM   3435  C  CB    . ASN E 3 60  ? 61.771 38.921  105.560 1.00 47.31  ? 60   ASN A CB    1 
ATOM   3436  C  CG    . ASN E 3 60  ? 61.442 38.803  107.058 1.00 56.34  ? 60   ASN A CG    1 
ATOM   3437  O  OD1   . ASN E 3 60  ? 61.600 39.760  107.832 1.00 54.45  ? 60   ASN A OD1   1 
ATOM   3438  N  ND2   . ASN E 3 60  ? 60.984 37.619  107.468 1.00 48.81  ? 60   ASN A ND2   1 
ATOM   3439  N  N     . ARG E 3 61  ? 60.591 40.713  102.522 1.00 58.00  ? 61   ARG A N     1 
ATOM   3440  C  CA    . ARG E 3 61  ? 60.863 40.708  101.084 1.00 55.20  ? 61   ARG A CA    1 
ATOM   3441  C  C     . ARG E 3 61  ? 61.125 42.139  100.622 1.00 55.66  ? 61   ARG A C     1 
ATOM   3442  O  O     . ARG E 3 61  ? 60.604 43.083  101.196 1.00 50.50  ? 61   ARG A O     1 
ATOM   3443  C  CB    . ARG E 3 61  ? 59.682 40.150  100.284 1.00 37.32  ? 61   ARG A CB    1 
ATOM   3444  C  CG    . ARG E 3 61  ? 58.760 39.243  101.031 1.00 30.14  ? 61   ARG A CG    1 
ATOM   3445  C  CD    . ARG E 3 61  ? 59.347 37.882  101.252 1.00 33.60  ? 61   ARG A CD    1 
ATOM   3446  N  NE    . ARG E 3 61  ? 58.789 36.891  100.335 1.00 34.06  ? 61   ARG A NE    1 
ATOM   3447  C  CZ    . ARG E 3 61  ? 58.080 35.837  100.718 1.00 35.96  ? 61   ARG A CZ    1 
ATOM   3448  N  NH1   . ARG E 3 61  ? 57.828 35.622  101.997 1.00 43.02  ? 61   ARG A NH1   1 
ATOM   3449  N  NH2   . ARG E 3 61  ? 57.633 34.987  99.822  1.00 27.91  ? 61   ARG A NH2   1 
ATOM   3450  N  N     . LYS E 3 62  ? 61.942 42.307  99.592  1.00 59.04  ? 62   LYS A N     1 
ATOM   3451  C  CA    . LYS E 3 62  ? 62.210 43.646  99.094  1.00 62.40  ? 62   LYS A CA    1 
ATOM   3452  C  C     . LYS E 3 62  ? 60.910 44.006  98.395  1.00 59.03  ? 62   LYS A C     1 
ATOM   3453  O  O     . LYS E 3 62  ? 60.434 43.250  97.554  1.00 60.62  ? 62   LYS A O     1 
ATOM   3454  C  CB    . LYS E 3 62  ? 63.373 43.633  98.092  1.00 76.97  ? 62   LYS A CB    1 
ATOM   3455  C  CG    . LYS E 3 62  ? 63.959 45.017  97.774  1.00 84.56  ? 62   LYS A CG    1 
ATOM   3456  C  CD    . LYS E 3 62  ? 64.579 45.092  96.370  1.00 91.86  ? 62   LYS A CD    1 
ATOM   3457  C  CE    . LYS E 3 62  ? 65.718 44.091  96.175  1.00 95.13  ? 62   LYS A CE    1 
ATOM   3458  N  NZ    . LYS E 3 62  ? 66.267 44.109  94.778  1.00 94.47  ? 62   LYS A NZ    1 
ATOM   3459  N  N     . TRP E 3 63  ? 60.332 45.149  98.740  1.00 55.39  ? 63   TRP A N     1 
ATOM   3460  C  CA    . TRP E 3 63  ? 59.066 45.540  98.145  1.00 53.53  ? 63   TRP A CA    1 
ATOM   3461  C  C     . TRP E 3 63  ? 59.136 46.185  96.781  1.00 51.49  ? 63   TRP A C     1 
ATOM   3462  O  O     . TRP E 3 63  ? 58.119 46.341  96.126  1.00 55.20  ? 63   TRP A O     1 
ATOM   3463  C  CB    . TRP E 3 63  ? 58.277 46.448  99.095  1.00 51.58  ? 63   TRP A CB    1 
ATOM   3464  C  CG    . TRP E 3 63  ? 58.593 47.910  99.010  1.00 53.80  ? 63   TRP A CG    1 
ATOM   3465  C  CD1   . TRP E 3 63  ? 59.534 48.585  99.719  1.00 54.41  ? 63   TRP A CD1   1 
ATOM   3466  C  CD2   . TRP E 3 63  ? 57.948 48.879  98.168  1.00 57.20  ? 63   TRP A CD2   1 
ATOM   3467  N  NE1   . TRP E 3 63  ? 59.519 49.917  99.377  1.00 59.50  ? 63   TRP A NE1   1 
ATOM   3468  C  CE2   . TRP E 3 63  ? 58.554 50.124  98.426  1.00 59.78  ? 63   TRP A CE2   1 
ATOM   3469  C  CE3   . TRP E 3 63  ? 56.912 48.813  97.219  1.00 59.55  ? 63   TRP A CE3   1 
ATOM   3470  C  CZ2   . TRP E 3 63  ? 58.163 51.300  97.771  1.00 59.51  ? 63   TRP A CZ2   1 
ATOM   3471  C  CZ3   . TRP E 3 63  ? 56.520 49.977  96.568  1.00 57.53  ? 63   TRP A CZ3   1 
ATOM   3472  C  CH2   . TRP E 3 63  ? 57.147 51.205  96.849  1.00 56.52  ? 63   TRP A CH2   1 
ATOM   3473  N  N     . PHE E 3 64  ? 60.322 46.565  96.340  1.00 49.97  ? 64   PHE A N     1 
ATOM   3474  C  CA    . PHE E 3 64  ? 60.439 47.176  95.030  1.00 49.99  ? 64   PHE A CA    1 
ATOM   3475  C  C     . PHE E 3 64  ? 61.883 47.219  94.552  1.00 49.96  ? 64   PHE A C     1 
ATOM   3476  O  O     . PHE E 3 64  ? 62.772 47.630  95.287  1.00 52.94  ? 64   PHE A O     1 
ATOM   3477  C  CB    . PHE E 3 64  ? 59.843 48.582  95.070  1.00 40.31  ? 64   PHE A CB    1 
ATOM   3478  C  CG    . PHE E 3 64  ? 59.855 49.299  93.734  1.00 41.38  ? 64   PHE A CG    1 
ATOM   3479  C  CD1   . PHE E 3 64  ? 60.950 50.062  93.342  1.00 36.34  ? 64   PHE A CD1   1 
ATOM   3480  C  CD2   . PHE E 3 64  ? 58.756 49.232  92.884  1.00 38.37  ? 64   PHE A CD2   1 
ATOM   3481  C  CE1   . PHE E 3 64  ? 60.941 50.748  92.131  1.00 35.95  ? 64   PHE A CE1   1 
ATOM   3482  C  CE2   . PHE E 3 64  ? 58.740 49.911  91.677  1.00 39.63  ? 64   PHE A CE2   1 
ATOM   3483  C  CZ    . PHE E 3 64  ? 59.830 50.672  91.298  1.00 39.99  ? 64   PHE A CZ    1 
ATOM   3484  N  N     . PRO E 3 65  ? 62.137 46.771  93.316  1.00 47.81  ? 65   PRO A N     1 
ATOM   3485  C  CA    . PRO E 3 65  ? 61.146 46.237  92.384  1.00 50.20  ? 65   PRO A CA    1 
ATOM   3486  C  C     . PRO E 3 65  ? 60.719 44.860  92.852  1.00 50.48  ? 65   PRO A C     1 
ATOM   3487  O  O     . PRO E 3 65  ? 61.533 44.102  93.361  1.00 54.96  ? 65   PRO A O     1 
ATOM   3488  C  CB    . PRO E 3 65  ? 61.909 46.179  91.063  1.00 46.58  ? 65   PRO A CB    1 
ATOM   3489  C  CG    . PRO E 3 65  ? 62.931 47.238  91.216  1.00 46.90  ? 65   PRO A CG    1 
ATOM   3490  C  CD    . PRO E 3 65  ? 63.402 47.026  92.620  1.00 44.94  ? 65   PRO A CD    1 
ATOM   3491  N  N     . ALA E 3 66  ? 59.447 44.539  92.667  1.00 49.51  ? 66   ALA A N     1 
ATOM   3492  C  CA    . ALA E 3 66  ? 58.915 43.255  93.089  1.00 47.82  ? 66   ALA A CA    1 
ATOM   3493  C  C     . ALA E 3 66  ? 59.433 42.068  92.284  1.00 52.19  ? 66   ALA A C     1 
ATOM   3494  O  O     . ALA E 3 66  ? 59.297 42.020  91.065  1.00 52.71  ? 66   ALA A O     1 
ATOM   3495  C  CB    . ALA E 3 66  ? 57.393 43.291  93.035  1.00 26.32  ? 66   ALA A CB    1 
ATOM   3496  N  N     . GLU E 3 67  ? 60.031 41.106  92.976  1.00 51.16  ? 67   GLU A N     1 
ATOM   3497  C  CA    . GLU E 3 67  ? 60.524 39.909  92.319  1.00 49.69  ? 67   GLU A CA    1 
ATOM   3498  C  C     . GLU E 3 67  ? 59.251 39.113  92.053  1.00 50.13  ? 67   GLU A C     1 
ATOM   3499  O  O     . GLU E 3 67  ? 58.305 39.180  92.833  1.00 48.75  ? 67   GLU A O     1 
ATOM   3500  C  CB    . GLU E 3 67  ? 61.442 39.130  93.261  1.00 49.96  ? 67   GLU A CB    1 
ATOM   3501  C  CG    . GLU E 3 67  ? 62.831 38.793  92.712  1.00 64.07  ? 67   GLU A CG    1 
ATOM   3502  C  CD    . GLU E 3 67  ? 63.776 40.008  92.639  1.00 76.64  ? 67   GLU A CD    1 
ATOM   3503  O  OE1   . GLU E 3 67  ? 63.655 40.931  93.485  1.00 78.60  ? 67   GLU A OE1   1 
ATOM   3504  O  OE2   . GLU E 3 67  ? 64.659 40.030  91.745  1.00 79.73  ? 67   GLU A OE2   1 
ATOM   3505  N  N     . PRO E 3 68  ? 59.197 38.363  90.948  1.00 48.63  ? 68   PRO A N     1 
ATOM   3506  C  CA    . PRO E 3 68  ? 58.002 37.576  90.636  1.00 44.76  ? 68   PRO A CA    1 
ATOM   3507  C  C     . PRO E 3 68  ? 57.608 36.514  91.656  1.00 41.93  ? 68   PRO A C     1 
ATOM   3508  O  O     . PRO E 3 68  ? 56.454 36.427  92.050  1.00 42.33  ? 68   PRO A O     1 
ATOM   3509  C  CB    . PRO E 3 68  ? 58.338 36.985  89.283  1.00 40.88  ? 68   PRO A CB    1 
ATOM   3510  C  CG    . PRO E 3 68  ? 59.110 38.091  88.667  1.00 41.14  ? 68   PRO A CG    1 
ATOM   3511  C  CD    . PRO E 3 68  ? 60.063 38.461  89.767  1.00 44.52  ? 68   PRO A CD    1 
ATOM   3512  N  N     . GLU E 3 69  ? 58.555 35.703  92.093  1.00 41.13  ? 69   GLU A N     1 
ATOM   3513  C  CA    . GLU E 3 69  ? 58.222 34.668  93.053  1.00 42.41  ? 69   GLU A CA    1 
ATOM   3514  C  C     . GLU E 3 69  ? 57.581 35.298  94.283  1.00 44.45  ? 69   GLU A C     1 
ATOM   3515  O  O     . GLU E 3 69  ? 56.777 34.672  94.966  1.00 44.10  ? 69   GLU A O     1 
ATOM   3516  C  CB    . GLU E 3 69  ? 59.473 33.863  93.428  1.00 37.54  ? 69   GLU A CB    1 
ATOM   3517  C  CG    . GLU E 3 69  ? 59.254 32.350  93.343  1.00 45.34  ? 69   GLU A CG    1 
ATOM   3518  C  CD    . GLU E 3 69  ? 58.975 31.853  91.914  1.00 52.03  ? 69   GLU A CD    1 
ATOM   3519  O  OE1   . GLU E 3 69  ? 58.204 30.880  91.747  1.00 56.52  ? 69   GLU A OE1   1 
ATOM   3520  O  OE2   . GLU E 3 69  ? 59.534 32.421  90.947  1.00 52.89  ? 69   GLU A OE2   1 
ATOM   3521  N  N     . ASP E 3 70  ? 57.924 36.555  94.547  1.00 45.49  ? 70   ASP A N     1 
ATOM   3522  C  CA    . ASP E 3 70  ? 57.383 37.274  95.696  1.00 41.99  ? 70   ASP A CA    1 
ATOM   3523  C  C     . ASP E 3 70  ? 55.996 37.788  95.400  1.00 42.36  ? 70   ASP A C     1 
ATOM   3524  O  O     . ASP E 3 70  ? 55.137 37.764  96.273  1.00 43.52  ? 70   ASP A O     1 
ATOM   3525  C  CB    . ASP E 3 70  ? 58.274 38.451  96.094  1.00 42.39  ? 70   ASP A CB    1 
ATOM   3526  C  CG    . ASP E 3 70  ? 59.413 38.045  97.002  1.00 40.76  ? 70   ASP A CG    1 
ATOM   3527  O  OD1   . ASP E 3 70  ? 59.457 36.882  97.457  1.00 44.48  ? 70   ASP A OD1   1 
ATOM   3528  O  OD2   . ASP E 3 70  ? 60.271 38.908  97.264  1.00 46.01  ? 70   ASP A OD2   1 
ATOM   3529  N  N     . VAL E 3 71  ? 55.771 38.273  94.183  1.00 39.45  ? 71   VAL A N     1 
ATOM   3530  C  CA    . VAL E 3 71  ? 54.444 38.750  93.842  1.00 35.14  ? 71   VAL A CA    1 
ATOM   3531  C  C     . VAL E 3 71  ? 53.502 37.569  93.852  1.00 35.43  ? 71   VAL A C     1 
ATOM   3532  O  O     . VAL E 3 71  ? 52.338 37.709  94.192  1.00 34.94  ? 71   VAL A O     1 
ATOM   3533  C  CB    . VAL E 3 71  ? 54.402 39.404  92.466  1.00 22.20  ? 71   VAL A CB    1 
ATOM   3534  C  CG1   . VAL E 3 71  ? 52.967 39.465  91.959  1.00 14.01  ? 71   VAL A CG1   1 
ATOM   3535  C  CG2   . VAL E 3 71  ? 54.971 40.798  92.560  1.00 29.96  ? 71   VAL A CG2   1 
ATOM   3536  N  N     . ARG E 3 72  ? 54.011 36.399  93.493  1.00 31.25  ? 72   ARG A N     1 
ATOM   3537  C  CA    . ARG E 3 72  ? 53.176 35.219  93.482  1.00 30.53  ? 72   ARG A CA    1 
ATOM   3538  C  C     . ARG E 3 72  ? 52.792 34.763  94.888  1.00 35.80  ? 72   ARG A C     1 
ATOM   3539  O  O     . ARG E 3 72  ? 51.650 34.390  95.137  1.00 38.29  ? 72   ARG A O     1 
ATOM   3540  C  CB    . ARG E 3 72  ? 53.853 34.063  92.749  1.00 23.33  ? 72   ARG A CB    1 
ATOM   3541  C  CG    . ARG E 3 72  ? 52.947 32.835  92.690  1.00 23.75  ? 72   ARG A CG    1 
ATOM   3542  C  CD    . ARG E 3 72  ? 53.589 31.619  92.096  1.00 21.50  ? 72   ARG A CD    1 
ATOM   3543  N  NE    . ARG E 3 72  ? 53.651 30.582  93.108  1.00 34.99  ? 72   ARG A NE    1 
ATOM   3544  C  CZ    . ARG E 3 72  ? 53.137 29.372  92.953  1.00 33.36  ? 72   ARG A CZ    1 
ATOM   3545  N  NH1   . ARG E 3 72  ? 52.532 29.078  91.818  1.00 31.97  ? 72   ARG A NH1   1 
ATOM   3546  N  NH2   . ARG E 3 72  ? 53.220 28.467  93.927  1.00 20.34  ? 72   ARG A NH2   1 
ATOM   3547  N  N     . ASP E 3 73  ? 53.734 34.768  95.816  1.00 40.27  ? 73   ASP A N     1 
ATOM   3548  C  CA    . ASP E 3 73  ? 53.379 34.345  97.157  1.00 40.66  ? 73   ASP A CA    1 
ATOM   3549  C  C     . ASP E 3 73  ? 52.282 35.289  97.636  1.00 42.43  ? 73   ASP A C     1 
ATOM   3550  O  O     . ASP E 3 73  ? 51.288 34.850  98.211  1.00 40.60  ? 73   ASP A O     1 
ATOM   3551  C  CB    . ASP E 3 73  ? 54.595 34.388  98.090  1.00 45.86  ? 73   ASP A CB    1 
ATOM   3552  C  CG    . ASP E 3 73  ? 55.545 33.201  97.883  1.00 55.57  ? 73   ASP A CG    1 
ATOM   3553  O  OD1   . ASP E 3 73  ? 56.632 33.159  98.508  1.00 59.68  ? 73   ASP A OD1   1 
ATOM   3554  O  OD2   . ASP E 3 73  ? 55.208 32.298  97.093  1.00 57.25  ? 73   ASP A OD2   1 
ATOM   3555  N  N     . TYR E 3 74  ? 52.442 36.579  97.347  1.00 42.64  ? 74   TYR A N     1 
ATOM   3556  C  CA    . TYR E 3 74  ? 51.476 37.600  97.753  1.00 41.50  ? 74   TYR A CA    1 
ATOM   3557  C  C     . TYR E 3 74  ? 50.100 37.427  97.137  1.00 40.94  ? 74   TYR A C     1 
ATOM   3558  O  O     . TYR E 3 74  ? 49.102 37.687  97.793  1.00 40.18  ? 74   TYR A O     1 
ATOM   3559  C  CB    . TYR E 3 74  ? 51.997 38.996  97.412  1.00 34.16  ? 74   TYR A CB    1 
ATOM   3560  C  CG    . TYR E 3 74  ? 51.040 40.135  97.731  1.00 28.89  ? 74   TYR A CG    1 
ATOM   3561  C  CD1   . TYR E 3 74  ? 50.729 40.469  99.047  1.00 28.98  ? 74   TYR A CD1   1 
ATOM   3562  C  CD2   . TYR E 3 74  ? 50.464 40.886  96.713  1.00 23.84  ? 74   TYR A CD2   1 
ATOM   3563  C  CE1   . TYR E 3 74  ? 49.869 41.523  99.331  1.00 23.60  ? 74   TYR A CE1   1 
ATOM   3564  C  CE2   . TYR E 3 74  ? 49.611 41.935  96.984  1.00 21.65  ? 74   TYR A CE2   1 
ATOM   3565  C  CZ    . TYR E 3 74  ? 49.314 42.252  98.292  1.00 25.69  ? 74   TYR A CZ    1 
ATOM   3566  O  OH    . TYR E 3 74  ? 48.452 43.292  98.551  1.00 26.37  ? 74   TYR A OH    1 
ATOM   3567  N  N     . LEU E 3 75  ? 50.036 37.022  95.874  1.00 38.59  ? 75   LEU A N     1 
ATOM   3568  C  CA    . LEU E 3 75  ? 48.745 36.824  95.235  1.00 30.83  ? 75   LEU A CA    1 
ATOM   3569  C  C     . LEU E 3 75  ? 48.050 35.633  95.874  1.00 32.87  ? 75   LEU A C     1 
ATOM   3570  O  O     . LEU E 3 75  ? 46.872 35.703  96.160  1.00 33.79  ? 75   LEU A O     1 
ATOM   3571  C  CB    . LEU E 3 75  ? 48.899 36.605  93.729  1.00 7.95   ? 75   LEU A CB    1 
ATOM   3572  C  CG    . LEU E 3 75  ? 49.303 37.859  92.934  1.00 8.50   ? 75   LEU A CG    1 
ATOM   3573  C  CD1   . LEU E 3 75  ? 49.176 37.592  91.452  1.00 6.08   ? 75   LEU A CD1   1 
ATOM   3574  C  CD2   . LEU E 3 75  ? 48.403 39.037  93.304  1.00 1.20   ? 75   LEU A CD2   1 
ATOM   3575  N  N     . LEU E 3 76  ? 48.769 34.541  96.110  1.00 34.77  ? 76   LEU A N     1 
ATOM   3576  C  CA    . LEU E 3 76  ? 48.158 33.383  96.746  1.00 36.09  ? 76   LEU A CA    1 
ATOM   3577  C  C     . LEU E 3 76  ? 47.733 33.753  98.157  1.00 39.03  ? 76   LEU A C     1 
ATOM   3578  O  O     . LEU E 3 76  ? 46.838 33.138  98.728  1.00 38.99  ? 76   LEU A O     1 
ATOM   3579  C  CB    . LEU E 3 76  ? 49.138 32.221  96.826  1.00 23.16  ? 76   LEU A CB    1 
ATOM   3580  C  CG    . LEU E 3 76  ? 49.475 31.512  95.529  1.00 24.92  ? 76   LEU A CG    1 
ATOM   3581  C  CD1   . LEU E 3 76  ? 50.423 30.361  95.837  1.00 21.97  ? 76   LEU A CD1   1 
ATOM   3582  C  CD2   . LEU E 3 76  ? 48.194 31.014  94.850  1.00 20.71  ? 76   LEU A CD2   1 
ATOM   3583  N  N     . TYR E 3 77  ? 48.399 34.751  98.720  1.00 42.52  ? 77   TYR A N     1 
ATOM   3584  C  CA    . TYR E 3 77  ? 48.101 35.225  100.063 1.00 43.06  ? 77   TYR A CA    1 
ATOM   3585  C  C     . TYR E 3 77  ? 46.809 36.033  100.095 1.00 44.47  ? 77   TYR A C     1 
ATOM   3586  O  O     . TYR E 3 77  ? 46.056 35.939  101.046 1.00 48.36  ? 77   TYR A O     1 
ATOM   3587  C  CB    . TYR E 3 77  ? 49.241 36.095  100.564 1.00 39.86  ? 77   TYR A CB    1 
ATOM   3588  C  CG    . TYR E 3 77  ? 48.840 37.034  101.667 1.00 36.95  ? 77   TYR A CG    1 
ATOM   3589  C  CD1   . TYR E 3 77  ? 48.620 36.570  102.949 1.00 33.10  ? 77   TYR A CD1   1 
ATOM   3590  C  CD2   . TYR E 3 77  ? 48.664 38.394  101.417 1.00 36.02  ? 77   TYR A CD2   1 
ATOM   3591  C  CE1   . TYR E 3 77  ? 48.240 37.433  103.954 1.00 29.32  ? 77   TYR A CE1   1 
ATOM   3592  C  CE2   . TYR E 3 77  ? 48.276 39.256  102.413 1.00 28.02  ? 77   TYR A CE2   1 
ATOM   3593  C  CZ    . TYR E 3 77  ? 48.068 38.766  103.675 1.00 26.04  ? 77   TYR A CZ    1 
ATOM   3594  O  OH    . TYR E 3 77  ? 47.670 39.606  104.675 1.00 24.92  ? 77   TYR A OH    1 
ATOM   3595  N  N     . LEU E 3 78  ? 46.574 36.852  99.075  1.00 44.12  ? 78   LEU A N     1 
ATOM   3596  C  CA    . LEU E 3 78  ? 45.358 37.639  99.006  1.00 39.31  ? 78   LEU A CA    1 
ATOM   3597  C  C     . LEU E 3 78  ? 44.201 36.692  98.758  1.00 44.54  ? 78   LEU A C     1 
ATOM   3598  O  O     . LEU E 3 78  ? 43.071 37.006  99.082  1.00 53.86  ? 78   LEU A O     1 
ATOM   3599  C  CB    . LEU E 3 78  ? 45.407 38.630  97.855  1.00 24.92  ? 78   LEU A CB    1 
ATOM   3600  C  CG    . LEU E 3 78  ? 46.371 39.807  97.882  1.00 14.29  ? 78   LEU A CG    1 
ATOM   3601  C  CD1   . LEU E 3 78  ? 46.318 40.541  96.543  1.00 14.41  ? 78   LEU A CD1   1 
ATOM   3602  C  CD2   . LEU E 3 78  ? 45.991 40.735  98.987  1.00 14.46  ? 78   LEU A CD2   1 
ATOM   3603  N  N     . GLN E 3 79  ? 44.474 35.538  98.165  1.00 42.85  ? 79   GLN A N     1 
ATOM   3604  C  CA    . GLN E 3 79  ? 43.418 34.575  97.900  1.00 39.95  ? 79   GLN A CA    1 
ATOM   3605  C  C     . GLN E 3 79  ? 42.943 33.933  99.180  1.00 42.17  ? 79   GLN A C     1 
ATOM   3606  O  O     . GLN E 3 79  ? 41.744 33.873  99.428  1.00 45.54  ? 79   GLN A O     1 
ATOM   3607  C  CB    . GLN E 3 79  ? 43.893 33.482  96.958  1.00 22.84  ? 79   GLN A CB    1 
ATOM   3608  C  CG    . GLN E 3 79  ? 42.874 32.381  96.733  1.00 19.31  ? 79   GLN A CG    1 
ATOM   3609  C  CD    . GLN E 3 79  ? 43.434 31.230  95.896  1.00 37.24  ? 79   GLN A CD    1 
ATOM   3610  O  OE1   . GLN E 3 79  ? 44.412 30.583  96.287  1.00 47.62  ? 79   GLN A OE1   1 
ATOM   3611  N  NE2   . GLN E 3 79  ? 42.822 30.975  94.740  1.00 35.53  ? 79   GLN A NE2   1 
ATOM   3612  N  N     . ALA E 3 80  ? 43.883 33.453  99.990  1.00 45.05  ? 80   ALA A N     1 
ATOM   3613  C  CA    . ALA E 3 80  ? 43.566 32.804  101.258 1.00 47.26  ? 80   ALA A CA    1 
ATOM   3614  C  C     . ALA E 3 80  ? 42.846 33.740  102.221 1.00 49.96  ? 80   ALA A C     1 
ATOM   3615  O  O     . ALA E 3 80  ? 42.017 33.305  103.015 1.00 50.29  ? 80   ALA A O     1 
ATOM   3616  C  CB    . ALA E 3 80  ? 44.824 32.284  101.897 1.00 47.77  ? 80   ALA A CB    1 
ATOM   3617  N  N     . ARG E 3 81  ? 43.165 35.028  102.157 1.00 52.49  ? 81   ARG A N     1 
ATOM   3618  C  CA    . ARG E 3 81  ? 42.519 36.005  103.020 1.00 51.95  ? 81   ARG A CA    1 
ATOM   3619  C  C     . ARG E 3 81  ? 41.057 36.021  102.642 1.00 53.75  ? 81   ARG A C     1 
ATOM   3620  O  O     . ARG E 3 81  ? 40.242 36.662  103.297 1.00 56.09  ? 81   ARG A O     1 
ATOM   3621  C  CB    . ARG E 3 81  ? 43.104 37.402  102.816 1.00 46.73  ? 81   ARG A CB    1 
ATOM   3622  C  CG    . ARG E 3 81  ? 43.873 37.938  104.016 1.00 59.34  ? 81   ARG A CG    1 
ATOM   3623  C  CD    . ARG E 3 81  ? 44.200 39.411  103.846 1.00 60.61  ? 81   ARG A CD    1 
ATOM   3624  N  NE    . ARG E 3 81  ? 43.009 40.236  104.009 1.00 65.92  ? 81   ARG A NE    1 
ATOM   3625  C  CZ    . ARG E 3 81  ? 42.949 41.533  103.717 1.00 73.94  ? 81   ARG A CZ    1 
ATOM   3626  N  NH1   . ARG E 3 81  ? 44.023 42.153  103.237 1.00 74.33  ? 81   ARG A NH1   1 
ATOM   3627  N  NH2   . ARG E 3 81  ? 41.817 42.213  103.912 1.00 75.66  ? 81   ARG A NH2   1 
ATOM   3628  N  N     . GLY E 3 82  ? 40.736 35.319  101.566 1.00 54.47  ? 82   GLY A N     1 
ATOM   3629  C  CA    . GLY E 3 82  ? 39.365 35.248  101.120 1.00 51.74  ? 82   GLY A CA    1 
ATOM   3630  C  C     . GLY E 3 82  ? 38.930 36.410  100.264 1.00 51.14  ? 82   GLY A C     1 
ATOM   3631  O  O     . GLY E 3 82  ? 37.737 36.616  100.064 1.00 56.55  ? 82   GLY A O     1 
ATOM   3632  N  N     . LEU E 3 83  ? 39.882 37.181  99.764  1.00 48.51  ? 83   LEU A N     1 
ATOM   3633  C  CA    . LEU E 3 83  ? 39.543 38.303  98.913  1.00 41.98  ? 83   LEU A CA    1 
ATOM   3634  C  C     . LEU E 3 83  ? 38.958 37.823  97.604  1.00 39.19  ? 83   LEU A C     1 
ATOM   3635  O  O     . LEU E 3 83  ? 39.218 36.710  97.155  1.00 39.39  ? 83   LEU A O     1 
ATOM   3636  C  CB    . LEU E 3 83  ? 40.766 39.145  98.619  1.00 38.53  ? 83   LEU A CB    1 
ATOM   3637  C  CG    . LEU E 3 83  ? 41.323 39.903  99.798  1.00 19.37  ? 83   LEU A CG    1 
ATOM   3638  C  CD1   . LEU E 3 83  ? 42.487 40.755  99.353  1.00 34.63  ? 83   LEU A CD1   1 
ATOM   3639  C  CD2   . LEU E 3 83  ? 40.248 40.754  100.348 1.00 19.67  ? 83   LEU A CD2   1 
ATOM   3640  N  N     . ALA E 3 84  ? 38.172 38.700  96.999  1.00 36.97  ? 84   ALA A N     1 
ATOM   3641  C  CA    . ALA E 3 84  ? 37.492 38.452  95.741  1.00 35.69  ? 84   ALA A CA    1 
ATOM   3642  C  C     . ALA E 3 84  ? 38.437 38.560  94.553  1.00 35.29  ? 84   ALA A C     1 
ATOM   3643  O  O     . ALA E 3 84  ? 39.355 39.372  94.557  1.00 42.44  ? 84   ALA A O     1 
ATOM   3644  C  CB    . ALA E 3 84  ? 36.374 39.448  95.600  1.00 22.53  ? 84   ALA A CB    1 
ATOM   3645  N  N     . VAL E 3 85  ? 38.206 37.755  93.527  1.00 31.17  ? 85   VAL A N     1 
ATOM   3646  C  CA    . VAL E 3 85  ? 39.066 37.790  92.358  1.00 27.32  ? 85   VAL A CA    1 
ATOM   3647  C  C     . VAL E 3 85  ? 39.232 39.180  91.749  1.00 27.58  ? 85   VAL A C     1 
ATOM   3648  O  O     . VAL E 3 85  ? 40.336 39.558  91.400  1.00 28.17  ? 85   VAL A O     1 
ATOM   3649  C  CB    . VAL E 3 85  ? 38.567 36.836  91.262  1.00 22.93  ? 85   VAL A CB    1 
ATOM   3650  C  CG1   . VAL E 3 85  ? 39.425 36.987  90.010  1.00 6.20   ? 85   VAL A CG1   1 
ATOM   3651  C  CG2   . VAL E 3 85  ? 38.616 35.391  91.769  1.00 15.07  ? 85   VAL A CG2   1 
ATOM   3652  N  N     . LYS E 3 86  ? 38.156 39.948  91.616  1.00 26.22  ? 86   LYS A N     1 
ATOM   3653  C  CA    . LYS E 3 86  ? 38.268 41.292  91.031  1.00 26.33  ? 86   LYS A CA    1 
ATOM   3654  C  C     . LYS E 3 86  ? 39.194 42.185  91.865  1.00 28.82  ? 86   LYS A C     1 
ATOM   3655  O  O     . LYS E 3 86  ? 39.819 43.111  91.343  1.00 30.28  ? 86   LYS A O     1 
ATOM   3656  C  CB    . LYS E 3 86  ? 36.885 41.953  90.931  1.00 18.79  ? 86   LYS A CB    1 
ATOM   3657  C  CG    . LYS E 3 86  ? 36.644 42.744  89.672  1.00 19.08  ? 86   LYS A CG    1 
ATOM   3658  C  CD    . LYS E 3 86  ? 37.676 43.846  89.478  1.00 40.43  ? 86   LYS A CD    1 
ATOM   3659  C  CE    . LYS E 3 86  ? 37.593 44.456  88.063  1.00 49.99  ? 86   LYS A CE    1 
ATOM   3660  N  NZ    . LYS E 3 86  ? 36.242 45.047  87.741  1.00 43.85  ? 86   LYS A NZ    1 
ATOM   3661  N  N     . THR E 3 87  ? 39.260 41.918  93.166  1.00 23.19  ? 87   THR A N     1 
ATOM   3662  C  CA    . THR E 3 87  ? 40.112 42.685  94.062  1.00 26.21  ? 87   THR A CA    1 
ATOM   3663  C  C     . THR E 3 87  ? 41.569 42.262  93.863  1.00 32.98  ? 87   THR A C     1 
ATOM   3664  O  O     . THR E 3 87  ? 42.481 43.096  93.799  1.00 33.31  ? 87   THR A O     1 
ATOM   3665  C  CB    . THR E 3 87  ? 39.714 42.440  95.519  1.00 31.96  ? 87   THR A CB    1 
ATOM   3666  O  OG1   . THR E 3 87  ? 38.462 43.077  95.778  1.00 41.50  ? 87   THR A OG1   1 
ATOM   3667  C  CG2   . THR E 3 87  ? 40.763 42.977  96.466  1.00 25.35  ? 87   THR A CG2   1 
ATOM   3668  N  N     . ILE E 3 88  ? 41.785 40.954  93.771  1.00 33.47  ? 88   ILE A N     1 
ATOM   3669  C  CA    . ILE E 3 88  ? 43.120 40.432  93.566  1.00 29.90  ? 88   ILE A CA    1 
ATOM   3670  C  C     . ILE E 3 88  ? 43.724 40.951  92.274  1.00 31.48  ? 88   ILE A C     1 
ATOM   3671  O  O     . ILE E 3 88  ? 44.920 41.176  92.199  1.00 34.32  ? 88   ILE A O     1 
ATOM   3672  C  CB    . ILE E 3 88  ? 43.106 38.920  93.516  1.00 20.71  ? 88   ILE A CB    1 
ATOM   3673  C  CG1   . ILE E 3 88  ? 42.866 38.362  94.911  1.00 16.71  ? 88   ILE A CG1   1 
ATOM   3674  C  CG2   . ILE E 3 88  ? 44.415 38.418  92.968  1.00 9.32   ? 88   ILE A CG2   1 
ATOM   3675  C  CD1   . ILE E 3 88  ? 42.755 36.848  94.915  1.00 17.67  ? 88   ILE A CD1   1 
ATOM   3676  N  N     . GLN E 3 89  ? 42.901 41.133  91.252  1.00 35.48  ? 89   GLN A N     1 
ATOM   3677  C  CA    . GLN E 3 89  ? 43.403 41.631  89.977  1.00 38.29  ? 89   GLN A CA    1 
ATOM   3678  C  C     . GLN E 3 89  ? 43.709 43.117  90.089  1.00 39.20  ? 89   GLN A C     1 
ATOM   3679  O  O     . GLN E 3 89  ? 44.609 43.617  89.423  1.00 40.39  ? 89   GLN A O     1 
ATOM   3680  C  CB    . GLN E 3 89  ? 42.386 41.396  88.862  1.00 42.51  ? 89   GLN A CB    1 
ATOM   3681  C  CG    . GLN E 3 89  ? 43.012 41.027  87.529  1.00 59.93  ? 89   GLN A CG    1 
ATOM   3682  C  CD    . GLN E 3 89  ? 42.191 39.967  86.794  1.00 70.01  ? 89   GLN A CD    1 
ATOM   3683  O  OE1   . GLN E 3 89  ? 42.747 39.088  86.115  1.00 69.98  ? 89   GLN A OE1   1 
ATOM   3684  N  NE2   . GLN E 3 89  ? 40.859 40.044  86.928  1.00 65.64  ? 89   GLN A NE2   1 
ATOM   3685  N  N     . GLN E 3 90  ? 42.951 43.816  90.929  1.00 35.23  ? 90   GLN A N     1 
ATOM   3686  C  CA    . GLN E 3 90  ? 43.157 45.237  91.139  1.00 37.90  ? 90   GLN A CA    1 
ATOM   3687  C  C     . GLN E 3 90  ? 44.546 45.384  91.726  1.00 43.10  ? 90   GLN A C     1 
ATOM   3688  O  O     . GLN E 3 90  ? 45.347 46.183  91.254  1.00 47.53  ? 90   GLN A O     1 
ATOM   3689  C  CB    . GLN E 3 90  ? 42.112 45.784  92.111  1.00 34.19  ? 90   GLN A CB    1 
ATOM   3690  C  CG    . GLN E 3 90  ? 42.431 47.141  92.757  1.00 32.08  ? 90   GLN A CG    1 
ATOM   3691  C  CD    . GLN E 3 90  ? 42.246 48.330  91.824  1.00 42.57  ? 90   GLN A CD    1 
ATOM   3692  O  OE1   . GLN E 3 90  ? 42.283 49.483  92.256  1.00 48.19  ? 90   GLN A OE1   1 
ATOM   3693  N  NE2   . GLN E 3 90  ? 42.058 48.055  90.542  1.00 44.61  ? 90   GLN A NE2   1 
ATOM   3694  N  N     . HIS E 3 91  ? 44.838 44.600  92.757  1.00 44.01  ? 91   HIS A N     1 
ATOM   3695  C  CA    . HIS E 3 91  ? 46.150 44.657  93.379  1.00 37.91  ? 91   HIS A CA    1 
ATOM   3696  C  C     . HIS E 3 91  ? 47.239 44.363  92.355  1.00 37.71  ? 91   HIS A C     1 
ATOM   3697  O  O     . HIS E 3 91  ? 48.244 45.062  92.299  1.00 40.43  ? 91   HIS A O     1 
ATOM   3698  C  CB    . HIS E 3 91  ? 46.249 43.655  94.529  1.00 31.03  ? 91   HIS A CB    1 
ATOM   3699  C  CG    . HIS E 3 91  ? 45.577 44.106  95.785  1.00 34.77  ? 91   HIS A CG    1 
ATOM   3700  N  ND1   . HIS E 3 91  ? 46.195 44.053  97.015  1.00 29.89  ? 91   HIS A ND1   1 
ATOM   3701  C  CD2   . HIS E 3 91  ? 44.335 44.590  96.010  1.00 39.24  ? 91   HIS A CD2   1 
ATOM   3702  C  CE1   . HIS E 3 91  ? 45.361 44.482  97.945  1.00 29.66  ? 91   HIS A CE1   1 
ATOM   3703  N  NE2   . HIS E 3 91  ? 44.225 44.815  97.362  1.00 39.36  ? 91   HIS A NE2   1 
ATOM   3704  N  N     . LEU E 3 92  ? 47.041 43.330  91.547  1.00 35.47  ? 92   LEU A N     1 
ATOM   3705  C  CA    . LEU E 3 92  ? 48.024 42.967  90.543  1.00 36.56  ? 92   LEU A CA    1 
ATOM   3706  C  C     . LEU E 3 92  ? 48.199 44.107  89.566  1.00 37.83  ? 92   LEU A C     1 
ATOM   3707  O  O     . LEU E 3 92  ? 49.294 44.404  89.107  1.00 38.79  ? 92   LEU A O     1 
ATOM   3708  C  CB    . LEU E 3 92  ? 47.562 41.749  89.764  1.00 26.33  ? 92   LEU A CB    1 
ATOM   3709  C  CG    . LEU E 3 92  ? 48.615 40.667  89.527  1.00 30.06  ? 92   LEU A CG    1 
ATOM   3710  C  CD1   . LEU E 3 92  ? 48.148 39.780  88.389  1.00 20.31  ? 92   LEU A CD1   1 
ATOM   3711  C  CD2   . LEU E 3 92  ? 49.965 41.284  89.194  1.00 19.10  ? 92   LEU A CD2   1 
ATOM   3712  N  N     . GLY E 3 93  ? 47.094 44.748  89.245  1.00 38.48  ? 93   GLY A N     1 
ATOM   3713  C  CA    . GLY E 3 93  ? 47.130 45.837  88.296  1.00 40.25  ? 93   GLY A CA    1 
ATOM   3714  C  C     . GLY E 3 93  ? 47.883 47.055  88.758  1.00 39.48  ? 93   GLY A C     1 
ATOM   3715  O  O     . GLY E 3 93  ? 48.585 47.669  87.958  1.00 45.96  ? 93   GLY A O     1 
ATOM   3716  N  N     . GLN E 3 94  ? 47.735 47.423  90.025  1.00 36.97  ? 94   GLN A N     1 
ATOM   3717  C  CA    . GLN E 3 94  ? 48.428 48.594  90.539  1.00 37.22  ? 94   GLN A CA    1 
ATOM   3718  C  C     . GLN E 3 94  ? 49.933 48.316  90.623  1.00 38.29  ? 94   GLN A C     1 
ATOM   3719  O  O     . GLN E 3 94  ? 50.754 49.165  90.295  1.00 38.56  ? 94   GLN A O     1 
ATOM   3720  C  CB    . GLN E 3 94  ? 47.873 48.977  91.905  1.00 38.46  ? 94   GLN A CB    1 
ATOM   3721  C  CG    . GLN E 3 94  ? 46.408 49.380  91.903  1.00 41.83  ? 94   GLN A CG    1 
ATOM   3722  C  CD    . GLN E 3 94  ? 46.130 50.617  91.072  1.00 45.85  ? 94   GLN A CD    1 
ATOM   3723  O  OE1   . GLN E 3 94  ? 46.105 50.570  89.840  1.00 49.00  ? 94   GLN A OE1   1 
ATOM   3724  N  NE2   . GLN E 3 94  ? 45.925 51.738  91.746  1.00 47.67  ? 94   GLN A NE2   1 
ATOM   3725  N  N     . LEU E 3 95  ? 50.295 47.124  91.070  1.00 35.92  ? 95   LEU A N     1 
ATOM   3726  C  CA    . LEU E 3 95  ? 51.695 46.745  91.136  1.00 33.57  ? 95   LEU A CA    1 
ATOM   3727  C  C     . LEU E 3 95  ? 52.268 46.828  89.728  1.00 36.21  ? 95   LEU A C     1 
ATOM   3728  O  O     . LEU E 3 95  ? 53.398 47.243  89.541  1.00 38.86  ? 95   LEU A O     1 
ATOM   3729  C  CB    . LEU E 3 95  ? 51.817 45.319  91.641  1.00 19.98  ? 95   LEU A CB    1 
ATOM   3730  C  CG    . LEU E 3 95  ? 52.446 45.078  92.993  1.00 26.47  ? 95   LEU A CG    1 
ATOM   3731  C  CD1   . LEU E 3 95  ? 52.403 46.327  93.826  1.00 21.72  ? 95   LEU A CD1   1 
ATOM   3732  C  CD2   . LEU E 3 95  ? 51.700 43.950  93.666  1.00 15.22  ? 95   LEU A CD2   1 
ATOM   3733  N  N     . ASN E 3 96  ? 51.488 46.414  88.737  1.00 37.55  ? 96   ASN A N     1 
ATOM   3734  C  CA    . ASN E 3 96  ? 51.945 46.469  87.357  1.00 38.68  ? 96   ASN A CA    1 
ATOM   3735  C  C     . ASN E 3 96  ? 52.104 47.901  86.875  1.00 41.27  ? 96   ASN A C     1 
ATOM   3736  O  O     . ASN E 3 96  ? 53.049 48.210  86.164  1.00 41.07  ? 96   ASN A O     1 
ATOM   3737  C  CB    . ASN E 3 96  ? 50.995 45.712  86.423  1.00 44.66  ? 96   ASN A CB    1 
ATOM   3738  C  CG    . ASN E 3 96  ? 51.334 44.247  86.318  1.00 44.47  ? 96   ASN A CG    1 
ATOM   3739  O  OD1   . ASN E 3 96  ? 52.479 43.873  86.459  1.00 46.73  ? 96   ASN A OD1   1 
ATOM   3740  N  ND2   . ASN E 3 96  ? 50.345 43.417  86.047  1.00 40.81  ? 96   ASN A ND2   1 
ATOM   3741  N  N     . MET E 3 97  ? 51.179 48.778  87.238  1.00 44.19  ? 97   MET A N     1 
ATOM   3742  C  CA    . MET E 3 97  ? 51.325 50.166  86.835  1.00 47.36  ? 97   MET A CA    1 
ATOM   3743  C  C     . MET E 3 97  ? 52.639 50.671  87.421  1.00 48.79  ? 97   MET A C     1 
ATOM   3744  O  O     . MET E 3 97  ? 53.595 50.950  86.708  1.00 50.71  ? 97   MET A O     1 
ATOM   3745  C  CB    . MET E 3 97  ? 50.188 51.036  87.375  1.00 41.95  ? 97   MET A CB    1 
ATOM   3746  C  CG    . MET E 3 97  ? 50.427 52.521  87.105  1.00 47.25  ? 97   MET A CG    1 
ATOM   3747  S  SD    . MET E 3 97  ? 48.999 53.597  87.407  1.00 58.99  ? 97   MET A SD    1 
ATOM   3748  C  CE    . MET E 3 97  ? 49.800 55.085  88.181  1.00 56.46  ? 97   MET A CE    1 
ATOM   3749  N  N     . LEU E 3 98  ? 52.666 50.767  88.741  1.00 45.53  ? 98   LEU A N     1 
ATOM   3750  C  CA    . LEU E 3 98  ? 53.821 51.229  89.483  1.00 42.77  ? 98   LEU A CA    1 
ATOM   3751  C  C     . LEU E 3 98  ? 55.147 50.810  88.864  1.00 47.07  ? 98   LEU A C     1 
ATOM   3752  O  O     . LEU E 3 98  ? 56.117 51.548  88.928  1.00 47.92  ? 98   LEU A O     1 
ATOM   3753  C  CB    . LEU E 3 98  ? 53.726 50.721  90.920  1.00 31.53  ? 98   LEU A CB    1 
ATOM   3754  C  CG    . LEU E 3 98  ? 54.447 51.485  92.037  1.00 25.48  ? 98   LEU A CG    1 
ATOM   3755  C  CD1   . LEU E 3 98  ? 55.666 50.697  92.435  1.00 17.28  ? 98   LEU A CD1   1 
ATOM   3756  C  CD2   . LEU E 3 98  ? 54.795 52.927  91.591  1.00 6.56   ? 98   LEU A CD2   1 
ATOM   3757  N  N     . HIS E 3 99  ? 55.200 49.632  88.263  1.00 47.44  ? 99   HIS A N     1 
ATOM   3758  C  CA    . HIS E 3 99  ? 56.436 49.192  87.634  1.00 45.49  ? 99   HIS A CA    1 
ATOM   3759  C  C     . HIS E 3 99  ? 56.621 49.761  86.241  1.00 48.36  ? 99   HIS A C     1 
ATOM   3760  O  O     . HIS E 3 99  ? 57.539 50.538  86.015  1.00 48.26  ? 99   HIS A O     1 
ATOM   3761  C  CB    . HIS E 3 99  ? 56.499 47.672  87.598  1.00 35.40  ? 99   HIS A CB    1 
ATOM   3762  C  CG    . HIS E 3 99  ? 56.920 47.077  88.899  1.00 32.61  ? 99   HIS A CG    1 
ATOM   3763  N  ND1   . HIS E 3 99  ? 56.330 47.424  90.094  1.00 39.42  ? 99   HIS A ND1   1 
ATOM   3764  C  CD2   . HIS E 3 99  ? 57.922 46.223  89.207  1.00 30.73  ? 99   HIS A CD2   1 
ATOM   3765  C  CE1   . HIS E 3 99  ? 56.955 46.813  91.085  1.00 34.50  ? 99   HIS A CE1   1 
ATOM   3766  N  NE2   . HIS E 3 99  ? 57.926 46.079  90.573  1.00 32.52  ? 99   HIS A NE2   1 
ATOM   3767  N  N     . ARG E 3 100 ? 55.754 49.372  85.310  1.00 52.39  ? 100  ARG A N     1 
ATOM   3768  C  CA    . ARG E 3 100 ? 55.819 49.868  83.935  1.00 54.47  ? 100  ARG A CA    1 
ATOM   3769  C  C     . ARG E 3 100 ? 55.881 51.396  83.917  1.00 55.18  ? 100  ARG A C     1 
ATOM   3770  O  O     . ARG E 3 100 ? 56.655 51.995  83.174  1.00 57.83  ? 100  ARG A O     1 
ATOM   3771  C  CB    . ARG E 3 100 ? 54.593 49.375  83.149  1.00 57.11  ? 100  ARG A CB    1 
ATOM   3772  C  CG    . ARG E 3 100 ? 54.336 50.015  81.775  1.00 64.19  ? 100  ARG A CG    1 
ATOM   3773  C  CD    . ARG E 3 100 ? 53.716 51.413  81.915  1.00 75.56  ? 100  ARG A CD    1 
ATOM   3774  N  NE    . ARG E 3 100 ? 52.925 51.823  80.754  1.00 95.66  ? 100  ARG A NE    1 
ATOM   3775  C  CZ    . ARG E 3 100 ? 51.597 51.745  80.684  1.00 104.13 ? 100  ARG A CZ    1 
ATOM   3776  N  NH1   . ARG E 3 100 ? 50.890 51.273  81.709  1.00 101.98 ? 100  ARG A NH1   1 
ATOM   3777  N  NH2   . ARG E 3 100 ? 50.971 52.139  79.583  1.00 103.41 ? 100  ARG A NH2   1 
ATOM   3778  N  N     . ARG E 3 101 ? 55.069 52.025  84.748  1.00 53.19  ? 101  ARG A N     1 
ATOM   3779  C  CA    . ARG E 3 101 ? 55.033 53.470  84.807  1.00 51.65  ? 101  ARG A CA    1 
ATOM   3780  C  C     . ARG E 3 101 ? 56.292 54.019  85.478  1.00 54.19  ? 101  ARG A C     1 
ATOM   3781  O  O     . ARG E 3 101 ? 56.315 55.152  85.959  1.00 56.13  ? 101  ARG A O     1 
ATOM   3782  C  CB    . ARG E 3 101 ? 53.773 53.904  85.560  1.00 50.10  ? 101  ARG A CB    1 
ATOM   3783  C  CG    . ARG E 3 101 ? 53.207 55.225  85.115  1.00 45.84  ? 101  ARG A CG    1 
ATOM   3784  C  CD    . ARG E 3 101 ? 53.193 55.339  83.599  1.00 43.00  ? 101  ARG A CD    1 
ATOM   3785  N  NE    . ARG E 3 101 ? 51.860 55.243  83.018  1.00 53.35  ? 101  ARG A NE    1 
ATOM   3786  C  CZ    . ARG E 3 101 ? 51.549 55.753  81.829  1.00 58.56  ? 101  ARG A CZ    1 
ATOM   3787  N  NH1   . ARG E 3 101 ? 52.478 56.388  81.118  1.00 56.17  ? 101  ARG A NH1   1 
ATOM   3788  N  NH2   . ARG E 3 101 ? 50.317 55.634  81.346  1.00 54.09  ? 101  ARG A NH2   1 
ATOM   3789  N  N     . SER E 3 102 ? 57.339 53.204  85.519  1.00 55.08  ? 102  SER A N     1 
ATOM   3790  C  CA    . SER E 3 102 ? 58.608 53.618  86.111  1.00 54.55  ? 102  SER A CA    1 
ATOM   3791  C  C     . SER E 3 102 ? 59.781 52.919  85.413  1.00 54.56  ? 102  SER A C     1 
ATOM   3792  O  O     . SER E 3 102 ? 60.909 52.925  85.901  1.00 54.55  ? 102  SER A O     1 
ATOM   3793  C  CB    . SER E 3 102 ? 58.634 53.328  87.613  1.00 46.64  ? 102  SER A CB    1 
ATOM   3794  O  OG    . SER E 3 102 ? 59.328 52.130  87.905  1.00 45.61  ? 102  SER A OG    1 
ATOM   3795  N  N     . GLY E 3 103 ? 59.490 52.297  84.277  1.00 53.47  ? 103  GLY A N     1 
ATOM   3796  C  CA    . GLY E 3 103 ? 60.521 51.657  83.489  1.00 51.49  ? 103  GLY A CA    1 
ATOM   3797  C  C     . GLY E 3 103 ? 60.996 50.240  83.733  1.00 51.85  ? 103  GLY A C     1 
ATOM   3798  O  O     . GLY E 3 103 ? 61.951 49.829  83.077  1.00 51.92  ? 103  GLY A O     1 
ATOM   3799  N  N     . LEU E 3 104 ? 60.381 49.484  84.638  1.00 53.51  ? 104  LEU A N     1 
ATOM   3800  C  CA    . LEU E 3 104 ? 60.830 48.116  84.889  1.00 54.94  ? 104  LEU A CA    1 
ATOM   3801  C  C     . LEU E 3 104 ? 59.876 47.063  84.332  1.00 59.70  ? 104  LEU A C     1 
ATOM   3802  O  O     . LEU E 3 104 ? 58.746 47.361  83.912  1.00 60.66  ? 104  LEU A O     1 
ATOM   3803  C  CB    . LEU E 3 104 ? 60.995 47.898  86.397  1.00 42.49  ? 104  LEU A CB    1 
ATOM   3804  C  CG    . LEU E 3 104 ? 61.850 48.962  87.089  1.00 49.86  ? 104  LEU A CG    1 
ATOM   3805  C  CD1   . LEU E 3 104 ? 61.648 48.942  88.593  1.00 37.08  ? 104  LEU A CD1   1 
ATOM   3806  C  CD2   . LEU E 3 104 ? 63.315 48.743  86.720  1.00 51.77  ? 104  LEU A CD2   1 
ATOM   3807  N  N     . PRO E 3 105 ? 60.334 45.806  84.279  1.00 62.38  ? 105  PRO A N     1 
ATOM   3808  C  CA    . PRO E 3 105 ? 59.417 44.784  83.763  1.00 63.77  ? 105  PRO A CA    1 
ATOM   3809  C  C     . PRO E 3 105 ? 58.352 44.561  84.853  1.00 66.10  ? 105  PRO A C     1 
ATOM   3810  O  O     . PRO E 3 105 ? 58.672 44.522  86.042  1.00 68.47  ? 105  PRO A O     1 
ATOM   3811  C  CB    . PRO E 3 105 ? 60.325 43.555  83.560  1.00 62.74  ? 105  PRO A CB    1 
ATOM   3812  C  CG    . PRO E 3 105 ? 61.743 44.128  83.542  1.00 62.36  ? 105  PRO A CG    1 
ATOM   3813  C  CD    . PRO E 3 105 ? 61.673 45.247  84.539  1.00 63.31  ? 105  PRO A CD    1 
ATOM   3814  N  N     . ARG E 3 106 ? 57.098 44.437  84.447  1.00 64.44  ? 106  ARG A N     1 
ATOM   3815  C  CA    . ARG E 3 106 ? 56.003 44.246  85.374  1.00 62.50  ? 106  ARG A CA    1 
ATOM   3816  C  C     . ARG E 3 106 ? 55.794 42.789  85.767  1.00 67.06  ? 106  ARG A C     1 
ATOM   3817  O  O     . ARG E 3 106 ? 56.162 41.868  85.040  1.00 71.37  ? 106  ARG A O     1 
ATOM   3818  C  CB    . ARG E 3 106 ? 54.724 44.795  84.733  1.00 54.41  ? 106  ARG A CB    1 
ATOM   3819  C  CG    . ARG E 3 106 ? 54.906 45.142  83.256  1.00 51.08  ? 106  ARG A CG    1 
ATOM   3820  C  CD    . ARG E 3 106 ? 53.598 45.501  82.596  1.00 57.04  ? 106  ARG A CD    1 
ATOM   3821  N  NE    . ARG E 3 106 ? 52.844 44.296  82.281  1.00 63.51  ? 106  ARG A NE    1 
ATOM   3822  C  CZ    . ARG E 3 106 ? 51.536 44.273  82.051  1.00 64.05  ? 106  ARG A CZ    1 
ATOM   3823  N  NH1   . ARG E 3 106 ? 50.838 45.407  82.104  1.00 59.80  ? 106  ARG A NH1   1 
ATOM   3824  N  NH2   . ARG E 3 106 ? 50.931 43.118  81.771  1.00 55.32  ? 106  ARG A NH2   1 
ATOM   3825  N  N     . PRO E 3 107 ? 55.238 42.554  86.963  1.00 66.91  ? 107  PRO A N     1 
ATOM   3826  C  CA    . PRO E 3 107 ? 55.023 41.146  87.308  1.00 67.35  ? 107  PRO A CA    1 
ATOM   3827  C  C     . PRO E 3 107 ? 53.891 40.802  86.352  1.00 66.86  ? 107  PRO A C     1 
ATOM   3828  O  O     . PRO E 3 107 ? 53.334 41.705  85.747  1.00 62.98  ? 107  PRO A O     1 
ATOM   3829  C  CB    . PRO E 3 107 ? 54.547 41.198  88.761  1.00 50.61  ? 107  PRO A CB    1 
ATOM   3830  C  CG    . PRO E 3 107 ? 54.808 42.641  89.211  1.00 46.57  ? 107  PRO A CG    1 
ATOM   3831  C  CD    . PRO E 3 107 ? 54.686 43.457  87.985  1.00 33.88  ? 107  PRO A CD    1 
ATOM   3832  N  N     . SER E 3 108 ? 53.540 39.535  86.194  1.00 60.82  ? 108  SER A N     1 
ATOM   3833  C  CA    . SER E 3 108 ? 52.469 39.156  85.248  1.00 57.89  ? 108  SER A CA    1 
ATOM   3834  C  C     . SER E 3 108 ? 53.008 39.291  83.822  1.00 60.09  ? 108  SER A C     1 
ATOM   3835  O  O     . SER E 3 108 ? 52.365 38.890  82.861  1.00 60.86  ? 108  SER A O     1 
ATOM   3836  C  CB    . SER E 3 108 ? 51.209 40.029  85.419  1.00 45.18  ? 108  SER A CB    1 
ATOM   3837  O  OG    . SER E 3 108 ? 51.334 41.278  84.769  1.00 42.18  ? 108  SER A OG    1 
ATOM   3838  N  N     . ASP E 3 109 ? 54.196 39.868  83.701  1.00 62.09  ? 109  ASP A N     1 
ATOM   3839  C  CA    . ASP E 3 109 ? 54.851 40.007  82.410  1.00 61.47  ? 109  ASP A CA    1 
ATOM   3840  C  C     . ASP E 3 109 ? 55.840 38.863  82.489  1.00 61.28  ? 109  ASP A C     1 
ATOM   3841  O  O     . ASP E 3 109 ? 56.726 38.705  81.658  1.00 63.52  ? 109  ASP A O     1 
ATOM   3842  C  CB    . ASP E 3 109 ? 55.582 41.353  82.319  1.00 65.17  ? 109  ASP A CB    1 
ATOM   3843  C  CG    . ASP E 3 109 ? 55.212 42.159  81.069  1.00 73.57  ? 109  ASP A CG    1 
ATOM   3844  O  OD1   . ASP E 3 109 ? 54.006 42.329  80.764  1.00 72.12  ? 109  ASP A OD1   1 
ATOM   3845  O  OD2   . ASP E 3 109 ? 56.145 42.642  80.395  1.00 71.40  ? 109  ASP A OD2   1 
ATOM   3846  N  N     . SER E 3 110 ? 55.658 38.067  83.533  1.00 59.46  ? 110  SER A N     1 
ATOM   3847  C  CA    . SER E 3 110 ? 56.491 36.911  83.797  1.00 58.91  ? 110  SER A CA    1 
ATOM   3848  C  C     . SER E 3 110 ? 55.622 35.652  83.896  1.00 55.87  ? 110  SER A C     1 
ATOM   3849  O  O     . SER E 3 110 ? 54.452 35.707  84.265  1.00 53.64  ? 110  SER A O     1 
ATOM   3850  C  CB    . SER E 3 110 ? 57.259 37.127  85.092  1.00 63.28  ? 110  SER A CB    1 
ATOM   3851  O  OG    . SER E 3 110 ? 56.353 37.369  86.145  1.00 78.10  ? 110  SER A OG    1 
ATOM   3852  N  N     . ASN E 3 111 ? 56.218 34.514  83.573  1.00 53.18  ? 111  ASN A N     1 
ATOM   3853  C  CA    . ASN E 3 111 ? 55.516 33.243  83.572  1.00 51.37  ? 111  ASN A CA    1 
ATOM   3854  C  C     . ASN E 3 111 ? 54.855 32.852  84.889  1.00 50.04  ? 111  ASN A C     1 
ATOM   3855  O  O     . ASN E 3 111 ? 53.692 32.474  84.908  1.00 46.63  ? 111  ASN A O     1 
ATOM   3856  C  CB    . ASN E 3 111 ? 56.486 32.147  83.120  1.00 52.23  ? 111  ASN A CB    1 
ATOM   3857  C  CG    . ASN E 3 111 ? 55.791 31.010  82.413  1.00 52.23  ? 111  ASN A CG    1 
ATOM   3858  O  OD1   . ASN E 3 111 ? 54.822 31.222  81.675  1.00 43.88  ? 111  ASN A OD1   1 
ATOM   3859  N  ND2   . ASN E 3 111 ? 56.290 29.794  82.616  1.00 56.51  ? 111  ASN A ND2   1 
ATOM   3860  N  N     . ALA E 3 112 ? 55.586 32.942  85.990  1.00 49.20  ? 112  ALA A N     1 
ATOM   3861  C  CA    . ALA E 3 112 ? 55.030 32.564  87.283  1.00 48.23  ? 112  ALA A CA    1 
ATOM   3862  C  C     . ALA E 3 112 ? 53.764 33.328  87.668  1.00 47.51  ? 112  ALA A C     1 
ATOM   3863  O  O     . ALA E 3 112 ? 52.723 32.723  87.906  1.00 46.17  ? 112  ALA A O     1 
ATOM   3864  C  CB    . ALA E 3 112 ? 56.088 32.726  88.378  1.00 43.88  ? 112  ALA A CB    1 
ATOM   3865  N  N     . VAL E 3 113 ? 53.842 34.651  87.724  1.00 43.78  ? 113  VAL A N     1 
ATOM   3866  C  CA    . VAL E 3 113 ? 52.686 35.435  88.114  1.00 40.80  ? 113  VAL A CA    1 
ATOM   3867  C  C     . VAL E 3 113 ? 51.503 35.306  87.182  1.00 42.26  ? 113  VAL A C     1 
ATOM   3868  O  O     . VAL E 3 113 ? 50.368 35.465  87.607  1.00 42.90  ? 113  VAL A O     1 
ATOM   3869  C  CB    . VAL E 3 113 ? 53.047 36.904  88.247  1.00 27.51  ? 113  VAL A CB    1 
ATOM   3870  C  CG1   . VAL E 3 113 ? 51.802 37.722  88.539  1.00 23.96  ? 113  VAL A CG1   1 
ATOM   3871  C  CG2   . VAL E 3 113 ? 54.049 37.079  89.366  1.00 23.04  ? 113  VAL A CG2   1 
ATOM   3872  N  N     . SER E 3 114 ? 51.756 35.021  85.914  1.00 43.14  ? 114  SER A N     1 
ATOM   3873  C  CA    . SER E 3 114 ? 50.665 34.869  84.966  1.00 45.76  ? 114  SER A CA    1 
ATOM   3874  C  C     . SER E 3 114 ? 49.883 33.569  85.157  1.00 44.83  ? 114  SER A C     1 
ATOM   3875  O  O     . SER E 3 114 ? 48.696 33.527  84.873  1.00 46.43  ? 114  SER A O     1 
ATOM   3876  C  CB    . SER E 3 114 ? 51.185 34.947  83.526  1.00 51.81  ? 114  SER A CB    1 
ATOM   3877  O  OG    . SER E 3 114 ? 51.021 36.249  82.969  1.00 53.33  ? 114  SER A OG    1 
ATOM   3878  N  N     . LEU E 3 115 ? 50.537 32.514  85.633  1.00 43.06  ? 115  LEU A N     1 
ATOM   3879  C  CA    . LEU E 3 115 ? 49.865 31.235  85.849  1.00 39.55  ? 115  LEU A CA    1 
ATOM   3880  C  C     . LEU E 3 115 ? 49.106 31.156  87.167  1.00 40.58  ? 115  LEU A C     1 
ATOM   3881  O  O     . LEU E 3 115 ? 48.096 30.488  87.259  1.00 39.81  ? 115  LEU A O     1 
ATOM   3882  C  CB    . LEU E 3 115 ? 50.867 30.092  85.797  1.00 30.21  ? 115  LEU A CB    1 
ATOM   3883  C  CG    . LEU E 3 115 ? 51.444 29.716  84.439  1.00 24.47  ? 115  LEU A CG    1 
ATOM   3884  C  CD1   . LEU E 3 115 ? 52.595 28.761  84.628  1.00 30.13  ? 115  LEU A CD1   1 
ATOM   3885  C  CD2   . LEU E 3 115 ? 50.389 29.081  83.583  1.00 23.27  ? 115  LEU A CD2   1 
ATOM   3886  N  N     . VAL E 3 116 ? 49.600 31.824  88.196  1.00 41.99  ? 116  VAL A N     1 
ATOM   3887  C  CA    . VAL E 3 116 ? 48.932 31.808  89.495  1.00 42.37  ? 116  VAL A CA    1 
ATOM   3888  C  C     . VAL E 3 116 ? 47.639 32.584  89.396  1.00 44.14  ? 116  VAL A C     1 
ATOM   3889  O  O     . VAL E 3 116 ? 46.616 32.205  89.959  1.00 44.51  ? 116  VAL A O     1 
ATOM   3890  C  CB    . VAL E 3 116 ? 49.744 32.515  90.562  1.00 36.36  ? 116  VAL A CB    1 
ATOM   3891  C  CG1   . VAL E 3 116 ? 49.482 31.877  91.901  1.00 25.61  ? 116  VAL A CG1   1 
ATOM   3892  C  CG2   . VAL E 3 116 ? 51.191 32.490  90.195  1.00 51.57  ? 116  VAL A CG2   1 
ATOM   3893  N  N     . MET E 3 117 ? 47.716 33.708  88.700  1.00 42.76  ? 117  MET A N     1 
ATOM   3894  C  CA    . MET E 3 117 ? 46.571 34.569  88.513  1.00 42.62  ? 117  MET A CA    1 
ATOM   3895  C  C     . MET E 3 117 ? 45.495 33.736  87.829  1.00 44.62  ? 117  MET A C     1 
ATOM   3896  O  O     . MET E 3 117 ? 44.330 33.765  88.221  1.00 45.64  ? 117  MET A O     1 
ATOM   3897  C  CB    . MET E 3 117 ? 46.983 35.762  87.653  1.00 41.75  ? 117  MET A CB    1 
ATOM   3898  C  CG    . MET E 3 117 ? 46.187 37.007  87.921  1.00 36.69  ? 117  MET A CG    1 
ATOM   3899  S  SD    . MET E 3 117 ? 45.884 37.134  89.669  1.00 40.88  ? 117  MET A SD    1 
ATOM   3900  C  CE    . MET E 3 117 ? 44.030 36.957  89.691  1.00 23.04  ? 117  MET A CE    1 
ATOM   3901  N  N     . ARG E 3 118 ? 45.904 32.974  86.818  1.00 45.53  ? 118  ARG A N     1 
ATOM   3902  C  CA    . ARG E 3 118 ? 44.997 32.107  86.077  1.00 43.14  ? 118  ARG A CA    1 
ATOM   3903  C  C     . ARG E 3 118 ? 44.469 31.009  87.006  1.00 42.08  ? 118  ARG A C     1 
ATOM   3904  O  O     . ARG E 3 118 ? 43.264 30.800  87.111  1.00 44.01  ? 118  ARG A O     1 
ATOM   3905  C  CB    . ARG E 3 118 ? 45.742 31.511  84.888  1.00 44.36  ? 118  ARG A CB    1 
ATOM   3906  C  CG    . ARG E 3 118 ? 44.949 30.569  84.022  1.00 46.54  ? 118  ARG A CG    1 
ATOM   3907  C  CD    . ARG E 3 118 ? 45.618 30.428  82.656  1.00 45.25  ? 118  ARG A CD    1 
ATOM   3908  N  NE    . ARG E 3 118 ? 45.097 29.307  81.873  1.00 49.65  ? 118  ARG A NE    1 
ATOM   3909  C  CZ    . ARG E 3 118 ? 45.375 29.105  80.588  1.00 54.40  ? 118  ARG A CZ    1 
ATOM   3910  N  NH1   . ARG E 3 118 ? 46.163 29.952  79.940  1.00 57.26  ? 118  ARG A NH1   1 
ATOM   3911  N  NH2   . ARG E 3 118 ? 44.880 28.051  79.955  1.00 53.33  ? 118  ARG A NH2   1 
ATOM   3912  N  N     . ARG E 3 119 ? 45.370 30.317  87.693  1.00 40.73  ? 119  ARG A N     1 
ATOM   3913  C  CA    . ARG E 3 119 ? 44.974 29.270  88.622  1.00 37.17  ? 119  ARG A CA    1 
ATOM   3914  C  C     . ARG E 3 119 ? 44.047 29.807  89.696  1.00 38.57  ? 119  ARG A C     1 
ATOM   3915  O  O     . ARG E 3 119 ? 43.101 29.144  90.087  1.00 34.87  ? 119  ARG A O     1 
ATOM   3916  C  CB    . ARG E 3 119 ? 46.188 28.683  89.311  1.00 28.06  ? 119  ARG A CB    1 
ATOM   3917  C  CG    . ARG E 3 119 ? 45.819 27.775  90.450  1.00 23.91  ? 119  ARG A CG    1 
ATOM   3918  C  CD    . ARG E 3 119 ? 46.950 27.690  91.444  1.00 39.09  ? 119  ARG A CD    1 
ATOM   3919  N  NE    . ARG E 3 119 ? 46.794 26.545  92.332  1.00 52.13  ? 119  ARG A NE    1 
ATOM   3920  C  CZ    . ARG E 3 119 ? 47.705 26.160  93.218  1.00 57.29  ? 119  ARG A CZ    1 
ATOM   3921  N  NH1   . ARG E 3 119 ? 48.841 26.841  93.340  1.00 57.10  ? 119  ARG A NH1   1 
ATOM   3922  N  NH2   . ARG E 3 119 ? 47.497 25.073  93.953  1.00 63.10  ? 119  ARG A NH2   1 
ATOM   3923  N  N     . ILE E 3 120 ? 44.339 31.004  90.193  1.00 42.17  ? 120  ILE A N     1 
ATOM   3924  C  CA    . ILE E 3 120 ? 43.517 31.619  91.229  1.00 42.31  ? 120  ILE A CA    1 
ATOM   3925  C  C     . ILE E 3 120 ? 42.141 31.965  90.710  1.00 41.76  ? 120  ILE A C     1 
ATOM   3926  O  O     . ILE E 3 120 ? 41.153 31.769  91.406  1.00 37.41  ? 120  ILE A O     1 
ATOM   3927  C  CB    . ILE E 3 120 ? 44.129 32.918  91.777  1.00 36.64  ? 120  ILE A CB    1 
ATOM   3928  C  CG1   . ILE E 3 120 ? 45.452 32.620  92.471  1.00 34.41  ? 120  ILE A CG1   1 
ATOM   3929  C  CG2   . ILE E 3 120 ? 43.177 33.549  92.783  1.00 29.84  ? 120  ILE A CG2   1 
ATOM   3930  C  CD1   . ILE E 3 120 ? 46.166 33.852  92.986  1.00 27.14  ? 120  ILE A CD1   1 
ATOM   3931  N  N     . ARG E 3 121 ? 42.067 32.487  89.492  1.00 40.85  ? 121  ARG A N     1 
ATOM   3932  C  CA    . ARG E 3 121 ? 40.765 32.848  88.954  1.00 45.08  ? 121  ARG A CA    1 
ATOM   3933  C  C     . ARG E 3 121 ? 39.881 31.629  88.795  1.00 47.52  ? 121  ARG A C     1 
ATOM   3934  O  O     . ARG E 3 121 ? 38.675 31.699  89.049  1.00 47.36  ? 121  ARG A O     1 
ATOM   3935  C  CB    . ARG E 3 121 ? 40.875 33.571  87.612  1.00 44.39  ? 121  ARG A CB    1 
ATOM   3936  C  CG    . ARG E 3 121 ? 39.508 33.877  87.037  1.00 46.60  ? 121  ARG A CG    1 
ATOM   3937  C  CD    . ARG E 3 121 ? 39.511 35.044  86.050  1.00 56.51  ? 121  ARG A CD    1 
ATOM   3938  N  NE    . ARG E 3 121 ? 40.515 34.940  84.988  1.00 73.39  ? 121  ARG A NE    1 
ATOM   3939  C  CZ    . ARG E 3 121 ? 40.749 33.855  84.249  1.00 80.02  ? 121  ARG A CZ    1 
ATOM   3940  N  NH1   . ARG E 3 121 ? 40.059 32.735  84.441  1.00 77.60  ? 121  ARG A NH1   1 
ATOM   3941  N  NH2   . ARG E 3 121 ? 41.674 33.896  83.295  1.00 78.97  ? 121  ARG A NH2   1 
ATOM   3942  N  N     . LYS E 3 122 ? 40.479 30.510  88.386  1.00 48.75  ? 122  LYS A N     1 
ATOM   3943  C  CA    . LYS E 3 122 ? 39.725 29.278  88.201  1.00 44.24  ? 122  LYS A CA    1 
ATOM   3944  C  C     . LYS E 3 122 ? 39.306 28.735  89.544  1.00 42.05  ? 122  LYS A C     1 
ATOM   3945  O  O     . LYS E 3 122 ? 38.133 28.753  89.878  1.00 38.79  ? 122  LYS A O     1 
ATOM   3946  C  CB    . LYS E 3 122 ? 40.562 28.240  87.466  1.00 37.87  ? 122  LYS A CB    1 
ATOM   3947  C  CG    . LYS E 3 122 ? 39.743 27.094  86.918  1.00 45.77  ? 122  LYS A CG    1 
ATOM   3948  C  CD    . LYS E 3 122 ? 40.537 26.260  85.932  1.00 47.91  ? 122  LYS A CD    1 
ATOM   3949  C  CE    . LYS E 3 122 ? 41.484 25.319  86.643  1.00 53.28  ? 122  LYS A CE    1 
ATOM   3950  N  NZ    . LYS E 3 122 ? 40.730 24.260  87.354  1.00 52.01  ? 122  LYS A NZ    1 
ATOM   3951  N  N     . GLU E 3 123 ? 40.275 28.273  90.321  1.00 47.36  ? 123  GLU A N     1 
ATOM   3952  C  CA    . GLU E 3 123 ? 39.989 27.720  91.639  1.00 51.55  ? 123  GLU A CA    1 
ATOM   3953  C  C     . GLU E 3 123 ? 38.889 28.515  92.316  1.00 49.91  ? 123  GLU A C     1 
ATOM   3954  O  O     . GLU E 3 123 ? 38.028 27.948  92.978  1.00 49.60  ? 123  GLU A O     1 
ATOM   3955  C  CB    . GLU E 3 123 ? 41.241 27.726  92.538  1.00 55.26  ? 123  GLU A CB    1 
ATOM   3956  C  CG    . GLU E 3 123 ? 42.460 26.967  91.993  1.00 61.28  ? 123  GLU A CG    1 
ATOM   3957  C  CD    . GLU E 3 123 ? 43.581 26.801  93.029  1.00 72.96  ? 123  GLU A CD    1 
ATOM   3958  O  OE1   . GLU E 3 123 ? 43.977 27.804  93.672  1.00 76.51  ? 123  GLU A OE1   1 
ATOM   3959  O  OE2   . GLU E 3 123 ? 44.073 25.660  93.195  1.00 73.77  ? 123  GLU A OE2   1 
ATOM   3960  N  N     . ASN E 3 124 ? 38.911 29.830  92.136  1.00 52.99  ? 124  ASN A N     1 
ATOM   3961  C  CA    . ASN E 3 124 ? 37.912 30.695  92.761  1.00 53.58  ? 124  ASN A CA    1 
ATOM   3962  C  C     . ASN E 3 124 ? 36.524 30.627  92.143  1.00 55.08  ? 124  ASN A C     1 
ATOM   3963  O  O     . ASN E 3 124 ? 35.526 30.597  92.866  1.00 52.32  ? 124  ASN A O     1 
ATOM   3964  C  CB    . ASN E 3 124 ? 38.392 32.142  92.771  1.00 44.79  ? 124  ASN A CB    1 
ATOM   3965  C  CG    . ASN E 3 124 ? 38.926 32.547  94.108  1.00 44.32  ? 124  ASN A CG    1 
ATOM   3966  O  OD1   . ASN E 3 124 ? 39.701 31.814  94.716  1.00 34.19  ? 124  ASN A OD1   1 
ATOM   3967  N  ND2   . ASN E 3 124 ? 38.523 33.716  94.581  1.00 46.57  ? 124  ASN A ND2   1 
ATOM   3968  N  N     . VAL E 3 125 ? 36.449 30.621  90.817  1.00 56.23  ? 125  VAL A N     1 
ATOM   3969  C  CA    . VAL E 3 125 ? 35.154 30.544  90.170  1.00 56.44  ? 125  VAL A CA    1 
ATOM   3970  C  C     . VAL E 3 125 ? 34.459 29.251  90.570  1.00 60.32  ? 125  VAL A C     1 
ATOM   3971  O  O     . VAL E 3 125 ? 33.238 29.163  90.517  1.00 60.34  ? 125  VAL A O     1 
ATOM   3972  C  CB    . VAL E 3 125 ? 35.286 30.602  88.654  1.00 46.85  ? 125  VAL A CB    1 
ATOM   3973  C  CG1   . VAL E 3 125 ? 33.973 30.242  88.001  1.00 48.28  ? 125  VAL A CG1   1 
ATOM   3974  C  CG2   . VAL E 3 125 ? 35.686 31.993  88.241  1.00 46.09  ? 125  VAL A CG2   1 
ATOM   3975  N  N     . ASP E 3 126 ? 35.234 28.254  90.988  1.00 63.10  ? 126  ASP A N     1 
ATOM   3976  C  CA    . ASP E 3 126 ? 34.655 26.986  91.400  1.00 66.27  ? 126  ASP A CA    1 
ATOM   3977  C  C     . ASP E 3 126 ? 34.253 26.913  92.855  1.00 65.41  ? 126  ASP A C     1 
ATOM   3978  O  O     . ASP E 3 126 ? 33.504 26.026  93.237  1.00 68.47  ? 126  ASP A O     1 
ATOM   3979  C  CB    . ASP E 3 126 ? 35.589 25.833  91.087  1.00 75.53  ? 126  ASP A CB    1 
ATOM   3980  C  CG    . ASP E 3 126 ? 35.420 25.338  89.680  1.00 81.73  ? 126  ASP A CG    1 
ATOM   3981  O  OD1   . ASP E 3 126 ? 34.252 25.239  89.245  1.00 82.91  ? 126  ASP A OD1   1 
ATOM   3982  O  OD2   . ASP E 3 126 ? 36.439 25.044  89.014  1.00 84.46  ? 126  ASP A OD2   1 
ATOM   3983  N  N     . ALA E 3 127 ? 34.759 27.818  93.683  1.00 67.46  ? 127  ALA A N     1 
ATOM   3984  C  CA    . ALA E 3 127 ? 34.360 27.824  95.086  1.00 68.82  ? 127  ALA A CA    1 
ATOM   3985  C  C     . ALA E 3 127 ? 32.948 28.396  95.060  1.00 70.44  ? 127  ALA A C     1 
ATOM   3986  O  O     . ALA E 3 127 ? 32.254 28.447  96.077  1.00 66.42  ? 127  ALA A O     1 
ATOM   3987  C  CB    . ALA E 3 127 ? 35.269 28.721  95.895  1.00 56.52  ? 127  ALA A CB    1 
ATOM   3988  N  N     . GLY E 3 128 ? 32.541 28.826  93.868  1.00 70.46  ? 128  GLY A N     1 
ATOM   3989  C  CA    . GLY E 3 128 ? 31.227 29.401  93.684  1.00 69.26  ? 128  GLY A CA    1 
ATOM   3990  C  C     . GLY E 3 128 ? 31.207 30.864  94.066  1.00 70.05  ? 128  GLY A C     1 
ATOM   3991  O  O     . GLY E 3 128 ? 30.265 31.333  94.709  1.00 68.49  ? 128  GLY A O     1 
ATOM   3992  N  N     . GLU E 3 129 ? 32.257 31.589  93.697  1.00 70.50  ? 129  GLU A N     1 
ATOM   3993  C  CA    . GLU E 3 129 ? 32.320 33.011  93.991  1.00 64.99  ? 129  GLU A CA    1 
ATOM   3994  C  C     . GLU E 3 129 ? 31.674 33.721  92.820  1.00 60.66  ? 129  GLU A C     1 
ATOM   3995  O  O     . GLU E 3 129 ? 31.911 33.361  91.670  1.00 58.66  ? 129  GLU A O     1 
ATOM   3996  C  CB    . GLU E 3 129 ? 33.768 33.484  94.124  1.00 70.40  ? 129  GLU A CB    1 
ATOM   3997  C  CG    . GLU E 3 129 ? 33.913 35.003  93.984  1.00 80.01  ? 129  GLU A CG    1 
ATOM   3998  C  CD    . GLU E 3 129 ? 35.343 35.456  93.762  1.00 82.76  ? 129  GLU A CD    1 
ATOM   3999  O  OE1   . GLU E 3 129 ? 35.540 36.573  93.234  1.00 82.92  ? 129  GLU A OE1   1 
ATOM   4000  O  OE2   . GLU E 3 129 ? 36.271 34.703  94.122  1.00 82.81  ? 129  GLU A OE2   1 
ATOM   4001  N  N     . ARG E 3 130 ? 30.850 34.719  93.105  1.00 57.45  ? 130  ARG A N     1 
ATOM   4002  C  CA    . ARG E 3 130 ? 30.203 35.461  92.034  1.00 52.39  ? 130  ARG A CA    1 
ATOM   4003  C  C     . ARG E 3 130 ? 30.047 36.931  92.338  1.00 48.83  ? 130  ARG A C     1 
ATOM   4004  O  O     . ARG E 3 130 ? 29.888 37.322  93.484  1.00 47.46  ? 130  ARG A O     1 
ATOM   4005  C  CB    . ARG E 3 130 ? 28.840 34.848  91.699  1.00 47.92  ? 130  ARG A CB    1 
ATOM   4006  C  CG    . ARG E 3 130 ? 28.062 34.362  92.892  1.00 44.33  ? 130  ARG A CG    1 
ATOM   4007  C  CD    . ARG E 3 130 ? 26.778 33.674  92.457  1.00 48.28  ? 130  ARG A CD    1 
ATOM   4008  N  NE    . ARG E 3 130 ? 25.957 34.554  91.631  1.00 56.82  ? 130  ARG A NE    1 
ATOM   4009  C  CZ    . ARG E 3 130 ? 24.647 34.398  91.454  1.00 57.87  ? 130  ARG A CZ    1 
ATOM   4010  N  NH1   . ARG E 3 130 ? 24.012 33.390  92.052  1.00 45.59  ? 130  ARG A NH1   1 
ATOM   4011  N  NH2   . ARG E 3 130 ? 23.972 35.252  90.688  1.00 45.92  ? 130  ARG A NH2   1 
ATOM   4012  N  N     . ALA E 3 131 ? 30.109 37.741  91.291  1.00 45.52  ? 131  ALA A N     1 
ATOM   4013  C  CA    . ALA E 3 131 ? 29.974 39.180  91.425  1.00 41.25  ? 131  ALA A CA    1 
ATOM   4014  C  C     . ALA E 3 131 ? 28.611 39.530  91.967  1.00 41.26  ? 131  ALA A C     1 
ATOM   4015  O  O     . ALA E 3 131 ? 27.599 38.954  91.561  1.00 39.80  ? 131  ALA A O     1 
ATOM   4016  C  CB    . ALA E 3 131 ? 30.167 39.850  90.088  1.00 34.24  ? 131  ALA A CB    1 
ATOM   4017  N  N     . LYS E 3 132 ? 28.593 40.482  92.888  1.00 41.16  ? 132  LYS A N     1 
ATOM   4018  C  CA    . LYS E 3 132 ? 27.361 40.927  93.485  1.00 42.55  ? 132  LYS A CA    1 
ATOM   4019  C  C     . LYS E 3 132 ? 26.908 42.177  92.748  1.00 44.23  ? 132  LYS A C     1 
ATOM   4020  O  O     . LYS E 3 132 ? 27.588 42.638  91.834  1.00 39.45  ? 132  LYS A O     1 
ATOM   4021  C  CB    . LYS E 3 132 ? 27.594 41.220  94.943  1.00 44.50  ? 132  LYS A CB    1 
ATOM   4022  C  CG    . LYS E 3 132 ? 28.096 40.025  95.715  1.00 54.82  ? 132  LYS A CG    1 
ATOM   4023  C  CD    . LYS E 3 132 ? 26.960 39.307  96.411  1.00 62.92  ? 132  LYS A CD    1 
ATOM   4024  C  CE    . LYS E 3 132 ? 27.501 38.491  97.567  1.00 72.86  ? 132  LYS A CE    1 
ATOM   4025  N  NZ    . LYS E 3 132 ? 28.322 39.351  98.487  1.00 78.35  ? 132  LYS A NZ    1 
ATOM   4026  N  N     . GLN E 3 133 ? 25.762 42.724  93.143  1.00 46.05  ? 133  GLN A N     1 
ATOM   4027  C  CA    . GLN E 3 133 ? 25.215 43.901  92.481  1.00 42.67  ? 133  GLN A CA    1 
ATOM   4028  C  C     . GLN E 3 133 ? 24.149 44.602  93.311  1.00 42.20  ? 133  GLN A C     1 
ATOM   4029  O  O     . GLN E 3 133 ? 23.385 43.959  94.018  1.00 44.08  ? 133  GLN A O     1 
ATOM   4030  C  CB    . GLN E 3 133 ? 24.637 43.469  91.153  1.00 39.37  ? 133  GLN A CB    1 
ATOM   4031  C  CG    . GLN E 3 133 ? 23.662 44.421  90.546  1.00 54.15  ? 133  GLN A CG    1 
ATOM   4032  C  CD    . GLN E 3 133 ? 22.574 43.670  89.807  1.00 60.22  ? 133  GLN A CD    1 
ATOM   4033  O  OE1   . GLN E 3 133 ? 21.430 43.564  90.286  1.00 64.06  ? 133  GLN A OE1   1 
ATOM   4034  N  NE2   . GLN E 3 133 ? 22.927 43.115  88.644  1.00 59.15  ? 133  GLN A NE2   1 
ATOM   4035  N  N     . ALA E 3 134 ? 24.102 45.924  93.203  1.00 36.55  ? 134  ALA A N     1 
ATOM   4036  C  CA    . ALA E 3 134 ? 23.159 46.763  93.941  1.00 33.74  ? 134  ALA A CA    1 
ATOM   4037  C  C     . ALA E 3 134 ? 21.766 46.189  94.074  1.00 33.46  ? 134  ALA A C     1 
ATOM   4038  O  O     . ALA E 3 134 ? 21.245 45.592  93.135  1.00 37.82  ? 134  ALA A O     1 
ATOM   4039  C  CB    . ALA E 3 134 ? 23.069 48.112  93.285  1.00 35.39  ? 134  ALA A CB    1 
ATOM   4040  N  N     . LEU E 3 135 ? 21.165 46.390  95.244  1.00 26.85  ? 135  LEU A N     1 
ATOM   4041  C  CA    . LEU E 3 135 ? 19.816 45.915  95.535  1.00 22.82  ? 135  LEU A CA    1 
ATOM   4042  C  C     . LEU E 3 135 ? 18.956 46.930  94.837  1.00 28.29  ? 135  LEU A C     1 
ATOM   4043  O  O     . LEU E 3 135 ? 19.127 48.117  95.073  1.00 31.23  ? 135  LEU A O     1 
ATOM   4044  C  CB    . LEU E 3 135 ? 19.568 45.972  97.032  1.00 26.66  ? 135  LEU A CB    1 
ATOM   4045  C  CG    . LEU E 3 135 ? 18.218 45.485  97.550  1.00 20.56  ? 135  LEU A CG    1 
ATOM   4046  C  CD1   . LEU E 3 135 ? 18.135 44.001  97.388  1.00 4.28   ? 135  LEU A CD1   1 
ATOM   4047  C  CD2   . LEU E 3 135 ? 18.071 45.825  99.024  1.00 24.92  ? 135  LEU A CD2   1 
ATOM   4048  N  N     . ALA E 3 136 ? 18.034 46.491  93.984  1.00 28.87  ? 136  ALA A N     1 
ATOM   4049  C  CA    . ALA E 3 136 ? 17.225 47.441  93.214  1.00 24.29  ? 136  ALA A CA    1 
ATOM   4050  C  C     . ALA E 3 136 ? 16.259 48.286  93.998  1.00 26.96  ? 136  ALA A C     1 
ATOM   4051  O  O     . ALA E 3 136 ? 15.716 47.860  95.009  1.00 32.48  ? 136  ALA A O     1 
ATOM   4052  C  CB    . ALA E 3 136 ? 16.481 46.731  92.113  1.00 18.87  ? 136  ALA A CB    1 
ATOM   4053  N  N     . PHE E 3 137 ? 16.063 49.501  93.509  1.00 28.06  ? 137  PHE A N     1 
ATOM   4054  C  CA    . PHE E 3 137 ? 15.154 50.465  94.100  1.00 25.01  ? 137  PHE A CA    1 
ATOM   4055  C  C     . PHE E 3 137 ? 14.245 50.792  92.931  1.00 29.73  ? 137  PHE A C     1 
ATOM   4056  O  O     . PHE E 3 137 ? 14.435 51.798  92.244  1.00 20.43  ? 137  PHE A O     1 
ATOM   4057  C  CB    . PHE E 3 137 ? 15.913 51.708  94.513  1.00 13.63  ? 137  PHE A CB    1 
ATOM   4058  C  CG    . PHE E 3 137 ? 15.072 52.719  95.205  1.00 16.81  ? 137  PHE A CG    1 
ATOM   4059  C  CD1   . PHE E 3 137 ? 14.709 52.538  96.535  1.00 16.31  ? 137  PHE A CD1   1 
ATOM   4060  C  CD2   . PHE E 3 137 ? 14.587 53.827  94.513  1.00 1.20   ? 137  PHE A CD2   1 
ATOM   4061  C  CE1   . PHE E 3 137 ? 13.866 53.442  97.176  1.00 11.06  ? 137  PHE A CE1   1 
ATOM   4062  C  CE2   . PHE E 3 137 ? 13.750 54.733  95.136  1.00 7.80   ? 137  PHE A CE2   1 
ATOM   4063  C  CZ    . PHE E 3 137 ? 13.383 54.542  96.472  1.00 14.92  ? 137  PHE A CZ    1 
ATOM   4064  N  N     . GLU E 3 138 ? 13.267 49.923  92.701  1.00 35.11  ? 138  GLU A N     1 
ATOM   4065  C  CA    . GLU E 3 138 ? 12.355 50.069  91.585  1.00 37.82  ? 138  GLU A CA    1 
ATOM   4066  C  C     . GLU E 3 138 ? 11.184 50.974  91.899  1.00 39.07  ? 138  GLU A C     1 
ATOM   4067  O  O     . GLU E 3 138 ? 11.003 51.382  93.030  1.00 40.59  ? 138  GLU A O     1 
ATOM   4068  C  CB    . GLU E 3 138 ? 11.876 48.684  91.163  1.00 38.60  ? 138  GLU A CB    1 
ATOM   4069  C  CG    . GLU E 3 138 ? 13.014 47.724  90.815  1.00 51.47  ? 138  GLU A CG    1 
ATOM   4070  C  CD    . GLU E 3 138 ? 12.549 46.284  90.661  1.00 62.81  ? 138  GLU A CD    1 
ATOM   4071  O  OE1   . GLU E 3 138 ? 13.391 45.405  90.365  1.00 72.08  ? 138  GLU A OE1   1 
ATOM   4072  O  OE2   . GLU E 3 138 ? 11.340 46.029  90.839  1.00 64.83  ? 138  GLU A OE2   1 
ATOM   4073  N  N     . ARG E 3 139 ? 10.384 51.278  90.889  1.00 41.73  ? 139  ARG A N     1 
ATOM   4074  C  CA    . ARG E 3 139 ? 9.238  52.164  91.054  1.00 42.80  ? 139  ARG A CA    1 
ATOM   4075  C  C     . ARG E 3 139 ? 8.324  51.866  92.233  1.00 43.21  ? 139  ARG A C     1 
ATOM   4076  O  O     . ARG E 3 139 ? 7.879  52.779  92.912  1.00 43.70  ? 139  ARG A O     1 
ATOM   4077  C  CB    . ARG E 3 139 ? 8.402  52.185  89.768  1.00 35.40  ? 139  ARG A CB    1 
ATOM   4078  C  CG    . ARG E 3 139 ? 7.034  52.861  89.885  1.00 26.67  ? 139  ARG A CG    1 
ATOM   4079  C  CD    . ARG E 3 139 ? 7.167  54.339  90.182  1.00 46.38  ? 139  ARG A CD    1 
ATOM   4080  N  NE    . ARG E 3 139 ? 5.884  55.037  90.106  1.00 55.32  ? 139  ARG A NE    1 
ATOM   4081  C  CZ    . ARG E 3 139 ? 5.204  55.257  88.983  1.00 58.99  ? 139  ARG A CZ    1 
ATOM   4082  N  NH1   . ARG E 3 139 ? 5.671  54.834  87.816  1.00 60.44  ? 139  ARG A NH1   1 
ATOM   4083  N  NH2   . ARG E 3 139 ? 4.061  55.916  89.031  1.00 58.23  ? 139  ARG A NH2   1 
ATOM   4084  N  N     . THR E 3 140 ? 8.032  50.603  92.484  1.00 43.74  ? 140  THR A N     1 
ATOM   4085  C  CA    . THR E 3 140 ? 7.140  50.293  93.584  1.00 44.02  ? 140  THR A CA    1 
ATOM   4086  C  C     . THR E 3 140 ? 7.740  50.658  94.931  1.00 44.63  ? 140  THR A C     1 
ATOM   4087  O  O     . THR E 3 140 ? 7.020  50.870  95.896  1.00 44.40  ? 140  THR A O     1 
ATOM   4088  C  CB    . THR E 3 140 ? 6.748  48.820  93.595  1.00 37.00  ? 140  THR A CB    1 
ATOM   4089  O  OG1   . THR E 3 140 ? 7.249  48.217  94.785  1.00 38.13  ? 140  THR A OG1   1 
ATOM   4090  C  CG2   . THR E 3 140 ? 7.353  48.101  92.405  1.00 39.45  ? 140  THR A CG2   1 
ATOM   4091  N  N     . ASP E 3 141 ? 9.055  50.735  95.015  1.00 47.59  ? 141  ASP A N     1 
ATOM   4092  C  CA    . ASP E 3 141 ? 9.681  51.102  96.281  1.00 45.16  ? 141  ASP A CA    1 
ATOM   4093  C  C     . ASP E 3 141 ? 9.614  52.606  96.483  1.00 44.37  ? 141  ASP A C     1 
ATOM   4094  O  O     . ASP E 3 141 ? 9.501  53.084  97.604  1.00 40.27  ? 141  ASP A O     1 
ATOM   4095  C  CB    . ASP E 3 141 ? 11.131 50.632  96.314  1.00 43.53  ? 141  ASP A CB    1 
ATOM   4096  C  CG    . ASP E 3 141 ? 11.256 49.170  96.674  1.00 50.02  ? 141  ASP A CG    1 
ATOM   4097  O  OD1   . ASP E 3 141 ? 10.885 48.819  97.822  1.00 56.72  ? 141  ASP A OD1   1 
ATOM   4098  O  OD2   . ASP E 3 141 ? 11.719 48.383  95.816  1.00 45.41  ? 141  ASP A OD2   1 
ATOM   4099  N  N     . PHE E 3 142 ? 9.694  53.347  95.386  1.00 43.08  ? 142  PHE A N     1 
ATOM   4100  C  CA    . PHE E 3 142 ? 9.599  54.796  95.430  1.00 42.93  ? 142  PHE A CA    1 
ATOM   4101  C  C     . PHE E 3 142 ? 8.179  55.160  95.850  1.00 45.12  ? 142  PHE A C     1 
ATOM   4102  O  O     . PHE E 3 142 ? 7.969  56.069  96.638  1.00 45.74  ? 142  PHE A O     1 
ATOM   4103  C  CB    . PHE E 3 142 ? 9.872  55.371  94.051  1.00 30.64  ? 142  PHE A CB    1 
ATOM   4104  C  CG    . PHE E 3 142 ? 9.759  56.861  93.978  1.00 32.26  ? 142  PHE A CG    1 
ATOM   4105  C  CD1   . PHE E 3 142 ? 10.504 57.673  94.829  1.00 29.65  ? 142  PHE A CD1   1 
ATOM   4106  C  CD2   . PHE E 3 142 ? 8.955  57.457  93.016  1.00 36.15  ? 142  PHE A CD2   1 
ATOM   4107  C  CE1   . PHE E 3 142 ? 10.455 59.064  94.717  1.00 30.64  ? 142  PHE A CE1   1 
ATOM   4108  C  CE2   . PHE E 3 142 ? 8.899  58.843  92.896  1.00 36.82  ? 142  PHE A CE2   1 
ATOM   4109  C  CZ    . PHE E 3 142 ? 9.653  59.647  93.749  1.00 38.52  ? 142  PHE A CZ    1 
ATOM   4110  N  N     . ASP E 3 143 ? 7.201  54.436  95.314  1.00 46.48  ? 143  ASP A N     1 
ATOM   4111  C  CA    . ASP E 3 143 ? 5.809  54.689  95.635  1.00 46.88  ? 143  ASP A CA    1 
ATOM   4112  C  C     . ASP E 3 143 ? 5.556  54.457  97.116  1.00 43.77  ? 143  ASP A C     1 
ATOM   4113  O  O     . ASP E 3 143 ? 4.889  55.253  97.761  1.00 46.78  ? 143  ASP A O     1 
ATOM   4114  C  CB    . ASP E 3 143 ? 4.894  53.793  94.790  1.00 59.05  ? 143  ASP A CB    1 
ATOM   4115  C  CG    . ASP E 3 143 ? 4.625  54.359  93.389  1.00 72.00  ? 143  ASP A CG    1 
ATOM   4116  O  OD1   . ASP E 3 143 ? 5.032  55.509  93.113  1.00 75.75  ? 143  ASP A OD1   1 
ATOM   4117  O  OD2   . ASP E 3 143 ? 3.988  53.656  92.565  1.00 75.78  ? 143  ASP A OD2   1 
ATOM   4118  N  N     . GLN E 3 144 ? 6.093  53.366  97.649  1.00 41.77  ? 144  GLN A N     1 
ATOM   4119  C  CA    . GLN E 3 144 ? 5.931  53.034  99.056  1.00 40.97  ? 144  GLN A CA    1 
ATOM   4120  C  C     . GLN E 3 144 ? 6.676  54.018  99.941  1.00 43.80  ? 144  GLN A C     1 
ATOM   4121  O  O     . GLN E 3 144 ? 6.140  54.492  100.932 1.00 44.81  ? 144  GLN A O     1 
ATOM   4122  C  CB    . GLN E 3 144 ? 6.449  51.625  99.332  1.00 40.08  ? 144  GLN A CB    1 
ATOM   4123  C  CG    . GLN E 3 144 ? 5.379  50.557  99.445  1.00 48.63  ? 144  GLN A CG    1 
ATOM   4124  C  CD    . GLN E 3 144 ? 5.858  49.173  99.002  1.00 48.45  ? 144  GLN A CD    1 
ATOM   4125  O  OE1   . GLN E 3 144 ? 6.943  48.718  99.380  1.00 52.60  ? 144  GLN A OE1   1 
ATOM   4126  N  NE2   . GLN E 3 144 ? 5.035  48.493  98.203  1.00 45.28  ? 144  GLN A NE2   1 
ATOM   4127  N  N     . VAL E 3 145 ? 7.920  54.320  99.590  1.00 46.37  ? 145  VAL A N     1 
ATOM   4128  C  CA    . VAL E 3 145 ? 8.723  55.261  100.363 1.00 40.98  ? 145  VAL A CA    1 
ATOM   4129  C  C     . VAL E 3 145 ? 8.162  56.674  100.325 1.00 42.13  ? 145  VAL A C     1 
ATOM   4130  O  O     . VAL E 3 145 ? 8.268  57.413  101.292 1.00 41.05  ? 145  VAL A O     1 
ATOM   4131  C  CB    . VAL E 3 145 ? 10.170 55.313  99.843  1.00 25.85  ? 145  VAL A CB    1 
ATOM   4132  C  CG1   . VAL E 3 145 ? 10.829 56.643  100.216 1.00 16.03  ? 145  VAL A CG1   1 
ATOM   4133  C  CG2   . VAL E 3 145 ? 10.947 54.166  100.416 1.00 22.53  ? 145  VAL A CG2   1 
ATOM   4134  N  N     . ARG E 3 146 ? 7.565  57.042  99.202  1.00 44.66  ? 146  ARG A N     1 
ATOM   4135  C  CA    . ARG E 3 146 ? 7.021  58.377  99.024  1.00 45.53  ? 146  ARG A CA    1 
ATOM   4136  C  C     . ARG E 3 146 ? 5.690  58.576  99.713  1.00 47.88  ? 146  ARG A C     1 
ATOM   4137  O  O     . ARG E 3 146 ? 5.328  59.699  100.053 1.00 50.68  ? 146  ARG A O     1 
ATOM   4138  C  CB    . ARG E 3 146 ? 6.870  58.676  97.531  1.00 37.30  ? 146  ARG A CB    1 
ATOM   4139  C  CG    . ARG E 3 146 ? 6.434  60.085  97.188  1.00 36.62  ? 146  ARG A CG    1 
ATOM   4140  C  CD    . ARG E 3 146 ? 5.099  60.059  96.474  1.00 38.96  ? 146  ARG A CD    1 
ATOM   4141  N  NE    . ARG E 3 146 ? 5.190  59.409  95.173  1.00 47.91  ? 146  ARG A NE    1 
ATOM   4142  C  CZ    . ARG E 3 146 ? 5.389  60.049  94.024  1.00 49.57  ? 146  ARG A CZ    1 
ATOM   4143  N  NH1   . ARG E 3 146 ? 5.514  61.376  94.002  1.00 43.00  ? 146  ARG A NH1   1 
ATOM   4144  N  NH2   . ARG E 3 146 ? 5.468  59.358  92.891  1.00 40.50  ? 146  ARG A NH2   1 
ATOM   4145  N  N     . SER E 3 147 ? 4.959  57.492  99.927  1.00 49.75  ? 147  SER A N     1 
ATOM   4146  C  CA    . SER E 3 147 ? 3.655  57.594  100.561 1.00 48.33  ? 147  SER A CA    1 
ATOM   4147  C  C     . SER E 3 147 ? 3.755  57.603  102.070 1.00 49.88  ? 147  SER A C     1 
ATOM   4148  O  O     . SER E 3 147 ? 2.746  57.607  102.754 1.00 49.76  ? 147  SER A O     1 
ATOM   4149  C  CB    . SER E 3 147 ? 2.778  56.436  100.137 1.00 34.82  ? 147  SER A CB    1 
ATOM   4150  O  OG    . SER E 3 147 ? 3.152  55.283  100.851 1.00 29.89  ? 147  SER A OG    1 
ATOM   4151  N  N     . LEU E 3 148 ? 4.975  57.585  102.583 1.00 48.97  ? 148  LEU A N     1 
ATOM   4152  C  CA    . LEU E 3 148 ? 5.195  57.611  104.011 1.00 46.46  ? 148  LEU A CA    1 
ATOM   4153  C  C     . LEU E 3 148 ? 5.907  58.885  104.388 1.00 52.26  ? 148  LEU A C     1 
ATOM   4154  O  O     . LEU E 3 148 ? 5.675  59.426  105.462 1.00 57.83  ? 148  LEU A O     1 
ATOM   4155  C  CB    . LEU E 3 148 ? 6.051  56.435  104.466 1.00 25.81  ? 148  LEU A CB    1 
ATOM   4156  C  CG    . LEU E 3 148 ? 5.396  55.065  104.589 1.00 30.73  ? 148  LEU A CG    1 
ATOM   4157  C  CD1   . LEU E 3 148 ? 6.461  54.001  104.882 1.00 31.27  ? 148  LEU A CD1   1 
ATOM   4158  C  CD2   . LEU E 3 148 ? 4.354  55.103  105.679 1.00 25.70  ? 148  LEU A CD2   1 
ATOM   4159  N  N     . MET E 3 149 ? 6.781  59.363  103.511 1.00 53.15  ? 149  MET A N     1 
ATOM   4160  C  CA    . MET E 3 149 ? 7.540  60.576  103.791 1.00 52.87  ? 149  MET A CA    1 
ATOM   4161  C  C     . MET E 3 149 ? 6.922  61.838  103.231 1.00 53.41  ? 149  MET A C     1 
ATOM   4162  O  O     . MET E 3 149 ? 7.380  62.935  103.526 1.00 50.83  ? 149  MET A O     1 
ATOM   4163  C  CB    . MET E 3 149 ? 8.966  60.454  103.254 1.00 47.31  ? 149  MET A CB    1 
ATOM   4164  C  CG    . MET E 3 149 ? 9.814  59.402  103.940 1.00 47.11  ? 149  MET A CG    1 
ATOM   4165  S  SD    . MET E 3 149 ? 11.441 59.344  103.167 1.00 43.92  ? 149  MET A SD    1 
ATOM   4166  C  CE    . MET E 3 149 ? 12.473 60.022  104.501 1.00 45.89  ? 149  MET A CE    1 
ATOM   4167  N  N     . GLU E 3 150 ? 5.890  61.695  102.418 1.00 55.17  ? 150  GLU A N     1 
ATOM   4168  C  CA    . GLU E 3 150 ? 5.270  62.867  101.846 1.00 59.11  ? 150  GLU A CA    1 
ATOM   4169  C  C     . GLU E 3 150 ? 4.408  63.587  102.869 1.00 63.15  ? 150  GLU A C     1 
ATOM   4170  O  O     . GLU E 3 150 ? 3.908  64.674  102.600 1.00 66.63  ? 150  GLU A O     1 
ATOM   4171  C  CB    . GLU E 3 150 ? 4.431  62.492  100.626 1.00 57.01  ? 150  GLU A CB    1 
ATOM   4172  C  CG    . GLU E 3 150 ? 3.184  61.682  100.928 1.00 65.16  ? 150  GLU A CG    1 
ATOM   4173  C  CD    . GLU E 3 150 ? 2.305  61.475  99.702  1.00 75.62  ? 150  GLU A CD    1 
ATOM   4174  O  OE1   . GLU E 3 150 ? 1.255  60.805  99.826  1.00 80.47  ? 150  GLU A OE1   1 
ATOM   4175  O  OE2   . GLU E 3 150 ? 2.660  61.982  98.614  1.00 84.32  ? 150  GLU A OE2   1 
ATOM   4176  N  N     . ASN E 3 151 ? 4.242  62.993  104.048 1.00 64.57  ? 151  ASN A N     1 
ATOM   4177  C  CA    . ASN E 3 151 ? 3.423  63.606  105.093 1.00 65.67  ? 151  ASN A CA    1 
ATOM   4178  C  C     . ASN E 3 151 ? 4.255  64.262  106.178 1.00 66.73  ? 151  ASN A C     1 
ATOM   4179  O  O     . ASN E 3 151 ? 3.712  64.741  107.171 1.00 67.63  ? 151  ASN A O     1 
ATOM   4180  C  CB    . ASN E 3 151 ? 2.518  62.576  105.764 1.00 59.04  ? 151  ASN A CB    1 
ATOM   4181  C  CG    . ASN E 3 151 ? 1.534  61.955  104.814 1.00 55.26  ? 151  ASN A CG    1 
ATOM   4182  O  OD1   . ASN E 3 151 ? 0.827  62.653  104.081 1.00 41.28  ? 151  ASN A OD1   1 
ATOM   4183  N  ND2   . ASN E 3 151 ? 1.468  60.627  104.828 1.00 48.10  ? 151  ASN A ND2   1 
ATOM   4184  N  N     . SER E 3 152 ? 5.568  64.283  105.997 1.00 68.35  ? 152  SER A N     1 
ATOM   4185  C  CA    . SER E 3 152 ? 6.440  64.876  106.994 1.00 66.64  ? 152  SER A CA    1 
ATOM   4186  C  C     . SER E 3 152 ? 6.835  66.305  106.671 1.00 69.68  ? 152  SER A C     1 
ATOM   4187  O  O     . SER E 3 152 ? 7.142  66.633  105.532 1.00 71.80  ? 152  SER A O     1 
ATOM   4188  C  CB    . SER E 3 152 ? 7.689  64.032  107.152 1.00 48.73  ? 152  SER A CB    1 
ATOM   4189  O  OG    . SER E 3 152 ? 8.462  64.522  108.219 1.00 46.12  ? 152  SER A OG    1 
ATOM   4190  N  N     . ASP E 3 153 ? 6.822  67.156  107.688 1.00 71.18  ? 153  ASP A N     1 
ATOM   4191  C  CA    . ASP E 3 153 ? 7.187  68.552  107.516 1.00 75.02  ? 153  ASP A CA    1 
ATOM   4192  C  C     . ASP E 3 153 ? 8.670  68.661  107.849 1.00 74.01  ? 153  ASP A C     1 
ATOM   4193  O  O     . ASP E 3 153 ? 9.282  69.711  107.672 1.00 71.53  ? 153  ASP A O     1 
ATOM   4194  C  CB    . ASP E 3 153 ? 6.350  69.428  108.459 1.00 90.98  ? 153  ASP A CB    1 
ATOM   4195  C  CG    . ASP E 3 153 ? 5.768  70.665  107.764 1.00 106.51 ? 153  ASP A CG    1 
ATOM   4196  O  OD1   . ASP E 3 153 ? 4.837  71.293  108.329 1.00 110.04 ? 153  ASP A OD1   1 
ATOM   4197  O  OD2   . ASP E 3 153 ? 6.242  71.016  106.659 1.00 112.87 ? 153  ASP A OD2   1 
ATOM   4198  N  N     . ARG E 3 154 ? 9.233  67.556  108.334 1.00 71.50  ? 154  ARG A N     1 
ATOM   4199  C  CA    . ARG E 3 154 ? 10.647 67.475  108.694 1.00 66.91  ? 154  ARG A CA    1 
ATOM   4200  C  C     . ARG E 3 154 ? 11.474 68.005  107.547 1.00 66.17  ? 154  ARG A C     1 
ATOM   4201  O  O     . ARG E 3 154 ? 11.175 67.733  106.396 1.00 66.95  ? 154  ARG A O     1 
ATOM   4202  C  CB    . ARG E 3 154 ? 11.047 66.026  108.957 1.00 62.12  ? 154  ARG A CB    1 
ATOM   4203  C  CG    . ARG E 3 154 ? 10.734 65.508  110.338 1.00 53.22  ? 154  ARG A CG    1 
ATOM   4204  C  CD    . ARG E 3 154 ? 11.859 65.839  111.301 1.00 66.37  ? 154  ARG A CD    1 
ATOM   4205  N  NE    . ARG E 3 154 ? 13.098 65.143  110.967 1.00 72.08  ? 154  ARG A NE    1 
ATOM   4206  C  CZ    . ARG E 3 154 ? 13.252 63.824  111.006 1.00 79.15  ? 154  ARG A CZ    1 
ATOM   4207  N  NH1   . ARG E 3 154 ? 12.245 63.041  111.368 1.00 81.93  ? 154  ARG A NH1   1 
ATOM   4208  N  NH2   . ARG E 3 154 ? 14.416 63.282  110.679 1.00 78.81  ? 154  ARG A NH2   1 
ATOM   4209  N  N     . CYS E 3 155 ? 12.527 68.747  107.854 1.00 65.06  ? 155  CYS A N     1 
ATOM   4210  C  CA    . CYS E 3 155 ? 13.361 69.299  106.802 1.00 61.24  ? 155  CYS A CA    1 
ATOM   4211  C  C     . CYS E 3 155 ? 14.259 68.228  106.213 1.00 60.67  ? 155  CYS A C     1 
ATOM   4212  O  O     . CYS E 3 155 ? 14.583 68.260  105.031 1.00 59.49  ? 155  CYS A O     1 
ATOM   4213  C  CB    . CYS E 3 155 ? 14.204 70.447  107.337 1.00 59.97  ? 155  CYS A CB    1 
ATOM   4214  S  SG    . CYS E 3 155 ? 14.853 71.497  106.019 1.00 62.86  ? 155  CYS A SG    1 
ATOM   4215  N  N     . GLN E 3 156 ? 14.665 67.277  107.041 1.00 60.67  ? 156  GLN A N     1 
ATOM   4216  C  CA    . GLN E 3 156 ? 15.510 66.191  106.570 1.00 58.70  ? 156  GLN A CA    1 
ATOM   4217  C  C     . GLN E 3 156 ? 14.695 65.225  105.726 1.00 57.47  ? 156  GLN A C     1 
ATOM   4218  O  O     . GLN E 3 156 ? 15.178 64.720  104.718 1.00 57.00  ? 156  GLN A O     1 
ATOM   4219  C  CB    . GLN E 3 156 ? 16.118 65.430  107.737 1.00 54.01  ? 156  GLN A CB    1 
ATOM   4220  C  CG    . GLN E 3 156 ? 16.944 64.251  107.297 1.00 56.09  ? 156  GLN A CG    1 
ATOM   4221  C  CD    . GLN E 3 156 ? 17.254 63.300  108.430 1.00 57.69  ? 156  GLN A CD    1 
ATOM   4222  O  OE1   . GLN E 3 156 ? 16.349 62.758  109.067 1.00 57.05  ? 156  GLN A OE1   1 
ATOM   4223  N  NE2   . GLN E 3 156 ? 18.537 63.088  108.688 1.00 56.78  ? 156  GLN A NE2   1 
ATOM   4224  N  N     . ASP E 3 157 ? 13.459 64.963  106.143 1.00 54.99  ? 157  ASP A N     1 
ATOM   4225  C  CA    . ASP E 3 157 ? 12.593 64.055  105.405 1.00 48.75  ? 157  ASP A CA    1 
ATOM   4226  C  C     . ASP E 3 157 ? 12.225 64.638  104.060 1.00 46.23  ? 157  ASP A C     1 
ATOM   4227  O  O     . ASP E 3 157 ? 12.070 63.914  103.092 1.00 45.46  ? 157  ASP A O     1 
ATOM   4228  C  CB    . ASP E 3 157 ? 11.329 63.722  106.197 1.00 41.87  ? 157  ASP A CB    1 
ATOM   4229  C  CG    . ASP E 3 157 ? 11.590 62.741  107.329 1.00 55.88  ? 157  ASP A CG    1 
ATOM   4230  O  OD1   . ASP E 3 157 ? 12.556 61.961  107.240 1.00 58.85  ? 157  ASP A OD1   1 
ATOM   4231  O  OD2   . ASP E 3 157 ? 10.818 62.728  108.307 1.00 58.08  ? 157  ASP A OD2   1 
ATOM   4232  N  N     . ILE E 3 158 ? 12.092 65.951  103.982 1.00 47.11  ? 158  ILE A N     1 
ATOM   4233  C  CA    . ILE E 3 158 ? 11.767 66.559  102.706 1.00 44.89  ? 158  ILE A CA    1 
ATOM   4234  C  C     . ILE E 3 158 ? 12.961 66.472  101.773 1.00 45.19  ? 158  ILE A C     1 
ATOM   4235  O  O     . ILE E 3 158 ? 12.792 66.221  100.591 1.00 45.58  ? 158  ILE A O     1 
ATOM   4236  C  CB    . ILE E 3 158 ? 11.394 68.040  102.831 1.00 34.71  ? 158  ILE A CB    1 
ATOM   4237  C  CG1   . ILE E 3 158 ? 10.163 68.203  103.710 1.00 19.92  ? 158  ILE A CG1   1 
ATOM   4238  C  CG2   . ILE E 3 158 ? 11.140 68.615  101.447 1.00 27.61  ? 158  ILE A CG2   1 
ATOM   4239  C  CD1   . ILE E 3 158 ? 9.834  69.644  103.996 1.00 24.96  ? 158  ILE A CD1   1 
ATOM   4240  N  N     . ARG E 3 159 ? 14.163 66.689  102.300 1.00 43.03  ? 159  ARG A N     1 
ATOM   4241  C  CA    . ARG E 3 159 ? 15.361 66.631  101.472 1.00 41.13  ? 159  ARG A CA    1 
ATOM   4242  C  C     . ARG E 3 159 ? 15.548 65.256  100.868 1.00 39.88  ? 159  ARG A C     1 
ATOM   4243  O  O     . ARG E 3 159 ? 15.709 65.118  99.660  1.00 37.45  ? 159  ARG A O     1 
ATOM   4244  C  CB    . ARG E 3 159 ? 16.604 66.966  102.278 1.00 33.62  ? 159  ARG A CB    1 
ATOM   4245  C  CG    . ARG E 3 159 ? 17.881 66.951  101.443 1.00 22.56  ? 159  ARG A CG    1 
ATOM   4246  C  CD    . ARG E 3 159 ? 19.121 66.864  102.321 1.00 22.81  ? 159  ARG A CD    1 
ATOM   4247  N  NE    . ARG E 3 159 ? 19.142 65.608  103.055 1.00 24.44  ? 159  ARG A NE    1 
ATOM   4248  C  CZ    . ARG E 3 159 ? 20.047 65.293  103.969 1.00 29.32  ? 159  ARG A CZ    1 
ATOM   4249  N  NH1   . ARG E 3 159 ? 21.019 66.147  104.263 1.00 33.61  ? 159  ARG A NH1   1 
ATOM   4250  N  NH2   . ARG E 3 159 ? 19.969 64.126  104.599 1.00 16.04  ? 159  ARG A NH2   1 
ATOM   4251  N  N     . ASN E 3 160 ? 15.529 64.239  101.719 1.00 40.91  ? 160  ASN A N     1 
ATOM   4252  C  CA    . ASN E 3 160 ? 15.696 62.865  101.275 1.00 40.73  ? 160  ASN A CA    1 
ATOM   4253  C  C     . ASN E 3 160 ? 14.670 62.409  100.237 1.00 44.93  ? 160  ASN A C     1 
ATOM   4254  O  O     . ASN E 3 160 ? 15.034 61.811  99.229  1.00 49.41  ? 160  ASN A O     1 
ATOM   4255  C  CB    . ASN E 3 160 ? 15.661 61.933  102.475 1.00 34.84  ? 160  ASN A CB    1 
ATOM   4256  C  CG    . ASN E 3 160 ? 16.810 62.172  103.420 1.00 39.42  ? 160  ASN A CG    1 
ATOM   4257  O  OD1   . ASN E 3 160 ? 17.598 63.096  103.228 1.00 42.39  ? 160  ASN A OD1   1 
ATOM   4258  N  ND2   . ASN E 3 160 ? 16.912 61.346  104.452 1.00 32.62  ? 160  ASN A ND2   1 
ATOM   4259  N  N     . LEU E 3 161 ? 13.389 62.677  100.465 1.00 44.76  ? 161  LEU A N     1 
ATOM   4260  C  CA    . LEU E 3 161 ? 12.394 62.259  99.497  1.00 38.87  ? 161  LEU A CA    1 
ATOM   4261  C  C     . LEU E 3 161 ? 12.692 62.916  98.166  1.00 42.27  ? 161  LEU A C     1 
ATOM   4262  O  O     . LEU E 3 161 ? 12.343 62.382  97.132  1.00 43.96  ? 161  LEU A O     1 
ATOM   4263  C  CB    . LEU E 3 161 ? 10.987 62.638  99.941  1.00 26.87  ? 161  LEU A CB    1 
ATOM   4264  C  CG    . LEU E 3 161 ? 9.857  61.647  99.608  1.00 30.89  ? 161  LEU A CG    1 
ATOM   4265  C  CD1   . LEU E 3 161 ? 8.556  62.397  99.414  1.00 21.58  ? 161  LEU A CD1   1 
ATOM   4266  C  CD2   . LEU E 3 161 ? 10.155 60.871  98.342  1.00 21.95  ? 161  LEU A CD2   1 
ATOM   4267  N  N     . ALA E 3 162 ? 13.334 64.078  98.184  1.00 43.27  ? 162  ALA A N     1 
ATOM   4268  C  CA    . ALA E 3 162 ? 13.673 64.767  96.940  1.00 45.13  ? 162  ALA A CA    1 
ATOM   4269  C  C     . ALA E 3 162 ? 14.861 64.089  96.280  1.00 49.40  ? 162  ALA A C     1 
ATOM   4270  O  O     . ALA E 3 162 ? 14.868 63.878  95.066  1.00 49.87  ? 162  ALA A O     1 
ATOM   4271  C  CB    . ALA E 3 162 ? 14.012 66.201  97.209  1.00 40.90  ? 162  ALA A CB    1 
ATOM   4272  N  N     . PHE E 3 163 ? 15.876 63.766  97.080  1.00 46.58  ? 163  PHE A N     1 
ATOM   4273  C  CA    . PHE E 3 163 ? 17.055 63.093  96.557  1.00 44.35  ? 163  PHE A CA    1 
ATOM   4274  C  C     . PHE E 3 163 ? 16.672 61.752  95.932  1.00 43.14  ? 163  PHE A C     1 
ATOM   4275  O  O     . PHE E 3 163 ? 17.134 61.421  94.850  1.00 43.29  ? 163  PHE A O     1 
ATOM   4276  C  CB    . PHE E 3 163 ? 18.084 62.866  97.658  1.00 35.58  ? 163  PHE A CB    1 
ATOM   4277  C  CG    . PHE E 3 163 ? 19.124 61.844  97.304  1.00 30.45  ? 163  PHE A CG    1 
ATOM   4278  C  CD1   . PHE E 3 163 ? 20.169 62.163  96.465  1.00 30.64  ? 163  PHE A CD1   1 
ATOM   4279  C  CD2   . PHE E 3 163 ? 19.020 60.538  97.771  1.00 31.95  ? 163  PHE A CD2   1 
ATOM   4280  C  CE1   . PHE E 3 163 ? 21.093 61.209  96.096  1.00 32.44  ? 163  PHE A CE1   1 
ATOM   4281  C  CE2   . PHE E 3 163 ? 19.940 59.573  97.406  1.00 36.70  ? 163  PHE A CE2   1 
ATOM   4282  C  CZ    . PHE E 3 163 ? 20.979 59.910  96.562  1.00 34.21  ? 163  PHE A CZ    1 
ATOM   4283  N  N     . LEU E 3 164 ? 15.831 60.976  96.604  1.00 41.34  ? 164  LEU A N     1 
ATOM   4284  C  CA    . LEU E 3 164 ? 15.419 59.698  96.045  1.00 37.87  ? 164  LEU A CA    1 
ATOM   4285  C  C     . LEU E 3 164 ? 14.727 59.960  94.719  1.00 40.12  ? 164  LEU A C     1 
ATOM   4286  O  O     . LEU E 3 164 ? 15.137 59.438  93.688  1.00 43.87  ? 164  LEU A O     1 
ATOM   4287  C  CB    . LEU E 3 164 ? 14.490 58.955  97.004  1.00 27.15  ? 164  LEU A CB    1 
ATOM   4288  C  CG    . LEU E 3 164 ? 15.178 58.537  98.303  1.00 24.87  ? 164  LEU A CG    1 
ATOM   4289  C  CD1   . LEU E 3 164 ? 14.221 57.848  99.207  1.00 28.77  ? 164  LEU A CD1   1 
ATOM   4290  C  CD2   . LEU E 3 164 ? 16.337 57.628  97.983  1.00 36.02  ? 164  LEU A CD2   1 
ATOM   4291  N  N     . GLY E 3 165 ? 13.690 60.784  94.737  1.00 38.75  ? 165  GLY A N     1 
ATOM   4292  C  CA    . GLY E 3 165 ? 12.994 61.106  93.504  1.00 36.70  ? 165  GLY A CA    1 
ATOM   4293  C  C     . GLY E 3 165 ? 13.945 61.464  92.369  1.00 38.92  ? 165  GLY A C     1 
ATOM   4294  O  O     . GLY E 3 165 ? 13.854 60.900  91.288  1.00 37.19  ? 165  GLY A O     1 
ATOM   4295  N  N     . ILE E 3 166 ? 14.874 62.389  92.593  1.00 38.92  ? 166  ILE A N     1 
ATOM   4296  C  CA    . ILE E 3 166 ? 15.799 62.748  91.522  1.00 35.79  ? 166  ILE A CA    1 
ATOM   4297  C  C     . ILE E 3 166 ? 16.706 61.594  91.137  1.00 33.31  ? 166  ILE A C     1 
ATOM   4298  O  O     . ILE E 3 166 ? 17.016 61.419  89.967  1.00 30.61  ? 166  ILE A O     1 
ATOM   4299  C  CB    . ILE E 3 166 ? 16.674 63.971  91.878  1.00 30.20  ? 166  ILE A CB    1 
ATOM   4300  C  CG1   . ILE E 3 166 ? 15.812 65.233  91.930  1.00 30.95  ? 166  ILE A CG1   1 
ATOM   4301  C  CG2   . ILE E 3 166 ? 17.727 64.179  90.813  1.00 22.40  ? 166  ILE A CG2   1 
ATOM   4302  C  CD1   . ILE E 3 166 ? 16.580 66.482  92.263  1.00 31.00  ? 166  ILE A CD1   1 
ATOM   4303  N  N     . ALA E 3 167 ? 17.121 60.797  92.112  1.00 32.78  ? 167  ALA A N     1 
ATOM   4304  C  CA    . ALA E 3 167 ? 17.994 59.656  91.831  1.00 35.11  ? 167  ALA A CA    1 
ATOM   4305  C  C     . ALA E 3 167 ? 17.306 58.572  90.998  1.00 38.85  ? 167  ALA A C     1 
ATOM   4306  O  O     . ALA E 3 167 ? 17.929 57.956  90.136  1.00 34.59  ? 167  ALA A O     1 
ATOM   4307  C  CB    . ALA E 3 167 ? 18.515 59.050  93.138  1.00 21.34  ? 167  ALA A CB    1 
ATOM   4308  N  N     . TYR E 3 168 ? 16.026 58.340  91.260  1.00 36.78  ? 168  TYR A N     1 
ATOM   4309  C  CA    . TYR E 3 168 ? 15.297 57.321  90.526  1.00 36.09  ? 168  TYR A CA    1 
ATOM   4310  C  C     . TYR E 3 168 ? 14.851 57.811  89.174  1.00 37.05  ? 168  TYR A C     1 
ATOM   4311  O  O     . TYR E 3 168 ? 14.835 57.063  88.210  1.00 38.06  ? 168  TYR A O     1 
ATOM   4312  C  CB    . TYR E 3 168 ? 14.051 56.869  91.287  1.00 30.15  ? 168  TYR A CB    1 
ATOM   4313  C  CG    . TYR E 3 168 ? 13.158 55.976  90.456  1.00 25.72  ? 168  TYR A CG    1 
ATOM   4314  C  CD1   . TYR E 3 168 ? 13.479 54.642  90.236  1.00 22.43  ? 168  TYR A CD1   1 
ATOM   4315  C  CD2   . TYR E 3 168 ? 12.018 56.481  89.851  1.00 30.61  ? 168  TYR A CD2   1 
ATOM   4316  C  CE1   . TYR E 3 168 ? 12.692 53.843  89.442  1.00 25.94  ? 168  TYR A CE1   1 
ATOM   4317  C  CE2   . TYR E 3 168 ? 11.217 55.683  89.048  1.00 28.81  ? 168  TYR A CE2   1 
ATOM   4318  C  CZ    . TYR E 3 168 ? 11.559 54.367  88.856  1.00 30.64  ? 168  TYR A CZ    1 
ATOM   4319  O  OH    . TYR E 3 168 ? 10.731 53.559  88.113  1.00 33.51  ? 168  TYR A OH    1 
ATOM   4320  N  N     . ASN E 3 169 ? 14.471 59.073  89.111  1.00 36.68  ? 169  ASN A N     1 
ATOM   4321  C  CA    . ASN E 3 169 ? 13.984 59.653  87.879  1.00 38.47  ? 169  ASN A CA    1 
ATOM   4322  C  C     . ASN E 3 169 ? 15.089 59.986  86.869  1.00 41.36  ? 169  ASN A C     1 
ATOM   4323  O  O     . ASN E 3 169 ? 14.904 59.789  85.675  1.00 36.95  ? 169  ASN A O     1 
ATOM   4324  C  CB    . ASN E 3 169 ? 13.153 60.893  88.230  1.00 38.98  ? 169  ASN A CB    1 
ATOM   4325  C  CG    . ASN E 3 169 ? 12.451 61.505  87.035  1.00 43.09  ? 169  ASN A CG    1 
ATOM   4326  O  OD1   . ASN E 3 169 ? 11.661 62.437  87.187  1.00 48.26  ? 169  ASN A OD1   1 
ATOM   4327  N  ND2   . ASN E 3 169 ? 12.736 60.995  85.844  1.00 33.57  ? 169  ASN A ND2   1 
ATOM   4328  N  N     . THR E 3 170 ? 16.244 60.455  87.330  1.00 43.66  ? 170  THR A N     1 
ATOM   4329  C  CA    . THR E 3 170 ? 17.308 60.826  86.396  1.00 42.30  ? 170  THR A CA    1 
ATOM   4330  C  C     . THR E 3 170 ? 18.412 59.794  86.195  1.00 41.10  ? 170  THR A C     1 
ATOM   4331  O  O     . THR E 3 170 ? 19.241 59.933  85.297  1.00 38.43  ? 170  THR A O     1 
ATOM   4332  C  CB    . THR E 3 170 ? 17.985 62.160  86.809  1.00 37.86  ? 170  THR A CB    1 
ATOM   4333  O  OG1   . THR E 3 170 ? 18.884 61.929  87.902  1.00 29.15  ? 170  THR A OG1   1 
ATOM   4334  C  CG2   . THR E 3 170 ? 16.944 63.178  87.237  1.00 31.20  ? 170  THR A CG2   1 
ATOM   4335  N  N     . LEU E 3 171 ? 18.429 58.761  87.024  1.00 40.96  ? 171  LEU A N     1 
ATOM   4336  C  CA    . LEU E 3 171 ? 19.458 57.725  86.927  1.00 41.78  ? 171  LEU A CA    1 
ATOM   4337  C  C     . LEU E 3 171 ? 20.897 58.253  86.985  1.00 44.08  ? 171  LEU A C     1 
ATOM   4338  O  O     . LEU E 3 171 ? 21.824 57.562  86.582  1.00 42.19  ? 171  LEU A O     1 
ATOM   4339  C  CB    . LEU E 3 171 ? 19.281 56.896  85.652  1.00 28.70  ? 171  LEU A CB    1 
ATOM   4340  C  CG    . LEU E 3 171 ? 18.113 55.920  85.559  1.00 20.78  ? 171  LEU A CG    1 
ATOM   4341  C  CD1   . LEU E 3 171 ? 16.950 56.532  84.801  1.00 14.52  ? 171  LEU A CD1   1 
ATOM   4342  C  CD2   . LEU E 3 171 ? 18.581 54.701  84.818  1.00 27.16  ? 171  LEU A CD2   1 
ATOM   4343  N  N     . LEU E 3 172 ? 21.078 59.474  87.484  1.00 44.82  ? 172  LEU A N     1 
ATOM   4344  C  CA    . LEU E 3 172 ? 22.409 60.058  87.623  1.00 43.01  ? 172  LEU A CA    1 
ATOM   4345  C  C     . LEU E 3 172 ? 23.151 59.329  88.747  1.00 44.62  ? 172  LEU A C     1 
ATOM   4346  O  O     . LEU E 3 172 ? 22.527 58.870  89.706  1.00 43.95  ? 172  LEU A O     1 
ATOM   4347  C  CB    . LEU E 3 172 ? 22.306 61.528  88.004  1.00 32.93  ? 172  LEU A CB    1 
ATOM   4348  C  CG    . LEU E 3 172 ? 21.616 62.527  87.081  1.00 32.50  ? 172  LEU A CG    1 
ATOM   4349  C  CD1   . LEU E 3 172 ? 21.409 63.816  87.845  1.00 18.17  ? 172  LEU A CD1   1 
ATOM   4350  C  CD2   . LEU E 3 172 ? 22.444 62.789  85.836  1.00 24.47  ? 172  LEU A CD2   1 
ATOM   4351  N  N     . ARG E 3 173 ? 24.473 59.219  88.632  1.00 44.77  ? 173  ARG A N     1 
ATOM   4352  C  CA    . ARG E 3 173 ? 25.273 58.577  89.672  1.00 45.63  ? 173  ARG A CA    1 
ATOM   4353  C  C     . ARG E 3 173 ? 25.256 59.517  90.883  1.00 46.98  ? 173  ARG A C     1 
ATOM   4354  O  O     . ARG E 3 173 ? 24.929 60.692  90.747  1.00 46.72  ? 173  ARG A O     1 
ATOM   4355  C  CB    . ARG E 3 173 ? 26.700 58.370  89.170  1.00 53.04  ? 173  ARG A CB    1 
ATOM   4356  C  CG    . ARG E 3 173 ? 26.754 57.510  87.921  1.00 60.62  ? 173  ARG A CG    1 
ATOM   4357  C  CD    . ARG E 3 173 ? 28.168 57.291  87.369  1.00 73.12  ? 173  ARG A CD    1 
ATOM   4358  N  NE    . ARG E 3 173 ? 28.124 56.326  86.269  1.00 87.75  ? 173  ARG A NE    1 
ATOM   4359  C  CZ    . ARG E 3 173 ? 27.473 56.520  85.122  1.00 95.80  ? 173  ARG A CZ    1 
ATOM   4360  N  NH1   . ARG E 3 173 ? 26.812 57.651  84.904  1.00 96.36  ? 173  ARG A NH1   1 
ATOM   4361  N  NH2   . ARG E 3 173 ? 27.456 55.569  84.200  1.00 94.18  ? 173  ARG A NH2   1 
ATOM   4362  N  N     . ILE E 3 174 ? 25.595 59.027  92.069  1.00 47.13  ? 174  ILE A N     1 
ATOM   4363  C  CA    . ILE E 3 174 ? 25.550 59.916  93.220  1.00 45.33  ? 174  ILE A CA    1 
ATOM   4364  C  C     . ILE E 3 174 ? 26.520 61.090  93.109  1.00 46.70  ? 174  ILE A C     1 
ATOM   4365  O  O     . ILE E 3 174 ? 26.131 62.238  93.338  1.00 49.94  ? 174  ILE A O     1 
ATOM   4366  C  CB    . ILE E 3 174 ? 25.775 59.157  94.553  1.00 36.75  ? 174  ILE A CB    1 
ATOM   4367  C  CG1   . ILE E 3 174 ? 26.980 58.231  94.446  1.00 38.70  ? 174  ILE A CG1   1 
ATOM   4368  C  CG2   . ILE E 3 174 ? 24.536 58.382  94.913  1.00 22.27  ? 174  ILE A CG2   1 
ATOM   4369  C  CD1   . ILE E 3 174 ? 27.230 57.432  95.714  1.00 38.38  ? 174  ILE A CD1   1 
ATOM   4370  N  N     . ALA E 3 175 ? 27.769 60.815  92.745  1.00 46.82  ? 175  ALA A N     1 
ATOM   4371  C  CA    . ALA E 3 175 ? 28.771 61.874  92.595  1.00 44.22  ? 175  ALA A CA    1 
ATOM   4372  C  C     . ALA E 3 175 ? 28.227 63.053  91.804  1.00 42.86  ? 175  ALA A C     1 
ATOM   4373  O  O     . ALA E 3 175 ? 28.527 64.191  92.114  1.00 44.11  ? 175  ALA A O     1 
ATOM   4374  C  CB    . ALA E 3 175 ? 30.002 61.333  91.903  1.00 48.17  ? 175  ALA A CB    1 
ATOM   4375  N  N     . GLU E 3 176 ? 27.425 62.760  90.785  1.00 41.24  ? 176  GLU A N     1 
ATOM   4376  C  CA    . GLU E 3 176 ? 26.814 63.766  89.926  1.00 42.14  ? 176  GLU A CA    1 
ATOM   4377  C  C     . GLU E 3 176 ? 25.735 64.564  90.628  1.00 43.13  ? 176  GLU A C     1 
ATOM   4378  O  O     . GLU E 3 176 ? 25.609 65.768  90.407  1.00 45.22  ? 176  GLU A O     1 
ATOM   4379  C  CB    . GLU E 3 176 ? 26.185 63.107  88.704  1.00 41.90  ? 176  GLU A CB    1 
ATOM   4380  C  CG    . GLU E 3 176 ? 27.149 62.335  87.830  1.00 66.33  ? 176  GLU A CG    1 
ATOM   4381  C  CD    . GLU E 3 176 ? 26.444 61.627  86.686  1.00 76.83  ? 176  GLU A CD    1 
ATOM   4382  O  OE1   . GLU E 3 176 ? 27.128 61.017  85.828  1.00 81.09  ? 176  GLU A OE1   1 
ATOM   4383  O  OE2   . GLU E 3 176 ? 25.194 61.680  86.651  1.00 77.57  ? 176  GLU A OE2   1 
ATOM   4384  N  N     . ILE E 3 177 ? 24.943 63.893  91.459  1.00 41.29  ? 177  ILE A N     1 
ATOM   4385  C  CA    . ILE E 3 177 ? 23.856 64.561  92.166  1.00 40.44  ? 177  ILE A CA    1 
ATOM   4386  C  C     . ILE E 3 177 ? 24.388 65.558  93.172  1.00 41.82  ? 177  ILE A C     1 
ATOM   4387  O  O     . ILE E 3 177 ? 23.791 66.605  93.385  1.00 38.83  ? 177  ILE A O     1 
ATOM   4388  C  CB    . ILE E 3 177 ? 22.932 63.541  92.874  1.00 34.73  ? 177  ILE A CB    1 
ATOM   4389  C  CG1   . ILE E 3 177 ? 22.180 62.730  91.822  1.00 26.65  ? 177  ILE A CG1   1 
ATOM   4390  C  CG2   . ILE E 3 177 ? 21.918 64.253  93.757  1.00 30.58  ? 177  ILE A CG2   1 
ATOM   4391  C  CD1   . ILE E 3 177 ? 21.426 61.576  92.375  1.00 22.09  ? 177  ILE A CD1   1 
ATOM   4392  N  N     . ALA E 3 178 ? 25.521 65.243  93.781  1.00 43.98  ? 178  ALA A N     1 
ATOM   4393  C  CA    . ALA E 3 178 ? 26.109 66.146  94.756  1.00 46.70  ? 178  ALA A CA    1 
ATOM   4394  C  C     . ALA E 3 178 ? 26.706 67.382  94.083  1.00 50.97  ? 178  ALA A C     1 
ATOM   4395  O  O     . ALA E 3 178 ? 27.076 68.341  94.763  1.00 52.09  ? 178  ALA A O     1 
ATOM   4396  C  CB    . ALA E 3 178 ? 27.171 65.431  95.538  1.00 38.45  ? 178  ALA A CB    1 
ATOM   4397  N  N     . ARG E 3 179 ? 26.799 67.357  92.752  1.00 52.09  ? 179  ARG A N     1 
ATOM   4398  C  CA    . ARG E 3 179 ? 27.357 68.472  91.998  1.00 49.75  ? 179  ARG A CA    1 
ATOM   4399  C  C     . ARG E 3 179 ? 26.315 69.426  91.455  1.00 49.03  ? 179  ARG A C     1 
ATOM   4400  O  O     . ARG E 3 179 ? 26.641 70.530  91.047  1.00 49.93  ? 179  ARG A O     1 
ATOM   4401  C  CB    . ARG E 3 179 ? 28.207 67.972  90.827  1.00 44.63  ? 179  ARG A CB    1 
ATOM   4402  C  CG    . ARG E 3 179 ? 29.616 67.537  91.198  1.00 55.23  ? 179  ARG A CG    1 
ATOM   4403  C  CD    . ARG E 3 179 ? 30.494 67.392  89.956  1.00 53.87  ? 179  ARG A CD    1 
ATOM   4404  N  NE    . ARG E 3 179 ? 30.373 66.097  89.277  1.00 59.02  ? 179  ARG A NE    1 
ATOM   4405  C  CZ    . ARG E 3 179 ? 30.920 64.969  89.724  1.00 56.77  ? 179  ARG A CZ    1 
ATOM   4406  N  NH1   . ARG E 3 179 ? 31.630 64.971  90.854  1.00 49.98  ? 179  ARG A NH1   1 
ATOM   4407  N  NH2   . ARG E 3 179 ? 30.763 63.839  89.044  1.00 55.26  ? 179  ARG A NH2   1 
ATOM   4408  N  N     . ILE E 3 180 ? 25.062 69.011  91.426  1.00 48.82  ? 180  ILE A N     1 
ATOM   4409  C  CA    . ILE E 3 180 ? 24.013 69.877  90.903  1.00 49.43  ? 180  ILE A CA    1 
ATOM   4410  C  C     . ILE E 3 180 ? 23.891 71.140  91.733  1.00 52.18  ? 180  ILE A C     1 
ATOM   4411  O  O     . ILE E 3 180 ? 23.595 71.060  92.918  1.00 53.84  ? 180  ILE A O     1 
ATOM   4412  C  CB    . ILE E 3 180 ? 22.664 69.174  90.953  1.00 41.72  ? 180  ILE A CB    1 
ATOM   4413  C  CG1   . ILE E 3 180 ? 22.710 67.915  90.107  1.00 36.06  ? 180  ILE A CG1   1 
ATOM   4414  C  CG2   . ILE E 3 180 ? 21.578 70.102  90.499  1.00 36.75  ? 180  ILE A CG2   1 
ATOM   4415  C  CD1   . ILE E 3 180 ? 21.648 66.921  90.490  1.00 32.02  ? 180  ILE A CD1   1 
ATOM   4416  N  N     . ARG E 3 181 ? 24.116 72.305  91.136  1.00 53.61  ? 181  ARG A N     1 
ATOM   4417  C  CA    . ARG E 3 181 ? 23.971 73.538  91.901  1.00 56.56  ? 181  ARG A CA    1 
ATOM   4418  C  C     . ARG E 3 181 ? 22.806 74.351  91.366  1.00 58.15  ? 181  ARG A C     1 
ATOM   4419  O  O     . ARG E 3 181 ? 22.660 74.510  90.167  1.00 59.26  ? 181  ARG A O     1 
ATOM   4420  C  CB    . ARG E 3 181 ? 25.280 74.342  91.920  1.00 52.46  ? 181  ARG A CB    1 
ATOM   4421  C  CG    . ARG E 3 181 ? 25.954 74.583  90.591  1.00 53.30  ? 181  ARG A CG    1 
ATOM   4422  C  CD    . ARG E 3 181 ? 27.486 74.629  90.766  1.00 54.48  ? 181  ARG A CD    1 
ATOM   4423  N  NE    . ARG E 3 181 ? 27.905 75.407  91.931  1.00 58.82  ? 181  ARG A NE    1 
ATOM   4424  C  CZ    . ARG E 3 181 ? 29.109 75.320  92.496  1.00 58.58  ? 181  ARG A CZ    1 
ATOM   4425  N  NH1   . ARG E 3 181 ? 30.022 74.494  92.006  1.00 57.61  ? 181  ARG A NH1   1 
ATOM   4426  N  NH2   . ARG E 3 181 ? 29.395 76.039  93.571  1.00 46.64  ? 181  ARG A NH2   1 
ATOM   4427  N  N     . VAL E 3 182 ? 21.964 74.823  92.279  1.00 56.56  ? 182  VAL A N     1 
ATOM   4428  C  CA    . VAL E 3 182 ? 20.759 75.590  91.964  1.00 54.67  ? 182  VAL A CA    1 
ATOM   4429  C  C     . VAL E 3 182 ? 20.624 76.178  90.567  1.00 55.32  ? 182  VAL A C     1 
ATOM   4430  O  O     . VAL E 3 182 ? 19.621 75.944  89.899  1.00 53.36  ? 182  VAL A O     1 
ATOM   4431  C  CB    . VAL E 3 182 ? 20.557 76.733  92.972  1.00 54.03  ? 182  VAL A CB    1 
ATOM   4432  C  CG1   . VAL E 3 182 ? 19.286 77.503  92.641  1.00 46.94  ? 182  VAL A CG1   1 
ATOM   4433  C  CG2   . VAL E 3 182 ? 20.482 76.164  94.385  1.00 53.27  ? 182  VAL A CG2   1 
ATOM   4434  N  N     . LYS E 3 183 ? 21.618 76.952  90.139  1.00 56.90  ? 183  LYS A N     1 
ATOM   4435  C  CA    . LYS E 3 183 ? 21.610 77.587  88.819  1.00 58.94  ? 183  LYS A CA    1 
ATOM   4436  C  C     . LYS E 3 183 ? 21.420 76.590  87.666  1.00 62.30  ? 183  LYS A C     1 
ATOM   4437  O  O     . LYS E 3 183 ? 21.250 76.994  86.514  1.00 62.79  ? 183  LYS A O     1 
ATOM   4438  C  CB    . LYS E 3 183 ? 22.925 78.340  88.592  1.00 54.32  ? 183  LYS A CB    1 
ATOM   4439  C  CG    . LYS E 3 183 ? 24.091 77.416  88.290  1.00 55.46  ? 183  LYS A CG    1 
ATOM   4440  C  CD    . LYS E 3 183 ? 25.290 78.133  87.680  1.00 62.28  ? 183  LYS A CD    1 
ATOM   4441  C  CE    . LYS E 3 183 ? 26.186 78.776  88.742  1.00 68.68  ? 183  LYS A CE    1 
ATOM   4442  N  NZ    . LYS E 3 183 ? 27.453 79.331  88.150  1.00 68.97  ? 183  LYS A NZ    1 
ATOM   4443  N  N     . ASP E 3 184 ? 21.465 75.295  87.977  1.00 63.88  ? 184  ASP A N     1 
ATOM   4444  C  CA    . ASP E 3 184 ? 21.323 74.247  86.972  1.00 59.54  ? 184  ASP A CA    1 
ATOM   4445  C  C     . ASP E 3 184 ? 19.880 73.823  86.739  1.00 58.75  ? 184  ASP A C     1 
ATOM   4446  O  O     . ASP E 3 184 ? 19.569 73.211  85.723  1.00 55.42  ? 184  ASP A O     1 
ATOM   4447  C  CB    . ASP E 3 184 ? 22.162 73.037  87.364  1.00 63.06  ? 184  ASP A CB    1 
ATOM   4448  C  CG    . ASP E 3 184 ? 23.648 73.339  87.362  1.00 73.96  ? 184  ASP A CG    1 
ATOM   4449  O  OD1   . ASP E 3 184 ? 24.440 72.487  87.830  1.00 78.88  ? 184  ASP A OD1   1 
ATOM   4450  O  OD2   . ASP E 3 184 ? 24.027 74.431  86.885  1.00 78.11  ? 184  ASP A OD2   1 
ATOM   4451  N  N     . ILE E 3 185 ? 18.997 74.142  87.674  1.00 60.79  ? 185  ILE A N     1 
ATOM   4452  C  CA    . ILE E 3 185 ? 17.597 73.798  87.507  1.00 60.78  ? 185  ILE A CA    1 
ATOM   4453  C  C     . ILE E 3 185 ? 16.928 74.879  86.674  1.00 64.91  ? 185  ILE A C     1 
ATOM   4454  O  O     . ILE E 3 185 ? 17.256 76.053  86.797  1.00 66.11  ? 185  ILE A O     1 
ATOM   4455  C  CB    . ILE E 3 185 ? 16.858 73.726  88.854  1.00 48.95  ? 185  ILE A CB    1 
ATOM   4456  C  CG1   . ILE E 3 185 ? 17.498 72.680  89.765  1.00 47.79  ? 185  ILE A CG1   1 
ATOM   4457  C  CG2   . ILE E 3 185 ? 15.408 73.354  88.622  1.00 45.13  ? 185  ILE A CG2   1 
ATOM   4458  C  CD1   . ILE E 3 185 ? 16.718 72.458  91.070  1.00 38.12  ? 185  ILE A CD1   1 
ATOM   4459  N  N     . SER E 3 186 ? 15.992 74.476  85.825  1.00 68.07  ? 186  SER A N     1 
ATOM   4460  C  CA    . SER E 3 186 ? 15.247 75.408  84.986  1.00 70.18  ? 186  SER A CA    1 
ATOM   4461  C  C     . SER E 3 186 ? 13.823 74.894  84.839  1.00 73.25  ? 186  SER A C     1 
ATOM   4462  O  O     . SER E 3 186 ? 13.521 73.778  85.256  1.00 73.75  ? 186  SER A O     1 
ATOM   4463  C  CB    . SER E 3 186 ? 15.913 75.555  83.616  1.00 64.91  ? 186  SER A CB    1 
ATOM   4464  O  OG    . SER E 3 186 ? 16.543 74.352  83.221  1.00 58.02  ? 186  SER A OG    1 
ATOM   4465  N  N     . ARG E 3 187 ? 12.943 75.702  84.259  1.00 76.75  ? 187  ARG A N     1 
ATOM   4466  C  CA    . ARG E 3 187 ? 11.554 75.290  84.103  1.00 80.50  ? 187  ARG A CA    1 
ATOM   4467  C  C     . ARG E 3 187 ? 11.114 75.073  82.667  1.00 84.71  ? 187  ARG A C     1 
ATOM   4468  O  O     . ARG E 3 187 ? 11.274 75.941  81.808  1.00 84.30  ? 187  ARG A O     1 
ATOM   4469  C  CB    . ARG E 3 187 ? 10.630 76.305  84.766  1.00 74.24  ? 187  ARG A CB    1 
ATOM   4470  C  CG    . ARG E 3 187 ? 10.566 76.188  86.280  1.00 78.54  ? 187  ARG A CG    1 
ATOM   4471  C  CD    . ARG E 3 187 ? 9.836  74.918  86.671  1.00 74.71  ? 187  ARG A CD    1 
ATOM   4472  N  NE    . ARG E 3 187 ? 9.167  75.024  87.966  1.00 79.78  ? 187  ARG A NE    1 
ATOM   4473  C  CZ    . ARG E 3 187 ? 7.998  74.448  88.236  1.00 79.48  ? 187  ARG A CZ    1 
ATOM   4474  N  NH1   . ARG E 3 187 ? 7.384  73.732  87.304  1.00 78.43  ? 187  ARG A NH1   1 
ATOM   4475  N  NH2   . ARG E 3 187 ? 7.430  74.603  89.424  1.00 65.63  ? 187  ARG A NH2   1 
ATOM   4476  N  N     . THR E 3 188 ? 10.550 73.896  82.423  1.00 89.95  ? 188  THR A N     1 
ATOM   4477  C  CA    . THR E 3 188 ? 10.058 73.509  81.108  1.00 94.12  ? 188  THR A CA    1 
ATOM   4478  C  C     . THR E 3 188 ? 8.634  74.004  80.925  1.00 98.40  ? 188  THR A C     1 
ATOM   4479  O  O     . THR E 3 188 ? 7.869  74.079  81.883  1.00 98.58  ? 188  THR A O     1 
ATOM   4480  C  CB    . THR E 3 188 ? 10.076 71.978  80.954  1.00 92.21  ? 188  THR A CB    1 
ATOM   4481  O  OG1   . THR E 3 188 ? 11.429 71.539  80.776  1.00 89.72  ? 188  THR A OG1   1 
ATOM   4482  C  CG2   . THR E 3 188 ? 9.221  71.538  79.773  1.00 91.89  ? 188  THR A CG2   1 
ATOM   4483  N  N     . ASP E 3 189 ? 8.289  74.346  79.689  1.00 100.64 ? 189  ASP A N     1 
ATOM   4484  C  CA    . ASP E 3 189 ? 6.951  74.830  79.357  1.00 102.50 ? 189  ASP A CA    1 
ATOM   4485  C  C     . ASP E 3 189 ? 5.857  74.084  80.129  1.00 103.30 ? 189  ASP A C     1 
ATOM   4486  O  O     . ASP E 3 189 ? 4.953  74.706  80.701  1.00 103.25 ? 189  ASP A O     1 
ATOM   4487  C  CB    . ASP E 3 189 ? 6.706  74.678  77.847  1.00 103.31 ? 189  ASP A CB    1 
ATOM   4488  C  CG    . ASP E 3 189 ? 7.465  75.712  77.012  1.00 104.23 ? 189  ASP A CG    1 
ATOM   4489  O  OD1   . ASP E 3 189 ? 7.607  75.502  75.782  1.00 99.79  ? 189  ASP A OD1   1 
ATOM   4490  O  OD2   . ASP E 3 189 ? 7.907  76.739  77.581  1.00 103.63 ? 189  ASP A OD2   1 
ATOM   4491  N  N     . GLY E 3 190 ? 5.959  72.754  80.148  1.00 100.72 ? 190  GLY A N     1 
ATOM   4492  C  CA    . GLY E 3 190 ? 4.978  71.918  80.825  1.00 96.20  ? 190  GLY A CA    1 
ATOM   4493  C  C     . GLY E 3 190 ? 4.758  72.139  82.315  1.00 93.95  ? 190  GLY A C     1 
ATOM   4494  O  O     . GLY E 3 190 ? 3.879  71.509  82.914  1.00 90.47  ? 190  GLY A O     1 
ATOM   4495  N  N     . GLY E 3 191 ? 5.542  73.031  82.916  1.00 91.17  ? 191  GLY A N     1 
ATOM   4496  C  CA    . GLY E 3 191 ? 5.404  73.303  84.338  1.00 85.73  ? 191  GLY A CA    1 
ATOM   4497  C  C     . GLY E 3 191 ? 6.180  72.311  85.187  1.00 80.98  ? 191  GLY A C     1 
ATOM   4498  O  O     . GLY E 3 191 ? 5.841  72.063  86.349  1.00 79.02  ? 191  GLY A O     1 
ATOM   4499  N  N     . ARG E 3 192 ? 7.225  71.739  84.598  1.00 75.37  ? 192  ARG A N     1 
ATOM   4500  C  CA    . ARG E 3 192 ? 8.053  70.770  85.288  1.00 70.26  ? 192  ARG A CA    1 
ATOM   4501  C  C     . ARG E 3 192 ? 9.494  71.215  85.171  1.00 67.67  ? 192  ARG A C     1 
ATOM   4502  O  O     . ARG E 3 192 ? 9.811  72.022  84.307  1.00 70.24  ? 192  ARG A O     1 
ATOM   4503  C  CB    . ARG E 3 192 ? 7.871  69.388  84.670  1.00 65.01  ? 192  ARG A CB    1 
ATOM   4504  C  CG    . ARG E 3 192 ? 8.209  69.300  83.203  1.00 48.82  ? 192  ARG A CG    1 
ATOM   4505  C  CD    . ARG E 3 192 ? 8.095  67.855  82.740  1.00 53.91  ? 192  ARG A CD    1 
ATOM   4506  N  NE    . ARG E 3 192 ? 6.719  67.362  82.785  1.00 64.43  ? 192  ARG A NE    1 
ATOM   4507  C  CZ    . ARG E 3 192 ? 5.986  67.102  81.704  1.00 67.77  ? 192  ARG A CZ    1 
ATOM   4508  N  NH1   . ARG E 3 192 ? 6.500  67.285  80.495  1.00 64.69  ? 192  ARG A NH1   1 
ATOM   4509  N  NH2   . ARG E 3 192 ? 4.740  66.662  81.826  1.00 62.95  ? 192  ARG A NH2   1 
ATOM   4510  N  N     . MET E 3 193 ? 10.367 70.689  86.026  1.00 63.08  ? 193  MET A N     1 
ATOM   4511  C  CA    . MET E 3 193 ? 11.764 71.096  86.005  1.00 58.05  ? 193  MET A CA    1 
ATOM   4512  C  C     . MET E 3 193 ? 12.609 70.495  84.913  1.00 57.35  ? 193  MET A C     1 
ATOM   4513  O  O     . MET E 3 193 ? 12.113 69.771  84.054  1.00 55.42  ? 193  MET A O     1 
ATOM   4514  C  CB    . MET E 3 193 ? 12.412 70.818  87.345  1.00 50.70  ? 193  MET A CB    1 
ATOM   4515  C  CG    . MET E 3 193 ? 11.744 71.543  88.468  1.00 51.92  ? 193  MET A CG    1 
ATOM   4516  S  SD    . MET E 3 193 ? 12.787 71.593  89.900  1.00 57.11  ? 193  MET A SD    1 
ATOM   4517  C  CE    . MET E 3 193 ? 11.900 72.838  90.893  1.00 55.04  ? 193  MET A CE    1 
ATOM   4518  N  N     . LEU E 3 194 ? 13.898 70.813  84.956  1.00 56.83  ? 194  LEU A N     1 
ATOM   4519  C  CA    . LEU E 3 194 ? 14.856 70.343  83.968  1.00 57.63  ? 194  LEU A CA    1 
ATOM   4520  C  C     . LEU E 3 194 ? 16.245 70.651  84.515  1.00 57.09  ? 194  LEU A C     1 
ATOM   4521  O  O     . LEU E 3 194 ? 16.657 71.801  84.546  1.00 62.58  ? 194  LEU A O     1 
ATOM   4522  C  CB    . LEU E 3 194 ? 14.634 71.084  82.654  1.00 60.55  ? 194  LEU A CB    1 
ATOM   4523  C  CG    . LEU E 3 194 ? 15.206 70.434  81.400  1.00 68.66  ? 194  LEU A CG    1 
ATOM   4524  C  CD1   . LEU E 3 194 ? 14.057 69.968  80.521  1.00 68.48  ? 194  LEU A CD1   1 
ATOM   4525  C  CD2   . LEU E 3 194 ? 16.091 71.420  80.649  1.00 68.76  ? 194  LEU A CD2   1 
ATOM   4526  N  N     . ILE E 3 195 ? 16.956 69.617  84.950  1.00 56.76  ? 195  ILE A N     1 
ATOM   4527  C  CA    . ILE E 3 195 ? 18.289 69.762  85.524  1.00 53.70  ? 195  ILE A CA    1 
ATOM   4528  C  C     . ILE E 3 195 ? 19.356 69.608  84.459  1.00 55.07  ? 195  ILE A C     1 
ATOM   4529  O  O     . ILE E 3 195 ? 19.266 68.718  83.629  1.00 53.61  ? 195  ILE A O     1 
ATOM   4530  C  CB    . ILE E 3 195 ? 18.527 68.688  86.596  1.00 46.93  ? 195  ILE A CB    1 
ATOM   4531  C  CG1   . ILE E 3 195 ? 17.340 68.640  87.551  1.00 42.71  ? 195  ILE A CG1   1 
ATOM   4532  C  CG2   . ILE E 3 195 ? 19.794 68.992  87.380  1.00 50.62  ? 195  ILE A CG2   1 
ATOM   4533  C  CD1   . ILE E 3 195 ? 17.336 67.423  88.424  1.00 42.30  ? 195  ILE A CD1   1 
ATOM   4534  N  N     . HIS E 3 196 ? 20.364 70.474  84.482  1.00 61.59  ? 196  HIS A N     1 
ATOM   4535  C  CA    . HIS E 3 196 ? 21.456 70.405  83.509  1.00 66.77  ? 196  HIS A CA    1 
ATOM   4536  C  C     . HIS E 3 196 ? 22.712 69.912  84.206  1.00 65.81  ? 196  HIS A C     1 
ATOM   4537  O  O     . HIS E 3 196 ? 23.089 70.448  85.243  1.00 64.41  ? 196  HIS A O     1 
ATOM   4538  C  CB    . HIS E 3 196 ? 21.744 71.781  82.906  1.00 79.02  ? 196  HIS A CB    1 
ATOM   4539  C  CG    . HIS E 3 196 ? 20.617 72.344  82.096  1.00 97.41  ? 196  HIS A CG    1 
ATOM   4540  N  ND1   . HIS E 3 196 ? 19.488 72.895  82.667  1.00 104.57 ? 196  HIS A ND1   1 
ATOM   4541  C  CD2   . HIS E 3 196 ? 20.452 72.457  80.755  1.00 104.35 ? 196  HIS A CD2   1 
ATOM   4542  C  CE1   . HIS E 3 196 ? 18.680 73.324  81.714  1.00 108.49 ? 196  HIS A CE1   1 
ATOM   4543  N  NE2   . HIS E 3 196 ? 19.240 73.070  80.545  1.00 106.44 ? 196  HIS A NE2   1 
ATOM   4544  N  N     . ILE E 3 197 ? 23.373 68.904  83.648  1.00 67.01  ? 197  ILE A N     1 
ATOM   4545  C  CA    . ILE E 3 197 ? 24.575 68.397  84.294  1.00 73.81  ? 197  ILE A CA    1 
ATOM   4546  C  C     . ILE E 3 197 ? 25.865 68.748  83.554  1.00 77.91  ? 197  ILE A C     1 
ATOM   4547  O  O     . ILE E 3 197 ? 26.225 68.112  82.569  1.00 73.97  ? 197  ILE A O     1 
ATOM   4548  C  CB    . ILE E 3 197 ? 24.488 66.867  84.508  1.00 75.25  ? 197  ILE A CB    1 
ATOM   4549  C  CG1   . ILE E 3 197 ? 24.487 66.132  83.167  1.00 84.68  ? 197  ILE A CG1   1 
ATOM   4550  C  CG2   . ILE E 3 197 ? 23.210 66.529  85.284  1.00 67.59  ? 197  ILE A CG2   1 
ATOM   4551  C  CD1   . ILE E 3 197 ? 24.629 64.620  83.298  1.00 85.51  ? 197  ILE A CD1   1 
ATOM   4552  N  N     . GLY E 3 198 ? 26.556 69.774  84.047  1.00 86.31  ? 198  GLY A N     1 
ATOM   4553  C  CA    . GLY E 3 198 ? 27.794 70.214  83.427  1.00 94.79  ? 198  GLY A CA    1 
ATOM   4554  C  C     . GLY E 3 198 ? 29.016 69.712  84.168  1.00 100.94 ? 198  GLY A C     1 
ATOM   4555  O  O     . GLY E 3 198 ? 28.931 69.355  85.343  1.00 101.81 ? 198  GLY A O     1 
ATOM   4556  N  N     . ARG E 3 199 ? 30.158 69.698  83.487  1.00 106.78 ? 199  ARG A N     1 
ATOM   4557  C  CA    . ARG E 3 199 ? 31.400 69.219  84.079  1.00 114.07 ? 199  ARG A CA    1 
ATOM   4558  C  C     . ARG E 3 199 ? 31.208 67.767  84.481  1.00 118.34 ? 199  ARG A C     1 
ATOM   4559  O  O     . ARG E 3 199 ? 30.649 67.466  85.533  1.00 116.94 ? 199  ARG A O     1 
ATOM   4560  C  CB    . ARG E 3 199 ? 31.780 70.056  85.303  1.00 116.10 ? 199  ARG A CB    1 
ATOM   4561  C  CG    . ARG E 3 199 ? 31.983 71.531  85.008  1.00 116.33 ? 199  ARG A CG    1 
ATOM   4562  C  CD    . ARG E 3 199 ? 32.677 72.257  86.161  1.00 115.77 ? 199  ARG A CD    1 
ATOM   4563  N  NE    . ARG E 3 199 ? 31.899 72.266  87.401  1.00 116.64 ? 199  ARG A NE    1 
ATOM   4564  C  CZ    . ARG E 3 199 ? 32.248 72.935  88.498  1.00 117.91 ? 199  ARG A CZ    1 
ATOM   4565  N  NH1   . ARG E 3 199 ? 33.365 73.655  88.517  1.00 115.70 ? 199  ARG A NH1   1 
ATOM   4566  N  NH2   . ARG E 3 199 ? 31.479 72.884  89.580  1.00 117.13 ? 199  ARG A NH2   1 
ATOM   4567  N  N     . THR E 3 200 ? 31.661 66.869  83.617  1.00 123.49 ? 200  THR A N     1 
ATOM   4568  C  CA    . THR E 3 200 ? 31.543 65.436  83.857  1.00 129.83 ? 200  THR A CA    1 
ATOM   4569  C  C     . THR E 3 200 ? 32.897 64.917  84.345  1.00 133.35 ? 200  THR A C     1 
ATOM   4570  O  O     . THR E 3 200 ? 33.270 65.076  85.509  1.00 133.36 ? 200  THR A O     1 
ATOM   4571  C  CB    . THR E 3 200 ? 31.170 64.690  82.550  1.00 132.12 ? 200  THR A CB    1 
ATOM   4572  O  OG1   . THR E 3 200 ? 30.099 65.375  81.888  1.00 135.51 ? 200  THR A OG1   1 
ATOM   4573  C  CG2   . THR E 3 200 ? 30.729 63.266  82.850  1.00 130.57 ? 200  THR A CG2   1 
ATOM   4574  N  N     . LYS E 3 201 ? 33.621 64.304  83.419  1.00 136.11 ? 201  LYS A N     1 
ATOM   4575  C  CA    . LYS E 3 201 ? 34.938 63.738  83.656  1.00 139.03 ? 201  LYS A CA    1 
ATOM   4576  C  C     . LYS E 3 201 ? 35.385 63.207  82.300  1.00 142.16 ? 201  LYS A C     1 
ATOM   4577  O  O     . LYS E 3 201 ? 36.555 63.311  81.924  1.00 141.93 ? 201  LYS A O     1 
ATOM   4578  C  CB    . LYS E 3 201 ? 34.857 62.584  84.660  1.00 129.91 ? 201  LYS A CB    1 
ATOM   4579  C  CG    . LYS E 3 201 ? 35.434 61.276  84.125  1.00 121.17 ? 201  LYS A CG    1 
ATOM   4580  C  CD    . LYS E 3 201 ? 35.151 60.111  85.047  1.00 115.09 ? 201  LYS A CD    1 
ATOM   4581  C  CE    . LYS E 3 201 ? 35.274 58.796  84.300  1.00 116.04 ? 201  LYS A CE    1 
ATOM   4582  N  NZ    . LYS E 3 201 ? 34.530 57.712  85.008  1.00 114.36 ? 201  LYS A NZ    1 
ATOM   4583  N  N     . THR E 3 202 ? 34.428 62.639  81.571  1.00 144.72 ? 202  THR A N     1 
ATOM   4584  C  CA    . THR E 3 202 ? 34.682 62.089  80.246  1.00 147.58 ? 202  THR A CA    1 
ATOM   4585  C  C     . THR E 3 202 ? 34.663 63.212  79.214  1.00 147.86 ? 202  THR A C     1 
ATOM   4586  O  O     . THR E 3 202 ? 33.888 64.165  79.331  1.00 149.33 ? 202  THR A O     1 
ATOM   4587  C  CB    . THR E 3 202 ? 33.599 61.068  79.848  1.00 150.00 ? 202  THR A CB    1 
ATOM   4588  O  OG1   . THR E 3 202 ? 33.395 60.146  80.924  1.00 152.02 ? 202  THR A OG1   1 
ATOM   4589  C  CG2   . THR E 3 202 ? 34.019 60.302  78.600  1.00 149.88 ? 202  THR A CG2   1 
ATOM   4590  N  N     . LEU E 3 203 ? 35.515 63.096  78.202  1.00 145.76 ? 203  LEU A N     1 
ATOM   4591  C  CA    . LEU E 3 203 ? 35.565 64.097  77.151  1.00 143.58 ? 203  LEU A CA    1 
ATOM   4592  C  C     . LEU E 3 203 ? 34.238 63.985  76.404  1.00 144.75 ? 203  LEU A C     1 
ATOM   4593  O  O     . LEU E 3 203 ? 33.689 64.980  75.929  1.00 145.35 ? 203  LEU A O     1 
ATOM   4594  C  CB    . LEU E 3 203 ? 36.740 63.810  76.214  1.00 135.25 ? 203  LEU A CB    1 
ATOM   4595  C  CG    . LEU E 3 203 ? 37.266 64.949  75.336  1.00 128.18 ? 203  LEU A CG    1 
ATOM   4596  C  CD1   . LEU E 3 203 ? 38.512 64.485  74.608  1.00 123.63 ? 203  LEU A CD1   1 
ATOM   4597  C  CD2   . LEU E 3 203 ? 36.206 65.390  74.347  1.00 126.40 ? 203  LEU A CD2   1 
ATOM   4598  N  N     . VAL E 3 204 ? 33.724 62.758  76.329  1.00 143.43 ? 204  VAL A N     1 
ATOM   4599  C  CA    . VAL E 3 204 ? 32.458 62.466  75.660  1.00 140.44 ? 204  VAL A CA    1 
ATOM   4600  C  C     . VAL E 3 204 ? 31.443 61.857  76.645  1.00 140.21 ? 204  VAL A C     1 
ATOM   4601  O  O     . VAL E 3 204 ? 31.507 60.669  76.971  1.00 141.37 ? 204  VAL A O     1 
ATOM   4602  C  CB    . VAL E 3 204 ? 32.681 61.502  74.460  1.00 134.05 ? 204  VAL A CB    1 
ATOM   4603  C  CG1   . VAL E 3 204 ? 33.424 60.253  74.917  1.00 127.95 ? 204  VAL A CG1   1 
ATOM   4604  C  CG2   . VAL E 3 204 ? 31.350 61.133  73.827  1.00 130.34 ? 204  VAL A CG2   1 
ATOM   4605  N  N     . SER E 3 205 ? 30.512 62.685  77.118  1.00 138.27 ? 205  SER A N     1 
ATOM   4606  C  CA    . SER E 3 205 ? 29.486 62.250  78.072  1.00 133.80 ? 205  SER A CA    1 
ATOM   4607  C  C     . SER E 3 205 ? 28.277 61.634  77.371  1.00 130.10 ? 205  SER A C     1 
ATOM   4608  O  O     . SER E 3 205 ? 27.392 62.343  76.888  1.00 128.82 ? 205  SER A O     1 
ATOM   4609  C  CB    . SER E 3 205 ? 29.039 63.434  78.937  1.00 133.93 ? 205  SER A CB    1 
ATOM   4610  O  OG    . SER E 3 205 ? 29.647 64.639  78.500  1.00 131.42 ? 205  SER A OG    1 
ATOM   4611  N  N     . THR E 3 206 ? 28.240 60.305  77.350  1.00 126.40 ? 206  THR A N     1 
ATOM   4612  C  CA    . THR E 3 206 ? 27.181 59.553  76.687  1.00 121.98 ? 206  THR A CA    1 
ATOM   4613  C  C     . THR E 3 206 ? 25.817 59.522  77.385  1.00 120.08 ? 206  THR A C     1 
ATOM   4614  O  O     . THR E 3 206 ? 24.875 58.897  76.885  1.00 119.42 ? 206  THR A O     1 
ATOM   4615  C  CB    . THR E 3 206 ? 27.625 58.108  76.465  1.00 118.27 ? 206  THR A CB    1 
ATOM   4616  O  OG1   . THR E 3 206 ? 27.048 57.615  75.253  1.00 115.47 ? 206  THR A OG1   1 
ATOM   4617  C  CG2   . THR E 3 206 ? 27.167 57.229  77.621  1.00 119.41 ? 206  THR A CG2   1 
ATOM   4618  N  N     . ALA E 3 207 ? 25.709 60.189  78.532  1.00 116.03 ? 207  ALA A N     1 
ATOM   4619  C  CA    . ALA E 3 207 ? 24.454 60.216  79.284  1.00 109.44 ? 207  ALA A CA    1 
ATOM   4620  C  C     . ALA E 3 207 ? 23.443 61.196  78.714  1.00 106.40 ? 207  ALA A C     1 
ATOM   4621  O  O     . ALA E 3 207 ? 22.493 60.805  78.030  1.00 104.48 ? 207  ALA A O     1 
ATOM   4622  C  CB    . ALA E 3 207 ? 24.726 60.553  80.747  1.00 101.81 ? 207  ALA A CB    1 
ATOM   4623  N  N     . GLY E 3 208 ? 23.658 62.475  79.011  1.00 104.09 ? 208  GLY A N     1 
ATOM   4624  C  CA    . GLY E 3 208 ? 22.762 63.519  78.546  1.00 100.63 ? 208  GLY A CA    1 
ATOM   4625  C  C     . GLY E 3 208 ? 23.001 64.857  79.230  1.00 95.38  ? 208  GLY A C     1 
ATOM   4626  O  O     . GLY E 3 208 ? 23.028 64.955  80.456  1.00 93.65  ? 208  GLY A O     1 
ATOM   4627  N  N     . VAL E 3 209 ? 23.172 65.899  78.434  1.00 89.88  ? 209  VAL A N     1 
ATOM   4628  C  CA    . VAL E 3 209 ? 23.406 67.214  78.987  1.00 81.83  ? 209  VAL A CA    1 
ATOM   4629  C  C     . VAL E 3 209 ? 22.270 67.542  79.950  1.00 77.88  ? 209  VAL A C     1 
ATOM   4630  O  O     . VAL E 3 209 ? 22.515 67.869  81.110  1.00 78.51  ? 209  VAL A O     1 
ATOM   4631  C  CB    . VAL E 3 209 ? 23.458 68.286  77.874  1.00 78.25  ? 209  VAL A CB    1 
ATOM   4632  C  CG1   . VAL E 3 209 ? 24.246 69.491  78.346  1.00 63.82  ? 209  VAL A CG1   1 
ATOM   4633  C  CG2   . VAL E 3 209 ? 24.084 67.707  76.616  1.00 76.65  ? 209  VAL A CG2   1 
ATOM   4634  N  N     . GLU E 3 210 ? 21.030 67.436  79.475  1.00 72.52  ? 210  GLU A N     1 
ATOM   4635  C  CA    . GLU E 3 210 ? 19.856 67.746  80.296  1.00 69.94  ? 210  GLU A CA    1 
ATOM   4636  C  C     . GLU E 3 210 ? 18.952 66.559  80.649  1.00 65.91  ? 210  GLU A C     1 
ATOM   4637  O  O     . GLU E 3 210 ? 18.735 65.649  79.839  1.00 62.49  ? 210  GLU A O     1 
ATOM   4638  C  CB    . GLU E 3 210 ? 19.004 68.821  79.615  1.00 79.57  ? 210  GLU A CB    1 
ATOM   4639  C  CG    . GLU E 3 210 ? 18.800 68.592  78.123  1.00 90.33  ? 210  GLU A CG    1 
ATOM   4640  C  CD    . GLU E 3 210 ? 17.573 69.300  77.575  1.00 100.05 ? 210  GLU A CD    1 
ATOM   4641  O  OE1   . GLU E 3 210 ? 16.457 68.730  77.664  1.00 103.88 ? 210  GLU A OE1   1 
ATOM   4642  O  OE2   . GLU E 3 210 ? 17.726 70.433  77.061  1.00 104.46 ? 210  GLU A OE2   1 
ATOM   4643  N  N     . LYS E 3 211 ? 18.424 66.589  81.871  1.00 59.31  ? 211  LYS A N     1 
ATOM   4644  C  CA    . LYS E 3 211 ? 17.540 65.549  82.377  1.00 51.89  ? 211  LYS A CA    1 
ATOM   4645  C  C     . LYS E 3 211 ? 16.273 66.239  82.852  1.00 48.97  ? 211  LYS A C     1 
ATOM   4646  O  O     . LYS E 3 211 ? 16.348 67.248  83.530  1.00 50.54  ? 211  LYS A O     1 
ATOM   4647  C  CB    . LYS E 3 211 ? 18.187 64.825  83.562  1.00 41.78  ? 211  LYS A CB    1 
ATOM   4648  C  CG    . LYS E 3 211 ? 19.521 64.155  83.264  1.00 34.61  ? 211  LYS A CG    1 
ATOM   4649  C  CD    . LYS E 3 211 ? 19.373 62.659  83.021  1.00 42.67  ? 211  LYS A CD    1 
ATOM   4650  C  CE    . LYS E 3 211 ? 20.721 62.008  82.670  1.00 45.84  ? 211  LYS A CE    1 
ATOM   4651  N  NZ    . LYS E 3 211 ? 20.629 60.540  82.353  1.00 38.64  ? 211  LYS A NZ    1 
ATOM   4652  N  N     . ALA E 3 212 ? 15.112 65.695  82.507  1.00 50.55  ? 212  ALA A N     1 
ATOM   4653  C  CA    . ALA E 3 212 ? 13.838 66.289  82.919  1.00 50.51  ? 212  ALA A CA    1 
ATOM   4654  C  C     . ALA E 3 212 ? 13.128 65.459  83.979  1.00 49.76  ? 212  ALA A C     1 
ATOM   4655  O  O     . ALA E 3 212 ? 13.125 64.233  83.919  1.00 47.38  ? 212  ALA A O     1 
ATOM   4656  C  CB    . ALA E 3 212 ? 12.933 66.458  81.714  1.00 35.46  ? 212  ALA A CB    1 
ATOM   4657  N  N     . LEU E 3 213 ? 12.521 66.134  84.945  1.00 49.62  ? 213  LEU A N     1 
ATOM   4658  C  CA    . LEU E 3 213 ? 11.813 65.449  86.014  1.00 50.53  ? 213  LEU A CA    1 
ATOM   4659  C  C     . LEU E 3 213 ? 10.318 65.403  85.732  1.00 53.12  ? 213  LEU A C     1 
ATOM   4660  O  O     . LEU E 3 213 ? 9.799  66.203  84.961  1.00 53.13  ? 213  LEU A O     1 
ATOM   4661  C  CB    . LEU E 3 213 ? 12.037 66.164  87.343  1.00 38.83  ? 213  LEU A CB    1 
ATOM   4662  C  CG    . LEU E 3 213 ? 13.448 66.637  87.649  1.00 38.90  ? 213  LEU A CG    1 
ATOM   4663  C  CD1   . LEU E 3 213 ? 13.513 67.097  89.082  1.00 36.39  ? 213  LEU A CD1   1 
ATOM   4664  C  CD2   . LEU E 3 213 ? 14.423 65.526  87.421  1.00 38.02  ? 213  LEU A CD2   1 
ATOM   4665  N  N     . SER E 3 214 ? 9.628  64.462  86.364  1.00 55.61  ? 214  SER A N     1 
ATOM   4666  C  CA    . SER E 3 214 ? 8.195  64.337  86.187  1.00 56.94  ? 214  SER A CA    1 
ATOM   4667  C  C     . SER E 3 214 ? 7.590  65.489  86.950  1.00 60.18  ? 214  SER A C     1 
ATOM   4668  O  O     . SER E 3 214 ? 8.303  66.217  87.634  1.00 61.52  ? 214  SER A O     1 
ATOM   4669  C  CB    . SER E 3 214 ? 7.691  63.034  86.796  1.00 57.43  ? 214  SER A CB    1 
ATOM   4670  O  OG    . SER E 3 214 ? 7.730  63.083  88.215  1.00 59.42  ? 214  SER A OG    1 
ATOM   4671  N  N     . LEU E 3 215 ? 6.278  65.662  86.844  1.00 60.03  ? 215  LEU A N     1 
ATOM   4672  C  CA    . LEU E 3 215 ? 5.635  66.740  87.580  1.00 59.31  ? 215  LEU A CA    1 
ATOM   4673  C  C     . LEU E 3 215 ? 5.737  66.383  89.044  1.00 58.07  ? 215  LEU A C     1 
ATOM   4674  O  O     . LEU E 3 215 ? 6.136  67.198  89.872  1.00 57.39  ? 215  LEU A O     1 
ATOM   4675  C  CB    . LEU E 3 215 ? 4.165  66.865  87.200  1.00 57.18  ? 215  LEU A CB    1 
ATOM   4676  C  CG    . LEU E 3 215 ? 3.881  67.151  85.729  1.00 54.36  ? 215  LEU A CG    1 
ATOM   4677  C  CD1   . LEU E 3 215 ? 2.361  67.229  85.542  1.00 33.13  ? 215  LEU A CD1   1 
ATOM   4678  C  CD2   . LEU E 3 215 ? 4.578  68.444  85.293  1.00 49.13  ? 215  LEU A CD2   1 
ATOM   4679  N  N     . GLY E 3 216 ? 5.377  65.140  89.345  1.00 60.92  ? 216  GLY A N     1 
ATOM   4680  C  CA    . GLY E 3 216 ? 5.419  64.662  90.711  1.00 60.85  ? 216  GLY A CA    1 
ATOM   4681  C  C     . GLY E 3 216 ? 6.760  64.884  91.377  1.00 60.04  ? 216  GLY A C     1 
ATOM   4682  O  O     . GLY E 3 216 ? 6.817  65.421  92.484  1.00 58.15  ? 216  GLY A O     1 
ATOM   4683  N  N     . VAL E 3 217 ? 7.839  64.470  90.717  1.00 59.27  ? 217  VAL A N     1 
ATOM   4684  C  CA    . VAL E 3 217 ? 9.171  64.624  91.287  1.00 55.14  ? 217  VAL A CA    1 
ATOM   4685  C  C     . VAL E 3 217 ? 9.486  66.101  91.394  1.00 57.03  ? 217  VAL A C     1 
ATOM   4686  O  O     . VAL E 3 217 ? 10.223 66.519  92.281  1.00 55.93  ? 217  VAL A O     1 
ATOM   4687  C  CB    . VAL E 3 217 ? 10.251 63.909  90.428  1.00 50.48  ? 217  VAL A CB    1 
ATOM   4688  C  CG1   . VAL E 3 217 ? 11.608 64.071  91.062  1.00 39.86  ? 217  VAL A CG1   1 
ATOM   4689  C  CG2   . VAL E 3 217 ? 9.932  62.431  90.298  1.00 42.25  ? 217  VAL A CG2   1 
ATOM   4690  N  N     . THR E 3 218 ? 8.911  66.900  90.500  1.00 56.94  ? 218  THR A N     1 
ATOM   4691  C  CA    . THR E 3 218 ? 9.144  68.344  90.528  1.00 56.39  ? 218  THR A CA    1 
ATOM   4692  C  C     . THR E 3 218 ? 8.581  68.949  91.812  1.00 57.65  ? 218  THR A C     1 
ATOM   4693  O  O     . THR E 3 218 ? 9.198  69.808  92.432  1.00 57.43  ? 218  THR A O     1 
ATOM   4694  C  CB    . THR E 3 218 ? 8.505  69.045  89.318  1.00 48.29  ? 218  THR A CB    1 
ATOM   4695  O  OG1   . THR E 3 218 ? 9.116  68.574  88.111  1.00 49.89  ? 218  THR A OG1   1 
ATOM   4696  C  CG2   . THR E 3 218 ? 8.715  70.534  89.411  1.00 36.86  ? 218  THR A CG2   1 
ATOM   4697  N  N     . LYS E 3 219 ? 7.399  68.498  92.205  1.00 59.00  ? 219  LYS A N     1 
ATOM   4698  C  CA    . LYS E 3 219 ? 6.794  68.985  93.427  1.00 59.63  ? 219  LYS A CA    1 
ATOM   4699  C  C     . LYS E 3 219 ? 7.681  68.598  94.595  1.00 58.59  ? 219  LYS A C     1 
ATOM   4700  O  O     . LYS E 3 219 ? 7.721  69.287  95.604  1.00 62.32  ? 219  LYS A O     1 
ATOM   4701  C  CB    . LYS E 3 219 ? 5.411  68.369  93.652  1.00 61.98  ? 219  LYS A CB    1 
ATOM   4702  C  CG    . LYS E 3 219 ? 4.258  68.984  92.870  1.00 70.23  ? 219  LYS A CG    1 
ATOM   4703  C  CD    . LYS E 3 219 ? 2.946  68.791  93.651  1.00 77.86  ? 219  LYS A CD    1 
ATOM   4704  C  CE    . LYS E 3 219 ? 1.707  69.137  92.822  1.00 80.40  ? 219  LYS A CE    1 
ATOM   4705  N  NZ    . LYS E 3 219 ? 1.415  68.110  91.772  1.00 72.14  ? 219  LYS A NZ    1 
ATOM   4706  N  N     . LEU E 3 220 ? 8.383  67.482  94.471  1.00 56.66  ? 220  LEU A N     1 
ATOM   4707  C  CA    . LEU E 3 220 ? 9.239  67.036  95.552  1.00 47.93  ? 220  LEU A CA    1 
ATOM   4708  C  C     . LEU E 3 220 ? 10.475 67.902  95.690  1.00 47.88  ? 220  LEU A C     1 
ATOM   4709  O  O     . LEU E 3 220 ? 10.814 68.336  96.792  1.00 44.01  ? 220  LEU A O     1 
ATOM   4710  C  CB    . LEU E 3 220 ? 9.676  65.594  95.334  1.00 35.80  ? 220  LEU A CB    1 
ATOM   4711  C  CG    . LEU E 3 220 ? 8.714  64.417  95.426  1.00 31.20  ? 220  LEU A CG    1 
ATOM   4712  C  CD1   . LEU E 3 220 ? 9.390  63.372  96.271  1.00 31.78  ? 220  LEU A CD1   1 
ATOM   4713  C  CD2   . LEU E 3 220 ? 7.393  64.802  96.040  1.00 31.92  ? 220  LEU A CD2   1 
ATOM   4714  N  N     . VAL E 3 221 ? 11.159 68.143  94.575  1.00 46.61  ? 221  VAL A N     1 
ATOM   4715  C  CA    . VAL E 3 221 ? 12.372 68.953  94.592  1.00 47.66  ? 221  VAL A CA    1 
ATOM   4716  C  C     . VAL E 3 221 ? 12.067 70.375  95.004  1.00 53.37  ? 221  VAL A C     1 
ATOM   4717  O  O     . VAL E 3 221 ? 12.791 70.973  95.796  1.00 53.48  ? 221  VAL A O     1 
ATOM   4718  C  CB    . VAL E 3 221 ? 13.035 69.014  93.218  1.00 33.80  ? 221  VAL A CB    1 
ATOM   4719  C  CG1   . VAL E 3 221 ? 14.369 69.736  93.328  1.00 22.68  ? 221  VAL A CG1   1 
ATOM   4720  C  CG2   . VAL E 3 221 ? 13.226 67.624  92.676  1.00 34.88  ? 221  VAL A CG2   1 
ATOM   4721  N  N     . GLU E 3 222 ? 10.987 70.908  94.449  1.00 57.38  ? 222  GLU A N     1 
ATOM   4722  C  CA    . GLU E 3 222 ? 10.544 72.267  94.724  1.00 59.50  ? 222  GLU A CA    1 
ATOM   4723  C  C     . GLU E 3 222 ? 10.303 72.513  96.218  1.00 57.95  ? 222  GLU A C     1 
ATOM   4724  O  O     . GLU E 3 222 ? 10.778 73.497  96.781  1.00 58.80  ? 222  GLU A O     1 
ATOM   4725  C  CB    . GLU E 3 222 ? 9.269  72.540  93.935  1.00 64.51  ? 222  GLU A CB    1 
ATOM   4726  C  CG    . GLU E 3 222 ? 9.208  73.918  93.334  1.00 78.48  ? 222  GLU A CG    1 
ATOM   4727  C  CD    . GLU E 3 222 ? 8.667  73.896  91.915  1.00 92.23  ? 222  GLU A CD    1 
ATOM   4728  O  OE1   . GLU E 3 222 ? 7.544  73.366  91.717  1.00 90.53  ? 222  GLU A OE1   1 
ATOM   4729  O  OE2   . GLU E 3 222 ? 9.368  74.409  91.006  1.00 95.82  ? 222  GLU A OE2   1 
ATOM   4730  N  N     . ARG E 3 223 ? 9.567  71.610  96.853  1.00 55.47  ? 223  ARG A N     1 
ATOM   4731  C  CA    . ARG E 3 223 ? 9.273  71.720  98.270  1.00 53.33  ? 223  ARG A CA    1 
ATOM   4732  C  C     . ARG E 3 223 ? 10.533 71.704  99.126  1.00 54.25  ? 223  ARG A C     1 
ATOM   4733  O  O     . ARG E 3 223 ? 10.522 72.222  100.238 1.00 56.38  ? 223  ARG A O     1 
ATOM   4734  C  CB    . ARG E 3 223 ? 8.336  70.592  98.685  1.00 50.09  ? 223  ARG A CB    1 
ATOM   4735  C  CG    . ARG E 3 223 ? 8.094  70.422  100.183 1.00 38.37  ? 223  ARG A CG    1 
ATOM   4736  C  CD    . ARG E 3 223 ? 7.048  69.342  100.357 1.00 46.24  ? 223  ARG A CD    1 
ATOM   4737  N  NE    . ARG E 3 223 ? 6.856  68.861  101.718 1.00 55.85  ? 223  ARG A NE    1 
ATOM   4738  C  CZ    . ARG E 3 223 ? 6.450  69.608  102.738 1.00 62.94  ? 223  ARG A CZ    1 
ATOM   4739  N  NH1   . ARG E 3 223 ? 6.201  70.904  102.570 1.00 66.47  ? 223  ARG A NH1   1 
ATOM   4740  N  NH2   . ARG E 3 223 ? 6.235  69.041  103.921 1.00 60.61  ? 223  ARG A NH2   1 
ATOM   4741  N  N     . TRP E 3 224 ? 11.614 71.110  98.625  1.00 54.10  ? 224  TRP A N     1 
ATOM   4742  C  CA    . TRP E 3 224 ? 12.866 71.074  99.379  1.00 52.05  ? 224  TRP A CA    1 
ATOM   4743  C  C     . TRP E 3 224 ? 13.562 72.409  99.250  1.00 55.33  ? 224  TRP A C     1 
ATOM   4744  O  O     . TRP E 3 224 ? 14.242 72.857  100.168 1.00 58.66  ? 224  TRP A O     1 
ATOM   4745  C  CB    . TRP E 3 224 ? 13.795 69.980  98.863  1.00 39.52  ? 224  TRP A CB    1 
ATOM   4746  C  CG    . TRP E 3 224 ? 15.264 70.256  99.123  1.00 37.98  ? 224  TRP A CG    1 
ATOM   4747  C  CD1   . TRP E 3 224 ? 16.232 70.466  98.188  1.00 38.11  ? 224  TRP A CD1   1 
ATOM   4748  C  CD2   . TRP E 3 224 ? 15.917 70.343  100.393 1.00 37.29  ? 224  TRP A CD2   1 
ATOM   4749  N  NE1   . TRP E 3 224 ? 17.445 70.673  98.792  1.00 35.36  ? 224  TRP A NE1   1 
ATOM   4750  C  CE2   . TRP E 3 224 ? 17.277 70.602  100.147 1.00 38.02  ? 224  TRP A CE2   1 
ATOM   4751  C  CE3   . TRP E 3 224 ? 15.484 70.228  101.714 1.00 37.60  ? 224  TRP A CE3   1 
ATOM   4752  C  CZ2   . TRP E 3 224 ? 18.205 70.745  101.171 1.00 35.56  ? 224  TRP A CZ2   1 
ATOM   4753  C  CZ3   . TRP E 3 224 ? 16.409 70.370  102.736 1.00 28.92  ? 224  TRP A CZ3   1 
ATOM   4754  C  CH2   . TRP E 3 224 ? 17.753 70.625  102.459 1.00 32.39  ? 224  TRP A CH2   1 
ATOM   4755  N  N     . ILE E 3 225 ? 13.398 73.036  98.094  1.00 55.25  ? 225  ILE A N     1 
ATOM   4756  C  CA    . ILE E 3 225 ? 14.008 74.326  97.851  1.00 57.30  ? 225  ILE A CA    1 
ATOM   4757  C  C     . ILE E 3 225 ? 13.339 75.392  98.712  1.00 62.65  ? 225  ILE A C     1 
ATOM   4758  O  O     . ILE E 3 225 ? 13.994 76.295  99.230  1.00 64.91  ? 225  ILE A O     1 
ATOM   4759  C  CB    . ILE E 3 225 ? 13.899 74.707  96.364  1.00 43.09  ? 225  ILE A CB    1 
ATOM   4760  C  CG1   . ILE E 3 225 ? 14.893 73.884  95.556  1.00 42.62  ? 225  ILE A CG1   1 
ATOM   4761  C  CG2   . ILE E 3 225 ? 14.193 76.175  96.169  1.00 39.99  ? 225  ILE A CG2   1 
ATOM   4762  C  CD1   . ILE E 3 225 ? 15.027 74.339  94.136  1.00 32.84  ? 225  ILE A CD1   1 
ATOM   4763  N  N     . SER E 3 226 ? 12.028 75.275  98.867  1.00 63.30  ? 226  SER A N     1 
ATOM   4764  C  CA    . SER E 3 226 ? 11.268 76.223  99.659  1.00 65.33  ? 226  SER A CA    1 
ATOM   4765  C  C     . SER E 3 226 ? 11.678 76.210  101.119 1.00 63.63  ? 226  SER A C     1 
ATOM   4766  O  O     . SER E 3 226 ? 11.733 77.251  101.761 1.00 68.08  ? 226  SER A O     1 
ATOM   4767  C  CB    . SER E 3 226 ? 9.777  75.910  99.556  1.00 69.10  ? 226  SER A CB    1 
ATOM   4768  O  OG    . SER E 3 226 ? 9.032  76.638  100.520 1.00 86.57  ? 226  SER A OG    1 
ATOM   4769  N  N     . VAL E 3 227 ? 11.975 75.028  101.637 1.00 61.69  ? 227  VAL A N     1 
ATOM   4770  C  CA    . VAL E 3 227 ? 12.335 74.875  103.038 1.00 58.06  ? 227  VAL A CA    1 
ATOM   4771  C  C     . VAL E 3 227 ? 13.820 74.989  103.371 1.00 59.23  ? 227  VAL A C     1 
ATOM   4772  O  O     . VAL E 3 227 ? 14.182 75.312  104.499 1.00 57.77  ? 227  VAL A O     1 
ATOM   4773  C  CB    . VAL E 3 227 ? 11.823 73.528  103.563 1.00 48.38  ? 227  VAL A CB    1 
ATOM   4774  C  CG1   . VAL E 3 227 ? 12.142 73.380  105.032 1.00 49.15  ? 227  VAL A CG1   1 
ATOM   4775  C  CG2   . VAL E 3 227 ? 10.335 73.430  103.346 1.00 50.47  ? 227  VAL A CG2   1 
ATOM   4776  N  N     . SER E 3 228 ? 14.683 74.724  102.402 1.00 62.15  ? 228  SER A N     1 
ATOM   4777  C  CA    . SER E 3 228 ? 16.119 74.786  102.646 1.00 63.64  ? 228  SER A CA    1 
ATOM   4778  C  C     . SER E 3 228 ? 16.679 76.170  102.401 1.00 65.32  ? 228  SER A C     1 
ATOM   4779  O  O     . SER E 3 228 ? 17.714 76.536  102.946 1.00 66.20  ? 228  SER A O     1 
ATOM   4780  C  CB    . SER E 3 228 ? 16.845 73.798  101.737 1.00 61.12  ? 228  SER A CB    1 
ATOM   4781  O  OG    . SER E 3 228 ? 16.718 74.190  100.378 1.00 50.06  ? 228  SER A OG    1 
ATOM   4782  N  N     . GLY E 3 229 ? 15.993 76.930  101.559 1.00 64.26  ? 229  GLY A N     1 
ATOM   4783  C  CA    . GLY E 3 229 ? 16.455 78.262  101.232 1.00 64.52  ? 229  GLY A CA    1 
ATOM   4784  C  C     . GLY E 3 229 ? 17.803 78.169  100.557 1.00 66.66  ? 229  GLY A C     1 
ATOM   4785  O  O     . GLY E 3 229 ? 18.751 78.834  100.957 1.00 68.55  ? 229  GLY A O     1 
ATOM   4786  N  N     . VAL E 3 230 ? 17.893 77.327  99.536  1.00 66.64  ? 230  VAL A N     1 
ATOM   4787  C  CA    . VAL E 3 230 ? 19.140 77.148  98.813  1.00 66.87  ? 230  VAL A CA    1 
ATOM   4788  C  C     . VAL E 3 230 ? 19.209 78.126  97.661  1.00 69.14  ? 230  VAL A C     1 
ATOM   4789  O  O     . VAL E 3 230 ? 20.284 78.397  97.137  1.00 67.73  ? 230  VAL A O     1 
ATOM   4790  C  CB    . VAL E 3 230 ? 19.263 75.718  98.242  1.00 57.55  ? 230  VAL A CB    1 
ATOM   4791  C  CG1   . VAL E 3 230 ? 19.596 74.736  99.345  1.00 39.05  ? 230  VAL A CG1   1 
ATOM   4792  C  CG2   . VAL E 3 230 ? 17.964 75.316  97.580  1.00 58.03  ? 230  VAL A CG2   1 
ATOM   4793  N  N     . ALA E 3 231 ? 18.054 78.659  97.277  1.00 73.74  ? 231  ALA A N     1 
ATOM   4794  C  CA    . ALA E 3 231 ? 17.981 79.598  96.165  1.00 81.24  ? 231  ALA A CA    1 
ATOM   4795  C  C     . ALA E 3 231 ? 18.578 80.961  96.501  1.00 87.42  ? 231  ALA A C     1 
ATOM   4796  O  O     . ALA E 3 231 ? 18.871 81.749  95.600  1.00 90.27  ? 231  ALA A O     1 
ATOM   4797  C  CB    . ALA E 3 231 ? 16.532 79.757  95.702  1.00 71.52  ? 231  ALA A CB    1 
ATOM   4798  N  N     . ASP E 3 232 ? 18.762 81.240  97.789  1.00 89.79  ? 232  ASP A N     1 
ATOM   4799  C  CA    . ASP E 3 232 ? 19.341 82.512  98.223  1.00 92.10  ? 232  ASP A CA    1 
ATOM   4800  C  C     . ASP E 3 232 ? 20.573 82.897  97.392  1.00 91.69  ? 232  ASP A C     1 
ATOM   4801  O  O     . ASP E 3 232 ? 20.993 84.056  97.391  1.00 91.74  ? 232  ASP A O     1 
ATOM   4802  C  CB    . ASP E 3 232 ? 19.716 82.439  99.709  1.00 96.88  ? 232  ASP A CB    1 
ATOM   4803  C  CG    . ASP E 3 232 ? 18.533 82.708  100.626 1.00 101.93 ? 232  ASP A CG    1 
ATOM   4804  O  OD1   . ASP E 3 232 ? 17.415 82.240  100.315 1.00 99.77  ? 232  ASP A OD1   1 
ATOM   4805  O  OD2   . ASP E 3 232 ? 18.724 83.383  101.665 1.00 99.73  ? 232  ASP A OD2   1 
ATOM   4806  N  N     . ASP E 3 233 ? 21.142 81.918  96.693  1.00 90.21  ? 233  ASP A N     1 
ATOM   4807  C  CA    . ASP E 3 233 ? 22.306 82.132  95.842  1.00 88.71  ? 233  ASP A CA    1 
ATOM   4808  C  C     . ASP E 3 233 ? 22.287 81.086  94.743  1.00 87.77  ? 233  ASP A C     1 
ATOM   4809  O  O     . ASP E 3 233 ? 22.289 79.893  95.022  1.00 91.63  ? 233  ASP A O     1 
ATOM   4810  C  CB    . ASP E 3 233 ? 23.605 81.981  96.638  1.00 86.03  ? 233  ASP A CB    1 
ATOM   4811  C  CG    . ASP E 3 233 ? 24.853 82.157  95.771  1.00 85.92  ? 233  ASP A CG    1 
ATOM   4812  O  OD1   . ASP E 3 233 ? 24.776 81.967  94.539  1.00 82.40  ? 233  ASP A OD1   1 
ATOM   4813  O  OD2   . ASP E 3 233 ? 25.925 82.472  96.326  1.00 86.08  ? 233  ASP A OD2   1 
ATOM   4814  N  N     . PRO E 3 234 ? 22.266 81.521  93.475  1.00 84.35  ? 234  PRO A N     1 
ATOM   4815  C  CA    . PRO E 3 234 ? 22.249 80.604  92.332  1.00 81.11  ? 234  PRO A CA    1 
ATOM   4816  C  C     . PRO E 3 234 ? 23.445 79.650  92.268  1.00 77.35  ? 234  PRO A C     1 
ATOM   4817  O  O     . PRO E 3 234 ? 23.447 78.704  91.485  1.00 76.27  ? 234  PRO A O     1 
ATOM   4818  C  CB    . PRO E 3 234 ? 22.202 81.555  91.139  1.00 79.82  ? 234  PRO A CB    1 
ATOM   4819  C  CG    . PRO E 3 234 ? 21.375 82.686  91.670  1.00 80.55  ? 234  PRO A CG    1 
ATOM   4820  C  CD    . PRO E 3 234 ? 21.998 82.901  93.033  1.00 82.73  ? 234  PRO A CD    1 
ATOM   4821  N  N     . ASN E 3 235 ? 24.454 79.898  93.095  1.00 74.33  ? 235  ASN A N     1 
ATOM   4822  C  CA    . ASN E 3 235 ? 25.640 79.057  93.111  1.00 71.43  ? 235  ASN A CA    1 
ATOM   4823  C  C     . ASN E 3 235 ? 25.630 77.987  94.191  1.00 68.60  ? 235  ASN A C     1 
ATOM   4824  O  O     . ASN E 3 235 ? 26.562 77.189  94.291  1.00 67.54  ? 235  ASN A O     1 
ATOM   4825  C  CB    . ASN E 3 235 ? 26.886 79.922  93.246  1.00 70.77  ? 235  ASN A CB    1 
ATOM   4826  C  CG    . ASN E 3 235 ? 27.539 80.198  91.913  1.00 73.17  ? 235  ASN A CG    1 
ATOM   4827  O  OD1   . ASN E 3 235 ? 28.398 79.436  91.454  1.00 71.31  ? 235  ASN A OD1   1 
ATOM   4828  N  ND2   . ASN E 3 235 ? 27.121 81.283  91.267  1.00 70.71  ? 235  ASN A ND2   1 
ATOM   4829  N  N     . ASN E 3 236 ? 24.586 77.980  95.008  1.00 64.02  ? 236  ASN A N     1 
ATOM   4830  C  CA    . ASN E 3 236 ? 24.452 76.975  96.046  1.00 59.55  ? 236  ASN A CA    1 
ATOM   4831  C  C     . ASN E 3 236 ? 24.178 75.626  95.388  1.00 60.32  ? 236  ASN A C     1 
ATOM   4832  O  O     . ASN E 3 236 ? 23.594 75.555  94.306  1.00 61.59  ? 236  ASN A O     1 
ATOM   4833  C  CB    . ASN E 3 236 ? 23.270 77.292  96.952  1.00 51.96  ? 236  ASN A CB    1 
ATOM   4834  C  CG    . ASN E 3 236 ? 23.624 78.228  98.072  1.00 53.20  ? 236  ASN A CG    1 
ATOM   4835  O  OD1   . ASN E 3 236 ? 24.798 78.470  98.350  1.00 57.32  ? 236  ASN A OD1   1 
ATOM   4836  N  ND2   . ASN E 3 236 ? 22.603 78.750  98.748  1.00 51.17  ? 236  ASN A ND2   1 
ATOM   4837  N  N     . TYR E 3 237 ? 24.593 74.550  96.037  1.00 56.77  ? 237  TYR A N     1 
ATOM   4838  C  CA    . TYR E 3 237 ? 24.328 73.225  95.504  1.00 51.68  ? 237  TYR A CA    1 
ATOM   4839  C  C     . TYR E 3 237 ? 22.893 72.861  95.889  1.00 54.09  ? 237  TYR A C     1 
ATOM   4840  O  O     . TYR E 3 237 ? 22.383 73.347  96.901  1.00 52.63  ? 237  TYR A O     1 
ATOM   4841  C  CB    . TYR E 3 237 ? 25.284 72.223  96.115  1.00 43.95  ? 237  TYR A CB    1 
ATOM   4842  C  CG    . TYR E 3 237 ? 26.699 72.362  95.656  1.00 35.53  ? 237  TYR A CG    1 
ATOM   4843  C  CD1   . TYR E 3 237 ? 27.702 72.692  96.550  1.00 30.98  ? 237  TYR A CD1   1 
ATOM   4844  C  CD2   . TYR E 3 237 ? 27.054 72.077  94.350  1.00 37.47  ? 237  TYR A CD2   1 
ATOM   4845  C  CE1   . TYR E 3 237 ? 29.028 72.726  96.162  1.00 32.74  ? 237  TYR A CE1   1 
ATOM   4846  C  CE2   . TYR E 3 237 ? 28.379 72.106  93.950  1.00 39.27  ? 237  TYR A CE2   1 
ATOM   4847  C  CZ    . TYR E 3 237 ? 29.362 72.428  94.866  1.00 38.40  ? 237  TYR A CZ    1 
ATOM   4848  O  OH    . TYR E 3 237 ? 30.686 72.431  94.498  1.00 41.62  ? 237  TYR A OH    1 
ATOM   4849  N  N     . LEU E 3 238 ? 22.245 72.008  95.101  1.00 51.86  ? 238  LEU A N     1 
ATOM   4850  C  CA    . LEU E 3 238 ? 20.871 71.614  95.385  1.00 48.30  ? 238  LEU A CA    1 
ATOM   4851  C  C     . LEU E 3 238 ? 20.721 70.972  96.758  1.00 49.45  ? 238  LEU A C     1 
ATOM   4852  O  O     . LEU E 3 238 ? 19.785 71.289  97.497  1.00 50.07  ? 238  LEU A O     1 
ATOM   4853  C  CB    . LEU E 3 238 ? 20.359 70.628  94.334  1.00 45.32  ? 238  LEU A CB    1 
ATOM   4854  C  CG    . LEU E 3 238 ? 18.980 70.857  93.704  1.00 39.23  ? 238  LEU A CG    1 
ATOM   4855  C  CD1   . LEU E 3 238 ? 18.272 69.530  93.521  1.00 30.60  ? 238  LEU A CD1   1 
ATOM   4856  C  CD2   . LEU E 3 238 ? 18.154 71.769  94.575  1.00 34.45  ? 238  LEU A CD2   1 
ATOM   4857  N  N     . PHE E 3 239 ? 21.637 70.070  97.100  1.00 49.76  ? 239  PHE A N     1 
ATOM   4858  C  CA    . PHE E 3 239 ? 21.574 69.371  98.378  1.00 49.38  ? 239  PHE A CA    1 
ATOM   4859  C  C     . PHE E 3 239 ? 22.662 69.777  99.346  1.00 53.16  ? 239  PHE A C     1 
ATOM   4860  O  O     . PHE E 3 239 ? 23.785 70.053  98.943  1.00 56.90  ? 239  PHE A O     1 
ATOM   4861  C  CB    . PHE E 3 239 ? 21.628 67.869  98.138  1.00 34.35  ? 239  PHE A CB    1 
ATOM   4862  C  CG    . PHE E 3 239 ? 20.494 67.362  97.307  1.00 30.53  ? 239  PHE A CG    1 
ATOM   4863  C  CD1   . PHE E 3 239 ? 20.722 66.815  96.058  1.00 33.81  ? 239  PHE A CD1   1 
ATOM   4864  C  CD2   . PHE E 3 239 ? 19.187 67.461  97.763  1.00 36.50  ? 239  PHE A CD2   1 
ATOM   4865  C  CE1   . PHE E 3 239 ? 19.662 66.374  95.276  1.00 42.68  ? 239  PHE A CE1   1 
ATOM   4866  C  CE2   . PHE E 3 239 ? 18.122 67.024  96.988  1.00 42.00  ? 239  PHE A CE2   1 
ATOM   4867  C  CZ    . PHE E 3 239 ? 18.356 66.481  95.747  1.00 39.49  ? 239  PHE A CZ    1 
ATOM   4868  N  N     . CYS E 3 240 ? 22.322 69.794  100.631 1.00 54.49  ? 240  CYS A N     1 
ATOM   4869  C  CA    . CYS E 3 240 ? 23.257 70.196  101.677 1.00 53.96  ? 240  CYS A CA    1 
ATOM   4870  C  C     . CYS E 3 240 ? 22.884 69.541  102.999 1.00 53.98  ? 240  CYS A C     1 
ATOM   4871  O  O     . CYS E 3 240 ? 21.977 68.711  103.053 1.00 54.25  ? 240  CYS A O     1 
ATOM   4872  C  CB    . CYS E 3 240 ? 23.171 71.691  101.862 1.00 45.90  ? 240  CYS A CB    1 
ATOM   4873  S  SG    . CYS E 3 240 ? 21.496 72.105  102.352 1.00 34.77  ? 240  CYS A SG    1 
ATOM   4874  N  N     . ARG E 3 241 ? 23.566 69.947  104.066 1.00 52.78  ? 241  ARG A N     1 
ATOM   4875  C  CA    . ARG E 3 241 ? 23.316 69.406  105.397 1.00 51.73  ? 241  ARG A CA    1 
ATOM   4876  C  C     . ARG E 3 241 ? 22.018 69.901  106.004 1.00 51.40  ? 241  ARG A C     1 
ATOM   4877  O  O     . ARG E 3 241 ? 21.381 70.815  105.495 1.00 50.77  ? 241  ARG A O     1 
ATOM   4878  C  CB    . ARG E 3 241 ? 24.444 69.784  106.348 1.00 41.27  ? 241  ARG A CB    1 
ATOM   4879  C  CG    . ARG E 3 241 ? 25.816 69.451  105.824 1.00 52.90  ? 241  ARG A CG    1 
ATOM   4880  C  CD    . ARG E 3 241 ? 26.920 69.934  106.761 1.00 50.99  ? 241  ARG A CD    1 
ATOM   4881  N  NE    . ARG E 3 241 ? 26.957 69.204  108.023 1.00 53.54  ? 241  ARG A NE    1 
ATOM   4882  C  CZ    . ARG E 3 241 ? 28.070 68.997  108.716 1.00 56.35  ? 241  ARG A CZ    1 
ATOM   4883  N  NH1   . ARG E 3 241 ? 29.223 69.464  108.265 1.00 52.94  ? 241  ARG A NH1   1 
ATOM   4884  N  NH2   . ARG E 3 241 ? 28.036 68.315  109.848 1.00 54.37  ? 241  ARG A NH2   1 
ATOM   4885  N  N     . VAL E 3 242 ? 21.643 69.266  107.103 1.00 51.00  ? 242  VAL A N     1 
ATOM   4886  C  CA    . VAL E 3 242 ? 20.459 69.597  107.879 1.00 49.03  ? 242  VAL A CA    1 
ATOM   4887  C  C     . VAL E 3 242 ? 20.871 69.076  109.240 1.00 52.83  ? 242  VAL A C     1 
ATOM   4888  O  O     . VAL E 3 242 ? 20.966 67.867  109.442 1.00 55.26  ? 242  VAL A O     1 
ATOM   4889  C  CB    . VAL E 3 242 ? 19.215 68.850  107.390 1.00 36.30  ? 242  VAL A CB    1 
ATOM   4890  C  CG1   . VAL E 3 242 ? 18.099 68.976  108.397 1.00 43.27  ? 242  VAL A CG1   1 
ATOM   4891  C  CG2   . VAL E 3 242 ? 18.752 69.426  106.084 1.00 27.22  ? 242  VAL A CG2   1 
ATOM   4892  N  N     . ARG E 3 243 ? 21.139 69.996  110.160 1.00 54.45  ? 243  ARG A N     1 
ATOM   4893  C  CA    . ARG E 3 243 ? 21.606 69.650  111.491 1.00 54.10  ? 243  ARG A CA    1 
ATOM   4894  C  C     . ARG E 3 243 ? 20.592 69.146  112.501 1.00 54.91  ? 243  ARG A C     1 
ATOM   4895  O  O     . ARG E 3 243 ? 19.386 69.204  112.296 1.00 56.68  ? 243  ARG A O     1 
ATOM   4896  C  CB    . ARG E 3 243 ? 22.357 70.840  112.081 1.00 43.60  ? 243  ARG A CB    1 
ATOM   4897  C  CG    . ARG E 3 243 ? 23.659 71.120  111.377 1.00 32.78  ? 243  ARG A CG    1 
ATOM   4898  C  CD    . ARG E 3 243 ? 24.015 72.607  111.291 1.00 37.24  ? 243  ARG A CD    1 
ATOM   4899  N  NE    . ARG E 3 243 ? 25.243 72.825  110.520 1.00 42.71  ? 243  ARG A NE    1 
ATOM   4900  C  CZ    . ARG E 3 243 ? 26.399 72.198  110.760 1.00 50.06  ? 243  ARG A CZ    1 
ATOM   4901  N  NH1   . ARG E 3 243 ? 26.501 71.309  111.756 1.00 43.74  ? 243  ARG A NH1   1 
ATOM   4902  N  NH2   . ARG E 3 243 ? 27.456 72.445  109.992 1.00 39.15  ? 243  ARG A NH2   1 
ATOM   4903  N  N     . LYS E 3 244 ? 21.138 68.615  113.586 1.00 54.99  ? 244  LYS A N     1 
ATOM   4904  C  CA    . LYS E 3 244 ? 20.411 68.085  114.728 1.00 57.13  ? 244  LYS A CA    1 
ATOM   4905  C  C     . LYS E 3 244 ? 19.044 68.760  114.891 1.00 60.59  ? 244  LYS A C     1 
ATOM   4906  O  O     . LYS E 3 244 ? 18.052 68.110  115.215 1.00 61.21  ? 244  LYS A O     1 
ATOM   4907  C  CB    . LYS E 3 244 ? 21.277 68.355  115.966 1.00 51.11  ? 244  LYS A CB    1 
ATOM   4908  C  CG    . LYS E 3 244 ? 21.109 67.451  117.175 1.00 46.67  ? 244  LYS A CG    1 
ATOM   4909  C  CD    . LYS E 3 244 ? 22.164 67.841  118.214 1.00 49.15  ? 244  LYS A CD    1 
ATOM   4910  C  CE    . LYS E 3 244 ? 22.551 66.680  119.142 1.00 56.73  ? 244  LYS A CE    1 
ATOM   4911  N  NZ    . LYS E 3 244 ? 21.676 66.472  120.353 1.00 58.03  ? 244  LYS A NZ    1 
ATOM   4912  N  N     . ASN E 3 245 ? 19.009 70.067  114.648 1.00 61.62  ? 245  ASN A N     1 
ATOM   4913  C  CA    . ASN E 3 245 ? 17.811 70.884  114.812 1.00 61.67  ? 245  ASN A CA    1 
ATOM   4914  C  C     . ASN E 3 245 ? 16.874 71.070  113.618 1.00 64.24  ? 245  ASN A C     1 
ATOM   4915  O  O     . ASN E 3 245 ? 15.915 71.834  113.700 1.00 66.38  ? 245  ASN A O     1 
ATOM   4916  C  CB    . ASN E 3 245 ? 18.234 72.258  115.277 1.00 56.89  ? 245  ASN A CB    1 
ATOM   4917  C  CG    . ASN E 3 245 ? 19.095 72.946  114.265 1.00 56.23  ? 245  ASN A CG    1 
ATOM   4918  O  OD1   . ASN E 3 245 ? 18.666 73.194  113.149 1.00 55.01  ? 245  ASN A OD1   1 
ATOM   4919  N  ND2   . ASN E 3 245 ? 20.328 73.246  114.638 1.00 62.54  ? 245  ASN A ND2   1 
ATOM   4920  N  N     . GLY E 3 246 ? 17.155 70.421  112.501 1.00 63.85  ? 246  GLY A N     1 
ATOM   4921  C  CA    . GLY E 3 246 ? 16.276 70.558  111.356 1.00 61.34  ? 246  GLY A CA    1 
ATOM   4922  C  C     . GLY E 3 246 ? 16.497 71.766  110.472 1.00 59.02  ? 246  GLY A C     1 
ATOM   4923  O  O     . GLY E 3 246 ? 15.637 72.103  109.673 1.00 59.49  ? 246  GLY A O     1 
ATOM   4924  N  N     . VAL E 3 247 ? 17.641 72.418  110.583 1.00 58.38  ? 247  VAL A N     1 
ATOM   4925  C  CA    . VAL E 3 247 ? 17.892 73.584  109.749 1.00 58.24  ? 247  VAL A CA    1 
ATOM   4926  C  C     . VAL E 3 247 ? 18.824 73.272  108.589 1.00 61.88  ? 247  VAL A C     1 
ATOM   4927  O  O     . VAL E 3 247 ? 19.928 72.765  108.785 1.00 61.94  ? 247  VAL A O     1 
ATOM   4928  C  CB    . VAL E 3 247 ? 18.506 74.743  110.566 1.00 45.31  ? 247  VAL A CB    1 
ATOM   4929  C  CG1   . VAL E 3 247 ? 18.881 75.880  109.648 1.00 39.73  ? 247  VAL A CG1   1 
ATOM   4930  C  CG2   . VAL E 3 247 ? 17.511 75.239  111.588 1.00 34.78  ? 247  VAL A CG2   1 
ATOM   4931  N  N     . ALA E 3 248 ? 18.380 73.578  107.377 1.00 61.17  ? 248  ALA A N     1 
ATOM   4932  C  CA    . ALA E 3 248 ? 19.215 73.331  106.213 1.00 60.61  ? 248  ALA A CA    1 
ATOM   4933  C  C     . ALA E 3 248 ? 20.424 74.243  106.326 1.00 61.32  ? 248  ALA A C     1 
ATOM   4934  O  O     . ALA E 3 248 ? 20.383 75.244  107.028 1.00 64.11  ? 248  ALA A O     1 
ATOM   4935  C  CB    . ALA E 3 248 ? 18.444 73.633  104.945 1.00 60.02  ? 248  ALA A CB    1 
ATOM   4936  N  N     . ALA E 3 249 ? 21.500 73.907  105.633 1.00 61.95  ? 249  ALA A N     1 
ATOM   4937  C  CA    . ALA E 3 249 ? 22.700 74.722  105.697 1.00 60.18  ? 249  ALA A CA    1 
ATOM   4938  C  C     . ALA E 3 249 ? 23.363 74.853  104.338 1.00 59.72  ? 249  ALA A C     1 
ATOM   4939  O  O     . ALA E 3 249 ? 24.345 74.173  104.052 1.00 61.57  ? 249  ALA A O     1 
ATOM   4940  C  CB    . ALA E 3 249 ? 23.669 74.120  106.686 1.00 57.91  ? 249  ALA A CB    1 
ATOM   4941  N  N     . PRO E 3 250 ? 22.831 75.727  103.479 1.00 56.56  ? 250  PRO A N     1 
ATOM   4942  C  CA    . PRO E 3 250 ? 23.374 75.948  102.142 1.00 57.80  ? 250  PRO A CA    1 
ATOM   4943  C  C     . PRO E 3 250 ? 24.858 76.265  102.113 1.00 60.39  ? 250  PRO A C     1 
ATOM   4944  O  O     . PRO E 3 250 ? 25.446 76.621  103.130 1.00 62.77  ? 250  PRO A O     1 
ATOM   4945  C  CB    . PRO E 3 250 ? 22.527 77.092  101.626 1.00 54.37  ? 250  PRO A CB    1 
ATOM   4946  C  CG    . PRO E 3 250 ? 21.198 76.758  102.200 1.00 54.53  ? 250  PRO A CG    1 
ATOM   4947  C  CD    . PRO E 3 250 ? 21.536 76.407  103.626 1.00 54.80  ? 250  PRO A CD    1 
ATOM   4948  N  N     . SER E 3 251 ? 25.449 76.131  100.931 1.00 60.03  ? 251  SER A N     1 
ATOM   4949  C  CA    . SER E 3 251 ? 26.867 76.390  100.706 1.00 60.86  ? 251  SER A CA    1 
ATOM   4950  C  C     . SER E 3 251 ? 27.132 76.280  99.214  1.00 61.84  ? 251  SER A C     1 
ATOM   4951  O  O     . SER E 3 251 ? 26.369 75.638  98.496  1.00 65.60  ? 251  SER A O     1 
ATOM   4952  C  CB    . SER E 3 251 ? 27.725 75.361  101.455 1.00 57.61  ? 251  SER A CB    1 
ATOM   4953  O  OG    . SER E 3 251 ? 29.067 75.335  100.975 1.00 63.31  ? 251  SER A OG    1 
ATOM   4954  N  N     . ALA E 3 252 ? 28.200 76.907  98.738  1.00 61.36  ? 252  ALA A N     1 
ATOM   4955  C  CA    . ALA E 3 252 ? 28.529 76.818  97.324  1.00 62.76  ? 252  ALA A CA    1 
ATOM   4956  C  C     . ALA E 3 252 ? 29.973 76.377  97.191  1.00 65.55  ? 252  ALA A C     1 
ATOM   4957  O  O     . ALA E 3 252 ? 30.524 76.327  96.098  1.00 63.65  ? 252  ALA A O     1 
ATOM   4958  C  CB    . ALA E 3 252 ? 28.318 78.148  96.647  1.00 47.07  ? 252  ALA A CB    1 
ATOM   4959  N  N     . THR E 3 253 ? 30.577 76.040  98.319  1.00 68.65  ? 253  THR A N     1 
ATOM   4960  C  CA    . THR E 3 253 ? 31.960 75.603  98.328  1.00 69.82  ? 253  THR A CA    1 
ATOM   4961  C  C     . THR E 3 253 ? 32.079 74.153  98.781  1.00 68.63  ? 253  THR A C     1 
ATOM   4962  O  O     . THR E 3 253 ? 33.074 73.485  98.479  1.00 67.04  ? 253  THR A O     1 
ATOM   4963  C  CB    . THR E 3 253 ? 32.805 76.478  99.268  1.00 73.74  ? 253  THR A CB    1 
ATOM   4964  O  OG1   . THR E 3 253 ? 32.347 76.318  100.621 1.00 73.98  ? 253  THR A OG1   1 
ATOM   4965  C  CG2   . THR E 3 253 ? 32.689 77.932  98.863  1.00 67.84  ? 253  THR A CG2   1 
ATOM   4966  N  N     . SER E 3 254 ? 31.083 73.669  99.521  1.00 64.57  ? 254  SER A N     1 
ATOM   4967  C  CA    . SER E 3 254 ? 31.119 72.289  99.983  1.00 60.86  ? 254  SER A CA    1 
ATOM   4968  C  C     . SER E 3 254 ? 29.825 71.566  99.665  1.00 61.19  ? 254  SER A C     1 
ATOM   4969  O  O     . SER E 3 254 ? 28.759 71.963  100.122 1.00 63.18  ? 254  SER A O     1 
ATOM   4970  C  CB    . SER E 3 254 ? 31.370 72.219  101.485 1.00 50.52  ? 254  SER A CB    1 
ATOM   4971  O  OG    . SER E 3 254 ? 30.203 71.808  102.175 1.00 51.90  ? 254  SER A OG    1 
ATOM   4972  N  N     . GLN E 3 255 ? 29.926 70.503  98.874  1.00 55.05  ? 255  GLN A N     1 
ATOM   4973  C  CA    . GLN E 3 255 ? 28.765 69.713  98.507  1.00 50.63  ? 255  GLN A CA    1 
ATOM   4974  C  C     . GLN E 3 255 ? 28.614 68.615  99.529  1.00 49.57  ? 255  GLN A C     1 
ATOM   4975  O  O     . GLN E 3 255 ? 29.428 68.500  100.435 1.00 52.91  ? 255  GLN A O     1 
ATOM   4976  C  CB    . GLN E 3 255 ? 28.963 69.103  97.125  1.00 49.46  ? 255  GLN A CB    1 
ATOM   4977  C  CG    . GLN E 3 255 ? 30.420 68.986  96.712  1.00 52.11  ? 255  GLN A CG    1 
ATOM   4978  C  CD    . GLN E 3 255 ? 30.598 68.238  95.401  1.00 52.80  ? 255  GLN A CD    1 
ATOM   4979  O  OE1   . GLN E 3 255 ? 30.462 67.012  95.348  1.00 53.36  ? 255  GLN A OE1   1 
ATOM   4980  N  NE2   . GLN E 3 255 ? 30.894 68.975  94.335  1.00 51.51  ? 255  GLN A NE2   1 
ATOM   4981  N  N     . LEU E 3 256 ? 27.564 67.819  99.410  1.00 48.71  ? 256  LEU A N     1 
ATOM   4982  C  CA    . LEU E 3 256 ? 27.384 66.713  100.335 1.00 44.93  ? 256  LEU A CA    1 
ATOM   4983  C  C     . LEU E 3 256 ? 28.363 65.616  99.933  1.00 48.76  ? 256  LEU A C     1 
ATOM   4984  O  O     . LEU E 3 256 ? 28.769 65.519  98.775  1.00 51.74  ? 256  LEU A O     1 
ATOM   4985  C  CB    . LEU E 3 256 ? 25.977 66.161  100.233 1.00 39.85  ? 256  LEU A CB    1 
ATOM   4986  C  CG    . LEU E 3 256 ? 24.905 66.636  101.185 1.00 26.43  ? 256  LEU A CG    1 
ATOM   4987  C  CD1   . LEU E 3 256 ? 23.596 65.943  100.820 1.00 18.86  ? 256  LEU A CD1   1 
ATOM   4988  C  CD2   . LEU E 3 256 ? 25.313 66.297  102.599 1.00 20.20  ? 256  LEU A CD2   1 
ATOM   4989  N  N     . SER E 3 257 ? 28.752 64.782  100.881 1.00 46.39  ? 257  SER A N     1 
ATOM   4990  C  CA    . SER E 3 257 ? 29.673 63.714  100.556 1.00 47.92  ? 257  SER A CA    1 
ATOM   4991  C  C     . SER E 3 257 ? 28.850 62.661  99.865  1.00 49.30  ? 257  SER A C     1 
ATOM   4992  O  O     . SER E 3 257 ? 27.648 62.563  100.101 1.00 51.15  ? 257  SER A O     1 
ATOM   4993  C  CB    . SER E 3 257 ? 30.285 63.132  101.823 1.00 42.71  ? 257  SER A CB    1 
ATOM   4994  O  OG    . SER E 3 257 ? 29.274 62.649  102.685 1.00 44.65  ? 257  SER A OG    1 
ATOM   4995  N  N     . THR E 3 258 ? 29.477 61.887  98.990  1.00 47.60  ? 258  THR A N     1 
ATOM   4996  C  CA    . THR E 3 258 ? 28.738 60.832  98.324  1.00 44.74  ? 258  THR A CA    1 
ATOM   4997  C  C     . THR E 3 258 ? 28.465 59.825  99.406  1.00 42.38  ? 258  THR A C     1 
ATOM   4998  O  O     . THR E 3 258 ? 27.581 58.989  99.286  1.00 45.34  ? 258  THR A O     1 
ATOM   4999  C  CB    . THR E 3 258 ? 29.552 60.135  97.231  1.00 42.75  ? 258  THR A CB    1 
ATOM   5000  O  OG1   . THR E 3 258 ? 30.914 60.018  97.656  1.00 52.68  ? 258  THR A OG1   1 
ATOM   5001  C  CG2   . THR E 3 258 ? 29.456 60.901  95.919  1.00 36.45  ? 258  THR A CG2   1 
ATOM   5002  N  N     . ARG E 3 259 ? 29.235 59.916  100.477 1.00 37.47  ? 259  ARG A N     1 
ATOM   5003  C  CA    . ARG E 3 259 ? 29.061 58.990  101.567 1.00 35.22  ? 259  ARG A CA    1 
ATOM   5004  C  C     . ARG E 3 259 ? 27.721 59.158  102.228 1.00 37.27  ? 259  ARG A C     1 
ATOM   5005  O  O     . ARG E 3 259 ? 27.136 58.185  102.678 1.00 37.06  ? 259  ARG A O     1 
ATOM   5006  C  CB    . ARG E 3 259 ? 30.143 59.173  102.609 1.00 22.90  ? 259  ARG A CB    1 
ATOM   5007  C  CG    . ARG E 3 259 ? 30.031 58.197  103.726 1.00 11.32  ? 259  ARG A CG    1 
ATOM   5008  C  CD    . ARG E 3 259 ? 30.185 56.825  103.190 1.00 24.75  ? 259  ARG A CD    1 
ATOM   5009  N  NE    . ARG E 3 259 ? 30.163 55.842  104.251 1.00 32.32  ? 259  ARG A NE    1 
ATOM   5010  C  CZ    . ARG E 3 259 ? 29.091 55.155  104.597 1.00 28.41  ? 259  ARG A CZ    1 
ATOM   5011  N  NH1   . ARG E 3 259 ? 27.944 55.345  103.966 1.00 23.85  ? 259  ARG A NH1   1 
ATOM   5012  N  NH2   . ARG E 3 259 ? 29.181 54.255  105.552 1.00 28.02  ? 259  ARG A NH2   1 
ATOM   5013  N  N     . ALA E 3 260 ? 27.239 60.395  102.290 1.00 39.24  ? 260  ALA A N     1 
ATOM   5014  C  CA    . ALA E 3 260 ? 25.949 60.696  102.912 1.00 37.79  ? 260  ALA A CA    1 
ATOM   5015  C  C     . ALA E 3 260 ? 24.788 60.392  101.974 1.00 39.39  ? 260  ALA A C     1 
ATOM   5016  O  O     . ALA E 3 260 ? 23.711 60.021  102.420 1.00 44.64  ? 260  ALA A O     1 
ATOM   5017  C  CB    . ALA E 3 260 ? 25.899 62.150  103.324 1.00 20.18  ? 260  ALA A CB    1 
ATOM   5018  N  N     . LEU E 3 261 ? 24.995 60.570  100.677 1.00 38.01  ? 261  LEU A N     1 
ATOM   5019  C  CA    . LEU E 3 261 ? 23.934 60.272  99.754  1.00 34.69  ? 261  LEU A CA    1 
ATOM   5020  C  C     . LEU E 3 261 ? 23.713 58.766  99.826  1.00 37.97  ? 261  LEU A C     1 
ATOM   5021  O  O     . LEU E 3 261 ? 22.585 58.299  99.702  1.00 40.88  ? 261  LEU A O     1 
ATOM   5022  C  CB    . LEU E 3 261 ? 24.302 60.735  98.347  1.00 28.30  ? 261  LEU A CB    1 
ATOM   5023  C  CG    . LEU E 3 261 ? 24.530 62.259  98.235  1.00 29.68  ? 261  LEU A CG    1 
ATOM   5024  C  CD1   . LEU E 3 261 ? 24.633 62.650  96.773  1.00 24.46  ? 261  LEU A CD1   1 
ATOM   5025  C  CD2   . LEU E 3 261 ? 23.384 63.031  98.871  1.00 25.87  ? 261  LEU A CD2   1 
ATOM   5026  N  N     . GLU E 3 262 ? 24.776 57.996  100.051 1.00 36.46  ? 262  GLU A N     1 
ATOM   5027  C  CA    . GLU E 3 262 ? 24.629 56.546  100.180 1.00 34.07  ? 262  GLU A CA    1 
ATOM   5028  C  C     . GLU E 3 262 ? 23.976 56.312  101.526 1.00 34.80  ? 262  GLU A C     1 
ATOM   5029  O  O     . GLU E 3 262 ? 23.375 55.275  101.773 1.00 33.69  ? 262  GLU A O     1 
ATOM   5030  C  CB    . GLU E 3 262 ? 25.979 55.848  100.186 1.00 29.52  ? 262  GLU A CB    1 
ATOM   5031  C  CG    . GLU E 3 262 ? 26.571 55.584  98.837  1.00 54.43  ? 262  GLU A CG    1 
ATOM   5032  C  CD    . GLU E 3 262 ? 28.025 55.176  98.920  1.00 55.83  ? 262  GLU A CD    1 
ATOM   5033  O  OE1   . GLU E 3 262 ? 28.605 54.885  97.865  1.00 54.57  ? 262  GLU A OE1   1 
ATOM   5034  O  OE2   . GLU E 3 262 ? 28.593 55.154  100.030 1.00 58.98  ? 262  GLU A OE2   1 
ATOM   5035  N  N     . GLY E 3 263 ? 24.121 57.289  102.407 1.00 35.31  ? 263  GLY A N     1 
ATOM   5036  C  CA    . GLY E 3 263 ? 23.545 57.184  103.729 1.00 37.62  ? 263  GLY A CA    1 
ATOM   5037  C  C     . GLY E 3 263 ? 22.061 57.465  103.732 1.00 39.70  ? 263  GLY A C     1 
ATOM   5038  O  O     . GLY E 3 263 ? 21.368 57.120  104.678 1.00 40.00  ? 263  GLY A O     1 
ATOM   5039  N  N     . ILE E 3 264 ? 21.568 58.102  102.679 1.00 40.17  ? 264  ILE A N     1 
ATOM   5040  C  CA    . ILE E 3 264 ? 20.155 58.404  102.588 1.00 33.12  ? 264  ILE A CA    1 
ATOM   5041  C  C     . ILE E 3 264 ? 19.467 57.145  102.119 1.00 33.79  ? 264  ILE A C     1 
ATOM   5042  O  O     . ILE E 3 264 ? 18.427 56.768  102.637 1.00 34.33  ? 264  ILE A O     1 
ATOM   5043  C  CB    . ILE E 3 264 ? 19.911 59.556  101.614 1.00 24.40  ? 264  ILE A CB    1 
ATOM   5044  C  CG1   . ILE E 3 264 ? 20.339 60.864  102.281 1.00 21.92  ? 264  ILE A CG1   1 
ATOM   5045  C  CG2   . ILE E 3 264 ? 18.471 59.626  101.233 1.00 19.02  ? 264  ILE A CG2   1 
ATOM   5046  C  CD1   . ILE E 3 264 ? 20.082 62.089  101.471 1.00 13.77  ? 264  ILE A CD1   1 
ATOM   5047  N  N     . PHE E 3 265 ? 20.068 56.485  101.140 1.00 33.66  ? 265  PHE A N     1 
ATOM   5048  C  CA    . PHE E 3 265 ? 19.526 55.238  100.623 1.00 29.03  ? 265  PHE A CA    1 
ATOM   5049  C  C     . PHE E 3 265 ? 19.553 54.204  101.748 1.00 32.34  ? 265  PHE A C     1 
ATOM   5050  O  O     . PHE E 3 265 ? 18.616 53.457  101.907 1.00 34.47  ? 265  PHE A O     1 
ATOM   5051  C  CB    . PHE E 3 265 ? 20.382 54.709  99.469  1.00 15.13  ? 265  PHE A CB    1 
ATOM   5052  C  CG    . PHE E 3 265 ? 19.961 55.168  98.097  1.00 19.60  ? 265  PHE A CG    1 
ATOM   5053  C  CD1   . PHE E 3 265 ? 18.729 54.807  97.574  1.00 24.21  ? 265  PHE A CD1   1 
ATOM   5054  C  CD2   . PHE E 3 265 ? 20.835 55.908  97.299  1.00 15.28  ? 265  PHE A CD2   1 
ATOM   5055  C  CE1   . PHE E 3 265 ? 18.373 55.168  96.283  1.00 22.84  ? 265  PHE A CE1   1 
ATOM   5056  C  CE2   . PHE E 3 265 ? 20.493 56.278  96.009  1.00 15.89  ? 265  PHE A CE2   1 
ATOM   5057  C  CZ    . PHE E 3 265 ? 19.261 55.908  95.501  1.00 24.58  ? 265  PHE A CZ    1 
ATOM   5058  N  N     . GLU E 3 266 ? 20.624 54.159  102.532 1.00 38.70  ? 266  GLU A N     1 
ATOM   5059  C  CA    . GLU E 3 266 ? 20.704 53.164  103.588 1.00 40.92  ? 266  GLU A CA    1 
ATOM   5060  C  C     . GLU E 3 266 ? 19.636 53.351  104.621 1.00 44.60  ? 266  GLU A C     1 
ATOM   5061  O  O     . GLU E 3 266 ? 18.983 52.393  105.011 1.00 46.19  ? 266  GLU A O     1 
ATOM   5062  C  CB    . GLU E 3 266 ? 22.058 53.178  104.292 1.00 38.47  ? 266  GLU A CB    1 
ATOM   5063  C  CG    . GLU E 3 266 ? 22.217 51.986  105.241 1.00 60.01  ? 266  GLU A CG    1 
ATOM   5064  C  CD    . GLU E 3 266 ? 23.553 51.963  105.989 1.00 77.85  ? 266  GLU A CD    1 
ATOM   5065  O  OE1   . GLU E 3 266 ? 24.556 52.494  105.443 1.00 83.27  ? 266  GLU A OE1   1 
ATOM   5066  O  OE2   . GLU E 3 266 ? 23.602 51.396  107.115 1.00 74.76  ? 266  GLU A OE2   1 
ATOM   5067  N  N     . ALA E 3 267 ? 19.465 54.592  105.066 1.00 47.32  ? 267  ALA A N     1 
ATOM   5068  C  CA    . ALA E 3 267 ? 18.474 54.937  106.081 1.00 45.00  ? 267  ALA A CA    1 
ATOM   5069  C  C     . ALA E 3 267 ? 17.044 54.718  105.614 1.00 45.28  ? 267  ALA A C     1 
ATOM   5070  O  O     . ALA E 3 267 ? 16.237 54.123  106.313 1.00 47.33  ? 267  ALA A O     1 
ATOM   5071  C  CB    . ALA E 3 267 ? 18.650 56.357  106.482 1.00 30.26  ? 267  ALA A CB    1 
ATOM   5072  N  N     . THR E 3 268 ? 16.731 55.223  104.431 1.00 41.77  ? 268  THR A N     1 
ATOM   5073  C  CA    . THR E 3 268 ? 15.409 55.066  103.875 1.00 36.91  ? 268  THR A CA    1 
ATOM   5074  C  C     . THR E 3 268 ? 15.010 53.609  103.785 1.00 41.85  ? 268  THR A C     1 
ATOM   5075  O  O     . THR E 3 268 ? 13.831 53.283  103.826 1.00 45.83  ? 268  THR A O     1 
ATOM   5076  C  CB    . THR E 3 268 ? 15.346 55.693  102.498 1.00 29.57  ? 268  THR A CB    1 
ATOM   5077  O  OG1   . THR E 3 268 ? 15.231 57.112  102.643 1.00 34.37  ? 268  THR A OG1   1 
ATOM   5078  C  CG2   . THR E 3 268 ? 14.168 55.168  101.719 1.00 23.36  ? 268  THR A CG2   1 
ATOM   5079  N  N     . HIS E 3 269 ? 15.987 52.726  103.660 1.00 41.10  ? 269  HIS A N     1 
ATOM   5080  C  CA    . HIS E 3 269 ? 15.699 51.305  103.580 1.00 39.79  ? 269  HIS A CA    1 
ATOM   5081  C  C     . HIS E 3 269 ? 15.524 50.727  104.963 1.00 46.13  ? 269  HIS A C     1 
ATOM   5082  O  O     . HIS E 3 269 ? 14.863 49.711  105.138 1.00 48.88  ? 269  HIS A O     1 
ATOM   5083  C  CB    . HIS E 3 269 ? 16.823 50.576  102.876 1.00 22.90  ? 269  HIS A CB    1 
ATOM   5084  C  CG    . HIS E 3 269 ? 16.638 49.096  102.811 1.00 23.79  ? 269  HIS A CG    1 
ATOM   5085  N  ND1   . HIS E 3 269 ? 16.874 48.270  103.889 1.00 27.64  ? 269  HIS A ND1   1 
ATOM   5086  C  CD2   . HIS E 3 269 ? 16.231 48.291  101.800 1.00 24.20  ? 269  HIS A CD2   1 
ATOM   5087  C  CE1   . HIS E 3 269 ? 16.618 47.020  103.545 1.00 26.51  ? 269  HIS A CE1   1 
ATOM   5088  N  NE2   . HIS E 3 269 ? 16.225 47.005  102.284 1.00 19.90  ? 269  HIS A NE2   1 
ATOM   5089  N  N     . ARG E 3 270 ? 16.123 51.379  105.949 1.00 49.18  ? 270  ARG A N     1 
ATOM   5090  C  CA    . ARG E 3 270 ? 16.022 50.930  107.329 1.00 48.77  ? 270  ARG A CA    1 
ATOM   5091  C  C     . ARG E 3 270 ? 14.696 51.389  107.941 1.00 50.99  ? 270  ARG A C     1 
ATOM   5092  O  O     . ARG E 3 270 ? 14.189 50.786  108.880 1.00 52.90  ? 270  ARG A O     1 
ATOM   5093  C  CB    . ARG E 3 270 ? 17.189 51.484  108.132 1.00 42.81  ? 270  ARG A CB    1 
ATOM   5094  C  CG    . ARG E 3 270 ? 17.207 51.024  109.559 1.00 42.48  ? 270  ARG A CG    1 
ATOM   5095  C  CD    . ARG E 3 270 ? 18.491 51.442  110.262 1.00 45.50  ? 270  ARG A CD    1 
ATOM   5096  N  NE    . ARG E 3 270 ? 18.600 52.883  110.452 1.00 53.48  ? 270  ARG A NE    1 
ATOM   5097  C  CZ    . ARG E 3 270 ? 19.546 53.637  109.903 1.00 60.66  ? 270  ARG A CZ    1 
ATOM   5098  N  NH1   . ARG E 3 270 ? 20.467 53.086  109.119 1.00 50.19  ? 270  ARG A NH1   1 
ATOM   5099  N  NH2   . ARG E 3 270 ? 19.582 54.942  110.155 1.00 65.27  ? 270  ARG A NH2   1 
ATOM   5100  N  N     . LEU E 3 271 ? 14.142 52.463  107.391 1.00 52.30  ? 271  LEU A N     1 
ATOM   5101  C  CA    . LEU E 3 271 ? 12.880 53.015  107.853 1.00 48.56  ? 271  LEU A CA    1 
ATOM   5102  C  C     . LEU E 3 271 ? 11.754 52.092  107.457 1.00 49.07  ? 271  LEU A C     1 
ATOM   5103  O  O     . LEU E 3 271 ? 10.761 51.972  108.157 1.00 50.28  ? 271  LEU A O     1 
ATOM   5104  C  CB    . LEU E 3 271 ? 12.644 54.369  107.210 1.00 39.32  ? 271  LEU A CB    1 
ATOM   5105  C  CG    . LEU E 3 271 ? 11.268 54.996  107.393 1.00 41.22  ? 271  LEU A CG    1 
ATOM   5106  C  CD1   . LEU E 3 271 ? 11.311 55.985  108.549 1.00 36.35  ? 271  LEU A CD1   1 
ATOM   5107  C  CD2   . LEU E 3 271 ? 10.870 55.713  106.107 1.00 34.86  ? 271  LEU A CD2   1 
ATOM   5108  N  N     . ILE E 3 272 ? 11.909 51.445  106.314 1.00 47.72  ? 272  ILE A N     1 
ATOM   5109  C  CA    . ILE E 3 272 ? 10.892 50.542  105.818 1.00 44.25  ? 272  ILE A CA    1 
ATOM   5110  C  C     . ILE E 3 272 ? 11.079 49.088  106.217 1.00 46.26  ? 272  ILE A C     1 
ATOM   5111  O  O     . ILE E 3 272 ? 10.118 48.431  106.593 1.00 45.95  ? 272  ILE A O     1 
ATOM   5112  C  CB    . ILE E 3 272 ? 10.800 50.622  104.293 1.00 31.82  ? 272  ILE A CB    1 
ATOM   5113  C  CG1   . ILE E 3 272 ? 10.236 51.977  103.904 1.00 40.32  ? 272  ILE A CG1   1 
ATOM   5114  C  CG2   . ILE E 3 272 ? 9.935  49.508  103.754 1.00 19.50  ? 272  ILE A CG2   1 
ATOM   5115  C  CD1   . ILE E 3 272 ? 9.787  52.053  102.451 1.00 42.15  ? 272  ILE A CD1   1 
ATOM   5116  N  N     . TYR E 3 273 ? 12.303 48.577  106.142 1.00 45.48  ? 273  TYR A N     1 
ATOM   5117  C  CA    . TYR E 3 273 ? 12.527 47.179  106.476 1.00 43.47  ? 273  TYR A CA    1 
ATOM   5118  C  C     . TYR E 3 273 ? 13.252 46.942  107.797 1.00 44.95  ? 273  TYR A C     1 
ATOM   5119  O  O     . TYR E 3 273 ? 13.468 45.799  108.206 1.00 42.13  ? 273  TYR A O     1 
ATOM   5120  C  CB    . TYR E 3 273 ? 13.262 46.492  105.330 1.00 37.99  ? 273  TYR A CB    1 
ATOM   5121  C  CG    . TYR E 3 273 ? 12.554 46.627  104.005 1.00 34.78  ? 273  TYR A CG    1 
ATOM   5122  C  CD1   . TYR E 3 273 ? 12.947 47.584  103.087 1.00 32.81  ? 273  TYR A CD1   1 
ATOM   5123  C  CD2   . TYR E 3 273 ? 11.436 45.856  103.715 1.00 30.49  ? 273  TYR A CD2   1 
ATOM   5124  C  CE1   . TYR E 3 273 ? 12.242 47.788  101.919 1.00 30.52  ? 273  TYR A CE1   1 
ATOM   5125  C  CE2   . TYR E 3 273 ? 10.723 46.042  102.551 1.00 30.12  ? 273  TYR A CE2   1 
ATOM   5126  C  CZ    . TYR E 3 273 ? 11.121 47.019  101.652 1.00 33.79  ? 273  TYR A CZ    1 
ATOM   5127  O  OH    . TYR E 3 273 ? 10.358 47.282  100.519 1.00 39.23  ? 273  TYR A OH    1 
ATOM   5128  N  N     . GLY E 3 274 ? 13.621 48.030  108.460 1.00 45.23  ? 274  GLY A N     1 
ATOM   5129  C  CA    . GLY E 3 274 ? 14.276 47.923  109.744 1.00 48.37  ? 274  GLY A CA    1 
ATOM   5130  C  C     . GLY E 3 274 ? 15.756 47.647  109.721 1.00 53.82  ? 274  GLY A C     1 
ATOM   5131  O  O     . GLY E 3 274 ? 16.366 47.547  108.669 1.00 58.09  ? 274  GLY A O     1 
ATOM   5132  N  N     . ALA E 3 275 ? 16.318 47.535  110.920 1.00 56.81  ? 275  ALA A N     1 
ATOM   5133  C  CA    . ALA E 3 275 ? 17.731 47.265  111.156 1.00 56.46  ? 275  ALA A CA    1 
ATOM   5134  C  C     . ALA E 3 275 ? 18.271 46.330  110.108 1.00 57.12  ? 275  ALA A C     1 
ATOM   5135  O  O     . ALA E 3 275 ? 17.560 45.460  109.633 1.00 53.16  ? 275  ALA A O     1 
ATOM   5136  C  CB    . ALA E 3 275 ? 17.904 46.648  112.543 1.00 64.20  ? 275  ALA A CB    1 
ATOM   5137  N  N     . LYS E 3 276 ? 19.538 46.497  109.762 1.00 61.07  ? 276  LYS A N     1 
ATOM   5138  C  CA    . LYS E 3 276 ? 20.144 45.658  108.748 1.00 67.71  ? 276  LYS A CA    1 
ATOM   5139  C  C     . LYS E 3 276 ? 20.253 44.227  109.223 1.00 74.96  ? 276  LYS A C     1 
ATOM   5140  O  O     . LYS E 3 276 ? 19.494 43.795  110.074 1.00 73.53  ? 276  LYS A O     1 
ATOM   5141  C  CB    . LYS E 3 276 ? 21.520 46.195  108.364 1.00 50.97  ? 276  LYS A CB    1 
ATOM   5142  C  CG    . LYS E 3 276 ? 22.135 45.512  107.147 1.00 40.87  ? 276  LYS A CG    1 
ATOM   5143  C  CD    . LYS E 3 276 ? 23.470 46.125  106.766 1.00 31.67  ? 276  LYS A CD    1 
ATOM   5144  C  CE    . LYS E 3 276 ? 23.267 47.401  105.973 1.00 27.73  ? 276  LYS A CE    1 
ATOM   5145  N  NZ    . LYS E 3 276 ? 24.574 48.041  105.647 1.00 29.55  ? 276  LYS A NZ    1 
ATOM   5146  N  N     . ASP E 3 277 ? 21.205 43.498  108.667 1.00 83.33  ? 277  ASP A N     1 
ATOM   5147  C  CA    . ASP E 3 277 ? 21.420 42.098  108.988 1.00 89.74  ? 277  ASP A CA    1 
ATOM   5148  C  C     . ASP E 3 277 ? 22.676 41.956  109.849 1.00 90.78  ? 277  ASP A C     1 
ATOM   5149  O  O     . ASP E 3 277 ? 23.150 42.942  110.422 1.00 89.34  ? 277  ASP A O     1 
ATOM   5150  C  CB    . ASP E 3 277 ? 21.559 41.332  107.674 1.00 97.45  ? 277  ASP A CB    1 
ATOM   5151  C  CG    . ASP E 3 277 ? 21.469 39.845  107.844 1.00 101.11 ? 277  ASP A CG    1 
ATOM   5152  O  OD1   . ASP E 3 277 ? 21.114 39.393  108.952 1.00 104.88 ? 277  ASP A OD1   1 
ATOM   5153  O  OD2   . ASP E 3 277 ? 21.744 39.129  106.856 1.00 92.56  ? 277  ASP A OD2   1 
ATOM   5154  N  N     . ASP E 3 278 ? 23.218 40.743  109.938 1.00 93.09  ? 278  ASP A N     1 
ATOM   5155  C  CA    . ASP E 3 278 ? 24.412 40.502  110.748 1.00 95.62  ? 278  ASP A CA    1 
ATOM   5156  C  C     . ASP E 3 278 ? 25.627 40.033  109.977 1.00 95.58  ? 278  ASP A C     1 
ATOM   5157  O  O     . ASP E 3 278 ? 26.755 40.363  110.338 1.00 97.43  ? 278  ASP A O     1 
ATOM   5158  C  CB    . ASP E 3 278 ? 24.105 39.506  111.857 1.00 93.86  ? 278  ASP A CB    1 
ATOM   5159  C  CG    . ASP E 3 278 ? 23.495 40.171  113.060 1.00 97.23  ? 278  ASP A CG    1 
ATOM   5160  O  OD1   . ASP E 3 278 ? 24.185 41.021  113.673 1.00 97.60  ? 278  ASP A OD1   1 
ATOM   5161  O  OD2   . ASP E 3 278 ? 22.328 39.854  113.385 1.00 91.40  ? 278  ASP A OD2   1 
ATOM   5162  N  N     . SER E 3 279 ? 25.403 39.245  108.933 1.00 92.40  ? 279  SER A N     1 
ATOM   5163  C  CA    . SER E 3 279 ? 26.507 38.779  108.115 1.00 86.12  ? 279  SER A CA    1 
ATOM   5164  C  C     . SER E 3 279 ? 27.225 40.022  107.614 1.00 85.16  ? 279  SER A C     1 
ATOM   5165  O  O     . SER E 3 279 ? 26.706 41.132  107.722 1.00 85.61  ? 279  SER A O     1 
ATOM   5166  C  CB    . SER E 3 279 ? 25.976 37.969  106.937 1.00 67.10  ? 279  SER A CB    1 
ATOM   5167  O  OG    . SER E 3 279 ? 24.877 38.623  106.333 1.00 56.53  ? 279  SER A OG    1 
ATOM   5168  N  N     . GLY E 3 280 ? 28.423 39.854  107.080 1.00 81.25  ? 280  GLY A N     1 
ATOM   5169  C  CA    . GLY E 3 280 ? 29.135 41.016  106.587 1.00 76.55  ? 280  GLY A CA    1 
ATOM   5170  C  C     . GLY E 3 280 ? 28.666 41.295  105.183 1.00 73.41  ? 280  GLY A C     1 
ATOM   5171  O  O     . GLY E 3 280 ? 29.234 42.127  104.478 1.00 72.26  ? 280  GLY A O     1 
ATOM   5172  N  N     . GLN E 3 281 ? 27.612 40.590  104.786 1.00 69.51  ? 281  GLN A N     1 
ATOM   5173  C  CA    . GLN E 3 281 ? 27.057 40.721  103.447 1.00 66.01  ? 281  GLN A CA    1 
ATOM   5174  C  C     . GLN E 3 281 ? 26.929 42.139  102.920 1.00 60.52  ? 281  GLN A C     1 
ATOM   5175  O  O     . GLN E 3 281 ? 26.375 43.022  103.566 1.00 61.15  ? 281  GLN A O     1 
ATOM   5176  C  CB    . GLN E 3 281 ? 25.701 40.032  103.354 1.00 63.50  ? 281  GLN A CB    1 
ATOM   5177  C  CG    . GLN E 3 281 ? 25.768 38.517  103.284 1.00 70.36  ? 281  GLN A CG    1 
ATOM   5178  C  CD    . GLN E 3 281 ? 24.467 37.915  102.765 1.00 76.80  ? 281  GLN A CD    1 
ATOM   5179  O  OE1   . GLN E 3 281 ? 24.130 38.059  101.583 1.00 78.71  ? 281  GLN A OE1   1 
ATOM   5180  N  NE2   . GLN E 3 281 ? 23.723 37.251  103.650 1.00 72.68  ? 281  GLN A NE2   1 
ATOM   5181  N  N     . ARG E 3 282 ? 27.448 42.327  101.719 1.00 56.66  ? 282  ARG A N     1 
ATOM   5182  C  CA    . ARG E 3 282 ? 27.434 43.599  101.029 1.00 52.79  ? 282  ARG A CA    1 
ATOM   5183  C  C     . ARG E 3 282 ? 26.101 43.661  100.289 1.00 52.28  ? 282  ARG A C     1 
ATOM   5184  O  O     . ARG E 3 282 ? 25.581 42.634  99.875  1.00 52.31  ? 282  ARG A O     1 
ATOM   5185  C  CB    . ARG E 3 282 ? 28.596 43.603  100.044 1.00 45.55  ? 282  ARG A CB    1 
ATOM   5186  C  CG    . ARG E 3 282 ? 29.055 44.933  99.544  1.00 37.40  ? 282  ARG A CG    1 
ATOM   5187  C  CD    . ARG E 3 282 ? 30.563 45.036  99.700  1.00 44.11  ? 282  ARG A CD    1 
ATOM   5188  N  NE    . ARG E 3 282 ? 31.183 45.815  98.634  1.00 50.02  ? 282  ARG A NE    1 
ATOM   5189  C  CZ    . ARG E 3 282 ? 32.396 46.356  98.704  1.00 54.21  ? 282  ARG A CZ    1 
ATOM   5190  N  NH1   . ARG E 3 282 ? 33.144 46.214  99.794  1.00 46.36  ? 282  ARG A NH1   1 
ATOM   5191  N  NH2   . ARG E 3 282 ? 32.856 47.047  97.675  1.00 58.73  ? 282  ARG A NH2   1 
ATOM   5192  N  N     . TYR E 3 283 ? 25.532 44.851  100.147 1.00 50.83  ? 283  TYR A N     1 
ATOM   5193  C  CA    . TYR E 3 283 ? 24.270 45.012  99.440  1.00 44.76  ? 283  TYR A CA    1 
ATOM   5194  C  C     . TYR E 3 283 ? 23.017 44.457  100.122 1.00 46.81  ? 283  TYR A C     1 
ATOM   5195  O  O     . TYR E 3 283 ? 22.186 43.840  99.477  1.00 56.56  ? 283  TYR A O     1 
ATOM   5196  C  CB    . TYR E 3 283 ? 24.390 44.390  98.063  1.00 40.44  ? 283  TYR A CB    1 
ATOM   5197  C  CG    . TYR E 3 283 ? 25.361 45.069  97.126  1.00 37.42  ? 283  TYR A CG    1 
ATOM   5198  C  CD1   . TYR E 3 283 ? 26.044 44.341  96.157  1.00 39.52  ? 283  TYR A CD1   1 
ATOM   5199  C  CD2   . TYR E 3 283 ? 25.551 46.436  97.160  1.00 34.03  ? 283  TYR A CD2   1 
ATOM   5200  C  CE1   . TYR E 3 283 ? 26.879 44.956  95.254  1.00 33.06  ? 283  TYR A CE1   1 
ATOM   5201  C  CE2   . TYR E 3 283 ? 26.394 47.067  96.248  1.00 37.94  ? 283  TYR A CE2   1 
ATOM   5202  C  CZ    . TYR E 3 283 ? 27.050 46.318  95.302  1.00 32.64  ? 283  TYR A CZ    1 
ATOM   5203  O  OH    . TYR E 3 283 ? 27.862 46.939  94.391  1.00 29.13  ? 283  TYR A OH    1 
ATOM   5204  N  N     . LEU E 3 284 ? 22.867 44.675  101.419 1.00 42.80  ? 284  LEU A N     1 
ATOM   5205  C  CA    . LEU E 3 284 ? 21.678 44.204  102.110 1.00 38.99  ? 284  LEU A CA    1 
ATOM   5206  C  C     . LEU E 3 284 ? 20.647 45.324  102.230 1.00 43.39  ? 284  LEU A C     1 
ATOM   5207  O  O     . LEU E 3 284 ? 19.614 45.165  102.885 1.00 44.60  ? 284  LEU A O     1 
ATOM   5208  C  CB    . LEU E 3 284 ? 22.023 43.736  103.509 1.00 22.73  ? 284  LEU A CB    1 
ATOM   5209  C  CG    . LEU E 3 284 ? 22.954 42.552  103.668 1.00 13.30  ? 284  LEU A CG    1 
ATOM   5210  C  CD1   . LEU E 3 284 ? 23.061 42.252  105.141 1.00 6.28   ? 284  LEU A CD1   1 
ATOM   5211  C  CD2   . LEU E 3 284 ? 22.444 41.341  102.911 1.00 1.73   ? 284  LEU A CD2   1 
ATOM   5212  N  N     . ALA E 3 285 ? 20.941 46.464  101.615 1.00 41.50  ? 285  ALA A N     1 
ATOM   5213  C  CA    . ALA E 3 285 ? 20.064 47.627  101.659 1.00 34.04  ? 285  ALA A CA    1 
ATOM   5214  C  C     . ALA E 3 285 ? 20.407 48.515  100.492 1.00 36.00  ? 285  ALA A C     1 
ATOM   5215  O  O     . ALA E 3 285 ? 21.483 48.397  99.908  1.00 38.83  ? 285  ALA A O     1 
ATOM   5216  C  CB    . ALA E 3 285 ? 20.273 48.382  102.931 1.00 12.36  ? 285  ALA A CB    1 
ATOM   5217  N  N     . TRP E 3 286 ? 19.512 49.427  100.154 1.00 34.11  ? 286  TRP A N     1 
ATOM   5218  C  CA    . TRP E 3 286 ? 19.782 50.279  99.023  1.00 34.50  ? 286  TRP A CA    1 
ATOM   5219  C  C     . TRP E 3 286 ? 21.103 50.995  99.144  1.00 36.73  ? 286  TRP A C     1 
ATOM   5220  O  O     . TRP E 3 286 ? 21.576 51.260  100.239 1.00 36.97  ? 286  TRP A O     1 
ATOM   5221  C  CB    . TRP E 3 286 ? 18.656 51.268  98.851  1.00 31.15  ? 286  TRP A CB    1 
ATOM   5222  C  CG    . TRP E 3 286 ? 17.362 50.594  98.588  1.00 33.87  ? 286  TRP A CG    1 
ATOM   5223  C  CD1   . TRP E 3 286 ? 17.144 49.540  97.754  1.00 31.59  ? 286  TRP A CD1   1 
ATOM   5224  C  CD2   . TRP E 3 286 ? 16.088 50.951  99.128  1.00 32.07  ? 286  TRP A CD2   1 
ATOM   5225  N  NE1   . TRP E 3 286 ? 15.818 49.221  97.738  1.00 28.16  ? 286  TRP A NE1   1 
ATOM   5226  C  CE2   . TRP E 3 286 ? 15.145 50.070  98.579  1.00 31.82  ? 286  TRP A CE2   1 
ATOM   5227  C  CE3   . TRP E 3 286 ? 15.651 51.935  100.023 1.00 25.38  ? 286  TRP A CE3   1 
ATOM   5228  C  CZ2   . TRP E 3 286 ? 13.785 50.139  98.899  1.00 24.97  ? 286  TRP A CZ2   1 
ATOM   5229  C  CZ3   . TRP E 3 286 ? 14.304 52.004  100.334 1.00 19.11  ? 286  TRP A CZ3   1 
ATOM   5230  C  CH2   . TRP E 3 286 ? 13.390 51.113  99.777  1.00 10.63  ? 286  TRP A CH2   1 
ATOM   5231  N  N     . SER E 3 287 ? 21.719 51.267  98.005  1.00 35.04  ? 287  SER A N     1 
ATOM   5232  C  CA    . SER E 3 287 ? 22.983 51.972  97.977  1.00 34.17  ? 287  SER A CA    1 
ATOM   5233  C  C     . SER E 3 287 ? 22.859 52.958  96.848  1.00 35.48  ? 287  SER A C     1 
ATOM   5234  O  O     . SER E 3 287 ? 21.847 52.979  96.173  1.00 38.36  ? 287  SER A O     1 
ATOM   5235  C  CB    . SER E 3 287 ? 24.163 51.020  97.752  1.00 33.85  ? 287  SER A CB    1 
ATOM   5236  O  OG    . SER E 3 287 ? 24.002 50.218  96.599  1.00 44.57  ? 287  SER A OG    1 
ATOM   5237  N  N     . GLY E 3 288 ? 23.882 53.770  96.639  1.00 36.13  ? 288  GLY A N     1 
ATOM   5238  C  CA    . GLY E 3 288 ? 23.804 54.782  95.609  1.00 37.01  ? 288  GLY A CA    1 
ATOM   5239  C  C     . GLY E 3 288 ? 23.700 54.330  94.170  1.00 39.90  ? 288  GLY A C     1 
ATOM   5240  O  O     . GLY E 3 288 ? 23.861 55.142  93.259  1.00 41.64  ? 288  GLY A O     1 
ATOM   5241  N  N     . HIS E 3 289 ? 23.432 53.053  93.939  1.00 37.43  ? 289  HIS A N     1 
ATOM   5242  C  CA    . HIS E 3 289 ? 23.344 52.576  92.574  1.00 37.73  ? 289  HIS A CA    1 
ATOM   5243  C  C     . HIS E 3 289 ? 22.074 51.840  92.334  1.00 39.36  ? 289  HIS A C     1 
ATOM   5244  O  O     . HIS E 3 289 ? 21.862 51.304  91.257  1.00 41.37  ? 289  HIS A O     1 
ATOM   5245  C  CB    . HIS E 3 289 ? 24.494 51.643  92.255  1.00 38.13  ? 289  HIS A CB    1 
ATOM   5246  C  CG    . HIS E 3 289 ? 25.312 52.087  91.091  1.00 52.75  ? 289  HIS A CG    1 
ATOM   5247  N  ND1   . HIS E 3 289 ? 25.763 51.217  90.124  1.00 60.73  ? 289  HIS A ND1   1 
ATOM   5248  C  CD2   . HIS E 3 289 ? 25.761 53.315  90.736  1.00 53.14  ? 289  HIS A CD2   1 
ATOM   5249  C  CE1   . HIS E 3 289 ? 26.453 51.892  89.222  1.00 67.60  ? 289  HIS A CE1   1 
ATOM   5250  N  NE2   . HIS E 3 289 ? 26.467 53.166  89.570  1.00 56.10  ? 289  HIS A NE2   1 
ATOM   5251  N  N     . SER E 3 290 ? 21.226 51.814  93.345  1.00 38.14  ? 290  SER A N     1 
ATOM   5252  C  CA    . SER E 3 290 ? 19.968 51.110  93.261  1.00 33.03  ? 290  SER A CA    1 
ATOM   5253  C  C     . SER E 3 290 ? 18.938 51.769  92.370  1.00 31.80  ? 290  SER A C     1 
ATOM   5254  O  O     . SER E 3 290 ? 18.248 51.093  91.641  1.00 35.87  ? 290  SER A O     1 
ATOM   5255  C  CB    . SER E 3 290 ? 19.416 50.947  94.654  1.00 19.52  ? 290  SER A CB    1 
ATOM   5256  O  OG    . SER E 3 290 ? 20.440 50.528  95.537  1.00 36.59  ? 290  SER A OG    1 
ATOM   5257  N  N     . ALA E 3 291 ? 18.825 53.084  92.411  1.00 34.13  ? 291  ALA A N     1 
ATOM   5258  C  CA    . ALA E 3 291 ? 17.835 53.738  91.565  1.00 33.71  ? 291  ALA A CA    1 
ATOM   5259  C  C     . ALA E 3 291 ? 18.097 53.461  90.093  1.00 34.33  ? 291  ALA A C     1 
ATOM   5260  O  O     . ALA E 3 291 ? 17.167 53.425  89.303  1.00 32.73  ? 291  ALA A O     1 
ATOM   5261  C  CB    . ALA E 3 291 ? 17.810 55.245  91.823  1.00 26.80  ? 291  ALA A CB    1 
ATOM   5262  N  N     . ARG E 3 292 ? 19.361 53.271  89.723  1.00 37.26  ? 292  ARG A N     1 
ATOM   5263  C  CA    . ARG E 3 292 ? 19.721 52.983  88.328  1.00 35.70  ? 292  ARG A CA    1 
ATOM   5264  C  C     . ARG E 3 292 ? 19.315 51.557  87.961  1.00 37.30  ? 292  ARG A C     1 
ATOM   5265  O  O     . ARG E 3 292 ? 18.630 51.336  86.967  1.00 34.75  ? 292  ARG A O     1 
ATOM   5266  C  CB    . ARG E 3 292 ? 21.229 53.136  88.106  1.00 25.27  ? 292  ARG A CB    1 
ATOM   5267  C  CG    . ARG E 3 292 ? 21.761 54.560  88.150  1.00 20.99  ? 292  ARG A CG    1 
ATOM   5268  C  CD    . ARG E 3 292 ? 23.309 54.568  88.190  1.00 21.38  ? 292  ARG A CD    1 
ATOM   5269  N  NE    . ARG E 3 292 ? 23.907 54.082  86.949  1.00 33.00  ? 292  ARG A NE    1 
ATOM   5270  C  CZ    . ARG E 3 292 ? 23.959 54.789  85.827  1.00 33.28  ? 292  ARG A CZ    1 
ATOM   5271  N  NH1   . ARG E 3 292 ? 23.459 56.012  85.796  1.00 34.33  ? 292  ARG A NH1   1 
ATOM   5272  N  NH2   . ARG E 3 292 ? 24.493 54.272  84.730  1.00 31.27  ? 292  ARG A NH2   1 
ATOM   5273  N  N     . VAL E 3 293 ? 19.751 50.595  88.766  1.00 33.30  ? 293  VAL A N     1 
ATOM   5274  C  CA    . VAL E 3 293 ? 19.425 49.202  88.532  1.00 30.59  ? 293  VAL A CA    1 
ATOM   5275  C  C     . VAL E 3 293 ? 17.926 49.067  88.468  1.00 30.00  ? 293  VAL A C     1 
ATOM   5276  O  O     . VAL E 3 293 ? 17.397 48.403  87.594  1.00 30.93  ? 293  VAL A O     1 
ATOM   5277  C  CB    . VAL E 3 293 ? 19.930 48.306  89.677  1.00 27.51  ? 293  VAL A CB    1 
ATOM   5278  C  CG1   . VAL E 3 293 ? 19.463 46.873  89.469  1.00 14.99  ? 293  VAL A CG1   1 
ATOM   5279  C  CG2   . VAL E 3 293 ? 21.435 48.362  89.747  1.00 21.76  ? 293  VAL A CG2   1 
ATOM   5280  N  N     . GLY E 3 294 ? 17.251 49.703  89.415  1.00 29.24  ? 294  GLY A N     1 
ATOM   5281  C  CA    . GLY E 3 294 ? 15.803 49.650  89.489  1.00 31.86  ? 294  GLY A CA    1 
ATOM   5282  C  C     . GLY E 3 294 ? 15.147 50.286  88.282  1.00 32.71  ? 294  GLY A C     1 
ATOM   5283  O  O     . GLY E 3 294 ? 14.423 49.629  87.546  1.00 34.53  ? 294  GLY A O     1 
ATOM   5284  N  N     . ALA E 3 295 ? 15.400 51.566  88.063  1.00 30.17  ? 295  ALA A N     1 
ATOM   5285  C  CA    . ALA E 3 295 ? 14.816 52.245  86.934  1.00 27.67  ? 295  ALA A CA    1 
ATOM   5286  C  C     . ALA E 3 295 ? 15.096 51.491  85.645  1.00 29.83  ? 295  ALA A C     1 
ATOM   5287  O  O     . ALA E 3 295 ? 14.298 51.508  84.724  1.00 27.18  ? 295  ALA A O     1 
ATOM   5288  C  CB    . ALA E 3 295 ? 15.360 53.633  86.845  1.00 22.60  ? 295  ALA A CB    1 
ATOM   5289  N  N     . ALA E 3 296 ? 16.234 50.831  85.555  1.00 34.47  ? 296  ALA A N     1 
ATOM   5290  C  CA    . ALA E 3 296 ? 16.525 50.110  84.329  1.00 33.52  ? 296  ALA A CA    1 
ATOM   5291  C  C     . ALA E 3 296 ? 15.528 48.978  84.185  1.00 32.19  ? 296  ALA A C     1 
ATOM   5292  O  O     . ALA E 3 296 ? 14.988 48.751  83.109  1.00 31.85  ? 296  ALA A O     1 
ATOM   5293  C  CB    . ALA E 3 296 ? 17.944 49.563  84.346  1.00 29.16  ? 296  ALA A CB    1 
ATOM   5294  N  N     . ARG E 3 297 ? 15.270 48.268  85.271  1.00 32.05  ? 297  ARG A N     1 
ATOM   5295  C  CA    . ARG E 3 297 ? 14.332 47.158  85.213  1.00 35.07  ? 297  ARG A CA    1 
ATOM   5296  C  C     . ARG E 3 297 ? 12.898 47.604  84.920  1.00 34.80  ? 297  ARG A C     1 
ATOM   5297  O  O     . ARG E 3 297 ? 12.214 46.995  84.116  1.00 35.68  ? 297  ARG A O     1 
ATOM   5298  C  CB    . ARG E 3 297 ? 14.403 46.365  86.513  1.00 18.66  ? 297  ARG A CB    1 
ATOM   5299  C  CG    . ARG E 3 297 ? 15.796 45.914  86.821  1.00 18.62  ? 297  ARG A CG    1 
ATOM   5300  C  CD    . ARG E 3 297 ? 15.871 45.378  88.210  1.00 30.51  ? 297  ARG A CD    1 
ATOM   5301  N  NE    . ARG E 3 297 ? 14.960 44.262  88.357  1.00 29.34  ? 297  ARG A NE    1 
ATOM   5302  C  CZ    . ARG E 3 297 ? 15.342 42.993  88.323  1.00 36.51  ? 297  ARG A CZ    1 
ATOM   5303  N  NH1   . ARG E 3 297 ? 16.625 42.688  88.156  1.00 40.80  ? 297  ARG A NH1   1 
ATOM   5304  N  NH2   . ARG E 3 297 ? 14.442 42.029  88.448  1.00 31.98  ? 297  ARG A NH2   1 
ATOM   5305  N  N     . ASP E 3 298 ? 12.441 48.664  85.567  1.00 36.94  ? 298  ASP A N     1 
ATOM   5306  C  CA    . ASP E 3 298 ? 11.095 49.145  85.323  1.00 40.30  ? 298  ASP A CA    1 
ATOM   5307  C  C     . ASP E 3 298 ? 10.935 49.423  83.842  1.00 40.94  ? 298  ASP A C     1 
ATOM   5308  O  O     . ASP E 3 298 ? 9.939  49.059  83.227  1.00 43.89  ? 298  ASP A O     1 
ATOM   5309  C  CB    . ASP E 3 298 ? 10.825 50.448  86.079  1.00 38.77  ? 298  ASP A CB    1 
ATOM   5310  C  CG    . ASP E 3 298 ? 10.862 50.281  87.580  1.00 42.87  ? 298  ASP A CG    1 
ATOM   5311  O  OD1   . ASP E 3 298 ? 10.273 49.303  88.106  1.00 41.59  ? 298  ASP A OD1   1 
ATOM   5312  O  OD2   . ASP E 3 298 ? 11.470 51.152  88.231  1.00 47.66  ? 298  ASP A OD2   1 
ATOM   5313  N  N     . MET E 3 299 ? 11.934 50.089  83.283  1.00 42.59  ? 299  MET A N     1 
ATOM   5314  C  CA    . MET E 3 299 ? 11.940 50.465  81.879  1.00 41.26  ? 299  MET A CA    1 
ATOM   5315  C  C     . MET E 3 299 ? 11.815 49.234  80.997  1.00 42.91  ? 299  MET A C     1 
ATOM   5316  O  O     . MET E 3 299 ? 11.025 49.206  80.053  1.00 42.30  ? 299  MET A O     1 
ATOM   5317  C  CB    . MET E 3 299 ? 13.230 51.220  81.560  1.00 34.07  ? 299  MET A CB    1 
ATOM   5318  C  CG    . MET E 3 299 ? 13.007 52.538  80.831  1.00 33.85  ? 299  MET A CG    1 
ATOM   5319  S  SD    . MET E 3 299 ? 13.998 53.902  81.517  1.00 32.41  ? 299  MET A SD    1 
ATOM   5320  C  CE    . MET E 3 299 ? 15.672 53.234  81.216  1.00 36.37  ? 299  MET A CE    1 
ATOM   5321  N  N     . ALA E 3 300 ? 12.602 48.213  81.310  1.00 42.32  ? 300  ALA A N     1 
ATOM   5322  C  CA    . ALA E 3 300 ? 12.554 46.987  80.552  1.00 39.79  ? 300  ALA A CA    1 
ATOM   5323  C  C     . ALA E 3 300 ? 11.128 46.442  80.630  1.00 41.26  ? 300  ALA A C     1 
ATOM   5324  O  O     . ALA E 3 300 ? 10.481 46.248  79.615  1.00 45.85  ? 300  ALA A O     1 
ATOM   5325  C  CB    . ALA E 3 300 ? 13.544 45.992  81.119  1.00 35.93  ? 300  ALA A CB    1 
ATOM   5326  N  N     . ARG E 3 301 ? 10.623 46.228  81.835  1.00 41.18  ? 301  ARG A N     1 
ATOM   5327  C  CA    . ARG E 3 301 ? 9.279  45.694  81.999  1.00 37.99  ? 301  ARG A CA    1 
ATOM   5328  C  C     . ARG E 3 301 ? 8.228  46.496  81.239  1.00 41.85  ? 301  ARG A C     1 
ATOM   5329  O  O     . ARG E 3 301 ? 7.176  45.970  80.866  1.00 41.58  ? 301  ARG A O     1 
ATOM   5330  C  CB    . ARG E 3 301 ? 8.896  45.645  83.483  1.00 22.14  ? 301  ARG A CB    1 
ATOM   5331  C  CG    . ARG E 3 301 ? 9.819  44.825  84.384  1.00 17.37  ? 301  ARG A CG    1 
ATOM   5332  C  CD    . ARG E 3 301 ? 9.003  44.013  85.379  1.00 34.81  ? 301  ARG A CD    1 
ATOM   5333  N  NE    . ARG E 3 301 ? 9.772  43.604  86.552  1.00 47.13  ? 301  ARG A NE    1 
ATOM   5334  C  CZ    . ARG E 3 301 ? 10.193 44.449  87.493  1.00 48.95  ? 301  ARG A CZ    1 
ATOM   5335  N  NH1   . ARG E 3 301 ? 9.914  45.758  87.397  1.00 28.65  ? 301  ARG A NH1   1 
ATOM   5336  N  NH2   . ARG E 3 301 ? 10.897 43.989  88.527  1.00 41.87  ? 301  ARG A NH2   1 
ATOM   5337  N  N     . ALA E 3 302 ? 8.515  47.771  81.012  1.00 44.68  ? 302  ALA A N     1 
ATOM   5338  C  CA    . ALA E 3 302 ? 7.587  48.653  80.312  1.00 43.44  ? 302  ALA A CA    1 
ATOM   5339  C  C     . ALA E 3 302 ? 7.741  48.610  78.805  1.00 41.66  ? 302  ALA A C     1 
ATOM   5340  O  O     . ALA E 3 302 ? 7.183  49.443  78.109  1.00 39.59  ? 302  ALA A O     1 
ATOM   5341  C  CB    . ALA E 3 302 ? 7.762  50.084  80.795  1.00 44.10  ? 302  ALA A CB    1 
ATOM   5342  N  N     . GLY E 3 303 ? 8.510  47.653  78.304  1.00 42.56  ? 303  GLY A N     1 
ATOM   5343  C  CA    . GLY E 3 303 ? 8.698  47.539  76.871  1.00 47.24  ? 303  GLY A CA    1 
ATOM   5344  C  C     . GLY E 3 303 ? 9.501  48.638  76.201  1.00 49.92  ? 303  GLY A C     1 
ATOM   5345  O  O     . GLY E 3 303 ? 9.189  49.046  75.093  1.00 49.55  ? 303  GLY A O     1 
ATOM   5346  N  N     . VAL E 3 304 ? 10.540 49.120  76.864  1.00 51.30  ? 304  VAL A N     1 
ATOM   5347  C  CA    . VAL E 3 304 ? 11.376 50.158  76.292  1.00 45.38  ? 304  VAL A CA    1 
ATOM   5348  C  C     . VAL E 3 304 ? 12.521 49.481  75.566  1.00 47.29  ? 304  VAL A C     1 
ATOM   5349  O  O     . VAL E 3 304 ? 12.987 48.433  75.991  1.00 41.89  ? 304  VAL A O     1 
ATOM   5350  C  CB    . VAL E 3 304 ? 11.941 51.059  77.381  1.00 34.70  ? 304  VAL A CB    1 
ATOM   5351  C  CG1   . VAL E 3 304 ? 12.730 52.185  76.760  1.00 30.26  ? 304  VAL A CG1   1 
ATOM   5352  C  CG2   . VAL E 3 304 ? 10.809 51.607  78.228  1.00 19.85  ? 304  VAL A CG2   1 
ATOM   5353  N  N     . SER E 3 305 ? 12.974 50.074  74.469  1.00 52.79  ? 305  SER A N     1 
ATOM   5354  C  CA    . SER E 3 305 ? 14.069 49.498  73.685  1.00 52.68  ? 305  SER A CA    1 
ATOM   5355  C  C     . SER E 3 305 ? 15.397 49.715  74.387  1.00 51.87  ? 305  SER A C     1 
ATOM   5356  O  O     . SER E 3 305 ? 15.577 50.730  75.052  1.00 56.56  ? 305  SER A O     1 
ATOM   5357  C  CB    . SER E 3 305 ? 14.117 50.144  72.301  1.00 49.37  ? 305  SER A CB    1 
ATOM   5358  O  OG    . SER E 3 305 ? 14.346 51.537  72.406  1.00 49.54  ? 305  SER A OG    1 
ATOM   5359  N  N     . ILE E 3 306 ? 16.330 48.779  74.240  1.00 49.92  ? 306  ILE A N     1 
ATOM   5360  C  CA    . ILE E 3 306 ? 17.620 48.925  74.898  1.00 46.02  ? 306  ILE A CA    1 
ATOM   5361  C  C     . ILE E 3 306 ? 18.312 50.254  74.629  1.00 46.29  ? 306  ILE A C     1 
ATOM   5362  O  O     . ILE E 3 306 ? 18.868 50.856  75.545  1.00 44.68  ? 306  ILE A O     1 
ATOM   5363  C  CB    . ILE E 3 306 ? 18.575 47.812  74.526  1.00 38.00  ? 306  ILE A CB    1 
ATOM   5364  C  CG1   . ILE E 3 306 ? 17.986 46.480  74.946  1.00 20.50  ? 306  ILE A CG1   1 
ATOM   5365  C  CG2   . ILE E 3 306 ? 19.901 48.010  75.241  1.00 49.75  ? 306  ILE A CG2   1 
ATOM   5366  C  CD1   . ILE E 3 306 ? 17.810 46.343  76.453  1.00 29.20  ? 306  ILE A CD1   1 
ATOM   5367  N  N     . PRO E 3 307 ? 18.316 50.728  73.370  1.00 49.16  ? 307  PRO A N     1 
ATOM   5368  C  CA    . PRO E 3 307 ? 18.983 52.012  73.146  1.00 46.71  ? 307  PRO A CA    1 
ATOM   5369  C  C     . PRO E 3 307 ? 18.308 53.111  73.961  1.00 44.55  ? 307  PRO A C     1 
ATOM   5370  O  O     . PRO E 3 307 ? 18.968 53.922  74.594  1.00 45.28  ? 307  PRO A O     1 
ATOM   5371  C  CB    . PRO E 3 307 ? 18.829 52.213  71.648  1.00 42.46  ? 307  PRO A CB    1 
ATOM   5372  C  CG    . PRO E 3 307 ? 18.921 50.825  71.138  1.00 46.18  ? 307  PRO A CG    1 
ATOM   5373  C  CD    . PRO E 3 307 ? 18.008 50.082  72.085  1.00 48.58  ? 307  PRO A CD    1 
ATOM   5374  N  N     . GLU E 3 308 ? 16.986 53.128  73.965  1.00 44.79  ? 308  GLU A N     1 
ATOM   5375  C  CA    . GLU E 3 308 ? 16.282 54.142  74.723  1.00 46.57  ? 308  GLU A CA    1 
ATOM   5376  C  C     . GLU E 3 308 ? 16.544 53.989  76.228  1.00 46.65  ? 308  GLU A C     1 
ATOM   5377  O  O     . GLU E 3 308 ? 16.556 54.982  76.960  1.00 43.31  ? 308  GLU A O     1 
ATOM   5378  C  CB    . GLU E 3 308 ? 14.788 54.084  74.411  1.00 51.93  ? 308  GLU A CB    1 
ATOM   5379  C  CG    . GLU E 3 308 ? 14.135 55.455  74.442  1.00 69.87  ? 308  GLU A CG    1 
ATOM   5380  C  CD    . GLU E 3 308 ? 12.813 55.503  73.695  1.00 79.52  ? 308  GLU A CD    1 
ATOM   5381  O  OE1   . GLU E 3 308 ? 12.214 56.604  73.631  1.00 75.22  ? 308  GLU A OE1   1 
ATOM   5382  O  OE2   . GLU E 3 308 ? 12.376 54.448  73.174  1.00 83.39  ? 308  GLU A OE2   1 
ATOM   5383  N  N     . ILE E 3 309 ? 16.754 52.759  76.693  1.00 43.47  ? 309  ILE A N     1 
ATOM   5384  C  CA    . ILE E 3 309 ? 17.050 52.530  78.106  1.00 39.59  ? 309  ILE A CA    1 
ATOM   5385  C  C     . ILE E 3 309 ? 18.444 53.057  78.340  1.00 43.73  ? 309  ILE A C     1 
ATOM   5386  O  O     . ILE E 3 309 ? 18.670 53.915  79.183  1.00 44.05  ? 309  ILE A O     1 
ATOM   5387  C  CB    . ILE E 3 309 ? 17.080 51.033  78.472  1.00 30.69  ? 309  ILE A CB    1 
ATOM   5388  C  CG1   . ILE E 3 309 ? 15.686 50.513  78.762  1.00 23.64  ? 309  ILE A CG1   1 
ATOM   5389  C  CG2   . ILE E 3 309 ? 17.929 50.800  79.708  1.00 23.20  ? 309  ILE A CG2   1 
ATOM   5390  C  CD1   . ILE E 3 309 ? 15.712 49.051  79.178  1.00 24.97  ? 309  ILE A CD1   1 
ATOM   5391  N  N     . MET E 3 310 ? 19.385 52.518  77.579  1.00 48.16  ? 310  MET A N     1 
ATOM   5392  C  CA    . MET E 3 310 ? 20.769 52.921  77.698  1.00 49.85  ? 310  MET A CA    1 
ATOM   5393  C  C     . MET E 3 310 ? 20.941 54.426  77.678  1.00 50.04  ? 310  MET A C     1 
ATOM   5394  O  O     . MET E 3 310 ? 21.759 54.947  78.414  1.00 51.49  ? 310  MET A O     1 
ATOM   5395  C  CB    . MET E 3 310 ? 21.611 52.293  76.594  1.00 46.61  ? 310  MET A CB    1 
ATOM   5396  C  CG    . MET E 3 310 ? 21.818 50.804  76.759  1.00 48.31  ? 310  MET A CG    1 
ATOM   5397  S  SD    . MET E 3 310 ? 22.864 50.150  75.440  1.00 53.47  ? 310  MET A SD    1 
ATOM   5398  C  CE    . MET E 3 310 ? 24.484 50.589  76.037  1.00 42.66  ? 310  MET A CE    1 
ATOM   5399  N  N     . GLN E 3 311 ? 20.180 55.138  76.859  1.00 47.67  ? 311  GLN A N     1 
ATOM   5400  C  CA    . GLN E 3 311 ? 20.341 56.583  76.835  1.00 49.61  ? 311  GLN A CA    1 
ATOM   5401  C  C     . GLN E 3 311 ? 19.793 57.201  78.092  1.00 50.62  ? 311  GLN A C     1 
ATOM   5402  O  O     . GLN E 3 311 ? 20.330 58.173  78.608  1.00 51.30  ? 311  GLN A O     1 
ATOM   5403  C  CB    . GLN E 3 311 ? 19.635 57.217  75.640  1.00 49.64  ? 311  GLN A CB    1 
ATOM   5404  C  CG    . GLN E 3 311 ? 19.679 58.747  75.679  1.00 43.78  ? 311  GLN A CG    1 
ATOM   5405  C  CD    . GLN E 3 311 ? 18.358 59.370  76.105  1.00 41.42  ? 311  GLN A CD    1 
ATOM   5406  O  OE1   . GLN E 3 311 ? 18.295 60.553  76.446  1.00 41.60  ? 311  GLN A OE1   1 
ATOM   5407  N  NE2   . GLN E 3 311 ? 17.287 58.574  76.073  1.00 42.11  ? 311  GLN A NE2   1 
ATOM   5408  N  N     . ALA E 3 312 ? 18.703 56.634  78.574  1.00 51.24  ? 312  ALA A N     1 
ATOM   5409  C  CA    . ALA E 3 312 ? 18.067 57.135  79.771  1.00 49.92  ? 312  ALA A CA    1 
ATOM   5410  C  C     . ALA E 3 312 ? 19.052 57.190  80.930  1.00 50.62  ? 312  ALA A C     1 
ATOM   5411  O  O     . ALA E 3 312 ? 19.036 58.134  81.713  1.00 50.69  ? 312  ALA A O     1 
ATOM   5412  C  CB    . ALA E 3 312 ? 16.891 56.259  80.123  1.00 41.17  ? 312  ALA A CB    1 
ATOM   5413  N  N     . GLY E 3 313 ? 19.917 56.184  81.029  1.00 50.22  ? 313  GLY A N     1 
ATOM   5414  C  CA    . GLY E 3 313 ? 20.880 56.150  82.114  1.00 46.72  ? 313  GLY A CA    1 
ATOM   5415  C  C     . GLY E 3 313 ? 22.297 56.532  81.745  1.00 44.71  ? 313  GLY A C     1 
ATOM   5416  O  O     . GLY E 3 313 ? 23.176 56.570  82.596  1.00 43.29  ? 313  GLY A O     1 
ATOM   5417  N  N     . GLY E 3 314 ? 22.521 56.823  80.472  1.00 44.77  ? 314  GLY A N     1 
ATOM   5418  C  CA    . GLY E 3 314 ? 23.852 57.193  80.015  1.00 43.17  ? 314  GLY A CA    1 
ATOM   5419  C  C     . GLY E 3 314 ? 24.827 56.031  80.013  1.00 43.17  ? 314  GLY A C     1 
ATOM   5420  O  O     . GLY E 3 314 ? 25.956 56.157  80.467  1.00 43.55  ? 314  GLY A O     1 
ATOM   5421  N  N     . TRP E 3 315 ? 24.389 54.895  79.494  1.00 43.54  ? 315  TRP A N     1 
ATOM   5422  C  CA    . TRP E 3 315 ? 25.216 53.706  79.438  1.00 44.27  ? 315  TRP A CA    1 
ATOM   5423  C  C     . TRP E 3 315 ? 25.819 53.604  78.047  1.00 41.37  ? 315  TRP A C     1 
ATOM   5424  O  O     . TRP E 3 315 ? 25.338 54.245  77.142  1.00 33.36  ? 315  TRP A O     1 
ATOM   5425  C  CB    . TRP E 3 315 ? 24.350 52.467  79.725  1.00 44.01  ? 315  TRP A CB    1 
ATOM   5426  C  CG    . TRP E 3 315 ? 24.112 52.128  81.198  1.00 45.29  ? 315  TRP A CG    1 
ATOM   5427  C  CD1   . TRP E 3 315 ? 25.002 51.564  82.068  1.00 50.51  ? 315  TRP A CD1   1 
ATOM   5428  C  CD2   . TRP E 3 315 ? 22.879 52.251  81.920  1.00 51.26  ? 315  TRP A CD2   1 
ATOM   5429  N  NE1   . TRP E 3 315 ? 24.398 51.322  83.276  1.00 59.32  ? 315  TRP A NE1   1 
ATOM   5430  C  CE2   . TRP E 3 315 ? 23.096 51.734  83.211  1.00 55.25  ? 315  TRP A CE2   1 
ATOM   5431  C  CE3   . TRP E 3 315 ? 21.610 52.745  81.595  1.00 45.84  ? 315  TRP A CE3   1 
ATOM   5432  C  CZ2   . TRP E 3 315 ? 22.096 51.697  84.172  1.00 49.48  ? 315  TRP A CZ2   1 
ATOM   5433  C  CZ3   . TRP E 3 315 ? 20.619 52.704  82.549  1.00 45.79  ? 315  TRP A CZ3   1 
ATOM   5434  C  CH2   . TRP E 3 315 ? 20.865 52.185  83.823  1.00 49.35  ? 315  TRP A CH2   1 
ATOM   5435  N  N     . THR E 3 316 ? 26.874 52.817  77.874  1.00 43.13  ? 316  THR A N     1 
ATOM   5436  C  CA    . THR E 3 316 ? 27.456 52.651  76.550  1.00 46.49  ? 316  THR A CA    1 
ATOM   5437  C  C     . THR E 3 316 ? 27.879 51.222  76.258  1.00 49.90  ? 316  THR A C     1 
ATOM   5438  O  O     . THR E 3 316 ? 28.223 50.889  75.126  1.00 49.82  ? 316  THR A O     1 
ATOM   5439  C  CB    . THR E 3 316 ? 28.650 53.584  76.308  1.00 47.79  ? 316  THR A CB    1 
ATOM   5440  O  OG1   . THR E 3 316 ? 29.331 53.839  77.538  1.00 46.83  ? 316  THR A OG1   1 
ATOM   5441  C  CG2   . THR E 3 316 ? 28.183 54.881  75.700  1.00 52.97  ? 316  THR A CG2   1 
ATOM   5442  N  N     . ASN E 3 317 ? 27.883 50.373  77.274  1.00 50.36  ? 317  ASN A N     1 
ATOM   5443  C  CA    . ASN E 3 317 ? 28.214 48.973  77.034  1.00 58.32  ? 317  ASN A CA    1 
ATOM   5444  C  C     . ASN E 3 317 ? 27.008 48.181  77.519  1.00 58.90  ? 317  ASN A C     1 
ATOM   5445  O  O     . ASN E 3 317 ? 26.864 47.910  78.715  1.00 60.72  ? 317  ASN A O     1 
ATOM   5446  C  CB    . ASN E 3 317 ? 29.506 48.510  77.763  1.00 69.59  ? 317  ASN A CB    1 
ATOM   5447  C  CG    . ASN E 3 317 ? 30.106 49.571  78.682  1.00 70.50  ? 317  ASN A CG    1 
ATOM   5448  O  OD1   . ASN E 3 317 ? 31.322 49.800  78.674  1.00 52.36  ? 317  ASN A OD1   1 
ATOM   5449  N  ND2   . ASN E 3 317 ? 29.262 50.204  79.493  1.00 70.33  ? 317  ASN A ND2   1 
ATOM   5450  N  N     . VAL E 3 318 ? 26.133 47.838  76.579  1.00 55.29  ? 318  VAL A N     1 
ATOM   5451  C  CA    . VAL E 3 318 ? 24.922 47.100  76.889  1.00 50.75  ? 318  VAL A CA    1 
ATOM   5452  C  C     . VAL E 3 318 ? 25.143 45.932  77.846  1.00 49.15  ? 318  VAL A C     1 
ATOM   5453  O  O     . VAL E 3 318 ? 24.252 45.591  78.621  1.00 50.91  ? 318  VAL A O     1 
ATOM   5454  C  CB    . VAL E 3 318 ? 24.258 46.541  75.616  1.00 38.66  ? 318  VAL A CB    1 
ATOM   5455  C  CG1   . VAL E 3 318 ? 24.345 47.553  74.495  1.00 25.74  ? 318  VAL A CG1   1 
ATOM   5456  C  CG2   . VAL E 3 318 ? 24.914 45.229  75.220  1.00 33.31  ? 318  VAL A CG2   1 
ATOM   5457  N  N     . ASN E 3 319 ? 26.315 45.314  77.805  1.00 49.40  ? 319  ASN A N     1 
ATOM   5458  C  CA    . ASN E 3 319 ? 26.566 44.180  78.682  1.00 53.76  ? 319  ASN A CA    1 
ATOM   5459  C  C     . ASN E 3 319 ? 26.079 44.469  80.094  1.00 52.17  ? 319  ASN A C     1 
ATOM   5460  O  O     . ASN E 3 319 ? 25.632 43.574  80.796  1.00 49.27  ? 319  ASN A O     1 
ATOM   5461  C  CB    . ASN E 3 319 ? 28.054 43.843  78.730  1.00 71.60  ? 319  ASN A CB    1 
ATOM   5462  C  CG    . ASN E 3 319 ? 28.790 44.613  79.812  1.00 84.98  ? 319  ASN A CG    1 
ATOM   5463  O  OD1   . ASN E 3 319 ? 28.903 45.842  79.751  1.00 88.04  ? 319  ASN A OD1   1 
ATOM   5464  N  ND2   . ASN E 3 319 ? 29.289 43.892  80.815  1.00 83.19  ? 319  ASN A ND2   1 
ATOM   5465  N  N     . ILE E 3 320 ? 26.154 45.721  80.513  1.00 53.27  ? 320  ILE A N     1 
ATOM   5466  C  CA    . ILE E 3 320 ? 25.710 46.058  81.852  1.00 49.64  ? 320  ILE A CA    1 
ATOM   5467  C  C     . ILE E 3 320 ? 24.186 46.103  81.993  1.00 48.12  ? 320  ILE A C     1 
ATOM   5468  O  O     . ILE E 3 320 ? 23.628 45.347  82.791  1.00 49.09  ? 320  ILE A O     1 
ATOM   5469  C  CB    . ILE E 3 320 ? 26.288 47.403  82.315  1.00 49.36  ? 320  ILE A CB    1 
ATOM   5470  C  CG1   . ILE E 3 320 ? 27.814 47.404  82.154  1.00 52.33  ? 320  ILE A CG1   1 
ATOM   5471  C  CG2   . ILE E 3 320 ? 25.891 47.658  83.764  1.00 40.77  ? 320  ILE A CG2   1 
ATOM   5472  C  CD1   . ILE E 3 320 ? 28.554 46.393  83.029  1.00 50.32  ? 320  ILE A CD1   1 
ATOM   5473  N  N     . VAL E 3 321 ? 23.494 46.963  81.241  1.00 42.39  ? 321  VAL A N     1 
ATOM   5474  C  CA    . VAL E 3 321 ? 22.043 47.004  81.405  1.00 38.11  ? 321  VAL A CA    1 
ATOM   5475  C  C     . VAL E 3 321 ? 21.482 45.623  81.128  1.00 38.84  ? 321  VAL A C     1 
ATOM   5476  O  O     . VAL E 3 321 ? 20.382 45.305  81.561  1.00 37.88  ? 321  VAL A O     1 
ATOM   5477  C  CB    . VAL E 3 321 ? 21.331 48.051  80.498  1.00 26.26  ? 321  VAL A CB    1 
ATOM   5478  C  CG1   . VAL E 3 321 ? 22.128 49.306  80.448  1.00 27.18  ? 321  VAL A CG1   1 
ATOM   5479  C  CG2   . VAL E 3 321 ? 21.086 47.498  79.130  1.00 24.12  ? 321  VAL A CG2   1 
ATOM   5480  N  N     . MET E 3 322 ? 22.228 44.794  80.408  1.00 38.55  ? 322  MET A N     1 
ATOM   5481  C  CA    . MET E 3 322 ? 21.738 43.452  80.170  1.00 42.07  ? 322  MET A CA    1 
ATOM   5482  C  C     . MET E 3 322 ? 21.874 42.694  81.479  1.00 45.08  ? 322  MET A C     1 
ATOM   5483  O  O     . MET E 3 322 ? 21.014 41.901  81.854  1.00 48.58  ? 322  MET A O     1 
ATOM   5484  C  CB    . MET E 3 322 ? 22.531 42.745  79.075  1.00 32.57  ? 322  MET A CB    1 
ATOM   5485  C  CG    . MET E 3 322 ? 22.192 43.205  77.690  1.00 37.15  ? 322  MET A CG    1 
ATOM   5486  S  SD    . MET E 3 322 ? 20.435 43.566  77.574  1.00 48.27  ? 322  MET A SD    1 
ATOM   5487  C  CE    . MET E 3 322 ? 19.751 41.914  77.923  1.00 43.54  ? 322  MET A CE    1 
ATOM   5488  N  N     . ASN E 3 323 ? 22.960 42.949  82.185  1.00 45.97  ? 323  ASN A N     1 
ATOM   5489  C  CA    . ASN E 3 323 ? 23.163 42.289  83.452  1.00 48.90  ? 323  ASN A CA    1 
ATOM   5490  C  C     . ASN E 3 323 ? 22.121 42.721  84.467  1.00 47.29  ? 323  ASN A C     1 
ATOM   5491  O  O     . ASN E 3 323 ? 21.836 41.987  85.411  1.00 48.96  ? 323  ASN A O     1 
ATOM   5492  C  CB    . ASN E 3 323 ? 24.551 42.591  84.000  1.00 65.54  ? 323  ASN A CB    1 
ATOM   5493  C  CG    . ASN E 3 323 ? 25.467 41.410  83.901  1.00 72.90  ? 323  ASN A CG    1 
ATOM   5494  O  OD1   . ASN E 3 323 ? 25.866 41.011  82.805  1.00 74.59  ? 323  ASN A OD1   1 
ATOM   5495  N  ND2   . ASN E 3 323 ? 25.797 40.822  85.047  1.00 75.31  ? 323  ASN A ND2   1 
ATOM   5496  N  N     . TYR E 3 324 ? 21.552 43.907  84.288  1.00 44.35  ? 324  TYR A N     1 
ATOM   5497  C  CA    . TYR E 3 324 ? 20.553 44.383  85.233  1.00 41.16  ? 324  TYR A CA    1 
ATOM   5498  C  C     . TYR E 3 324 ? 19.142 43.854  84.967  1.00 38.97  ? 324  TYR A C     1 
ATOM   5499  O  O     . TYR E 3 324 ? 18.331 43.778  85.875  1.00 40.22  ? 324  TYR A O     1 
ATOM   5500  C  CB    . TYR E 3 324 ? 20.512 45.911  85.249  1.00 41.72  ? 324  TYR A CB    1 
ATOM   5501  C  CG    . TYR E 3 324 ? 21.713 46.603  85.852  1.00 41.67  ? 324  TYR A CG    1 
ATOM   5502  C  CD1   . TYR E 3 324 ? 22.473 46.003  86.842  1.00 42.45  ? 324  TYR A CD1   1 
ATOM   5503  C  CD2   . TYR E 3 324 ? 22.051 47.893  85.467  1.00 40.38  ? 324  TYR A CD2   1 
ATOM   5504  C  CE1   . TYR E 3 324 ? 23.539 46.678  87.430  1.00 42.17  ? 324  TYR A CE1   1 
ATOM   5505  C  CE2   . TYR E 3 324 ? 23.102 48.564  86.049  1.00 40.68  ? 324  TYR A CE2   1 
ATOM   5506  C  CZ    . TYR E 3 324 ? 23.840 47.957  87.027  1.00 41.53  ? 324  TYR A CZ    1 
ATOM   5507  O  OH    . TYR E 3 324 ? 24.875 48.644  87.608  1.00 40.47  ? 324  TYR A OH    1 
ATOM   5508  N  N     . ILE E 3 325 ? 18.848 43.489  83.728  1.00 37.70  ? 325  ILE A N     1 
ATOM   5509  C  CA    . ILE E 3 325 ? 17.523 42.990  83.393  1.00 35.78  ? 325  ILE A CA    1 
ATOM   5510  C  C     . ILE E 3 325 ? 17.576 41.522  82.991  1.00 40.08  ? 325  ILE A C     1 
ATOM   5511  O  O     . ILE E 3 325 ? 16.754 41.066  82.211  1.00 35.58  ? 325  ILE A O     1 
ATOM   5512  C  CB    . ILE E 3 325 ? 16.925 43.759  82.217  1.00 29.28  ? 325  ILE A CB    1 
ATOM   5513  C  CG1   . ILE E 3 325 ? 17.724 43.438  80.954  1.00 18.37  ? 325  ILE A CG1   1 
ATOM   5514  C  CG2   . ILE E 3 325 ? 16.971 45.260  82.477  1.00 18.47  ? 325  ILE A CG2   1 
ATOM   5515  C  CD1   . ILE E 3 325 ? 17.105 43.964  79.674  1.00 11.28  ? 325  ILE A CD1   1 
ATOM   5516  N  N     . ARG E 3 326 ? 18.529 40.774  83.534  1.00 46.63  ? 326  ARG A N     1 
ATOM   5517  C  CA    . ARG E 3 326 ? 18.664 39.371  83.163  1.00 53.52  ? 326  ARG A CA    1 
ATOM   5518  C  C     . ARG E 3 326 ? 17.661 38.400  83.746  1.00 53.26  ? 326  ARG A C     1 
ATOM   5519  O  O     . ARG E 3 326 ? 17.396 37.367  83.138  1.00 56.99  ? 326  ARG A O     1 
ATOM   5520  C  CB    . ARG E 3 326 ? 20.074 38.858  83.476  1.00 62.15  ? 326  ARG A CB    1 
ATOM   5521  C  CG    . ARG E 3 326 ? 20.504 39.022  84.918  1.00 76.16  ? 326  ARG A CG    1 
ATOM   5522  C  CD    . ARG E 3 326 ? 21.806 38.277  85.176  1.00 87.62  ? 326  ARG A CD    1 
ATOM   5523  N  NE    . ARG E 3 326 ? 22.746 38.439  84.069  1.00 94.75  ? 326  ARG A NE    1 
ATOM   5524  C  CZ    . ARG E 3 326 ? 23.942 37.863  84.011  1.00 97.67  ? 326  ARG A CZ    1 
ATOM   5525  N  NH1   . ARG E 3 326 ? 24.357 37.083  85.003  1.00 96.49  ? 326  ARG A NH1   1 
ATOM   5526  N  NH2   . ARG E 3 326 ? 24.721 38.063  82.956  1.00 94.45  ? 326  ARG A NH2   1 
ATOM   5527  N  N     . ASN E 3 327 ? 17.095 38.708  84.905  1.00 49.95  ? 327  ASN A N     1 
ATOM   5528  C  CA    . ASN E 3 327 ? 16.151 37.777  85.511  1.00 50.87  ? 327  ASN A CA    1 
ATOM   5529  C  C     . ASN E 3 327 ? 14.682 38.072  85.219  1.00 51.07  ? 327  ASN A C     1 
ATOM   5530  O  O     . ASN E 3 327 ? 13.797 37.465  85.824  1.00 46.48  ? 327  ASN A O     1 
ATOM   5531  C  CB    . ASN E 3 327 ? 16.393 37.711  87.015  1.00 57.43  ? 327  ASN A CB    1 
ATOM   5532  C  CG    . ASN E 3 327 ? 16.305 39.064  87.673  1.00 62.41  ? 327  ASN A CG    1 
ATOM   5533  O  OD1   . ASN E 3 327 ? 15.220 39.530  88.001  1.00 60.92  ? 327  ASN A OD1   1 
ATOM   5534  N  ND2   . ASN E 3 327 ? 17.449 39.713  87.858  1.00 65.66  ? 327  ASN A ND2   1 
ATOM   5535  N  N     . LEU E 3 328 ? 14.423 38.994  84.288  1.00 50.33  ? 328  LEU A N     1 
ATOM   5536  C  CA    . LEU E 3 328 ? 13.053 39.335  83.908  1.00 49.33  ? 328  LEU A CA    1 
ATOM   5537  C  C     . LEU E 3 328 ? 12.525 38.267  82.973  1.00 53.42  ? 328  LEU A C     1 
ATOM   5538  O  O     . LEU E 3 328 ? 13.299 37.516  82.389  1.00 50.69  ? 328  LEU A O     1 
ATOM   5539  C  CB    . LEU E 3 328 ? 12.991 40.676  83.178  1.00 37.68  ? 328  LEU A CB    1 
ATOM   5540  C  CG    . LEU E 3 328 ? 13.533 41.915  83.888  1.00 36.54  ? 328  LEU A CG    1 
ATOM   5541  C  CD1   . LEU E 3 328 ? 12.864 43.140  83.304  1.00 26.96  ? 328  LEU A CD1   1 
ATOM   5542  C  CD2   . LEU E 3 328 ? 13.266 41.839  85.381  1.00 33.16  ? 328  LEU A CD2   1 
ATOM   5543  N  N     . ASP E 3 329 ? 11.206 38.202  82.833  1.00 58.68  ? 329  ASP A N     1 
ATOM   5544  C  CA    . ASP E 3 329 ? 10.585 37.226  81.949  1.00 60.98  ? 329  ASP A CA    1 
ATOM   5545  C  C     . ASP E 3 329 ? 10.695 37.775  80.544  1.00 61.29  ? 329  ASP A C     1 
ATOM   5546  O  O     . ASP E 3 329 ? 10.565 37.055  79.561  1.00 61.38  ? 329  ASP A O     1 
ATOM   5547  C  CB    . ASP E 3 329 ? 9.132  37.033  82.345  1.00 71.11  ? 329  ASP A CB    1 
ATOM   5548  C  CG    . ASP E 3 329 ? 8.992  36.551  83.774  1.00 80.04  ? 329  ASP A CG    1 
ATOM   5549  O  OD1   . ASP E 3 329 ? 8.966  35.312  83.991  1.00 75.20  ? 329  ASP A OD1   1 
ATOM   5550  O  OD2   . ASP E 3 329 ? 8.933  37.418  84.680  1.00 85.47  ? 329  ASP A OD2   1 
ATOM   5551  N  N     . SER E 3 330 ? 10.945 39.073  80.472  1.00 61.30  ? 330  SER A N     1 
ATOM   5552  C  CA    . SER E 3 330 ? 11.120 39.759  79.213  1.00 60.41  ? 330  SER A CA    1 
ATOM   5553  C  C     . SER E 3 330 ? 12.350 39.168  78.518  1.00 62.91  ? 330  SER A C     1 
ATOM   5554  O  O     . SER E 3 330 ? 12.415 39.109  77.292  1.00 63.23  ? 330  SER A O     1 
ATOM   5555  C  CB    . SER E 3 330 ? 11.320 41.257  79.496  1.00 59.48  ? 330  SER A CB    1 
ATOM   5556  O  OG    . SER E 3 330 ? 12.085 41.915  78.491  1.00 59.92  ? 330  SER A OG    1 
ATOM   5557  N  N     . GLU E 3 331 ? 13.311 38.708  79.317  1.00 64.78  ? 331  GLU A N     1 
ATOM   5558  C  CA    . GLU E 3 331 ? 14.562 38.158  78.801  1.00 65.75  ? 331  GLU A CA    1 
ATOM   5559  C  C     . GLU E 3 331 ? 14.812 36.677  79.083  1.00 67.02  ? 331  GLU A C     1 
ATOM   5560  O  O     . GLU E 3 331 ? 15.962 36.294  79.291  1.00 66.35  ? 331  GLU A O     1 
ATOM   5561  C  CB    . GLU E 3 331 ? 15.746 38.938  79.383  1.00 66.13  ? 331  GLU A CB    1 
ATOM   5562  C  CG    . GLU E 3 331 ? 15.715 40.438  79.173  1.00 81.80  ? 331  GLU A CG    1 
ATOM   5563  C  CD    . GLU E 3 331 ? 16.214 40.846  77.802  1.00 89.20  ? 331  GLU A CD    1 
ATOM   5564  O  OE1   . GLU E 3 331 ? 17.296 40.356  77.403  1.00 84.77  ? 331  GLU A OE1   1 
ATOM   5565  O  OE2   . GLU E 3 331 ? 15.533 41.659  77.132  1.00 91.65  ? 331  GLU A OE2   1 
ATOM   5566  N  N     . THR E 3 332 ? 13.779 35.838  79.089  1.00 68.40  ? 332  THR A N     1 
ATOM   5567  C  CA    . THR E 3 332 ? 14.002 34.417  79.367  1.00 63.35  ? 332  THR A CA    1 
ATOM   5568  C  C     . THR E 3 332 ? 14.557 33.553  78.228  1.00 62.53  ? 332  THR A C     1 
ATOM   5569  O  O     . THR E 3 332 ? 15.228 32.555  78.500  1.00 62.53  ? 332  THR A O     1 
ATOM   5570  C  CB    . THR E 3 332 ? 12.744 33.746  79.927  1.00 52.18  ? 332  THR A CB    1 
ATOM   5571  O  OG1   . THR E 3 332 ? 11.577 34.324  79.341  1.00 52.05  ? 332  THR A OG1   1 
ATOM   5572  C  CG2   . THR E 3 332 ? 12.690 33.928  81.421  1.00 47.18  ? 332  THR A CG2   1 
ATOM   5573  N  N     . GLY E 3 333 ? 14.281 33.906  76.970  1.00 59.17  ? 333  GLY A N     1 
ATOM   5574  C  CA    . GLY E 3 333 ? 14.837 33.132  75.866  1.00 58.84  ? 333  GLY A CA    1 
ATOM   5575  C  C     . GLY E 3 333 ? 13.968 32.300  74.934  1.00 58.64  ? 333  GLY A C     1 
ATOM   5576  O  O     . GLY E 3 333 ? 12.810 32.016  75.223  1.00 59.37  ? 333  GLY A O     1 
ATOM   5577  N  N     . ALA E 3 334 ? 14.564 31.884  73.817  1.00 59.31  ? 334  ALA A N     1 
ATOM   5578  C  CA    . ALA E 3 334 ? 13.892 31.091  72.793  1.00 56.98  ? 334  ALA A CA    1 
ATOM   5579  C  C     . ALA E 3 334 ? 13.507 29.678  73.200  1.00 57.76  ? 334  ALA A C     1 
ATOM   5580  O  O     . ALA E 3 334 ? 12.420 29.223  72.869  1.00 56.89  ? 334  ALA A O     1 
ATOM   5581  C  CB    . ALA E 3 334 ? 14.748 31.035  71.546  1.00 46.34  ? 334  ALA A CB    1 
ATOM   5582  N  N     . MET E 3 335 ? 14.389 28.971  73.896  1.00 57.80  ? 335  MET A N     1 
ATOM   5583  C  CA    . MET E 3 335 ? 14.068 27.605  74.316  1.00 54.22  ? 335  MET A CA    1 
ATOM   5584  C  C     . MET E 3 335 ? 12.868 27.524  75.247  1.00 54.61  ? 335  MET A C     1 
ATOM   5585  O  O     . MET E 3 335 ? 12.215 26.492  75.330  1.00 56.43  ? 335  MET A O     1 
ATOM   5586  C  CB    . MET E 3 335 ? 15.267 26.941  74.994  1.00 46.26  ? 335  MET A CB    1 
ATOM   5587  C  CG    . MET E 3 335 ? 16.271 26.351  74.026  1.00 42.31  ? 335  MET A CG    1 
ATOM   5588  S  SD    . MET E 3 335 ? 15.495 25.262  72.816  1.00 41.52  ? 335  MET A SD    1 
ATOM   5589  C  CE    . MET E 3 335 ? 15.086 23.811  73.866  1.00 34.65  ? 335  MET A CE    1 
ATOM   5590  N  N     . VAL E 3 336 ? 12.577 28.598  75.965  1.00 52.35  ? 336  VAL A N     1 
ATOM   5591  C  CA    . VAL E 3 336 ? 11.429 28.572  76.853  1.00 48.33  ? 336  VAL A CA    1 
ATOM   5592  C  C     . VAL E 3 336 ? 10.209 28.823  76.001  1.00 48.99  ? 336  VAL A C     1 
ATOM   5593  O  O     . VAL E 3 336 ? 9.207  28.136  76.122  1.00 49.62  ? 336  VAL A O     1 
ATOM   5594  C  CB    . VAL E 3 336 ? 11.513 29.659  77.931  1.00 40.42  ? 336  VAL A CB    1 
ATOM   5595  C  CG1   . VAL E 3 336 ? 10.240 29.682  78.747  1.00 36.21  ? 336  VAL A CG1   1 
ATOM   5596  C  CG2   . VAL E 3 336 ? 12.697 29.390  78.831  1.00 38.16  ? 336  VAL A CG2   1 
ATOM   5597  N  N     . ARG E 3 337 ? 10.313 29.811  75.126  1.00 49.20  ? 337  ARG A N     1 
ATOM   5598  C  CA    . ARG E 3 337 ? 9.223  30.174  74.244  1.00 52.01  ? 337  ARG A CA    1 
ATOM   5599  C  C     . ARG E 3 337 ? 8.693  28.960  73.493  1.00 54.22  ? 337  ARG A C     1 
ATOM   5600  O  O     . ARG E 3 337 ? 7.490  28.816  73.336  1.00 57.84  ? 337  ARG A O     1 
ATOM   5601  C  CB    . ARG E 3 337 ? 9.699  31.234  73.259  1.00 57.65  ? 337  ARG A CB    1 
ATOM   5602  C  CG    . ARG E 3 337 ? 8.613  31.860  72.401  1.00 68.16  ? 337  ARG A CG    1 
ATOM   5603  C  CD    . ARG E 3 337 ? 9.265  32.576  71.223  1.00 75.44  ? 337  ARG A CD    1 
ATOM   5604  N  NE    . ARG E 3 337 ? 10.311 33.494  71.680  1.00 78.63  ? 337  ARG A NE    1 
ATOM   5605  C  CZ    . ARG E 3 337 ? 11.378 33.825  70.961  1.00 80.38  ? 337  ARG A CZ    1 
ATOM   5606  N  NH1   . ARG E 3 337 ? 11.545 33.311  69.747  1.00 78.91  ? 337  ARG A NH1   1 
ATOM   5607  N  NH2   . ARG E 3 337 ? 12.277 34.666  71.458  1.00 76.23  ? 337  ARG A NH2   1 
ATOM   5608  N  N     . LEU E 3 338 ? 9.580  28.092  73.018  1.00 53.09  ? 338  LEU A N     1 
ATOM   5609  C  CA    . LEU E 3 338 ? 9.139  26.895  72.303  1.00 50.63  ? 338  LEU A CA    1 
ATOM   5610  C  C     . LEU E 3 338 ? 8.389  25.986  73.253  1.00 54.86  ? 338  LEU A C     1 
ATOM   5611  O  O     . LEU E 3 338 ? 7.221  25.685  73.042  1.00 59.27  ? 338  LEU A O     1 
ATOM   5612  C  CB    . LEU E 3 338 ? 10.325 26.134  71.720  1.00 42.43  ? 338  LEU A CB    1 
ATOM   5613  C  CG    . LEU E 3 338 ? 10.798 26.548  70.328  1.00 37.41  ? 338  LEU A CG    1 
ATOM   5614  C  CD1   . LEU E 3 338 ? 10.981 28.049  70.285  1.00 38.70  ? 338  LEU A CD1   1 
ATOM   5615  C  CD2   . LEU E 3 338 ? 12.091 25.846  69.997  1.00 36.71  ? 338  LEU A CD2   1 
ATOM   5616  N  N     . LEU E 3 339 ? 9.070  25.549  74.303  1.00 56.85  ? 339  LEU A N     1 
ATOM   5617  C  CA    . LEU E 3 339 ? 8.473  24.686  75.304  1.00 58.80  ? 339  LEU A CA    1 
ATOM   5618  C  C     . LEU E 3 339 ? 7.122  25.195  75.807  1.00 63.49  ? 339  LEU A C     1 
ATOM   5619  O  O     . LEU E 3 339 ? 6.313  24.421  76.298  1.00 64.17  ? 339  LEU A O     1 
ATOM   5620  C  CB    . LEU E 3 339 ? 9.424  24.540  76.479  1.00 46.02  ? 339  LEU A CB    1 
ATOM   5621  C  CG    . LEU E 3 339 ? 10.663 23.704  76.220  1.00 41.23  ? 339  LEU A CG    1 
ATOM   5622  C  CD1   . LEU E 3 339 ? 11.557 23.745  77.436  1.00 43.33  ? 339  LEU A CD1   1 
ATOM   5623  C  CD2   . LEU E 3 339 ? 10.263 22.280  75.914  1.00 37.32  ? 339  LEU A CD2   1 
ATOM   5624  N  N     . GLU E 3 340 ? 6.882  26.492  75.691  1.00 66.25  ? 340  GLU A N     1 
ATOM   5625  C  CA    . GLU E 3 340 ? 5.628  27.068  76.140  1.00 73.83  ? 340  GLU A CA    1 
ATOM   5626  C  C     . GLU E 3 340 ? 4.781  27.536  74.958  1.00 81.24  ? 340  GLU A C     1 
ATOM   5627  O  O     . GLU E 3 340 ? 3.624  27.919  75.123  1.00 82.32  ? 340  GLU A O     1 
ATOM   5628  C  CB    . GLU E 3 340 ? 5.898  28.252  77.077  1.00 71.50  ? 340  GLU A CB    1 
ATOM   5629  C  CG    . GLU E 3 340 ? 6.381  27.885  78.484  1.00 70.26  ? 340  GLU A CG    1 
ATOM   5630  C  CD    . GLU E 3 340 ? 6.684  29.114  79.355  1.00 68.41  ? 340  GLU A CD    1 
ATOM   5631  O  OE1   . GLU E 3 340 ? 5.876  30.073  79.349  1.00 72.95  ? 340  GLU A OE1   1 
ATOM   5632  O  OE2   . GLU E 3 340 ? 7.723  29.117  80.058  1.00 63.86  ? 340  GLU A OE2   1 
ATOM   5633  N  N     . ASP E 3 341 ? 5.366  27.500  73.766  1.00 91.16  ? 341  ASP A N     1 
ATOM   5634  C  CA    . ASP E 3 341 ? 4.694  27.931  72.535  1.00 98.54  ? 341  ASP A CA    1 
ATOM   5635  C  C     . ASP E 3 341 ? 4.383  29.439  72.536  1.00 102.09 ? 341  ASP A C     1 
ATOM   5636  O  O     . ASP E 3 341 ? 3.265  29.820  72.108  1.00 104.17 ? 341  ASP A O     1 
ATOM   5637  C  CB    . ASP E 3 341 ? 3.394  27.145  72.332  1.00 96.72  ? 341  ASP A CB    1 
ATOM   5638  C  CG    . ASP E 3 341 ? 3.608  25.651  72.374  1.00 90.79  ? 341  ASP A CG    1 
ATOM   5639  O  OD1   . ASP E 3 341 ? 4.487  25.160  71.635  1.00 83.66  ? 341  ASP A OD1   1 
ATOM   5640  O  OD2   . ASP E 3 341 ? 2.898  24.969  73.144  1.00 83.48  ? 341  ASP A OD2   1 
ATOM   5641  N  N     . SER F 3 20  ? 69.376 58.736  61.277  1.00 100.09 ? 20   SER B N     1 
ATOM   5642  C  CA    . SER F 3 20  ? 70.105 57.493  60.875  1.00 99.31  ? 20   SER B CA    1 
ATOM   5643  C  C     . SER F 3 20  ? 69.941 57.219  59.380  1.00 100.47 ? 20   SER B C     1 
ATOM   5644  O  O     . SER F 3 20  ? 69.375 58.039  58.651  1.00 101.47 ? 20   SER B O     1 
ATOM   5645  C  CB    . SER F 3 20  ? 69.592 56.292  61.679  1.00 98.96  ? 20   SER B CB    1 
ATOM   5646  O  OG    . SER F 3 20  ? 70.239 55.089  61.289  1.00 91.73  ? 20   SER B OG    1 
ATOM   5647  N  N     . ASP F 3 21  ? 70.431 56.062  58.935  1.00 105.98 ? 21   ASP B N     1 
ATOM   5648  C  CA    . ASP F 3 21  ? 70.358 55.678  57.525  1.00 106.44 ? 21   ASP B CA    1 
ATOM   5649  C  C     . ASP F 3 21  ? 69.150 54.788  57.244  1.00 104.81 ? 21   ASP B C     1 
ATOM   5650  O  O     . ASP F 3 21  ? 68.405 55.024  56.291  1.00 104.00 ? 21   ASP B O     1 
ATOM   5651  C  CB    . ASP F 3 21  ? 71.643 54.950  57.113  1.00 108.50 ? 21   ASP B CB    1 
ATOM   5652  C  CG    . ASP F 3 21  ? 72.111 55.329  55.714  1.00 110.26 ? 21   ASP B CG    1 
ATOM   5653  O  OD1   . ASP F 3 21  ? 73.112 54.746  55.241  1.00 107.31 ? 21   ASP B OD1   1 
ATOM   5654  O  OD2   . ASP F 3 21  ? 71.484 56.215  55.087  1.00 106.19 ? 21   ASP B OD2   1 
ATOM   5655  N  N     . GLU F 3 22  ? 68.965 53.764  58.072  1.00 103.29 ? 22   GLU B N     1 
ATOM   5656  C  CA    . GLU F 3 22  ? 67.838 52.842  57.921  1.00 101.78 ? 22   GLU B CA    1 
ATOM   5657  C  C     . GLU F 3 22  ? 66.529 53.627  58.007  1.00 98.80  ? 22   GLU B C     1 
ATOM   5658  O  O     . GLU F 3 22  ? 65.532 53.269  57.381  1.00 99.49  ? 22   GLU B O     1 
ATOM   5659  C  CB    . GLU F 3 22  ? 67.876 51.784  59.025  1.00 103.67 ? 22   GLU B CB    1 
ATOM   5660  C  CG    . GLU F 3 22  ? 69.240 51.132  59.203  1.00 113.22 ? 22   GLU B CG    1 
ATOM   5661  C  CD    . GLU F 3 22  ? 69.332 50.309  60.479  1.00 119.81 ? 22   GLU B CD    1 
ATOM   5662  O  OE1   . GLU F 3 22  ? 69.075 50.870  61.571  1.00 119.39 ? 22   GLU B OE1   1 
ATOM   5663  O  OE2   . GLU F 3 22  ? 69.666 49.105  60.393  1.00 122.85 ? 22   GLU B OE2   1 
ATOM   5664  N  N     . VAL F 3 23  ? 66.551 54.702  58.790  1.00 94.43  ? 23   VAL B N     1 
ATOM   5665  C  CA    . VAL F 3 23  ? 65.386 55.560  58.967  1.00 88.84  ? 23   VAL B CA    1 
ATOM   5666  C  C     . VAL F 3 23  ? 65.050 56.294  57.669  1.00 89.34  ? 23   VAL B C     1 
ATOM   5667  O  O     . VAL F 3 23  ? 63.899 56.311  57.229  1.00 87.28  ? 23   VAL B O     1 
ATOM   5668  C  CB    . VAL F 3 23  ? 65.630 56.602  60.092  1.00 76.12  ? 23   VAL B CB    1 
ATOM   5669  C  CG1   . VAL F 3 23  ? 64.502 57.627  60.121  1.00 67.21  ? 23   VAL B CG1   1 
ATOM   5670  C  CG2   . VAL F 3 23  ? 65.735 55.895  61.433  1.00 58.28  ? 23   VAL B CG2   1 
ATOM   5671  N  N     . ARG F 3 24  ? 66.061 56.899  57.056  1.00 88.98  ? 24   ARG B N     1 
ATOM   5672  C  CA    . ARG F 3 24  ? 65.851 57.625  55.814  1.00 88.80  ? 24   ARG B CA    1 
ATOM   5673  C  C     . ARG F 3 24  ? 65.201 56.715  54.773  1.00 87.32  ? 24   ARG B C     1 
ATOM   5674  O  O     . ARG F 3 24  ? 64.345 57.155  54.004  1.00 87.57  ? 24   ARG B O     1 
ATOM   5675  C  CB    . ARG F 3 24  ? 67.185 58.187  55.299  1.00 93.19  ? 24   ARG B CB    1 
ATOM   5676  C  CG    . ARG F 3 24  ? 67.953 58.975  56.367  1.00 101.06 ? 24   ARG B CG    1 
ATOM   5677  C  CD    . ARG F 3 24  ? 69.072 59.863  55.809  1.00 108.18 ? 24   ARG B CD    1 
ATOM   5678  N  NE    . ARG F 3 24  ? 68.563 61.091  55.194  1.00 115.19 ? 24   ARG B NE    1 
ATOM   5679  C  CZ    . ARG F 3 24  ? 69.289 62.193  55.001  1.00 117.95 ? 24   ARG B CZ    1 
ATOM   5680  N  NH1   . ARG F 3 24  ? 70.564 62.230  55.375  1.00 119.85 ? 24   ARG B NH1   1 
ATOM   5681  N  NH2   . ARG F 3 24  ? 68.741 63.262  54.434  1.00 116.51 ? 24   ARG B NH2   1 
ATOM   5682  N  N     . LYS F 3 25  ? 65.595 55.444  54.755  1.00 83.47  ? 25   LYS B N     1 
ATOM   5683  C  CA    . LYS F 3 25  ? 65.013 54.507  53.802  1.00 82.20  ? 25   LYS B CA    1 
ATOM   5684  C  C     . LYS F 3 25  ? 63.534 54.335  54.112  1.00 83.66  ? 25   LYS B C     1 
ATOM   5685  O  O     . LYS F 3 25  ? 62.676 54.727  53.315  1.00 83.86  ? 25   LYS B O     1 
ATOM   5686  C  CB    . LYS F 3 25  ? 65.689 53.137  53.868  1.00 77.12  ? 25   LYS B CB    1 
ATOM   5687  C  CG    . LYS F 3 25  ? 65.103 52.160  52.851  1.00 77.74  ? 25   LYS B CG    1 
ATOM   5688  C  CD    . LYS F 3 25  ? 65.426 50.703  53.165  1.00 82.02  ? 25   LYS B CD    1 
ATOM   5689  C  CE    . LYS F 3 25  ? 64.687 49.762  52.207  1.00 82.41  ? 25   LYS B CE    1 
ATOM   5690  N  NZ    . LYS F 3 25  ? 64.925 48.318  52.503  1.00 70.86  ? 25   LYS B NZ    1 
ATOM   5691  N  N     . ASN F 3 26  ? 63.249 53.737  55.272  1.00 81.61  ? 26   ASN B N     1 
ATOM   5692  C  CA    . ASN F 3 26  ? 61.877 53.506  55.722  1.00 76.46  ? 26   ASN B CA    1 
ATOM   5693  C  C     . ASN F 3 26  ? 61.029 54.740  55.447  1.00 76.07  ? 26   ASN B C     1 
ATOM   5694  O  O     . ASN F 3 26  ? 59.926 54.645  54.913  1.00 76.52  ? 26   ASN B O     1 
ATOM   5695  C  CB    . ASN F 3 26  ? 61.855 53.194  57.221  1.00 73.67  ? 26   ASN B CB    1 
ATOM   5696  C  CG    . ASN F 3 26  ? 62.391 51.808  57.540  1.00 76.55  ? 26   ASN B CG    1 
ATOM   5697  O  OD1   . ASN F 3 26  ? 62.920 51.118  56.669  1.00 76.84  ? 26   ASN B OD1   1 
ATOM   5698  N  ND2   . ASN F 3 26  ? 62.255 51.395  58.797  1.00 66.92  ? 26   ASN B ND2   1 
ATOM   5699  N  N     . LEU F 3 27  ? 61.558 55.902  55.813  1.00 74.06  ? 27   LEU B N     1 
ATOM   5700  C  CA    . LEU F 3 27  ? 60.859 57.156  55.593  1.00 74.38  ? 27   LEU B CA    1 
ATOM   5701  C  C     . LEU F 3 27  ? 60.467 57.240  54.119  1.00 78.08  ? 27   LEU B C     1 
ATOM   5702  O  O     . LEU F 3 27  ? 59.321 57.546  53.781  1.00 78.48  ? 27   LEU B O     1 
ATOM   5703  C  CB    . LEU F 3 27  ? 61.769 58.336  55.946  1.00 66.60  ? 27   LEU B CB    1 
ATOM   5704  C  CG    . LEU F 3 27  ? 61.184 59.481  56.779  1.00 65.42  ? 27   LEU B CG    1 
ATOM   5705  C  CD1   . LEU F 3 27  ? 59.844 59.931  56.207  1.00 63.12  ? 27   LEU B CD1   1 
ATOM   5706  C  CD2   . LEU F 3 27  ? 61.018 59.020  58.212  1.00 60.90  ? 27   LEU B CD2   1 
ATOM   5707  N  N     . MET F 3 28  ? 61.425 56.951  53.243  1.00 79.46  ? 28   MET B N     1 
ATOM   5708  C  CA    . MET F 3 28  ? 61.183 57.013  51.808  1.00 81.41  ? 28   MET B CA    1 
ATOM   5709  C  C     . MET F 3 28  ? 60.217 55.966  51.256  1.00 81.61  ? 28   MET B C     1 
ATOM   5710  O  O     . MET F 3 28  ? 59.420 56.278  50.372  1.00 82.05  ? 28   MET B O     1 
ATOM   5711  C  CB    . MET F 3 28  ? 62.510 56.971  51.048  1.00 87.29  ? 28   MET B CB    1 
ATOM   5712  C  CG    . MET F 3 28  ? 63.144 58.350  50.872  1.00 93.54  ? 28   MET B CG    1 
ATOM   5713  S  SD    . MET F 3 28  ? 64.707 58.339  49.941  1.00 105.42 ? 28   MET B SD    1 
ATOM   5714  C  CE    . MET F 3 28  ? 65.509 59.882  50.548  1.00 96.87  ? 28   MET B CE    1 
ATOM   5715  N  N     . ASP F 3 29  ? 60.274 54.735  51.757  1.00 80.62  ? 29   ASP B N     1 
ATOM   5716  C  CA    . ASP F 3 29  ? 59.351 53.707  51.276  1.00 79.88  ? 29   ASP B CA    1 
ATOM   5717  C  C     . ASP F 3 29  ? 57.941 54.121  51.672  1.00 78.83  ? 29   ASP B C     1 
ATOM   5718  O  O     . ASP F 3 29  ? 56.965 53.832  50.981  1.00 80.23  ? 29   ASP B O     1 
ATOM   5719  C  CB    . ASP F 3 29  ? 59.650 52.344  51.906  1.00 84.48  ? 29   ASP B CB    1 
ATOM   5720  C  CG    . ASP F 3 29  ? 61.067 51.880  51.658  1.00 87.58  ? 29   ASP B CG    1 
ATOM   5721  O  OD1   . ASP F 3 29  ? 61.559 52.022  50.515  1.00 88.09  ? 29   ASP B OD1   1 
ATOM   5722  O  OD2   . ASP F 3 29  ? 61.683 51.357  52.613  1.00 83.29  ? 29   ASP B OD2   1 
ATOM   5723  N  N     . MET F 3 30  ? 57.852 54.810  52.800  1.00 75.77  ? 30   MET B N     1 
ATOM   5724  C  CA    . MET F 3 30  ? 56.581 55.271  53.326  1.00 73.68  ? 30   MET B CA    1 
ATOM   5725  C  C     . MET F 3 30  ? 55.999 56.387  52.467  1.00 74.55  ? 30   MET B C     1 
ATOM   5726  O  O     . MET F 3 30  ? 54.786 56.483  52.293  1.00 74.94  ? 30   MET B O     1 
ATOM   5727  C  CB    . MET F 3 30  ? 56.783 55.748  54.758  1.00 70.58  ? 30   MET B CB    1 
ATOM   5728  C  CG    . MET F 3 30  ? 55.725 55.277  55.723  1.00 69.27  ? 30   MET B CG    1 
ATOM   5729  S  SD    . MET F 3 30  ? 54.534 56.556  56.061  1.00 71.17  ? 30   MET B SD    1 
ATOM   5730  C  CE    . MET F 3 30  ? 55.611 57.794  56.884  1.00 54.05  ? 30   MET B CE    1 
ATOM   5731  N  N     . PHE F 3 31  ? 56.865 57.242  51.936  1.00 76.28  ? 31   PHE B N     1 
ATOM   5732  C  CA    . PHE F 3 31  ? 56.410 58.324  51.078  1.00 77.27  ? 31   PHE B CA    1 
ATOM   5733  C  C     . PHE F 3 31  ? 56.224 57.782  49.668  1.00 76.29  ? 31   PHE B C     1 
ATOM   5734  O  O     . PHE F 3 31  ? 55.384 58.262  48.914  1.00 76.35  ? 31   PHE B O     1 
ATOM   5735  C  CB    . PHE F 3 31  ? 57.427 59.472  51.059  1.00 85.96  ? 31   PHE B CB    1 
ATOM   5736  C  CG    . PHE F 3 31  ? 57.364 60.311  49.808  1.00 97.39  ? 31   PHE B CG    1 
ATOM   5737  C  CD1   . PHE F 3 31  ? 56.195 60.987  49.462  1.00 98.50  ? 31   PHE B CD1   1 
ATOM   5738  C  CD2   . PHE F 3 31  ? 58.457 60.380  48.945  1.00 101.11 ? 31   PHE B CD2   1 
ATOM   5739  C  CE1   . PHE F 3 31  ? 56.113 61.716  48.273  1.00 104.59 ? 31   PHE B CE1   1 
ATOM   5740  C  CE2   . PHE F 3 31  ? 58.387 61.107  47.752  1.00 103.90 ? 31   PHE B CE2   1 
ATOM   5741  C  CZ    . PHE F 3 31  ? 57.209 61.775  47.416  1.00 106.19 ? 31   PHE B CZ    1 
ATOM   5742  N  N     . ARG F 3 32  ? 57.020 56.779  49.314  1.00 74.75  ? 32   ARG B N     1 
ATOM   5743  C  CA    . ARG F 3 32  ? 56.933 56.188  47.992  1.00 73.82  ? 32   ARG B CA    1 
ATOM   5744  C  C     . ARG F 3 32  ? 55.511 55.737  47.733  1.00 75.92  ? 32   ARG B C     1 
ATOM   5745  O  O     . ARG F 3 32  ? 54.864 56.232  46.816  1.00 73.80  ? 32   ARG B O     1 
ATOM   5746  C  CB    . ARG F 3 32  ? 57.889 55.004  47.864  1.00 70.06  ? 32   ARG B CB    1 
ATOM   5747  C  CG    . ARG F 3 32  ? 57.854 54.346  46.500  1.00 75.70  ? 32   ARG B CG    1 
ATOM   5748  C  CD    . ARG F 3 32  ? 59.067 53.475  46.278  1.00 75.25  ? 32   ARG B CD    1 
ATOM   5749  N  NE    . ARG F 3 32  ? 59.145 52.391  47.244  1.00 82.51  ? 32   ARG B NE    1 
ATOM   5750  C  CZ    . ARG F 3 32  ? 60.137 51.510  47.291  1.00 85.76  ? 32   ARG B CZ    1 
ATOM   5751  N  NH1   . ARG F 3 32  ? 61.137 51.588  46.423  1.00 87.00  ? 32   ARG B NH1   1 
ATOM   5752  N  NH2   . ARG F 3 32  ? 60.131 50.550  48.204  1.00 87.55  ? 32   ARG B NH2   1 
ATOM   5753  N  N     . ASP F 3 33  ? 55.024 54.801  48.541  1.00 78.39  ? 33   ASP B N     1 
ATOM   5754  C  CA    . ASP F 3 33  ? 53.657 54.313  48.395  1.00 81.34  ? 33   ASP B CA    1 
ATOM   5755  C  C     . ASP F 3 33  ? 52.744 55.104  49.329  1.00 80.80  ? 33   ASP B C     1 
ATOM   5756  O  O     . ASP F 3 33  ? 51.938 54.531  50.053  1.00 82.46  ? 33   ASP B O     1 
ATOM   5757  C  CB    . ASP F 3 33  ? 53.575 52.823  48.739  1.00 86.24  ? 33   ASP B CB    1 
ATOM   5758  C  CG    . ASP F 3 33  ? 54.269 51.939  47.711  1.00 88.04  ? 33   ASP B CG    1 
ATOM   5759  O  OD1   . ASP F 3 33  ? 54.043 52.134  46.500  1.00 80.88  ? 33   ASP B OD1   1 
ATOM   5760  O  OD2   . ASP F 3 33  ? 55.030 51.034  48.118  1.00 88.81  ? 33   ASP B OD2   1 
ATOM   5761  N  N     . ARG F 3 34  ? 52.872 56.427  49.306  1.00 81.17  ? 34   ARG B N     1 
ATOM   5762  C  CA    . ARG F 3 34  ? 52.072 57.275  50.172  1.00 79.49  ? 34   ARG B CA    1 
ATOM   5763  C  C     . ARG F 3 34  ? 50.622 57.231  49.761  1.00 78.30  ? 34   ARG B C     1 
ATOM   5764  O  O     . ARG F 3 34  ? 49.761 57.787  50.437  1.00 76.61  ? 34   ARG B O     1 
ATOM   5765  C  CB    . ARG F 3 34  ? 52.567 58.723  50.134  1.00 85.08  ? 34   ARG B CB    1 
ATOM   5766  C  CG    . ARG F 3 34  ? 52.169 59.517  48.894  1.00 92.85  ? 34   ARG B CG    1 
ATOM   5767  C  CD    . ARG F 3 34  ? 52.407 61.018  49.121  1.00 102.77 ? 34   ARG B CD    1 
ATOM   5768  N  NE    . ARG F 3 34  ? 52.045 61.848  47.970  1.00 112.47 ? 34   ARG B NE    1 
ATOM   5769  C  CZ    . ARG F 3 34  ? 52.694 61.851  46.806  1.00 115.90 ? 34   ARG B CZ    1 
ATOM   5770  N  NH1   . ARG F 3 34  ? 53.752 61.066  46.621  1.00 113.71 ? 34   ARG B NH1   1 
ATOM   5771  N  NH2   . ARG F 3 34  ? 52.284 62.644  45.819  1.00 114.65 ? 34   ARG B NH2   1 
ATOM   5772  N  N     . GLN F 3 35  ? 50.354 56.569  48.645  1.00 76.82  ? 35   GLN B N     1 
ATOM   5773  C  CA    . GLN F 3 35  ? 48.990 56.453  48.142  1.00 74.69  ? 35   GLN B CA    1 
ATOM   5774  C  C     . GLN F 3 35  ? 48.227 55.383  48.937  1.00 68.77  ? 35   GLN B C     1 
ATOM   5775  O  O     . GLN F 3 35  ? 47.001 55.275  48.846  1.00 65.17  ? 35   GLN B O     1 
ATOM   5776  C  CB    . GLN F 3 35  ? 49.021 56.087  46.652  1.00 80.25  ? 35   GLN B CB    1 
ATOM   5777  C  CG    . GLN F 3 35  ? 47.692 56.227  45.907  1.00 88.62  ? 35   GLN B CG    1 
ATOM   5778  C  CD    . GLN F 3 35  ? 47.424 57.648  45.442  1.00 96.59  ? 35   GLN B CD    1 
ATOM   5779  O  OE1   . GLN F 3 35  ? 46.533 57.887  44.623  1.00 101.73 ? 35   GLN B OE1   1 
ATOM   5780  N  NE2   . GLN F 3 35  ? 48.194 58.599  45.964  1.00 97.41  ? 35   GLN B NE2   1 
ATOM   5781  N  N     . ALA F 3 36  ? 48.966 54.598  49.715  1.00 65.20  ? 36   ALA B N     1 
ATOM   5782  C  CA    . ALA F 3 36  ? 48.374 53.544  50.528  1.00 61.58  ? 36   ALA B CA    1 
ATOM   5783  C  C     . ALA F 3 36  ? 47.538 54.184  51.614  1.00 63.13  ? 36   ALA B C     1 
ATOM   5784  O  O     . ALA F 3 36  ? 46.489 53.663  51.991  1.00 66.53  ? 36   ALA B O     1 
ATOM   5785  C  CB    . ALA F 3 36  ? 49.456 52.689  51.152  1.00 41.58  ? 36   ALA B CB    1 
ATOM   5786  N  N     . PHE F 3 37  ? 48.013 55.316  52.123  1.00 61.49  ? 37   PHE B N     1 
ATOM   5787  C  CA    . PHE F 3 37  ? 47.297 56.036  53.163  1.00 58.15  ? 37   PHE B CA    1 
ATOM   5788  C  C     . PHE F 3 37  ? 46.371 57.056  52.521  1.00 60.86  ? 37   PHE B C     1 
ATOM   5789  O  O     . PHE F 3 37  ? 46.629 57.525  51.419  1.00 62.72  ? 37   PHE B O     1 
ATOM   5790  C  CB    . PHE F 3 37  ? 48.275 56.754  54.080  1.00 51.96  ? 37   PHE B CB    1 
ATOM   5791  C  CG    . PHE F 3 37  ? 49.324 55.861  54.673  1.00 50.10  ? 37   PHE B CG    1 
ATOM   5792  C  CD1   . PHE F 3 37  ? 50.637 55.910  54.214  1.00 47.09  ? 37   PHE B CD1   1 
ATOM   5793  C  CD2   . PHE F 3 37  ? 49.015 55.011  55.726  1.00 51.76  ? 37   PHE B CD2   1 
ATOM   5794  C  CE1   . PHE F 3 37  ? 51.636 55.126  54.804  1.00 51.02  ? 37   PHE B CE1   1 
ATOM   5795  C  CE2   . PHE F 3 37  ? 50.001 54.225  56.320  1.00 51.86  ? 37   PHE B CE2   1 
ATOM   5796  C  CZ    . PHE F 3 37  ? 51.316 54.283  55.860  1.00 52.64  ? 37   PHE B CZ    1 
ATOM   5797  N  N     . SER F 3 38  ? 45.291 57.393  53.211  1.00 64.39  ? 38   SER B N     1 
ATOM   5798  C  CA    . SER F 3 38  ? 44.332 58.361  52.700  1.00 65.66  ? 38   SER B CA    1 
ATOM   5799  C  C     . SER F 3 38  ? 44.982 59.709  52.478  1.00 66.31  ? 38   SER B C     1 
ATOM   5800  O  O     . SER F 3 38  ? 45.983 60.035  53.112  1.00 63.81  ? 38   SER B O     1 
ATOM   5801  C  CB    . SER F 3 38  ? 43.177 58.522  53.683  1.00 68.04  ? 38   SER B CB    1 
ATOM   5802  O  OG    . SER F 3 38  ? 42.546 59.782  53.530  1.00 68.50  ? 38   SER B OG    1 
ATOM   5803  N  N     . GLU F 3 39  ? 44.403 60.490  51.575  1.00 67.62  ? 39   GLU B N     1 
ATOM   5804  C  CA    . GLU F 3 39  ? 44.916 61.818  51.272  1.00 68.34  ? 39   GLU B CA    1 
ATOM   5805  C  C     . GLU F 3 39  ? 44.929 62.673  52.541  1.00 67.36  ? 39   GLU B C     1 
ATOM   5806  O  O     . GLU F 3 39  ? 45.949 63.275  52.897  1.00 65.14  ? 39   GLU B O     1 
ATOM   5807  C  CB    . GLU F 3 39  ? 44.040 62.478  50.202  1.00 78.17  ? 39   GLU B CB    1 
ATOM   5808  C  CG    . GLU F 3 39  ? 44.423 63.910  49.860  1.00 95.44  ? 39   GLU B CG    1 
ATOM   5809  C  CD    . GLU F 3 39  ? 43.743 64.406  48.592  1.00 107.19 ? 39   GLU B CD    1 
ATOM   5810  O  OE1   . GLU F 3 39  ? 44.447 64.619  47.577  1.00 110.91 ? 39   GLU B OE1   1 
ATOM   5811  O  OE2   . GLU F 3 39  ? 42.503 64.577  48.610  1.00 111.09 ? 39   GLU B OE2   1 
ATOM   5812  N  N     . HIS F 3 40  ? 43.789 62.708  53.222  1.00 63.57  ? 40   HIS B N     1 
ATOM   5813  C  CA    . HIS F 3 40  ? 43.635 63.476  54.445  1.00 57.17  ? 40   HIS B CA    1 
ATOM   5814  C  C     . HIS F 3 40  ? 44.645 63.095  55.525  1.00 55.02  ? 40   HIS B C     1 
ATOM   5815  O  O     . HIS F 3 40  ? 44.916 63.870  56.441  1.00 53.37  ? 40   HIS B O     1 
ATOM   5816  C  CB    . HIS F 3 40  ? 42.231 63.283  54.978  1.00 53.48  ? 40   HIS B CB    1 
ATOM   5817  C  CG    . HIS F 3 40  ? 41.163 63.671  54.010  1.00 59.46  ? 40   HIS B CG    1 
ATOM   5818  N  ND1   . HIS F 3 40  ? 40.934 64.981  53.649  1.00 63.46  ? 40   HIS B ND1   1 
ATOM   5819  C  CD2   . HIS F 3 40  ? 40.254 62.927  53.337  1.00 64.90  ? 40   HIS B CD2   1 
ATOM   5820  C  CE1   . HIS F 3 40  ? 39.926 65.027  52.795  1.00 65.30  ? 40   HIS B CE1   1 
ATOM   5821  N  NE2   . HIS F 3 40  ? 39.496 63.795  52.589  1.00 67.33  ? 40   HIS B NE2   1 
ATOM   5822  N  N     . THR F 3 41  ? 45.199 61.899  55.443  1.00 52.93  ? 41   THR B N     1 
ATOM   5823  C  CA    . THR F 3 41  ? 46.167 61.518  56.444  1.00 50.59  ? 41   THR B CA    1 
ATOM   5824  C  C     . THR F 3 41  ? 47.413 62.321  56.192  1.00 51.64  ? 41   THR B C     1 
ATOM   5825  O  O     . THR F 3 41  ? 48.038 62.797  57.130  1.00 51.51  ? 41   THR B O     1 
ATOM   5826  C  CB    . THR F 3 41  ? 46.514 60.035  56.371  1.00 47.54  ? 41   THR B CB    1 
ATOM   5827  O  OG1   . THR F 3 41  ? 45.424 59.272  56.891  1.00 44.75  ? 41   THR B OG1   1 
ATOM   5828  C  CG2   . THR F 3 41  ? 47.752 59.743  57.184  1.00 38.81  ? 41   THR B CG2   1 
ATOM   5829  N  N     . TRP F 3 42  ? 47.766 62.475  54.918  1.00 52.41  ? 42   TRP B N     1 
ATOM   5830  C  CA    . TRP F 3 42  ? 48.958 63.226  54.542  1.00 50.47  ? 42   TRP B CA    1 
ATOM   5831  C  C     . TRP F 3 42  ? 48.811 64.718  54.742  1.00 48.38  ? 42   TRP B C     1 
ATOM   5832  O  O     . TRP F 3 42  ? 49.660 65.348  55.362  1.00 41.45  ? 42   TRP B O     1 
ATOM   5833  C  CB    . TRP F 3 42  ? 49.349 62.940  53.093  1.00 51.70  ? 42   TRP B CB    1 
ATOM   5834  C  CG    . TRP F 3 42  ? 50.128 61.686  52.974  1.00 64.91  ? 42   TRP B CG    1 
ATOM   5835  C  CD1   . TRP F 3 42  ? 49.637 60.423  52.809  1.00 66.90  ? 42   TRP B CD1   1 
ATOM   5836  C  CD2   . TRP F 3 42  ? 51.537 61.548  53.165  1.00 74.53  ? 42   TRP B CD2   1 
ATOM   5837  N  NE1   . TRP F 3 42  ? 50.655 59.503  52.896  1.00 69.90  ? 42   TRP B NE1   1 
ATOM   5838  C  CE2   . TRP F 3 42  ? 51.833 60.166  53.117  1.00 75.89  ? 42   TRP B CE2   1 
ATOM   5839  C  CE3   . TRP F 3 42  ? 52.579 62.458  53.378  1.00 78.38  ? 42   TRP B CE3   1 
ATOM   5840  C  CZ2   . TRP F 3 42  ? 53.130 59.670  53.279  1.00 77.19  ? 42   TRP B CZ2   1 
ATOM   5841  C  CZ3   . TRP F 3 42  ? 53.870 61.965  53.538  1.00 83.41  ? 42   TRP B CZ3   1 
ATOM   5842  C  CH2   . TRP F 3 42  ? 54.132 60.580  53.489  1.00 83.50  ? 42   TRP B CH2   1 
ATOM   5843  N  N     . LYS F 3 43  ? 47.738 65.291  54.219  1.00 48.95  ? 43   LYS B N     1 
ATOM   5844  C  CA    . LYS F 3 43  ? 47.526 66.720  54.378  1.00 50.78  ? 43   LYS B CA    1 
ATOM   5845  C  C     . LYS F 3 43  ? 47.853 67.090  55.824  1.00 50.59  ? 43   LYS B C     1 
ATOM   5846  O  O     . LYS F 3 43  ? 48.351 68.184  56.099  1.00 50.33  ? 43   LYS B O     1 
ATOM   5847  C  CB    . LYS F 3 43  ? 46.069 67.076  54.059  1.00 52.64  ? 43   LYS B CB    1 
ATOM   5848  C  CG    . LYS F 3 43  ? 45.742 68.563  54.118  1.00 57.92  ? 43   LYS B CG    1 
ATOM   5849  C  CD    . LYS F 3 43  ? 44.244 68.815  53.907  1.00 66.96  ? 43   LYS B CD    1 
ATOM   5850  C  CE    . LYS F 3 43  ? 43.412 68.276  55.077  1.00 71.18  ? 43   LYS B CE    1 
ATOM   5851  N  NZ    . LYS F 3 43  ? 41.930 68.341  54.852  1.00 67.27  ? 43   LYS B NZ    1 
ATOM   5852  N  N     . MET F 3 44  ? 47.597 66.156  56.740  1.00 52.13  ? 44   MET B N     1 
ATOM   5853  C  CA    . MET F 3 44  ? 47.839 66.378  58.161  1.00 51.87  ? 44   MET B CA    1 
ATOM   5854  C  C     . MET F 3 44  ? 49.262 66.148  58.656  1.00 52.35  ? 44   MET B C     1 
ATOM   5855  O  O     . MET F 3 44  ? 49.813 66.993  59.344  1.00 50.75  ? 44   MET B O     1 
ATOM   5856  C  CB    . MET F 3 44  ? 46.874 65.537  58.977  1.00 36.94  ? 44   MET B CB    1 
ATOM   5857  C  CG    . MET F 3 44  ? 45.507 66.147  59.069  1.00 32.80  ? 44   MET B CG    1 
ATOM   5858  S  SD    . MET F 3 44  ? 45.602 67.733  59.940  1.00 42.34  ? 44   MET B SD    1 
ATOM   5859  C  CE    . MET F 3 44  ? 43.991 68.491  59.447  1.00 37.37  ? 44   MET B CE    1 
ATOM   5860  N  N     . LEU F 3 45  ? 49.849 65.005  58.328  1.00 51.20  ? 45   LEU B N     1 
ATOM   5861  C  CA    . LEU F 3 45  ? 51.214 64.705  58.735  1.00 50.53  ? 45   LEU B CA    1 
ATOM   5862  C  C     . LEU F 3 45  ? 52.039 65.959  58.509  1.00 51.90  ? 45   LEU B C     1 
ATOM   5863  O  O     . LEU F 3 45  ? 52.840 66.362  59.357  1.00 51.04  ? 45   LEU B O     1 
ATOM   5864  C  CB    . LEU F 3 45  ? 51.776 63.592  57.866  1.00 49.76  ? 45   LEU B CB    1 
ATOM   5865  C  CG    . LEU F 3 45  ? 52.861 62.685  58.438  1.00 44.27  ? 45   LEU B CG    1 
ATOM   5866  C  CD1   . LEU F 3 45  ? 53.389 61.827  57.286  1.00 40.34  ? 45   LEU B CD1   1 
ATOM   5867  C  CD2   . LEU F 3 45  ? 53.985 63.493  59.087  1.00 44.73  ? 45   LEU B CD2   1 
ATOM   5868  N  N     . LEU F 3 46  ? 51.820 66.575  57.349  1.00 50.57  ? 46   LEU B N     1 
ATOM   5869  C  CA    . LEU F 3 46  ? 52.514 67.799  56.959  1.00 47.88  ? 46   LEU B CA    1 
ATOM   5870  C  C     . LEU F 3 46  ? 52.063 68.971  57.825  1.00 48.01  ? 46   LEU B C     1 
ATOM   5871  O  O     . LEU F 3 46  ? 52.871 69.572  58.540  1.00 46.28  ? 46   LEU B O     1 
ATOM   5872  C  CB    . LEU F 3 46  ? 52.246 68.101  55.485  1.00 42.54  ? 46   LEU B CB    1 
ATOM   5873  C  CG    . LEU F 3 46  ? 52.575 66.939  54.531  1.00 46.19  ? 46   LEU B CG    1 
ATOM   5874  C  CD1   . LEU F 3 46  ? 52.186 67.296  53.100  1.00 36.16  ? 46   LEU B CD1   1 
ATOM   5875  C  CD2   . LEU F 3 46  ? 54.049 66.605  54.621  1.00 38.92  ? 46   LEU B CD2   1 
ATOM   5876  N  N     . SER F 3 47  ? 50.774 69.288  57.775  1.00 48.07  ? 47   SER B N     1 
ATOM   5877  C  CA    . SER F 3 47  ? 50.254 70.385  58.577  1.00 50.19  ? 47   SER B CA    1 
ATOM   5878  C  C     . SER F 3 47  ? 50.816 70.332  59.983  1.00 50.56  ? 47   SER B C     1 
ATOM   5879  O  O     . SER F 3 47  ? 50.994 71.359  60.623  1.00 48.41  ? 47   SER B O     1 
ATOM   5880  C  CB    . SER F 3 47  ? 48.728 70.331  58.653  1.00 51.08  ? 47   SER B CB    1 
ATOM   5881  O  OG    . SER F 3 47  ? 48.234 71.316  59.550  1.00 47.37  ? 47   SER B OG    1 
ATOM   5882  N  N     . VAL F 3 48  ? 51.100 69.128  60.465  1.00 53.08  ? 48   VAL B N     1 
ATOM   5883  C  CA    . VAL F 3 48  ? 51.627 68.974  61.812  1.00 53.02  ? 48   VAL B CA    1 
ATOM   5884  C  C     . VAL F 3 48  ? 53.133 69.165  61.865  1.00 52.09  ? 48   VAL B C     1 
ATOM   5885  O  O     . VAL F 3 48  ? 53.614 69.977  62.651  1.00 49.06  ? 48   VAL B O     1 
ATOM   5886  C  CB    . VAL F 3 48  ? 51.243 67.589  62.428  1.00 50.64  ? 48   VAL B CB    1 
ATOM   5887  C  CG1   . VAL F 3 48  ? 51.706 67.503  63.891  1.00 36.22  ? 48   VAL B CG1   1 
ATOM   5888  C  CG2   . VAL F 3 48  ? 49.729 67.402  62.365  1.00 43.86  ? 48   VAL B CG2   1 
ATOM   5889  N  N     . CYS F 3 49  ? 53.885 68.437  61.045  1.00 51.17  ? 49   CYS B N     1 
ATOM   5890  C  CA    . CYS F 3 49  ? 55.334 68.608  61.070  1.00 53.66  ? 49   CYS B CA    1 
ATOM   5891  C  C     . CYS F 3 49  ? 55.676 70.077  60.865  1.00 58.36  ? 49   CYS B C     1 
ATOM   5892  O  O     . CYS F 3 49  ? 56.654 70.580  61.425  1.00 59.42  ? 49   CYS B O     1 
ATOM   5893  C  CB    . CYS F 3 49  ? 55.992 67.767  59.997  1.00 41.02  ? 49   CYS B CB    1 
ATOM   5894  S  SG    . CYS F 3 49  ? 55.754 66.043  60.319  1.00 56.54  ? 49   CYS B SG    1 
ATOM   5895  N  N     . ARG F 3 50  ? 54.868 70.765  60.062  1.00 58.13  ? 50   ARG B N     1 
ATOM   5896  C  CA    . ARG F 3 50  ? 55.080 72.187  59.840  1.00 59.38  ? 50   ARG B CA    1 
ATOM   5897  C  C     . ARG F 3 50  ? 55.052 72.842  61.212  1.00 58.17  ? 50   ARG B C     1 
ATOM   5898  O  O     . ARG F 3 50  ? 56.094 73.268  61.717  1.00 58.62  ? 50   ARG B O     1 
ATOM   5899  C  CB    . ARG F 3 50  ? 53.962 72.782  58.977  1.00 72.50  ? 50   ARG B CB    1 
ATOM   5900  C  CG    . ARG F 3 50  ? 54.278 72.931  57.485  1.00 73.57  ? 50   ARG B CG    1 
ATOM   5901  C  CD    . ARG F 3 50  ? 53.000 73.299  56.731  1.00 79.47  ? 50   ARG B CD    1 
ATOM   5902  N  NE    . ARG F 3 50  ? 52.647 72.304  55.712  1.00 85.70  ? 50   ARG B NE    1 
ATOM   5903  C  CZ    . ARG F 3 50  ? 51.403 72.055  55.301  1.00 89.44  ? 50   ARG B CZ    1 
ATOM   5904  N  NH1   . ARG F 3 50  ? 50.375 72.723  55.825  1.00 86.42  ? 50   ARG B NH1   1 
ATOM   5905  N  NH2   . ARG F 3 50  ? 51.187 71.146  54.356  1.00 84.47  ? 50   ARG B NH2   1 
ATOM   5906  N  N     . SER F 3 51  ? 53.856 72.897  61.807  1.00 55.18  ? 51   SER B N     1 
ATOM   5907  C  CA    . SER F 3 51  ? 53.639 73.492  63.132  1.00 53.55  ? 51   SER B CA    1 
ATOM   5908  C  C     . SER F 3 51  ? 54.646 73.062  64.203  1.00 53.54  ? 51   SER B C     1 
ATOM   5909  O  O     . SER F 3 51  ? 54.970 73.835  65.097  1.00 49.15  ? 51   SER B O     1 
ATOM   5910  C  CB    . SER F 3 51  ? 52.226 73.177  63.628  1.00 46.66  ? 51   SER B CB    1 
ATOM   5911  O  OG    . SER F 3 51  ? 52.018 73.699  64.934  1.00 44.14  ? 51   SER B OG    1 
ATOM   5912  N  N     . TRP F 3 52  ? 55.112 71.821  64.115  1.00 55.99  ? 52   TRP B N     1 
ATOM   5913  C  CA    . TRP F 3 52  ? 56.099 71.273  65.040  1.00 56.14  ? 52   TRP B CA    1 
ATOM   5914  C  C     . TRP F 3 52  ? 57.414 71.986  64.752  1.00 57.70  ? 52   TRP B C     1 
ATOM   5915  O  O     . TRP F 3 52  ? 57.852 72.836  65.534  1.00 56.66  ? 52   TRP B O     1 
ATOM   5916  C  CB    . TRP F 3 52  ? 56.242 69.768  64.782  1.00 50.00  ? 52   TRP B CB    1 
ATOM   5917  C  CG    . TRP F 3 52  ? 57.348 69.021  65.508  1.00 43.94  ? 52   TRP B CG    1 
ATOM   5918  C  CD1   . TRP F 3 52  ? 58.185 68.089  64.961  1.00 42.91  ? 52   TRP B CD1   1 
ATOM   5919  C  CD2   . TRP F 3 52  ? 57.671 69.074  66.897  1.00 38.38  ? 52   TRP B CD2   1 
ATOM   5920  N  NE1   . TRP F 3 52  ? 59.005 67.558  65.919  1.00 35.92  ? 52   TRP B NE1   1 
ATOM   5921  C  CE2   . TRP F 3 52  ? 58.714 68.144  67.119  1.00 36.87  ? 52   TRP B CE2   1 
ATOM   5922  C  CE3   . TRP F 3 52  ? 57.185 69.812  67.977  1.00 41.39  ? 52   TRP B CE3   1 
ATOM   5923  C  CZ2   . TRP F 3 52  ? 59.279 67.936  68.372  1.00 27.73  ? 52   TRP B CZ2   1 
ATOM   5924  C  CZ3   . TRP F 3 52  ? 57.751 69.603  69.233  1.00 42.39  ? 52   TRP B CZ3   1 
ATOM   5925  C  CH2   . TRP F 3 52  ? 58.788 68.671  69.417  1.00 33.88  ? 52   TRP B CH2   1 
ATOM   5926  N  N     . ALA F 3 53  ? 58.025 71.651  63.615  1.00 59.87  ? 53   ALA B N     1 
ATOM   5927  C  CA    . ALA F 3 53  ? 59.305 72.244  63.200  1.00 62.05  ? 53   ALA B CA    1 
ATOM   5928  C  C     . ALA F 3 53  ? 59.324 73.744  63.431  1.00 62.46  ? 53   ALA B C     1 
ATOM   5929  O  O     . ALA F 3 53  ? 60.326 74.301  63.861  1.00 59.03  ? 53   ALA B O     1 
ATOM   5930  C  CB    . ALA F 3 53  ? 59.578 71.950  61.729  1.00 55.00  ? 53   ALA B CB    1 
ATOM   5931  N  N     . ALA F 3 54  ? 58.212 74.393  63.126  1.00 62.11  ? 54   ALA B N     1 
ATOM   5932  C  CA    . ALA F 3 54  ? 58.112 75.817  63.333  1.00 63.78  ? 54   ALA B CA    1 
ATOM   5933  C  C     . ALA F 3 54  ? 58.490 76.064  64.793  1.00 65.86  ? 54   ALA B C     1 
ATOM   5934  O  O     . ALA F 3 54  ? 59.509 76.686  65.092  1.00 65.48  ? 54   ALA B O     1 
ATOM   5935  C  CB    . ALA F 3 54  ? 56.682 76.280  63.061  1.00 63.15  ? 54   ALA B CB    1 
ATOM   5936  N  N     . TRP F 3 55  ? 57.666 75.548  65.697  1.00 66.39  ? 55   TRP B N     1 
ATOM   5937  C  CA    . TRP F 3 55  ? 57.884 75.693  67.131  1.00 64.50  ? 55   TRP B CA    1 
ATOM   5938  C  C     . TRP F 3 55  ? 59.289 75.261  67.530  1.00 65.64  ? 55   TRP B C     1 
ATOM   5939  O  O     . TRP F 3 55  ? 59.915 75.889  68.383  1.00 62.41  ? 55   TRP B O     1 
ATOM   5940  C  CB    . TRP F 3 55  ? 56.864 74.854  67.896  1.00 56.39  ? 55   TRP B CB    1 
ATOM   5941  C  CG    . TRP F 3 55  ? 57.035 74.892  69.376  1.00 48.02  ? 55   TRP B CG    1 
ATOM   5942  C  CD1   . TRP F 3 55  ? 56.435 75.747  70.252  1.00 49.17  ? 55   TRP B CD1   1 
ATOM   5943  C  CD2   . TRP F 3 55  ? 57.873 74.037  70.156  1.00 44.47  ? 55   TRP B CD2   1 
ATOM   5944  N  NE1   . TRP F 3 55  ? 56.845 75.474  71.537  1.00 51.32  ? 55   TRP B NE1   1 
ATOM   5945  C  CE2   . TRP F 3 55  ? 57.730 74.431  71.506  1.00 43.40  ? 55   TRP B CE2   1 
ATOM   5946  C  CE3   . TRP F 3 55  ? 58.736 72.974  69.845  1.00 32.00  ? 55   TRP B CE3   1 
ATOM   5947  C  CZ2   . TRP F 3 55  ? 58.415 73.805  72.542  1.00 33.84  ? 55   TRP B CZ2   1 
ATOM   5948  C  CZ3   . TRP F 3 55  ? 59.421 72.347  70.880  1.00 23.06  ? 55   TRP B CZ3   1 
ATOM   5949  C  CH2   . TRP F 3 55  ? 59.254 72.768  72.211  1.00 26.70  ? 55   TRP B CH2   1 
ATOM   5950  N  N     . CYS F 3 56  ? 59.773 74.183  66.919  1.00 65.61  ? 56   CYS B N     1 
ATOM   5951  C  CA    . CYS F 3 56  ? 61.112 73.670  67.209  1.00 68.47  ? 56   CYS B CA    1 
ATOM   5952  C  C     . CYS F 3 56  ? 62.225 74.661  66.855  1.00 71.68  ? 56   CYS B C     1 
ATOM   5953  O  O     . CYS F 3 56  ? 63.147 74.890  67.646  1.00 70.90  ? 56   CYS B O     1 
ATOM   5954  C  CB    . CYS F 3 56  ? 61.362 72.363  66.451  1.00 69.98  ? 56   CYS B CB    1 
ATOM   5955  S  SG    . CYS F 3 56  ? 60.620 70.902  67.185  1.00 62.74  ? 56   CYS B SG    1 
ATOM   5956  N  N     . LYS F 3 57  ? 62.142 75.237  65.661  1.00 74.14  ? 57   LYS B N     1 
ATOM   5957  C  CA    . LYS F 3 57  ? 63.141 76.193  65.208  1.00 72.18  ? 57   LYS B CA    1 
ATOM   5958  C  C     . LYS F 3 57  ? 63.228 77.383  66.165  1.00 71.22  ? 57   LYS B C     1 
ATOM   5959  O  O     . LYS F 3 57  ? 64.311 77.710  66.659  1.00 68.97  ? 57   LYS B O     1 
ATOM   5960  C  CB    . LYS F 3 57  ? 62.801 76.692  63.800  1.00 70.50  ? 57   LYS B CB    1 
ATOM   5961  C  CG    . LYS F 3 57  ? 63.922 77.490  63.145  1.00 78.40  ? 57   LYS B CG    1 
ATOM   5962  C  CD    . LYS F 3 57  ? 63.429 78.382  62.003  1.00 84.30  ? 57   LYS B CD    1 
ATOM   5963  C  CE    . LYS F 3 57  ? 62.581 79.545  62.517  1.00 86.92  ? 57   LYS B CE    1 
ATOM   5964  N  NZ    . LYS F 3 57  ? 61.306 79.098  63.169  1.00 82.91  ? 57   LYS B NZ    1 
ATOM   5965  N  N     . LEU F 3 58  ? 62.086 78.018  66.431  1.00 68.96  ? 58   LEU B N     1 
ATOM   5966  C  CA    . LEU F 3 58  ? 62.036 79.183  67.312  1.00 67.73  ? 58   LEU B CA    1 
ATOM   5967  C  C     . LEU F 3 58  ? 62.403 78.898  68.761  1.00 70.49  ? 58   LEU B C     1 
ATOM   5968  O  O     . LEU F 3 58  ? 62.913 79.777  69.459  1.00 66.41  ? 58   LEU B O     1 
ATOM   5969  C  CB    . LEU F 3 58  ? 60.656 79.850  67.207  1.00 57.64  ? 58   LEU B CB    1 
ATOM   5970  C  CG    . LEU F 3 58  ? 59.788 80.382  68.362  1.00 60.14  ? 58   LEU B CG    1 
ATOM   5971  C  CD1   . LEU F 3 58  ? 60.581 81.008  69.490  1.00 53.88  ? 58   LEU B CD1   1 
ATOM   5972  C  CD2   . LEU F 3 58  ? 58.823 81.415  67.762  1.00 56.67  ? 58   LEU B CD2   1 
ATOM   5973  N  N     . ASN F 3 59  ? 62.170 77.670  69.213  1.00 75.60  ? 59   ASN B N     1 
ATOM   5974  C  CA    . ASN F 3 59  ? 62.495 77.306  70.589  1.00 77.00  ? 59   ASN B CA    1 
ATOM   5975  C  C     . ASN F 3 59  ? 63.795 76.520  70.735  1.00 76.85  ? 59   ASN B C     1 
ATOM   5976  O  O     . ASN F 3 59  ? 64.004 75.818  71.721  1.00 76.51  ? 59   ASN B O     1 
ATOM   5977  C  CB    . ASN F 3 59  ? 61.324 76.552  71.218  1.00 69.82  ? 59   ASN B CB    1 
ATOM   5978  C  CG    . ASN F 3 59  ? 60.304 77.492  71.842  1.00 69.25  ? 59   ASN B CG    1 
ATOM   5979  O  OD1   . ASN F 3 59  ? 60.491 77.961  72.964  1.00 66.86  ? 59   ASN B OD1   1 
ATOM   5980  N  ND2   . ASN F 3 59  ? 59.231 77.787  71.110  1.00 64.97  ? 59   ASN B ND2   1 
ATOM   5981  N  N     . ASN F 3 60  ? 64.662 76.650  69.737  1.00 77.52  ? 60   ASN B N     1 
ATOM   5982  C  CA    . ASN F 3 60  ? 65.978 76.015  69.739  1.00 80.28  ? 60   ASN B CA    1 
ATOM   5983  C  C     . ASN F 3 60  ? 66.048 74.499  69.884  1.00 78.17  ? 60   ASN B C     1 
ATOM   5984  O  O     . ASN F 3 60  ? 67.105 73.962  70.229  1.00 76.67  ? 60   ASN B O     1 
ATOM   5985  C  CB    . ASN F 3 60  ? 66.845 76.642  70.836  1.00 90.85  ? 60   ASN B CB    1 
ATOM   5986  C  CG    . ASN F 3 60  ? 68.106 77.284  70.287  1.00 99.59  ? 60   ASN B CG    1 
ATOM   5987  O  OD1   . ASN F 3 60  ? 69.034 77.595  71.040  1.00 100.61 ? 60   ASN B OD1   1 
ATOM   5988  N  ND2   . ASN F 3 60  ? 68.146 77.493  68.970  1.00 98.71  ? 60   ASN B ND2   1 
ATOM   5989  N  N     . ARG F 3 61  ? 64.950 73.803  69.607  1.00 76.79  ? 61   ARG B N     1 
ATOM   5990  C  CA    . ARG F 3 61  ? 64.945 72.350  69.740  1.00 72.07  ? 61   ARG B CA    1 
ATOM   5991  C  C     . ARG F 3 61  ? 64.963 71.607  68.417  1.00 71.35  ? 61   ARG B C     1 
ATOM   5992  O  O     . ARG F 3 61  ? 64.469 72.101  67.403  1.00 70.49  ? 61   ARG B O     1 
ATOM   5993  C  CB    . ARG F 3 61  ? 63.727 71.915  70.560  1.00 63.80  ? 61   ARG B CB    1 
ATOM   5994  C  CG    . ARG F 3 61  ? 63.740 72.442  71.992  1.00 66.58  ? 61   ARG B CG    1 
ATOM   5995  C  CD    . ARG F 3 61  ? 62.367 72.934  72.384  1.00 71.67  ? 61   ARG B CD    1 
ATOM   5996  N  NE    . ARG F 3 61  ? 62.348 73.654  73.655  1.00 74.31  ? 61   ARG B NE    1 
ATOM   5997  C  CZ    . ARG F 3 61  ? 62.383 73.078  74.853  1.00 73.46  ? 61   ARG B CZ    1 
ATOM   5998  N  NH1   . ARG F 3 61  ? 62.442 71.756  74.967  1.00 75.61  ? 61   ARG B NH1   1 
ATOM   5999  N  NH2   . ARG F 3 61  ? 62.335 73.829  75.946  1.00 72.83  ? 61   ARG B NH2   1 
ATOM   6000  N  N     . LYS F 3 62  ? 65.543 70.411  68.443  1.00 70.77  ? 62   LYS B N     1 
ATOM   6001  C  CA    . LYS F 3 62  ? 65.625 69.546  67.267  1.00 73.67  ? 62   LYS B CA    1 
ATOM   6002  C  C     . LYS F 3 62  ? 64.195 69.264  66.787  1.00 73.40  ? 62   LYS B C     1 
ATOM   6003  O  O     . LYS F 3 62  ? 63.241 69.765  67.375  1.00 76.15  ? 62   LYS B O     1 
ATOM   6004  C  CB    . LYS F 3 62  ? 66.336 68.245  67.658  1.00 81.38  ? 62   LYS B CB    1 
ATOM   6005  C  CG    . LYS F 3 62  ? 66.801 67.377  66.496  1.00 87.69  ? 62   LYS B CG    1 
ATOM   6006  C  CD    . LYS F 3 62  ? 68.003 66.524  66.906  1.00 89.39  ? 62   LYS B CD    1 
ATOM   6007  C  CE    . LYS F 3 62  ? 69.192 67.409  67.300  1.00 89.66  ? 62   LYS B CE    1 
ATOM   6008  N  NZ    . LYS F 3 62  ? 70.375 66.630  67.783  1.00 87.03  ? 62   LYS B NZ    1 
ATOM   6009  N  N     . TRP F 3 63  ? 64.026 68.485  65.725  1.00 72.40  ? 63   TRP B N     1 
ATOM   6010  C  CA    . TRP F 3 63  ? 62.670 68.202  65.265  1.00 72.01  ? 63   TRP B CA    1 
ATOM   6011  C  C     . TRP F 3 63  ? 62.482 66.742  64.896  1.00 71.69  ? 63   TRP B C     1 
ATOM   6012  O  O     . TRP F 3 63  ? 61.355 66.279  64.726  1.00 72.39  ? 63   TRP B O     1 
ATOM   6013  C  CB    . TRP F 3 63  ? 62.277 69.096  64.074  1.00 75.85  ? 63   TRP B CB    1 
ATOM   6014  C  CG    . TRP F 3 63  ? 62.484 68.454  62.731  1.00 79.70  ? 63   TRP B CG    1 
ATOM   6015  C  CD1   . TRP F 3 63  ? 63.670 68.269  62.085  1.00 77.27  ? 63   TRP B CD1   1 
ATOM   6016  C  CD2   . TRP F 3 63  ? 61.484 67.827  61.919  1.00 79.76  ? 63   TRP B CD2   1 
ATOM   6017  N  NE1   . TRP F 3 63  ? 63.472 67.559  60.924  1.00 77.70  ? 63   TRP B NE1   1 
ATOM   6018  C  CE2   . TRP F 3 63  ? 62.139 67.274  60.800  1.00 76.51  ? 63   TRP B CE2   1 
ATOM   6019  C  CE3   . TRP F 3 63  ? 60.098 67.675  62.033  1.00 77.84  ? 63   TRP B CE3   1 
ATOM   6020  C  CZ2   . TRP F 3 63  ? 61.456 66.577  59.800  1.00 70.27  ? 63   TRP B CZ2   1 
ATOM   6021  C  CZ3   . TRP F 3 63  ? 59.418 66.981  61.036  1.00 74.12  ? 63   TRP B CZ3   1 
ATOM   6022  C  CH2   . TRP F 3 63  ? 60.100 66.441  59.936  1.00 71.54  ? 63   TRP B CH2   1 
ATOM   6023  N  N     . PHE F 3 64  ? 63.580 66.011  64.770  1.00 68.70  ? 64   PHE B N     1 
ATOM   6024  C  CA    . PHE F 3 64  ? 63.473 64.603  64.441  1.00 68.43  ? 64   PHE B CA    1 
ATOM   6025  C  C     . PHE F 3 64  ? 64.801 63.887  64.589  1.00 70.42  ? 64   PHE B C     1 
ATOM   6026  O  O     . PHE F 3 64  ? 65.769 64.239  63.934  1.00 71.40  ? 64   PHE B O     1 
ATOM   6027  C  CB    . PHE F 3 64  ? 62.963 64.428  63.012  1.00 62.07  ? 64   PHE B CB    1 
ATOM   6028  C  CG    . PHE F 3 64  ? 62.681 62.995  62.642  1.00 65.65  ? 64   PHE B CG    1 
ATOM   6029  C  CD1   . PHE F 3 64  ? 61.370 62.544  62.499  1.00 62.52  ? 64   PHE B CD1   1 
ATOM   6030  C  CD2   . PHE F 3 64  ? 63.727 62.094  62.434  1.00 59.40  ? 64   PHE B CD2   1 
ATOM   6031  C  CE1   . PHE F 3 64  ? 61.106 61.220  62.151  1.00 55.86  ? 64   PHE B CE1   1 
ATOM   6032  C  CE2   . PHE F 3 64  ? 63.473 60.769  62.087  1.00 59.52  ? 64   PHE B CE2   1 
ATOM   6033  C  CZ    . PHE F 3 64  ? 62.163 60.330  61.944  1.00 57.67  ? 64   PHE B CZ    1 
ATOM   6034  N  N     . PRO F 3 65  ? 64.866 62.876  65.469  1.00 73.20  ? 65   PRO B N     1 
ATOM   6035  C  CA    . PRO F 3 65  ? 63.751 62.404  66.291  1.00 73.77  ? 65   PRO B CA    1 
ATOM   6036  C  C     . PRO F 3 65  ? 63.290 63.510  67.232  1.00 74.64  ? 65   PRO B C     1 
ATOM   6037  O  O     . PRO F 3 65  ? 64.055 64.424  67.542  1.00 76.14  ? 65   PRO B O     1 
ATOM   6038  C  CB    . PRO F 3 65  ? 64.362 61.232  67.054  1.00 71.94  ? 65   PRO B CB    1 
ATOM   6039  C  CG    . PRO F 3 65  ? 65.378 60.703  66.094  1.00 72.41  ? 65   PRO B CG    1 
ATOM   6040  C  CD    . PRO F 3 65  ? 66.024 61.976  65.612  1.00 73.98  ? 65   PRO B CD    1 
ATOM   6041  N  N     . ALA F 3 66  ? 62.038 63.439  67.667  1.00 74.66  ? 66   ALA B N     1 
ATOM   6042  C  CA    . ALA F 3 66  ? 61.506 64.430  68.587  1.00 73.43  ? 66   ALA B CA    1 
ATOM   6043  C  C     . ALA F 3 66  ? 61.871 63.960  69.988  1.00 74.09  ? 66   ALA B C     1 
ATOM   6044  O  O     . ALA F 3 66  ? 61.786 62.766  70.281  1.00 73.98  ? 66   ALA B O     1 
ATOM   6045  C  CB    . ALA F 3 66  ? 60.001 64.524  68.438  1.00 70.40  ? 66   ALA B CB    1 
ATOM   6046  N  N     . GLU F 3 67  ? 62.303 64.880  70.848  1.00 74.09  ? 67   GLU B N     1 
ATOM   6047  C  CA    . GLU F 3 67  ? 62.663 64.494  72.207  1.00 74.34  ? 67   GLU B CA    1 
ATOM   6048  C  C     . GLU F 3 67  ? 61.470 64.644  73.139  1.00 72.13  ? 67   GLU B C     1 
ATOM   6049  O  O     . GLU F 3 67  ? 60.699 65.601  73.027  1.00 69.94  ? 67   GLU B O     1 
ATOM   6050  C  CB    . GLU F 3 67  ? 63.832 65.328  72.734  1.00 83.82  ? 67   GLU B CB    1 
ATOM   6051  C  CG    . GLU F 3 67  ? 65.148 65.109  72.000  1.00 100.20 ? 67   GLU B CG    1 
ATOM   6052  C  CD    . GLU F 3 67  ? 66.366 65.426  72.865  1.00 110.10 ? 67   GLU B CD    1 
ATOM   6053  O  OE1   . GLU F 3 67  ? 66.800 64.534  73.633  1.00 110.95 ? 67   GLU B OE1   1 
ATOM   6054  O  OE2   . GLU F 3 67  ? 66.881 66.567  72.783  1.00 114.31 ? 67   GLU B OE2   1 
ATOM   6055  N  N     . PRO F 3 68  ? 61.303 63.687  74.070  1.00 70.06  ? 68   PRO B N     1 
ATOM   6056  C  CA    . PRO F 3 68  ? 60.217 63.660  75.051  1.00 64.89  ? 68   PRO B CA    1 
ATOM   6057  C  C     . PRO F 3 68  ? 59.896 65.025  75.657  1.00 63.40  ? 68   PRO B C     1 
ATOM   6058  O  O     . PRO F 3 68  ? 58.799 65.551  75.470  1.00 62.71  ? 68   PRO B O     1 
ATOM   6059  C  CB    . PRO F 3 68  ? 60.728 62.664  76.081  1.00 61.23  ? 68   PRO B CB    1 
ATOM   6060  C  CG    . PRO F 3 68  ? 61.421 61.667  75.226  1.00 63.85  ? 68   PRO B CG    1 
ATOM   6061  C  CD    . PRO F 3 68  ? 62.211 62.543  74.279  1.00 68.49  ? 68   PRO B CD    1 
ATOM   6062  N  N     . GLU F 3 69  ? 60.850 65.600  76.377  1.00 60.52  ? 69   GLU B N     1 
ATOM   6063  C  CA    . GLU F 3 69  ? 60.620 66.893  76.994  1.00 57.60  ? 69   GLU B CA    1 
ATOM   6064  C  C     . GLU F 3 69  ? 60.223 67.935  75.957  1.00 58.59  ? 69   GLU B C     1 
ATOM   6065  O  O     . GLU F 3 69  ? 59.351 68.764  76.213  1.00 58.66  ? 69   GLU B O     1 
ATOM   6066  C  CB    . GLU F 3 69  ? 61.867 67.336  77.746  1.00 56.48  ? 69   GLU B CB    1 
ATOM   6067  C  CG    . GLU F 3 69  ? 62.216 66.424  78.912  1.00 65.31  ? 69   GLU B CG    1 
ATOM   6068  C  CD    . GLU F 3 69  ? 61.151 66.427  80.010  1.00 70.89  ? 69   GLU B CD    1 
ATOM   6069  O  OE1   . GLU F 3 69  ? 60.742 65.321  80.455  1.00 65.17  ? 69   GLU B OE1   1 
ATOM   6070  O  OE2   . GLU F 3 69  ? 60.733 67.533  80.433  1.00 68.96  ? 69   GLU B OE2   1 
ATOM   6071  N  N     . ASP F 3 70  ? 60.852 67.887  74.784  1.00 58.59  ? 70   ASP B N     1 
ATOM   6072  C  CA    . ASP F 3 70  ? 60.539 68.835  73.714  1.00 57.79  ? 70   ASP B CA    1 
ATOM   6073  C  C     . ASP F 3 70  ? 59.077 68.662  73.311  1.00 56.46  ? 70   ASP B C     1 
ATOM   6074  O  O     . ASP F 3 70  ? 58.312 69.622  73.257  1.00 57.73  ? 70   ASP B O     1 
ATOM   6075  C  CB    . ASP F 3 70  ? 61.440 68.607  72.485  1.00 64.31  ? 70   ASP B CB    1 
ATOM   6076  C  CG    . ASP F 3 70  ? 62.917 68.953  72.742  1.00 67.20  ? 70   ASP B CG    1 
ATOM   6077  O  OD1   . ASP F 3 70  ? 63.222 69.595  73.772  1.00 67.23  ? 70   ASP B OD1   1 
ATOM   6078  O  OD2   . ASP F 3 70  ? 63.776 68.589  71.900  1.00 63.96  ? 70   ASP B OD2   1 
ATOM   6079  N  N     . VAL F 3 71  ? 58.693 67.423  73.033  1.00 52.72  ? 71   VAL B N     1 
ATOM   6080  C  CA    . VAL F 3 71  ? 57.324 67.117  72.652  1.00 45.85  ? 71   VAL B CA    1 
ATOM   6081  C  C     . VAL F 3 71  ? 56.338 67.416  73.779  1.00 46.72  ? 71   VAL B C     1 
ATOM   6082  O  O     . VAL F 3 71  ? 55.171 67.705  73.528  1.00 44.67  ? 71   VAL B O     1 
ATOM   6083  C  CB    . VAL F 3 71  ? 57.199 65.648  72.252  1.00 35.15  ? 71   VAL B CB    1 
ATOM   6084  C  CG1   . VAL F 3 71  ? 55.745 65.252  72.145  1.00 37.98  ? 71   VAL B CG1   1 
ATOM   6085  C  CG2   . VAL F 3 71  ? 57.890 65.429  70.929  1.00 27.99  ? 71   VAL B CG2   1 
ATOM   6086  N  N     . ARG F 3 72  ? 56.797 67.349  75.021  1.00 45.07  ? 72   ARG B N     1 
ATOM   6087  C  CA    . ARG F 3 72  ? 55.904 67.635  76.130  1.00 47.39  ? 72   ARG B CA    1 
ATOM   6088  C  C     . ARG F 3 72  ? 55.682 69.135  76.260  1.00 51.60  ? 72   ARG B C     1 
ATOM   6089  O  O     . ARG F 3 72  ? 54.555 69.591  76.465  1.00 47.26  ? 72   ARG B O     1 
ATOM   6090  C  CB    . ARG F 3 72  ? 56.464 67.093  77.446  1.00 42.79  ? 72   ARG B CB    1 
ATOM   6091  C  CG    . ARG F 3 72  ? 55.465 67.141  78.601  1.00 35.47  ? 72   ARG B CG    1 
ATOM   6092  C  CD    . ARG F 3 72  ? 56.131 66.752  79.886  1.00 42.37  ? 72   ARG B CD    1 
ATOM   6093  N  NE    . ARG F 3 72  ? 56.244 67.888  80.798  1.00 48.85  ? 72   ARG B NE    1 
ATOM   6094  C  CZ    . ARG F 3 72  ? 55.287 68.261  81.637  1.00 48.18  ? 72   ARG B CZ    1 
ATOM   6095  N  NH1   . ARG F 3 72  ? 54.144 67.588  81.688  1.00 56.73  ? 72   ARG B NH1   1 
ATOM   6096  N  NH2   . ARG F 3 72  ? 55.464 69.308  82.418  1.00 38.25  ? 72   ARG B NH2   1 
ATOM   6097  N  N     . ASP F 3 73  ? 56.760 69.909  76.157  1.00 54.97  ? 73   ASP B N     1 
ATOM   6098  C  CA    . ASP F 3 73  ? 56.630 71.359  76.257  1.00 56.92  ? 73   ASP B CA    1 
ATOM   6099  C  C     . ASP F 3 73  ? 55.793 71.811  75.066  1.00 56.41  ? 73   ASP B C     1 
ATOM   6100  O  O     . ASP F 3 73  ? 55.016 72.771  75.158  1.00 55.65  ? 73   ASP B O     1 
ATOM   6101  C  CB    . ASP F 3 73  ? 58.005 72.038  76.237  1.00 63.85  ? 73   ASP B CB    1 
ATOM   6102  C  CG    . ASP F 3 73  ? 58.839 71.732  77.486  1.00 68.45  ? 73   ASP B CG    1 
ATOM   6103  O  OD1   . ASP F 3 73  ? 58.312 71.872  78.613  1.00 63.11  ? 73   ASP B OD1   1 
ATOM   6104  O  OD2   . ASP F 3 73  ? 60.029 71.365  77.343  1.00 72.30  ? 73   ASP B OD2   1 
ATOM   6105  N  N     . TYR F 3 74  ? 55.944 71.092  73.954  1.00 53.18  ? 74   TYR B N     1 
ATOM   6106  C  CA    . TYR F 3 74  ? 55.203 71.396  72.738  1.00 53.51  ? 74   TYR B CA    1 
ATOM   6107  C  C     . TYR F 3 74  ? 53.716 71.148  72.904  1.00 53.22  ? 74   TYR B C     1 
ATOM   6108  O  O     . TYR F 3 74  ? 52.905 72.021  72.610  1.00 54.56  ? 74   TYR B O     1 
ATOM   6109  C  CB    . TYR F 3 74  ? 55.693 70.552  71.569  1.00 52.24  ? 74   TYR B CB    1 
ATOM   6110  C  CG    . TYR F 3 74  ? 54.856 70.750  70.332  1.00 52.49  ? 74   TYR B CG    1 
ATOM   6111  C  CD1   . TYR F 3 74  ? 54.661 72.020  69.811  1.00 54.41  ? 74   TYR B CD1   1 
ATOM   6112  C  CD2   . TYR F 3 74  ? 54.269 69.671  69.676  1.00 53.74  ? 74   TYR B CD2   1 
ATOM   6113  C  CE1   . TYR F 3 74  ? 53.906 72.221  68.665  1.00 56.89  ? 74   TYR B CE1   1 
ATOM   6114  C  CE2   . TYR F 3 74  ? 53.508 69.858  68.520  1.00 55.34  ? 74   TYR B CE2   1 
ATOM   6115  C  CZ    . TYR F 3 74  ? 53.333 71.143  68.017  1.00 55.67  ? 74   TYR B CZ    1 
ATOM   6116  O  OH    . TYR F 3 74  ? 52.610 71.367  66.865  1.00 51.55  ? 74   TYR B OH    1 
ATOM   6117  N  N     . LEU F 3 75  ? 53.358 69.944  73.346  1.00 51.16  ? 75   LEU B N     1 
ATOM   6118  C  CA    . LEU F 3 75  ? 51.955 69.614  73.540  1.00 44.11  ? 75   LEU B CA    1 
ATOM   6119  C  C     . LEU F 3 75  ? 51.384 70.585  74.549  1.00 41.22  ? 75   LEU B C     1 
ATOM   6120  O  O     . LEU F 3 75  ? 50.239 70.983  74.448  1.00 34.82  ? 75   LEU B O     1 
ATOM   6121  C  CB    . LEU F 3 75  ? 51.792 68.170  74.027  1.00 34.76  ? 75   LEU B CB    1 
ATOM   6122  C  CG    . LEU F 3 75  ? 52.206 67.092  73.015  1.00 29.64  ? 75   LEU B CG    1 
ATOM   6123  C  CD1   . LEU F 3 75  ? 51.836 65.731  73.561  1.00 27.79  ? 75   LEU B CD1   1 
ATOM   6124  C  CD2   . LEU F 3 75  ? 51.511 67.313  71.675  1.00 19.91  ? 75   LEU B CD2   1 
ATOM   6125  N  N     . LEU F 3 76  ? 52.202 70.985  75.509  1.00 44.03  ? 76   LEU B N     1 
ATOM   6126  C  CA    . LEU F 3 76  ? 51.760 71.927  76.523  1.00 47.84  ? 76   LEU B CA    1 
ATOM   6127  C  C     . LEU F 3 76  ? 51.513 73.308  75.910  1.00 50.54  ? 76   LEU B C     1 
ATOM   6128  O  O     . LEU F 3 76  ? 50.628 74.055  76.344  1.00 49.21  ? 76   LEU B O     1 
ATOM   6129  C  CB    . LEU F 3 76  ? 52.803 72.000  77.638  1.00 43.03  ? 76   LEU B CB    1 
ATOM   6130  C  CG    . LEU F 3 76  ? 52.392 71.240  78.901  1.00 40.20  ? 76   LEU B CG    1 
ATOM   6131  C  CD1   . LEU F 3 76  ? 53.579 71.004  79.811  1.00 32.58  ? 76   LEU B CD1   1 
ATOM   6132  C  CD2   . LEU F 3 76  ? 51.317 72.042  79.600  1.00 37.02  ? 76   LEU B CD2   1 
ATOM   6133  N  N     . TYR F 3 77  ? 52.296 73.638  74.892  1.00 51.75  ? 77   TYR B N     1 
ATOM   6134  C  CA    . TYR F 3 77  ? 52.159 74.908  74.201  1.00 54.08  ? 77   TYR B CA    1 
ATOM   6135  C  C     . TYR F 3 77  ? 50.836 74.961  73.442  1.00 56.07  ? 77   TYR B C     1 
ATOM   6136  O  O     . TYR F 3 77  ? 50.130 75.958  73.498  1.00 59.71  ? 77   TYR B O     1 
ATOM   6137  C  CB    . TYR F 3 77  ? 53.349 75.089  73.249  1.00 58.93  ? 77   TYR B CB    1 
ATOM   6138  C  CG    . TYR F 3 77  ? 53.106 75.977  72.045  1.00 62.79  ? 77   TYR B CG    1 
ATOM   6139  C  CD1   . TYR F 3 77  ? 52.694 77.300  72.191  1.00 63.18  ? 77   TYR B CD1   1 
ATOM   6140  C  CD2   . TYR F 3 77  ? 53.289 75.481  70.757  1.00 60.79  ? 77   TYR B CD2   1 
ATOM   6141  C  CE1   . TYR F 3 77  ? 52.466 78.102  71.079  1.00 68.41  ? 77   TYR B CE1   1 
ATOM   6142  C  CE2   . TYR F 3 77  ? 53.068 76.267  69.646  1.00 63.93  ? 77   TYR B CE2   1 
ATOM   6143  C  CZ    . TYR F 3 77  ? 52.652 77.577  69.805  1.00 68.85  ? 77   TYR B CZ    1 
ATOM   6144  O  OH    . TYR F 3 77  ? 52.389 78.345  68.686  1.00 67.48  ? 77   TYR B OH    1 
ATOM   6145  N  N     . LEU F 3 78  ? 50.510 73.880  72.738  1.00 55.33  ? 78   LEU B N     1 
ATOM   6146  C  CA    . LEU F 3 78  ? 49.272 73.788  71.967  1.00 52.40  ? 78   LEU B CA    1 
ATOM   6147  C  C     . LEU F 3 78  ? 48.068 73.883  72.885  1.00 54.00  ? 78   LEU B C     1 
ATOM   6148  O  O     . LEU F 3 78  ? 46.977 74.211  72.442  1.00 54.09  ? 78   LEU B O     1 
ATOM   6149  C  CB    . LEU F 3 78  ? 49.204 72.461  71.204  1.00 39.83  ? 78   LEU B CB    1 
ATOM   6150  C  CG    . LEU F 3 78  ? 50.251 72.190  70.118  1.00 44.29  ? 78   LEU B CG    1 
ATOM   6151  C  CD1   . LEU F 3 78  ? 50.539 70.705  70.045  1.00 43.78  ? 78   LEU B CD1   1 
ATOM   6152  C  CD2   . LEU F 3 78  ? 49.759 72.697  68.768  1.00 43.41  ? 78   LEU B CD2   1 
ATOM   6153  N  N     . GLN F 3 79  ? 48.258 73.581  74.164  1.00 54.57  ? 79   GLN B N     1 
ATOM   6154  C  CA    . GLN F 3 79  ? 47.157 73.650  75.112  1.00 57.24  ? 79   GLN B CA    1 
ATOM   6155  C  C     . GLN F 3 79  ? 46.963 75.095  75.516  1.00 61.14  ? 79   GLN B C     1 
ATOM   6156  O  O     . GLN F 3 79  ? 45.836 75.555  75.697  1.00 61.45  ? 79   GLN B O     1 
ATOM   6157  C  CB    . GLN F 3 79  ? 47.449 72.815  76.360  1.00 54.89  ? 79   GLN B CB    1 
ATOM   6158  C  CG    . GLN F 3 79  ? 46.386 72.956  77.448  1.00 54.11  ? 79   GLN B CG    1 
ATOM   6159  C  CD    . GLN F 3 79  ? 46.865 72.486  78.812  1.00 57.46  ? 79   GLN B CD    1 
ATOM   6160  O  OE1   . GLN F 3 79  ? 47.963 72.840  79.257  1.00 50.75  ? 79   GLN B OE1   1 
ATOM   6161  N  NE2   . GLN F 3 79  ? 46.036 71.701  79.492  1.00 59.90  ? 79   GLN B NE2   1 
ATOM   6162  N  N     . ALA F 3 80  ? 48.076 75.807  75.667  1.00 62.61  ? 80   ALA B N     1 
ATOM   6163  C  CA    . ALA F 3 80  ? 48.038 77.214  76.048  1.00 62.51  ? 80   ALA B CA    1 
ATOM   6164  C  C     . ALA F 3 80  ? 47.342 78.022  74.958  1.00 63.20  ? 80   ALA B C     1 
ATOM   6165  O  O     . ALA F 3 80  ? 46.482 78.856  75.247  1.00 61.85  ? 80   ALA B O     1 
ATOM   6166  C  CB    . ALA F 3 80  ? 49.446 77.730  76.269  1.00 50.41  ? 80   ALA B CB    1 
ATOM   6167  N  N     . ARG F 3 81  ? 47.713 77.770  73.705  1.00 62.90  ? 81   ARG B N     1 
ATOM   6168  C  CA    . ARG F 3 81  ? 47.095 78.461  72.583  1.00 63.54  ? 81   ARG B CA    1 
ATOM   6169  C  C     . ARG F 3 81  ? 45.579 78.304  72.650  1.00 63.06  ? 81   ARG B C     1 
ATOM   6170  O  O     . ARG F 3 81  ? 44.839 79.029  71.984  1.00 63.13  ? 81   ARG B O     1 
ATOM   6171  C  CB    . ARG F 3 81  ? 47.616 77.907  71.257  1.00 69.61  ? 81   ARG B CB    1 
ATOM   6172  C  CG    . ARG F 3 81  ? 48.890 78.571  70.769  1.00 75.53  ? 81   ARG B CG    1 
ATOM   6173  C  CD    . ARG F 3 81  ? 49.449 77.879  69.536  1.00 79.51  ? 81   ARG B CD    1 
ATOM   6174  N  NE    . ARG F 3 81  ? 48.460 77.749  68.472  1.00 80.23  ? 81   ARG B NE    1 
ATOM   6175  C  CZ    . ARG F 3 81  ? 48.701 77.154  67.307  1.00 80.64  ? 81   ARG B CZ    1 
ATOM   6176  N  NH1   . ARG F 3 81  ? 49.906 76.635  67.050  1.00 70.76  ? 81   ARG B NH1   1 
ATOM   6177  N  NH2   . ARG F 3 81  ? 47.734 77.068  66.401  1.00 77.69  ? 81   ARG B NH2   1 
ATOM   6178  N  N     . GLY F 3 82  ? 45.122 77.349  73.455  1.00 62.45  ? 82   GLY B N     1 
ATOM   6179  C  CA    . GLY F 3 82  ? 43.695 77.131  73.609  1.00 60.91  ? 82   GLY B CA    1 
ATOM   6180  C  C     . GLY F 3 82  ? 43.038 76.163  72.640  1.00 59.89  ? 82   GLY B C     1 
ATOM   6181  O  O     . GLY F 3 82  ? 41.810 76.169  72.504  1.00 60.32  ? 82   GLY B O     1 
ATOM   6182  N  N     . LEU F 3 83  ? 43.839 75.341  71.967  1.00 57.38  ? 83   LEU B N     1 
ATOM   6183  C  CA    . LEU F 3 83  ? 43.317 74.359  71.029  1.00 52.76  ? 83   LEU B CA    1 
ATOM   6184  C  C     . LEU F 3 83  ? 42.499 73.303  71.770  1.00 55.47  ? 83   LEU B C     1 
ATOM   6185  O  O     . LEU F 3 83  ? 42.580 73.168  72.990  1.00 56.34  ? 83   LEU B O     1 
ATOM   6186  C  CB    . LEU F 3 83  ? 44.463 73.677  70.291  1.00 46.53  ? 83   LEU B CB    1 
ATOM   6187  C  CG    . LEU F 3 83  ? 45.420 74.611  69.563  1.00 47.54  ? 83   LEU B CG    1 
ATOM   6188  C  CD1   . LEU F 3 83  ? 46.558 73.833  68.928  1.00 37.95  ? 83   LEU B CD1   1 
ATOM   6189  C  CD2   . LEU F 3 83  ? 44.652 75.363  68.513  1.00 49.17  ? 83   LEU B CD2   1 
ATOM   6190  N  N     . ALA F 3 84  ? 41.715 72.544  71.020  1.00 56.95  ? 84   ALA B N     1 
ATOM   6191  C  CA    . ALA F 3 84  ? 40.883 71.498  71.596  1.00 52.29  ? 84   ALA B CA    1 
ATOM   6192  C  C     . ALA F 3 84  ? 41.675 70.234  71.939  1.00 52.23  ? 84   ALA B C     1 
ATOM   6193  O  O     . ALA F 3 84  ? 42.685 69.916  71.304  1.00 55.32  ? 84   ALA B O     1 
ATOM   6194  C  CB    . ALA F 3 84  ? 39.767 71.157  70.637  1.00 38.59  ? 84   ALA B CB    1 
ATOM   6195  N  N     . VAL F 3 85  ? 41.193 69.507  72.943  1.00 48.49  ? 85   VAL B N     1 
ATOM   6196  C  CA    . VAL F 3 85  ? 41.844 68.283  73.380  1.00 42.79  ? 85   VAL B CA    1 
ATOM   6197  C  C     . VAL F 3 85  ? 41.989 67.297  72.228  1.00 41.55  ? 85   VAL B C     1 
ATOM   6198  O  O     . VAL F 3 85  ? 43.046 66.701  72.027  1.00 39.19  ? 85   VAL B O     1 
ATOM   6199  C  CB    . VAL F 3 85  ? 41.052 67.631  74.515  1.00 39.74  ? 85   VAL B CB    1 
ATOM   6200  C  CG1   . VAL F 3 85  ? 41.596 66.246  74.800  1.00 32.91  ? 85   VAL B CG1   1 
ATOM   6201  C  CG2   . VAL F 3 85  ? 41.135 68.498  75.756  1.00 38.04  ? 85   VAL B CG2   1 
ATOM   6202  N  N     . LYS F 3 86  ? 40.921 67.128  71.463  1.00 39.88  ? 86   LYS B N     1 
ATOM   6203  C  CA    . LYS F 3 86  ? 40.969 66.213  70.333  1.00 38.31  ? 86   LYS B CA    1 
ATOM   6204  C  C     . LYS F 3 86  ? 41.981 66.731  69.302  1.00 39.51  ? 86   LYS B C     1 
ATOM   6205  O  O     . LYS F 3 86  ? 42.593 65.947  68.581  1.00 36.83  ? 86   LYS B O     1 
ATOM   6206  C  CB    . LYS F 3 86  ? 39.582 66.084  69.701  1.00 32.45  ? 86   LYS B CB    1 
ATOM   6207  C  CG    . LYS F 3 86  ? 39.514 65.005  68.654  1.00 40.58  ? 86   LYS B CG    1 
ATOM   6208  C  CD    . LYS F 3 86  ? 39.122 63.652  69.240  1.00 51.84  ? 86   LYS B CD    1 
ATOM   6209  C  CE    . LYS F 3 86  ? 37.622 63.602  69.559  1.00 52.79  ? 86   LYS B CE    1 
ATOM   6210  N  NZ    . LYS F 3 86  ? 37.172 62.215  69.871  1.00 46.60  ? 86   LYS B NZ    1 
ATOM   6211  N  N     . THR F 3 87  ? 42.153 68.053  69.242  1.00 41.30  ? 87   THR B N     1 
ATOM   6212  C  CA    . THR F 3 87  ? 43.101 68.668  68.311  1.00 42.34  ? 87   THR B CA    1 
ATOM   6213  C  C     . THR F 3 87  ? 44.528 68.332  68.738  1.00 42.70  ? 87   THR B C     1 
ATOM   6214  O  O     . THR F 3 87  ? 45.357 67.923  67.920  1.00 37.97  ? 87   THR B O     1 
ATOM   6215  C  CB    . THR F 3 87  ? 42.936 70.225  68.264  1.00 41.30  ? 87   THR B CB    1 
ATOM   6216  O  OG1   . THR F 3 87  ? 41.900 70.577  67.337  1.00 48.89  ? 87   THR B OG1   1 
ATOM   6217  C  CG2   . THR F 3 87  ? 44.232 70.903  67.835  1.00 29.55  ? 87   THR B CG2   1 
ATOM   6218  N  N     . ILE F 3 88  ? 44.803 68.502  70.028  1.00 41.21  ? 88   ILE B N     1 
ATOM   6219  C  CA    . ILE F 3 88  ? 46.123 68.231  70.560  1.00 39.37  ? 88   ILE B CA    1 
ATOM   6220  C  C     . ILE F 3 88  ? 46.498 66.772  70.408  1.00 44.88  ? 88   ILE B C     1 
ATOM   6221  O  O     . ILE F 3 88  ? 47.656 66.446  70.176  1.00 45.44  ? 88   ILE B O     1 
ATOM   6222  C  CB    . ILE F 3 88  ? 46.210 68.615  72.034  1.00 24.61  ? 88   ILE B CB    1 
ATOM   6223  C  CG1   . ILE F 3 88  ? 45.878 70.093  72.203  1.00 22.35  ? 88   ILE B CG1   1 
ATOM   6224  C  CG2   . ILE F 3 88  ? 47.614 68.353  72.564  1.00 22.82  ? 88   ILE B CG2   1 
ATOM   6225  C  CD1   . ILE F 3 88  ? 46.006 70.578  73.613  1.00 24.37  ? 88   ILE B CD1   1 
ATOM   6226  N  N     . GLN F 3 89  ? 45.520 65.886  70.528  1.00 50.38  ? 89   GLN B N     1 
ATOM   6227  C  CA    . GLN F 3 89  ? 45.797 64.458  70.392  1.00 51.65  ? 89   GLN B CA    1 
ATOM   6228  C  C     . GLN F 3 89  ? 46.188 64.121  68.954  1.00 52.93  ? 89   GLN B C     1 
ATOM   6229  O  O     . GLN F 3 89  ? 46.815 63.088  68.706  1.00 51.79  ? 89   GLN B O     1 
ATOM   6230  C  CB    . GLN F 3 89  ? 44.572 63.629  70.803  1.00 44.82  ? 89   GLN B CB    1 
ATOM   6231  C  CG    . GLN F 3 89  ? 44.015 63.989  72.165  1.00 55.27  ? 89   GLN B CG    1 
ATOM   6232  C  CD    . GLN F 3 89  ? 42.906 63.062  72.612  1.00 58.70  ? 89   GLN B CD    1 
ATOM   6233  O  OE1   . GLN F 3 89  ? 41.962 62.796  71.867  1.00 55.89  ? 89   GLN B OE1   1 
ATOM   6234  N  NE2   . GLN F 3 89  ? 43.008 62.571  73.842  1.00 61.09  ? 89   GLN B NE2   1 
ATOM   6235  N  N     . GLN F 3 90  ? 45.811 64.997  68.019  1.00 52.37  ? 90   GLN B N     1 
ATOM   6236  C  CA    . GLN F 3 90  ? 46.106 64.809  66.597  1.00 51.01  ? 90   GLN B CA    1 
ATOM   6237  C  C     . GLN F 3 90  ? 47.545 65.165  66.304  1.00 50.91  ? 90   GLN B C     1 
ATOM   6238  O  O     . GLN F 3 90  ? 48.203 64.510  65.491  1.00 48.00  ? 90   GLN B O     1 
ATOM   6239  C  CB    . GLN F 3 90  ? 45.197 65.680  65.732  1.00 56.57  ? 90   GLN B CB    1 
ATOM   6240  C  CG    . GLN F 3 90  ? 45.626 65.786  64.266  1.00 55.67  ? 90   GLN B CG    1 
ATOM   6241  C  CD    . GLN F 3 90  ? 45.296 64.552  63.451  1.00 57.96  ? 90   GLN B CD    1 
ATOM   6242  O  OE1   . GLN F 3 90  ? 44.133 64.262  63.184  1.00 56.67  ? 90   GLN B OE1   1 
ATOM   6243  N  NE2   . GLN F 3 90  ? 46.321 63.819  63.051  1.00 64.50  ? 90   GLN B NE2   1 
ATOM   6244  N  N     . HIS F 3 91  ? 48.044 66.215  66.944  1.00 48.56  ? 91   HIS B N     1 
ATOM   6245  C  CA    . HIS F 3 91  ? 49.427 66.568  66.703  1.00 44.19  ? 91   HIS B CA    1 
ATOM   6246  C  C     . HIS F 3 91  ? 50.266 65.467  67.309  1.00 43.35  ? 91   HIS B C     1 
ATOM   6247  O  O     . HIS F 3 91  ? 51.067 64.854  66.619  1.00 44.02  ? 91   HIS B O     1 
ATOM   6248  C  CB    . HIS F 3 91  ? 49.779 67.928  67.311  1.00 44.18  ? 91   HIS B CB    1 
ATOM   6249  C  CG    . HIS F 3 91  ? 49.171 69.084  66.581  1.00 51.62  ? 91   HIS B CG    1 
ATOM   6250  N  ND1   . HIS F 3 91  ? 49.764 70.327  66.526  1.00 52.29  ? 91   HIS B ND1   1 
ATOM   6251  C  CD2   . HIS F 3 91  ? 48.015 69.189  65.879  1.00 51.70  ? 91   HIS B CD2   1 
ATOM   6252  C  CE1   . HIS F 3 91  ? 49.002 71.145  65.820  1.00 49.09  ? 91   HIS B CE1   1 
ATOM   6253  N  NE2   . HIS F 3 91  ? 47.934 70.479  65.416  1.00 47.15  ? 91   HIS B NE2   1 
ATOM   6254  N  N     . LEU F 3 92  ? 50.057 65.197  68.595  1.00 46.51  ? 92   LEU B N     1 
ATOM   6255  C  CA    . LEU F 3 92  ? 50.802 64.150  69.283  1.00 41.31  ? 92   LEU B CA    1 
ATOM   6256  C  C     . LEU F 3 92  ? 50.658 62.862  68.502  1.00 39.70  ? 92   LEU B C     1 
ATOM   6257  O  O     . LEU F 3 92  ? 51.559 62.036  68.478  1.00 38.92  ? 92   LEU B O     1 
ATOM   6258  C  CB    . LEU F 3 92  ? 50.261 63.946  70.696  1.00 30.56  ? 92   LEU B CB    1 
ATOM   6259  C  CG    . LEU F 3 92  ? 50.843 62.764  71.479  1.00 31.43  ? 92   LEU B CG    1 
ATOM   6260  C  CD1   . LEU F 3 92  ? 52.338 62.931  71.600  1.00 26.52  ? 92   LEU B CD1   1 
ATOM   6261  C  CD2   . LEU F 3 92  ? 50.203 62.687  72.864  1.00 29.34  ? 92   LEU B CD2   1 
ATOM   6262  N  N     . GLY F 3 93  ? 49.511 62.712  67.855  1.00 37.47  ? 93   GLY B N     1 
ATOM   6263  C  CA    . GLY F 3 93  ? 49.239 61.526  67.070  1.00 36.55  ? 93   GLY B CA    1 
ATOM   6264  C  C     . GLY F 3 93  ? 50.067 61.444  65.814  1.00 38.16  ? 93   GLY B C     1 
ATOM   6265  O  O     . GLY F 3 93  ? 50.792 60.476  65.615  1.00 37.63  ? 93   GLY B O     1 
ATOM   6266  N  N     . GLN F 3 94  ? 49.963 62.451  64.954  1.00 41.73  ? 94   GLN B N     1 
ATOM   6267  C  CA    . GLN F 3 94  ? 50.731 62.450  63.713  1.00 42.51  ? 94   GLN B CA    1 
ATOM   6268  C  C     . GLN F 3 94  ? 52.209 62.303  64.033  1.00 44.89  ? 94   GLN B C     1 
ATOM   6269  O  O     . GLN F 3 94  ? 52.923 61.493  63.441  1.00 43.19  ? 94   GLN B O     1 
ATOM   6270  C  CB    . GLN F 3 94  ? 50.497 63.744  62.937  1.00 36.58  ? 94   GLN B CB    1 
ATOM   6271  C  CG    . GLN F 3 94  ? 49.132 63.824  62.291  1.00 43.68  ? 94   GLN B CG    1 
ATOM   6272  C  CD    . GLN F 3 94  ? 48.852 62.651  61.378  1.00 40.21  ? 94   GLN B CD    1 
ATOM   6273  O  OE1   . GLN F 3 94  ? 49.618 61.695  61.319  1.00 40.50  ? 94   GLN B OE1   1 
ATOM   6274  N  NE2   . GLN F 3 94  ? 47.743 62.712  60.671  1.00 41.44  ? 94   GLN B NE2   1 
ATOM   6275  N  N     . LEU F 3 95  ? 52.653 63.103  64.990  1.00 44.67  ? 95   LEU B N     1 
ATOM   6276  C  CA    . LEU F 3 95  ? 54.026 63.093  65.435  1.00 41.95  ? 95   LEU B CA    1 
ATOM   6277  C  C     . LEU F 3 95  ? 54.420 61.659  65.718  1.00 47.35  ? 95   LEU B C     1 
ATOM   6278  O  O     . LEU F 3 95  ? 55.545 61.267  65.433  1.00 48.77  ? 95   LEU B O     1 
ATOM   6279  C  CB    . LEU F 3 95  ? 54.149 63.942  66.693  1.00 30.00  ? 95   LEU B CB    1 
ATOM   6280  C  CG    . LEU F 3 95  ? 55.374 64.834  66.819  1.00 31.90  ? 95   LEU B CG    1 
ATOM   6281  C  CD1   . LEU F 3 95  ? 55.959 65.115  65.443  1.00 32.50  ? 95   LEU B CD1   1 
ATOM   6282  C  CD2   . LEU F 3 95  ? 54.968 66.131  67.514  1.00 23.42  ? 95   LEU B CD2   1 
ATOM   6283  N  N     . ASN F 3 96  ? 53.494 60.875  66.271  1.00 49.09  ? 96   ASN B N     1 
ATOM   6284  C  CA    . ASN F 3 96  ? 53.763 59.469  66.570  1.00 50.18  ? 96   ASN B CA    1 
ATOM   6285  C  C     . ASN F 3 96  ? 53.918 58.661  65.297  1.00 52.75  ? 96   ASN B C     1 
ATOM   6286  O  O     . ASN F 3 96  ? 54.907 57.957  65.119  1.00 53.35  ? 96   ASN B O     1 
ATOM   6287  C  CB    . ASN F 3 96  ? 52.632 58.834  67.381  1.00 53.13  ? 96   ASN B CB    1 
ATOM   6288  C  CG    . ASN F 3 96  ? 52.829 58.966  68.869  1.00 52.54  ? 96   ASN B CG    1 
ATOM   6289  O  OD1   . ASN F 3 96  ? 53.955 58.959  69.357  1.00 53.56  ? 96   ASN B OD1   1 
ATOM   6290  N  ND2   . ASN F 3 96  ? 51.727 59.063  69.607  1.00 46.03  ? 96   ASN B ND2   1 
ATOM   6291  N  N     . MET F 3 97  ? 52.926 58.753  64.416  1.00 54.07  ? 97   MET B N     1 
ATOM   6292  C  CA    . MET F 3 97  ? 52.955 58.006  63.160  1.00 51.67  ? 97   MET B CA    1 
ATOM   6293  C  C     . MET F 3 97  ? 54.293 58.158  62.466  1.00 51.33  ? 97   MET B C     1 
ATOM   6294  O  O     . MET F 3 97  ? 54.835 57.199  61.936  1.00 49.44  ? 97   MET B O     1 
ATOM   6295  C  CB    . MET F 3 97  ? 51.855 58.483  62.216  1.00 50.25  ? 97   MET B CB    1 
ATOM   6296  C  CG    . MET F 3 97  ? 51.654 57.582  61.012  1.00 48.41  ? 97   MET B CG    1 
ATOM   6297  S  SD    . MET F 3 97  ? 50.927 58.471  59.611  1.00 61.64  ? 97   MET B SD    1 
ATOM   6298  C  CE    . MET F 3 97  ? 49.348 59.114  60.342  1.00 44.09  ? 97   MET B CE    1 
ATOM   6299  N  N     . LEU F 3 98  ? 54.824 59.372  62.478  1.00 53.70  ? 98   LEU B N     1 
ATOM   6300  C  CA    . LEU F 3 98  ? 56.098 59.645  61.836  1.00 50.70  ? 98   LEU B CA    1 
ATOM   6301  C  C     . LEU F 3 98  ? 57.162 58.718  62.369  1.00 50.10  ? 98   LEU B C     1 
ATOM   6302  O  O     . LEU F 3 98  ? 57.660 57.868  61.650  1.00 48.76  ? 98   LEU B O     1 
ATOM   6303  C  CB    . LEU F 3 98  ? 56.514 61.094  62.074  1.00 48.98  ? 98   LEU B CB    1 
ATOM   6304  C  CG    . LEU F 3 98  ? 57.501 61.671  61.060  1.00 45.89  ? 98   LEU B CG    1 
ATOM   6305  C  CD1   . LEU F 3 98  ? 56.949 61.519  59.650  1.00 38.59  ? 98   LEU B CD1   1 
ATOM   6306  C  CD2   . LEU F 3 98  ? 57.730 63.136  61.375  1.00 36.97  ? 98   LEU B CD2   1 
ATOM   6307  N  N     . HIS F 3 99  ? 57.497 58.864  63.640  1.00 49.29  ? 99   HIS B N     1 
ATOM   6308  C  CA    . HIS F 3 99  ? 58.526 58.024  64.216  1.00 50.95  ? 99   HIS B CA    1 
ATOM   6309  C  C     . HIS F 3 99  ? 58.279 56.519  64.124  1.00 53.27  ? 99   HIS B C     1 
ATOM   6310  O  O     . HIS F 3 99  ? 59.151 55.782  63.669  1.00 54.53  ? 99   HIS B O     1 
ATOM   6311  C  CB    . HIS F 3 99  ? 58.768 58.408  65.668  1.00 44.88  ? 99   HIS B CB    1 
ATOM   6312  C  CG    . HIS F 3 99  ? 59.133 59.845  65.853  1.00 48.86  ? 99   HIS B CG    1 
ATOM   6313  N  ND1   . HIS F 3 99  ? 58.255 60.874  65.589  1.00 53.42  ? 99   HIS B ND1   1 
ATOM   6314  C  CD2   . HIS F 3 99  ? 60.267 60.426  66.308  1.00 41.96  ? 99   HIS B CD2   1 
ATOM   6315  C  CE1   . HIS F 3 99  ? 58.830 62.027  65.881  1.00 46.22  ? 99   HIS B CE1   1 
ATOM   6316  N  NE2   . HIS F 3 99  ? 60.051 61.782  66.320  1.00 43.88  ? 99   HIS B NE2   1 
ATOM   6317  N  N     . ARG F 3 100 ? 57.108 56.047  64.537  1.00 55.46  ? 100  ARG B N     1 
ATOM   6318  C  CA    . ARG F 3 100 ? 56.880 54.614  64.490  1.00 56.93  ? 100  ARG B CA    1 
ATOM   6319  C  C     . ARG F 3 100 ? 57.072 54.091  63.096  1.00 58.36  ? 100  ARG B C     1 
ATOM   6320  O  O     . ARG F 3 100 ? 57.798 53.117  62.888  1.00 59.47  ? 100  ARG B O     1 
ATOM   6321  C  CB    . ARG F 3 100 ? 55.482 54.216  64.954  1.00 57.14  ? 100  ARG B CB    1 
ATOM   6322  C  CG    . ARG F 3 100 ? 55.434 52.723  65.306  1.00 63.05  ? 100  ARG B CG    1 
ATOM   6323  C  CD    . ARG F 3 100 ? 54.032 52.165  65.483  1.00 67.27  ? 100  ARG B CD    1 
ATOM   6324  N  NE    . ARG F 3 100 ? 53.338 52.026  64.205  1.00 75.35  ? 100  ARG B NE    1 
ATOM   6325  C  CZ    . ARG F 3 100 ? 52.454 51.066  63.938  1.00 78.45  ? 100  ARG B CZ    1 
ATOM   6326  N  NH1   . ARG F 3 100 ? 52.153 50.155  64.863  1.00 69.45  ? 100  ARG B NH1   1 
ATOM   6327  N  NH2   . ARG F 3 100 ? 51.877 51.005  62.741  1.00 79.57  ? 100  ARG B NH2   1 
ATOM   6328  N  N     . ARG F 3 101 ? 56.419 54.746  62.143  1.00 58.12  ? 101  ARG B N     1 
ATOM   6329  C  CA    . ARG F 3 101 ? 56.489 54.339  60.749  1.00 58.41  ? 101  ARG B CA    1 
ATOM   6330  C  C     . ARG F 3 101 ? 57.918 54.293  60.220  1.00 60.93  ? 101  ARG B C     1 
ATOM   6331  O  O     . ARG F 3 101 ? 58.213 53.539  59.293  1.00 61.18  ? 101  ARG B O     1 
ATOM   6332  C  CB    . ARG F 3 101 ? 55.657 55.275  59.889  1.00 55.70  ? 101  ARG B CB    1 
ATOM   6333  C  CG    . ARG F 3 101 ? 54.992 54.567  58.739  1.00 58.25  ? 101  ARG B CG    1 
ATOM   6334  C  CD    . ARG F 3 101 ? 53.802 53.740  59.193  1.00 53.07  ? 101  ARG B CD    1 
ATOM   6335  N  NE    . ARG F 3 101 ? 53.520 52.658  58.255  1.00 63.99  ? 101  ARG B NE    1 
ATOM   6336  C  CZ    . ARG F 3 101 ? 52.382 51.973  58.221  1.00 65.55  ? 101  ARG B CZ    1 
ATOM   6337  N  NH1   . ARG F 3 101 ? 51.406 52.265  59.070  1.00 72.36  ? 101  ARG B NH1   1 
ATOM   6338  N  NH2   . ARG F 3 101 ? 52.224 50.982  57.348  1.00 60.16  ? 101  ARG B NH2   1 
ATOM   6339  N  N     . SER F 3 102 ? 58.806 55.097  60.796  1.00 61.17  ? 102  SER B N     1 
ATOM   6340  C  CA    . SER F 3 102 ? 60.198 55.088  60.372  1.00 59.31  ? 102  SER B CA    1 
ATOM   6341  C  C     . SER F 3 102 ? 61.064 54.350  61.401  1.00 58.93  ? 102  SER B C     1 
ATOM   6342  O  O     . SER F 3 102 ? 62.092 54.849  61.850  1.00 59.02  ? 102  SER B O     1 
ATOM   6343  C  CB    . SER F 3 102 ? 60.705 56.511  60.175  1.00 60.47  ? 102  SER B CB    1 
ATOM   6344  O  OG    . SER F 3 102 ? 60.824 57.177  61.412  1.00 66.00  ? 102  SER B OG    1 
ATOM   6345  N  N     . GLY F 3 103 ? 60.616 53.160  61.783  1.00 58.83  ? 103  GLY B N     1 
ATOM   6346  C  CA    . GLY F 3 103 ? 61.352 52.327  62.717  1.00 59.08  ? 103  GLY B CA    1 
ATOM   6347  C  C     . GLY F 3 103 ? 61.869 52.897  64.024  1.00 60.21  ? 103  GLY B C     1 
ATOM   6348  O  O     . GLY F 3 103 ? 62.607 52.218  64.737  1.00 57.76  ? 103  GLY B O     1 
ATOM   6349  N  N     . LEU F 3 104 ? 61.492 54.122  64.359  1.00 62.08  ? 104  LEU B N     1 
ATOM   6350  C  CA    . LEU F 3 104 ? 61.945 54.731  65.609  1.00 64.31  ? 104  LEU B CA    1 
ATOM   6351  C  C     . LEU F 3 104 ? 60.888 54.664  66.713  1.00 66.68  ? 104  LEU B C     1 
ATOM   6352  O  O     . LEU F 3 104 ? 59.695 54.565  66.441  1.00 66.98  ? 104  LEU B O     1 
ATOM   6353  C  CB    . LEU F 3 104 ? 62.298 56.186  65.357  1.00 57.33  ? 104  LEU B CB    1 
ATOM   6354  C  CG    . LEU F 3 104 ? 63.294 56.364  64.228  1.00 53.00  ? 104  LEU B CG    1 
ATOM   6355  C  CD1   . LEU F 3 104 ? 63.258 57.796  63.723  1.00 47.58  ? 104  LEU B CD1   1 
ATOM   6356  C  CD2   . LEU F 3 104 ? 64.664 55.968  64.733  1.00 52.30  ? 104  LEU B CD2   1 
ATOM   6357  N  N     . PRO F 3 105 ? 61.313 54.714  67.981  1.00 67.17  ? 105  PRO B N     1 
ATOM   6358  C  CA    . PRO F 3 105 ? 60.326 54.662  69.063  1.00 67.63  ? 105  PRO B CA    1 
ATOM   6359  C  C     . PRO F 3 105 ? 59.429 55.910  69.074  1.00 67.27  ? 105  PRO B C     1 
ATOM   6360  O  O     . PRO F 3 105 ? 59.875 57.009  68.731  1.00 68.45  ? 105  PRO B O     1 
ATOM   6361  C  CB    . PRO F 3 105 ? 61.196 54.531  70.315  1.00 67.83  ? 105  PRO B CB    1 
ATOM   6362  C  CG    . PRO F 3 105 ? 62.486 55.187  69.908  1.00 66.10  ? 105  PRO B CG    1 
ATOM   6363  C  CD    . PRO F 3 105 ? 62.683 54.672  68.512  1.00 66.76  ? 105  PRO B CD    1 
ATOM   6364  N  N     . ARG F 3 106 ? 58.170 55.725  69.467  1.00 62.92  ? 106  ARG B N     1 
ATOM   6365  C  CA    . ARG F 3 106 ? 57.182 56.797  69.505  1.00 59.06  ? 106  ARG B CA    1 
ATOM   6366  C  C     . ARG F 3 106 ? 57.366 57.749  70.668  1.00 60.05  ? 106  ARG B C     1 
ATOM   6367  O  O     . ARG F 3 106 ? 57.657 57.322  71.777  1.00 62.52  ? 106  ARG B O     1 
ATOM   6368  C  CB    . ARG F 3 106 ? 55.777 56.199  69.616  1.00 49.49  ? 106  ARG B CB    1 
ATOM   6369  C  CG    . ARG F 3 106 ? 55.380 55.256  68.509  1.00 48.72  ? 106  ARG B CG    1 
ATOM   6370  C  CD    . ARG F 3 106 ? 54.537 54.079  69.019  1.00 54.75  ? 106  ARG B CD    1 
ATOM   6371  N  NE    . ARG F 3 106 ? 53.186 54.439  69.449  1.00 60.05  ? 106  ARG B NE    1 
ATOM   6372  C  CZ    . ARG F 3 106 ? 52.849 54.797  70.688  1.00 59.81  ? 106  ARG B CZ    1 
ATOM   6373  N  NH1   . ARG F 3 106 ? 53.755 54.854  71.650  1.00 53.07  ? 106  ARG B NH1   1 
ATOM   6374  N  NH2   . ARG F 3 106 ? 51.589 55.088  70.973  1.00 57.10  ? 106  ARG B NH2   1 
ATOM   6375  N  N     . PRO F 3 107 ? 57.206 59.059  70.434  1.00 58.78  ? 107  PRO B N     1 
ATOM   6376  C  CA    . PRO F 3 107 ? 57.365 59.980  71.559  1.00 57.92  ? 107  PRO B CA    1 
ATOM   6377  C  C     . PRO F 3 107 ? 56.308 59.691  72.624  1.00 58.06  ? 107  PRO B C     1 
ATOM   6378  O  O     . PRO F 3 107 ? 56.421 60.139  73.758  1.00 58.73  ? 107  PRO B O     1 
ATOM   6379  C  CB    . PRO F 3 107 ? 57.212 61.361  70.912  1.00 52.72  ? 107  PRO B CB    1 
ATOM   6380  C  CG    . PRO F 3 107 ? 56.498 61.092  69.646  1.00 53.85  ? 107  PRO B CG    1 
ATOM   6381  C  CD    . PRO F 3 107 ? 57.117 59.807  69.175  1.00 54.15  ? 107  PRO B CD    1 
ATOM   6382  N  N     . SER F 3 108 ? 55.281 58.934  72.257  1.00 57.32  ? 108  SER B N     1 
ATOM   6383  C  CA    . SER F 3 108 ? 54.246 58.575  73.214  1.00 56.69  ? 108  SER B CA    1 
ATOM   6384  C  C     . SER F 3 108 ? 54.665 57.333  73.980  1.00 56.00  ? 108  SER B C     1 
ATOM   6385  O  O     . SER F 3 108 ? 53.949 56.878  74.866  1.00 55.96  ? 108  SER B O     1 
ATOM   6386  C  CB    . SER F 3 108 ? 52.909 58.306  72.522  1.00 54.05  ? 108  SER B CB    1 
ATOM   6387  O  OG    . SER F 3 108 ? 52.205 59.511  72.284  1.00 58.09  ? 108  SER B OG    1 
ATOM   6388  N  N     . ASP F 3 109 ? 55.821 56.776  73.641  1.00 55.73  ? 109  ASP B N     1 
ATOM   6389  C  CA    . ASP F 3 109 ? 56.305 55.584  74.328  1.00 54.70  ? 109  ASP B CA    1 
ATOM   6390  C  C     . ASP F 3 109 ? 57.091 55.980  75.565  1.00 54.85  ? 109  ASP B C     1 
ATOM   6391  O  O     . ASP F 3 109 ? 57.529 55.125  76.330  1.00 55.13  ? 109  ASP B O     1 
ATOM   6392  C  CB    . ASP F 3 109 ? 57.177 54.738  73.389  1.00 51.72  ? 109  ASP B CB    1 
ATOM   6393  C  CG    . ASP F 3 109 ? 56.351 53.827  72.468  1.00 62.05  ? 109  ASP B CG    1 
ATOM   6394  O  OD1   . ASP F 3 109 ? 56.778 53.565  71.312  1.00 60.67  ? 109  ASP B OD1   1 
ATOM   6395  O  OD2   . ASP F 3 109 ? 55.277 53.356  72.911  1.00 62.38  ? 109  ASP B OD2   1 
ATOM   6396  N  N     . SER F 3 110 ? 57.266 57.285  75.753  1.00 55.82  ? 110  SER B N     1 
ATOM   6397  C  CA    . SER F 3 110 ? 57.998 57.810  76.901  1.00 57.88  ? 110  SER B CA    1 
ATOM   6398  C  C     . SER F 3 110 ? 57.045 58.409  77.905  1.00 58.61  ? 110  SER B C     1 
ATOM   6399  O  O     . SER F 3 110 ? 56.224 59.258  77.573  1.00 59.49  ? 110  SER B O     1 
ATOM   6400  C  CB    . SER F 3 110 ? 59.015 58.879  76.483  1.00 59.77  ? 110  SER B CB    1 
ATOM   6401  O  OG    . SER F 3 110 ? 60.245 58.305  76.051  1.00 69.47  ? 110  SER B OG    1 
ATOM   6402  N  N     . ASN F 3 111 ? 57.179 57.960  79.143  1.00 57.58  ? 111  ASN B N     1 
ATOM   6403  C  CA    . ASN F 3 111 ? 56.348 58.406  80.245  1.00 56.36  ? 111  ASN B CA    1 
ATOM   6404  C  C     . ASN F 3 111 ? 56.013 59.894  80.254  1.00 53.90  ? 111  ASN B C     1 
ATOM   6405  O  O     . ASN F 3 111 ? 54.882 60.275  80.506  1.00 54.58  ? 111  ASN B O     1 
ATOM   6406  C  CB    . ASN F 3 111 ? 57.033 58.022  81.544  1.00 60.64  ? 111  ASN B CB    1 
ATOM   6407  C  CG    . ASN F 3 111 ? 56.155 57.192  82.427  1.00 60.36  ? 111  ASN B CG    1 
ATOM   6408  O  OD1   . ASN F 3 111 ? 55.466 56.282  81.958  1.00 64.89  ? 111  ASN B OD1   1 
ATOM   6409  N  ND2   . ASN F 3 111 ? 56.174 57.486  83.723  1.00 56.66  ? 111  ASN B ND2   1 
ATOM   6410  N  N     . ALA F 3 112 ? 56.999 60.734  79.980  1.00 53.49  ? 112  ALA B N     1 
ATOM   6411  C  CA    . ALA F 3 112 ? 56.793 62.175  79.971  1.00 51.02  ? 112  ALA B CA    1 
ATOM   6412  C  C     . ALA F 3 112 ? 55.676 62.642  79.033  1.00 50.47  ? 112  ALA B C     1 
ATOM   6413  O  O     . ALA F 3 112 ? 54.843 63.456  79.412  1.00 47.47  ? 112  ALA B O     1 
ATOM   6414  C  CB    . ALA F 3 112 ? 58.096 62.868  79.610  1.00 48.07  ? 112  ALA B CB    1 
ATOM   6415  N  N     . VAL F 3 113 ? 55.666 62.138  77.804  1.00 50.83  ? 113  VAL B N     1 
ATOM   6416  C  CA    . VAL F 3 113 ? 54.642 62.525  76.837  1.00 48.59  ? 113  VAL B CA    1 
ATOM   6417  C  C     . VAL F 3 113 ? 53.268 61.938  77.150  1.00 47.05  ? 113  VAL B C     1 
ATOM   6418  O  O     . VAL F 3 113 ? 52.299 62.671  77.316  1.00 45.40  ? 113  VAL B O     1 
ATOM   6419  C  CB    . VAL F 3 113 ? 55.057 62.129  75.384  1.00 44.26  ? 113  VAL B CB    1 
ATOM   6420  C  CG1   . VAL F 3 113 ? 53.844 61.877  74.518  1.00 35.52  ? 113  VAL B CG1   1 
ATOM   6421  C  CG2   . VAL F 3 113 ? 55.857 63.243  74.765  1.00 36.31  ? 113  VAL B CG2   1 
ATOM   6422  N  N     . SER F 3 114 ? 53.179 60.619  77.242  1.00 44.55  ? 114  SER B N     1 
ATOM   6423  C  CA    . SER F 3 114 ? 51.896 59.992  77.505  1.00 45.20  ? 114  SER B CA    1 
ATOM   6424  C  C     . SER F 3 114 ? 51.216 60.496  78.776  1.00 44.20  ? 114  SER B C     1 
ATOM   6425  O  O     . SER F 3 114 ? 49.992 60.532  78.851  1.00 44.02  ? 114  SER B O     1 
ATOM   6426  C  CB    . SER F 3 114 ? 52.043 58.469  77.548  1.00 42.43  ? 114  SER B CB    1 
ATOM   6427  O  OG    . SER F 3 114 ? 52.913 58.057  78.578  1.00 43.94  ? 114  SER B OG    1 
ATOM   6428  N  N     . LEU F 3 115 ? 51.987 60.896  79.776  1.00 41.10  ? 115  LEU B N     1 
ATOM   6429  C  CA    . LEU F 3 115 ? 51.360 61.385  80.987  1.00 39.18  ? 115  LEU B CA    1 
ATOM   6430  C  C     . LEU F 3 115 ? 50.861 62.804  80.816  1.00 41.14  ? 115  LEU B C     1 
ATOM   6431  O  O     . LEU F 3 115 ? 49.833 63.168  81.366  1.00 43.05  ? 115  LEU B O     1 
ATOM   6432  C  CB    . LEU F 3 115 ? 52.323 61.305  82.175  1.00 27.78  ? 115  LEU B CB    1 
ATOM   6433  C  CG    . LEU F 3 115 ? 52.416 59.908  82.808  1.00 28.11  ? 115  LEU B CG    1 
ATOM   6434  C  CD1   . LEU F 3 115 ? 53.647 59.783  83.683  1.00 23.44  ? 115  LEU B CD1   1 
ATOM   6435  C  CD2   . LEU F 3 115 ? 51.159 59.637  83.621  1.00 25.12  ? 115  LEU B CD2   1 
ATOM   6436  N  N     . VAL F 3 116 ? 51.573 63.609  80.039  1.00 44.37  ? 116  VAL B N     1 
ATOM   6437  C  CA    . VAL F 3 116 ? 51.174 64.998  79.850  1.00 43.77  ? 116  VAL B CA    1 
ATOM   6438  C  C     . VAL F 3 116 ? 49.917 65.082  79.014  1.00 42.90  ? 116  VAL B C     1 
ATOM   6439  O  O     . VAL F 3 116 ? 49.060 65.932  79.251  1.00 42.70  ? 116  VAL B O     1 
ATOM   6440  C  CB    . VAL F 3 116 ? 52.299 65.824  79.182  1.00 41.32  ? 116  VAL B CB    1 
ATOM   6441  C  CG1   . VAL F 3 116 ? 52.539 65.344  77.771  1.00 36.60  ? 116  VAL B CG1   1 
ATOM   6442  C  CG2   . VAL F 3 116 ? 51.932 67.281  79.175  1.00 37.28  ? 116  VAL B CG2   1 
ATOM   6443  N  N     . MET F 3 117 ? 49.810 64.188  78.040  1.00 39.89  ? 117  MET B N     1 
ATOM   6444  C  CA    . MET F 3 117 ? 48.652 64.155  77.163  1.00 41.50  ? 117  MET B CA    1 
ATOM   6445  C  C     . MET F 3 117 ? 47.417 63.800  77.978  1.00 44.85  ? 117  MET B C     1 
ATOM   6446  O  O     . MET F 3 117 ? 46.360 64.392  77.795  1.00 46.77  ? 117  MET B O     1 
ATOM   6447  C  CB    . MET F 3 117 ? 48.860 63.126  76.063  1.00 34.26  ? 117  MET B CB    1 
ATOM   6448  C  CG    . MET F 3 117 ? 47.732 63.070  75.069  1.00 38.36  ? 117  MET B CG    1 
ATOM   6449  S  SD    . MET F 3 117 ? 47.747 64.492  73.984  1.00 51.15  ? 117  MET B SD    1 
ATOM   6450  C  CE    . MET F 3 117 ? 46.367 65.466  74.671  1.00 41.72  ? 117  MET B CE    1 
ATOM   6451  N  N     . ARG F 3 118 ? 47.552 62.822  78.871  1.00 48.18  ? 118  ARG B N     1 
ATOM   6452  C  CA    . ARG F 3 118 ? 46.452 62.416  79.742  1.00 47.01  ? 118  ARG B CA    1 
ATOM   6453  C  C     . ARG F 3 118 ? 46.035 63.628  80.560  1.00 48.74  ? 118  ARG B C     1 
ATOM   6454  O  O     . ARG F 3 118 ? 44.861 63.977  80.634  1.00 49.44  ? 118  ARG B O     1 
ATOM   6455  C  CB    . ARG F 3 118 ? 46.897 61.322  80.708  1.00 38.18  ? 118  ARG B CB    1 
ATOM   6456  C  CG    . ARG F 3 118 ? 46.637 59.908  80.266  1.00 37.06  ? 118  ARG B CG    1 
ATOM   6457  C  CD    . ARG F 3 118 ? 46.766 58.961  81.459  1.00 38.01  ? 118  ARG B CD    1 
ATOM   6458  N  NE    . ARG F 3 118 ? 45.875 57.816  81.324  1.00 40.97  ? 118  ARG B NE    1 
ATOM   6459  C  CZ    . ARG F 3 118 ? 46.081 56.810  80.478  1.00 52.99  ? 118  ARG B CZ    1 
ATOM   6460  N  NH1   . ARG F 3 118 ? 47.163 56.800  79.698  1.00 49.93  ? 118  ARG B NH1   1 
ATOM   6461  N  NH2   . ARG F 3 118 ? 45.190 55.826  80.383  1.00 53.42  ? 118  ARG B NH2   1 
ATOM   6462  N  N     . ARG F 3 119 ? 47.018 64.267  81.177  1.00 48.39  ? 119  ARG B N     1 
ATOM   6463  C  CA    . ARG F 3 119 ? 46.764 65.437  81.991  1.00 47.42  ? 119  ARG B CA    1 
ATOM   6464  C  C     . ARG F 3 119 ? 45.988 66.501  81.252  1.00 47.80  ? 119  ARG B C     1 
ATOM   6465  O  O     . ARG F 3 119 ? 44.934 66.929  81.702  1.00 48.70  ? 119  ARG B O     1 
ATOM   6466  C  CB    . ARG F 3 119 ? 48.072 66.047  82.484  1.00 45.64  ? 119  ARG B CB    1 
ATOM   6467  C  CG    . ARG F 3 119 ? 47.838 67.264  83.342  1.00 45.81  ? 119  ARG B CG    1 
ATOM   6468  C  CD    . ARG F 3 119 ? 49.057 67.636  84.140  1.00 51.79  ? 119  ARG B CD    1 
ATOM   6469  N  NE    . ARG F 3 119 ? 49.673 68.868  83.665  1.00 59.04  ? 119  ARG B NE    1 
ATOM   6470  C  CZ    . ARG F 3 119 ? 50.503 69.600  84.395  1.00 65.38  ? 119  ARG B CZ    1 
ATOM   6471  N  NH1   . ARG F 3 119 ? 50.806 69.219  85.629  1.00 67.58  ? 119  ARG B NH1   1 
ATOM   6472  N  NH2   . ARG F 3 119 ? 51.029 70.706  83.891  1.00 71.26  ? 119  ARG B NH2   1 
ATOM   6473  N  N     . ILE F 3 120 ? 46.520 66.933  80.118  1.00 46.52  ? 120  ILE B N     1 
ATOM   6474  C  CA    . ILE F 3 120 ? 45.870 67.969  79.336  1.00 43.32  ? 120  ILE B CA    1 
ATOM   6475  C  C     . ILE F 3 120 ? 44.418 67.656  79.066  1.00 45.07  ? 120  ILE B C     1 
ATOM   6476  O  O     . ILE F 3 120 ? 43.604 68.559  78.954  1.00 47.41  ? 120  ILE B O     1 
ATOM   6477  C  CB    . ILE F 3 120 ? 46.592 68.201  78.007  1.00 42.70  ? 120  ILE B CB    1 
ATOM   6478  C  CG1   . ILE F 3 120 ? 48.009 68.697  78.285  1.00 41.97  ? 120  ILE B CG1   1 
ATOM   6479  C  CG2   . ILE F 3 120 ? 45.846 69.221  77.178  1.00 39.06  ? 120  ILE B CG2   1 
ATOM   6480  C  CD1   . ILE F 3 120 ? 48.841 68.906  77.052  1.00 32.35  ? 120  ILE B CD1   1 
ATOM   6481  N  N     . ARG F 3 121 ? 44.078 66.380  78.970  1.00 45.49  ? 121  ARG B N     1 
ATOM   6482  C  CA    . ARG F 3 121 ? 42.689 66.012  78.725  1.00 44.22  ? 121  ARG B CA    1 
ATOM   6483  C  C     . ARG F 3 121 ? 41.841 66.295  79.954  1.00 44.34  ? 121  ARG B C     1 
ATOM   6484  O  O     . ARG F 3 121 ? 40.860 67.026  79.892  1.00 42.42  ? 121  ARG B O     1 
ATOM   6485  C  CB    . ARG F 3 121 ? 42.584 64.540  78.380  1.00 37.06  ? 121  ARG B CB    1 
ATOM   6486  C  CG    . ARG F 3 121 ? 41.209 64.123  77.947  1.00 33.36  ? 121  ARG B CG    1 
ATOM   6487  C  CD    . ARG F 3 121 ? 41.194 62.626  77.811  1.00 33.37  ? 121  ARG B CD    1 
ATOM   6488  N  NE    . ARG F 3 121 ? 41.252 61.995  79.124  1.00 49.47  ? 121  ARG B NE    1 
ATOM   6489  C  CZ    . ARG F 3 121 ? 41.984 60.927  79.409  1.00 54.71  ? 121  ARG B CZ    1 
ATOM   6490  N  NH1   . ARG F 3 121 ? 42.724 60.374  78.470  1.00 52.28  ? 121  ARG B NH1   1 
ATOM   6491  N  NH2   . ARG F 3 121 ? 41.978 60.417  80.633  1.00 59.87  ? 121  ARG B NH2   1 
ATOM   6492  N  N     . LYS F 3 122 ? 42.223 65.707  81.078  1.00 47.27  ? 122  LYS B N     1 
ATOM   6493  C  CA    . LYS F 3 122 ? 41.492 65.921  82.317  1.00 49.45  ? 122  LYS B CA    1 
ATOM   6494  C  C     . LYS F 3 122 ? 41.428 67.412  82.630  1.00 51.13  ? 122  LYS B C     1 
ATOM   6495  O  O     . LYS F 3 122 ? 40.351 67.981  82.744  1.00 52.99  ? 122  LYS B O     1 
ATOM   6496  C  CB    . LYS F 3 122 ? 42.171 65.172  83.459  1.00 42.97  ? 122  LYS B CB    1 
ATOM   6497  C  CG    . LYS F 3 122 ? 42.556 63.749  83.099  1.00 43.74  ? 122  LYS B CG    1 
ATOM   6498  C  CD    . LYS F 3 122 ? 42.980 62.972  84.333  1.00 45.27  ? 122  LYS B CD    1 
ATOM   6499  C  CE    . LYS F 3 122 ? 41.794 62.690  85.238  1.00 51.91  ? 122  LYS B CE    1 
ATOM   6500  N  NZ    . LYS F 3 122 ? 40.784 61.829  84.551  1.00 54.85  ? 122  LYS B NZ    1 
ATOM   6501  N  N     . GLU F 3 123 ? 42.584 68.049  82.757  1.00 54.80  ? 123  GLU B N     1 
ATOM   6502  C  CA    . GLU F 3 123 ? 42.616 69.475  83.050  1.00 58.69  ? 123  GLU B CA    1 
ATOM   6503  C  C     . GLU F 3 123 ? 41.648 70.247  82.170  1.00 59.24  ? 123  GLU B C     1 
ATOM   6504  O  O     . GLU F 3 123 ? 40.992 71.172  82.639  1.00 60.68  ? 123  GLU B O     1 
ATOM   6505  C  CB    . GLU F 3 123 ? 44.031 70.042  82.878  1.00 62.24  ? 123  GLU B CB    1 
ATOM   6506  C  CG    . GLU F 3 123 ? 44.957 69.765  84.057  1.00 74.29  ? 123  GLU B CG    1 
ATOM   6507  C  CD    . GLU F 3 123 ? 46.313 70.446  83.923  1.00 84.85  ? 123  GLU B CD    1 
ATOM   6508  O  OE1   . GLU F 3 123 ? 47.096 70.403  84.900  1.00 88.35  ? 123  GLU B OE1   1 
ATOM   6509  O  OE2   . GLU F 3 123 ? 46.601 71.019  82.845  1.00 87.38  ? 123  GLU B OE2   1 
ATOM   6510  N  N     . ASN F 3 124 ? 41.549 69.871  80.899  1.00 58.21  ? 124  ASN B N     1 
ATOM   6511  C  CA    . ASN F 3 124 ? 40.644 70.564  79.993  1.00 57.34  ? 124  ASN B CA    1 
ATOM   6512  C  C     . ASN F 3 124 ? 39.202 70.123  80.177  1.00 59.35  ? 124  ASN B C     1 
ATOM   6513  O  O     . ASN F 3 124 ? 38.293 70.944  80.150  1.00 59.49  ? 124  ASN B O     1 
ATOM   6514  C  CB    . ASN F 3 124 ? 41.078 70.366  78.542  1.00 54.77  ? 124  ASN B CB    1 
ATOM   6515  C  CG    . ASN F 3 124 ? 41.916 71.521  78.027  1.00 57.53  ? 124  ASN B CG    1 
ATOM   6516  O  OD1   . ASN F 3 124 ? 42.823 71.993  78.712  1.00 55.12  ? 124  ASN B OD1   1 
ATOM   6517  N  ND2   . ASN F 3 124 ? 41.622 71.980  76.814  1.00 58.51  ? 124  ASN B ND2   1 
ATOM   6518  N  N     . VAL F 3 125 ? 38.982 68.832  80.366  1.00 60.05  ? 125  VAL B N     1 
ATOM   6519  C  CA    . VAL F 3 125 ? 37.629 68.354  80.573  1.00 63.09  ? 125  VAL B CA    1 
ATOM   6520  C  C     . VAL F 3 125 ? 37.051 68.950  81.854  1.00 66.55  ? 125  VAL B C     1 
ATOM   6521  O  O     . VAL F 3 125 ? 35.867 69.272  81.917  1.00 67.01  ? 125  VAL B O     1 
ATOM   6522  C  CB    . VAL F 3 125 ? 37.587 66.825  80.668  1.00 58.07  ? 125  VAL B CB    1 
ATOM   6523  C  CG1   . VAL F 3 125 ? 36.290 66.377  81.308  1.00 56.95  ? 125  VAL B CG1   1 
ATOM   6524  C  CG2   . VAL F 3 125 ? 37.709 66.227  79.284  1.00 59.86  ? 125  VAL B CG2   1 
ATOM   6525  N  N     . ASP F 3 126 ? 37.887 69.102  82.875  1.00 70.88  ? 126  ASP B N     1 
ATOM   6526  C  CA    . ASP F 3 126 ? 37.437 69.661  84.145  1.00 75.75  ? 126  ASP B CA    1 
ATOM   6527  C  C     . ASP F 3 126 ? 37.061 71.132  84.027  1.00 72.82  ? 126  ASP B C     1 
ATOM   6528  O  O     . ASP F 3 126 ? 36.108 71.584  84.653  1.00 72.15  ? 126  ASP B O     1 
ATOM   6529  C  CB    . ASP F 3 126 ? 38.520 69.494  85.218  1.00 90.01  ? 126  ASP B CB    1 
ATOM   6530  C  CG    . ASP F 3 126 ? 38.162 68.435  86.253  1.00 101.99 ? 126  ASP B CG    1 
ATOM   6531  O  OD1   . ASP F 3 126 ? 37.148 68.614  86.968  1.00 105.42 ? 126  ASP B OD1   1 
ATOM   6532  O  OD2   . ASP F 3 126 ? 38.895 67.423  86.353  1.00 106.00 ? 126  ASP B OD2   1 
ATOM   6533  N  N     . ALA F 3 127 ? 37.808 71.874  83.222  1.00 71.15  ? 127  ALA B N     1 
ATOM   6534  C  CA    . ALA F 3 127 ? 37.540 73.293  83.036  1.00 72.12  ? 127  ALA B CA    1 
ATOM   6535  C  C     . ALA F 3 127 ? 36.304 73.557  82.175  1.00 75.94  ? 127  ALA B C     1 
ATOM   6536  O  O     . ALA F 3 127 ? 35.924 74.709  81.956  1.00 74.63  ? 127  ALA B O     1 
ATOM   6537  C  CB    . ALA F 3 127 ? 38.753 73.971  82.419  1.00 59.61  ? 127  ALA B CB    1 
ATOM   6538  N  N     . GLY F 3 128 ? 35.682 72.495  81.674  1.00 78.39  ? 128  GLY B N     1 
ATOM   6539  C  CA    . GLY F 3 128 ? 34.493 72.676  80.861  1.00 80.06  ? 128  GLY B CA    1 
ATOM   6540  C  C     . GLY F 3 128 ? 34.570 72.174  79.435  1.00 82.15  ? 128  GLY B C     1 
ATOM   6541  O  O     . GLY F 3 128 ? 33.719 71.391  79.018  1.00 83.66  ? 128  GLY B O     1 
ATOM   6542  N  N     . GLU F 3 129 ? 35.584 72.613  78.692  1.00 83.55  ? 129  GLU B N     1 
ATOM   6543  C  CA    . GLU F 3 129 ? 35.748 72.214  77.296  1.00 84.29  ? 129  GLU B CA    1 
ATOM   6544  C  C     . GLU F 3 129 ? 35.340 70.774  76.982  1.00 85.79  ? 129  GLU B C     1 
ATOM   6545  O  O     . GLU F 3 129 ? 35.945 69.822  77.469  1.00 85.47  ? 129  GLU B O     1 
ATOM   6546  C  CB    . GLU F 3 129 ? 37.195 72.417  76.828  1.00 86.64  ? 129  GLU B CB    1 
ATOM   6547  C  CG    . GLU F 3 129 ? 37.355 72.149  75.320  1.00 98.03  ? 129  GLU B CG    1 
ATOM   6548  C  CD    . GLU F 3 129 ? 38.729 71.617  74.921  1.00 98.24  ? 129  GLU B CD    1 
ATOM   6549  O  OE1   . GLU F 3 129 ? 39.718 72.378  75.032  1.00 100.05 ? 129  GLU B OE1   1 
ATOM   6550  O  OE2   . GLU F 3 129 ? 38.813 70.435  74.493  1.00 91.16  ? 129  GLU B OE2   1 
ATOM   6551  N  N     . ARG F 3 130 ? 34.308 70.634  76.154  1.00 87.39  ? 130  ARG B N     1 
ATOM   6552  C  CA    . ARG F 3 130 ? 33.814 69.326  75.727  1.00 86.56  ? 130  ARG B CA    1 
ATOM   6553  C  C     . ARG F 3 130 ? 33.711 69.334  74.201  1.00 80.91  ? 130  ARG B C     1 
ATOM   6554  O  O     . ARG F 3 130 ? 33.705 70.396  73.577  1.00 76.63  ? 130  ARG B O     1 
ATOM   6555  C  CB    . ARG F 3 130 ? 32.444 69.030  76.350  1.00 93.30  ? 130  ARG B CB    1 
ATOM   6556  C  CG    . ARG F 3 130 ? 31.922 67.625  76.066  1.00 105.37 ? 130  ARG B CG    1 
ATOM   6557  C  CD    . ARG F 3 130 ? 30.728 67.299  76.948  1.00 114.00 ? 130  ARG B CD    1 
ATOM   6558  N  NE    . ARG F 3 130 ? 29.563 68.128  76.647  1.00 121.73 ? 130  ARG B NE    1 
ATOM   6559  C  CZ    . ARG F 3 130 ? 28.542 68.315  77.478  1.00 124.68 ? 130  ARG B CZ    1 
ATOM   6560  N  NH1   . ARG F 3 130 ? 28.542 67.734  78.670  1.00 125.89 ? 130  ARG B NH1   1 
ATOM   6561  N  NH2   . ARG F 3 130 ? 27.517 69.079  77.115  1.00 123.89 ? 130  ARG B NH2   1 
ATOM   6562  N  N     . ALA F 3 131 ? 33.636 68.148  73.608  1.00 75.76  ? 131  ALA B N     1 
ATOM   6563  C  CA    . ALA F 3 131 ? 33.550 68.023  72.159  1.00 69.19  ? 131  ALA B CA    1 
ATOM   6564  C  C     . ALA F 3 131 ? 32.197 68.457  71.618  1.00 67.08  ? 131  ALA B C     1 
ATOM   6565  O  O     . ALA F 3 131 ? 31.155 68.227  72.244  1.00 67.19  ? 131  ALA B O     1 
ATOM   6566  C  CB    . ALA F 3 131 ? 33.834 66.587  71.739  1.00 63.20  ? 131  ALA B CB    1 
ATOM   6567  N  N     . LYS F 3 132 ? 32.221 69.088  70.448  1.00 62.36  ? 132  LYS B N     1 
ATOM   6568  C  CA    . LYS F 3 132 ? 30.998 69.536  69.806  1.00 58.30  ? 132  LYS B CA    1 
ATOM   6569  C  C     . LYS F 3 132 ? 30.484 68.388  68.944  1.00 57.71  ? 132  LYS B C     1 
ATOM   6570  O  O     . LYS F 3 132 ? 31.106 67.331  68.872  1.00 58.50  ? 132  LYS B O     1 
ATOM   6571  C  CB    . LYS F 3 132 ? 31.266 70.788  68.953  1.00 57.79  ? 132  LYS B CB    1 
ATOM   6572  C  CG    . LYS F 3 132 ? 31.072 72.109  69.703  1.00 61.11  ? 132  LYS B CG    1 
ATOM   6573  C  CD    . LYS F 3 132 ? 31.865 72.113  71.000  1.00 63.47  ? 132  LYS B CD    1 
ATOM   6574  C  CE    . LYS F 3 132 ? 31.198 72.966  72.081  1.00 66.16  ? 132  LYS B CE    1 
ATOM   6575  N  NZ    . LYS F 3 132 ? 31.706 72.618  73.459  1.00 66.88  ? 132  LYS B NZ    1 
ATOM   6576  N  N     . GLN F 3 133 ? 29.354 68.592  68.287  1.00 54.84  ? 133  GLN B N     1 
ATOM   6577  C  CA    . GLN F 3 133 ? 28.782 67.550  67.460  1.00 54.35  ? 133  GLN B CA    1 
ATOM   6578  C  C     . GLN F 3 133 ? 27.834 68.155  66.428  1.00 58.07  ? 133  GLN B C     1 
ATOM   6579  O  O     . GLN F 3 133 ? 27.230 69.201  66.667  1.00 58.87  ? 133  GLN B O     1 
ATOM   6580  C  CB    . GLN F 3 133 ? 28.074 66.570  68.377  1.00 51.49  ? 133  GLN B CB    1 
ATOM   6581  C  CG    . GLN F 3 133 ? 26.840 65.926  67.843  1.00 68.17  ? 133  GLN B CG    1 
ATOM   6582  C  CD    . GLN F 3 133 ? 26.201 65.057  68.897  1.00 75.52  ? 133  GLN B CD    1 
ATOM   6583  O  OE1   . GLN F 3 133 ? 26.860 64.199  69.473  1.00 73.39  ? 133  GLN B OE1   1 
ATOM   6584  N  NE2   . GLN F 3 133 ? 24.918 65.278  69.165  1.00 80.69  ? 133  GLN B NE2   1 
ATOM   6585  N  N     . ALA F 3 134 ? 27.718 67.514  65.272  1.00 58.09  ? 134  ALA B N     1 
ATOM   6586  C  CA    . ALA F 3 134 ? 26.845 68.028  64.231  1.00 55.29  ? 134  ALA B CA    1 
ATOM   6587  C  C     . ALA F 3 134 ? 25.460 68.357  64.777  1.00 56.96  ? 134  ALA B C     1 
ATOM   6588  O  O     . ALA F 3 134 ? 24.957 67.666  65.665  1.00 56.09  ? 134  ALA B O     1 
ATOM   6589  C  CB    . ALA F 3 134 ? 26.729 67.016  63.130  1.00 46.24  ? 134  ALA B CB    1 
ATOM   6590  N  N     . LEU F 3 135 ? 24.850 69.424  64.262  1.00 56.82  ? 135  LEU B N     1 
ATOM   6591  C  CA    . LEU F 3 135 ? 23.504 69.795  64.696  1.00 53.41  ? 135  LEU B CA    1 
ATOM   6592  C  C     . LEU F 3 135 ? 22.547 68.896  63.936  1.00 53.04  ? 135  LEU B C     1 
ATOM   6593  O  O     . LEU F 3 135 ? 22.629 68.776  62.716  1.00 54.50  ? 135  LEU B O     1 
ATOM   6594  C  CB    . LEU F 3 135 ? 23.191 71.258  64.378  1.00 50.47  ? 135  LEU B CB    1 
ATOM   6595  C  CG    . LEU F 3 135 ? 21.712 71.639  64.559  1.00 51.23  ? 135  LEU B CG    1 
ATOM   6596  C  CD1   . LEU F 3 135 ? 21.281 71.402  66.008  1.00 50.85  ? 135  LEU B CD1   1 
ATOM   6597  C  CD2   . LEU F 3 135 ? 21.496 73.098  64.162  1.00 49.24  ? 135  LEU B CD2   1 
ATOM   6598  N  N     . ALA F 3 136 ? 21.633 68.265  64.658  1.00 55.40  ? 136  ALA B N     1 
ATOM   6599  C  CA    . ALA F 3 136 ? 20.691 67.344  64.045  1.00 58.44  ? 136  ALA B CA    1 
ATOM   6600  C  C     . ALA F 3 136 ? 19.820 67.905  62.931  1.00 62.81  ? 136  ALA B C     1 
ATOM   6601  O  O     . ALA F 3 136 ? 19.308 69.022  63.011  1.00 62.55  ? 136  ALA B O     1 
ATOM   6602  C  CB    . ALA F 3 136 ? 19.803 66.729  65.116  1.00 51.04  ? 136  ALA B CB    1 
ATOM   6603  N  N     . PHE F 3 137 ? 19.687 67.103  61.883  1.00 63.57  ? 137  PHE B N     1 
ATOM   6604  C  CA    . PHE F 3 137 ? 18.834 67.397  60.748  1.00 61.46  ? 137  PHE B CA    1 
ATOM   6605  C  C     . PHE F 3 137 ? 17.966 66.148  60.810  1.00 60.82  ? 137  PHE B C     1 
ATOM   6606  O  O     . PHE F 3 137 ? 18.282 65.121  60.206  1.00 57.58  ? 137  PHE B O     1 
ATOM   6607  C  CB    . PHE F 3 137 ? 19.624 67.422  59.438  1.00 59.73  ? 137  PHE B CB    1 
ATOM   6608  C  CG    . PHE F 3 137 ? 18.758 67.594  58.212  1.00 58.48  ? 137  PHE B CG    1 
ATOM   6609  C  CD1   . PHE F 3 137 ? 18.262 68.850  57.861  1.00 56.59  ? 137  PHE B CD1   1 
ATOM   6610  C  CD2   . PHE F 3 137 ? 18.393 66.487  57.439  1.00 53.58  ? 137  PHE B CD2   1 
ATOM   6611  C  CE1   . PHE F 3 137 ? 17.411 69.000  56.759  1.00 51.88  ? 137  PHE B CE1   1 
ATOM   6612  C  CE2   . PHE F 3 137 ? 17.541 66.624  56.336  1.00 44.32  ? 137  PHE B CE2   1 
ATOM   6613  C  CZ    . PHE F 3 137 ? 17.049 67.883  55.996  1.00 50.98  ? 137  PHE B CZ    1 
ATOM   6614  N  N     . GLU F 3 138 ? 16.889 66.233  61.579  1.00 62.03  ? 138  GLU B N     1 
ATOM   6615  C  CA    . GLU F 3 138 ? 15.994 65.103  61.779  1.00 64.34  ? 138  GLU B CA    1 
ATOM   6616  C  C     . GLU F 3 138 ? 14.904 64.981  60.738  1.00 64.08  ? 138  GLU B C     1 
ATOM   6617  O  O     . GLU F 3 138 ? 14.852 65.759  59.798  1.00 62.52  ? 138  GLU B O     1 
ATOM   6618  C  CB    . GLU F 3 138 ? 15.369 65.199  63.170  1.00 65.28  ? 138  GLU B CB    1 
ATOM   6619  C  CG    . GLU F 3 138 ? 16.409 65.249  64.281  1.00 66.98  ? 138  GLU B CG    1 
ATOM   6620  C  CD    . GLU F 3 138 ? 15.806 65.486  65.656  1.00 74.71  ? 138  GLU B CD    1 
ATOM   6621  O  OE1   . GLU F 3 138 ? 15.246 66.581  65.899  1.00 79.06  ? 138  GLU B OE1   1 
ATOM   6622  O  OE2   . GLU F 3 138 ? 15.893 64.570  66.500  1.00 72.15  ? 138  GLU B OE2   1 
ATOM   6623  N  N     . ARG F 3 139 ? 14.038 63.991  60.917  1.00 64.96  ? 139  ARG B N     1 
ATOM   6624  C  CA    . ARG F 3 139 ? 12.919 63.747  60.009  1.00 67.27  ? 139  ARG B CA    1 
ATOM   6625  C  C     . ARG F 3 139 ? 11.970 64.951  59.915  1.00 65.80  ? 139  ARG B C     1 
ATOM   6626  O  O     . ARG F 3 139 ? 11.444 65.275  58.843  1.00 62.30  ? 139  ARG B O     1 
ATOM   6627  C  CB    . ARG F 3 139 ? 12.144 62.514  60.481  1.00 70.24  ? 139  ARG B CB    1 
ATOM   6628  C  CG    . ARG F 3 139 ? 10.756 62.364  59.884  1.00 67.58  ? 139  ARG B CG    1 
ATOM   6629  C  CD    . ARG F 3 139 ? 10.785 62.258  58.376  1.00 70.08  ? 139  ARG B CD    1 
ATOM   6630  N  NE    . ARG F 3 139 ? 9.588  61.587  57.889  1.00 77.90  ? 139  ARG B NE    1 
ATOM   6631  C  CZ    . ARG F 3 139 ? 9.263  60.340  58.213  1.00 85.65  ? 139  ARG B CZ    1 
ATOM   6632  N  NH1   . ARG F 3 139 ? 10.052 59.637  59.019  1.00 86.38  ? 139  ARG B NH1   1 
ATOM   6633  N  NH2   . ARG F 3 139 ? 8.148  59.798  57.745  1.00 85.81  ? 139  ARG B NH2   1 
ATOM   6634  N  N     . THR F 3 140 ? 11.748 65.601  61.051  1.00 67.06  ? 140  THR B N     1 
ATOM   6635  C  CA    . THR F 3 140 ? 10.882 66.765  61.107  1.00 65.66  ? 140  THR B CA    1 
ATOM   6636  C  C     . THR F 3 140 ? 11.387 67.826  60.139  1.00 66.89  ? 140  THR B C     1 
ATOM   6637  O  O     . THR F 3 140 ? 10.619 68.377  59.357  1.00 68.02  ? 140  THR B O     1 
ATOM   6638  C  CB    . THR F 3 140 ? 10.838 67.338  62.538  1.00 61.55  ? 140  THR B CB    1 
ATOM   6639  O  OG1   . THR F 3 140 ? 10.026 66.490  63.363  1.00 55.41  ? 140  THR B OG1   1 
ATOM   6640  C  CG2   . THR F 3 140 ? 10.274 68.742  62.544  1.00 57.24  ? 140  THR B CG2   1 
ATOM   6641  N  N     . ASP F 3 141 ? 12.684 68.100  60.183  1.00 68.13  ? 141  ASP B N     1 
ATOM   6642  C  CA    . ASP F 3 141 ? 13.273 69.096  59.301  1.00 67.93  ? 141  ASP B CA    1 
ATOM   6643  C  C     . ASP F 3 141 ? 13.129 68.699  57.835  1.00 66.25  ? 141  ASP B C     1 
ATOM   6644  O  O     . ASP F 3 141 ? 12.810 69.529  56.987  1.00 63.28  ? 141  ASP B O     1 
ATOM   6645  C  CB    . ASP F 3 141 ? 14.757 69.291  59.634  1.00 79.03  ? 141  ASP B CB    1 
ATOM   6646  C  CG    . ASP F 3 141 ? 14.993 69.589  61.105  1.00 87.46  ? 141  ASP B CG    1 
ATOM   6647  O  OD1   . ASP F 3 141 ? 14.213 70.374  61.688  1.00 92.11  ? 141  ASP B OD1   1 
ATOM   6648  O  OD2   . ASP F 3 141 ? 15.964 69.043  61.674  1.00 92.74  ? 141  ASP B OD2   1 
ATOM   6649  N  N     . PHE F 3 142 ? 13.373 67.427  57.544  1.00 65.57  ? 142  PHE B N     1 
ATOM   6650  C  CA    . PHE F 3 142 ? 13.275 66.913  56.184  1.00 63.81  ? 142  PHE B CA    1 
ATOM   6651  C  C     . PHE F 3 142 ? 11.895 67.199  55.610  1.00 65.65  ? 142  PHE B C     1 
ATOM   6652  O  O     . PHE F 3 142 ? 11.774 67.772  54.525  1.00 63.71  ? 142  PHE B O     1 
ATOM   6653  C  CB    . PHE F 3 142 ? 13.525 65.410  56.184  1.00 55.72  ? 142  PHE B CB    1 
ATOM   6654  C  CG    . PHE F 3 142 ? 13.471 64.778  54.825  1.00 53.53  ? 142  PHE B CG    1 
ATOM   6655  C  CD1   . PHE F 3 142 ? 14.392 65.120  53.850  1.00 57.25  ? 142  PHE B CD1   1 
ATOM   6656  C  CD2   . PHE F 3 142 ? 12.529 63.787  54.545  1.00 52.57  ? 142  PHE B CD2   1 
ATOM   6657  C  CE1   . PHE F 3 142 ? 14.385 64.478  52.614  1.00 53.33  ? 142  PHE B CE1   1 
ATOM   6658  C  CE2   . PHE F 3 142 ? 12.508 63.137  53.313  1.00 49.39  ? 142  PHE B CE2   1 
ATOM   6659  C  CZ    . PHE F 3 142 ? 13.440 63.482  52.346  1.00 53.93  ? 142  PHE B CZ    1 
ATOM   6660  N  N     . ASP F 3 143 ? 10.857 66.800  56.342  1.00 67.35  ? 143  ASP B N     1 
ATOM   6661  C  CA    . ASP F 3 143 ? 9.483  67.020  55.899  1.00 67.26  ? 143  ASP B CA    1 
ATOM   6662  C  C     . ASP F 3 143 ? 9.227  68.486  55.575  1.00 65.44  ? 143  ASP B C     1 
ATOM   6663  O  O     . ASP F 3 143 ? 8.449  68.809  54.679  1.00 65.11  ? 143  ASP B O     1 
ATOM   6664  C  CB    . ASP F 3 143 ? 8.492  66.559  56.967  1.00 71.41  ? 143  ASP B CB    1 
ATOM   6665  C  CG    . ASP F 3 143 ? 8.323  65.047  56.999  1.00 78.78  ? 143  ASP B CG    1 
ATOM   6666  O  OD1   . ASP F 3 143 ? 8.834  64.370  56.076  1.00 80.53  ? 143  ASP B OD1   1 
ATOM   6667  O  OD2   . ASP F 3 143 ? 7.667  64.539  57.940  1.00 75.75  ? 143  ASP B OD2   1 
ATOM   6668  N  N     . GLN F 3 144 ? 9.880  69.373  56.314  1.00 64.64  ? 144  GLN B N     1 
ATOM   6669  C  CA    . GLN F 3 144 ? 9.726  70.802  56.086  1.00 65.13  ? 144  GLN B CA    1 
ATOM   6670  C  C     . GLN F 3 144 ? 10.472 71.172  54.814  1.00 65.75  ? 144  GLN B C     1 
ATOM   6671  O  O     . GLN F 3 144 ? 9.859  71.559  53.820  1.00 67.33  ? 144  GLN B O     1 
ATOM   6672  C  CB    . GLN F 3 144 ? 10.283 71.601  57.267  1.00 69.26  ? 144  GLN B CB    1 
ATOM   6673  C  CG    . GLN F 3 144 ? 9.919  73.088  57.253  1.00 77.43  ? 144  GLN B CG    1 
ATOM   6674  C  CD    . GLN F 3 144 ? 10.357 73.824  58.518  1.00 79.44  ? 144  GLN B CD    1 
ATOM   6675  O  OE1   . GLN F 3 144 ? 11.465 74.364  58.600  1.00 71.05  ? 144  GLN B OE1   1 
ATOM   6676  N  NE2   . GLN F 3 144 ? 9.486  73.837  59.515  1.00 79.48  ? 144  GLN B NE2   1 
ATOM   6677  N  N     . VAL F 3 145 ? 11.794 71.046  54.836  1.00 63.89  ? 145  VAL B N     1 
ATOM   6678  C  CA    . VAL F 3 145 ? 12.584 71.379  53.659  1.00 61.59  ? 145  VAL B CA    1 
ATOM   6679  C  C     . VAL F 3 145 ? 11.903 70.917  52.383  1.00 65.57  ? 145  VAL B C     1 
ATOM   6680  O  O     . VAL F 3 145 ? 11.938 71.606  51.364  1.00 64.36  ? 145  VAL B O     1 
ATOM   6681  C  CB    . VAL F 3 145 ? 13.980 70.754  53.734  1.00 50.15  ? 145  VAL B CB    1 
ATOM   6682  C  CG1   . VAL F 3 145 ? 14.631 70.740  52.360  1.00 30.33  ? 145  VAL B CG1   1 
ATOM   6683  C  CG2   . VAL F 3 145 ? 14.837 71.552  54.699  1.00 43.68  ? 145  VAL B CG2   1 
ATOM   6684  N  N     . ARG F 3 146 ? 11.274 69.752  52.445  1.00 69.59  ? 146  ARG B N     1 
ATOM   6685  C  CA    . ARG F 3 146 ? 10.574 69.225  51.283  1.00 73.13  ? 146  ARG B CA    1 
ATOM   6686  C  C     . ARG F 3 146 ? 9.330  70.076  51.009  1.00 75.87  ? 146  ARG B C     1 
ATOM   6687  O  O     . ARG F 3 146 ? 9.252  70.737  49.981  1.00 78.63  ? 146  ARG B O     1 
ATOM   6688  C  CB    . ARG F 3 146 ? 10.209 67.745  51.501  1.00 68.98  ? 146  ARG B CB    1 
ATOM   6689  C  CG    . ARG F 3 146 ? 9.547  67.080  50.310  1.00 66.50  ? 146  ARG B CG    1 
ATOM   6690  C  CD    . ARG F 3 146 ? 9.659  65.558  50.357  1.00 67.82  ? 146  ARG B CD    1 
ATOM   6691  N  NE    . ARG F 3 146 ? 9.308  64.993  51.660  1.00 77.23  ? 146  ARG B NE    1 
ATOM   6692  C  CZ    . ARG F 3 146 ? 9.055  63.700  51.872  1.00 79.99  ? 146  ARG B CZ    1 
ATOM   6693  N  NH1   . ARG F 3 146 ? 9.109  62.838  50.861  1.00 74.91  ? 146  ARG B NH1   1 
ATOM   6694  N  NH2   . ARG F 3 146 ? 8.757  63.264  53.094  1.00 77.38  ? 146  ARG B NH2   1 
ATOM   6695  N  N     . SER F 3 147 ? 8.365  70.076  51.924  1.00 76.32  ? 147  SER B N     1 
ATOM   6696  C  CA    . SER F 3 147 ? 7.154  70.878  51.745  1.00 75.12  ? 147  SER B CA    1 
ATOM   6697  C  C     . SER F 3 147 ? 7.560  72.339  51.770  1.00 73.29  ? 147  SER B C     1 
ATOM   6698  O  O     . SER F 3 147 ? 7.028  73.128  52.551  1.00 70.88  ? 147  SER B O     1 
ATOM   6699  C  CB    . SER F 3 147 ? 6.168  70.615  52.883  1.00 75.75  ? 147  SER B CB    1 
ATOM   6700  O  OG    . SER F 3 147 ? 5.881  69.233  53.001  1.00 73.21  ? 147  SER B OG    1 
ATOM   6701  N  N     . LEU F 3 148 ? 8.507  72.695  50.913  1.00 72.12  ? 148  LEU B N     1 
ATOM   6702  C  CA    . LEU F 3 148 ? 9.017  74.052  50.868  1.00 69.91  ? 148  LEU B CA    1 
ATOM   6703  C  C     . LEU F 3 148 ? 9.691  74.221  49.518  1.00 71.72  ? 148  LEU B C     1 
ATOM   6704  O  O     . LEU F 3 148 ? 9.709  75.307  48.947  1.00 70.77  ? 148  LEU B O     1 
ATOM   6705  C  CB    . LEU F 3 148 ? 10.040 74.225  51.990  1.00 65.70  ? 148  LEU B CB    1 
ATOM   6706  C  CG    . LEU F 3 148 ? 10.245 75.551  52.722  1.00 62.40  ? 148  LEU B CG    1 
ATOM   6707  C  CD1   . LEU F 3 148 ? 10.672 76.647  51.753  1.00 53.05  ? 148  LEU B CD1   1 
ATOM   6708  C  CD2   . LEU F 3 148 ? 8.961  75.912  53.446  1.00 59.71  ? 148  LEU B CD2   1 
ATOM   6709  N  N     . MET F 3 149 ? 10.251 73.125  49.023  1.00 72.89  ? 149  MET B N     1 
ATOM   6710  C  CA    . MET F 3 149 ? 10.936 73.103  47.737  1.00 76.02  ? 149  MET B CA    1 
ATOM   6711  C  C     . MET F 3 149 ? 10.358 71.962  46.907  1.00 77.41  ? 149  MET B C     1 
ATOM   6712  O  O     . MET F 3 149 ? 10.645 71.837  45.721  1.00 78.61  ? 149  MET B O     1 
ATOM   6713  C  CB    . MET F 3 149 ? 12.431 72.843  47.933  1.00 79.29  ? 149  MET B CB    1 
ATOM   6714  C  CG    . MET F 3 149 ? 13.060 73.482  49.155  1.00 79.40  ? 149  MET B CG    1 
ATOM   6715  S  SD    . MET F 3 149 ? 14.782 72.920  49.325  1.00 85.55  ? 149  MET B SD    1 
ATOM   6716  C  CE    . MET F 3 149 ? 15.633 74.451  49.852  1.00 81.78  ? 149  MET B CE    1 
ATOM   6717  N  N     . GLU F 3 150 ? 9.560  71.124  47.559  1.00 79.30  ? 150  GLU B N     1 
ATOM   6718  C  CA    . GLU F 3 150 ? 8.936  69.963  46.938  1.00 83.44  ? 150  GLU B CA    1 
ATOM   6719  C  C     . GLU F 3 150 ? 8.479  70.264  45.512  1.00 85.44  ? 150  GLU B C     1 
ATOM   6720  O  O     . GLU F 3 150 ? 8.662  69.444  44.604  1.00 81.33  ? 150  GLU B O     1 
ATOM   6721  C  CB    . GLU F 3 150 ? 7.747  69.509  47.796  1.00 91.77  ? 150  GLU B CB    1 
ATOM   6722  C  CG    . GLU F 3 150 ? 7.056  68.230  47.335  1.00 102.25 ? 150  GLU B CG    1 
ATOM   6723  C  CD    . GLU F 3 150 ? 5.871  67.832  48.229  1.00 108.40 ? 150  GLU B CD    1 
ATOM   6724  O  OE1   . GLU F 3 150 ? 5.166  66.851  47.894  1.00 109.66 ? 150  GLU B OE1   1 
ATOM   6725  O  OE2   . GLU F 3 150 ? 5.641  68.500  49.263  1.00 109.21 ? 150  GLU B OE2   1 
ATOM   6726  N  N     . ASN F 3 151 ? 7.913  71.456  45.317  1.00 88.77  ? 151  ASN B N     1 
ATOM   6727  C  CA    . ASN F 3 151 ? 7.398  71.874  44.010  1.00 90.39  ? 151  ASN B CA    1 
ATOM   6728  C  C     . ASN F 3 151 ? 8.421  72.495  43.055  1.00 91.61  ? 151  ASN B C     1 
ATOM   6729  O  O     . ASN F 3 151 ? 8.793  71.867  42.065  1.00 92.94  ? 151  ASN B O     1 
ATOM   6730  C  CB    . ASN F 3 151 ? 6.230  72.853  44.189  1.00 92.97  ? 151  ASN B CB    1 
ATOM   6731  C  CG    . ASN F 3 151 ? 5.007  72.203  44.835  1.00 95.69  ? 151  ASN B CG    1 
ATOM   6732  O  OD1   . ASN F 3 151 ? 4.540  71.151  44.394  1.00 89.91  ? 151  ASN B OD1   1 
ATOM   6733  N  ND2   . ASN F 3 151 ? 4.483  72.835  45.882  1.00 98.39  ? 151  ASN B ND2   1 
ATOM   6734  N  N     . SER F 3 152 ? 8.854  73.725  43.348  1.00 90.68  ? 152  SER B N     1 
ATOM   6735  C  CA    . SER F 3 152 ? 9.822  74.466  42.517  1.00 90.10  ? 152  SER B CA    1 
ATOM   6736  C  C     . SER F 3 152 ? 10.418 73.645  41.384  1.00 89.79  ? 152  SER B C     1 
ATOM   6737  O  O     . SER F 3 152 ? 11.022 72.606  41.614  1.00 87.19  ? 152  SER B O     1 
ATOM   6738  C  CB    . SER F 3 152 ? 10.968 75.019  43.373  1.00 90.81  ? 152  SER B CB    1 
ATOM   6739  O  OG    . SER F 3 152 ? 11.932 75.687  42.565  1.00 89.30  ? 152  SER B OG    1 
ATOM   6740  N  N     . ASP F 3 153 ? 10.256 74.122  40.157  1.00 91.25  ? 153  ASP B N     1 
ATOM   6741  C  CA    . ASP F 3 153 ? 10.781 73.405  39.006  1.00 94.32  ? 153  ASP B CA    1 
ATOM   6742  C  C     . ASP F 3 153 ? 12.235 73.787  38.754  1.00 92.89  ? 153  ASP B C     1 
ATOM   6743  O  O     . ASP F 3 153 ? 12.803 73.427  37.717  1.00 91.63  ? 153  ASP B O     1 
ATOM   6744  C  CB    . ASP F 3 153 ? 9.935  73.712  37.767  1.00 107.65 ? 153  ASP B CB    1 
ATOM   6745  C  CG    . ASP F 3 153 ? 8.444  73.496  38.004  1.00 116.08 ? 153  ASP B CG    1 
ATOM   6746  O  OD1   . ASP F 3 153 ? 7.999  72.326  38.085  1.00 117.58 ? 153  ASP B OD1   1 
ATOM   6747  O  OD2   . ASP F 3 153 ? 7.715  74.506  38.116  1.00 117.77 ? 153  ASP B OD2   1 
ATOM   6748  N  N     . ARG F 3 154 ? 12.828 74.512  39.706  1.00 90.57  ? 154  ARG B N     1 
ATOM   6749  C  CA    . ARG F 3 154 ? 14.224 74.950  39.608  1.00 87.55  ? 154  ARG B CA    1 
ATOM   6750  C  C     . ARG F 3 154 ? 15.236 73.804  39.630  1.00 86.72  ? 154  ARG B C     1 
ATOM   6751  O  O     . ARG F 3 154 ? 15.142 72.883  40.441  1.00 84.14  ? 154  ARG B O     1 
ATOM   6752  C  CB    . ARG F 3 154 ? 14.558 75.922  40.736  1.00 87.02  ? 154  ARG B CB    1 
ATOM   6753  C  CG    . ARG F 3 154 ? 14.077 77.333  40.510  1.00 89.05  ? 154  ARG B CG    1 
ATOM   6754  C  CD    . ARG F 3 154 ? 14.882 78.286  41.372  1.00 91.11  ? 154  ARG B CD    1 
ATOM   6755  N  NE    . ARG F 3 154 ? 16.298 77.915  41.367  1.00 92.85  ? 154  ARG B NE    1 
ATOM   6756  C  CZ    . ARG F 3 154 ? 17.276 78.654  41.884  1.00 97.55  ? 154  ARG B CZ    1 
ATOM   6757  N  NH1   . ARG F 3 154 ? 16.994 79.819  42.450  1.00 101.82 ? 154  ARG B NH1   1 
ATOM   6758  N  NH2   . ARG F 3 154 ? 18.534 78.224  41.841  1.00 94.20  ? 154  ARG B NH2   1 
ATOM   6759  N  N     . CYS F 3 155 ? 16.225 73.878  38.748  1.00 86.22  ? 155  CYS B N     1 
ATOM   6760  C  CA    . CYS F 3 155 ? 17.228 72.829  38.664  1.00 85.13  ? 155  CYS B CA    1 
ATOM   6761  C  C     . CYS F 3 155 ? 17.929 72.559  39.989  1.00 84.09  ? 155  CYS B C     1 
ATOM   6762  O  O     . CYS F 3 155 ? 17.779 71.478  40.552  1.00 83.48  ? 155  CYS B O     1 
ATOM   6763  C  CB    . CYS F 3 155 ? 18.261 73.170  37.591  1.00 84.67  ? 155  CYS B CB    1 
ATOM   6764  S  SG    . CYS F 3 155 ? 19.112 71.725  36.901  1.00 84.29  ? 155  CYS B SG    1 
ATOM   6765  N  N     . GLN F 3 156 ? 18.688 73.527  40.495  1.00 81.30  ? 156  GLN B N     1 
ATOM   6766  C  CA    . GLN F 3 156 ? 19.395 73.321  41.756  1.00 78.62  ? 156  GLN B CA    1 
ATOM   6767  C  C     . GLN F 3 156 ? 18.444 72.956  42.902  1.00 76.26  ? 156  GLN B C     1 
ATOM   6768  O  O     . GLN F 3 156 ? 18.760 72.097  43.727  1.00 73.92  ? 156  GLN B O     1 
ATOM   6769  C  CB    . GLN F 3 156 ? 20.220 74.557  42.132  1.00 80.63  ? 156  GLN B CB    1 
ATOM   6770  C  CG    . GLN F 3 156 ? 19.571 75.491  43.143  1.00 77.17  ? 156  GLN B CG    1 
ATOM   6771  C  CD    . GLN F 3 156 ? 20.538 76.551  43.643  1.00 75.29  ? 156  GLN B CD    1 
ATOM   6772  O  OE1   . GLN F 3 156 ? 20.153 77.476  44.368  1.00 72.71  ? 156  GLN B OE1   1 
ATOM   6773  N  NE2   . GLN F 3 156 ? 21.808 76.419  43.259  1.00 67.43  ? 156  GLN B NE2   1 
ATOM   6774  N  N     . ASP F 3 157 ? 17.281 73.599  42.955  1.00 74.53  ? 157  ASP B N     1 
ATOM   6775  C  CA    . ASP F 3 157 ? 16.311 73.296  44.001  1.00 72.84  ? 157  ASP B CA    1 
ATOM   6776  C  C     . ASP F 3 157 ? 15.926 71.826  43.928  1.00 71.68  ? 157  ASP B C     1 
ATOM   6777  O  O     . ASP F 3 157 ? 15.541 71.227  44.928  1.00 70.44  ? 157  ASP B O     1 
ATOM   6778  C  CB    . ASP F 3 157 ? 15.066 74.170  43.860  1.00 76.73  ? 157  ASP B CB    1 
ATOM   6779  C  CG    . ASP F 3 157 ? 15.022 75.279  44.884  1.00 85.78  ? 157  ASP B CG    1 
ATOM   6780  O  OD1   . ASP F 3 157 ? 15.915 76.154  44.862  1.00 87.66  ? 157  ASP B OD1   1 
ATOM   6781  O  OD2   . ASP F 3 157 ? 14.093 75.268  45.718  1.00 88.82  ? 157  ASP B OD2   1 
ATOM   6782  N  N     . ILE F 3 158 ? 16.022 71.251  42.735  1.00 72.56  ? 158  ILE B N     1 
ATOM   6783  C  CA    . ILE F 3 158 ? 15.717 69.841  42.551  1.00 69.55  ? 158  ILE B CA    1 
ATOM   6784  C  C     . ILE F 3 158 ? 16.883 69.083  43.162  1.00 67.57  ? 158  ILE B C     1 
ATOM   6785  O  O     . ILE F 3 158 ? 16.729 68.403  44.169  1.00 67.37  ? 158  ILE B O     1 
ATOM   6786  C  CB    . ILE F 3 158 ? 15.610 69.467  41.054  1.00 67.36  ? 158  ILE B CB    1 
ATOM   6787  C  CG1   . ILE F 3 158 ? 14.421 70.188  40.417  1.00 65.37  ? 158  ILE B CG1   1 
ATOM   6788  C  CG2   . ILE F 3 158 ? 15.460 67.960  40.895  1.00 60.63  ? 158  ILE B CG2   1 
ATOM   6789  C  CD1   . ILE F 3 158 ? 13.097 69.912  41.106  1.00 66.06  ? 158  ILE B CD1   1 
ATOM   6790  N  N     . ARG F 3 159 ? 18.053 69.220  42.554  1.00 64.07  ? 159  ARG B N     1 
ATOM   6791  C  CA    . ARG F 3 159 ? 19.258 68.552  43.036  1.00 62.30  ? 159  ARG B CA    1 
ATOM   6792  C  C     . ARG F 3 159 ? 19.360 68.496  44.543  1.00 61.26  ? 159  ARG B C     1 
ATOM   6793  O  O     . ARG F 3 159 ? 19.471 67.429  45.127  1.00 61.98  ? 159  ARG B O     1 
ATOM   6794  C  CB    . ARG F 3 159 ? 20.505 69.260  42.532  1.00 60.19  ? 159  ARG B CB    1 
ATOM   6795  C  CG    . ARG F 3 159 ? 21.771 68.635  43.048  1.00 47.08  ? 159  ARG B CG    1 
ATOM   6796  C  CD    . ARG F 3 159 ? 22.956 69.538  42.815  1.00 43.46  ? 159  ARG B CD    1 
ATOM   6797  N  NE    . ARG F 3 159 ? 22.874 70.741  43.630  1.00 43.88  ? 159  ARG B NE    1 
ATOM   6798  C  CZ    . ARG F 3 159 ? 23.813 71.680  43.652  1.00 44.82  ? 159  ARG B CZ    1 
ATOM   6799  N  NH1   . ARG F 3 159 ? 24.903 71.542  42.899  1.00 40.20  ? 159  ARG B NH1   1 
ATOM   6800  N  NH2   . ARG F 3 159 ? 23.660 72.757  44.423  1.00 38.87  ? 159  ARG B NH2   1 
ATOM   6801  N  N     . ASN F 3 160 ? 19.333 69.659  45.169  1.00 60.86  ? 160  ASN B N     1 
ATOM   6802  C  CA    . ASN F 3 160 ? 19.460 69.743  46.611  1.00 62.70  ? 160  ASN B CA    1 
ATOM   6803  C  C     . ASN F 3 160 ? 18.442 68.942  47.422  1.00 63.41  ? 160  ASN B C     1 
ATOM   6804  O  O     . ASN F 3 160 ? 18.819 68.180  48.308  1.00 63.72  ? 160  ASN B O     1 
ATOM   6805  C  CB    . ASN F 3 160 ? 19.475 71.215  47.009  1.00 58.87  ? 160  ASN B CB    1 
ATOM   6806  C  CG    . ASN F 3 160 ? 20.682 71.947  46.427  1.00 63.74  ? 160  ASN B CG    1 
ATOM   6807  O  OD1   . ASN F 3 160 ? 21.292 71.483  45.452  1.00 62.27  ? 160  ASN B OD1   1 
ATOM   6808  N  ND2   . ASN F 3 160 ? 21.025 73.093  47.009  1.00 61.66  ? 160  ASN B ND2   1 
ATOM   6809  N  N     . LEU F 3 161 ? 17.158 69.089  47.138  1.00 63.86  ? 161  LEU B N     1 
ATOM   6810  C  CA    . LEU F 3 161 ? 16.178 68.314  47.892  1.00 61.66  ? 161  LEU B CA    1 
ATOM   6811  C  C     . LEU F 3 161 ? 16.387 66.821  47.622  1.00 62.74  ? 161  LEU B C     1 
ATOM   6812  O  O     . LEU F 3 161 ? 15.788 65.973  48.279  1.00 60.49  ? 161  LEU B O     1 
ATOM   6813  C  CB    . LEU F 3 161 ? 14.745 68.700  47.515  1.00 55.28  ? 161  LEU B CB    1 
ATOM   6814  C  CG    . LEU F 3 161 ? 13.695 67.910  48.297  1.00 51.49  ? 161  LEU B CG    1 
ATOM   6815  C  CD1   . LEU F 3 161 ? 13.562 68.520  49.685  1.00 48.51  ? 161  LEU B CD1   1 
ATOM   6816  C  CD2   . LEU F 3 161 ? 12.361 67.924  47.579  1.00 59.61  ? 161  LEU B CD2   1 
ATOM   6817  N  N     . ALA F 3 162 ? 17.221 66.495  46.641  1.00 63.06  ? 162  ALA B N     1 
ATOM   6818  C  CA    . ALA F 3 162 ? 17.493 65.096  46.336  1.00 63.42  ? 162  ALA B CA    1 
ATOM   6819  C  C     . ALA F 3 162 ? 18.602 64.668  47.277  1.00 63.80  ? 162  ALA B C     1 
ATOM   6820  O  O     . ALA F 3 162 ? 18.450 63.728  48.059  1.00 66.15  ? 162  ALA B O     1 
ATOM   6821  C  CB    . ALA F 3 162 ? 17.942 64.934  44.895  1.00 51.21  ? 162  ALA B CB    1 
ATOM   6822  N  N     . PHE F 3 163 ? 19.720 65.379  47.197  1.00 61.84  ? 163  PHE B N     1 
ATOM   6823  C  CA    . PHE F 3 163 ? 20.876 65.116  48.046  1.00 59.28  ? 163  PHE B CA    1 
ATOM   6824  C  C     . PHE F 3 163 ? 20.434 64.958  49.489  1.00 57.48  ? 163  PHE B C     1 
ATOM   6825  O  O     . PHE F 3 163 ? 20.869 64.047  50.173  1.00 59.13  ? 163  PHE B O     1 
ATOM   6826  C  CB    . PHE F 3 163 ? 21.873 66.267  47.949  1.00 52.53  ? 163  PHE B CB    1 
ATOM   6827  C  CG    . PHE F 3 163 ? 22.858 66.306  49.066  1.00 52.49  ? 163  PHE B CG    1 
ATOM   6828  C  CD1   . PHE F 3 163 ? 24.040 65.587  48.992  1.00 53.97  ? 163  PHE B CD1   1 
ATOM   6829  C  CD2   . PHE F 3 163 ? 22.604 67.071  50.199  1.00 55.04  ? 163  PHE B CD2   1 
ATOM   6830  C  CE1   . PHE F 3 163 ? 24.960 65.636  50.031  1.00 56.31  ? 163  PHE B CE1   1 
ATOM   6831  C  CE2   . PHE F 3 163 ? 23.518 67.124  51.245  1.00 52.15  ? 163  PHE B CE2   1 
ATOM   6832  C  CZ    . PHE F 3 163 ? 24.697 66.406  51.161  1.00 55.20  ? 163  PHE B CZ    1 
ATOM   6833  N  N     . LEU F 3 164 ? 19.573 65.847  49.959  1.00 54.20  ? 164  LEU B N     1 
ATOM   6834  C  CA    . LEU F 3 164 ? 19.117 65.737  51.326  1.00 51.68  ? 164  LEU B CA    1 
ATOM   6835  C  C     . LEU F 3 164 ? 18.371 64.431  51.524  1.00 51.97  ? 164  LEU B C     1 
ATOM   6836  O  O     . LEU F 3 164 ? 18.628 63.694  52.476  1.00 51.70  ? 164  LEU B O     1 
ATOM   6837  C  CB    . LEU F 3 164 ? 18.231 66.922  51.694  1.00 52.19  ? 164  LEU B CB    1 
ATOM   6838  C  CG    . LEU F 3 164 ? 18.981 68.257  51.745  1.00 49.49  ? 164  LEU B CG    1 
ATOM   6839  C  CD1   . LEU F 3 164 ? 18.166 69.261  52.571  1.00 43.34  ? 164  LEU B CD1   1 
ATOM   6840  C  CD2   . LEU F 3 164 ? 20.362 68.054  52.375  1.00 45.47  ? 164  LEU B CD2   1 
ATOM   6841  N  N     . GLY F 3 165 ? 17.454 64.136  50.615  1.00 52.06  ? 165  GLY B N     1 
ATOM   6842  C  CA    . GLY F 3 165 ? 16.706 62.896  50.722  1.00 52.59  ? 165  GLY B CA    1 
ATOM   6843  C  C     . GLY F 3 165 ? 17.636 61.708  50.910  1.00 52.05  ? 165  GLY B C     1 
ATOM   6844  O  O     . GLY F 3 165 ? 17.421 60.865  51.780  1.00 50.71  ? 165  GLY B O     1 
ATOM   6845  N  N     . ILE F 3 166 ? 18.671 61.641  50.083  1.00 47.14  ? 166  ILE B N     1 
ATOM   6846  C  CA    . ILE F 3 166 ? 19.631 60.566  50.174  1.00 45.50  ? 166  ILE B CA    1 
ATOM   6847  C  C     . ILE F 3 166 ? 20.390 60.672  51.492  1.00 47.74  ? 166  ILE B C     1 
ATOM   6848  O  O     . ILE F 3 166 ? 20.552 59.678  52.197  1.00 48.86  ? 166  ILE B O     1 
ATOM   6849  C  CB    . ILE F 3 166 ? 20.624 60.613  48.992  1.00 41.65  ? 166  ILE B CB    1 
ATOM   6850  C  CG1   . ILE F 3 166 ? 19.958 60.054  47.740  1.00 48.36  ? 166  ILE B CG1   1 
ATOM   6851  C  CG2   . ILE F 3 166 ? 21.868 59.807  49.299  1.00 24.88  ? 166  ILE B CG2   1 
ATOM   6852  C  CD1   . ILE F 3 166 ? 20.894 59.918  46.563  1.00 59.59  ? 166  ILE B CD1   1 
ATOM   6853  N  N     . ALA F 3 167 ? 20.836 61.877  51.838  1.00 46.54  ? 167  ALA B N     1 
ATOM   6854  C  CA    . ALA F 3 167 ? 21.597 62.085  53.073  1.00 45.84  ? 167  ALA B CA    1 
ATOM   6855  C  C     . ALA F 3 167 ? 20.899 61.547  54.322  1.00 48.26  ? 167  ALA B C     1 
ATOM   6856  O  O     . ALA F 3 167 ? 21.516 60.863  55.137  1.00 48.87  ? 167  ALA B O     1 
ATOM   6857  C  CB    . ALA F 3 167 ? 21.919 63.574  53.260  1.00 31.55  ? 167  ALA B CB    1 
ATOM   6858  N  N     . TYR F 3 168 ? 19.623 61.860  54.482  1.00 46.66  ? 168  TYR B N     1 
ATOM   6859  C  CA    . TYR F 3 168 ? 18.889 61.390  55.637  1.00 45.42  ? 168  TYR B CA    1 
ATOM   6860  C  C     . TYR F 3 168 ? 18.620 59.897  55.496  1.00 48.15  ? 168  TYR B C     1 
ATOM   6861  O  O     . TYR F 3 168 ? 18.905 59.115  56.390  1.00 50.55  ? 168  TYR B O     1 
ATOM   6862  C  CB    . TYR F 3 168 ? 17.568 62.152  55.755  1.00 38.08  ? 168  TYR B CB    1 
ATOM   6863  C  CG    . TYR F 3 168 ? 16.638 61.630  56.820  1.00 37.98  ? 168  TYR B CG    1 
ATOM   6864  C  CD1   . TYR F 3 168 ? 16.542 62.256  58.061  1.00 41.09  ? 168  TYR B CD1   1 
ATOM   6865  C  CD2   . TYR F 3 168 ? 15.859 60.494  56.594  1.00 41.19  ? 168  TYR B CD2   1 
ATOM   6866  C  CE1   . TYR F 3 168 ? 15.687 61.763  59.058  1.00 43.01  ? 168  TYR B CE1   1 
ATOM   6867  C  CE2   . TYR F 3 168 ? 15.010 59.990  57.574  1.00 43.15  ? 168  TYR B CE2   1 
ATOM   6868  C  CZ    . TYR F 3 168 ? 14.928 60.626  58.802  1.00 45.05  ? 168  TYR B CZ    1 
ATOM   6869  O  OH    . TYR F 3 168 ? 14.092 60.115  59.767  1.00 41.55  ? 168  TYR B OH    1 
ATOM   6870  N  N     . ASN F 3 169 ? 18.083 59.500  54.355  1.00 48.69  ? 169  ASN B N     1 
ATOM   6871  C  CA    . ASN F 3 169 ? 17.737 58.108  54.118  1.00 48.19  ? 169  ASN B CA    1 
ATOM   6872  C  C     . ASN F 3 169 ? 18.887 57.096  54.230  1.00 47.74  ? 169  ASN B C     1 
ATOM   6873  O  O     . ASN F 3 169 ? 18.699 56.020  54.777  1.00 47.46  ? 169  ASN B O     1 
ATOM   6874  C  CB    . ASN F 3 169 ? 17.047 58.011  52.745  1.00 56.07  ? 169  ASN B CB    1 
ATOM   6875  C  CG    . ASN F 3 169 ? 16.395 56.653  52.481  1.00 54.58  ? 169  ASN B CG    1 
ATOM   6876  O  OD1   . ASN F 3 169 ? 15.420 56.561  51.729  1.00 50.95  ? 169  ASN B OD1   1 
ATOM   6877  N  ND2   . ASN F 3 169 ? 16.940 55.600  53.071  1.00 50.93  ? 169  ASN B ND2   1 
ATOM   6878  N  N     . THR F 3 170 ? 20.078 57.422  53.746  1.00 48.19  ? 170  THR B N     1 
ATOM   6879  C  CA    . THR F 3 170 ? 21.165 56.444  53.806  1.00 51.17  ? 170  THR B CA    1 
ATOM   6880  C  C     . THR F 3 170 ? 22.220 56.662  54.880  1.00 52.93  ? 170  THR B C     1 
ATOM   6881  O  O     . THR F 3 170 ? 23.083 55.813  55.080  1.00 52.67  ? 170  THR B O     1 
ATOM   6882  C  CB    . THR F 3 170 ? 21.908 56.347  52.463  1.00 54.23  ? 170  THR B CB    1 
ATOM   6883  O  OG1   . THR F 3 170 ? 22.949 57.325  52.420  1.00 55.02  ? 170  THR B OG1   1 
ATOM   6884  C  CG2   . THR F 3 170 ? 20.965 56.619  51.322  1.00 45.35  ? 170  THR B CG2   1 
ATOM   6885  N  N     . LEU F 3 171 ? 22.166 57.796  55.564  1.00 52.53  ? 171  LEU B N     1 
ATOM   6886  C  CA    . LEU F 3 171 ? 23.139 58.092  56.605  1.00 50.49  ? 171  LEU B CA    1 
ATOM   6887  C  C     . LEU F 3 171 ? 24.567 58.096  56.070  1.00 51.31  ? 171  LEU B C     1 
ATOM   6888  O  O     . LEU F 3 171 ? 25.520 58.243  56.837  1.00 53.73  ? 171  LEU B O     1 
ATOM   6889  C  CB    . LEU F 3 171 ? 23.047 57.069  57.740  1.00 46.96  ? 171  LEU B CB    1 
ATOM   6890  C  CG    . LEU F 3 171 ? 21.929 57.152  58.776  1.00 35.53  ? 171  LEU B CG    1 
ATOM   6891  C  CD1   . LEU F 3 171 ? 20.880 56.072  58.523  1.00 17.75  ? 171  LEU B CD1   1 
ATOM   6892  C  CD2   . LEU F 3 171 ? 22.538 56.959  60.156  1.00 31.87  ? 171  LEU B CD2   1 
ATOM   6893  N  N     . LEU F 3 172 ? 24.730 57.915  54.765  1.00 48.98  ? 172  LEU B N     1 
ATOM   6894  C  CA    . LEU F 3 172 ? 26.069 57.918  54.182  1.00 48.50  ? 172  LEU B CA    1 
ATOM   6895  C  C     . LEU F 3 172 ? 26.745 59.234  54.523  1.00 51.38  ? 172  LEU B C     1 
ATOM   6896  O  O     . LEU F 3 172 ? 26.076 60.263  54.652  1.00 51.23  ? 172  LEU B O     1 
ATOM   6897  C  CB    . LEU F 3 172 ? 25.994 57.776  52.659  1.00 37.49  ? 172  LEU B CB    1 
ATOM   6898  C  CG    . LEU F 3 172 ? 25.739 56.378  52.077  1.00 36.13  ? 172  LEU B CG    1 
ATOM   6899  C  CD1   . LEU F 3 172 ? 25.298 56.474  50.638  1.00 24.53  ? 172  LEU B CD1   1 
ATOM   6900  C  CD2   . LEU F 3 172 ? 27.009 55.548  52.177  1.00 26.87  ? 172  LEU B CD2   1 
ATOM   6901  N  N     . ARG F 3 173 ? 28.063 59.198  54.700  1.00 51.78  ? 173  ARG B N     1 
ATOM   6902  C  CA    . ARG F 3 173 ? 28.818 60.418  54.973  1.00 53.12  ? 173  ARG B CA    1 
ATOM   6903  C  C     . ARG F 3 173 ? 28.703 61.194  53.657  1.00 55.70  ? 173  ARG B C     1 
ATOM   6904  O  O     . ARG F 3 173 ? 28.132 60.686  52.695  1.00 57.35  ? 173  ARG B O     1 
ATOM   6905  C  CB    . ARG F 3 173 ? 30.286 60.085  55.263  1.00 47.84  ? 173  ARG B CB    1 
ATOM   6906  C  CG    . ARG F 3 173 ? 30.518 59.151  56.449  1.00 47.43  ? 173  ARG B CG    1 
ATOM   6907  C  CD    . ARG F 3 173 ? 31.960 58.663  56.446  1.00 55.68  ? 173  ARG B CD    1 
ATOM   6908  N  NE    . ARG F 3 173 ? 32.284 57.739  57.535  1.00 66.11  ? 173  ARG B NE    1 
ATOM   6909  C  CZ    . ARG F 3 173 ? 31.777 56.515  57.670  1.00 73.63  ? 173  ARG B CZ    1 
ATOM   6910  N  NH1   . ARG F 3 173 ? 30.904 56.044  56.786  1.00 80.01  ? 173  ARG B NH1   1 
ATOM   6911  N  NH2   . ARG F 3 173 ? 32.161 55.749  58.683  1.00 68.81  ? 173  ARG B NH2   1 
ATOM   6912  N  N     . ILE F 3 174 ? 29.229 62.408  53.581  1.00 56.81  ? 174  ILE B N     1 
ATOM   6913  C  CA    . ILE F 3 174 ? 29.106 63.136  52.323  1.00 54.07  ? 174  ILE B CA    1 
ATOM   6914  C  C     . ILE F 3 174 ? 30.155 62.729  51.291  1.00 56.54  ? 174  ILE B C     1 
ATOM   6915  O  O     . ILE F 3 174 ? 29.813 62.432  50.143  1.00 57.06  ? 174  ILE B O     1 
ATOM   6916  C  CB    . ILE F 3 174 ? 29.148 64.668  52.538  1.00 46.88  ? 174  ILE B CB    1 
ATOM   6917  C  CG1   . ILE F 3 174 ? 30.416 65.065  53.284  1.00 39.83  ? 174  ILE B CG1   1 
ATOM   6918  C  CG2   . ILE F 3 174 ? 27.916 65.110  53.306  1.00 42.72  ? 174  ILE B CG2   1 
ATOM   6919  C  CD1   . ILE F 3 174 ? 30.407 66.513  53.746  1.00 34.18  ? 174  ILE B CD1   1 
ATOM   6920  N  N     . ALA F 3 175 ? 31.424 62.706  51.688  1.00 57.68  ? 175  ALA B N     1 
ATOM   6921  C  CA    . ALA F 3 175 ? 32.488 62.321  50.767  1.00 56.19  ? 175  ALA B CA    1 
ATOM   6922  C  C     . ALA F 3 175 ? 32.054 61.097  49.987  1.00 54.89  ? 175  ALA B C     1 
ATOM   6923  O  O     . ALA F 3 175 ? 32.413 60.929  48.828  1.00 55.28  ? 175  ALA B O     1 
ATOM   6924  C  CB    . ALA F 3 175 ? 33.761 62.014  51.527  1.00 61.08  ? 175  ALA B CB    1 
ATOM   6925  N  N     . GLU F 3 176 ? 31.258 60.252  50.631  1.00 54.42  ? 176  GLU B N     1 
ATOM   6926  C  CA    . GLU F 3 176 ? 30.773 59.024  50.017  1.00 55.04  ? 176  GLU B CA    1 
ATOM   6927  C  C     . GLU F 3 176 ? 29.664 59.309  49.009  1.00 53.39  ? 176  GLU B C     1 
ATOM   6928  O  O     . GLU F 3 176 ? 29.618 58.695  47.949  1.00 53.10  ? 176  GLU B O     1 
ATOM   6929  C  CB    . GLU F 3 176 ? 30.270 58.065  51.104  1.00 56.69  ? 176  GLU B CB    1 
ATOM   6930  C  CG    . GLU F 3 176 ? 31.164 58.033  52.351  1.00 72.76  ? 176  GLU B CG    1 
ATOM   6931  C  CD    . GLU F 3 176 ? 30.631 57.139  53.465  1.00 77.47  ? 176  GLU B CD    1 
ATOM   6932  O  OE1   . GLU F 3 176 ? 29.440 57.260  53.830  1.00 75.90  ? 176  GLU B OE1   1 
ATOM   6933  O  OE2   . GLU F 3 176 ? 31.415 56.320  53.985  1.00 75.57  ? 176  GLU B OE2   1 
ATOM   6934  N  N     . ILE F 3 177 ? 28.768 60.235  49.342  1.00 52.79  ? 177  ILE B N     1 
ATOM   6935  C  CA    . ILE F 3 177 ? 27.668 60.599  48.445  1.00 50.10  ? 177  ILE B CA    1 
ATOM   6936  C  C     . ILE F 3 177 ? 28.258 61.247  47.198  1.00 51.74  ? 177  ILE B C     1 
ATOM   6937  O  O     . ILE F 3 177 ? 27.688 61.166  46.106  1.00 50.79  ? 177  ILE B O     1 
ATOM   6938  C  CB    . ILE F 3 177 ? 26.690 61.604  49.107  1.00 40.81  ? 177  ILE B CB    1 
ATOM   6939  C  CG1   . ILE F 3 177 ? 25.961 60.939  50.268  1.00 37.91  ? 177  ILE B CG1   1 
ATOM   6940  C  CG2   . ILE F 3 177 ? 25.679 62.097  48.096  1.00 32.24  ? 177  ILE B CG2   1 
ATOM   6941  C  CD1   . ILE F 3 177 ? 25.081 61.887  51.035  1.00 41.87  ? 177  ILE B CD1   1 
ATOM   6942  N  N     . ALA F 3 178 ? 29.402 61.896  47.371  1.00 51.57  ? 178  ALA B N     1 
ATOM   6943  C  CA    . ALA F 3 178 ? 30.071 62.533  46.256  1.00 52.63  ? 178  ALA B CA    1 
ATOM   6944  C  C     . ALA F 3 178 ? 30.390 61.469  45.226  1.00 53.31  ? 178  ALA B C     1 
ATOM   6945  O  O     . ALA F 3 178 ? 29.812 61.457  44.149  1.00 56.53  ? 178  ALA B O     1 
ATOM   6946  C  CB    . ALA F 3 178 ? 31.337 63.192  46.717  1.00 55.71  ? 178  ALA B CB    1 
ATOM   6947  N  N     . ARG F 3 179 ? 31.294 60.561  45.580  1.00 54.10  ? 179  ARG B N     1 
ATOM   6948  C  CA    . ARG F 3 179 ? 31.724 59.474  44.696  1.00 54.40  ? 179  ARG B CA    1 
ATOM   6949  C  C     . ARG F 3 179 ? 30.645 58.583  44.076  1.00 55.44  ? 179  ARG B C     1 
ATOM   6950  O  O     . ARG F 3 179 ? 30.982 57.584  43.443  1.00 54.35  ? 179  ARG B O     1 
ATOM   6951  C  CB    . ARG F 3 179 ? 32.717 58.561  45.428  1.00 52.16  ? 179  ARG B CB    1 
ATOM   6952  C  CG    . ARG F 3 179 ? 34.019 59.232  45.845  1.00 53.74  ? 179  ARG B CG    1 
ATOM   6953  C  CD    . ARG F 3 179 ? 35.045 58.191  46.268  1.00 61.80  ? 179  ARG B CD    1 
ATOM   6954  N  NE    . ARG F 3 179 ? 34.778 57.640  47.591  1.00 71.99  ? 179  ARG B NE    1 
ATOM   6955  C  CZ    . ARG F 3 179 ? 35.075 58.263  48.727  1.00 79.19  ? 179  ARG B CZ    1 
ATOM   6956  N  NH1   . ARG F 3 179 ? 35.650 59.460  48.699  1.00 80.13  ? 179  ARG B NH1   1 
ATOM   6957  N  NH2   . ARG F 3 179 ? 34.803 57.688  49.892  1.00 81.73  ? 179  ARG B NH2   1 
ATOM   6958  N  N     . ILE F 3 180 ? 29.366 58.911  44.248  1.00 54.90  ? 180  ILE B N     1 
ATOM   6959  C  CA    . ILE F 3 180 ? 28.316 58.073  43.672  1.00 53.46  ? 180  ILE B CA    1 
ATOM   6960  C  C     . ILE F 3 180 ? 28.203 58.258  42.167  1.00 59.11  ? 180  ILE B C     1 
ATOM   6961  O  O     . ILE F 3 180 ? 27.877 59.353  41.706  1.00 60.49  ? 180  ILE B O     1 
ATOM   6962  C  CB    . ILE F 3 180 ? 26.923 58.376  44.261  1.00 44.69  ? 180  ILE B CB    1 
ATOM   6963  C  CG1   . ILE F 3 180 ? 26.906 58.121  45.768  1.00 34.68  ? 180  ILE B CG1   1 
ATOM   6964  C  CG2   . ILE F 3 180 ? 25.883 57.495  43.588  1.00 32.84  ? 180  ILE B CG2   1 
ATOM   6965  C  CD1   . ILE F 3 180 ? 25.508 58.166  46.392  1.00 16.75  ? 180  ILE B CD1   1 
ATOM   6966  N  N     . ARG F 3 181 ? 28.467 57.190  41.411  1.00 60.40  ? 181  ARG B N     1 
ATOM   6967  C  CA    . ARG F 3 181 ? 28.370 57.224  39.949  1.00 59.22  ? 181  ARG B CA    1 
ATOM   6968  C  C     . ARG F 3 181 ? 27.026 56.659  39.516  1.00 62.44  ? 181  ARG B C     1 
ATOM   6969  O  O     . ARG F 3 181 ? 26.441 55.837  40.209  1.00 67.35  ? 181  ARG B O     1 
ATOM   6970  C  CB    . ARG F 3 181 ? 29.497 56.421  39.298  1.00 50.40  ? 181  ARG B CB    1 
ATOM   6971  C  CG    . ARG F 3 181 ? 30.858 57.091  39.401  1.00 59.74  ? 181  ARG B CG    1 
ATOM   6972  C  CD    . ARG F 3 181 ? 31.843 56.502  38.399  1.00 60.38  ? 181  ARG B CD    1 
ATOM   6973  N  NE    . ARG F 3 181 ? 32.838 57.487  37.971  1.00 68.68  ? 181  ARG B NE    1 
ATOM   6974  C  CZ    . ARG F 3 181 ? 33.983 57.734  38.600  1.00 73.17  ? 181  ARG B CZ    1 
ATOM   6975  N  NH1   . ARG F 3 181 ? 34.300 57.060  39.701  1.00 72.02  ? 181  ARG B NH1   1 
ATOM   6976  N  NH2   . ARG F 3 181 ? 34.808 58.664  38.128  1.00 74.85  ? 181  ARG B NH2   1 
ATOM   6977  N  N     . VAL F 3 182 ? 26.536 57.100  38.368  1.00 63.24  ? 182  VAL B N     1 
ATOM   6978  C  CA    . VAL F 3 182 ? 25.245 56.643  37.892  1.00 61.05  ? 182  VAL B CA    1 
ATOM   6979  C  C     . VAL F 3 182 ? 25.216 55.139  37.714  1.00 62.21  ? 182  VAL B C     1 
ATOM   6980  O  O     . VAL F 3 182 ? 24.179 54.508  37.904  1.00 62.44  ? 182  VAL B O     1 
ATOM   6981  C  CB    . VAL F 3 182 ? 24.876 57.302  36.558  1.00 54.93  ? 182  VAL B CB    1 
ATOM   6982  C  CG1   . VAL F 3 182 ? 23.397 57.151  36.318  1.00 51.03  ? 182  VAL B CG1   1 
ATOM   6983  C  CG2   . VAL F 3 182 ? 25.260 58.768  36.573  1.00 51.34  ? 182  VAL B CG2   1 
ATOM   6984  N  N     . LYS F 3 183 ? 26.355 54.559  37.356  1.00 61.74  ? 183  LYS B N     1 
ATOM   6985  C  CA    . LYS F 3 183 ? 26.420 53.116  37.155  1.00 65.16  ? 183  LYS B CA    1 
ATOM   6986  C  C     . LYS F 3 183 ? 26.424 52.391  38.490  1.00 67.05  ? 183  LYS B C     1 
ATOM   6987  O  O     . LYS F 3 183 ? 26.696 51.191  38.552  1.00 68.81  ? 183  LYS B O     1 
ATOM   6988  C  CB    . LYS F 3 183 ? 27.676 52.730  36.367  1.00 67.49  ? 183  LYS B CB    1 
ATOM   6989  C  CG    . LYS F 3 183 ? 28.985 52.995  37.093  1.00 63.17  ? 183  LYS B CG    1 
ATOM   6990  C  CD    . LYS F 3 183 ? 30.168 52.463  36.294  1.00 65.92  ? 183  LYS B CD    1 
ATOM   6991  C  CE    . LYS F 3 183 ? 31.488 52.748  37.003  1.00 68.17  ? 183  LYS B CE    1 
ATOM   6992  N  NZ    . LYS F 3 183 ? 32.660 52.218  36.247  1.00 67.48  ? 183  LYS B NZ    1 
ATOM   6993  N  N     . ASP F 3 184 ? 26.137 53.127  39.559  1.00 67.05  ? 184  ASP B N     1 
ATOM   6994  C  CA    . ASP F 3 184 ? 26.103 52.543  40.890  1.00 64.31  ? 184  ASP B CA    1 
ATOM   6995  C  C     . ASP F 3 184 ? 24.671 52.443  41.388  1.00 65.41  ? 184  ASP B C     1 
ATOM   6996  O  O     . ASP F 3 184 ? 24.425 51.896  42.456  1.00 67.44  ? 184  ASP B O     1 
ATOM   6997  C  CB    . ASP F 3 184 ? 26.944 53.369  41.877  1.00 63.09  ? 184  ASP B CB    1 
ATOM   6998  C  CG    . ASP F 3 184 ? 28.450 53.302  41.583  1.00 70.78  ? 184  ASP B CG    1 
ATOM   6999  O  OD1   . ASP F 3 184 ? 28.959 52.192  41.301  1.00 71.97  ? 184  ASP B OD1   1 
ATOM   7000  O  OD2   . ASP F 3 184 ? 29.131 54.354  41.654  1.00 66.51  ? 184  ASP B OD2   1 
ATOM   7001  N  N     . ILE F 3 185 ? 23.723 52.971  40.623  1.00 65.91  ? 185  ILE B N     1 
ATOM   7002  C  CA    . ILE F 3 185 ? 22.326 52.901  41.033  1.00 63.92  ? 185  ILE B CA    1 
ATOM   7003  C  C     . ILE F 3 185 ? 21.648 51.697  40.397  1.00 67.82  ? 185  ILE B C     1 
ATOM   7004  O  O     . ILE F 3 185 ? 21.965 51.338  39.268  1.00 67.98  ? 185  ILE B O     1 
ATOM   7005  C  CB    . ILE F 3 185 ? 21.539 54.157  40.617  1.00 52.45  ? 185  ILE B CB    1 
ATOM   7006  C  CG1   . ILE F 3 185 ? 22.172 55.400  41.242  1.00 46.85  ? 185  ILE B CG1   1 
ATOM   7007  C  CG2   . ILE F 3 185 ? 20.078 54.012  41.047  1.00 38.87  ? 185  ILE B CG2   1 
ATOM   7008  C  CD1   . ILE F 3 185 ? 21.263 56.633  41.256  1.00 44.06  ? 185  ILE B CD1   1 
ATOM   7009  N  N     . SER F 3 186 ? 20.727 51.071  41.125  1.00 68.16  ? 186  SER B N     1 
ATOM   7010  C  CA    . SER F 3 186 ? 19.992 49.916  40.610  1.00 68.48  ? 186  SER B CA    1 
ATOM   7011  C  C     . SER F 3 186 ? 18.622 49.916  41.261  1.00 71.39  ? 186  SER B C     1 
ATOM   7012  O  O     . SER F 3 186 ? 18.250 50.889  41.908  1.00 71.65  ? 186  SER B O     1 
ATOM   7013  C  CB    . SER F 3 186 ? 20.718 48.602  40.929  1.00 63.70  ? 186  SER B CB    1 
ATOM   7014  O  OG    . SER F 3 186 ? 20.332 48.075  42.186  1.00 64.71  ? 186  SER B OG    1 
ATOM   7015  N  N     . ARG F 3 187 ? 17.864 48.840  41.109  1.00 74.37  ? 187  ARG B N     1 
ATOM   7016  C  CA    . ARG F 3 187 ? 16.545 48.823  41.715  1.00 77.57  ? 187  ARG B CA    1 
ATOM   7017  C  C     . ARG F 3 187 ? 16.065 47.491  42.263  1.00 80.78  ? 187  ARG B C     1 
ATOM   7018  O  O     . ARG F 3 187 ? 16.519 46.423  41.855  1.00 77.49  ? 187  ARG B O     1 
ATOM   7019  C  CB    . ARG F 3 187 ? 15.510 49.356  40.721  1.00 77.25  ? 187  ARG B CB    1 
ATOM   7020  C  CG    . ARG F 3 187 ? 15.612 50.850  40.458  1.00 80.35  ? 187  ARG B CG    1 
ATOM   7021  C  CD    . ARG F 3 187 ? 14.430 51.355  39.641  1.00 80.13  ? 187  ARG B CD    1 
ATOM   7022  N  NE    . ARG F 3 187 ? 14.382 52.816  39.599  1.00 85.73  ? 187  ARG B NE    1 
ATOM   7023  C  CZ    . ARG F 3 187 ? 15.302 53.587  39.025  1.00 92.04  ? 187  ARG B CZ    1 
ATOM   7024  N  NH1   . ARG F 3 187 ? 16.362 53.045  38.430  1.00 91.20  ? 187  ARG B NH1   1 
ATOM   7025  N  NH2   . ARG F 3 187 ? 15.160 54.906  39.045  1.00 89.11  ? 187  ARG B NH2   1 
ATOM   7026  N  N     . THR F 3 188 ? 15.139 47.581  43.211  1.00 84.74  ? 188  THR B N     1 
ATOM   7027  C  CA    . THR F 3 188 ? 14.532 46.414  43.831  1.00 89.33  ? 188  THR B CA    1 
ATOM   7028  C  C     . THR F 3 188 ? 13.342 46.101  42.942  1.00 93.22  ? 188  THR B C     1 
ATOM   7029  O  O     . THR F 3 188 ? 12.695 47.022  42.437  1.00 94.28  ? 188  THR B O     1 
ATOM   7030  C  CB    . THR F 3 188 ? 14.013 46.727  45.260  1.00 85.28  ? 188  THR B CB    1 
ATOM   7031  O  OG1   . THR F 3 188 ? 13.237 47.934  45.238  1.00 81.19  ? 188  THR B OG1   1 
ATOM   7032  C  CG2   . THR F 3 188 ? 15.170 46.880  46.232  1.00 74.67  ? 188  THR B CG2   1 
ATOM   7033  N  N     . ASP F 3 189 ? 13.048 44.821  42.737  1.00 96.20  ? 189  ASP B N     1 
ATOM   7034  C  CA    . ASP F 3 189 ? 11.916 44.460  41.896  1.00 96.93  ? 189  ASP B CA    1 
ATOM   7035  C  C     . ASP F 3 189 ? 10.651 45.148  42.399  1.00 95.97  ? 189  ASP B C     1 
ATOM   7036  O  O     . ASP F 3 189 ? 9.596  45.062  41.774  1.00 97.27  ? 189  ASP B O     1 
ATOM   7037  C  CB    . ASP F 3 189 ? 11.726 42.940  41.871  1.00 103.82 ? 189  ASP B CB    1 
ATOM   7038  C  CG    . ASP F 3 189 ? 12.602 42.255  40.822  1.00 110.74 ? 189  ASP B CG    1 
ATOM   7039  O  OD1   . ASP F 3 189 ? 12.451 42.570  39.618  1.00 112.64 ? 189  ASP B OD1   1 
ATOM   7040  O  OD2   . ASP F 3 189 ? 13.440 41.401  41.198  1.00 111.36 ? 189  ASP B OD2   1 
ATOM   7041  N  N     . GLY F 3 190 ? 10.775 45.845  43.524  1.00 93.50  ? 190  GLY B N     1 
ATOM   7042  C  CA    . GLY F 3 190 ? 9.646  46.550  44.103  1.00 88.61  ? 190  GLY B CA    1 
ATOM   7043  C  C     . GLY F 3 190 ? 9.589  48.026  43.747  1.00 86.84  ? 190  GLY B C     1 
ATOM   7044  O  O     . GLY F 3 190 ? 8.550  48.662  43.920  1.00 85.51  ? 190  GLY B O     1 
ATOM   7045  N  N     . GLY F 3 191 ? 10.698 48.585  43.272  1.00 85.45  ? 191  GLY B N     1 
ATOM   7046  C  CA    . GLY F 3 191 ? 10.687 49.986  42.887  1.00 82.58  ? 191  GLY B CA    1 
ATOM   7047  C  C     . GLY F 3 191 ? 11.718 50.935  43.474  1.00 80.97  ? 191  GLY B C     1 
ATOM   7048  O  O     . GLY F 3 191 ? 11.961 52.000  42.899  1.00 80.50  ? 191  GLY B O     1 
ATOM   7049  N  N     . ARG F 3 192 ? 12.331 50.573  44.598  1.00 78.39  ? 192  ARG B N     1 
ATOM   7050  C  CA    . ARG F 3 192 ? 13.315 51.445  45.236  1.00 72.53  ? 192  ARG B CA    1 
ATOM   7051  C  C     . ARG F 3 192 ? 14.701 51.342  44.607  1.00 71.81  ? 192  ARG B C     1 
ATOM   7052  O  O     . ARG F 3 192 ? 15.012 50.373  43.923  1.00 72.43  ? 192  ARG B O     1 
ATOM   7053  C  CB    . ARG F 3 192 ? 13.411 51.115  46.723  1.00 57.31  ? 192  ARG B CB    1 
ATOM   7054  C  CG    . ARG F 3 192 ? 12.070 50.867  47.382  1.00 55.62  ? 192  ARG B CG    1 
ATOM   7055  C  CD    . ARG F 3 192 ? 12.006 49.440  47.913  1.00 50.74  ? 192  ARG B CD    1 
ATOM   7056  N  NE    . ARG F 3 192 ? 10.657 49.016  48.289  1.00 56.93  ? 192  ARG B NE    1 
ATOM   7057  C  CZ    . ARG F 3 192 ? 9.876  49.675  49.139  1.00 59.35  ? 192  ARG B CZ    1 
ATOM   7058  N  NH1   . ARG F 3 192 ? 10.307 50.799  49.709  1.00 54.49  ? 192  ARG B NH1   1 
ATOM   7059  N  NH2   . ARG F 3 192 ? 8.664  49.211  49.417  1.00 55.68  ? 192  ARG B NH2   1 
ATOM   7060  N  N     . MET F 3 193 ? 15.533 52.350  44.843  1.00 69.51  ? 193  MET B N     1 
ATOM   7061  C  CA    . MET F 3 193 ? 16.886 52.353  44.305  1.00 66.21  ? 193  MET B CA    1 
ATOM   7062  C  C     . MET F 3 193 ? 17.872 51.674  45.256  1.00 66.21  ? 193  MET B C     1 
ATOM   7063  O  O     . MET F 3 193 ? 17.674 51.664  46.471  1.00 65.33  ? 193  MET B O     1 
ATOM   7064  C  CB    . MET F 3 193 ? 17.358 53.782  44.033  1.00 56.06  ? 193  MET B CB    1 
ATOM   7065  C  CG    . MET F 3 193 ? 16.704 54.460  42.855  1.00 55.83  ? 193  MET B CG    1 
ATOM   7066  S  SD    . MET F 3 193 ? 17.518 56.029  42.500  1.00 66.14  ? 193  MET B SD    1 
ATOM   7067  C  CE    . MET F 3 193 ? 17.602 56.015  40.697  1.00 61.64  ? 193  MET B CE    1 
ATOM   7068  N  N     . LEU F 3 194 ? 18.941 51.124  44.691  1.00 64.31  ? 194  LEU B N     1 
ATOM   7069  C  CA    . LEU F 3 194 ? 19.969 50.437  45.460  1.00 61.75  ? 194  LEU B CA    1 
ATOM   7070  C  C     . LEU F 3 194 ? 21.356 51.027  45.217  1.00 61.29  ? 194  LEU B C     1 
ATOM   7071  O  O     . LEU F 3 194 ? 22.194 50.390  44.572  1.00 62.77  ? 194  LEU B O     1 
ATOM   7072  C  CB    . LEU F 3 194 ? 19.990 48.954  45.082  1.00 57.03  ? 194  LEU B CB    1 
ATOM   7073  C  CG    . LEU F 3 194 ? 19.074 47.935  45.769  1.00 57.35  ? 194  LEU B CG    1 
ATOM   7074  C  CD1   . LEU F 3 194 ? 19.866 47.195  46.833  1.00 51.15  ? 194  LEU B CD1   1 
ATOM   7075  C  CD2   . LEU F 3 194 ? 17.858 48.615  46.353  1.00 63.00  ? 194  LEU B CD2   1 
ATOM   7076  N  N     . ILE F 3 195 ? 21.609 52.230  45.724  1.00 58.07  ? 195  ILE B N     1 
ATOM   7077  C  CA    . ILE F 3 195 ? 22.918 52.851  45.538  1.00 55.31  ? 195  ILE B CA    1 
ATOM   7078  C  C     . ILE F 3 195 ? 24.000 51.936  46.118  1.00 58.00  ? 195  ILE B C     1 
ATOM   7079  O  O     . ILE F 3 195 ? 23.919 51.524  47.268  1.00 62.27  ? 195  ILE B O     1 
ATOM   7080  C  CB    . ILE F 3 195 ? 23.003 54.198  46.262  1.00 42.84  ? 195  ILE B CB    1 
ATOM   7081  C  CG1   . ILE F 3 195 ? 21.772 55.038  45.942  1.00 40.25  ? 195  ILE B CG1   1 
ATOM   7082  C  CG2   . ILE F 3 195 ? 24.279 54.936  45.853  1.00 31.45  ? 195  ILE B CG2   1 
ATOM   7083  C  CD1   . ILE F 3 195 ? 21.696 56.319  46.748  1.00 41.42  ? 195  ILE B CD1   1 
ATOM   7084  N  N     . HIS F 3 196 ? 25.005 51.613  45.320  1.00 55.42  ? 196  HIS B N     1 
ATOM   7085  C  CA    . HIS F 3 196 ? 26.082 50.759  45.782  1.00 57.45  ? 196  HIS B CA    1 
ATOM   7086  C  C     . HIS F 3 196 ? 27.298 51.585  46.204  1.00 60.63  ? 196  HIS B C     1 
ATOM   7087  O  O     . HIS F 3 196 ? 27.809 52.406  45.442  1.00 59.69  ? 196  HIS B O     1 
ATOM   7088  C  CB    . HIS F 3 196 ? 26.459 49.763  44.679  1.00 58.59  ? 196  HIS B CB    1 
ATOM   7089  C  CG    . HIS F 3 196 ? 27.734 49.018  44.937  1.00 67.05  ? 196  HIS B CG    1 
ATOM   7090  N  ND1   . HIS F 3 196 ? 28.974 49.545  44.648  1.00 70.46  ? 196  HIS B ND1   1 
ATOM   7091  C  CD2   . HIS F 3 196 ? 27.962 47.800  45.482  1.00 69.09  ? 196  HIS B CD2   1 
ATOM   7092  C  CE1   . HIS F 3 196 ? 29.912 48.685  45.007  1.00 70.35  ? 196  HIS B CE1   1 
ATOM   7093  N  NE2   . HIS F 3 196 ? 29.325 47.618  45.516  1.00 70.48  ? 196  HIS B NE2   1 
ATOM   7094  N  N     . ILE F 3 197 ? 27.761 51.372  47.427  1.00 60.05  ? 197  ILE B N     1 
ATOM   7095  C  CA    . ILE F 3 197 ? 28.917 52.102  47.925  1.00 61.69  ? 197  ILE B CA    1 
ATOM   7096  C  C     . ILE F 3 197 ? 30.123 51.179  48.018  1.00 66.23  ? 197  ILE B C     1 
ATOM   7097  O  O     . ILE F 3 197 ? 30.062 50.134  48.658  1.00 69.69  ? 197  ILE B O     1 
ATOM   7098  C  CB    . ILE F 3 197 ? 28.653 52.683  49.320  1.00 53.94  ? 197  ILE B CB    1 
ATOM   7099  C  CG1   . ILE F 3 197 ? 27.320 53.447  49.334  1.00 46.23  ? 197  ILE B CG1   1 
ATOM   7100  C  CG2   . ILE F 3 197 ? 29.820 53.579  49.723  1.00 43.74  ? 197  ILE B CG2   1 
ATOM   7101  C  CD1   . ILE F 3 197 ? 27.330 54.720  48.527  1.00 41.41  ? 197  ILE B CD1   1 
ATOM   7102  N  N     . GLY F 3 198 ? 31.223 51.574  47.387  1.00 68.77  ? 198  GLY B N     1 
ATOM   7103  C  CA    . GLY F 3 198 ? 32.423 50.756  47.414  1.00 73.56  ? 198  GLY B CA    1 
ATOM   7104  C  C     . GLY F 3 198 ? 33.412 51.096  48.517  1.00 77.27  ? 198  GLY B C     1 
ATOM   7105  O  O     . GLY F 3 198 ? 33.933 50.208  49.192  1.00 78.53  ? 198  GLY B O     1 
ATOM   7106  N  N     . ARG F 3 199 ? 33.678 52.380  48.715  1.00 80.72  ? 199  ARG B N     1 
ATOM   7107  C  CA    . ARG F 3 199 ? 34.628 52.776  49.737  1.00 83.36  ? 199  ARG B CA    1 
ATOM   7108  C  C     . ARG F 3 199 ? 34.094 53.841  50.678  1.00 86.32  ? 199  ARG B C     1 
ATOM   7109  O  O     . ARG F 3 199 ? 33.554 54.861  50.247  1.00 86.72  ? 199  ARG B O     1 
ATOM   7110  C  CB    . ARG F 3 199 ? 35.913 53.283  49.091  1.00 83.94  ? 199  ARG B CB    1 
ATOM   7111  C  CG    . ARG F 3 199 ? 37.055 53.388  50.069  1.00 85.21  ? 199  ARG B CG    1 
ATOM   7112  C  CD    . ARG F 3 199 ? 38.190 54.206  49.512  1.00 85.40  ? 199  ARG B CD    1 
ATOM   7113  N  NE    . ARG F 3 199 ? 37.791 55.592  49.310  1.00 89.28  ? 199  ARG B NE    1 
ATOM   7114  C  CZ    . ARG F 3 199 ? 38.647 56.594  49.137  1.00 95.91  ? 199  ARG B CZ    1 
ATOM   7115  N  NH1   . ARG F 3 199 ? 39.957 56.362  49.145  1.00 97.02  ? 199  ARG B NH1   1 
ATOM   7116  N  NH2   . ARG F 3 199 ? 38.192 57.828  48.951  1.00 96.42  ? 199  ARG B NH2   1 
ATOM   7117  N  N     . THR F 3 200 ? 34.263 53.590  51.972  1.00 88.70  ? 200  THR B N     1 
ATOM   7118  C  CA    . THR F 3 200 ? 33.823 54.511  53.008  1.00 90.15  ? 200  THR B CA    1 
ATOM   7119  C  C     . THR F 3 200 ? 35.030 54.910  53.841  1.00 90.05  ? 200  THR B C     1 
ATOM   7120  O  O     . THR F 3 200 ? 36.140 55.032  53.324  1.00 90.45  ? 200  THR B O     1 
ATOM   7121  C  CB    . THR F 3 200 ? 32.782 53.864  53.944  1.00 89.16  ? 200  THR B CB    1 
ATOM   7122  O  OG1   . THR F 3 200 ? 33.397 52.789  54.664  1.00 86.75  ? 200  THR B OG1   1 
ATOM   7123  C  CG2   . THR F 3 200 ? 31.591 53.335  53.149  1.00 83.64  ? 200  THR B CG2   1 
ATOM   7124  N  N     . LYS F 3 201 ? 34.800 55.095  55.135  1.00 88.59  ? 201  LYS B N     1 
ATOM   7125  C  CA    . LYS F 3 201 ? 35.837 55.492  56.078  1.00 87.82  ? 201  LYS B CA    1 
ATOM   7126  C  C     . LYS F 3 201 ? 36.404 54.279  56.806  1.00 90.82  ? 201  LYS B C     1 
ATOM   7127  O  O     . LYS F 3 201 ? 37.618 54.118  56.937  1.00 90.94  ? 201  LYS B O     1 
ATOM   7128  C  CB    . LYS F 3 201 ? 35.237 56.487  57.075  1.00 75.30  ? 201  LYS B CB    1 
ATOM   7129  C  CG    . LYS F 3 201 ? 35.994 56.672  58.373  1.00 65.81  ? 201  LYS B CG    1 
ATOM   7130  C  CD    . LYS F 3 201 ? 35.282 57.719  59.229  1.00 64.75  ? 201  LYS B CD    1 
ATOM   7131  C  CE    . LYS F 3 201 ? 35.770 57.738  60.666  1.00 54.07  ? 201  LYS B CE    1 
ATOM   7132  N  NZ    . LYS F 3 201 ? 37.234 57.887  60.725  1.00 55.52  ? 201  LYS B NZ    1 
ATOM   7133  N  N     . THR F 3 202 ? 35.504 53.422  57.266  1.00 93.22  ? 202  THR B N     1 
ATOM   7134  C  CA    . THR F 3 202 ? 35.870 52.219  57.996  1.00 92.77  ? 202  THR B CA    1 
ATOM   7135  C  C     . THR F 3 202 ? 36.340 51.094  57.084  1.00 91.64  ? 202  THR B C     1 
ATOM   7136  O  O     . THR F 3 202 ? 37.279 50.366  57.409  1.00 90.06  ? 202  THR B O     1 
ATOM   7137  C  CB    . THR F 3 202 ? 34.670 51.695  58.783  1.00 94.01  ? 202  THR B CB    1 
ATOM   7138  O  OG1   . THR F 3 202 ? 33.661 51.262  57.860  1.00 91.57  ? 202  THR B OG1   1 
ATOM   7139  C  CG2   . THR F 3 202 ? 34.093 52.792  59.673  1.00 93.14  ? 202  THR B CG2   1 
ATOM   7140  N  N     . LEU F 3 203 ? 35.677 50.960  55.941  1.00 92.41  ? 203  LEU B N     1 
ATOM   7141  C  CA    . LEU F 3 203 ? 35.983 49.901  54.987  1.00 93.56  ? 203  LEU B CA    1 
ATOM   7142  C  C     . LEU F 3 203 ? 36.478 50.424  53.630  1.00 93.39  ? 203  LEU B C     1 
ATOM   7143  O  O     . LEU F 3 203 ? 36.175 51.550  53.230  1.00 92.17  ? 203  LEU B O     1 
ATOM   7144  C  CB    . LEU F 3 203 ? 34.721 49.042  54.796  1.00 91.89  ? 203  LEU B CB    1 
ATOM   7145  C  CG    . LEU F 3 203 ? 34.744 47.707  54.039  1.00 87.96  ? 203  LEU B CG    1 
ATOM   7146  C  CD1   . LEU F 3 203 ? 35.602 46.682  54.795  1.00 86.91  ? 203  LEU B CD1   1 
ATOM   7147  C  CD2   . LEU F 3 203 ? 33.312 47.194  53.887  1.00 80.35  ? 203  LEU B CD2   1 
ATOM   7148  N  N     . VAL F 3 204 ? 37.250 49.594  52.936  1.00 92.53  ? 204  VAL B N     1 
ATOM   7149  C  CA    . VAL F 3 204 ? 37.779 49.924  51.616  1.00 91.99  ? 204  VAL B CA    1 
ATOM   7150  C  C     . VAL F 3 204 ? 37.936 48.600  50.862  1.00 93.08  ? 204  VAL B C     1 
ATOM   7151  O  O     . VAL F 3 204 ? 39.021 48.021  50.807  1.00 90.60  ? 204  VAL B O     1 
ATOM   7152  C  CB    . VAL F 3 204 ? 39.143 50.668  51.722  1.00 84.22  ? 204  VAL B CB    1 
ATOM   7153  C  CG1   . VAL F 3 204 ? 40.184 49.790  52.405  1.00 79.02  ? 204  VAL B CG1   1 
ATOM   7154  C  CG2   . VAL F 3 204 ? 39.615 51.089  50.342  1.00 71.63  ? 204  VAL B CG2   1 
ATOM   7155  N  N     . SER F 3 205 ? 36.835 48.120  50.286  1.00 93.54  ? 205  SER B N     1 
ATOM   7156  C  CA    . SER F 3 205 ? 36.847 46.843  49.578  1.00 97.22  ? 205  SER B CA    1 
ATOM   7157  C  C     . SER F 3 205 ? 36.040 46.776  48.285  1.00 98.49  ? 205  SER B C     1 
ATOM   7158  O  O     . SER F 3 205 ? 35.282 47.686  47.952  1.00 99.45  ? 205  SER B O     1 
ATOM   7159  C  CB    . SER F 3 205 ? 36.363 45.737  50.519  1.00 99.18  ? 205  SER B CB    1 
ATOM   7160  O  OG    . SER F 3 205 ? 36.216 44.503  49.834  1.00 100.09 ? 205  SER B OG    1 
ATOM   7161  N  N     . THR F 3 206 ? 36.209 45.662  47.578  1.00 98.46  ? 206  THR B N     1 
ATOM   7162  C  CA    . THR F 3 206 ? 35.534 45.406  46.311  1.00 95.54  ? 206  THR B CA    1 
ATOM   7163  C  C     . THR F 3 206 ? 34.138 44.806  46.472  1.00 94.39  ? 206  THR B C     1 
ATOM   7164  O  O     . THR F 3 206 ? 33.386 44.708  45.500  1.00 92.88  ? 206  THR B O     1 
ATOM   7165  C  CB    . THR F 3 206 ? 36.365 44.454  45.448  1.00 93.23  ? 206  THR B CB    1 
ATOM   7166  O  OG1   . THR F 3 206 ? 36.678 43.280  46.209  1.00 88.93  ? 206  THR B OG1   1 
ATOM   7167  C  CG2   . THR F 3 206 ? 37.652 45.130  45.004  1.00 93.12  ? 206  THR B CG2   1 
ATOM   7168  N  N     . ALA F 3 207 ? 33.797 44.395  47.691  1.00 93.06  ? 207  ALA B N     1 
ATOM   7169  C  CA    . ALA F 3 207 ? 32.479 43.816  47.952  1.00 91.57  ? 207  ALA B CA    1 
ATOM   7170  C  C     . ALA F 3 207 ? 31.456 44.914  48.263  1.00 90.91  ? 207  ALA B C     1 
ATOM   7171  O  O     . ALA F 3 207 ? 30.290 44.827  47.858  1.00 87.99  ? 207  ALA B O     1 
ATOM   7172  C  CB    . ALA F 3 207 ? 32.560 42.828  49.114  1.00 87.89  ? 207  ALA B CB    1 
ATOM   7173  N  N     . GLY F 3 208 ? 31.912 45.946  48.976  1.00 90.38  ? 208  GLY B N     1 
ATOM   7174  C  CA    . GLY F 3 208 ? 31.054 47.061  49.347  1.00 88.61  ? 208  GLY B CA    1 
ATOM   7175  C  C     . GLY F 3 208 ? 29.715 46.642  49.925  1.00 86.89  ? 208  GLY B C     1 
ATOM   7176  O  O     . GLY F 3 208 ? 29.449 45.459  50.121  1.00 86.53  ? 208  GLY B O     1 
ATOM   7177  N  N     . VAL F 3 209 ? 28.862 47.618  50.201  1.00 83.58  ? 209  VAL B N     1 
ATOM   7178  C  CA    . VAL F 3 209 ? 27.546 47.330  50.744  1.00 78.46  ? 209  VAL B CA    1 
ATOM   7179  C  C     . VAL F 3 209 ? 26.492 48.053  49.908  1.00 75.65  ? 209  VAL B C     1 
ATOM   7180  O  O     . VAL F 3 209 ? 26.828 48.874  49.063  1.00 75.61  ? 209  VAL B O     1 
ATOM   7181  C  CB    . VAL F 3 209 ? 27.459 47.778  52.216  1.00 79.27  ? 209  VAL B CB    1 
ATOM   7182  C  CG1   . VAL F 3 209 ? 27.657 49.281  52.312  1.00 70.81  ? 209  VAL B CG1   1 
ATOM   7183  C  CG2   . VAL F 3 209 ? 26.126 47.346  52.821  1.00 80.67  ? 209  VAL B CG2   1 
ATOM   7184  N  N     . GLU F 3 210 ? 25.222 47.740  50.130  1.00 73.72  ? 210  GLU B N     1 
ATOM   7185  C  CA    . GLU F 3 210 ? 24.141 48.375  49.385  1.00 71.84  ? 210  GLU B CA    1 
ATOM   7186  C  C     . GLU F 3 210 ? 23.215 49.173  50.305  1.00 69.07  ? 210  GLU B C     1 
ATOM   7187  O  O     . GLU F 3 210 ? 22.782 48.677  51.347  1.00 70.18  ? 210  GLU B O     1 
ATOM   7188  C  CB    . GLU F 3 210 ? 23.314 47.317  48.650  1.00 78.19  ? 210  GLU B CB    1 
ATOM   7189  C  CG    . GLU F 3 210 ? 24.089 46.470  47.660  1.00 90.80  ? 210  GLU B CG    1 
ATOM   7190  C  CD    . GLU F 3 210 ? 24.504 47.241  46.422  1.00 97.15  ? 210  GLU B CD    1 
ATOM   7191  O  OE1   . GLU F 3 210 ? 25.106 46.622  45.513  1.00 94.88  ? 210  GLU B OE1   1 
ATOM   7192  O  OE2   . GLU F 3 210 ? 24.229 48.462  46.354  1.00 102.22 ? 210  GLU B OE2   1 
ATOM   7193  N  N     . LYS F 3 211 ? 22.916 50.407  49.909  1.00 65.42  ? 211  LYS B N     1 
ATOM   7194  C  CA    . LYS F 3 211 ? 22.024 51.279  50.670  1.00 61.36  ? 211  LYS B CA    1 
ATOM   7195  C  C     . LYS F 3 211 ? 20.803 51.551  49.797  1.00 58.78  ? 211  LYS B C     1 
ATOM   7196  O  O     . LYS F 3 211 ? 20.937 52.106  48.712  1.00 60.54  ? 211  LYS B O     1 
ATOM   7197  C  CB    . LYS F 3 211 ? 22.722 52.605  51.012  1.00 58.42  ? 211  LYS B CB    1 
ATOM   7198  C  CG    . LYS F 3 211 ? 23.864 52.512  52.032  1.00 57.78  ? 211  LYS B CG    1 
ATOM   7199  C  CD    . LYS F 3 211 ? 23.338 52.179  53.431  1.00 66.15  ? 211  LYS B CD    1 
ATOM   7200  C  CE    . LYS F 3 211 ? 24.366 52.472  54.531  1.00 69.78  ? 211  LYS B CE    1 
ATOM   7201  N  NZ    . LYS F 3 211 ? 25.615 51.653  54.435  1.00 69.44  ? 211  LYS B NZ    1 
ATOM   7202  N  N     . ALA F 3 212 ? 19.622 51.155  50.259  1.00 56.90  ? 212  ALA B N     1 
ATOM   7203  C  CA    . ALA F 3 212 ? 18.398 51.355  49.490  1.00 54.97  ? 212  ALA B CA    1 
ATOM   7204  C  C     . ALA F 3 212 ? 17.599 52.557  49.989  1.00 53.85  ? 212  ALA B C     1 
ATOM   7205  O  O     . ALA F 3 212 ? 17.578 52.841  51.182  1.00 51.08  ? 212  ALA B O     1 
ATOM   7206  C  CB    . ALA F 3 212 ? 17.545 50.104  49.550  1.00 51.40  ? 212  ALA B CB    1 
ATOM   7207  N  N     . LEU F 3 213 ? 16.934 53.257  49.072  1.00 54.34  ? 213  LEU B N     1 
ATOM   7208  C  CA    . LEU F 3 213 ? 16.145 54.432  49.439  1.00 55.41  ? 213  LEU B CA    1 
ATOM   7209  C  C     . LEU F 3 213 ? 14.647 54.143  49.464  1.00 57.69  ? 213  LEU B C     1 
ATOM   7210  O  O     . LEU F 3 213 ? 14.181 53.179  48.862  1.00 59.07  ? 213  LEU B O     1 
ATOM   7211  C  CB    . LEU F 3 213 ? 16.409 55.569  48.453  1.00 49.27  ? 213  LEU B CB    1 
ATOM   7212  C  CG    . LEU F 3 213 ? 17.824 55.693  47.907  1.00 49.23  ? 213  LEU B CG    1 
ATOM   7213  C  CD1   . LEU F 3 213 ? 17.984 57.014  47.180  1.00 54.62  ? 213  LEU B CD1   1 
ATOM   7214  C  CD2   . LEU F 3 213 ? 18.798 55.620  49.042  1.00 51.23  ? 213  LEU B CD2   1 
ATOM   7215  N  N     . SER F 3 214 ? 13.895 54.994  50.155  1.00 60.82  ? 214  SER B N     1 
ATOM   7216  C  CA    . SER F 3 214 ? 12.447 54.840  50.241  1.00 63.07  ? 214  SER B CA    1 
ATOM   7217  C  C     . SER F 3 214 ? 11.819 55.140  48.878  1.00 66.04  ? 214  SER B C     1 
ATOM   7218  O  O     . SER F 3 214 ? 12.503 55.600  47.955  1.00 67.71  ? 214  SER B O     1 
ATOM   7219  C  CB    . SER F 3 214 ? 11.867 55.793  51.298  1.00 62.73  ? 214  SER B CB    1 
ATOM   7220  O  OG    . SER F 3 214 ? 12.080 57.159  50.964  1.00 54.48  ? 214  SER B OG    1 
ATOM   7221  N  N     . LEU F 3 215 ? 10.521 54.877  48.747  1.00 67.37  ? 215  LEU B N     1 
ATOM   7222  C  CA    . LEU F 3 215 ? 9.833  55.139  47.491  1.00 65.85  ? 215  LEU B CA    1 
ATOM   7223  C  C     . LEU F 3 215 ? 9.757  56.636  47.249  1.00 66.66  ? 215  LEU B C     1 
ATOM   7224  O  O     . LEU F 3 215 ? 9.905  57.103  46.118  1.00 68.61  ? 215  LEU B O     1 
ATOM   7225  C  CB    . LEU F 3 215 ? 8.426  54.544  47.514  1.00 61.87  ? 215  LEU B CB    1 
ATOM   7226  C  CG    . LEU F 3 215 ? 8.365  53.015  47.437  1.00 57.39  ? 215  LEU B CG    1 
ATOM   7227  C  CD1   . LEU F 3 215 ? 6.922  52.557  47.559  1.00 62.17  ? 215  LEU B CD1   1 
ATOM   7228  C  CD2   . LEU F 3 215 ? 8.968  52.534  46.124  1.00 35.18  ? 215  LEU B CD2   1 
ATOM   7229  N  N     . GLY F 3 216 ? 9.534  57.386  48.322  1.00 64.75  ? 216  GLY B N     1 
ATOM   7230  C  CA    . GLY F 3 216 ? 9.448  58.828  48.205  1.00 64.26  ? 216  GLY B CA    1 
ATOM   7231  C  C     . GLY F 3 216 ? 10.775 59.461  47.829  1.00 63.03  ? 216  GLY B C     1 
ATOM   7232  O  O     . GLY F 3 216 ? 10.814 60.429  47.074  1.00 62.70  ? 216  GLY B O     1 
ATOM   7233  N  N     . VAL F 3 217 ? 11.869 58.928  48.361  1.00 61.50  ? 217  VAL B N     1 
ATOM   7234  C  CA    . VAL F 3 217 ? 13.182 59.471  48.054  1.00 59.68  ? 217  VAL B CA    1 
ATOM   7235  C  C     . VAL F 3 217 ? 13.658 58.923  46.722  1.00 63.07  ? 217  VAL B C     1 
ATOM   7236  O  O     . VAL F 3 217 ? 14.275 59.643  45.933  1.00 63.08  ? 217  VAL B O     1 
ATOM   7237  C  CB    . VAL F 3 217 ? 14.209 59.132  49.167  1.00 50.42  ? 217  VAL B CB    1 
ATOM   7238  C  CG1   . VAL F 3 217 ? 15.619 59.182  48.623  1.00 46.10  ? 217  VAL B CG1   1 
ATOM   7239  C  CG2   . VAL F 3 217 ? 14.089 60.127  50.289  1.00 39.24  ? 217  VAL B CG2   1 
ATOM   7240  N  N     . THR F 3 218 ? 13.366 57.652  46.460  1.00 64.81  ? 218  THR B N     1 
ATOM   7241  C  CA    . THR F 3 218 ? 13.783 57.051  45.198  1.00 67.88  ? 218  THR B CA    1 
ATOM   7242  C  C     . THR F 3 218 ? 13.192 57.924  44.087  1.00 68.70  ? 218  THR B C     1 
ATOM   7243  O  O     . THR F 3 218 ? 13.768 58.073  43.010  1.00 65.44  ? 218  THR B O     1 
ATOM   7244  C  CB    . THR F 3 218 ? 13.270 55.587  45.069  1.00 66.25  ? 218  THR B CB    1 
ATOM   7245  O  OG1   . THR F 3 218 ? 14.098 54.862  44.149  1.00 66.83  ? 218  THR B OG1   1 
ATOM   7246  C  CG2   . THR F 3 218 ? 11.839 55.564  44.554  1.00 69.92  ? 218  THR B CG2   1 
ATOM   7247  N  N     . LYS F 3 219 ? 12.042 58.516  44.393  1.00 70.11  ? 219  LYS B N     1 
ATOM   7248  C  CA    . LYS F 3 219 ? 11.328 59.393  43.476  1.00 70.88  ? 219  LYS B CA    1 
ATOM   7249  C  C     . LYS F 3 219 ? 12.066 60.722  43.317  1.00 69.30  ? 219  LYS B C     1 
ATOM   7250  O  O     . LYS F 3 219 ? 12.323 61.167  42.200  1.00 68.94  ? 219  LYS B O     1 
ATOM   7251  C  CB    . LYS F 3 219 ? 9.905  59.631  44.003  1.00 74.86  ? 219  LYS B CB    1 
ATOM   7252  C  CG    . LYS F 3 219 ? 9.101  60.672  43.243  1.00 82.85  ? 219  LYS B CG    1 
ATOM   7253  C  CD    . LYS F 3 219 ? 7.670  60.769  43.772  1.00 88.99  ? 219  LYS B CD    1 
ATOM   7254  C  CE    . LYS F 3 219 ? 6.889  61.908  43.100  1.00 97.43  ? 219  LYS B CE    1 
ATOM   7255  N  NZ    . LYS F 3 219 ? 6.771  61.771  41.610  1.00 98.43  ? 219  LYS B NZ    1 
ATOM   7256  N  N     . LEU F 3 220 ? 12.405 61.355  44.434  1.00 68.52  ? 220  LEU B N     1 
ATOM   7257  C  CA    . LEU F 3 220 ? 13.118 62.621  44.372  1.00 66.06  ? 220  LEU B CA    1 
ATOM   7258  C  C     . LEU F 3 220 ? 14.380 62.445  43.544  1.00 69.04  ? 220  LEU B C     1 
ATOM   7259  O  O     . LEU F 3 220 ? 14.685 63.269  42.681  1.00 68.92  ? 220  LEU B O     1 
ATOM   7260  C  CB    . LEU F 3 220 ? 13.516 63.114  45.764  1.00 62.18  ? 220  LEU B CB    1 
ATOM   7261  C  CG    . LEU F 3 220 ? 12.441 63.429  46.800  1.00 66.50  ? 220  LEU B CG    1 
ATOM   7262  C  CD1   . LEU F 3 220 ? 13.079 64.305  47.869  1.00 61.91  ? 220  LEU B CD1   1 
ATOM   7263  C  CD2   . LEU F 3 220 ? 11.253 64.154  46.166  1.00 70.15  ? 220  LEU B CD2   1 
ATOM   7264  N  N     . VAL F 3 221 ? 15.116 61.369  43.808  1.00 68.96  ? 221  VAL B N     1 
ATOM   7265  C  CA    . VAL F 3 221 ? 16.342 61.112  43.076  1.00 69.48  ? 221  VAL B CA    1 
ATOM   7266  C  C     . VAL F 3 221 ? 16.039 60.994  41.590  1.00 71.96  ? 221  VAL B C     1 
ATOM   7267  O  O     . VAL F 3 221 ? 16.723 61.594  40.765  1.00 72.57  ? 221  VAL B O     1 
ATOM   7268  C  CB    . VAL F 3 221 ? 17.017 59.826  43.560  1.00 64.03  ? 221  VAL B CB    1 
ATOM   7269  C  CG1   . VAL F 3 221 ? 18.331 59.628  42.837  1.00 59.43  ? 221  VAL B CG1   1 
ATOM   7270  C  CG2   . VAL F 3 221 ? 17.249 59.905  45.045  1.00 62.67  ? 221  VAL B CG2   1 
ATOM   7271  N  N     . GLU F 3 222 ? 15.006 60.233  41.247  1.00 75.30  ? 222  GLU B N     1 
ATOM   7272  C  CA    . GLU F 3 222 ? 14.640 60.064  39.844  1.00 77.20  ? 222  GLU B CA    1 
ATOM   7273  C  C     . GLU F 3 222 ? 14.466 61.413  39.167  1.00 77.27  ? 222  GLU B C     1 
ATOM   7274  O  O     . GLU F 3 222 ? 15.061 61.668  38.116  1.00 78.16  ? 222  GLU B O     1 
ATOM   7275  C  CB    . GLU F 3 222 ? 13.341 59.258  39.704  1.00 82.24  ? 222  GLU B CB    1 
ATOM   7276  C  CG    . GLU F 3 222 ? 13.472 57.789  40.090  1.00 90.71  ? 222  GLU B CG    1 
ATOM   7277  C  CD    . GLU F 3 222 ? 12.307 56.937  39.602  1.00 95.95  ? 222  GLU B CD    1 
ATOM   7278  O  OE1   . GLU F 3 222 ? 11.144 57.228  39.986  1.00 95.47  ? 222  GLU B OE1   1 
ATOM   7279  O  OE2   . GLU F 3 222 ? 12.562 55.976  38.832  1.00 90.94  ? 222  GLU B OE2   1 
ATOM   7280  N  N     . ARG F 3 223 ? 13.663 62.281  39.776  1.00 74.45  ? 223  ARG B N     1 
ATOM   7281  C  CA    . ARG F 3 223 ? 13.419 63.596  39.206  1.00 71.39  ? 223  ARG B CA    1 
ATOM   7282  C  C     . ARG F 3 223 ? 14.686 64.401  38.935  1.00 70.28  ? 223  ARG B C     1 
ATOM   7283  O  O     . ARG F 3 223 ? 14.763 65.100  37.930  1.00 70.39  ? 223  ARG B O     1 
ATOM   7284  C  CB    . ARG F 3 223 ? 12.469 64.408  40.089  1.00 67.12  ? 223  ARG B CB    1 
ATOM   7285  C  CG    . ARG F 3 223 ? 12.304 65.837  39.604  1.00 70.05  ? 223  ARG B CG    1 
ATOM   7286  C  CD    . ARG F 3 223 ? 11.043 66.490  40.122  1.00 75.54  ? 223  ARG B CD    1 
ATOM   7287  N  NE    . ARG F 3 223 ? 10.974 67.884  39.695  1.00 84.73  ? 223  ARG B NE    1 
ATOM   7288  C  CZ    . ARG F 3 223 ? 9.955  68.699  39.946  1.00 91.44  ? 223  ARG B CZ    1 
ATOM   7289  N  NH1   . ARG F 3 223 ? 8.903  68.260  40.626  1.00 96.10  ? 223  ARG B NH1   1 
ATOM   7290  N  NH2   . ARG F 3 223 ? 9.991  69.959  39.524  1.00 93.49  ? 223  ARG B NH2   1 
ATOM   7291  N  N     . TRP F 3 224 ? 15.680 64.321  39.812  1.00 68.25  ? 224  TRP B N     1 
ATOM   7292  C  CA    . TRP F 3 224 ? 16.905 65.069  39.563  1.00 68.14  ? 224  TRP B CA    1 
ATOM   7293  C  C     . TRP F 3 224 ? 17.767 64.396  38.512  1.00 69.98  ? 224  TRP B C     1 
ATOM   7294  O  O     . TRP F 3 224 ? 18.577 65.048  37.861  1.00 68.87  ? 224  TRP B O     1 
ATOM   7295  C  CB    . TRP F 3 224 ? 17.727 65.237  40.832  1.00 59.06  ? 224  TRP B CB    1 
ATOM   7296  C  CG    . TRP F 3 224 ? 19.192 65.342  40.551  1.00 58.07  ? 224  TRP B CG    1 
ATOM   7297  C  CD1   . TRP F 3 224 ? 20.114 64.344  40.654  1.00 57.95  ? 224  TRP B CD1   1 
ATOM   7298  C  CD2   . TRP F 3 224 ? 19.902 66.500  40.103  1.00 61.68  ? 224  TRP B CD2   1 
ATOM   7299  N  NE1   . TRP F 3 224 ? 21.355 64.807  40.305  1.00 60.44  ? 224  TRP B NE1   1 
ATOM   7300  C  CE2   . TRP F 3 224 ? 21.254 66.130  39.962  1.00 63.32  ? 224  TRP B CE2   1 
ATOM   7301  C  CE3   . TRP F 3 224 ? 19.528 67.814  39.806  1.00 59.87  ? 224  TRP B CE3   1 
ATOM   7302  C  CZ2   . TRP F 3 224 ? 22.238 67.030  39.539  1.00 61.21  ? 224  TRP B CZ2   1 
ATOM   7303  C  CZ3   . TRP F 3 224 ? 20.506 68.707  39.386  1.00 54.91  ? 224  TRP B CZ3   1 
ATOM   7304  C  CH2   . TRP F 3 224 ? 21.843 68.310  39.258  1.00 55.92  ? 224  TRP B CH2   1 
ATOM   7305  N  N     . ILE F 3 225 ? 17.606 63.087  38.359  1.00 70.33  ? 225  ILE B N     1 
ATOM   7306  C  CA    . ILE F 3 225 ? 18.384 62.357  37.372  1.00 72.00  ? 225  ILE B CA    1 
ATOM   7307  C  C     . ILE F 3 225 ? 17.949 62.802  35.982  1.00 75.19  ? 225  ILE B C     1 
ATOM   7308  O  O     . ILE F 3 225 ? 18.790 63.084  35.122  1.00 76.57  ? 225  ILE B O     1 
ATOM   7309  C  CB    . ILE F 3 225 ? 18.192 60.815  37.512  1.00 67.56  ? 225  ILE B CB    1 
ATOM   7310  C  CG1   . ILE F 3 225 ? 18.877 60.320  38.787  1.00 67.35  ? 225  ILE B CG1   1 
ATOM   7311  C  CG2   . ILE F 3 225 ? 18.792 60.083  36.307  1.00 58.73  ? 225  ILE B CG2   1 
ATOM   7312  C  CD1   . ILE F 3 225 ? 18.823 58.808  38.972  1.00 63.38  ? 225  ILE B CD1   1 
ATOM   7313  N  N     . SER F 3 226 ? 16.638 62.884  35.771  1.00 74.95  ? 226  SER B N     1 
ATOM   7314  C  CA    . SER F 3 226 ? 16.110 63.282  34.472  1.00 74.41  ? 226  SER B CA    1 
ATOM   7315  C  C     . SER F 3 226 ? 16.387 64.748  34.175  1.00 74.25  ? 226  SER B C     1 
ATOM   7316  O  O     . SER F 3 226 ? 17.046 65.083  33.194  1.00 74.34  ? 226  SER B O     1 
ATOM   7317  C  CB    . SER F 3 226 ? 14.602 63.039  34.408  1.00 76.80  ? 226  SER B CB    1 
ATOM   7318  O  OG    . SER F 3 226 ? 13.886 64.113  34.995  1.00 71.21  ? 226  SER B OG    1 
ATOM   7319  N  N     . VAL F 3 227 ? 15.886 65.618  35.040  1.00 71.34  ? 227  VAL B N     1 
ATOM   7320  C  CA    . VAL F 3 227 ? 16.046 67.051  34.874  1.00 68.96  ? 227  VAL B CA    1 
ATOM   7321  C  C     . VAL F 3 227 ? 17.488 67.564  34.838  1.00 69.04  ? 227  VAL B C     1 
ATOM   7322  O  O     . VAL F 3 227 ? 17.726 68.694  34.424  1.00 68.91  ? 227  VAL B O     1 
ATOM   7323  C  CB    . VAL F 3 227 ? 15.291 67.794  35.991  1.00 67.36  ? 227  VAL B CB    1 
ATOM   7324  C  CG1   . VAL F 3 227 ? 15.386 69.294  35.785  1.00 64.76  ? 227  VAL B CG1   1 
ATOM   7325  C  CG2   . VAL F 3 227 ? 13.838 67.351  36.013  1.00 62.65  ? 227  VAL B CG2   1 
ATOM   7326  N  N     . SER F 3 228 ? 18.450 66.744  35.251  1.00 69.97  ? 228  SER B N     1 
ATOM   7327  C  CA    . SER F 3 228 ? 19.846 67.184  35.284  1.00 70.98  ? 228  SER B CA    1 
ATOM   7328  C  C     . SER F 3 228 ? 20.705 66.719  34.125  1.00 69.90  ? 228  SER B C     1 
ATOM   7329  O  O     . SER F 3 228 ? 21.696 67.360  33.803  1.00 66.53  ? 228  SER B O     1 
ATOM   7330  C  CB    . SER F 3 228 ? 20.513 66.734  36.578  1.00 75.50  ? 228  SER B CB    1 
ATOM   7331  O  OG    . SER F 3 228 ? 20.766 65.341  36.540  1.00 76.18  ? 228  SER B OG    1 
ATOM   7332  N  N     . GLY F 3 229 ? 20.361 65.591  33.521  1.00 72.00  ? 229  GLY B N     1 
ATOM   7333  C  CA    . GLY F 3 229 ? 21.144 65.117  32.393  1.00 77.59  ? 229  GLY B CA    1 
ATOM   7334  C  C     . GLY F 3 229 ? 22.369 64.271  32.704  1.00 79.92  ? 229  GLY B C     1 
ATOM   7335  O  O     . GLY F 3 229 ? 23.093 63.865  31.793  1.00 79.88  ? 229  GLY B O     1 
ATOM   7336  N  N     . VAL F 3 230 ? 22.614 64.001  33.980  1.00 81.51  ? 230  VAL B N     1 
ATOM   7337  C  CA    . VAL F 3 230 ? 23.756 63.180  34.365  1.00 79.56  ? 230  VAL B CA    1 
ATOM   7338  C  C     . VAL F 3 230 ? 23.639 61.775  33.763  1.00 80.81  ? 230  VAL B C     1 
ATOM   7339  O  O     . VAL F 3 230 ? 24.641 61.089  33.550  1.00 77.46  ? 230  VAL B O     1 
ATOM   7340  C  CB    . VAL F 3 230 ? 23.835 63.037  35.900  1.00 75.33  ? 230  VAL B CB    1 
ATOM   7341  C  CG1   . VAL F 3 230 ? 24.368 64.314  36.522  1.00 74.23  ? 230  VAL B CG1   1 
ATOM   7342  C  CG2   . VAL F 3 230 ? 22.447 62.719  36.458  1.00 68.32  ? 230  VAL B CG2   1 
ATOM   7343  N  N     . ALA F 3 231 ? 22.401 61.371  33.486  1.00 81.97  ? 231  ALA B N     1 
ATOM   7344  C  CA    . ALA F 3 231 ? 22.083 60.052  32.944  1.00 85.37  ? 231  ALA B CA    1 
ATOM   7345  C  C     . ALA F 3 231 ? 22.617 59.693  31.554  1.00 89.91  ? 231  ALA B C     1 
ATOM   7346  O  O     . ALA F 3 231 ? 22.739 58.507  31.233  1.00 87.74  ? 231  ALA B O     1 
ATOM   7347  C  CB    . ALA F 3 231 ? 20.575 59.859  32.971  1.00 78.53  ? 231  ALA B CB    1 
ATOM   7348  N  N     . ASP F 3 232 ? 22.927 60.697  30.731  1.00 94.65  ? 232  ASP B N     1 
ATOM   7349  C  CA    . ASP F 3 232 ? 23.427 60.451  29.372  1.00 96.89  ? 232  ASP B CA    1 
ATOM   7350  C  C     . ASP F 3 232 ? 24.695 59.595  29.326  1.00 96.37  ? 232  ASP B C     1 
ATOM   7351  O  O     . ASP F 3 232 ? 25.038 59.027  28.285  1.00 95.88  ? 232  ASP B O     1 
ATOM   7352  C  CB    . ASP F 3 232 ? 23.654 61.777  28.634  1.00 101.36 ? 232  ASP B CB    1 
ATOM   7353  C  CG    . ASP F 3 232 ? 22.349 62.504  28.327  1.00 104.48 ? 232  ASP B CG    1 
ATOM   7354  O  OD1   . ASP F 3 232 ? 21.375 61.829  27.917  1.00 99.68  ? 232  ASP B OD1   1 
ATOM   7355  O  OD2   . ASP F 3 232 ? 22.295 63.744  28.488  1.00 105.30 ? 232  ASP B OD2   1 
ATOM   7356  N  N     . ASP F 3 233 ? 25.387 59.514  30.457  1.00 94.62  ? 233  ASP B N     1 
ATOM   7357  C  CA    . ASP F 3 233 ? 26.588 58.700  30.576  1.00 92.55  ? 233  ASP B CA    1 
ATOM   7358  C  C     . ASP F 3 233 ? 26.566 58.043  31.947  1.00 91.59  ? 233  ASP B C     1 
ATOM   7359  O  O     . ASP F 3 233 ? 26.423 58.719  32.968  1.00 92.19  ? 233  ASP B O     1 
ATOM   7360  C  CB    . ASP F 3 233 ? 27.854 59.538  30.437  1.00 89.67  ? 233  ASP B CB    1 
ATOM   7361  C  CG    . ASP F 3 233 ? 29.113 58.700  30.562  1.00 92.82  ? 233  ASP B CG    1 
ATOM   7362  O  OD1   . ASP F 3 233 ? 29.330 58.106  31.640  1.00 92.60  ? 233  ASP B OD1   1 
ATOM   7363  O  OD2   . ASP F 3 233 ? 29.882 58.627  29.581  1.00 91.84  ? 233  ASP B OD2   1 
ATOM   7364  N  N     . PRO F 3 234 ? 26.714 56.711  31.988  1.00 89.37  ? 234  PRO B N     1 
ATOM   7365  C  CA    . PRO F 3 234 ? 26.703 55.979  33.251  1.00 87.43  ? 234  PRO B CA    1 
ATOM   7366  C  C     . PRO F 3 234 ? 27.830 56.360  34.209  1.00 85.79  ? 234  PRO B C     1 
ATOM   7367  O  O     . PRO F 3 234 ? 27.599 56.485  35.411  1.00 86.83  ? 234  PRO B O     1 
ATOM   7368  C  CB    . PRO F 3 234 ? 26.780 54.525  32.796  1.00 86.99  ? 234  PRO B CB    1 
ATOM   7369  C  CG    . PRO F 3 234 ? 27.634 54.615  31.584  1.00 86.59  ? 234  PRO B CG    1 
ATOM   7370  C  CD    . PRO F 3 234 ? 27.044 55.811  30.871  1.00 88.69  ? 234  PRO B CD    1 
ATOM   7371  N  N     . ASN F 3 235 ? 29.040 56.551  33.688  1.00 82.64  ? 235  ASN B N     1 
ATOM   7372  C  CA    . ASN F 3 235 ? 30.178 56.907  34.535  1.00 78.10  ? 235  ASN B CA    1 
ATOM   7373  C  C     . ASN F 3 235 ? 30.127 58.318  35.105  1.00 75.52  ? 235  ASN B C     1 
ATOM   7374  O  O     . ASN F 3 235 ? 31.112 58.811  35.660  1.00 73.69  ? 235  ASN B O     1 
ATOM   7375  C  CB    . ASN F 3 235 ? 31.486 56.715  33.776  1.00 79.24  ? 235  ASN B CB    1 
ATOM   7376  C  CG    . ASN F 3 235 ? 31.917 55.265  33.730  1.00 77.94  ? 235  ASN B CG    1 
ATOM   7377  O  OD1   . ASN F 3 235 ? 32.988 54.908  34.233  1.00 75.87  ? 235  ASN B OD1   1 
ATOM   7378  N  ND2   . ASN F 3 235 ? 31.084 54.415  33.132  1.00 78.82  ? 235  ASN B ND2   1 
ATOM   7379  N  N     . ASN F 3 236 ? 28.974 58.961  34.967  1.00 73.26  ? 236  ASN B N     1 
ATOM   7380  C  CA    . ASN F 3 236 ? 28.768 60.306  35.488  1.00 72.85  ? 236  ASN B CA    1 
ATOM   7381  C  C     . ASN F 3 236 ? 28.510 60.268  36.994  1.00 70.31  ? 236  ASN B C     1 
ATOM   7382  O  O     . ASN F 3 236 ? 27.867 59.352  37.496  1.00 69.45  ? 236  ASN B O     1 
ATOM   7383  C  CB    . ASN F 3 236 ? 27.570 60.952  34.790  1.00 79.97  ? 236  ASN B CB    1 
ATOM   7384  C  CG    . ASN F 3 236 ? 27.966 61.758  33.573  1.00 81.79  ? 236  ASN B CG    1 
ATOM   7385  O  OD1   . ASN F 3 236 ? 28.886 61.396  32.840  1.00 84.54  ? 236  ASN B OD1   1 
ATOM   7386  N  ND2   . ASN F 3 236 ? 27.260 62.856  33.343  1.00 79.10  ? 236  ASN B ND2   1 
ATOM   7387  N  N     . TYR F 3 237 ? 29.021 61.256  37.718  1.00 67.08  ? 237  TYR B N     1 
ATOM   7388  C  CA    . TYR F 3 237 ? 28.781 61.315  39.150  1.00 63.61  ? 237  TYR B CA    1 
ATOM   7389  C  C     . TYR F 3 237 ? 27.348 61.820  39.341  1.00 62.89  ? 237  TYR B C     1 
ATOM   7390  O  O     . TYR F 3 237 ? 26.991 62.880  38.834  1.00 62.68  ? 237  TYR B O     1 
ATOM   7391  C  CB    . TYR F 3 237 ? 29.772 62.265  39.813  1.00 60.36  ? 237  TYR B CB    1 
ATOM   7392  C  CG    . TYR F 3 237 ? 31.172 61.711  39.958  1.00 58.08  ? 237  TYR B CG    1 
ATOM   7393  C  CD1   . TYR F 3 237 ? 32.262 62.380  39.412  1.00 57.05  ? 237  TYR B CD1   1 
ATOM   7394  C  CD2   . TYR F 3 237 ? 31.419 60.550  40.692  1.00 58.42  ? 237  TYR B CD2   1 
ATOM   7395  C  CE1   . TYR F 3 237 ? 33.570 61.914  39.595  1.00 55.29  ? 237  TYR B CE1   1 
ATOM   7396  C  CE2   . TYR F 3 237 ? 32.726 60.078  40.883  1.00 55.80  ? 237  TYR B CE2   1 
ATOM   7397  C  CZ    . TYR F 3 237 ? 33.794 60.770  40.331  1.00 53.80  ? 237  TYR B CZ    1 
ATOM   7398  O  OH    . TYR F 3 237 ? 35.088 60.352  40.534  1.00 49.12  ? 237  TYR B OH    1 
ATOM   7399  N  N     . LEU F 3 238 ? 26.533 61.057  40.066  1.00 60.10  ? 238  LEU B N     1 
ATOM   7400  C  CA    . LEU F 3 238 ? 25.133 61.408  40.303  1.00 56.80  ? 238  LEU B CA    1 
ATOM   7401  C  C     . LEU F 3 238 ? 24.862 62.892  40.578  1.00 59.19  ? 238  LEU B C     1 
ATOM   7402  O  O     . LEU F 3 238 ? 23.867 63.444  40.106  1.00 59.23  ? 238  LEU B O     1 
ATOM   7403  C  CB    . LEU F 3 238 ? 24.564 60.578  41.456  1.00 42.86  ? 238  LEU B CB    1 
ATOM   7404  C  CG    . LEU F 3 238 ? 23.061 60.806  41.664  1.00 44.02  ? 238  LEU B CG    1 
ATOM   7405  C  CD1   . LEU F 3 238 ? 22.303 60.076  40.577  1.00 33.66  ? 238  LEU B CD1   1 
ATOM   7406  C  CD2   . LEU F 3 238 ? 22.614 60.301  43.024  1.00 41.11  ? 238  LEU B CD2   1 
ATOM   7407  N  N     . PHE F 3 239 ? 25.729 63.532  41.354  1.00 60.05  ? 239  PHE B N     1 
ATOM   7408  C  CA    . PHE F 3 239 ? 25.547 64.945  41.661  1.00 62.60  ? 239  PHE B CA    1 
ATOM   7409  C  C     . PHE F 3 239 ? 26.648 65.766  41.030  1.00 65.45  ? 239  PHE B C     1 
ATOM   7410  O  O     . PHE F 3 239 ? 27.835 65.457  41.166  1.00 64.47  ? 239  PHE B O     1 
ATOM   7411  C  CB    . PHE F 3 239 ? 25.559 65.213  43.171  1.00 62.82  ? 239  PHE B CB    1 
ATOM   7412  C  CG    . PHE F 3 239 ? 24.399 64.614  43.918  1.00 59.37  ? 239  PHE B CG    1 
ATOM   7413  C  CD1   . PHE F 3 239 ? 24.480 63.336  44.443  1.00 52.11  ? 239  PHE B CD1   1 
ATOM   7414  C  CD2   . PHE F 3 239 ? 23.232 65.336  44.105  1.00 58.29  ? 239  PHE B CD2   1 
ATOM   7415  C  CE1   . PHE F 3 239 ? 23.427 62.796  45.144  1.00 52.36  ? 239  PHE B CE1   1 
ATOM   7416  C  CE2   . PHE F 3 239 ? 22.172 64.800  44.807  1.00 58.74  ? 239  PHE B CE2   1 
ATOM   7417  C  CZ    . PHE F 3 239 ? 22.268 63.526  45.326  1.00 59.04  ? 239  PHE B CZ    1 
ATOM   7418  N  N     . CYS F 3 240 ? 26.239 66.826  40.348  1.00 67.91  ? 240  CYS B N     1 
ATOM   7419  C  CA    . CYS F 3 240 ? 27.170 67.725  39.688  1.00 66.83  ? 240  CYS B CA    1 
ATOM   7420  C  C     . CYS F 3 240 ? 26.768 69.134  40.076  1.00 65.32  ? 240  CYS B C     1 
ATOM   7421  O  O     . CYS F 3 240 ? 25.845 69.328  40.877  1.00 62.90  ? 240  CYS B O     1 
ATOM   7422  C  CB    . CYS F 3 240 ? 27.062 67.562  38.180  1.00 66.31  ? 240  CYS B CB    1 
ATOM   7423  S  SG    . CYS F 3 240 ? 25.365 67.691  37.635  1.00 58.14  ? 240  CYS B SG    1 
ATOM   7424  N  N     . ARG F 3 241 ? 27.448 70.123  39.510  1.00 63.81  ? 241  ARG B N     1 
ATOM   7425  C  CA    . ARG F 3 241 ? 27.121 71.501  39.830  1.00 63.65  ? 241  ARG B CA    1 
ATOM   7426  C  C     . ARG F 3 241 ? 25.964 72.029  38.988  1.00 63.18  ? 241  ARG B C     1 
ATOM   7427  O  O     . ARG F 3 241 ? 25.439 71.343  38.113  1.00 64.28  ? 241  ARG B O     1 
ATOM   7428  C  CB    . ARG F 3 241 ? 28.361 72.384  39.667  1.00 61.42  ? 241  ARG B CB    1 
ATOM   7429  C  CG    . ARG F 3 241 ? 29.100 72.168  38.371  1.00 66.14  ? 241  ARG B CG    1 
ATOM   7430  C  CD    . ARG F 3 241 ? 30.561 72.594  38.497  1.00 70.56  ? 241  ARG B CD    1 
ATOM   7431  N  NE    . ARG F 3 241 ? 30.732 74.011  38.827  1.00 71.56  ? 241  ARG B NE    1 
ATOM   7432  C  CZ    . ARG F 3 241 ? 31.918 74.612  38.917  1.00 69.42  ? 241  ARG B CZ    1 
ATOM   7433  N  NH1   . ARG F 3 241 ? 33.033 73.918  38.704  1.00 62.85  ? 241  ARG B NH1   1 
ATOM   7434  N  NH2   . ARG F 3 241 ? 31.993 75.906  39.203  1.00 69.53  ? 241  ARG B NH2   1 
ATOM   7435  N  N     . VAL F 3 242 ? 25.559 73.252  39.286  1.00 63.92  ? 242  VAL B N     1 
ATOM   7436  C  CA    . VAL F 3 242 ? 24.476 73.907  38.579  1.00 62.86  ? 242  VAL B CA    1 
ATOM   7437  C  C     . VAL F 3 242 ? 24.876 75.377  38.487  1.00 66.53  ? 242  VAL B C     1 
ATOM   7438  O  O     . VAL F 3 242 ? 24.876 76.103  39.483  1.00 64.77  ? 242  VAL B O     1 
ATOM   7439  C  CB    . VAL F 3 242 ? 23.141 73.698  39.340  1.00 53.80  ? 242  VAL B CB    1 
ATOM   7440  C  CG1   . VAL F 3 242 ? 22.370 75.011  39.471  1.00 45.01  ? 242  VAL B CG1   1 
ATOM   7441  C  CG2   . VAL F 3 242 ? 22.304 72.651  38.610  1.00 47.11  ? 242  VAL B CG2   1 
ATOM   7442  N  N     . ARG F 3 243 ? 25.248 75.796  37.284  1.00 68.73  ? 243  ARG B N     1 
ATOM   7443  C  CA    . ARG F 3 243 ? 25.701 77.159  37.046  1.00 70.44  ? 243  ARG B CA    1 
ATOM   7444  C  C     . ARG F 3 243 ? 24.599 78.189  37.231  1.00 72.83  ? 243  ARG B C     1 
ATOM   7445  O  O     . ARG F 3 243 ? 23.415 77.862  37.161  1.00 75.30  ? 243  ARG B O     1 
ATOM   7446  C  CB    . ARG F 3 243 ? 26.331 77.235  35.654  1.00 60.40  ? 243  ARG B CB    1 
ATOM   7447  C  CG    . ARG F 3 243 ? 27.497 76.251  35.511  1.00 53.35  ? 243  ARG B CG    1 
ATOM   7448  C  CD    . ARG F 3 243 ? 27.982 76.067  34.087  1.00 50.91  ? 243  ARG B CD    1 
ATOM   7449  N  NE    . ARG F 3 243 ? 29.073 75.097  34.006  1.00 55.29  ? 243  ARG B NE    1 
ATOM   7450  C  CZ    . ARG F 3 243 ? 30.227 75.210  34.669  1.00 62.12  ? 243  ARG B CZ    1 
ATOM   7451  N  NH1   . ARG F 3 243 ? 30.438 76.260  35.468  1.00 61.52  ? 243  ARG B NH1   1 
ATOM   7452  N  NH2   . ARG F 3 243 ? 31.172 74.271  34.541  1.00 49.95  ? 243  ARG B NH2   1 
ATOM   7453  N  N     . LYS F 3 244 ? 25.005 79.429  37.483  1.00 74.63  ? 244  LYS B N     1 
ATOM   7454  C  CA    . LYS F 3 244 ? 24.077 80.536  37.730  1.00 76.83  ? 244  LYS B CA    1 
ATOM   7455  C  C     . LYS F 3 244 ? 22.787 80.598  36.900  1.00 77.62  ? 244  LYS B C     1 
ATOM   7456  O  O     . LYS F 3 244 ? 21.826 81.270  37.295  1.00 75.05  ? 244  LYS B O     1 
ATOM   7457  C  CB    . LYS F 3 244 ? 24.817 81.878  37.612  1.00 76.21  ? 244  LYS B CB    1 
ATOM   7458  C  CG    . LYS F 3 244 ? 25.585 82.086  36.302  1.00 76.44  ? 244  LYS B CG    1 
ATOM   7459  C  CD    . LYS F 3 244 ? 25.567 83.551  35.896  1.00 78.97  ? 244  LYS B CD    1 
ATOM   7460  C  CE    . LYS F 3 244 ? 26.039 84.444  37.030  1.00 82.23  ? 244  LYS B CE    1 
ATOM   7461  N  NZ    . LYS F 3 244 ? 25.362 85.774  37.008  1.00 74.10  ? 244  LYS B NZ    1 
ATOM   7462  N  N     . ASN F 3 245 ? 22.752 79.912  35.760  1.00 79.26  ? 245  ASN B N     1 
ATOM   7463  C  CA    . ASN F 3 245 ? 21.553 79.935  34.928  1.00 79.95  ? 245  ASN B CA    1 
ATOM   7464  C  C     . ASN F 3 245 ? 20.532 78.882  35.344  1.00 80.49  ? 245  ASN B C     1 
ATOM   7465  O  O     . ASN F 3 245 ? 19.346 79.181  35.487  1.00 80.35  ? 245  ASN B O     1 
ATOM   7466  C  CB    . ASN F 3 245 ? 21.913 79.765  33.444  1.00 81.71  ? 245  ASN B CB    1 
ATOM   7467  C  CG    . ASN F 3 245 ? 22.534 78.420  33.134  1.00 80.81  ? 245  ASN B CG    1 
ATOM   7468  O  OD1   . ASN F 3 245 ? 21.939 77.375  33.397  1.00 77.97  ? 245  ASN B OD1   1 
ATOM   7469  N  ND2   . ASN F 3 245 ? 23.735 78.438  32.554  1.00 77.99  ? 245  ASN B ND2   1 
ATOM   7470  N  N     . GLY F 3 246 ? 20.998 77.656  35.554  1.00 81.17  ? 246  GLY B N     1 
ATOM   7471  C  CA    . GLY F 3 246 ? 20.107 76.586  35.952  1.00 79.62  ? 246  GLY B CA    1 
ATOM   7472  C  C     . GLY F 3 246 ? 20.284 75.377  35.063  1.00 77.90  ? 246  GLY B C     1 
ATOM   7473  O  O     . GLY F 3 246 ? 19.327 74.898  34.465  1.00 77.14  ? 246  GLY B O     1 
ATOM   7474  N  N     . VAL F 3 247 ? 21.517 74.887  34.977  1.00 77.49  ? 247  VAL B N     1 
ATOM   7475  C  CA    . VAL F 3 247 ? 21.837 73.726  34.149  1.00 78.34  ? 247  VAL B CA    1 
ATOM   7476  C  C     . VAL F 3 247 ? 23.010 72.929  34.739  1.00 79.37  ? 247  VAL B C     1 
ATOM   7477  O  O     . VAL F 3 247 ? 24.093 73.476  34.993  1.00 77.64  ? 247  VAL B O     1 
ATOM   7478  C  CB    . VAL F 3 247 ? 22.188 74.156  32.694  1.00 79.05  ? 247  VAL B CB    1 
ATOM   7479  C  CG1   . VAL F 3 247 ? 22.501 72.926  31.838  1.00 73.40  ? 247  VAL B CG1   1 
ATOM   7480  C  CG2   . VAL F 3 247 ? 21.027 74.930  32.082  1.00 76.26  ? 247  VAL B CG2   1 
ATOM   7481  N  N     . ALA F 3 248 ? 22.782 71.632  34.949  1.00 79.93  ? 248  ALA B N     1 
ATOM   7482  C  CA    . ALA F 3 248 ? 23.789 70.733  35.517  1.00 79.68  ? 248  ALA B CA    1 
ATOM   7483  C  C     . ALA F 3 248 ? 25.047 70.676  34.668  1.00 79.29  ? 248  ALA B C     1 
ATOM   7484  O  O     . ALA F 3 248 ? 25.015 71.035  33.495  1.00 80.31  ? 248  ALA B O     1 
ATOM   7485  C  CB    . ALA F 3 248 ? 23.201 69.340  35.667  1.00 78.10  ? 248  ALA B CB    1 
ATOM   7486  N  N     . ALA F 3 249 ? 26.145 70.208  35.258  1.00 78.60  ? 249  ALA B N     1 
ATOM   7487  C  CA    . ALA F 3 249 ? 27.422 70.110  34.552  1.00 78.49  ? 249  ALA B CA    1 
ATOM   7488  C  C     . ALA F 3 249 ? 28.025 68.703  34.614  1.00 77.16  ? 249  ALA B C     1 
ATOM   7489  O  O     . ALA F 3 249 ? 29.203 68.544  34.934  1.00 74.90  ? 249  ALA B O     1 
ATOM   7490  C  CB    . ALA F 3 249 ? 28.403 71.108  35.141  1.00 74.72  ? 249  ALA B CB    1 
ATOM   7491  N  N     . PRO F 3 250 ? 27.232 67.674  34.284  1.00 76.14  ? 250  PRO B N     1 
ATOM   7492  C  CA    . PRO F 3 250 ? 27.640 66.265  34.295  1.00 76.21  ? 250  PRO B CA    1 
ATOM   7493  C  C     . PRO F 3 250 ? 29.109 65.990  33.941  1.00 75.94  ? 250  PRO B C     1 
ATOM   7494  O  O     . PRO F 3 250 ? 29.649 66.547  32.983  1.00 78.65  ? 250  PRO B O     1 
ATOM   7495  C  CB    . PRO F 3 250 ? 26.676 65.637  33.303  1.00 75.05  ? 250  PRO B CB    1 
ATOM   7496  C  CG    . PRO F 3 250 ? 25.448 66.433  33.506  1.00 74.89  ? 250  PRO B CG    1 
ATOM   7497  C  CD    . PRO F 3 250 ? 25.974 67.835  33.536  1.00 75.16  ? 250  PRO B CD    1 
ATOM   7498  N  N     . SER F 3 251 ? 29.740 65.114  34.723  1.00 74.38  ? 251  SER B N     1 
ATOM   7499  C  CA    . SER F 3 251 ? 31.141 64.747  34.520  1.00 72.89  ? 251  SER B CA    1 
ATOM   7500  C  C     . SER F 3 251 ? 31.430 63.267  34.798  1.00 73.39  ? 251  SER B C     1 
ATOM   7501  O  O     . SER F 3 251 ? 30.525 62.439  34.881  1.00 73.20  ? 251  SER B O     1 
ATOM   7502  C  CB    . SER F 3 251 ? 32.042 65.613  35.408  1.00 66.43  ? 251  SER B CB    1 
ATOM   7503  O  OG    . SER F 3 251 ? 33.374 65.121  35.453  1.00 59.46  ? 251  SER B OG    1 
ATOM   7504  N  N     . ALA F 3 252 ? 32.709 62.947  34.925  1.00 72.69  ? 252  ALA B N     1 
ATOM   7505  C  CA    . ALA F 3 252 ? 33.152 61.589  35.193  1.00 73.22  ? 252  ALA B CA    1 
ATOM   7506  C  C     . ALA F 3 252 ? 34.610 61.667  35.628  1.00 74.67  ? 252  ALA B C     1 
ATOM   7507  O  O     . ALA F 3 252 ? 35.303 60.652  35.782  1.00 74.59  ? 252  ALA B O     1 
ATOM   7508  C  CB    . ALA F 3 252 ? 33.013 60.739  33.941  1.00 69.99  ? 252  ALA B CB    1 
ATOM   7509  N  N     . THR F 3 253 ? 35.067 62.897  35.824  1.00 74.73  ? 253  THR B N     1 
ATOM   7510  C  CA    . THR F 3 253 ? 36.434 63.148  36.242  1.00 74.01  ? 253  THR B CA    1 
ATOM   7511  C  C     . THR F 3 253 ? 36.404 64.279  37.255  1.00 71.98  ? 253  THR B C     1 
ATOM   7512  O  O     . THR F 3 253 ? 37.449 64.761  37.704  1.00 69.43  ? 253  THR B O     1 
ATOM   7513  C  CB    . THR F 3 253 ? 37.309 63.573  35.043  1.00 77.75  ? 253  THR B CB    1 
ATOM   7514  O  OG1   . THR F 3 253 ? 36.669 64.656  34.351  1.00 73.96  ? 253  THR B OG1   1 
ATOM   7515  C  CG2   . THR F 3 253 ? 37.539 62.396  34.088  1.00 66.79  ? 253  THR B CG2   1 
ATOM   7516  N  N     . SER F 3 254 ? 35.197 64.705  37.606  1.00 68.17  ? 254  SER B N     1 
ATOM   7517  C  CA    . SER F 3 254 ? 35.052 65.789  38.554  1.00 67.85  ? 254  SER B CA    1 
ATOM   7518  C  C     . SER F 3 254 ? 33.837 65.631  39.459  1.00 69.15  ? 254  SER B C     1 
ATOM   7519  O  O     . SER F 3 254 ? 32.689 65.718  39.014  1.00 67.60  ? 254  SER B O     1 
ATOM   7520  C  CB    . SER F 3 254 ? 34.982 67.117  37.804  1.00 69.81  ? 254  SER B CB    1 
ATOM   7521  O  OG    . SER F 3 254 ? 34.826 68.197  38.708  1.00 80.84  ? 254  SER B OG    1 
ATOM   7522  N  N     . GLN F 3 255 ? 34.107 65.399  40.739  1.00 68.08  ? 255  GLN B N     1 
ATOM   7523  C  CA    . GLN F 3 255 ? 33.055 65.236  41.738  1.00 66.73  ? 255  GLN B CA    1 
ATOM   7524  C  C     . GLN F 3 255 ? 32.641 66.598  42.280  1.00 63.19  ? 255  GLN B C     1 
ATOM   7525  O  O     . GLN F 3 255 ? 33.411 67.560  42.226  1.00 60.66  ? 255  GLN B O     1 
ATOM   7526  C  CB    . GLN F 3 255 ? 33.558 64.395  42.914  1.00 68.52  ? 255  GLN B CB    1 
ATOM   7527  C  CG    . GLN F 3 255 ? 34.036 63.018  42.553  1.00 67.21  ? 255  GLN B CG    1 
ATOM   7528  C  CD    . GLN F 3 255 ? 34.898 62.423  43.635  1.00 71.04  ? 255  GLN B CD    1 
ATOM   7529  O  OE1   . GLN F 3 255 ? 35.365 61.284  43.522  1.00 72.70  ? 255  GLN B OE1   1 
ATOM   7530  N  NE2   . GLN F 3 255 ? 35.124 63.193  44.699  1.00 69.92  ? 255  GLN B NE2   1 
ATOM   7531  N  N     . LEU F 3 256 ? 31.419 66.683  42.791  1.00 59.18  ? 256  LEU B N     1 
ATOM   7532  C  CA    . LEU F 3 256 ? 30.977 67.929  43.379  1.00 57.56  ? 256  LEU B CA    1 
ATOM   7533  C  C     . LEU F 3 256 ? 31.805 67.964  44.662  1.00 61.05  ? 256  LEU B C     1 
ATOM   7534  O  O     . LEU F 3 256 ? 31.910 66.953  45.350  1.00 64.22  ? 256  LEU B O     1 
ATOM   7535  C  CB    . LEU F 3 256 ? 29.482 67.862  43.675  1.00 46.57  ? 256  LEU B CB    1 
ATOM   7536  C  CG    . LEU F 3 256 ? 28.861 69.079  44.361  1.00 43.65  ? 256  LEU B CG    1 
ATOM   7537  C  CD1   . LEU F 3 256 ? 29.238 70.355  43.626  1.00 44.17  ? 256  LEU B CD1   1 
ATOM   7538  C  CD2   . LEU F 3 256 ? 27.339 68.895  44.405  1.00 44.76  ? 256  LEU B CD2   1 
ATOM   7539  N  N     . SER F 3 257 ? 32.422 69.095  44.979  1.00 61.05  ? 257  SER B N     1 
ATOM   7540  C  CA    . SER F 3 257 ? 33.251 69.152  46.175  1.00 61.51  ? 257  SER B CA    1 
ATOM   7541  C  C     . SER F 3 257 ? 32.440 68.887  47.440  1.00 62.74  ? 257  SER B C     1 
ATOM   7542  O  O     . SER F 3 257 ? 31.263 69.257  47.533  1.00 62.27  ? 257  SER B O     1 
ATOM   7543  C  CB    . SER F 3 257 ? 33.935 70.510  46.290  1.00 58.50  ? 257  SER B CB    1 
ATOM   7544  O  OG    . SER F 3 257 ? 33.240 71.337  47.211  1.00 63.87  ? 257  SER B OG    1 
ATOM   7545  N  N     . THR F 3 258 ? 33.081 68.238  48.411  1.00 60.56  ? 258  THR B N     1 
ATOM   7546  C  CA    . THR F 3 258 ? 32.443 67.925  49.687  1.00 56.22  ? 258  THR B CA    1 
ATOM   7547  C  C     . THR F 3 258 ? 32.070 69.234  50.354  1.00 54.80  ? 258  THR B C     1 
ATOM   7548  O  O     . THR F 3 258 ? 31.035 69.333  51.007  1.00 54.31  ? 258  THR B O     1 
ATOM   7549  C  CB    . THR F 3 258 ? 33.395 67.164  50.602  1.00 53.43  ? 258  THR B CB    1 
ATOM   7550  O  OG1   . THR F 3 258 ? 34.501 68.010  50.941  1.00 54.90  ? 258  THR B OG1   1 
ATOM   7551  C  CG2   . THR F 3 258 ? 33.908 65.917  49.894  1.00 45.31  ? 258  THR B CG2   1 
ATOM   7552  N  N     . ARG F 3 259 ? 32.936 70.230  50.183  1.00 52.02  ? 259  ARG B N     1 
ATOM   7553  C  CA    . ARG F 3 259 ? 32.713 71.565  50.720  1.00 47.18  ? 259  ARG B CA    1 
ATOM   7554  C  C     . ARG F 3 259 ? 31.372 72.072  50.183  1.00 47.71  ? 259  ARG B C     1 
ATOM   7555  O  O     . ARG F 3 259 ? 30.565 72.654  50.916  1.00 40.58  ? 259  ARG B O     1 
ATOM   7556  C  CB    . ARG F 3 259 ? 33.815 72.500  50.247  1.00 37.11  ? 259  ARG B CB    1 
ATOM   7557  C  CG    . ARG F 3 259 ? 33.654 73.934  50.706  1.00 34.60  ? 259  ARG B CG    1 
ATOM   7558  C  CD    . ARG F 3 259 ? 34.345 74.135  52.034  1.00 46.37  ? 259  ARG B CD    1 
ATOM   7559  N  NE    . ARG F 3 259 ? 33.873 75.321  52.738  1.00 42.31  ? 259  ARG B NE    1 
ATOM   7560  C  CZ    . ARG F 3 259 ? 32.593 75.577  52.954  1.00 40.53  ? 259  ARG B CZ    1 
ATOM   7561  N  NH1   . ARG F 3 259 ? 31.676 74.724  52.503  1.00 20.55  ? 259  ARG B NH1   1 
ATOM   7562  N  NH2   . ARG F 3 259 ? 32.233 76.667  53.630  1.00 37.95  ? 259  ARG B NH2   1 
ATOM   7563  N  N     . ALA F 3 260 ? 31.149 71.853  48.889  1.00 45.19  ? 260  ALA B N     1 
ATOM   7564  C  CA    . ALA F 3 260 ? 29.914 72.281  48.253  1.00 45.20  ? 260  ALA B CA    1 
ATOM   7565  C  C     . ALA F 3 260 ? 28.729 71.598  48.909  1.00 46.27  ? 260  ALA B C     1 
ATOM   7566  O  O     . ALA F 3 260 ? 27.664 72.196  49.075  1.00 44.68  ? 260  ALA B O     1 
ATOM   7567  C  CB    . ALA F 3 260 ? 29.945 71.947  46.790  1.00 37.69  ? 260  ALA B CB    1 
ATOM   7568  N  N     . LEU F 3 261 ? 28.913 70.337  49.284  1.00 48.41  ? 261  LEU B N     1 
ATOM   7569  C  CA    . LEU F 3 261 ? 27.837 69.593  49.915  1.00 49.41  ? 261  LEU B CA    1 
ATOM   7570  C  C     . LEU F 3 261 ? 27.549 70.099  51.320  1.00 51.57  ? 261  LEU B C     1 
ATOM   7571  O  O     . LEU F 3 261 ? 26.380 70.193  51.711  1.00 50.18  ? 261  LEU B O     1 
ATOM   7572  C  CB    . LEU F 3 261 ? 28.160 68.100  49.899  1.00 46.54  ? 261  LEU B CB    1 
ATOM   7573  C  CG    . LEU F 3 261 ? 28.038 67.594  48.453  1.00 48.66  ? 261  LEU B CG    1 
ATOM   7574  C  CD1   . LEU F 3 261 ? 28.516 66.165  48.332  1.00 49.76  ? 261  LEU B CD1   1 
ATOM   7575  C  CD2   . LEU F 3 261 ? 26.590 67.699  48.009  1.00 42.76  ? 261  LEU B CD2   1 
ATOM   7576  N  N     . GLU F 3 262 ? 28.596 70.442  52.072  1.00 51.67  ? 262  GLU B N     1 
ATOM   7577  C  CA    . GLU F 3 262 ? 28.396 70.974  53.418  1.00 49.91  ? 262  GLU B CA    1 
ATOM   7578  C  C     . GLU F 3 262 ? 27.565 72.219  53.182  1.00 52.78  ? 262  GLU B C     1 
ATOM   7579  O  O     . GLU F 3 262 ? 26.661 72.539  53.952  1.00 50.24  ? 262  GLU B O     1 
ATOM   7580  C  CB    . GLU F 3 262 ? 29.716 71.385  54.068  1.00 49.74  ? 262  GLU B CB    1 
ATOM   7581  C  CG    . GLU F 3 262 ? 30.818 70.347  54.019  1.00 53.00  ? 262  GLU B CG    1 
ATOM   7582  C  CD    . GLU F 3 262 ? 32.108 70.852  54.651  1.00 62.86  ? 262  GLU B CD    1 
ATOM   7583  O  OE1   . GLU F 3 262 ? 32.073 71.154  55.859  1.00 58.70  ? 262  GLU B OE1   1 
ATOM   7584  O  OE2   . GLU F 3 262 ? 33.150 70.954  53.954  1.00 71.81  ? 262  GLU B OE2   1 
ATOM   7585  N  N     . GLY F 3 263 ? 27.888 72.903  52.083  1.00 53.89  ? 263  GLY B N     1 
ATOM   7586  C  CA    . GLY F 3 263 ? 27.189 74.117  51.709  1.00 53.41  ? 263  GLY B CA    1 
ATOM   7587  C  C     . GLY F 3 263 ? 25.697 73.912  51.523  1.00 53.64  ? 263  GLY B C     1 
ATOM   7588  O  O     . GLY F 3 263 ? 24.887 74.643  52.110  1.00 54.28  ? 263  GLY B O     1 
ATOM   7589  N  N     . ILE F 3 264 ? 25.321 72.931  50.705  1.00 51.24  ? 264  ILE B N     1 
ATOM   7590  C  CA    . ILE F 3 264 ? 23.909 72.662  50.483  1.00 48.48  ? 264  ILE B CA    1 
ATOM   7591  C  C     . ILE F 3 264 ? 23.192 72.717  51.831  1.00 51.29  ? 264  ILE B C     1 
ATOM   7592  O  O     . ILE F 3 264 ? 22.131 73.326  51.954  1.00 46.30  ? 264  ILE B O     1 
ATOM   7593  C  CB    . ILE F 3 264 ? 23.695 71.275  49.843  1.00 44.74  ? 264  ILE B CB    1 
ATOM   7594  C  CG1   . ILE F 3 264 ? 24.417 71.214  48.494  1.00 45.34  ? 264  ILE B CG1   1 
ATOM   7595  C  CG2   . ILE F 3 264 ? 22.190 70.998  49.678  1.00 34.82  ? 264  ILE B CG2   1 
ATOM   7596  C  CD1   . ILE F 3 264 ? 24.115 69.962  47.694  1.00 42.89  ? 264  ILE B CD1   1 
ATOM   7597  N  N     . PHE F 3 265 ? 23.795 72.091  52.839  1.00 52.05  ? 265  PHE B N     1 
ATOM   7598  C  CA    . PHE F 3 265 ? 23.235 72.075  54.188  1.00 53.02  ? 265  PHE B CA    1 
ATOM   7599  C  C     . PHE F 3 265 ? 23.192 73.491  54.751  1.00 55.66  ? 265  PHE B C     1 
ATOM   7600  O  O     . PHE F 3 265 ? 22.141 73.986  55.153  1.00 55.40  ? 265  PHE B O     1 
ATOM   7601  C  CB    . PHE F 3 265 ? 24.092 71.205  55.123  1.00 48.60  ? 265  PHE B CB    1 
ATOM   7602  C  CG    . PHE F 3 265 ? 23.622 69.777  55.248  1.00 45.47  ? 265  PHE B CG    1 
ATOM   7603  C  CD1   . PHE F 3 265 ? 24.349 68.736  54.674  1.00 43.60  ? 265  PHE B CD1   1 
ATOM   7604  C  CD2   . PHE F 3 265 ? 22.446 69.474  55.938  1.00 42.10  ? 265  PHE B CD2   1 
ATOM   7605  C  CE1   . PHE F 3 265 ? 23.916 67.416  54.781  1.00 38.84  ? 265  PHE B CE1   1 
ATOM   7606  C  CE2   . PHE F 3 265 ? 22.002 68.156  56.051  1.00 38.59  ? 265  PHE B CE2   1 
ATOM   7607  C  CZ    . PHE F 3 265 ? 22.745 67.122  55.465  1.00 37.07  ? 265  PHE B CZ    1 
ATOM   7608  N  N     . GLU F 3 266 ? 24.356 74.128  54.772  1.00 56.39  ? 266  GLU B N     1 
ATOM   7609  C  CA    . GLU F 3 266 ? 24.507 75.475  55.303  1.00 59.06  ? 266  GLU B CA    1 
ATOM   7610  C  C     . GLU F 3 266 ? 23.420 76.433  54.840  1.00 61.50  ? 266  GLU B C     1 
ATOM   7611  O  O     . GLU F 3 266 ? 22.909 77.222  55.631  1.00 61.31  ? 266  GLU B O     1 
ATOM   7612  C  CB    . GLU F 3 266 ? 25.882 76.035  54.920  1.00 63.19  ? 266  GLU B CB    1 
ATOM   7613  C  CG    . GLU F 3 266 ? 27.033 75.058  55.160  1.00 77.35  ? 266  GLU B CG    1 
ATOM   7614  C  CD    . GLU F 3 266 ? 28.398 75.625  54.785  1.00 91.37  ? 266  GLU B CD    1 
ATOM   7615  O  OE1   . GLU F 3 266 ? 29.372 74.841  54.738  1.00 91.50  ? 266  GLU B OE1   1 
ATOM   7616  O  OE2   . GLU F 3 266 ? 28.508 76.848  54.546  1.00 93.39  ? 266  GLU B OE2   1 
ATOM   7617  N  N     . ALA F 3 267 ? 23.063 76.353  53.562  1.00 61.09  ? 267  ALA B N     1 
ATOM   7618  C  CA    . ALA F 3 267 ? 22.054 77.238  52.987  1.00 59.02  ? 267  ALA B CA    1 
ATOM   7619  C  C     . ALA F 3 267 ? 20.591 76.840  53.243  1.00 61.31  ? 267  ALA B C     1 
ATOM   7620  O  O     . ALA F 3 267 ? 19.753 77.700  53.540  1.00 63.30  ? 267  ALA B O     1 
ATOM   7621  C  CB    . ALA F 3 267 ? 22.297 77.373  51.505  1.00 53.39  ? 267  ALA B CB    1 
ATOM   7622  N  N     . THR F 3 268 ? 20.270 75.554  53.116  1.00 57.76  ? 268  THR B N     1 
ATOM   7623  C  CA    . THR F 3 268 ? 18.900 75.118  53.350  1.00 52.80  ? 268  THR B CA    1 
ATOM   7624  C  C     . THR F 3 268 ? 18.516 75.531  54.771  1.00 54.41  ? 268  THR B C     1 
ATOM   7625  O  O     . THR F 3 268 ? 17.337 75.686  55.101  1.00 51.45  ? 268  THR B O     1 
ATOM   7626  C  CB    . THR F 3 268 ? 18.754 73.581  53.197  1.00 49.09  ? 268  THR B CB    1 
ATOM   7627  O  OG1   . THR F 3 268 ? 19.150 73.190  51.878  1.00 52.74  ? 268  THR B OG1   1 
ATOM   7628  C  CG2   . THR F 3 268 ? 17.304 73.148  53.406  1.00 41.06  ? 268  THR B CG2   1 
ATOM   7629  N  N     . HIS F 3 269 ? 19.527 75.710  55.614  1.00 57.64  ? 269  HIS B N     1 
ATOM   7630  C  CA    . HIS F 3 269 ? 19.289 76.114  56.985  1.00 61.49  ? 269  HIS B CA    1 
ATOM   7631  C  C     . HIS F 3 269 ? 19.016 77.605  56.950  1.00 65.06  ? 269  HIS B C     1 
ATOM   7632  O  O     . HIS F 3 269 ? 18.025 78.074  57.512  1.00 64.29  ? 269  HIS B O     1 
ATOM   7633  C  CB    . HIS F 3 269 ? 20.511 75.805  57.853  1.00 59.00  ? 269  HIS B CB    1 
ATOM   7634  C  CG    . HIS F 3 269 ? 20.278 76.004  59.320  1.00 61.20  ? 269  HIS B CG    1 
ATOM   7635  N  ND1   . HIS F 3 269 ? 20.610 77.170  59.978  1.00 62.23  ? 269  HIS B ND1   1 
ATOM   7636  C  CD2   . HIS F 3 269 ? 19.717 75.195  60.250  1.00 61.92  ? 269  HIS B CD2   1 
ATOM   7637  C  CE1   . HIS F 3 269 ? 20.263 77.069  61.249  1.00 62.54  ? 269  HIS B CE1   1 
ATOM   7638  N  NE2   . HIS F 3 269 ? 19.718 75.881  61.439  1.00 63.57  ? 269  HIS B NE2   1 
ATOM   7639  N  N     . ARG F 3 270 ? 19.894 78.340  56.271  1.00 68.68  ? 270  ARG B N     1 
ATOM   7640  C  CA    . ARG F 3 270 ? 19.752 79.789  56.128  1.00 72.16  ? 270  ARG B CA    1 
ATOM   7641  C  C     . ARG F 3 270 ? 18.384 80.075  55.520  1.00 72.60  ? 270  ARG B C     1 
ATOM   7642  O  O     . ARG F 3 270 ? 17.718 81.051  55.870  1.00 72.04  ? 270  ARG B O     1 
ATOM   7643  C  CB    . ARG F 3 270 ? 20.828 80.344  55.193  1.00 76.52  ? 270  ARG B CB    1 
ATOM   7644  C  CG    . ARG F 3 270 ? 20.947 81.866  55.206  1.00 82.21  ? 270  ARG B CG    1 
ATOM   7645  C  CD    . ARG F 3 270 ? 21.663 82.397  53.961  1.00 91.80  ? 270  ARG B CD    1 
ATOM   7646  N  NE    . ARG F 3 270 ? 22.793 81.567  53.542  1.00 97.79  ? 270  ARG B NE    1 
ATOM   7647  C  CZ    . ARG F 3 270 ? 23.836 81.257  54.310  1.00 99.82  ? 270  ARG B CZ    1 
ATOM   7648  N  NH1   . ARG F 3 270 ? 23.912 81.705  55.560  1.00 97.99  ? 270  ARG B NH1   1 
ATOM   7649  N  NH2   . ARG F 3 270 ? 24.812 80.497  53.824  1.00 99.68  ? 270  ARG B NH2   1 
ATOM   7650  N  N     . LEU F 3 271 ? 17.976 79.208  54.602  1.00 71.85  ? 271  LEU B N     1 
ATOM   7651  C  CA    . LEU F 3 271 ? 16.694 79.350  53.938  1.00 70.22  ? 271  LEU B CA    1 
ATOM   7652  C  C     . LEU F 3 271 ? 15.527 79.314  54.928  1.00 69.76  ? 271  LEU B C     1 
ATOM   7653  O  O     . LEU F 3 271 ? 14.529 80.007  54.736  1.00 71.05  ? 271  LEU B O     1 
ATOM   7654  C  CB    . LEU F 3 271 ? 16.530 78.238  52.893  1.00 70.00  ? 271  LEU B CB    1 
ATOM   7655  C  CG    . LEU F 3 271 ? 15.279 78.204  51.998  1.00 67.62  ? 271  LEU B CG    1 
ATOM   7656  C  CD1   . LEU F 3 271 ? 14.055 77.741  52.784  1.00 62.29  ? 271  LEU B CD1   1 
ATOM   7657  C  CD2   . LEU F 3 271 ? 15.059 79.595  51.399  1.00 68.68  ? 271  LEU B CD2   1 
ATOM   7658  N  N     . ILE F 3 272 ? 15.659 78.524  55.990  1.00 66.27  ? 272  ILE B N     1 
ATOM   7659  C  CA    . ILE F 3 272 ? 14.589 78.386  56.974  1.00 62.80  ? 272  ILE B CA    1 
ATOM   7660  C  C     . ILE F 3 272 ? 14.764 79.184  58.273  1.00 65.16  ? 272  ILE B C     1 
ATOM   7661  O  O     . ILE F 3 272 ? 13.776 79.621  58.864  1.00 64.82  ? 272  ILE B O     1 
ATOM   7662  C  CB    . ILE F 3 272 ? 14.392 76.898  57.341  1.00 50.59  ? 272  ILE B CB    1 
ATOM   7663  C  CG1   . ILE F 3 272 ? 14.258 76.064  56.065  1.00 46.90  ? 272  ILE B CG1   1 
ATOM   7664  C  CG2   . ILE F 3 272 ? 13.163 76.734  58.230  1.00 37.30  ? 272  ILE B CG2   1 
ATOM   7665  C  CD1   . ILE F 3 272 ? 14.311 74.567  56.296  1.00 47.30  ? 272  ILE B CD1   1 
ATOM   7666  N  N     . TYR F 3 273 ? 16.001 79.376  58.727  1.00 66.69  ? 273  TYR B N     1 
ATOM   7667  C  CA    . TYR F 3 273 ? 16.220 80.115  59.970  1.00 68.60  ? 273  TYR B CA    1 
ATOM   7668  C  C     . TYR F 3 273 ? 17.083 81.365  59.802  1.00 70.48  ? 273  TYR B C     1 
ATOM   7669  O  O     . TYR F 3 273 ? 17.549 81.957  60.781  1.00 66.28  ? 273  TYR B O     1 
ATOM   7670  C  CB    . TYR F 3 273 ? 16.830 79.191  61.027  1.00 68.40  ? 273  TYR B CB    1 
ATOM   7671  C  CG    . TYR F 3 273 ? 16.033 77.922  61.241  1.00 70.35  ? 273  TYR B CG    1 
ATOM   7672  C  CD1   . TYR F 3 273 ? 16.104 76.873  60.329  1.00 70.16  ? 273  TYR B CD1   1 
ATOM   7673  C  CD2   . TYR F 3 273 ? 15.183 77.781  62.337  1.00 70.15  ? 273  TYR B CD2   1 
ATOM   7674  C  CE1   . TYR F 3 273 ? 15.349 75.717  60.501  1.00 70.80  ? 273  TYR B CE1   1 
ATOM   7675  C  CE2   . TYR F 3 273 ? 14.421 76.625  62.516  1.00 70.32  ? 273  TYR B CE2   1 
ATOM   7676  C  CZ    . TYR F 3 273 ? 14.511 75.601  61.594  1.00 70.44  ? 273  TYR B CZ    1 
ATOM   7677  O  OH    . TYR F 3 273 ? 13.762 74.460  61.749  1.00 70.15  ? 273  TYR B OH    1 
ATOM   7678  N  N     . GLY F 3 274 ? 17.291 81.755  58.550  1.00 73.09  ? 274  GLY B N     1 
ATOM   7679  C  CA    . GLY F 3 274 ? 18.064 82.945  58.251  1.00 74.02  ? 274  GLY B CA    1 
ATOM   7680  C  C     . GLY F 3 274 ? 19.522 82.952  58.655  1.00 77.12  ? 274  GLY B C     1 
ATOM   7681  O  O     . GLY F 3 274 ? 20.088 81.923  59.016  1.00 77.94  ? 274  GLY B O     1 
ATOM   7682  N  N     . ALA F 3 275 ? 20.113 84.143  58.589  1.00 80.18  ? 275  ALA B N     1 
ATOM   7683  C  CA    . ALA F 3 275 ? 21.515 84.382  58.918  1.00 82.86  ? 275  ALA B CA    1 
ATOM   7684  C  C     . ALA F 3 275 ? 21.993 83.627  60.143  1.00 86.10  ? 275  ALA B C     1 
ATOM   7685  O  O     . ALA F 3 275 ? 21.235 83.407  61.093  1.00 85.21  ? 275  ALA B O     1 
ATOM   7686  C  CB    . ALA F 3 275 ? 21.756 85.877  59.112  1.00 79.91  ? 275  ALA B CB    1 
ATOM   7687  N  N     . LYS F 3 276 ? 23.265 83.242  60.110  1.00 89.41  ? 276  LYS B N     1 
ATOM   7688  C  CA    . LYS F 3 276 ? 23.880 82.508  61.205  1.00 92.51  ? 276  LYS B CA    1 
ATOM   7689  C  C     . LYS F 3 276 ? 24.444 83.499  62.220  1.00 95.11  ? 276  LYS B C     1 
ATOM   7690  O  O     . LYS F 3 276 ? 25.316 84.307  61.898  1.00 92.27  ? 276  LYS B O     1 
ATOM   7691  C  CB    . LYS F 3 276 ? 24.991 81.600  60.656  1.00 89.08  ? 276  LYS B CB    1 
ATOM   7692  C  CG    . LYS F 3 276 ? 25.569 80.617  61.669  1.00 80.33  ? 276  LYS B CG    1 
ATOM   7693  C  CD    . LYS F 3 276 ? 26.419 79.540  60.994  1.00 80.36  ? 276  LYS B CD    1 
ATOM   7694  C  CE    . LYS F 3 276 ? 27.636 80.126  60.283  1.00 78.21  ? 276  LYS B CE    1 
ATOM   7695  N  NZ    . LYS F 3 276 ? 28.494 79.074  59.635  1.00 67.29  ? 276  LYS B NZ    1 
ATOM   7696  N  N     . ASP F 3 277 ? 23.926 83.444  63.441  1.00 97.99  ? 277  ASP B N     1 
ATOM   7697  C  CA    . ASP F 3 277 ? 24.383 84.333  64.500  1.00 102.27 ? 277  ASP B CA    1 
ATOM   7698  C  C     . ASP F 3 277 ? 25.904 84.374  64.586  1.00 103.07 ? 277  ASP B C     1 
ATOM   7699  O  O     . ASP F 3 277 ? 26.516 83.478  65.166  1.00 104.11 ? 277  ASP B O     1 
ATOM   7700  C  CB    . ASP F 3 277 ? 23.829 83.874  65.848  1.00 105.92 ? 277  ASP B CB    1 
ATOM   7701  C  CG    . ASP F 3 277 ? 24.662 84.378  67.019  1.00 112.36 ? 277  ASP B CG    1 
ATOM   7702  O  OD1   . ASP F 3 277 ? 24.709 85.611  67.247  1.00 115.55 ? 277  ASP B OD1   1 
ATOM   7703  O  OD2   . ASP F 3 277 ? 25.282 83.532  67.702  1.00 113.86 ? 277  ASP B OD2   1 
ATOM   7704  N  N     . ASP F 3 278 ? 26.519 85.407  64.018  1.00 103.79 ? 278  ASP B N     1 
ATOM   7705  C  CA    . ASP F 3 278 ? 27.972 85.509  64.073  1.00 105.72 ? 278  ASP B CA    1 
ATOM   7706  C  C     . ASP F 3 278 ? 28.414 85.402  65.526  1.00 103.94 ? 278  ASP B C     1 
ATOM   7707  O  O     . ASP F 3 278 ? 28.156 86.291  66.340  1.00 103.02 ? 278  ASP B O     1 
ATOM   7708  C  CB    . ASP F 3 278 ? 28.456 86.834  63.466  1.00 114.60 ? 278  ASP B CB    1 
ATOM   7709  C  CG    . ASP F 3 278 ? 29.973 86.997  63.545  1.00 116.62 ? 278  ASP B CG    1 
ATOM   7710  O  OD1   . ASP F 3 278 ? 30.485 87.309  64.647  1.00 116.45 ? 278  ASP B OD1   1 
ATOM   7711  O  OD2   . ASP F 3 278 ? 30.651 86.803  62.509  1.00 115.40 ? 278  ASP B OD2   1 
ATOM   7712  N  N     . SER F 3 279 ? 29.070 84.293  65.843  1.00 101.76 ? 279  SER B N     1 
ATOM   7713  C  CA    . SER F 3 279 ? 29.543 84.042  67.194  1.00 98.43  ? 279  SER B CA    1 
ATOM   7714  C  C     . SER F 3 279 ? 30.842 83.247  67.133  1.00 96.69  ? 279  SER B C     1 
ATOM   7715  O  O     . SER F 3 279 ? 31.501 83.030  68.155  1.00 95.57  ? 279  SER B O     1 
ATOM   7716  C  CB    . SER F 3 279 ? 28.484 83.264  67.979  1.00 93.44  ? 279  SER B CB    1 
ATOM   7717  O  OG    . SER F 3 279 ? 28.844 83.149  69.343  1.00 83.84  ? 279  SER B OG    1 
ATOM   7718  N  N     . GLY F 3 280 ? 31.201 82.816  65.925  1.00 93.97  ? 280  GLY B N     1 
ATOM   7719  C  CA    . GLY F 3 280 ? 32.424 82.054  65.736  1.00 91.53  ? 280  GLY B CA    1 
ATOM   7720  C  C     . GLY F 3 280 ? 32.286 80.571  66.039  1.00 90.94  ? 280  GLY B C     1 
ATOM   7721  O  O     . GLY F 3 280 ? 33.022 79.750  65.483  1.00 89.57  ? 280  GLY B O     1 
ATOM   7722  N  N     . GLN F 3 281 ? 31.346 80.229  66.917  1.00 88.29  ? 281  GLN B N     1 
ATOM   7723  C  CA    . GLN F 3 281 ? 31.105 78.841  67.308  1.00 83.76  ? 281  GLN B CA    1 
ATOM   7724  C  C     . GLN F 3 281 ? 30.810 77.941  66.098  1.00 78.23  ? 281  GLN B C     1 
ATOM   7725  O  O     . GLN F 3 281 ? 30.320 78.413  65.068  1.00 79.36  ? 281  GLN B O     1 
ATOM   7726  C  CB    . GLN F 3 281 ? 29.934 78.782  68.300  1.00 90.10  ? 281  GLN B CB    1 
ATOM   7727  C  CG    . GLN F 3 281 ? 29.379 80.154  68.697  1.00 95.83  ? 281  GLN B CG    1 
ATOM   7728  C  CD    . GLN F 3 281 ? 28.152 80.074  69.609  1.00 98.40  ? 281  GLN B CD    1 
ATOM   7729  O  OE1   . GLN F 3 281 ? 28.207 79.491  70.695  1.00 99.96  ? 281  GLN B OE1   1 
ATOM   7730  N  NE2   . GLN F 3 281 ? 27.042 80.671  69.171  1.00 94.58  ? 281  GLN B NE2   1 
ATOM   7731  N  N     . ARG F 3 282 ? 31.115 76.650  66.226  1.00 70.17  ? 282  ARG B N     1 
ATOM   7732  C  CA    . ARG F 3 282 ? 30.864 75.696  65.147  1.00 64.95  ? 282  ARG B CA    1 
ATOM   7733  C  C     . ARG F 3 282 ? 29.495 75.060  65.252  1.00 65.43  ? 282  ARG B C     1 
ATOM   7734  O  O     . ARG F 3 282 ? 28.771 75.276  66.216  1.00 66.14  ? 282  ARG B O     1 
ATOM   7735  C  CB    . ARG F 3 282 ? 31.898 74.570  65.138  1.00 53.56  ? 282  ARG B CB    1 
ATOM   7736  C  CG    . ARG F 3 282 ? 33.175 74.873  64.393  1.00 50.70  ? 282  ARG B CG    1 
ATOM   7737  C  CD    . ARG F 3 282 ? 33.929 73.592  64.101  1.00 41.82  ? 282  ARG B CD    1 
ATOM   7738  N  NE    . ARG F 3 282 ? 35.268 73.848  63.581  1.00 43.54  ? 282  ARG B NE    1 
ATOM   7739  C  CZ    . ARG F 3 282 ? 36.152 72.892  63.321  1.00 53.30  ? 282  ARG B CZ    1 
ATOM   7740  N  NH1   . ARG F 3 282 ? 35.827 71.619  63.528  1.00 64.30  ? 282  ARG B NH1   1 
ATOM   7741  N  NH2   . ARG F 3 282 ? 37.365 73.204  62.884  1.00 45.17  ? 282  ARG B NH2   1 
ATOM   7742  N  N     . TYR F 3 283 ? 29.161 74.251  64.255  1.00 66.19  ? 283  TYR B N     1 
ATOM   7743  C  CA    . TYR F 3 283 ? 27.878 73.567  64.213  1.00 67.41  ? 283  TYR B CA    1 
ATOM   7744  C  C     . TYR F 3 283 ? 26.740 74.523  64.558  1.00 68.43  ? 283  TYR B C     1 
ATOM   7745  O  O     . TYR F 3 283 ? 25.849 74.195  65.345  1.00 68.19  ? 283  TYR B O     1 
ATOM   7746  C  CB    . TYR F 3 283 ? 27.881 72.375  65.178  1.00 67.58  ? 283  TYR B CB    1 
ATOM   7747  C  CG    . TYR F 3 283 ? 28.997 71.389  64.916  1.00 66.09  ? 283  TYR B CG    1 
ATOM   7748  C  CD1   . TYR F 3 283 ? 30.064 71.266  65.798  1.00 66.46  ? 283  TYR B CD1   1 
ATOM   7749  C  CD2   . TYR F 3 283 ? 29.011 70.619  63.760  1.00 65.63  ? 283  TYR B CD2   1 
ATOM   7750  C  CE1   . TYR F 3 283 ? 31.118 70.406  65.530  1.00 63.61  ? 283  TYR B CE1   1 
ATOM   7751  C  CE2   . TYR F 3 283 ? 30.062 69.755  63.482  1.00 64.50  ? 283  TYR B CE2   1 
ATOM   7752  C  CZ    . TYR F 3 283 ? 31.111 69.654  64.369  1.00 60.12  ? 283  TYR B CZ    1 
ATOM   7753  O  OH    . TYR F 3 283 ? 32.158 68.811  64.081  1.00 50.89  ? 283  TYR B OH    1 
ATOM   7754  N  N     . LEU F 3 284 ? 26.778 75.710  63.960  1.00 68.04  ? 284  LEU B N     1 
ATOM   7755  C  CA    . LEU F 3 284 ? 25.754 76.715  64.194  1.00 64.67  ? 284  LEU B CA    1 
ATOM   7756  C  C     . LEU F 3 284 ? 24.555 76.527  63.293  1.00 62.68  ? 284  LEU B C     1 
ATOM   7757  O  O     . LEU F 3 284 ? 23.523 77.158  63.480  1.00 62.92  ? 284  LEU B O     1 
ATOM   7758  C  CB    . LEU F 3 284 ? 26.336 78.106  64.003  1.00 61.83  ? 284  LEU B CB    1 
ATOM   7759  C  CG    . LEU F 3 284 ? 26.790 78.661  65.349  1.00 61.36  ? 284  LEU B CG    1 
ATOM   7760  C  CD1   . LEU F 3 284 ? 27.392 80.053  65.195  1.00 64.78  ? 284  LEU B CD1   1 
ATOM   7761  C  CD2   . LEU F 3 284 ? 25.575 78.675  66.279  1.00 55.39  ? 284  LEU B CD2   1 
ATOM   7762  N  N     . ALA F 3 285 ? 24.710 75.642  62.318  1.00 59.55  ? 285  ALA B N     1 
ATOM   7763  C  CA    . ALA F 3 285 ? 23.661 75.313  61.366  1.00 56.86  ? 285  ALA B CA    1 
ATOM   7764  C  C     . ALA F 3 285 ? 24.087 74.024  60.669  1.00 56.14  ? 285  ALA B C     1 
ATOM   7765  O  O     . ALA F 3 285 ? 25.281 73.764  60.521  1.00 56.05  ? 285  ALA B O     1 
ATOM   7766  C  CB    . ALA F 3 285 ? 23.514 76.430  60.364  1.00 63.06  ? 285  ALA B CB    1 
ATOM   7767  N  N     . TRP F 3 286 ? 23.120 73.218  60.247  1.00 52.12  ? 286  TRP B N     1 
ATOM   7768  C  CA    . TRP F 3 286 ? 23.407 71.953  59.571  1.00 48.80  ? 286  TRP B CA    1 
ATOM   7769  C  C     . TRP F 3 286 ? 24.689 71.880  58.740  1.00 50.75  ? 286  TRP B C     1 
ATOM   7770  O  O     . TRP F 3 286 ? 25.128 72.863  58.145  1.00 46.10  ? 286  TRP B O     1 
ATOM   7771  C  CB    . TRP F 3 286 ? 22.231 71.561  58.693  1.00 44.07  ? 286  TRP B CB    1 
ATOM   7772  C  CG    . TRP F 3 286 ? 20.967 71.508  59.444  1.00 44.95  ? 286  TRP B CG    1 
ATOM   7773  C  CD1   . TRP F 3 286 ? 20.798 71.057  60.710  1.00 45.46  ? 286  TRP B CD1   1 
ATOM   7774  C  CD2   . TRP F 3 286 ? 19.668 71.845  58.957  1.00 50.24  ? 286  TRP B CD2   1 
ATOM   7775  N  NE1   . TRP F 3 286 ? 19.474 71.082  61.047  1.00 53.22  ? 286  TRP B NE1   1 
ATOM   7776  C  CE2   . TRP F 3 286 ? 18.754 71.563  59.987  1.00 50.83  ? 286  TRP B CE2   1 
ATOM   7777  C  CE3   . TRP F 3 286 ? 19.188 72.357  57.746  1.00 49.89  ? 286  TRP B CE3   1 
ATOM   7778  C  CZ2   . TRP F 3 286 ? 17.382 71.773  59.851  1.00 52.14  ? 286  TRP B CZ2   1 
ATOM   7779  C  CZ3   . TRP F 3 286 ? 17.827 72.567  57.605  1.00 51.52  ? 286  TRP B CZ3   1 
ATOM   7780  C  CH2   . TRP F 3 286 ? 16.937 72.274  58.656  1.00 55.71  ? 286  TRP B CH2   1 
ATOM   7781  N  N     . SER F 3 287 ? 25.276 70.689  58.705  1.00 53.63  ? 287  SER B N     1 
ATOM   7782  C  CA    . SER F 3 287 ? 26.507 70.445  57.974  1.00 52.40  ? 287  SER B CA    1 
ATOM   7783  C  C     . SER F 3 287 ? 26.545 69.011  57.489  1.00 51.67  ? 287  SER B C     1 
ATOM   7784  O  O     . SER F 3 287 ? 25.536 68.320  57.492  1.00 53.86  ? 287  SER B O     1 
ATOM   7785  C  CB    . SER F 3 287 ? 27.701 70.698  58.872  1.00 47.28  ? 287  SER B CB    1 
ATOM   7786  O  OG    . SER F 3 287 ? 27.540 69.975  60.076  1.00 48.58  ? 287  SER B OG    1 
ATOM   7787  N  N     . GLY F 3 288 ? 27.724 68.563  57.086  1.00 50.34  ? 288  GLY B N     1 
ATOM   7788  C  CA    . GLY F 3 288 ? 27.863 67.212  56.584  1.00 52.69  ? 288  GLY B CA    1 
ATOM   7789  C  C     . GLY F 3 288 ? 27.237 66.093  57.405  1.00 55.74  ? 288  GLY B C     1 
ATOM   7790  O  O     . GLY F 3 288 ? 26.570 65.208  56.852  1.00 51.24  ? 288  GLY B O     1 
ATOM   7791  N  N     . HIS F 3 289 ? 27.436 66.112  58.719  1.00 55.02  ? 289  HIS B N     1 
ATOM   7792  C  CA    . HIS F 3 289 ? 26.888 65.042  59.536  1.00 52.92  ? 289  HIS B CA    1 
ATOM   7793  C  C     . HIS F 3 289 ? 25.480 65.212  60.033  1.00 52.46  ? 289  HIS B C     1 
ATOM   7794  O  O     . HIS F 3 289 ? 24.864 64.240  60.449  1.00 56.92  ? 289  HIS B O     1 
ATOM   7795  C  CB    . HIS F 3 289 ? 27.799 64.744  60.716  1.00 54.74  ? 289  HIS B CB    1 
ATOM   7796  C  CG    . HIS F 3 289 ? 28.846 63.726  60.409  1.00 60.71  ? 289  HIS B CG    1 
ATOM   7797  N  ND1   . HIS F 3 289 ? 29.944 64.001  59.625  1.00 69.57  ? 289  HIS B ND1   1 
ATOM   7798  C  CD2   . HIS F 3 289 ? 28.934 62.415  60.730  1.00 64.39  ? 289  HIS B CD2   1 
ATOM   7799  C  CE1   . HIS F 3 289 ? 30.663 62.904  59.477  1.00 69.13  ? 289  HIS B CE1   1 
ATOM   7800  N  NE2   . HIS F 3 289 ? 30.072 61.926  60.138  1.00 68.07  ? 289  HIS B NE2   1 
ATOM   7801  N  N     . SER F 3 290 ? 24.965 66.431  59.983  1.00 49.84  ? 290  SER B N     1 
ATOM   7802  C  CA    . SER F 3 290 ? 23.612 66.715  60.447  1.00 46.74  ? 290  SER B CA    1 
ATOM   7803  C  C     . SER F 3 290 ? 22.626 65.584  60.166  1.00 45.49  ? 290  SER B C     1 
ATOM   7804  O  O     . SER F 3 290 ? 21.777 65.269  60.995  1.00 47.39  ? 290  SER B O     1 
ATOM   7805  C  CB    . SER F 3 290 ? 23.110 67.995  59.791  1.00 49.91  ? 290  SER B CB    1 
ATOM   7806  O  OG    . SER F 3 290 ? 24.073 69.026  59.919  1.00 56.33  ? 290  SER B OG    1 
ATOM   7807  N  N     . ALA F 3 291 ? 22.747 64.970  58.997  1.00 44.97  ? 291  ALA B N     1 
ATOM   7808  C  CA    . ALA F 3 291 ? 21.852 63.889  58.614  1.00 43.14  ? 291  ALA B CA    1 
ATOM   7809  C  C     . ALA F 3 291 ? 22.010 62.619  59.462  1.00 43.34  ? 291  ALA B C     1 
ATOM   7810  O  O     . ALA F 3 291 ? 21.017 62.044  59.896  1.00 38.44  ? 291  ALA B O     1 
ATOM   7811  C  CB    . ALA F 3 291 ? 22.056 63.562  57.139  1.00 47.14  ? 291  ALA B CB    1 
ATOM   7812  N  N     . ARG F 3 292 ? 23.250 62.176  59.681  1.00 42.62  ? 292  ARG B N     1 
ATOM   7813  C  CA    . ARG F 3 292 ? 23.522 60.967  60.468  1.00 38.00  ? 292  ARG B CA    1 
ATOM   7814  C  C     . ARG F 3 292 ? 23.034 61.070  61.905  1.00 38.62  ? 292  ARG B C     1 
ATOM   7815  O  O     . ARG F 3 292 ? 22.217 60.257  62.352  1.00 39.35  ? 292  ARG B O     1 
ATOM   7816  C  CB    . ARG F 3 292 ? 25.024 60.655  60.500  1.00 32.37  ? 292  ARG B CB    1 
ATOM   7817  C  CG    . ARG F 3 292 ? 25.557 59.958  59.276  1.00 36.00  ? 292  ARG B CG    1 
ATOM   7818  C  CD    . ARG F 3 292 ? 27.062 60.122  59.159  1.00 44.07  ? 292  ARG B CD    1 
ATOM   7819  N  NE    . ARG F 3 292 ? 27.811 59.191  59.997  1.00 49.87  ? 292  ARG B NE    1 
ATOM   7820  C  CZ    . ARG F 3 292 ? 27.853 57.876  59.796  1.00 50.17  ? 292  ARG B CZ    1 
ATOM   7821  N  NH1   . ARG F 3 292 ? 27.177 57.336  58.782  1.00 42.73  ? 292  ARG B NH1   1 
ATOM   7822  N  NH2   . ARG F 3 292 ? 28.591 57.102  60.594  1.00 49.54  ? 292  ARG B NH2   1 
ATOM   7823  N  N     . VAL F 3 293 ? 23.533 62.056  62.641  1.00 30.88  ? 293  VAL B N     1 
ATOM   7824  C  CA    . VAL F 3 293 ? 23.108 62.153  64.013  1.00 30.34  ? 293  VAL B CA    1 
ATOM   7825  C  C     . VAL F 3 293 ? 21.600 62.212  63.987  1.00 31.94  ? 293  VAL B C     1 
ATOM   7826  O  O     . VAL F 3 293 ? 20.931 61.566  64.784  1.00 32.42  ? 293  VAL B O     1 
ATOM   7827  C  CB    . VAL F 3 293 ? 23.724 63.380  64.744  1.00 26.49  ? 293  VAL B CB    1 
ATOM   7828  C  CG1   . VAL F 3 293 ? 24.716 64.072  63.852  1.00 28.36  ? 293  VAL B CG1   1 
ATOM   7829  C  CG2   . VAL F 3 293 ? 22.642 64.311  65.233  1.00 9.78   ? 293  VAL B CG2   1 
ATOM   7830  N  N     . GLY F 3 294 ? 21.060 62.956  63.037  1.00 32.58  ? 294  GLY B N     1 
ATOM   7831  C  CA    . GLY F 3 294 ? 19.618 63.044  62.941  1.00 31.06  ? 294  GLY B CA    1 
ATOM   7832  C  C     . GLY F 3 294 ? 18.985 61.670  62.783  1.00 32.95  ? 294  GLY B C     1 
ATOM   7833  O  O     . GLY F 3 294 ? 18.163 61.264  63.598  1.00 28.48  ? 294  GLY B O     1 
ATOM   7834  N  N     . ALA F 3 295 ? 19.371 60.954  61.732  1.00 36.71  ? 295  ALA B N     1 
ATOM   7835  C  CA    . ALA F 3 295 ? 18.836 59.631  61.453  1.00 37.34  ? 295  ALA B CA    1 
ATOM   7836  C  C     . ALA F 3 295 ? 18.929 58.736  62.675  1.00 39.69  ? 295  ALA B C     1 
ATOM   7837  O  O     . ALA F 3 295 ? 17.951 58.085  63.053  1.00 35.91  ? 295  ALA B O     1 
ATOM   7838  C  CB    . ALA F 3 295 ? 19.580 59.009  60.307  1.00 28.59  ? 295  ALA B CB    1 
ATOM   7839  N  N     . ALA F 3 296 ? 20.102 58.684  63.295  1.00 41.09  ? 296  ALA B N     1 
ATOM   7840  C  CA    . ALA F 3 296 ? 20.249 57.864  64.491  1.00 40.99  ? 296  ALA B CA    1 
ATOM   7841  C  C     . ALA F 3 296 ? 19.143 58.266  65.468  1.00 40.94  ? 296  ALA B C     1 
ATOM   7842  O  O     . ALA F 3 296 ? 18.288 57.458  65.821  1.00 38.88  ? 296  ALA B O     1 
ATOM   7843  C  CB    . ALA F 3 296 ? 21.615 58.086  65.120  1.00 34.96  ? 296  ALA B CB    1 
ATOM   7844  N  N     . ARG F 3 297 ? 19.145 59.529  65.875  1.00 42.73  ? 297  ARG B N     1 
ATOM   7845  C  CA    . ARG F 3 297 ? 18.144 60.023  66.803  1.00 46.13  ? 297  ARG B CA    1 
ATOM   7846  C  C     . ARG F 3 297 ? 16.718 59.631  66.430  1.00 49.50  ? 297  ARG B C     1 
ATOM   7847  O  O     . ARG F 3 297 ? 15.964 59.167  67.286  1.00 49.95  ? 297  ARG B O     1 
ATOM   7848  C  CB    . ARG F 3 297 ? 18.255 61.541  66.944  1.00 42.17  ? 297  ARG B CB    1 
ATOM   7849  C  CG    . ARG F 3 297 ? 19.468 61.971  67.745  1.00 39.88  ? 297  ARG B CG    1 
ATOM   7850  C  CD    . ARG F 3 297 ? 19.891 63.367  67.385  1.00 51.93  ? 297  ARG B CD    1 
ATOM   7851  N  NE    . ARG F 3 297 ? 18.813 64.316  67.621  1.00 63.11  ? 297  ARG B NE    1 
ATOM   7852  C  CZ    . ARG F 3 297 ? 18.512 64.808  68.812  1.00 62.10  ? 297  ARG B CZ    1 
ATOM   7853  N  NH1   . ARG F 3 297 ? 19.223 64.433  69.866  1.00 35.32  ? 297  ARG B NH1   1 
ATOM   7854  N  NH2   . ARG F 3 297 ? 17.506 65.666  68.941  1.00 67.99  ? 297  ARG B NH2   1 
ATOM   7855  N  N     . ASP F 3 298 ? 16.329 59.795  65.169  1.00 50.63  ? 298  ASP B N     1 
ATOM   7856  C  CA    . ASP F 3 298 ? 14.963 59.438  64.802  1.00 52.22  ? 298  ASP B CA    1 
ATOM   7857  C  C     . ASP F 3 298 ? 14.726 57.955  65.002  1.00 51.73  ? 298  ASP B C     1 
ATOM   7858  O  O     . ASP F 3 298 ? 13.651 57.544  65.442  1.00 52.98  ? 298  ASP B O     1 
ATOM   7859  C  CB    . ASP F 3 298 ? 14.644 59.824  63.354  1.00 59.86  ? 298  ASP B CB    1 
ATOM   7860  C  CG    . ASP F 3 298 ? 14.397 61.317  63.185  1.00 68.10  ? 298  ASP B CG    1 
ATOM   7861  O  OD1   . ASP F 3 298 ? 13.675 61.895  64.026  1.00 69.44  ? 298  ASP B OD1   1 
ATOM   7862  O  OD2   . ASP F 3 298 ? 14.912 61.911  62.209  1.00 65.69  ? 298  ASP B OD2   1 
ATOM   7863  N  N     . MET F 3 299 ? 15.732 57.147  64.690  1.00 51.27  ? 299  MET B N     1 
ATOM   7864  C  CA    . MET F 3 299 ? 15.581 55.712  64.852  1.00 49.17  ? 299  MET B CA    1 
ATOM   7865  C  C     . MET F 3 299 ? 15.488 55.403  66.328  1.00 49.26  ? 299  MET B C     1 
ATOM   7866  O  O     . MET F 3 299 ? 14.641 54.628  66.742  1.00 46.79  ? 299  MET B O     1 
ATOM   7867  C  CB    . MET F 3 299 ? 16.764 54.959  64.247  1.00 40.23  ? 299  MET B CB    1 
ATOM   7868  C  CG    . MET F 3 299 ? 16.905 55.111  62.753  1.00 42.85  ? 299  MET B CG    1 
ATOM   7869  S  SD    . MET F 3 299 ? 18.324 54.194  62.123  1.00 47.44  ? 299  MET B SD    1 
ATOM   7870  C  CE    . MET F 3 299 ? 17.514 52.725  61.541  1.00 44.69  ? 299  MET B CE    1 
ATOM   7871  N  N     . ALA F 3 300 ? 16.360 56.023  67.117  1.00 51.82  ? 300  ALA B N     1 
ATOM   7872  C  CA    . ALA F 3 300 ? 16.379 55.798  68.559  1.00 53.38  ? 300  ALA B CA    1 
ATOM   7873  C  C     . ALA F 3 300 ? 14.986 55.959  69.122  1.00 52.30  ? 300  ALA B C     1 
ATOM   7874  O  O     . ALA F 3 300 ? 14.484 55.057  69.793  1.00 53.54  ? 300  ALA B O     1 
ATOM   7875  C  CB    . ALA F 3 300 ? 17.329 56.773  69.244  1.00 47.76  ? 300  ALA B CB    1 
ATOM   7876  N  N     . ARG F 3 301 ? 14.368 57.106  68.838  1.00 50.97  ? 301  ARG B N     1 
ATOM   7877  C  CA    . ARG F 3 301 ? 13.017 57.420  69.307  1.00 51.21  ? 301  ARG B CA    1 
ATOM   7878  C  C     . ARG F 3 301 ? 11.961 56.390  68.892  1.00 53.94  ? 301  ARG B C     1 
ATOM   7879  O  O     . ARG F 3 301 ? 11.004 56.141  69.630  1.00 56.55  ? 301  ARG B O     1 
ATOM   7880  C  CB    . ARG F 3 301 ? 12.552 58.772  68.766  1.00 50.08  ? 301  ARG B CB    1 
ATOM   7881  C  CG    . ARG F 3 301 ? 13.308 60.002  69.213  1.00 53.83  ? 301  ARG B CG    1 
ATOM   7882  C  CD    . ARG F 3 301 ? 12.467 61.229  68.862  1.00 54.80  ? 301  ARG B CD    1 
ATOM   7883  N  NE    . ARG F 3 301 ? 13.134 62.481  69.188  1.00 62.23  ? 301  ARG B NE    1 
ATOM   7884  C  CZ    . ARG F 3 301 ? 14.018 63.077  68.401  1.00 71.08  ? 301  ARG B CZ    1 
ATOM   7885  N  NH1   . ARG F 3 301 ? 14.335 62.531  67.236  1.00 72.34  ? 301  ARG B NH1   1 
ATOM   7886  N  NH2   . ARG F 3 301 ? 14.587 64.216  68.783  1.00 72.13  ? 301  ARG B NH2   1 
ATOM   7887  N  N     . ALA F 3 302 ? 12.118 55.813  67.705  1.00 54.49  ? 302  ALA B N     1 
ATOM   7888  C  CA    . ALA F 3 302 ? 11.151 54.840  67.207  1.00 53.65  ? 302  ALA B CA    1 
ATOM   7889  C  C     . ALA F 3 302 ? 11.287 53.413  67.768  1.00 55.65  ? 302  ALA B C     1 
ATOM   7890  O  O     . ALA F 3 302 ? 10.416 52.574  67.535  1.00 55.05  ? 302  ALA B O     1 
ATOM   7891  C  CB    . ALA F 3 302 ? 11.200 54.809  65.689  1.00 35.73  ? 302  ALA B CB    1 
ATOM   7892  N  N     . GLY F 3 303 ? 12.367 53.135  68.492  1.00 54.41  ? 303  GLY B N     1 
ATOM   7893  C  CA    . GLY F 3 303 ? 12.543 51.811  69.059  1.00 56.63  ? 303  GLY B CA    1 
ATOM   7894  C  C     . GLY F 3 303 ? 13.319 50.790  68.237  1.00 59.74  ? 303  GLY B C     1 
ATOM   7895  O  O     . GLY F 3 303 ? 13.343 49.603  68.575  1.00 60.49  ? 303  GLY B O     1 
ATOM   7896  N  N     . VAL F 3 304 ? 13.959 51.226  67.162  1.00 58.49  ? 304  VAL B N     1 
ATOM   7897  C  CA    . VAL F 3 304 ? 14.735 50.305  66.338  1.00 58.93  ? 304  VAL B CA    1 
ATOM   7898  C  C     . VAL F 3 304 ? 15.804 49.662  67.208  1.00 57.50  ? 304  VAL B C     1 
ATOM   7899  O  O     . VAL F 3 304 ? 16.381 50.323  68.063  1.00 53.06  ? 304  VAL B O     1 
ATOM   7900  C  CB    . VAL F 3 304 ? 15.447 51.035  65.191  1.00 62.25  ? 304  VAL B CB    1 
ATOM   7901  C  CG1   . VAL F 3 304 ? 15.842 50.025  64.109  1.00 62.76  ? 304  VAL B CG1   1 
ATOM   7902  C  CG2   . VAL F 3 304 ? 14.554 52.139  64.637  1.00 57.56  ? 304  VAL B CG2   1 
ATOM   7903  N  N     . SER F 3 305 ? 16.073 48.382  66.977  1.00 56.99  ? 305  SER B N     1 
ATOM   7904  C  CA    . SER F 3 305 ? 17.073 47.661  67.760  1.00 56.58  ? 305  SER B CA    1 
ATOM   7905  C  C     . SER F 3 305 ? 18.499 48.168  67.550  1.00 56.85  ? 305  SER B C     1 
ATOM   7906  O  O     . SER F 3 305 ? 18.765 48.943  66.637  1.00 59.49  ? 305  SER B O     1 
ATOM   7907  C  CB    . SER F 3 305 ? 17.019 46.165  67.439  1.00 52.20  ? 305  SER B CB    1 
ATOM   7908  O  OG    . SER F 3 305 ? 17.580 45.879  66.169  1.00 46.92  ? 305  SER B OG    1 
ATOM   7909  N  N     . ILE F 3 306 ? 19.411 47.735  68.415  1.00 54.78  ? 306  ILE B N     1 
ATOM   7910  C  CA    . ILE F 3 306 ? 20.805 48.140  68.308  1.00 47.36  ? 306  ILE B CA    1 
ATOM   7911  C  C     . ILE F 3 306 ? 21.360 47.624  66.995  1.00 48.34  ? 306  ILE B C     1 
ATOM   7912  O  O     . ILE F 3 306 ? 21.854 48.398  66.183  1.00 51.36  ? 306  ILE B O     1 
ATOM   7913  C  CB    . ILE F 3 306 ? 21.683 47.545  69.429  1.00 40.62  ? 306  ILE B CB    1 
ATOM   7914  C  CG1   . ILE F 3 306 ? 21.301 48.123  70.790  1.00 37.24  ? 306  ILE B CG1   1 
ATOM   7915  C  CG2   . ILE F 3 306 ? 23.140 47.828  69.138  1.00 40.66  ? 306  ILE B CG2   1 
ATOM   7916  C  CD1   . ILE F 3 306 ? 21.816 49.513  71.022  1.00 40.31  ? 306  ILE B CD1   1 
ATOM   7917  N  N     . PRO F 3 307 ? 21.269 46.303  66.758  1.00 47.38  ? 307  PRO B N     1 
ATOM   7918  C  CA    . PRO F 3 307 ? 21.793 45.739  65.513  1.00 46.89  ? 307  PRO B CA    1 
ATOM   7919  C  C     . PRO F 3 307 ? 21.239 46.377  64.247  1.00 47.11  ? 307  PRO B C     1 
ATOM   7920  O  O     . PRO F 3 307 ? 21.919 46.381  63.228  1.00 48.34  ? 307  PRO B O     1 
ATOM   7921  C  CB    . PRO F 3 307 ? 21.447 44.257  65.631  1.00 38.51  ? 307  PRO B CB    1 
ATOM   7922  C  CG    . PRO F 3 307 ? 20.168 44.296  66.369  1.00 38.28  ? 307  PRO B CG    1 
ATOM   7923  C  CD    . PRO F 3 307 ? 20.466 45.296  67.469  1.00 42.14  ? 307  PRO B CD    1 
ATOM   7924  N  N     . GLU F 3 308 ? 20.022 46.914  64.292  1.00 48.33  ? 308  GLU B N     1 
ATOM   7925  C  CA    . GLU F 3 308 ? 19.479 47.543  63.093  1.00 51.80  ? 308  GLU B CA    1 
ATOM   7926  C  C     . GLU F 3 308 ? 19.924 48.996  62.944  1.00 52.17  ? 308  GLU B C     1 
ATOM   7927  O  O     . GLU F 3 308 ? 20.078 49.482  61.822  1.00 48.08  ? 308  GLU B O     1 
ATOM   7928  C  CB    . GLU F 3 308 ? 17.950 47.451  63.042  1.00 57.84  ? 308  GLU B CB    1 
ATOM   7929  C  CG    . GLU F 3 308 ? 17.433 46.070  62.639  1.00 77.79  ? 308  GLU B CG    1 
ATOM   7930  C  CD    . GLU F 3 308 ? 15.998 46.095  62.116  1.00 95.62  ? 308  GLU B CD    1 
ATOM   7931  O  OE1   . GLU F 3 308 ? 15.112 46.652  62.805  1.00 105.60 ? 308  GLU B OE1   1 
ATOM   7932  O  OE2   . GLU F 3 308 ? 15.758 45.548  61.014  1.00 93.37  ? 308  GLU B OE2   1 
ATOM   7933  N  N     . ILE F 3 309 ? 20.128 49.697  64.054  1.00 50.28  ? 309  ILE B N     1 
ATOM   7934  C  CA    . ILE F 3 309 ? 20.598 51.066  63.953  1.00 47.81  ? 309  ILE B CA    1 
ATOM   7935  C  C     . ILE F 3 309 ? 22.028 50.980  63.444  1.00 49.89  ? 309  ILE B C     1 
ATOM   7936  O  O     . ILE F 3 309 ? 22.505 51.862  62.749  1.00 48.92  ? 309  ILE B O     1 
ATOM   7937  C  CB    . ILE F 3 309 ? 20.635 51.781  65.305  1.00 32.90  ? 309  ILE B CB    1 
ATOM   7938  C  CG1   . ILE F 3 309 ? 19.233 51.925  65.875  1.00 38.56  ? 309  ILE B CG1   1 
ATOM   7939  C  CG2   . ILE F 3 309 ? 21.197 53.166  65.134  1.00 22.59  ? 309  ILE B CG2   1 
ATOM   7940  C  CD1   . ILE F 3 309 ? 19.191 52.754  67.163  1.00 34.10  ? 309  ILE B CD1   1 
ATOM   7941  N  N     . MET F 3 310 ? 22.712 49.905  63.797  1.00 54.05  ? 310  MET B N     1 
ATOM   7942  C  CA    . MET F 3 310 ? 24.090 49.717  63.376  1.00 57.02  ? 310  MET B CA    1 
ATOM   7943  C  C     . MET F 3 310 ? 24.196 49.624  61.864  1.00 58.50  ? 310  MET B C     1 
ATOM   7944  O  O     . MET F 3 310 ? 24.895 50.417  61.240  1.00 59.89  ? 310  MET B O     1 
ATOM   7945  C  CB    . MET F 3 310 ? 24.651 48.447  63.995  1.00 56.69  ? 310  MET B CB    1 
ATOM   7946  C  CG    . MET F 3 310 ? 24.491 48.389  65.498  1.00 57.50  ? 310  MET B CG    1 
ATOM   7947  S  SD    . MET F 3 310 ? 25.702 49.363  66.364  1.00 75.98  ? 310  MET B SD    1 
ATOM   7948  C  CE    . MET F 3 310 ? 26.858 48.048  66.760  1.00 70.47  ? 310  MET B CE    1 
ATOM   7949  N  N     . GLN F 3 311 ? 23.521 48.639  61.281  1.00 59.41  ? 311  GLN B N     1 
ATOM   7950  C  CA    . GLN F 3 311 ? 23.527 48.450  59.834  1.00 57.38  ? 311  GLN B CA    1 
ATOM   7951  C  C     . GLN F 3 311 ? 23.194 49.766  59.150  1.00 58.60  ? 311  GLN B C     1 
ATOM   7952  O  O     . GLN F 3 311 ? 23.800 50.125  58.143  1.00 60.19  ? 311  GLN B O     1 
ATOM   7953  C  CB    . GLN F 3 311 ? 22.480 47.412  59.430  1.00 53.69  ? 311  GLN B CB    1 
ATOM   7954  C  CG    . GLN F 3 311 ? 23.009 46.019  59.166  1.00 66.88  ? 311  GLN B CG    1 
ATOM   7955  C  CD    . GLN F 3 311 ? 23.534 45.851  57.754  1.00 82.60  ? 311  GLN B CD    1 
ATOM   7956  O  OE1   . GLN F 3 311 ? 22.789 46.020  56.782  1.00 89.63  ? 311  GLN B OE1   1 
ATOM   7957  N  NE2   . GLN F 3 311 ? 24.821 45.514  57.630  1.00 86.22  ? 311  GLN B NE2   1 
ATOM   7958  N  N     . ALA F 3 312 ? 22.225 50.482  59.713  1.00 58.88  ? 312  ALA B N     1 
ATOM   7959  C  CA    . ALA F 3 312 ? 21.770 51.754  59.169  1.00 54.82  ? 312  ALA B CA    1 
ATOM   7960  C  C     . ALA F 3 312 ? 22.883 52.749  58.901  1.00 53.68  ? 312  ALA B C     1 
ATOM   7961  O  O     . ALA F 3 312 ? 22.791 53.545  57.973  1.00 54.81  ? 312  ALA B O     1 
ATOM   7962  C  CB    . ALA F 3 312 ? 20.757 52.370  60.103  1.00 48.13  ? 312  ALA B CB    1 
ATOM   7963  N  N     . GLY F 3 313 ? 23.931 52.715  59.714  1.00 53.67  ? 313  GLY B N     1 
ATOM   7964  C  CA    . GLY F 3 313 ? 25.026 53.647  59.525  1.00 51.88  ? 313  GLY B CA    1 
ATOM   7965  C  C     . GLY F 3 313 ? 26.393 52.997  59.403  1.00 52.56  ? 313  GLY B C     1 
ATOM   7966  O  O     . GLY F 3 313 ? 27.424 53.662  59.555  1.00 51.74  ? 313  GLY B O     1 
ATOM   7967  N  N     . GLY F 3 314 ? 26.413 51.699  59.124  1.00 50.26  ? 314  GLY B N     1 
ATOM   7968  C  CA    . GLY F 3 314 ? 27.678 51.006  58.986  1.00 51.59  ? 314  GLY B CA    1 
ATOM   7969  C  C     . GLY F 3 314 ? 28.522 51.158  60.232  1.00 50.50  ? 314  GLY B C     1 
ATOM   7970  O  O     . GLY F 3 314 ? 29.729 51.407  60.161  1.00 49.64  ? 314  GLY B O     1 
ATOM   7971  N  N     . TRP F 3 315 ? 27.876 51.025  61.384  1.00 51.77  ? 315  TRP B N     1 
ATOM   7972  C  CA    . TRP F 3 315 ? 28.551 51.127  62.670  1.00 49.25  ? 315  TRP B CA    1 
ATOM   7973  C  C     . TRP F 3 315 ? 28.672 49.718  63.229  1.00 49.58  ? 315  TRP B C     1 
ATOM   7974  O  O     . TRP F 3 315 ? 27.976 48.815  62.786  1.00 43.65  ? 315  TRP B O     1 
ATOM   7975  C  CB    . TRP F 3 315 ? 27.718 51.960  63.633  1.00 37.98  ? 315  TRP B CB    1 
ATOM   7976  C  CG    . TRP F 3 315 ? 27.802 53.443  63.477  1.00 39.53  ? 315  TRP B CG    1 
ATOM   7977  C  CD1   . TRP F 3 315 ? 28.923 54.221  63.573  1.00 37.67  ? 315  TRP B CD1   1 
ATOM   7978  C  CD2   . TRP F 3 315 ? 26.698 54.346  63.355  1.00 40.57  ? 315  TRP B CD2   1 
ATOM   7979  N  NE1   . TRP F 3 315 ? 28.579 55.549  63.533  1.00 45.67  ? 315  TRP B NE1   1 
ATOM   7980  C  CE2   . TRP F 3 315 ? 27.219 55.653  63.400  1.00 47.39  ? 315  TRP B CE2   1 
ATOM   7981  C  CE3   . TRP F 3 315 ? 25.317 54.175  63.221  1.00 36.12  ? 315  TRP B CE3   1 
ATOM   7982  C  CZ2   . TRP F 3 315 ? 26.409 56.780  63.315  1.00 59.28  ? 315  TRP B CZ2   1 
ATOM   7983  C  CZ3   . TRP F 3 315 ? 24.515 55.293  63.137  1.00 48.18  ? 315  TRP B CZ3   1 
ATOM   7984  C  CH2   . TRP F 3 315 ? 25.061 56.580  63.185  1.00 61.37  ? 315  TRP B CH2   1 
ATOM   7985  N  N     . THR F 3 316 ? 29.536 49.524  64.215  1.00 53.14  ? 316  THR B N     1 
ATOM   7986  C  CA    . THR F 3 316 ? 29.678 48.200  64.794  1.00 53.65  ? 316  THR B CA    1 
ATOM   7987  C  C     . THR F 3 316 ? 29.800 48.248  66.311  1.00 56.56  ? 316  THR B C     1 
ATOM   7988  O  O     . THR F 3 316 ? 30.137 47.257  66.946  1.00 53.59  ? 316  THR B O     1 
ATOM   7989  C  CB    . THR F 3 316 ? 30.881 47.485  64.188  1.00 42.91  ? 316  THR B CB    1 
ATOM   7990  O  OG1   . THR F 3 316 ? 30.754 47.514  62.766  1.00 47.62  ? 316  THR B OG1   1 
ATOM   7991  C  CG2   . THR F 3 316 ? 30.926 46.036  64.623  1.00 38.57  ? 316  THR B CG2   1 
ATOM   7992  N  N     . ASN F 3 317 ? 29.505 49.408  66.887  1.00 60.42  ? 317  ASN B N     1 
ATOM   7993  C  CA    . ASN F 3 317 ? 29.557 49.612  68.333  1.00 68.30  ? 317  ASN B CA    1 
ATOM   7994  C  C     . ASN F 3 317 ? 28.417 50.572  68.649  1.00 69.17  ? 317  ASN B C     1 
ATOM   7995  O  O     . ASN F 3 317 ? 28.186 51.525  67.902  1.00 64.58  ? 317  ASN B O     1 
ATOM   7996  C  CB    . ASN F 3 317 ? 30.892 50.242  68.730  1.00 73.78  ? 317  ASN B CB    1 
ATOM   7997  C  CG    . ASN F 3 317 ? 31.148 50.174  70.215  1.00 80.27  ? 317  ASN B CG    1 
ATOM   7998  O  OD1   . ASN F 3 317 ? 31.597 49.149  70.736  1.00 77.34  ? 317  ASN B OD1   1 
ATOM   7999  N  ND2   . ASN F 3 317 ? 30.853 51.264  70.912  1.00 81.45  ? 317  ASN B ND2   1 
ATOM   8000  N  N     . VAL F 3 318 ? 27.699 50.341  69.740  1.00 72.81  ? 318  VAL B N     1 
ATOM   8001  C  CA    . VAL F 3 318 ? 26.581 51.225  70.050  1.00 76.16  ? 318  VAL B CA    1 
ATOM   8002  C  C     . VAL F 3 318 ? 27.066 52.612  70.394  1.00 72.87  ? 318  VAL B C     1 
ATOM   8003  O  O     . VAL F 3 318 ? 26.276 53.544  70.492  1.00 66.08  ? 318  VAL B O     1 
ATOM   8004  C  CB    . VAL F 3 318 ? 25.736 50.709  71.225  1.00 81.29  ? 318  VAL B CB    1 
ATOM   8005  C  CG1   . VAL F 3 318 ? 24.445 51.508  71.310  1.00 77.43  ? 318  VAL B CG1   1 
ATOM   8006  C  CG2   . VAL F 3 318 ? 25.442 49.230  71.049  1.00 70.60  ? 318  VAL B CG2   1 
ATOM   8007  N  N     . ASN F 3 319 ? 28.372 52.751  70.569  1.00 74.08  ? 319  ASN B N     1 
ATOM   8008  C  CA    . ASN F 3 319 ? 28.931 54.046  70.915  1.00 73.97  ? 319  ASN B CA    1 
ATOM   8009  C  C     . ASN F 3 319 ? 28.882 55.013  69.734  1.00 72.91  ? 319  ASN B C     1 
ATOM   8010  O  O     . ASN F 3 319 ? 28.923 54.582  68.572  1.00 72.89  ? 319  ASN B O     1 
ATOM   8011  C  CB    . ASN F 3 319 ? 30.361 53.890  71.403  1.00 65.50  ? 319  ASN B CB    1 
ATOM   8012  C  CG    . ASN F 3 319 ? 30.788 55.052  72.250  1.00 59.97  ? 319  ASN B CG    1 
ATOM   8013  O  OD1   . ASN F 3 319 ? 31.881 55.059  72.853  1.00 53.79  ? 319  ASN B OD1   1 
ATOM   8014  N  ND2   . ASN F 3 319 ? 29.912 56.067  72.313  1.00 36.68  ? 319  ASN B ND2   1 
ATOM   8015  N  N     . ILE F 3 320 ? 28.809 56.311  70.035  1.00 73.90  ? 320  ILE B N     1 
ATOM   8016  C  CA    . ILE F 3 320 ? 28.706 57.362  69.017  1.00 69.75  ? 320  ILE B CA    1 
ATOM   8017  C  C     . ILE F 3 320 ? 27.220 57.527  68.745  1.00 64.73  ? 320  ILE B C     1 
ATOM   8018  O  O     . ILE F 3 320 ? 26.709 58.635  68.720  1.00 47.82  ? 320  ILE B O     1 
ATOM   8019  C  CB    . ILE F 3 320 ? 29.420 57.001  67.686  1.00 75.03  ? 320  ILE B CB    1 
ATOM   8020  C  CG1   . ILE F 3 320 ? 30.932 57.192  67.825  1.00 76.19  ? 320  ILE B CG1   1 
ATOM   8021  C  CG2   . ILE F 3 320 ? 28.883 57.863  66.556  1.00 59.93  ? 320  ILE B CG2   1 
ATOM   8022  C  CD1   . ILE F 3 320 ? 31.364 58.635  67.930  1.00 76.06  ? 320  ILE B CD1   1 
ATOM   8023  N  N     . VAL F 3 321 ? 26.523 56.421  68.524  1.00 64.36  ? 321  VAL B N     1 
ATOM   8024  C  CA    . VAL F 3 321 ? 25.091 56.500  68.310  1.00 62.12  ? 321  VAL B CA    1 
ATOM   8025  C  C     . VAL F 3 321 ? 24.564 56.960  69.655  1.00 63.39  ? 321  VAL B C     1 
ATOM   8026  O  O     . VAL F 3 321 ? 23.623 57.741  69.737  1.00 58.06  ? 321  VAL B O     1 
ATOM   8027  C  CB    . VAL F 3 321 ? 24.478 55.132  67.993  1.00 59.73  ? 321  VAL B CB    1 
ATOM   8028  C  CG1   . VAL F 3 321 ? 22.969 55.266  67.840  1.00 58.11  ? 321  VAL B CG1   1 
ATOM   8029  C  CG2   . VAL F 3 321 ? 25.093 54.570  66.731  1.00 57.85  ? 321  VAL B CG2   1 
ATOM   8030  N  N     . MET F 3 322 ? 25.190 56.458  70.714  1.00 68.53  ? 322  MET B N     1 
ATOM   8031  C  CA    . MET F 3 322 ? 24.812 56.824  72.070  1.00 70.14  ? 322  MET B CA    1 
ATOM   8032  C  C     . MET F 3 322 ? 25.161 58.283  72.244  1.00 71.79  ? 322  MET B C     1 
ATOM   8033  O  O     . MET F 3 322 ? 24.372 59.072  72.754  1.00 64.42  ? 322  MET B O     1 
ATOM   8034  C  CB    . MET F 3 322 ? 25.585 55.992  73.099  1.00 61.40  ? 322  MET B CB    1 
ATOM   8035  C  CG    . MET F 3 322 ? 25.145 54.540  73.210  1.00 61.87  ? 322  MET B CG    1 
ATOM   8036  S  SD    . MET F 3 322 ? 23.362 54.435  73.379  1.00 59.43  ? 322  MET B SD    1 
ATOM   8037  C  CE    . MET F 3 322 ? 23.087 55.653  74.684  1.00 57.59  ? 322  MET B CE    1 
ATOM   8038  N  N     . ASN F 3 323 ? 26.360 58.632  71.805  1.00 79.99  ? 323  ASN B N     1 
ATOM   8039  C  CA    . ASN F 3 323 ? 26.834 59.995  71.898  1.00 86.73  ? 323  ASN B CA    1 
ATOM   8040  C  C     . ASN F 3 323 ? 25.888 60.932  71.149  1.00 85.22  ? 323  ASN B C     1 
ATOM   8041  O  O     . ASN F 3 323 ? 25.577 62.011  71.639  1.00 73.41  ? 323  ASN B O     1 
ATOM   8042  C  CB    . ASN F 3 323 ? 28.260 60.072  71.341  1.00 102.55 ? 323  ASN B CB    1 
ATOM   8043  C  CG    . ASN F 3 323 ? 28.774 61.486  71.245  1.00 112.46 ? 323  ASN B CG    1 
ATOM   8044  O  OD1   . ASN F 3 323 ? 28.422 62.341  72.054  1.00 107.58 ? 323  ASN B OD1   1 
ATOM   8045  N  ND2   . ASN F 3 323 ? 29.626 61.740  70.259  1.00 117.20 ? 323  ASN B ND2   1 
ATOM   8046  N  N     . TYR F 3 324 ? 25.413 60.504  69.978  1.00 86.22  ? 324  TYR B N     1 
ATOM   8047  C  CA    . TYR F 3 324 ? 24.497 61.307  69.158  1.00 83.99  ? 324  TYR B CA    1 
ATOM   8048  C  C     . TYR F 3 324 ? 23.147 61.466  69.828  1.00 83.78  ? 324  TYR B C     1 
ATOM   8049  O  O     . TYR F 3 324 ? 22.252 62.144  69.309  1.00 77.79  ? 324  TYR B O     1 
ATOM   8050  C  CB    . TYR F 3 324 ? 24.291 60.664  67.783  1.00 79.08  ? 324  TYR B CB    1 
ATOM   8051  C  CG    . TYR F 3 324 ? 25.412 60.919  66.810  1.00 73.24  ? 324  TYR B CG    1 
ATOM   8052  C  CD1   . TYR F 3 324 ? 25.487 60.220  65.611  1.00 74.67  ? 324  TYR B CD1   1 
ATOM   8053  C  CD2   . TYR F 3 324 ? 26.412 61.838  67.098  1.00 63.91  ? 324  TYR B CD2   1 
ATOM   8054  C  CE1   . TYR F 3 324 ? 26.533 60.426  64.727  1.00 72.77  ? 324  TYR B CE1   1 
ATOM   8055  C  CE2   . TYR F 3 324 ? 27.457 62.049  66.228  1.00 65.04  ? 324  TYR B CE2   1 
ATOM   8056  C  CZ    . TYR F 3 324 ? 27.517 61.340  65.042  1.00 69.10  ? 324  TYR B CZ    1 
ATOM   8057  O  OH    . TYR F 3 324 ? 28.577 61.535  64.185  1.00 68.83  ? 324  TYR B OH    1 
ATOM   8058  N  N     . ILE F 3 325 ? 22.990 60.825  70.979  1.00 87.63  ? 325  ILE B N     1 
ATOM   8059  C  CA    . ILE F 3 325 ? 21.737 60.927  71.690  1.00 84.56  ? 325  ILE B CA    1 
ATOM   8060  C  C     . ILE F 3 325 ? 21.836 61.611  73.045  1.00 93.60  ? 325  ILE B C     1 
ATOM   8061  O  O     . ILE F 3 325 ? 22.768 61.417  73.821  1.00 93.65  ? 325  ILE B O     1 
ATOM   8062  C  CB    . ILE F 3 325 ? 21.096 59.574  71.917  1.00 54.09  ? 325  ILE B CB    1 
ATOM   8063  C  CG1   . ILE F 3 325 ? 21.058 58.760  70.635  1.00 39.45  ? 325  ILE B CG1   1 
ATOM   8064  C  CG2   . ILE F 3 325 ? 19.679 59.786  72.390  1.00 48.13  ? 325  ILE B CG2   1 
ATOM   8065  C  CD1   . ILE F 3 325 ? 20.667 57.325  70.900  1.00 37.95  ? 325  ILE B CD1   1 
ATOM   8066  N  N     . ARG F 3 326 ? 20.815 62.406  73.289  1.00 99.37  ? 326  ARG B N     1 
ATOM   8067  C  CA    . ARG F 3 326 ? 20.600 63.186  74.485  1.00 106.10 ? 326  ARG B CA    1 
ATOM   8068  C  C     . ARG F 3 326 ? 19.228 63.721  74.094  1.00 108.52 ? 326  ARG B C     1 
ATOM   8069  O  O     . ARG F 3 326 ? 18.920 64.900  74.249  1.00 110.28 ? 326  ARG B O     1 
ATOM   8070  C  CB    . ARG F 3 326 ? 21.644 64.301  74.595  1.00 114.10 ? 326  ARG B CB    1 
ATOM   8071  C  CG    . ARG F 3 326 ? 22.951 63.883  75.288  1.00 118.27 ? 326  ARG B CG    1 
ATOM   8072  C  CD    . ARG F 3 326 ? 24.171 63.850  74.366  1.00 119.57 ? 326  ARG B CD    1 
ATOM   8073  N  NE    . ARG F 3 326 ? 25.415 64.009  75.124  1.00 123.73 ? 326  ARG B NE    1 
ATOM   8074  C  CZ    . ARG F 3 326 ? 26.613 64.195  74.578  1.00 123.82 ? 326  ARG B CZ    1 
ATOM   8075  N  NH1   . ARG F 3 326 ? 26.746 64.241  73.262  1.00 119.76 ? 326  ARG B NH1   1 
ATOM   8076  N  NH2   . ARG F 3 326 ? 27.678 64.359  75.348  1.00 123.08 ? 326  ARG B NH2   1 
ATOM   8077  N  N     . ASN F 3 327 ? 18.446 62.791  73.541  1.00 110.88 ? 327  ASN B N     1 
ATOM   8078  C  CA    . ASN F 3 327 ? 17.096 62.982  73.011  1.00 112.86 ? 327  ASN B CA    1 
ATOM   8079  C  C     . ASN F 3 327 ? 16.230 64.168  73.394  1.00 116.39 ? 327  ASN B C     1 
ATOM   8080  O  O     . ASN F 3 327 ? 16.716 65.259  73.679  1.00 110.73 ? 327  ASN B O     1 
ATOM   8081  C  CB    . ASN F 3 327 ? 16.281 61.707  73.215  1.00 109.59 ? 327  ASN B CB    1 
ATOM   8082  C  CG    . ASN F 3 327 ? 16.434 60.730  72.069  1.00 108.81 ? 327  ASN B CG    1 
ATOM   8083  O  OD1   . ASN F 3 327 ? 16.221 61.080  70.911  1.00 100.35 ? 327  ASN B OD1   1 
ATOM   8084  N  ND2   . ASN F 3 327 ? 16.796 59.494  72.387  1.00 112.45 ? 327  ASN B ND2   1 
ATOM   8085  N  N     . LEU F 3 328 ? 14.923 63.922  73.360  1.00 124.35 ? 328  LEU B N     1 
ATOM   8086  C  CA    . LEU F 3 328 ? 13.899 64.914  73.660  1.00 132.69 ? 328  LEU B CA    1 
ATOM   8087  C  C     . LEU F 3 328 ? 14.267 65.938  74.729  1.00 137.32 ? 328  LEU B C     1 
ATOM   8088  O  O     . LEU F 3 328 ? 14.817 65.606  75.781  1.00 136.52 ? 328  LEU B O     1 
ATOM   8089  C  CB    . LEU F 3 328 ? 12.595 64.217  74.061  1.00 131.03 ? 328  LEU B CB    1 
ATOM   8090  C  CG    . LEU F 3 328 ? 11.980 63.236  73.059  1.00 129.73 ? 328  LEU B CG    1 
ATOM   8091  C  CD1   . LEU F 3 328 ? 10.707 62.650  73.654  1.00 125.72 ? 328  LEU B CD1   1 
ATOM   8092  C  CD2   . LEU F 3 328 ? 11.682 63.938  71.739  1.00 128.06 ? 328  LEU B CD2   1 
ATOM   8093  N  N     . ASP F 3 329 ? 13.945 67.192  74.439  1.00 141.69 ? 329  ASP B N     1 
ATOM   8094  C  CA    . ASP F 3 329 ? 14.213 68.293  75.345  1.00 143.51 ? 329  ASP B CA    1 
ATOM   8095  C  C     . ASP F 3 329 ? 12.951 68.500  76.167  1.00 143.11 ? 329  ASP B C     1 
ATOM   8096  O  O     . ASP F 3 329 ? 12.104 67.612  76.253  1.00 141.07 ? 329  ASP B O     1 
ATOM   8097  C  CB    . ASP F 3 329 ? 14.521 69.574  74.555  1.00 144.74 ? 329  ASP B CB    1 
ATOM   8098  C  CG    . ASP F 3 329 ? 15.627 69.385  73.525  1.00 143.19 ? 329  ASP B CG    1 
ATOM   8099  O  OD1   . ASP F 3 329 ? 16.761 69.031  73.913  1.00 141.92 ? 329  ASP B OD1   1 
ATOM   8100  O  OD2   . ASP F 3 329 ? 15.360 69.592  72.319  1.00 139.47 ? 329  ASP B OD2   1 
ATOM   8101  N  N     . SER F 3 330 ? 12.833 69.690  76.746  1.00 143.07 ? 330  SER B N     1 
ATOM   8102  C  CA    . SER F 3 330 ? 11.693 70.082  77.570  1.00 141.77 ? 330  SER B CA    1 
ATOM   8103  C  C     . SER F 3 330 ? 10.928 68.911  78.187  1.00 139.80 ? 330  SER B C     1 
ATOM   8104  O  O     . SER F 3 330 ? 11.492 68.142  78.963  1.00 139.48 ? 330  SER B O     1 
ATOM   8105  C  CB    . SER F 3 330 ? 10.739 70.985  76.763  1.00 140.36 ? 330  SER B CB    1 
ATOM   8106  O  OG    . SER F 3 330 ? 10.269 70.357  75.579  1.00 133.50 ? 330  SER B OG    1 
ATOM   8107  N  N     . GLU F 3 331 ? 9.649  68.775  77.851  1.00 136.34 ? 331  GLU B N     1 
ATOM   8108  C  CA    . GLU F 3 331 ? 8.835  67.698  78.406  1.00 131.23 ? 331  GLU B CA    1 
ATOM   8109  C  C     . GLU F 3 331 ? 9.574  66.364  78.449  1.00 125.73 ? 331  GLU B C     1 
ATOM   8110  O  O     . GLU F 3 331 ? 9.343  65.554  79.342  1.00 125.47 ? 331  GLU B O     1 
ATOM   8111  C  CB    . GLU F 3 331 ? 7.540  67.525  77.600  1.00 136.14 ? 331  GLU B CB    1 
ATOM   8112  C  CG    . GLU F 3 331 ? 6.596  68.729  77.623  1.00 135.73 ? 331  GLU B CG    1 
ATOM   8113  C  CD    . GLU F 3 331 ? 5.222  68.415  77.035  1.00 136.60 ? 331  GLU B CD    1 
ATOM   8114  O  OE1   . GLU F 3 331 ? 4.534  67.517  77.570  1.00 133.23 ? 331  GLU B OE1   1 
ATOM   8115  O  OE2   . GLU F 3 331 ? 4.832  69.069  76.044  1.00 135.74 ? 331  GLU B OE2   1 
ATOM   8116  N  N     . THR F 3 332 ? 10.466 66.145  77.488  1.00 119.33 ? 332  THR B N     1 
ATOM   8117  C  CA    . THR F 3 332 ? 11.228 64.900  77.399  1.00 111.65 ? 332  THR B CA    1 
ATOM   8118  C  C     . THR F 3 332 ? 10.322 63.710  77.706  1.00 104.51 ? 332  THR B C     1 
ATOM   8119  O  O     . THR F 3 332 ? 9.093  63.831  77.667  1.00 99.75  ? 332  THR B O     1 
ATOM   8120  C  CB    . THR F 3 332 ? 12.458 64.923  78.351  1.00 113.76 ? 332  THR B CB    1 
ATOM   8121  O  OG1   . THR F 3 332 ? 13.263 66.069  78.037  1.00 119.43 ? 332  THR B OG1   1 
ATOM   8122  C  CG2   . THR F 3 332 ? 13.326 63.668  78.173  1.00 108.12 ? 332  THR B CG2   1 
ATOM   8123  N  N     . GLY F 3 333 ? 10.923 62.560  77.990  1.00 99.32  ? 333  GLY B N     1 
ATOM   8124  C  CA    . GLY F 3 333 ? 10.131 61.381  78.282  1.00 93.73  ? 333  GLY B CA    1 
ATOM   8125  C  C     . GLY F 3 333 ? 10.890 60.152  78.749  1.00 85.72  ? 333  GLY B C     1 
ATOM   8126  O  O     . GLY F 3 333 ? 11.853 60.244  79.513  1.00 86.88  ? 333  GLY B O     1 
ATOM   8127  N  N     . ALA F 3 334 ? 10.430 58.995  78.281  1.00 76.71  ? 334  ALA B N     1 
ATOM   8128  C  CA    . ALA F 3 334 ? 11.003 57.705  78.640  1.00 66.75  ? 334  ALA B CA    1 
ATOM   8129  C  C     . ALA F 3 334 ? 10.749 57.417  80.112  1.00 62.11  ? 334  ALA B C     1 
ATOM   8130  O  O     . ALA F 3 334 ? 9.803  56.726  80.478  1.00 58.38  ? 334  ALA B O     1 
ATOM   8131  C  CB    . ALA F 3 334 ? 12.496 57.699  78.353  1.00 64.37  ? 334  ALA B CB    1 
ATOM   8132  N  N     . MET F 3 335 ? 11.607 57.973  80.952  1.00 58.32  ? 335  MET B N     1 
ATOM   8133  C  CA    . MET F 3 335 ? 11.513 57.798  82.387  1.00 51.34  ? 335  MET B CA    1 
ATOM   8134  C  C     . MET F 3 335 ? 10.428 58.714  82.931  1.00 49.87  ? 335  MET B C     1 
ATOM   8135  O  O     . MET F 3 335 ? 9.928  58.499  84.019  1.00 50.67  ? 335  MET B O     1 
ATOM   8136  C  CB    . MET F 3 335 ? 12.865 58.121  83.019  1.00 42.75  ? 335  MET B CB    1 
ATOM   8137  C  CG    . MET F 3 335 ? 13.185 57.345  84.272  1.00 33.46  ? 335  MET B CG    1 
ATOM   8138  S  SD    . MET F 3 335 ? 12.968 55.546  84.118  1.00 32.28  ? 335  MET B SD    1 
ATOM   8139  C  CE    . MET F 3 335 ? 12.068 55.282  85.663  1.00 13.62  ? 335  MET B CE    1 
ATOM   8140  N  N     . VAL F 3 336 ? 10.060 59.740  82.173  1.00 50.59  ? 336  VAL B N     1 
ATOM   8141  C  CA    . VAL F 3 336 ? 9.010  60.661  82.609  1.00 50.12  ? 336  VAL B CA    1 
ATOM   8142  C  C     . VAL F 3 336 ? 7.642  60.160  82.172  1.00 48.35  ? 336  VAL B C     1 
ATOM   8143  O  O     . VAL F 3 336 ? 6.646  60.350  82.875  1.00 44.20  ? 336  VAL B O     1 
ATOM   8144  C  CB    . VAL F 3 336 ? 9.209  62.061  82.031  1.00 47.10  ? 336  VAL B CB    1 
ATOM   8145  C  CG1   . VAL F 3 336 ? 8.006  62.925  82.347  1.00 39.32  ? 336  VAL B CG1   1 
ATOM   8146  C  CG2   . VAL F 3 336 ? 10.461 62.681  82.611  1.00 49.51  ? 336  VAL B CG2   1 
ATOM   8147  N  N     . ARG F 3 337 ? 7.597  59.542  80.994  1.00 50.91  ? 337  ARG B N     1 
ATOM   8148  C  CA    . ARG F 3 337 ? 6.356  58.982  80.470  1.00 54.14  ? 337  ARG B CA    1 
ATOM   8149  C  C     . ARG F 3 337 ? 5.951  57.896  81.457  1.00 55.76  ? 337  ARG B C     1 
ATOM   8150  O  O     . ARG F 3 337 ? 4.778  57.727  81.790  1.00 58.36  ? 337  ARG B O     1 
ATOM   8151  C  CB    . ARG F 3 337 ? 6.580  58.357  79.081  1.00 53.82  ? 337  ARG B CB    1 
ATOM   8152  C  CG    . ARG F 3 337 ? 7.007  59.351  77.989  1.00 58.73  ? 337  ARG B CG    1 
ATOM   8153  C  CD    . ARG F 3 337 ? 7.067  58.747  76.570  1.00 63.00  ? 337  ARG B CD    1 
ATOM   8154  N  NE    . ARG F 3 337 ? 8.234  57.892  76.316  1.00 72.43  ? 337  ARG B NE    1 
ATOM   8155  C  CZ    . ARG F 3 337 ? 8.261  56.567  76.483  1.00 75.60  ? 337  ARG B CZ    1 
ATOM   8156  N  NH1   . ARG F 3 337 ? 7.182  55.915  76.915  1.00 68.87  ? 337  ARG B NH1   1 
ATOM   8157  N  NH2   . ARG F 3 337 ? 9.367  55.887  76.191  1.00 66.39  ? 337  ARG B NH2   1 
ATOM   8158  N  N     . LEU F 3 338 ? 6.959  57.175  81.932  1.00 55.13  ? 338  LEU B N     1 
ATOM   8159  C  CA    . LEU F 3 338 ? 6.778  56.085  82.873  1.00 53.16  ? 338  LEU B CA    1 
ATOM   8160  C  C     . LEU F 3 338 ? 6.214  56.558  84.199  1.00 55.68  ? 338  LEU B C     1 
ATOM   8161  O  O     . LEU F 3 338 ? 5.199  56.046  84.656  1.00 56.54  ? 338  LEU B O     1 
ATOM   8162  C  CB    . LEU F 3 338 ? 8.115  55.400  83.105  1.00 48.28  ? 338  LEU B CB    1 
ATOM   8163  C  CG    . LEU F 3 338 ? 8.105  53.887  83.253  1.00 51.01  ? 338  LEU B CG    1 
ATOM   8164  C  CD1   . LEU F 3 338 ? 7.426  53.271  82.032  1.00 50.56  ? 338  LEU B CD1   1 
ATOM   8165  C  CD2   . LEU F 3 338 ? 9.546  53.393  83.400  1.00 47.99  ? 338  LEU B CD2   1 
ATOM   8166  N  N     . LEU F 3 339 ? 6.879  57.527  84.822  1.00 57.29  ? 339  LEU B N     1 
ATOM   8167  C  CA    . LEU F 3 339 ? 6.422  58.048  86.104  1.00 56.61  ? 339  LEU B CA    1 
ATOM   8168  C  C     . LEU F 3 339 ? 5.046  58.680  86.005  1.00 62.64  ? 339  LEU B C     1 
ATOM   8169  O  O     . LEU F 3 339 ? 4.284  58.655  86.971  1.00 63.96  ? 339  LEU B O     1 
ATOM   8170  C  CB    . LEU F 3 339 ? 7.391  59.092  86.660  1.00 36.02  ? 339  LEU B CB    1 
ATOM   8171  C  CG    . LEU F 3 339 ? 8.675  58.646  87.355  1.00 34.74  ? 339  LEU B CG    1 
ATOM   8172  C  CD1   . LEU F 3 339 ? 9.456  59.872  87.753  1.00 28.06  ? 339  LEU B CD1   1 
ATOM   8173  C  CD2   . LEU F 3 339 ? 8.379  57.797  88.578  1.00 25.74  ? 339  LEU B CD2   1 
ATOM   8174  N  N     . GLU F 3 340 ? 4.727  59.251  84.845  1.00 66.67  ? 340  GLU B N     1 
ATOM   8175  C  CA    . GLU F 3 340 ? 3.438  59.904  84.663  1.00 71.55  ? 340  GLU B CA    1 
ATOM   8176  C  C     . GLU F 3 340 ? 2.392  59.049  83.950  1.00 80.10  ? 340  GLU B C     1 
ATOM   8177  O  O     . GLU F 3 340 ? 2.058  59.296  82.795  1.00 80.82  ? 340  GLU B O     1 
ATOM   8178  C  CB    . GLU F 3 340 ? 3.632  61.223  83.919  1.00 59.79  ? 340  GLU B CB    1 
ATOM   8179  C  CG    . GLU F 3 340 ? 4.485  62.216  84.678  1.00 67.89  ? 340  GLU B CG    1 
ATOM   8180  C  CD    . GLU F 3 340 ? 4.756  63.493  83.893  1.00 72.27  ? 340  GLU B CD    1 
ATOM   8181  O  OE1   . GLU F 3 340 ? 5.446  64.389  84.434  1.00 65.68  ? 340  GLU B OE1   1 
ATOM   8182  O  OE2   . GLU F 3 340 ? 4.283  63.605  82.739  1.00 67.66  ? 340  GLU B OE2   1 
ATOM   8183  N  N     . ASP F 3 341 ? 1.870  58.044  84.648  1.00 89.35  ? 341  ASP B N     1 
ATOM   8184  C  CA    . ASP F 3 341 ? 0.849  57.174  84.079  1.00 95.17  ? 341  ASP B CA    1 
ATOM   8185  C  C     . ASP F 3 341 ? -0.250 56.939  85.116  1.00 99.43  ? 341  ASP B C     1 
ATOM   8186  O  O     . ASP F 3 341 ? -1.389 57.403  84.882  1.00 100.91 ? 341  ASP B O     1 
ATOM   8187  C  CB    . ASP F 3 341 ? 1.464  55.837  83.650  1.00 96.23  ? 341  ASP B CB    1 
ATOM   8188  C  CG    . ASP F 3 341 ? 0.542  55.032  82.745  1.00 100.07 ? 341  ASP B CG    1 
ATOM   8189  O  OD1   . ASP F 3 341 ? -0.579 54.685  83.183  1.00 99.91  ? 341  ASP B OD1   1 
ATOM   8190  O  OD2   . ASP F 3 341 ? 0.939  54.746  81.592  1.00 95.99  ? 341  ASP B OD2   1 
ATOM   8191  N  N     . ASP G 3 21  ? 70.532 26.749  50.445  1.00 107.22 ? 21   ASP E N     1 
ATOM   8192  C  CA    . ASP G 3 21  ? 71.218 25.529  50.964  1.00 114.89 ? 21   ASP E CA    1 
ATOM   8193  C  C     . ASP G 3 21  ? 70.240 24.550  51.615  1.00 114.92 ? 21   ASP E C     1 
ATOM   8194  O  O     . ASP G 3 21  ? 70.108 23.406  51.169  1.00 113.41 ? 21   ASP E O     1 
ATOM   8195  C  CB    . ASP G 3 21  ? 72.293 25.921  51.986  1.00 122.56 ? 21   ASP E CB    1 
ATOM   8196  C  CG    . ASP G 3 21  ? 73.041 24.714  52.549  1.00 125.48 ? 21   ASP E CG    1 
ATOM   8197  O  OD1   . ASP G 3 21  ? 73.827 24.897  53.505  1.00 126.33 ? 21   ASP E OD1   1 
ATOM   8198  O  OD2   . ASP G 3 21  ? 72.850 23.586  52.036  1.00 124.36 ? 21   ASP E OD2   1 
ATOM   8199  N  N     . GLU G 3 22  ? 69.563 24.996  52.672  1.00 115.54 ? 22   GLU E N     1 
ATOM   8200  C  CA    . GLU G 3 22  ? 68.608 24.138  53.372  1.00 113.58 ? 22   GLU E CA    1 
ATOM   8201  C  C     . GLU G 3 22  ? 67.201 24.170  52.769  1.00 110.93 ? 22   GLU E C     1 
ATOM   8202  O  O     . GLU G 3 22  ? 66.334 23.387  53.161  1.00 110.64 ? 22   GLU E O     1 
ATOM   8203  C  CB    . GLU G 3 22  ? 68.557 24.488  54.870  1.00 117.72 ? 22   GLU E CB    1 
ATOM   8204  C  CG    . GLU G 3 22  ? 68.354 25.963  55.206  1.00 121.82 ? 22   GLU E CG    1 
ATOM   8205  C  CD    . GLU G 3 22  ? 68.158 26.201  56.705  1.00 122.75 ? 22   GLU E CD    1 
ATOM   8206  O  OE1   . GLU G 3 22  ? 68.117 27.382  57.127  1.00 120.65 ? 22   GLU E OE1   1 
ATOM   8207  O  OE2   . GLU G 3 22  ? 68.037 25.206  57.460  1.00 120.08 ? 22   GLU E OE2   1 
ATOM   8208  N  N     . VAL G 3 23  ? 66.976 25.068  51.814  1.00 107.22 ? 23   VAL E N     1 
ATOM   8209  C  CA    . VAL G 3 23  ? 65.674 25.149  51.165  1.00 101.00 ? 23   VAL E CA    1 
ATOM   8210  C  C     . VAL G 3 23  ? 65.527 23.919  50.276  1.00 99.27  ? 23   VAL E C     1 
ATOM   8211  O  O     . VAL G 3 23  ? 64.417 23.509  49.943  1.00 97.11  ? 23   VAL E O     1 
ATOM   8212  C  CB    . VAL G 3 23  ? 65.539 26.423  50.293  1.00 92.10  ? 23   VAL E CB    1 
ATOM   8213  C  CG1   . VAL G 3 23  ? 65.869 27.661  51.121  1.00 87.54  ? 23   VAL E CG1   1 
ATOM   8214  C  CG2   . VAL G 3 23  ? 66.442 26.324  49.073  1.00 77.33  ? 23   VAL E CG2   1 
ATOM   8215  N  N     . ARG G 3 24  ? 66.665 23.343  49.892  1.00 98.28  ? 24   ARG E N     1 
ATOM   8216  C  CA    . ARG G 3 24  ? 66.689 22.148  49.055  1.00 96.46  ? 24   ARG E CA    1 
ATOM   8217  C  C     . ARG G 3 24  ? 66.005 21.043  49.834  1.00 92.75  ? 24   ARG E C     1 
ATOM   8218  O  O     . ARG G 3 24  ? 65.117 20.358  49.333  1.00 86.54  ? 24   ARG E O     1 
ATOM   8219  C  CB    . ARG G 3 24  ? 68.134 21.734  48.750  1.00 108.03 ? 24   ARG E CB    1 
ATOM   8220  C  CG    . ARG G 3 24  ? 68.906 22.690  47.836  1.00 115.59 ? 24   ARG E CG    1 
ATOM   8221  C  CD    . ARG G 3 24  ? 70.393 22.313  47.740  1.00 118.77 ? 24   ARG E CD    1 
ATOM   8222  N  NE    . ARG G 3 24  ? 70.612 20.951  47.246  1.00 123.48 ? 24   ARG E NE    1 
ATOM   8223  C  CZ    . ARG G 3 24  ? 71.182 19.976  47.953  1.00 126.42 ? 24   ARG E CZ    1 
ATOM   8224  N  NH1   . ARG G 3 24  ? 71.596 20.204  49.195  1.00 124.27 ? 24   ARG E NH1   1 
ATOM   8225  N  NH2   . ARG G 3 24  ? 71.339 18.770  47.418  1.00 126.46 ? 24   ARG E NH2   1 
ATOM   8226  N  N     . LYS G 3 25  ? 66.440 20.881  51.075  1.00 93.94  ? 25   LYS E N     1 
ATOM   8227  C  CA    . LYS G 3 25  ? 65.886 19.879  51.970  1.00 95.99  ? 25   LYS E CA    1 
ATOM   8228  C  C     . LYS G 3 25  ? 64.396 20.157  52.195  1.00 95.78  ? 25   LYS E C     1 
ATOM   8229  O  O     . LYS G 3 25  ? 63.560 19.259  52.072  1.00 98.26  ? 25   LYS E O     1 
ATOM   8230  C  CB    . LYS G 3 25  ? 66.650 19.921  53.300  1.00 94.89  ? 25   LYS E CB    1 
ATOM   8231  C  CG    . LYS G 3 25  ? 66.038 19.118  54.435  1.00 98.24  ? 25   LYS E CG    1 
ATOM   8232  C  CD    . LYS G 3 25  ? 66.746 19.437  55.755  1.00 97.91  ? 25   LYS E CD    1 
ATOM   8233  C  CE    . LYS G 3 25  ? 66.075 18.756  56.942  1.00 95.46  ? 25   LYS E CE    1 
ATOM   8234  N  NZ    . LYS G 3 25  ? 64.658 19.198  57.093  1.00 96.56  ? 25   LYS E NZ    1 
ATOM   8235  N  N     . ASN G 3 26  ? 64.070 21.408  52.512  1.00 93.95  ? 26   ASN E N     1 
ATOM   8236  C  CA    . ASN G 3 26  ? 62.685 21.794  52.759  1.00 88.92  ? 26   ASN E CA    1 
ATOM   8237  C  C     . ASN G 3 26  ? 61.753 21.475  51.595  1.00 85.88  ? 26   ASN E C     1 
ATOM   8238  O  O     . ASN G 3 26  ? 60.677 20.909  51.803  1.00 83.06  ? 26   ASN E O     1 
ATOM   8239  C  CB    . ASN G 3 26  ? 62.599 23.283  53.094  1.00 89.11  ? 26   ASN E CB    1 
ATOM   8240  C  CG    . ASN G 3 26  ? 63.211 23.610  54.438  1.00 90.40  ? 26   ASN E CG    1 
ATOM   8241  O  OD1   . ASN G 3 26  ? 62.955 22.922  55.430  1.00 90.24  ? 26   ASN E OD1   1 
ATOM   8242  N  ND2   . ASN G 3 26  ? 64.017 24.670  54.484  1.00 87.67  ? 26   ASN E ND2   1 
ATOM   8243  N  N     . LEU G 3 27  ? 62.154 21.846  50.378  1.00 85.56  ? 27   LEU E N     1 
ATOM   8244  C  CA    . LEU G 3 27  ? 61.336 21.571  49.203  1.00 83.43  ? 27   LEU E CA    1 
ATOM   8245  C  C     . LEU G 3 27  ? 61.137 20.074  49.052  1.00 84.80  ? 27   LEU E C     1 
ATOM   8246  O  O     . LEU G 3 27  ? 60.108 19.626  48.548  1.00 84.36  ? 27   LEU E O     1 
ATOM   8247  C  CB    . LEU G 3 27  ? 61.977 22.131  47.934  1.00 70.87  ? 27   LEU E CB    1 
ATOM   8248  C  CG    . LEU G 3 27  ? 61.878 23.641  47.718  1.00 67.13  ? 27   LEU E CG    1 
ATOM   8249  C  CD1   . LEU G 3 27  ? 62.108 23.963  46.239  1.00 63.38  ? 27   LEU E CD1   1 
ATOM   8250  C  CD2   . LEU G 3 27  ? 60.498 24.124  48.141  1.00 62.14  ? 27   LEU E CD2   1 
ATOM   8251  N  N     . MET G 3 28  ? 62.129 19.301  49.480  1.00 87.50  ? 28   MET E N     1 
ATOM   8252  C  CA    . MET G 3 28  ? 62.022 17.851  49.415  1.00 91.03  ? 28   MET E CA    1 
ATOM   8253  C  C     . MET G 3 28  ? 60.863 17.455  50.321  1.00 90.89  ? 28   MET E C     1 
ATOM   8254  O  O     . MET G 3 28  ? 59.863 16.898  49.863  1.00 90.34  ? 28   MET E O     1 
ATOM   8255  C  CB    . MET G 3 28  ? 63.307 17.191  49.919  1.00 101.77 ? 28   MET E CB    1 
ATOM   8256  C  CG    . MET G 3 28  ? 64.462 17.166  48.927  1.00 108.17 ? 28   MET E CG    1 
ATOM   8257  S  SD    . MET G 3 28  ? 66.013 16.632  49.719  1.00 115.91 ? 28   MET E SD    1 
ATOM   8258  C  CE    . MET G 3 28  ? 65.462 15.125  50.613  1.00 111.08 ? 28   MET E CE    1 
ATOM   8259  N  N     . ASP G 3 29  ? 61.009 17.758  51.610  1.00 90.19  ? 29   ASP E N     1 
ATOM   8260  C  CA    . ASP G 3 29  ? 59.985 17.447  52.603  1.00 89.52  ? 29   ASP E CA    1 
ATOM   8261  C  C     . ASP G 3 29  ? 58.658 18.013  52.111  1.00 84.89  ? 29   ASP E C     1 
ATOM   8262  O  O     . ASP G 3 29  ? 57.590 17.456  52.369  1.00 84.94  ? 29   ASP E O     1 
ATOM   8263  C  CB    . ASP G 3 29  ? 60.336 18.084  53.954  1.00 102.53 ? 29   ASP E CB    1 
ATOM   8264  C  CG    . ASP G 3 29  ? 61.794 17.890  54.340  1.00 111.96 ? 29   ASP E CG    1 
ATOM   8265  O  OD1   . ASP G 3 29  ? 62.275 16.735  54.316  1.00 116.71 ? 29   ASP E OD1   1 
ATOM   8266  O  OD2   . ASP G 3 29  ? 62.457 18.897  54.677  1.00 112.33 ? 29   ASP E OD2   1 
ATOM   8267  N  N     . MET G 3 30  ? 58.753 19.136  51.406  1.00 80.13  ? 30   MET E N     1 
ATOM   8268  C  CA    . MET G 3 30  ? 57.604 19.827  50.844  1.00 77.32  ? 30   MET E CA    1 
ATOM   8269  C  C     . MET G 3 30  ? 56.896 18.963  49.805  1.00 75.87  ? 30   MET E C     1 
ATOM   8270  O  O     . MET G 3 30  ? 55.683 18.773  49.866  1.00 73.25  ? 30   MET E O     1 
ATOM   8271  C  CB    . MET G 3 30  ? 58.075 21.138  50.213  1.00 75.53  ? 30   MET E CB    1 
ATOM   8272  C  CG    . MET G 3 30  ? 57.347 21.539  48.947  1.00 71.69  ? 30   MET E CG    1 
ATOM   8273  S  SD    . MET G 3 30  ? 55.709 22.189  49.247  1.00 64.87  ? 30   MET E SD    1 
ATOM   8274  C  CE    . MET G 3 30  ? 55.991 23.960  48.921  1.00 55.69  ? 30   MET E CE    1 
ATOM   8275  N  N     . PHE G 3 31  ? 57.662 18.447  48.850  1.00 76.67  ? 31   PHE E N     1 
ATOM   8276  C  CA    . PHE G 3 31  ? 57.110 17.603  47.797  1.00 78.73  ? 31   PHE E CA    1 
ATOM   8277  C  C     . PHE G 3 31  ? 56.855 16.196  48.310  1.00 79.06  ? 31   PHE E C     1 
ATOM   8278  O  O     . PHE G 3 31  ? 55.961 15.501  47.828  1.00 77.71  ? 31   PHE E O     1 
ATOM   8279  C  CB    . PHE G 3 31  ? 58.070 17.548  46.607  1.00 84.00  ? 31   PHE E CB    1 
ATOM   8280  C  CG    . PHE G 3 31  ? 58.098 18.810  45.784  1.00 92.52  ? 31   PHE E CG    1 
ATOM   8281  C  CD1   . PHE G 3 31  ? 59.105 19.017  44.844  1.00 97.02  ? 31   PHE E CD1   1 
ATOM   8282  C  CD2   . PHE G 3 31  ? 57.111 19.782  45.931  1.00 89.93  ? 31   PHE E CD2   1 
ATOM   8283  C  CE1   . PHE G 3 31  ? 59.131 20.177  44.065  1.00 96.21  ? 31   PHE E CE1   1 
ATOM   8284  C  CE2   . PHE G 3 31  ? 57.128 20.944  45.157  1.00 87.03  ? 31   PHE E CE2   1 
ATOM   8285  C  CZ    . PHE G 3 31  ? 58.137 21.141  44.222  1.00 92.42  ? 31   PHE E CZ    1 
ATOM   8286  N  N     . ARG G 3 32  ? 57.651 15.782  49.288  1.00 81.31  ? 32   ARG E N     1 
ATOM   8287  C  CA    . ARG G 3 32  ? 57.533 14.458  49.888  1.00 82.16  ? 32   ARG E CA    1 
ATOM   8288  C  C     . ARG G 3 32  ? 56.096 14.221  50.353  1.00 82.59  ? 32   ARG E C     1 
ATOM   8289  O  O     . ARG G 3 32  ? 55.642 13.084  50.464  1.00 76.89  ? 32   ARG E O     1 
ATOM   8290  C  CB    . ARG G 3 32  ? 58.502 14.356  51.067  1.00 79.84  ? 32   ARG E CB    1 
ATOM   8291  C  CG    . ARG G 3 32  ? 58.699 12.965  51.650  1.00 76.22  ? 32   ARG E CG    1 
ATOM   8292  C  CD    . ARG G 3 32  ? 59.486 13.088  52.945  1.00 75.02  ? 32   ARG E CD    1 
ATOM   8293  N  NE    . ARG G 3 32  ? 58.816 14.053  53.808  1.00 79.45  ? 32   ARG E NE    1 
ATOM   8294  C  CZ    . ARG G 3 32  ? 59.274 14.483  54.976  1.00 78.15  ? 32   ARG E CZ    1 
ATOM   8295  N  NH1   . ARG G 3 32  ? 60.432 14.033  55.449  1.00 75.74  ? 32   ARG E NH1   1 
ATOM   8296  N  NH2   . ARG G 3 32  ? 58.558 15.365  55.669  1.00 77.04  ? 32   ARG E NH2   1 
ATOM   8297  N  N     . ASP G 3 33  ? 55.392 15.314  50.625  1.00 85.79  ? 33   ASP E N     1 
ATOM   8298  C  CA    . ASP G 3 33  ? 54.000 15.274  51.062  1.00 87.95  ? 33   ASP E CA    1 
ATOM   8299  C  C     . ASP G 3 33  ? 53.285 16.343  50.245  1.00 89.54  ? 33   ASP E C     1 
ATOM   8300  O  O     . ASP G 3 33  ? 53.082 17.452  50.735  1.00 91.43  ? 33   ASP E O     1 
ATOM   8301  C  CB    . ASP G 3 33  ? 53.874 15.649  52.547  1.00 87.90  ? 33   ASP E CB    1 
ATOM   8302  C  CG    . ASP G 3 33  ? 54.740 14.794  53.459  1.00 91.14  ? 33   ASP E CG    1 
ATOM   8303  O  OD1   . ASP G 3 33  ? 54.524 13.563  53.506  1.00 97.52  ? 33   ASP E OD1   1 
ATOM   8304  O  OD2   . ASP G 3 33  ? 55.633 15.359  54.139  1.00 85.46  ? 33   ASP E OD2   1 
ATOM   8305  N  N     . ARG G 3 34  ? 52.917 16.042  49.004  1.00 91.04  ? 34   ARG E N     1 
ATOM   8306  C  CA    . ARG G 3 34  ? 52.234 17.047  48.201  1.00 92.82  ? 34   ARG E CA    1 
ATOM   8307  C  C     . ARG G 3 34  ? 50.723 16.923  48.332  1.00 92.83  ? 34   ARG E C     1 
ATOM   8308  O  O     . ARG G 3 34  ? 49.977 17.844  47.987  1.00 92.76  ? 34   ARG E O     1 
ATOM   8309  C  CB    . ARG G 3 34  ? 52.649 16.956  46.726  1.00 100.51 ? 34   ARG E CB    1 
ATOM   8310  C  CG    . ARG G 3 34  ? 52.185 15.721  45.950  1.00 109.24 ? 34   ARG E CG    1 
ATOM   8311  C  CD    . ARG G 3 34  ? 52.301 15.994  44.444  1.00 112.91 ? 34   ARG E CD    1 
ATOM   8312  N  NE    . ARG G 3 34  ? 52.014 14.838  43.592  1.00 119.99 ? 34   ARG E NE    1 
ATOM   8313  C  CZ    . ARG G 3 34  ? 52.811 13.779  43.460  1.00 121.58 ? 34   ARG E CZ    1 
ATOM   8314  N  NH1   . ARG G 3 34  ? 53.959 13.712  44.131  1.00 120.93 ? 34   ARG E NH1   1 
ATOM   8315  N  NH2   . ARG G 3 34  ? 52.470 12.793  42.636  1.00 118.15 ? 34   ARG E NH2   1 
ATOM   8316  N  N     . GLN G 3 35  ? 50.279 15.783  48.850  1.00 91.31  ? 35   GLN E N     1 
ATOM   8317  C  CA    . GLN G 3 35  ? 48.855 15.535  49.038  1.00 90.15  ? 35   GLN E CA    1 
ATOM   8318  C  C     . GLN G 3 35  ? 48.351 16.480  50.116  1.00 86.81  ? 35   GLN E C     1 
ATOM   8319  O  O     . GLN G 3 35  ? 47.147 16.588  50.346  1.00 85.83  ? 35   GLN E O     1 
ATOM   8320  C  CB    . GLN G 3 35  ? 48.620 14.085  49.475  1.00 97.65  ? 35   GLN E CB    1 
ATOM   8321  C  CG    . GLN G 3 35  ? 49.418 13.038  48.692  1.00 105.10 ? 35   GLN E CG    1 
ATOM   8322  C  CD    . GLN G 3 35  ? 49.045 12.965  47.215  1.00 112.10 ? 35   GLN E CD    1 
ATOM   8323  O  OE1   . GLN G 3 35  ? 49.647 12.202  46.453  1.00 115.19 ? 35   GLN E OE1   1 
ATOM   8324  N  NE2   . GLN G 3 35  ? 48.051 13.754  46.805  1.00 114.12 ? 35   GLN E NE2   1 
ATOM   8325  N  N     . ALA G 3 36  ? 49.290 17.158  50.774  1.00 84.15  ? 36   ALA E N     1 
ATOM   8326  C  CA    . ALA G 3 36  ? 48.980 18.108  51.840  1.00 77.83  ? 36   ALA E CA    1 
ATOM   8327  C  C     . ALA G 3 36  ? 48.284 19.295  51.225  1.00 76.46  ? 36   ALA E C     1 
ATOM   8328  O  O     . ALA G 3 36  ? 48.045 20.302  51.889  1.00 76.87  ? 36   ALA E O     1 
ATOM   8329  C  CB    . ALA G 3 36  ? 50.256 18.560  52.534  1.00 69.78  ? 36   ALA E CB    1 
ATOM   8330  N  N     . PHE G 3 37  ? 47.980 19.168  49.938  1.00 74.67  ? 37   PHE E N     1 
ATOM   8331  C  CA    . PHE G 3 37  ? 47.291 20.211  49.201  1.00 73.21  ? 37   PHE E CA    1 
ATOM   8332  C  C     . PHE G 3 37  ? 46.405 19.621  48.111  1.00 73.95  ? 37   PHE E C     1 
ATOM   8333  O  O     . PHE G 3 37  ? 46.650 18.520  47.618  1.00 73.46  ? 37   PHE E O     1 
ATOM   8334  C  CB    . PHE G 3 37  ? 48.290 21.167  48.557  1.00 65.37  ? 37   PHE E CB    1 
ATOM   8335  C  CG    . PHE G 3 37  ? 49.190 21.862  49.534  1.00 63.72  ? 37   PHE E CG    1 
ATOM   8336  C  CD1   . PHE G 3 37  ? 50.512 21.461  49.691  1.00 57.70  ? 37   PHE E CD1   1 
ATOM   8337  C  CD2   . PHE G 3 37  ? 48.723 22.936  50.279  1.00 65.99  ? 37   PHE E CD2   1 
ATOM   8338  C  CE1   . PHE G 3 37  ? 51.358 22.125  50.573  1.00 62.76  ? 37   PHE E CE1   1 
ATOM   8339  C  CE2   . PHE G 3 37  ? 49.561 23.607  51.165  1.00 65.81  ? 37   PHE E CE2   1 
ATOM   8340  C  CZ    . PHE G 3 37  ? 50.880 23.202  51.311  1.00 64.58  ? 37   PHE E CZ    1 
ATOM   8341  N  N     . SER G 3 38  ? 45.371 20.371  47.747  1.00 75.73  ? 38   SER E N     1 
ATOM   8342  C  CA    . SER G 3 38  ? 44.448 19.965  46.699  1.00 78.01  ? 38   SER E CA    1 
ATOM   8343  C  C     . SER G 3 38  ? 45.118 20.136  45.336  1.00 77.99  ? 38   SER E C     1 
ATOM   8344  O  O     . SER G 3 38  ? 45.946 21.035  45.155  1.00 76.66  ? 38   SER E O     1 
ATOM   8345  C  CB    . SER G 3 38  ? 43.190 20.831  46.754  1.00 79.23  ? 38   SER E CB    1 
ATOM   8346  O  OG    . SER G 3 38  ? 42.401 20.653  45.590  1.00 87.01  ? 38   SER E OG    1 
ATOM   8347  N  N     . GLU G 3 39  ? 44.769 19.279  44.378  1.00 77.43  ? 39   GLU E N     1 
ATOM   8348  C  CA    . GLU G 3 39  ? 45.358 19.389  43.050  1.00 76.72  ? 39   GLU E CA    1 
ATOM   8349  C  C     . GLU G 3 39  ? 45.160 20.830  42.603  1.00 73.95  ? 39   GLU E C     1 
ATOM   8350  O  O     . GLU G 3 39  ? 46.095 21.487  42.151  1.00 71.81  ? 39   GLU E O     1 
ATOM   8351  C  CB    . GLU G 3 39  ? 44.678 18.434  42.064  1.00 83.95  ? 39   GLU E CB    1 
ATOM   8352  C  CG    . GLU G 3 39  ? 43.191 18.708  41.839  1.00 100.04 ? 39   GLU E CG    1 
ATOM   8353  C  CD    . GLU G 3 39  ? 42.576 17.834  40.745  1.00 104.98 ? 39   GLU E CD    1 
ATOM   8354  O  OE1   . GLU G 3 39  ? 41.352 17.961  40.497  1.00 104.30 ? 39   GLU E OE1   1 
ATOM   8355  O  OE2   . GLU G 3 39  ? 43.316 17.026  40.136  1.00 102.28 ? 39   GLU E OE2   1 
ATOM   8356  N  N     . HIS G 3 40  ? 43.939 21.324  42.767  1.00 69.34  ? 40   HIS E N     1 
ATOM   8357  C  CA    . HIS G 3 40  ? 43.603 22.687  42.381  1.00 65.87  ? 40   HIS E CA    1 
ATOM   8358  C  C     . HIS G 3 40  ? 44.519 23.748  42.975  1.00 62.69  ? 40   HIS E C     1 
ATOM   8359  O  O     . HIS G 3 40  ? 44.766 24.786  42.359  1.00 57.61  ? 40   HIS E O     1 
ATOM   8360  C  CB    . HIS G 3 40  ? 42.155 22.985  42.750  1.00 71.00  ? 40   HIS E CB    1 
ATOM   8361  C  CG    . HIS G 3 40  ? 41.175 22.446  41.764  1.00 79.23  ? 40   HIS E CG    1 
ATOM   8362  N  ND1   . HIS G 3 40  ? 41.145 22.868  40.452  1.00 82.31  ? 40   HIS E ND1   1 
ATOM   8363  C  CD2   . HIS G 3 40  ? 40.229 21.485  41.877  1.00 79.21  ? 40   HIS E CD2   1 
ATOM   8364  C  CE1   . HIS G 3 40  ? 40.222 22.186  39.798  1.00 84.61  ? 40   HIS E CE1   1 
ATOM   8365  N  NE2   . HIS G 3 40  ? 39.652 21.340  40.639  1.00 82.52  ? 40   HIS E NE2   1 
ATOM   8366  N  N     . THR G 3 41  ? 45.018 23.490  44.175  1.00 63.66  ? 41   THR E N     1 
ATOM   8367  C  CA    . THR G 3 41  ? 45.910 24.430  44.825  1.00 63.52  ? 41   THR E CA    1 
ATOM   8368  C  C     . THR G 3 41  ? 47.236 24.364  44.091  1.00 63.13  ? 41   THR E C     1 
ATOM   8369  O  O     . THR G 3 41  ? 47.706 25.367  43.542  1.00 63.17  ? 41   THR E O     1 
ATOM   8370  C  CB    . THR G 3 41  ? 46.127 24.052  46.292  1.00 70.40  ? 41   THR E CB    1 
ATOM   8371  O  OG1   . THR G 3 41  ? 44.863 24.028  46.967  1.00 75.00  ? 41   THR E OG1   1 
ATOM   8372  C  CG2   . THR G 3 41  ? 47.042 25.057  46.967  1.00 71.63  ? 41   THR E CG2   1 
ATOM   8373  N  N     . TRP G 3 42  ? 47.825 23.170  44.071  1.00 60.66  ? 42   TRP E N     1 
ATOM   8374  C  CA    . TRP G 3 42  ? 49.104 22.946  43.403  1.00 58.66  ? 42   TRP E CA    1 
ATOM   8375  C  C     . TRP G 3 42  ? 49.177 23.620  42.040  1.00 58.44  ? 42   TRP E C     1 
ATOM   8376  O  O     . TRP G 3 42  ? 50.177 24.251  41.684  1.00 55.71  ? 42   TRP E O     1 
ATOM   8377  C  CB    . TRP G 3 42  ? 49.350 21.450  43.233  1.00 56.71  ? 42   TRP E CB    1 
ATOM   8378  C  CG    . TRP G 3 42  ? 50.050 20.827  44.385  1.00 56.31  ? 42   TRP E CG    1 
ATOM   8379  C  CD1   . TRP G 3 42  ? 49.549 19.894  45.251  1.00 56.49  ? 42   TRP E CD1   1 
ATOM   8380  C  CD2   . TRP G 3 42  ? 51.392 21.086  44.807  1.00 56.67  ? 42   TRP E CD2   1 
ATOM   8381  N  NE1   . TRP G 3 42  ? 50.500 19.554  46.189  1.00 51.67  ? 42   TRP E NE1   1 
ATOM   8382  C  CE2   . TRP G 3 42  ? 51.639 20.272  45.940  1.00 56.06  ? 42   TRP E CE2   1 
ATOM   8383  C  CE3   . TRP G 3 42  ? 52.411 21.928  44.339  1.00 58.19  ? 42   TRP E CE3   1 
ATOM   8384  C  CZ2   . TRP G 3 42  ? 52.863 20.275  46.612  1.00 53.79  ? 42   TRP E CZ2   1 
ATOM   8385  C  CZ3   . TRP G 3 42  ? 53.634 21.933  45.007  1.00 58.42  ? 42   TRP E CZ3   1 
ATOM   8386  C  CH2   . TRP G 3 42  ? 53.848 21.111  46.134  1.00 58.42  ? 42   TRP E CH2   1 
ATOM   8387  N  N     . LYS G 3 43  ? 48.104 23.472  41.280  1.00 57.78  ? 43   LYS E N     1 
ATOM   8388  C  CA    . LYS G 3 43  ? 48.030 24.052  39.956  1.00 58.26  ? 43   LYS E CA    1 
ATOM   8389  C  C     . LYS G 3 43  ? 48.326 25.543  40.007  1.00 59.68  ? 43   LYS E C     1 
ATOM   8390  O  O     . LYS G 3 43  ? 49.336 26.003  39.471  1.00 59.76  ? 43   LYS E O     1 
ATOM   8391  C  CB    . LYS G 3 43  ? 46.645 23.814  39.379  1.00 62.48  ? 43   LYS E CB    1 
ATOM   8392  C  CG    . LYS G 3 43  ? 46.485 24.312  37.962  1.00 77.82  ? 43   LYS E CG    1 
ATOM   8393  C  CD    . LYS G 3 43  ? 45.020 24.225  37.533  1.00 80.78  ? 43   LYS E CD    1 
ATOM   8394  C  CE    . LYS G 3 43  ? 44.130 25.150  38.400  1.00 76.94  ? 43   LYS E CE    1 
ATOM   8395  N  NZ    . LYS G 3 43  ? 42.670 24.762  38.417  1.00 67.12  ? 43   LYS E NZ    1 
ATOM   8396  N  N     . MET G 3 44  ? 47.454 26.301  40.662  1.00 57.54  ? 44   MET E N     1 
ATOM   8397  C  CA    . MET G 3 44  ? 47.662 27.737  40.754  1.00 57.61  ? 44   MET E CA    1 
ATOM   8398  C  C     . MET G 3 44  ? 49.066 28.047  41.288  1.00 59.21  ? 44   MET E C     1 
ATOM   8399  O  O     . MET G 3 44  ? 49.706 29.005  40.841  1.00 57.50  ? 44   MET E O     1 
ATOM   8400  C  CB    . MET G 3 44  ? 46.610 28.376  41.656  1.00 53.58  ? 44   MET E CB    1 
ATOM   8401  C  CG    . MET G 3 44  ? 45.180 28.303  41.133  1.00 48.58  ? 44   MET E CG    1 
ATOM   8402  S  SD    . MET G 3 44  ? 44.739 29.369  39.710  1.00 53.75  ? 44   MET E SD    1 
ATOM   8403  C  CE    . MET G 3 44  ? 46.051 30.633  39.765  1.00 45.41  ? 44   MET E CE    1 
ATOM   8404  N  N     . LEU G 3 45  ? 49.552 27.245  42.234  1.00 57.02  ? 45   LEU E N     1 
ATOM   8405  C  CA    . LEU G 3 45  ? 50.889 27.484  42.778  1.00 56.19  ? 45   LEU E CA    1 
ATOM   8406  C  C     . LEU G 3 45  ? 51.878 27.561  41.631  1.00 57.65  ? 45   LEU E C     1 
ATOM   8407  O  O     . LEU G 3 45  ? 52.658 28.516  41.519  1.00 54.36  ? 45   LEU E O     1 
ATOM   8408  C  CB    . LEU G 3 45  ? 51.309 26.358  43.724  1.00 50.98  ? 45   LEU E CB    1 
ATOM   8409  C  CG    . LEU G 3 45  ? 52.809 26.301  44.043  1.00 53.82  ? 45   LEU E CG    1 
ATOM   8410  C  CD1   . LEU G 3 45  ? 53.335 27.671  44.447  1.00 47.69  ? 45   LEU E CD1   1 
ATOM   8411  C  CD2   . LEU G 3 45  ? 53.037 25.288  45.148  1.00 53.35  ? 45   LEU E CD2   1 
ATOM   8412  N  N     . LEU G 3 46  ? 51.834 26.535  40.784  1.00 58.41  ? 46   LEU E N     1 
ATOM   8413  C  CA    . LEU G 3 46  ? 52.709 26.449  39.621  1.00 57.20  ? 46   LEU E CA    1 
ATOM   8414  C  C     . LEU G 3 46  ? 52.388 27.628  38.716  1.00 57.26  ? 46   LEU E C     1 
ATOM   8415  O  O     . LEU G 3 46  ? 53.254 28.451  38.406  1.00 54.54  ? 46   LEU E O     1 
ATOM   8416  C  CB    . LEU G 3 46  ? 52.456 25.147  38.854  1.00 55.49  ? 46   LEU E CB    1 
ATOM   8417  C  CG    . LEU G 3 46  ? 52.451 23.824  39.628  1.00 58.58  ? 46   LEU E CG    1 
ATOM   8418  C  CD1   . LEU G 3 46  ? 52.012 22.699  38.682  1.00 58.33  ? 46   LEU E CD1   1 
ATOM   8419  C  CD2   . LEU G 3 46  ? 53.834 23.538  40.217  1.00 50.55  ? 46   LEU E CD2   1 
ATOM   8420  N  N     . SER G 3 47  ? 51.124 27.705  38.315  1.00 55.50  ? 47   SER E N     1 
ATOM   8421  C  CA    . SER G 3 47  ? 50.667 28.758  37.429  1.00 55.80  ? 47   SER E CA    1 
ATOM   8422  C  C     . SER G 3 47  ? 51.207 30.130  37.802  1.00 56.70  ? 47   SER E C     1 
ATOM   8423  O  O     . SER G 3 47  ? 51.600 30.910  36.930  1.00 58.56  ? 47   SER E O     1 
ATOM   8424  C  CB    . SER G 3 47  ? 49.141 28.804  37.403  1.00 52.09  ? 47   SER E CB    1 
ATOM   8425  O  OG    . SER G 3 47  ? 48.685 29.862  36.569  1.00 58.86  ? 47   SER E OG    1 
ATOM   8426  N  N     . VAL G 3 48  ? 51.237 30.434  39.092  1.00 56.78  ? 48   VAL E N     1 
ATOM   8427  C  CA    . VAL G 3 48  ? 51.723 31.735  39.493  1.00 55.49  ? 48   VAL E CA    1 
ATOM   8428  C  C     . VAL G 3 48  ? 53.248 31.760  39.392  1.00 55.64  ? 48   VAL E C     1 
ATOM   8429  O  O     . VAL G 3 48  ? 53.814 32.685  38.809  1.00 52.59  ? 48   VAL E O     1 
ATOM   8430  C  CB    . VAL G 3 48  ? 51.244 32.097  40.919  1.00 52.74  ? 48   VAL E CB    1 
ATOM   8431  C  CG1   . VAL G 3 48  ? 52.145 31.452  41.953  1.00 56.27  ? 48   VAL E CG1   1 
ATOM   8432  C  CG2   . VAL G 3 48  ? 51.187 33.617  41.081  1.00 38.72  ? 48   VAL E CG2   1 
ATOM   8433  N  N     . CYS G 3 49  ? 53.916 30.743  39.932  1.00 55.16  ? 49   CYS E N     1 
ATOM   8434  C  CA    . CYS G 3 49  ? 55.374 30.700  39.850  1.00 58.57  ? 49   CYS E CA    1 
ATOM   8435  C  C     . CYS G 3 49  ? 55.817 31.001  38.428  1.00 60.97  ? 49   CYS E C     1 
ATOM   8436  O  O     . CYS G 3 49  ? 56.804 31.698  38.217  1.00 58.10  ? 49   CYS E O     1 
ATOM   8437  C  CB    . CYS G 3 49  ? 55.902 29.327  40.248  1.00 54.81  ? 49   CYS E CB    1 
ATOM   8438  S  SG    . CYS G 3 49  ? 55.878 29.025  42.006  1.00 56.92  ? 49   CYS E SG    1 
ATOM   8439  N  N     . ARG G 3 50  ? 55.081 30.461  37.456  1.00 63.04  ? 50   ARG E N     1 
ATOM   8440  C  CA    . ARG G 3 50  ? 55.390 30.682  36.046  1.00 63.46  ? 50   ARG E CA    1 
ATOM   8441  C  C     . ARG G 3 50  ? 55.353 32.171  35.720  1.00 62.81  ? 50   ARG E C     1 
ATOM   8442  O  O     . ARG G 3 50  ? 56.321 32.725  35.197  1.00 61.97  ? 50   ARG E O     1 
ATOM   8443  C  CB    . ARG G 3 50  ? 54.395 29.942  35.145  1.00 67.15  ? 50   ARG E CB    1 
ATOM   8444  C  CG    . ARG G 3 50  ? 54.586 28.425  35.086  1.00 69.32  ? 50   ARG E CG    1 
ATOM   8445  C  CD    . ARG G 3 50  ? 53.885 27.824  33.855  1.00 70.33  ? 50   ARG E CD    1 
ATOM   8446  N  NE    . ARG G 3 50  ? 52.421 27.866  33.926  1.00 70.66  ? 50   ARG E NE    1 
ATOM   8447  C  CZ    . ARG G 3 50  ? 51.674 26.903  34.458  1.00 70.93  ? 50   ARG E CZ    1 
ATOM   8448  N  NH1   . ARG G 3 50  ? 52.253 25.819  34.966  1.00 63.81  ? 50   ARG E NH1   1 
ATOM   8449  N  NH2   . ARG G 3 50  ? 50.353 27.019  34.483  1.00 71.76  ? 50   ARG E NH2   1 
ATOM   8450  N  N     . SER G 3 51  ? 54.232 32.816  36.025  1.00 61.15  ? 51   SER E N     1 
ATOM   8451  C  CA    . SER G 3 51  ? 54.099 34.239  35.763  1.00 62.32  ? 51   SER E CA    1 
ATOM   8452  C  C     . SER G 3 51  ? 55.239 34.982  36.455  1.00 63.29  ? 51   SER E C     1 
ATOM   8453  O  O     . SER G 3 51  ? 55.838 35.878  35.872  1.00 63.48  ? 51   SER E O     1 
ATOM   8454  C  CB    . SER G 3 51  ? 52.747 34.753  36.269  1.00 62.43  ? 51   SER E CB    1 
ATOM   8455  O  OG    . SER G 3 51  ? 52.495 36.078  35.816  1.00 57.08  ? 51   SER E OG    1 
ATOM   8456  N  N     . TRP G 3 52  ? 55.542 34.608  37.695  1.00 63.16  ? 52   TRP E N     1 
ATOM   8457  C  CA    . TRP G 3 52  ? 56.630 35.246  38.439  1.00 63.46  ? 52   TRP E CA    1 
ATOM   8458  C  C     . TRP G 3 52  ? 57.921 35.082  37.623  1.00 65.70  ? 52   TRP E C     1 
ATOM   8459  O  O     . TRP G 3 52  ? 58.510 36.064  37.156  1.00 62.14  ? 52   TRP E O     1 
ATOM   8460  C  CB    . TRP G 3 52  ? 56.774 34.577  39.823  1.00 52.23  ? 52   TRP E CB    1 
ATOM   8461  C  CG    . TRP G 3 52  ? 57.922 35.072  40.696  1.00 46.90  ? 52   TRP E CG    1 
ATOM   8462  C  CD1   . TRP G 3 52  ? 58.809 34.298  41.385  1.00 48.65  ? 52   TRP E CD1   1 
ATOM   8463  C  CD2   . TRP G 3 52  ? 58.267 36.433  41.000  1.00 41.98  ? 52   TRP E CD2   1 
ATOM   8464  N  NE1   . TRP G 3 52  ? 59.682 35.086  42.097  1.00 44.00  ? 52   TRP E NE1   1 
ATOM   8465  C  CE2   . TRP G 3 52  ? 59.371 36.399  41.878  1.00 39.46  ? 52   TRP E CE2   1 
ATOM   8466  C  CE3   . TRP G 3 52  ? 57.751 37.671  40.618  1.00 38.02  ? 52   TRP E CE3   1 
ATOM   8467  C  CZ2   . TRP G 3 52  ? 59.965 37.550  42.378  1.00 33.24  ? 52   TRP E CZ2   1 
ATOM   8468  C  CZ3   . TRP G 3 52  ? 58.346 38.822  41.120  1.00 45.28  ? 52   TRP E CZ3   1 
ATOM   8469  C  CH2   . TRP G 3 52  ? 59.441 38.752  41.991  1.00 39.18  ? 52   TRP E CH2   1 
ATOM   8470  N  N     . ALA G 3 53  ? 58.327 33.827  37.443  1.00 68.37  ? 53   ALA E N     1 
ATOM   8471  C  CA    . ALA G 3 53  ? 59.531 33.458  36.696  1.00 68.82  ? 53   ALA E CA    1 
ATOM   8472  C  C     . ALA G 3 53  ? 59.704 34.260  35.408  1.00 68.32  ? 53   ALA E C     1 
ATOM   8473  O  O     . ALA G 3 53  ? 60.790 34.769  35.124  1.00 66.55  ? 53   ALA E O     1 
ATOM   8474  C  CB    . ALA G 3 53  ? 59.492 31.972  36.372  1.00 68.49  ? 53   ALA E CB    1 
ATOM   8475  N  N     . ALA G 3 54  ? 58.636 34.355  34.626  1.00 67.10  ? 54   ALA E N     1 
ATOM   8476  C  CA    . ALA G 3 54  ? 58.681 35.102  33.383  1.00 65.49  ? 54   ALA E CA    1 
ATOM   8477  C  C     . ALA G 3 54  ? 59.093 36.540  33.673  1.00 66.31  ? 54   ALA E C     1 
ATOM   8478  O  O     . ALA G 3 54  ? 60.252 36.909  33.493  1.00 66.80  ? 54   ALA E O     1 
ATOM   8479  C  CB    . ALA G 3 54  ? 57.316 35.075  32.708  1.00 57.73  ? 54   ALA E CB    1 
ATOM   8480  N  N     . TRP G 3 55  ? 58.133 37.343  34.125  1.00 67.57  ? 55   TRP E N     1 
ATOM   8481  C  CA    . TRP G 3 55  ? 58.365 38.748  34.450  1.00 70.49  ? 55   TRP E CA    1 
ATOM   8482  C  C     . TRP G 3 55  ? 59.749 38.957  35.042  1.00 73.90  ? 55   TRP E C     1 
ATOM   8483  O  O     . TRP G 3 55  ? 60.444 39.908  34.690  1.00 74.07  ? 55   TRP E O     1 
ATOM   8484  C  CB    . TRP G 3 55  ? 57.316 39.244  35.446  1.00 67.71  ? 55   TRP E CB    1 
ATOM   8485  C  CG    . TRP G 3 55  ? 57.497 40.674  35.844  1.00 64.53  ? 55   TRP E CG    1 
ATOM   8486  C  CD1   . TRP G 3 55  ? 56.865 41.764  35.316  1.00 66.74  ? 55   TRP E CD1   1 
ATOM   8487  C  CD2   . TRP G 3 55  ? 58.391 41.172  36.838  1.00 61.31  ? 55   TRP E CD2   1 
ATOM   8488  N  NE1   . TRP G 3 55  ? 57.310 42.913  35.924  1.00 63.37  ? 55   TRP E NE1   1 
ATOM   8489  C  CE2   . TRP G 3 55  ? 58.250 42.577  36.863  1.00 60.68  ? 55   TRP E CE2   1 
ATOM   8490  C  CE3   . TRP G 3 55  ? 59.302 40.566  37.712  1.00 61.42  ? 55   TRP E CE3   1 
ATOM   8491  C  CZ2   . TRP G 3 55  ? 58.987 43.387  37.727  1.00 59.02  ? 55   TRP E CZ2   1 
ATOM   8492  C  CZ3   . TRP G 3 55  ? 60.036 41.371  38.571  1.00 61.35  ? 55   TRP E CZ3   1 
ATOM   8493  C  CH2   . TRP G 3 55  ? 59.872 42.771  38.571  1.00 58.37  ? 55   TRP E CH2   1 
ATOM   8494  N  N     . CYS G 3 56  ? 60.144 38.072  35.949  1.00 75.11  ? 56   CYS E N     1 
ATOM   8495  C  CA    . CYS G 3 56  ? 61.455 38.187  36.568  1.00 79.31  ? 56   CYS E CA    1 
ATOM   8496  C  C     . CYS G 3 56  ? 62.568 38.202  35.526  1.00 81.94  ? 56   CYS E C     1 
ATOM   8497  O  O     . CYS G 3 56  ? 63.325 39.175  35.431  1.00 84.82  ? 56   CYS E O     1 
ATOM   8498  C  CB    . CYS G 3 56  ? 61.685 37.040  37.551  1.00 84.11  ? 56   CYS E CB    1 
ATOM   8499  S  SG    . CYS G 3 56  ? 61.242 37.446  39.248  1.00 77.68  ? 56   CYS E SG    1 
ATOM   8500  N  N     . LYS G 3 57  ? 62.668 37.130  34.744  1.00 82.65  ? 57   LYS E N     1 
ATOM   8501  C  CA    . LYS G 3 57  ? 63.699 37.040  33.714  1.00 82.66  ? 57   LYS E CA    1 
ATOM   8502  C  C     . LYS G 3 57  ? 63.276 37.708  32.408  1.00 80.82  ? 57   LYS E C     1 
ATOM   8503  O  O     . LYS G 3 57  ? 63.138 37.054  31.373  1.00 80.80  ? 57   LYS E O     1 
ATOM   8504  C  CB    . LYS G 3 57  ? 64.080 35.575  33.466  1.00 89.16  ? 57   LYS E CB    1 
ATOM   8505  C  CG    . LYS G 3 57  ? 64.810 34.913  34.644  1.00 95.02  ? 57   LYS E CG    1 
ATOM   8506  C  CD    . LYS G 3 57  ? 63.881 34.633  35.828  1.00 94.37  ? 57   LYS E CD    1 
ATOM   8507  C  CE    . LYS G 3 57  ? 63.616 33.129  36.012  1.00 96.15  ? 57   LYS E CE    1 
ATOM   8508  N  NZ    . LYS G 3 57  ? 62.982 32.464  34.828  1.00 93.29  ? 57   LYS E NZ    1 
ATOM   8509  N  N     . LEU G 3 58  ? 63.067 39.019  32.493  1.00 78.06  ? 58   LEU E N     1 
ATOM   8510  C  CA    . LEU G 3 58  ? 62.674 39.884  31.379  1.00 78.49  ? 58   LEU E CA    1 
ATOM   8511  C  C     . LEU G 3 58  ? 62.902 41.297  31.905  1.00 80.53  ? 58   LEU E C     1 
ATOM   8512  O  O     . LEU G 3 58  ? 63.005 42.265  31.148  1.00 80.51  ? 58   LEU E O     1 
ATOM   8513  C  CB    . LEU G 3 58  ? 61.199 39.702  31.007  1.00 74.93  ? 58   LEU E CB    1 
ATOM   8514  C  CG    . LEU G 3 58  ? 60.573 40.852  30.194  1.00 75.79  ? 58   LEU E CG    1 
ATOM   8515  C  CD1   . LEU G 3 58  ? 61.428 41.176  28.970  1.00 72.00  ? 58   LEU E CD1   1 
ATOM   8516  C  CD2   . LEU G 3 58  ? 59.156 40.477  29.780  1.00 77.79  ? 58   LEU E CD2   1 
ATOM   8517  N  N     . ASN G 3 59  ? 62.962 41.387  33.230  1.00 81.29  ? 59   ASN E N     1 
ATOM   8518  C  CA    . ASN G 3 59  ? 63.228 42.632  33.933  1.00 80.66  ? 59   ASN E CA    1 
ATOM   8519  C  C     . ASN G 3 59  ? 64.539 42.351  34.658  1.00 81.65  ? 59   ASN E C     1 
ATOM   8520  O  O     . ASN G 3 59  ? 65.089 43.207  35.353  1.00 83.72  ? 59   ASN E O     1 
ATOM   8521  C  CB    . ASN G 3 59  ? 62.100 42.946  34.915  1.00 78.03  ? 59   ASN E CB    1 
ATOM   8522  C  CG    . ASN G 3 59  ? 60.784 43.204  34.213  1.00 78.93  ? 59   ASN E CG    1 
ATOM   8523  O  OD1   . ASN G 3 59  ? 60.614 44.217  33.543  1.00 74.43  ? 59   ASN E OD1   1 
ATOM   8524  N  ND2   . ASN G 3 59  ? 59.848 42.281  34.360  1.00 77.62  ? 59   ASN E ND2   1 
ATOM   8525  N  N     . ASN G 3 60  ? 65.019 41.122  34.460  1.00 82.66  ? 60   ASN E N     1 
ATOM   8526  C  CA    . ASN G 3 60  ? 66.270 40.624  35.025  1.00 85.84  ? 60   ASN E CA    1 
ATOM   8527  C  C     . ASN G 3 60  ? 66.359 40.679  36.552  1.00 84.17  ? 60   ASN E C     1 
ATOM   8528  O  O     . ASN G 3 60  ? 66.949 41.601  37.119  1.00 83.73  ? 60   ASN E O     1 
ATOM   8529  C  CB    . ASN G 3 60  ? 67.450 41.375  34.392  1.00 98.74  ? 60   ASN E CB    1 
ATOM   8530  C  CG    . ASN G 3 60  ? 68.436 40.439  33.711  1.00 104.76 ? 60   ASN E CG    1 
ATOM   8531  O  OD1   . ASN G 3 60  ? 69.277 39.818  34.368  1.00 103.99 ? 60   ASN E OD1   1 
ATOM   8532  N  ND2   . ASN G 3 60  ? 68.323 40.318  32.389  1.00 108.05 ? 60   ASN E ND2   1 
ATOM   8533  N  N     . ARG G 3 61  ? 65.772 39.677  37.206  1.00 82.51  ? 61   ARG E N     1 
ATOM   8534  C  CA    . ARG G 3 61  ? 65.773 39.595  38.662  1.00 81.49  ? 61   ARG E CA    1 
ATOM   8535  C  C     . ARG G 3 61  ? 65.783 38.138  39.100  1.00 79.90  ? 61   ARG E C     1 
ATOM   8536  O  O     . ARG G 3 61  ? 65.165 37.288  38.457  1.00 77.44  ? 61   ARG E O     1 
ATOM   8537  C  CB    . ARG G 3 61  ? 64.524 40.275  39.241  1.00 79.01  ? 61   ARG E CB    1 
ATOM   8538  C  CG    . ARG G 3 61  ? 63.712 41.068  38.228  1.00 77.93  ? 61   ARG E CG    1 
ATOM   8539  C  CD    . ARG G 3 61  ? 64.223 42.484  38.049  1.00 78.42  ? 61   ARG E CD    1 
ATOM   8540  N  NE    . ARG G 3 61  ? 63.809 43.342  39.149  1.00 83.63  ? 61   ARG E NE    1 
ATOM   8541  C  CZ    . ARG G 3 61  ? 63.313 44.565  38.993  1.00 86.68  ? 61   ARG E CZ    1 
ATOM   8542  N  NH1   . ARG G 3 61  ? 63.169 45.078  37.778  1.00 82.11  ? 61   ARG E NH1   1 
ATOM   8543  N  NH2   . ARG G 3 61  ? 62.947 45.276  40.052  1.00 88.51  ? 61   ARG E NH2   1 
ATOM   8544  N  N     . LYS G 3 62  ? 66.493 37.843  40.185  1.00 79.52  ? 62   LYS E N     1 
ATOM   8545  C  CA    . LYS G 3 62  ? 66.522 36.474  40.690  1.00 83.03  ? 62   LYS E CA    1 
ATOM   8546  C  C     . LYS G 3 62  ? 65.090 36.178  41.119  1.00 84.27  ? 62   LYS E C     1 
ATOM   8547  O  O     . LYS G 3 62  ? 64.501 36.952  41.873  1.00 86.38  ? 62   LYS E O     1 
ATOM   8548  C  CB    . LYS G 3 62  ? 67.476 36.345  41.886  1.00 84.68  ? 62   LYS E CB    1 
ATOM   8549  C  CG    . LYS G 3 62  ? 68.927 36.797  41.655  1.00 88.95  ? 62   LYS E CG    1 
ATOM   8550  C  CD    . LYS G 3 62  ? 69.058 38.327  41.540  1.00 95.13  ? 62   LYS E CD    1 
ATOM   8551  C  CE    . LYS G 3 62  ? 70.528 38.778  41.454  1.00 97.13  ? 62   LYS E CE    1 
ATOM   8552  N  NZ    . LYS G 3 62  ? 70.674 40.275  41.421  1.00 94.08  ? 62   LYS E NZ    1 
ATOM   8553  N  N     . TRP G 3 63  ? 64.528 35.065  40.648  1.00 82.87  ? 63   TRP E N     1 
ATOM   8554  C  CA    . TRP G 3 63  ? 63.138 34.732  40.977  1.00 81.38  ? 63   TRP E CA    1 
ATOM   8555  C  C     . TRP G 3 63  ? 62.918 34.076  42.354  1.00 79.13  ? 63   TRP E C     1 
ATOM   8556  O  O     . TRP G 3 63  ? 61.865 34.280  42.952  1.00 79.63  ? 63   TRP E O     1 
ATOM   8557  C  CB    . TRP G 3 63  ? 62.531 33.811  39.915  1.00 81.88  ? 63   TRP E CB    1 
ATOM   8558  C  CG    . TRP G 3 63  ? 62.767 32.334  40.145  1.00 84.96  ? 63   TRP E CG    1 
ATOM   8559  C  CD1   . TRP G 3 63  ? 63.897 31.627  39.849  1.00 84.42  ? 63   TRP E CD1   1 
ATOM   8560  C  CD2   . TRP G 3 63  ? 61.845 31.392  40.721  1.00 88.32  ? 63   TRP E CD2   1 
ATOM   8561  N  NE1   . TRP G 3 63  ? 63.738 30.309  40.205  1.00 88.00  ? 63   TRP E NE1   1 
ATOM   8562  C  CE2   . TRP G 3 63  ? 62.491 30.136  40.744  1.00 89.04  ? 63   TRP E CE2   1 
ATOM   8563  C  CE3   . TRP G 3 63  ? 60.538 31.488  41.222  1.00 85.26  ? 63   TRP E CE3   1 
ATOM   8564  C  CZ2   . TRP G 3 63  ? 61.874 28.982  41.244  1.00 85.97  ? 63   TRP E CZ2   1 
ATOM   8565  C  CZ3   . TRP G 3 63  ? 59.923 30.337  41.718  1.00 83.28  ? 63   TRP E CZ3   1 
ATOM   8566  C  CH2   . TRP G 3 63  ? 60.594 29.104  41.726  1.00 83.72  ? 63   TRP E CH2   1 
ATOM   8567  N  N     . PHE G 3 64  ? 63.885 33.314  42.856  1.00 74.41  ? 64   PHE E N     1 
ATOM   8568  C  CA    . PHE G 3 64  ? 63.702 32.655  44.128  1.00 72.38  ? 64   PHE E CA    1 
ATOM   8569  C  C     . PHE G 3 64  ? 65.048 32.331  44.735  1.00 72.82  ? 64   PHE E C     1 
ATOM   8570  O  O     . PHE G 3 64  ? 65.855 31.679  44.095  1.00 71.94  ? 64   PHE E O     1 
ATOM   8571  C  CB    . PHE G 3 64  ? 62.893 31.355  43.925  1.00 66.94  ? 64   PHE E CB    1 
ATOM   8572  C  CG    . PHE G 3 64  ? 62.971 30.408  45.085  1.00 65.18  ? 64   PHE E CG    1 
ATOM   8573  C  CD1   . PHE G 3 64  ? 64.051 29.524  45.212  1.00 62.19  ? 64   PHE E CD1   1 
ATOM   8574  C  CD2   . PHE G 3 64  ? 61.976 30.402  46.061  1.00 62.97  ? 64   PHE E CD2   1 
ATOM   8575  C  CE1   . PHE G 3 64  ? 64.148 28.656  46.304  1.00 62.81  ? 64   PHE E CE1   1 
ATOM   8576  C  CE2   . PHE G 3 64  ? 62.061 29.532  47.168  1.00 69.89  ? 64   PHE E CE2   1 
ATOM   8577  C  CZ    . PHE G 3 64  ? 63.150 28.651  47.287  1.00 66.48  ? 64   PHE E CZ    1 
ATOM   8578  N  N     . PRO G 3 65  ? 65.304 32.762  45.979  1.00 74.47  ? 65   PRO E N     1 
ATOM   8579  C  CA    . PRO G 3 65  ? 64.319 33.547  46.755  1.00 75.55  ? 65   PRO E CA    1 
ATOM   8580  C  C     . PRO G 3 65  ? 64.159 35.027  46.302  1.00 75.82  ? 65   PRO E C     1 
ATOM   8581  O  O     . PRO G 3 65  ? 65.143 35.724  46.007  1.00 76.25  ? 65   PRO E O     1 
ATOM   8582  C  CB    . PRO G 3 65  ? 64.833 33.425  48.186  1.00 76.80  ? 65   PRO E CB    1 
ATOM   8583  C  CG    . PRO G 3 65  ? 65.774 32.209  48.123  1.00 77.13  ? 65   PRO E CG    1 
ATOM   8584  C  CD    . PRO G 3 65  ? 66.444 32.340  46.818  1.00 76.62  ? 65   PRO E CD    1 
ATOM   8585  N  N     . ALA G 3 66  ? 62.907 35.469  46.199  1.00 75.28  ? 66   ALA E N     1 
ATOM   8586  C  CA    . ALA G 3 66  ? 62.575 36.818  45.738  1.00 73.58  ? 66   ALA E CA    1 
ATOM   8587  C  C     . ALA G 3 66  ? 62.771 37.929  46.767  1.00 74.12  ? 66   ALA E C     1 
ATOM   8588  O  O     . ALA G 3 66  ? 62.253 37.856  47.878  1.00 74.09  ? 66   ALA E O     1 
ATOM   8589  C  CB    . ALA G 3 66  ? 61.144 36.830  45.239  1.00 65.59  ? 66   ALA E CB    1 
ATOM   8590  N  N     . GLU G 3 67  ? 63.510 38.966  46.382  1.00 76.78  ? 67   GLU E N     1 
ATOM   8591  C  CA    . GLU G 3 67  ? 63.721 40.111  47.262  1.00 79.13  ? 67   GLU E CA    1 
ATOM   8592  C  C     . GLU G 3 67  ? 62.389 40.875  47.302  1.00 76.41  ? 67   GLU E C     1 
ATOM   8593  O  O     . GLU G 3 67  ? 61.696 41.009  46.280  1.00 75.08  ? 67   GLU E O     1 
ATOM   8594  C  CB    . GLU G 3 67  ? 64.829 41.036  46.725  1.00 94.53  ? 67   GLU E CB    1 
ATOM   8595  C  CG    . GLU G 3 67  ? 66.268 40.483  46.805  1.00 106.53 ? 67   GLU E CG    1 
ATOM   8596  C  CD    . GLU G 3 67  ? 66.916 40.639  48.182  1.00 114.46 ? 67   GLU E CD    1 
ATOM   8597  O  OE1   . GLU G 3 67  ? 66.428 40.023  49.154  1.00 117.57 ? 67   GLU E OE1   1 
ATOM   8598  O  OE2   . GLU G 3 67  ? 67.919 41.382  48.293  1.00 116.67 ? 67   GLU E OE2   1 
ATOM   8599  N  N     . PRO G 3 68  ? 62.016 41.387  48.487  1.00 73.51  ? 68   PRO E N     1 
ATOM   8600  C  CA    . PRO G 3 68  ? 60.763 42.131  48.638  1.00 70.04  ? 68   PRO E CA    1 
ATOM   8601  C  C     . PRO G 3 68  ? 60.625 43.284  47.660  1.00 69.13  ? 68   PRO E C     1 
ATOM   8602  O  O     . PRO G 3 68  ? 59.518 43.679  47.303  1.00 66.58  ? 68   PRO E O     1 
ATOM   8603  C  CB    . PRO G 3 68  ? 60.820 42.602  50.085  1.00 69.07  ? 68   PRO E CB    1 
ATOM   8604  C  CG    . PRO G 3 68  ? 62.292 42.775  50.309  1.00 68.34  ? 68   PRO E CG    1 
ATOM   8605  C  CD    . PRO G 3 68  ? 62.842 41.520  49.700  1.00 70.94  ? 68   PRO E CD    1 
ATOM   8606  N  N     . GLU G 3 69  ? 61.760 43.807  47.215  1.00 70.31  ? 69   GLU E N     1 
ATOM   8607  C  CA    . GLU G 3 69  ? 61.764 44.922  46.278  1.00 72.18  ? 69   GLU E CA    1 
ATOM   8608  C  C     . GLU G 3 69  ? 61.203 44.556  44.901  1.00 71.89  ? 69   GLU E C     1 
ATOM   8609  O  O     . GLU G 3 69  ? 60.422 45.314  44.312  1.00 70.23  ? 69   GLU E O     1 
ATOM   8610  C  CB    . GLU G 3 69  ? 63.182 45.481  46.126  1.00 79.33  ? 69   GLU E CB    1 
ATOM   8611  C  CG    . GLU G 3 69  ? 63.180 46.892  45.592  1.00 85.62  ? 69   GLU E CG    1 
ATOM   8612  C  CD    . GLU G 3 69  ? 62.116 47.737  46.269  1.00 89.35  ? 69   GLU E CD    1 
ATOM   8613  O  OE1   . GLU G 3 69  ? 62.206 47.938  47.500  1.00 87.48  ? 69   GLU E OE1   1 
ATOM   8614  O  OE2   . GLU G 3 69  ? 61.181 48.188  45.570  1.00 89.18  ? 69   GLU E OE2   1 
ATOM   8615  N  N     . ASP G 3 70  ? 61.603 43.394  44.391  1.00 70.28  ? 70   ASP E N     1 
ATOM   8616  C  CA    . ASP G 3 70  ? 61.136 42.939  43.090  1.00 68.96  ? 70   ASP E CA    1 
ATOM   8617  C  C     . ASP G 3 70  ? 59.645 42.602  43.129  1.00 66.75  ? 70   ASP E C     1 
ATOM   8618  O  O     . ASP G 3 70  ? 58.887 42.998  42.237  1.00 66.74  ? 70   ASP E O     1 
ATOM   8619  C  CB    . ASP G 3 70  ? 61.955 41.729  42.642  1.00 76.49  ? 70   ASP E CB    1 
ATOM   8620  C  CG    . ASP G 3 70  ? 63.423 42.075  42.413  1.00 81.68  ? 70   ASP E CG    1 
ATOM   8621  O  OD1   . ASP G 3 70  ? 64.214 41.148  42.127  1.00 79.58  ? 70   ASP E OD1   1 
ATOM   8622  O  OD2   . ASP G 3 70  ? 63.790 43.272  42.515  1.00 79.17  ? 70   ASP E OD2   1 
ATOM   8623  N  N     . VAL G 3 71  ? 59.222 41.880  44.164  1.00 62.14  ? 71   VAL E N     1 
ATOM   8624  C  CA    . VAL G 3 71  ? 57.814 41.535  44.297  1.00 54.49  ? 71   VAL E CA    1 
ATOM   8625  C  C     . VAL G 3 71  ? 56.997 42.818  44.240  1.00 54.00  ? 71   VAL E C     1 
ATOM   8626  O  O     . VAL G 3 71  ? 56.010 42.913  43.510  1.00 54.15  ? 71   VAL E O     1 
ATOM   8627  C  CB    . VAL G 3 71  ? 57.528 40.854  45.623  1.00 42.65  ? 71   VAL E CB    1 
ATOM   8628  C  CG1   . VAL G 3 71  ? 56.055 40.486  45.693  1.00 38.13  ? 71   VAL E CG1   1 
ATOM   8629  C  CG2   . VAL G 3 71  ? 58.400 39.633  45.771  1.00 37.09  ? 71   VAL E CG2   1 
ATOM   8630  N  N     . ARG G 3 72  ? 57.417 43.800  45.028  1.00 50.78  ? 72   ARG E N     1 
ATOM   8631  C  CA    . ARG G 3 72  ? 56.750 45.090  45.047  1.00 52.16  ? 72   ARG E CA    1 
ATOM   8632  C  C     . ARG G 3 72  ? 56.504 45.470  43.595  1.00 55.38  ? 72   ARG E C     1 
ATOM   8633  O  O     . ARG G 3 72  ? 55.384 45.807  43.199  1.00 53.21  ? 72   ARG E O     1 
ATOM   8634  C  CB    . ARG G 3 72  ? 57.654 46.129  45.713  1.00 49.93  ? 72   ARG E CB    1 
ATOM   8635  C  CG    . ARG G 3 72  ? 57.425 47.560  45.247  1.00 55.93  ? 72   ARG E CG    1 
ATOM   8636  C  CD    . ARG G 3 72  ? 56.483 48.334  46.146  1.00 57.68  ? 72   ARG E CD    1 
ATOM   8637  N  NE    . ARG G 3 72  ? 56.175 49.652  45.594  1.00 64.40  ? 72   ARG E NE    1 
ATOM   8638  C  CZ    . ARG G 3 72  ? 57.091 50.571  45.299  1.00 58.30  ? 72   ARG E CZ    1 
ATOM   8639  N  NH1   . ARG G 3 72  ? 58.377 50.312  45.510  1.00 53.93  ? 72   ARG E NH1   1 
ATOM   8640  N  NH2   . ARG G 3 72  ? 56.730 51.740  44.779  1.00 53.37  ? 72   ARG E NH2   1 
ATOM   8641  N  N     . ASP G 3 73  ? 57.564 45.394  42.798  1.00 58.63  ? 73   ASP E N     1 
ATOM   8642  C  CA    . ASP G 3 73  ? 57.461 45.727  41.383  1.00 62.51  ? 73   ASP E CA    1 
ATOM   8643  C  C     . ASP G 3 73  ? 56.465 44.814  40.684  1.00 62.04  ? 73   ASP E C     1 
ATOM   8644  O  O     . ASP G 3 73  ? 55.478 45.291  40.100  1.00 60.04  ? 73   ASP E O     1 
ATOM   8645  C  CB    . ASP G 3 73  ? 58.832 45.630  40.707  1.00 70.16  ? 73   ASP E CB    1 
ATOM   8646  C  CG    . ASP G 3 73  ? 59.744 46.792  41.077  1.00 76.18  ? 73   ASP E CG    1 
ATOM   8647  O  OD1   . ASP G 3 73  ? 60.100 46.912  42.275  1.00 78.42  ? 73   ASP E OD1   1 
ATOM   8648  O  OD2   . ASP G 3 73  ? 60.092 47.591  40.173  1.00 73.92  ? 73   ASP E OD2   1 
ATOM   8649  N  N     . TYR G 3 74  ? 56.720 43.508  40.758  1.00 60.61  ? 74   TYR E N     1 
ATOM   8650  C  CA    . TYR G 3 74  ? 55.853 42.518  40.136  1.00 61.35  ? 74   TYR E CA    1 
ATOM   8651  C  C     . TYR G 3 74  ? 54.379 42.819  40.368  1.00 61.55  ? 74   TYR E C     1 
ATOM   8652  O  O     . TYR G 3 74  ? 53.616 42.966  39.417  1.00 60.08  ? 74   TYR E O     1 
ATOM   8653  C  CB    . TYR G 3 74  ? 56.173 41.124  40.666  1.00 60.44  ? 74   TYR E CB    1 
ATOM   8654  C  CG    . TYR G 3 74  ? 55.246 40.050  40.140  1.00 60.58  ? 74   TYR E CG    1 
ATOM   8655  C  CD1   . TYR G 3 74  ? 54.984 39.936  38.779  1.00 59.50  ? 74   TYR E CD1   1 
ATOM   8656  C  CD2   . TYR G 3 74  ? 54.642 39.142  41.003  1.00 61.63  ? 74   TYR E CD2   1 
ATOM   8657  C  CE1   . TYR G 3 74  ? 54.143 38.945  38.290  1.00 61.99  ? 74   TYR E CE1   1 
ATOM   8658  C  CE2   . TYR G 3 74  ? 53.801 38.147  40.522  1.00 62.59  ? 74   TYR E CE2   1 
ATOM   8659  C  CZ    . TYR G 3 74  ? 53.555 38.057  39.167  1.00 63.26  ? 74   TYR E CZ    1 
ATOM   8660  O  OH    . TYR G 3 74  ? 52.706 37.088  38.697  1.00 64.42  ? 74   TYR E OH    1 
ATOM   8661  N  N     . LEU G 3 75  ? 53.980 42.913  41.633  1.00 60.27  ? 75   LEU E N     1 
ATOM   8662  C  CA    . LEU G 3 75  ? 52.587 43.199  41.964  1.00 56.54  ? 75   LEU E CA    1 
ATOM   8663  C  C     . LEU G 3 75  ? 52.135 44.463  41.244  1.00 55.97  ? 75   LEU E C     1 
ATOM   8664  O  O     . LEU G 3 75  ? 51.071 44.487  40.624  1.00 53.01  ? 75   LEU E O     1 
ATOM   8665  C  CB    . LEU G 3 75  ? 52.427 43.356  43.481  1.00 46.35  ? 75   LEU E CB    1 
ATOM   8666  C  CG    . LEU G 3 75  ? 52.753 42.073  44.260  1.00 49.35  ? 75   LEU E CG    1 
ATOM   8667  C  CD1   . LEU G 3 75  ? 52.989 42.380  45.718  1.00 51.31  ? 75   LEU E CD1   1 
ATOM   8668  C  CD2   . LEU G 3 75  ? 51.622 41.075  44.088  1.00 45.61  ? 75   LEU E CD2   1 
ATOM   8669  N  N     . LEU G 3 76  ? 52.954 45.508  41.302  1.00 55.68  ? 76   LEU E N     1 
ATOM   8670  C  CA    . LEU G 3 76  ? 52.600 46.751  40.644  1.00 54.51  ? 76   LEU E CA    1 
ATOM   8671  C  C     . LEU G 3 76  ? 52.275 46.534  39.177  1.00 56.48  ? 76   LEU E C     1 
ATOM   8672  O  O     . LEU G 3 76  ? 51.507 47.299  38.583  1.00 53.12  ? 76   LEU E O     1 
ATOM   8673  C  CB    . LEU G 3 76  ? 53.730 47.760  40.787  1.00 49.19  ? 76   LEU E CB    1 
ATOM   8674  C  CG    . LEU G 3 76  ? 53.475 48.796  41.887  1.00 54.96  ? 76   LEU E CG    1 
ATOM   8675  C  CD1   . LEU G 3 76  ? 54.672 49.735  42.019  1.00 51.35  ? 76   LEU E CD1   1 
ATOM   8676  C  CD2   . LEU G 3 76  ? 52.204 49.574  41.558  1.00 54.13  ? 76   LEU E CD2   1 
ATOM   8677  N  N     . TYR G 3 77  ? 52.858 45.484  38.602  1.00 59.53  ? 77   TYR E N     1 
ATOM   8678  C  CA    . TYR G 3 77  ? 52.643 45.133  37.197  1.00 62.63  ? 77   TYR E CA    1 
ATOM   8679  C  C     . TYR G 3 77  ? 51.317 44.403  36.993  1.00 63.67  ? 77   TYR E C     1 
ATOM   8680  O  O     . TYR G 3 77  ? 50.556 44.743  36.084  1.00 63.01  ? 77   TYR E O     1 
ATOM   8681  C  CB    . TYR G 3 77  ? 53.819 44.280  36.685  1.00 69.24  ? 77   TYR E CB    1 
ATOM   8682  C  CG    . TYR G 3 77  ? 53.515 43.381  35.495  1.00 77.86  ? 77   TYR E CG    1 
ATOM   8683  C  CD1   . TYR G 3 77  ? 52.916 43.886  34.336  1.00 79.33  ? 77   TYR E CD1   1 
ATOM   8684  C  CD2   . TYR G 3 77  ? 53.826 42.020  35.537  1.00 76.45  ? 77   TYR E CD2   1 
ATOM   8685  C  CE1   . TYR G 3 77  ? 52.629 43.053  33.254  1.00 79.60  ? 77   TYR E CE1   1 
ATOM   8686  C  CE2   . TYR G 3 77  ? 53.552 41.180  34.462  1.00 77.17  ? 77   TYR E CE2   1 
ATOM   8687  C  CZ    . TYR G 3 77  ? 52.950 41.700  33.323  1.00 80.18  ? 77   TYR E CZ    1 
ATOM   8688  O  OH    . TYR G 3 77  ? 52.660 40.867  32.263  1.00 80.15  ? 77   TYR E OH    1 
ATOM   8689  N  N     . LEU G 3 78  ? 51.042 43.400  37.828  1.00 63.14  ? 78   LEU E N     1 
ATOM   8690  C  CA    . LEU G 3 78  ? 49.789 42.669  37.712  1.00 60.32  ? 78   LEU E CA    1 
ATOM   8691  C  C     . LEU G 3 78  ? 48.677 43.709  37.683  1.00 62.86  ? 78   LEU E C     1 
ATOM   8692  O  O     . LEU G 3 78  ? 47.653 43.518  37.026  1.00 62.87  ? 78   LEU E O     1 
ATOM   8693  C  CB    . LEU G 3 78  ? 49.567 41.744  38.912  1.00 52.97  ? 78   LEU E CB    1 
ATOM   8694  C  CG    . LEU G 3 78  ? 50.440 40.522  39.216  1.00 54.90  ? 78   LEU E CG    1 
ATOM   8695  C  CD1   . LEU G 3 78  ? 50.391 39.537  38.066  1.00 42.03  ? 78   LEU E CD1   1 
ATOM   8696  C  CD2   . LEU G 3 78  ? 51.853 40.966  39.487  1.00 63.19  ? 78   LEU E CD2   1 
ATOM   8697  N  N     . GLN G 3 79  ? 48.882 44.810  38.402  1.00 64.26  ? 79   GLN E N     1 
ATOM   8698  C  CA    . GLN G 3 79  ? 47.889 45.871  38.444  1.00 64.74  ? 79   GLN E CA    1 
ATOM   8699  C  C     . GLN G 3 79  ? 47.761 46.536  37.084  1.00 66.82  ? 79   GLN E C     1 
ATOM   8700  O  O     . GLN G 3 79  ? 46.649 46.733  36.597  1.00 65.30  ? 79   GLN E O     1 
ATOM   8701  C  CB    . GLN G 3 79  ? 48.245 46.920  39.505  1.00 62.30  ? 79   GLN E CB    1 
ATOM   8702  C  CG    . GLN G 3 79  ? 47.513 48.263  39.321  1.00 62.58  ? 79   GLN E CG    1 
ATOM   8703  C  CD    . GLN G 3 79  ? 47.619 49.194  40.528  1.00 62.94  ? 79   GLN E CD    1 
ATOM   8704  O  OE1   . GLN G 3 79  ? 48.702 49.425  41.069  1.00 61.05  ? 79   GLN E OE1   1 
ATOM   8705  N  NE2   . GLN G 3 79  ? 46.486 49.743  40.942  1.00 57.41  ? 79   GLN E NE2   1 
ATOM   8706  N  N     . ALA G 3 80  ? 48.895 46.878  36.474  1.00 68.78  ? 80   ALA E N     1 
ATOM   8707  C  CA    . ALA G 3 80  ? 48.900 47.526  35.158  1.00 69.79  ? 80   ALA E CA    1 
ATOM   8708  C  C     . ALA G 3 80  ? 48.197 46.663  34.123  1.00 69.99  ? 80   ALA E C     1 
ATOM   8709  O  O     . ALA G 3 80  ? 47.531 47.178  33.223  1.00 67.48  ? 80   ALA E O     1 
ATOM   8710  C  CB    . ALA G 3 80  ? 50.319 47.796  34.710  1.00 68.17  ? 80   ALA E CB    1 
ATOM   8711  N  N     . ARG G 3 81  ? 48.358 45.349  34.256  1.00 70.42  ? 81   ARG E N     1 
ATOM   8712  C  CA    . ARG G 3 81  ? 47.734 44.402  33.343  1.00 72.14  ? 81   ARG E CA    1 
ATOM   8713  C  C     . ARG G 3 81  ? 46.216 44.480  33.513  1.00 72.88  ? 81   ARG E C     1 
ATOM   8714  O  O     . ARG G 3 81  ? 45.461 44.120  32.608  1.00 74.88  ? 81   ARG E O     1 
ATOM   8715  C  CB    . ARG G 3 81  ? 48.240 42.980  33.629  1.00 71.66  ? 81   ARG E CB    1 
ATOM   8716  C  CG    . ARG G 3 81  ? 48.515 42.155  32.378  1.00 75.97  ? 81   ARG E CG    1 
ATOM   8717  C  CD    . ARG G 3 81  ? 49.417 40.955  32.666  1.00 77.36  ? 81   ARG E CD    1 
ATOM   8718  N  NE    . ARG G 3 81  ? 48.704 39.841  33.293  1.00 86.26  ? 81   ARG E NE    1 
ATOM   8719  C  CZ    . ARG G 3 81  ? 49.286 38.722  33.731  1.00 88.48  ? 81   ARG E CZ    1 
ATOM   8720  N  NH1   . ARG G 3 81  ? 50.602 38.551  33.618  1.00 79.89  ? 81   ARG E NH1   1 
ATOM   8721  N  NH2   . ARG G 3 81  ? 48.549 37.768  34.287  1.00 88.27  ? 81   ARG E NH2   1 
ATOM   8722  N  N     . GLY G 3 82  ? 45.774 44.957  34.675  1.00 70.31  ? 82   GLY E N     1 
ATOM   8723  C  CA    . GLY G 3 82  ? 44.350 45.093  34.926  1.00 67.41  ? 82   GLY E CA    1 
ATOM   8724  C  C     . GLY G 3 82  ? 43.734 43.979  35.751  1.00 66.26  ? 82   GLY E C     1 
ATOM   8725  O  O     . GLY G 3 82  ? 42.509 43.893  35.880  1.00 61.78  ? 82   GLY E O     1 
ATOM   8726  N  N     . LEU G 3 83  ? 44.576 43.116  36.307  1.00 64.63  ? 83   LEU E N     1 
ATOM   8727  C  CA    . LEU G 3 83  ? 44.086 42.016  37.122  1.00 60.87  ? 83   LEU E CA    1 
ATOM   8728  C  C     . LEU G 3 83  ? 43.297 42.527  38.317  1.00 59.77  ? 83   LEU E C     1 
ATOM   8729  O  O     . LEU G 3 83  ? 43.593 43.588  38.859  1.00 56.74  ? 83   LEU E O     1 
ATOM   8730  C  CB    . LEU G 3 83  ? 45.253 41.173  37.608  1.00 55.18  ? 83   LEU E CB    1 
ATOM   8731  C  CG    . LEU G 3 83  ? 45.997 40.504  36.467  1.00 52.40  ? 83   LEU E CG    1 
ATOM   8732  C  CD1   . LEU G 3 83  ? 47.190 39.731  37.003  1.00 54.83  ? 83   LEU E CD1   1 
ATOM   8733  C  CD2   . LEU G 3 83  ? 45.037 39.589  35.747  1.00 45.68  ? 83   LEU E CD2   1 
ATOM   8734  N  N     . ALA G 3 84  ? 42.291 41.763  38.723  1.00 61.87  ? 84   ALA E N     1 
ATOM   8735  C  CA    . ALA G 3 84  ? 41.467 42.142  39.857  1.00 60.50  ? 84   ALA E CA    1 
ATOM   8736  C  C     . ALA G 3 84  ? 42.255 41.971  41.147  1.00 60.55  ? 84   ALA E C     1 
ATOM   8737  O  O     . ALA G 3 84  ? 43.094 41.072  41.266  1.00 60.10  ? 84   ALA E O     1 
ATOM   8738  C  CB    . ALA G 3 84  ? 40.216 41.299  39.893  1.00 58.64  ? 84   ALA E CB    1 
ATOM   8739  N  N     . VAL G 3 85  ? 41.975 42.847  42.109  1.00 57.85  ? 85   VAL E N     1 
ATOM   8740  C  CA    . VAL G 3 85  ? 42.654 42.833  43.394  1.00 52.55  ? 85   VAL E CA    1 
ATOM   8741  C  C     . VAL G 3 85  ? 42.673 41.441  43.984  1.00 49.42  ? 85   VAL E C     1 
ATOM   8742  O  O     . VAL G 3 85  ? 43.684 41.022  44.544  1.00 45.45  ? 85   VAL E O     1 
ATOM   8743  C  CB    . VAL G 3 85  ? 41.977 43.779  44.393  1.00 51.86  ? 85   VAL E CB    1 
ATOM   8744  C  CG1   . VAL G 3 85  ? 42.826 43.887  45.651  1.00 39.67  ? 85   VAL E CG1   1 
ATOM   8745  C  CG2   . VAL G 3 85  ? 41.785 45.149  43.762  1.00 48.00  ? 85   VAL E CG2   1 
ATOM   8746  N  N     . LYS G 3 86  ? 41.555 40.731  43.848  1.00 47.07  ? 86   LYS E N     1 
ATOM   8747  C  CA    . LYS G 3 86  ? 41.432 39.367  44.365  1.00 46.59  ? 86   LYS E CA    1 
ATOM   8748  C  C     . LYS G 3 86  ? 42.491 38.488  43.712  1.00 45.92  ? 86   LYS E C     1 
ATOM   8749  O  O     . LYS G 3 86  ? 43.093 37.631  44.361  1.00 40.41  ? 86   LYS E O     1 
ATOM   8750  C  CB    . LYS G 3 86  ? 40.045 38.804  44.048  1.00 44.67  ? 86   LYS E CB    1 
ATOM   8751  C  CG    . LYS G 3 86  ? 39.337 38.136  45.211  1.00 49.68  ? 86   LYS E CG    1 
ATOM   8752  C  CD    . LYS G 3 86  ? 40.209 37.091  45.895  1.00 58.66  ? 86   LYS E CD    1 
ATOM   8753  C  CE    . LYS G 3 86  ? 39.363 36.120  46.741  1.00 62.97  ? 86   LYS E CE    1 
ATOM   8754  N  NZ    . LYS G 3 86  ? 38.279 36.788  47.536  1.00 51.28  ? 86   LYS E NZ    1 
ATOM   8755  N  N     . THR G 3 87  ? 42.710 38.711  42.419  1.00 44.90  ? 87   THR E N     1 
ATOM   8756  C  CA    . THR G 3 87  ? 43.692 37.946  41.665  1.00 46.33  ? 87   THR E CA    1 
ATOM   8757  C  C     . THR G 3 87  ? 45.106 38.282  42.110  1.00 47.91  ? 87   THR E C     1 
ATOM   8758  O  O     . THR G 3 87  ? 45.945 37.392  42.263  1.00 47.28  ? 87   THR E O     1 
ATOM   8759  C  CB    . THR G 3 87  ? 43.566 38.211  40.153  1.00 51.89  ? 87   THR E CB    1 
ATOM   8760  O  OG1   . THR G 3 87  ? 42.365 37.605  39.659  1.00 51.65  ? 87   THR E OG1   1 
ATOM   8761  C  CG2   . THR G 3 87  ? 44.751 37.629  39.409  1.00 42.28  ? 87   THR E CG2   1 
ATOM   8762  N  N     . ILE G 3 88  ? 45.380 39.563  42.321  1.00 45.84  ? 88   ILE E N     1 
ATOM   8763  C  CA    . ILE G 3 88  ? 46.713 39.947  42.749  1.00 44.50  ? 88   ILE E CA    1 
ATOM   8764  C  C     . ILE G 3 88  ? 47.034 39.351  44.112  1.00 50.45  ? 88   ILE E C     1 
ATOM   8765  O  O     . ILE G 3 88  ? 48.166 38.936  44.372  1.00 50.29  ? 88   ILE E O     1 
ATOM   8766  C  CB    . ILE G 3 88  ? 46.850 41.444  42.856  1.00 35.21  ? 88   ILE E CB    1 
ATOM   8767  C  CG1   . ILE G 3 88  ? 46.408 42.091  41.555  1.00 33.76  ? 88   ILE E CG1   1 
ATOM   8768  C  CG2   . ILE G 3 88  ? 48.289 41.793  43.155  1.00 25.04  ? 88   ILE E CG2   1 
ATOM   8769  C  CD1   . ILE G 3 88  ? 46.688 43.579  41.502  1.00 27.70  ? 88   ILE E CD1   1 
ATOM   8770  N  N     . GLN G 3 89  ? 46.032 39.321  44.984  1.00 52.64  ? 89   GLN E N     1 
ATOM   8771  C  CA    . GLN G 3 89  ? 46.208 38.773  46.321  1.00 55.31  ? 89   GLN E CA    1 
ATOM   8772  C  C     . GLN G 3 89  ? 46.572 37.299  46.178  1.00 57.08  ? 89   GLN E C     1 
ATOM   8773  O  O     . GLN G 3 89  ? 47.408 36.779  46.915  1.00 56.46  ? 89   GLN E O     1 
ATOM   8774  C  CB    . GLN G 3 89  ? 44.913 38.951  47.132  1.00 59.22  ? 89   GLN E CB    1 
ATOM   8775  C  CG    . GLN G 3 89  ? 44.977 38.526  48.601  1.00 68.04  ? 89   GLN E CG    1 
ATOM   8776  C  CD    . GLN G 3 89  ? 46.100 39.205  49.386  1.00 83.83  ? 89   GLN E CD    1 
ATOM   8777  O  OE1   . GLN G 3 89  ? 47.151 38.602  49.642  1.00 85.66  ? 89   GLN E OE1   1 
ATOM   8778  N  NE2   . GLN G 3 89  ? 45.883 40.465  49.768  1.00 84.80  ? 89   GLN E NE2   1 
ATOM   8779  N  N     . GLN G 3 90  ? 45.949 36.641  45.204  1.00 58.12  ? 90   GLN E N     1 
ATOM   8780  C  CA    . GLN G 3 90  ? 46.204 35.228  44.942  1.00 57.21  ? 90   GLN E CA    1 
ATOM   8781  C  C     . GLN G 3 90  ? 47.660 35.016  44.533  1.00 56.41  ? 90   GLN E C     1 
ATOM   8782  O  O     . GLN G 3 90  ? 48.296 34.043  44.954  1.00 55.00  ? 90   GLN E O     1 
ATOM   8783  C  CB    . GLN G 3 90  ? 45.275 34.717  43.834  1.00 56.94  ? 90   GLN E CB    1 
ATOM   8784  C  CG    . GLN G 3 90  ? 45.648 33.344  43.273  1.00 56.45  ? 90   GLN E CG    1 
ATOM   8785  C  CD    . GLN G 3 90  ? 45.381 32.203  44.241  1.00 63.62  ? 90   GLN E CD    1 
ATOM   8786  O  OE1   . GLN G 3 90  ? 44.237 31.779  44.416  1.00 64.27  ? 90   GLN E OE1   1 
ATOM   8787  N  NE2   . GLN G 3 90  ? 46.439 31.701  44.877  1.00 58.05  ? 90   GLN E NE2   1 
ATOM   8788  N  N     . HIS G 3 91  ? 48.186 35.920  43.710  1.00 54.92  ? 91   HIS E N     1 
ATOM   8789  C  CA    . HIS G 3 91  ? 49.572 35.801  43.271  1.00 54.42  ? 91   HIS E CA    1 
ATOM   8790  C  C     . HIS G 3 91  ? 50.535 36.001  44.435  1.00 54.35  ? 91   HIS E C     1 
ATOM   8791  O  O     . HIS G 3 91  ? 51.313 35.103  44.771  1.00 49.07  ? 91   HIS E O     1 
ATOM   8792  C  CB    . HIS G 3 91  ? 49.888 36.812  42.167  1.00 54.55  ? 91   HIS E CB    1 
ATOM   8793  C  CG    . HIS G 3 91  ? 49.463 36.370  40.802  1.00 60.62  ? 91   HIS E CG    1 
ATOM   8794  N  ND1   . HIS G 3 91  ? 50.082 36.813  39.651  1.00 58.20  ? 91   HIS E ND1   1 
ATOM   8795  C  CD2   . HIS G 3 91  ? 48.473 35.537  40.400  1.00 61.77  ? 91   HIS E CD2   1 
ATOM   8796  C  CE1   . HIS G 3 91  ? 49.491 36.271  38.601  1.00 59.45  ? 91   HIS E CE1   1 
ATOM   8797  N  NE2   . HIS G 3 91  ? 48.511 35.493  39.027  1.00 58.34  ? 91   HIS E NE2   1 
ATOM   8798  N  N     . LEU G 3 92  ? 50.478 37.178  45.048  1.00 54.75  ? 92   LEU E N     1 
ATOM   8799  C  CA    . LEU G 3 92  ? 51.343 37.479  46.174  1.00 52.42  ? 92   LEU E CA    1 
ATOM   8800  C  C     . LEU G 3 92  ? 51.228 36.344  47.178  1.00 53.29  ? 92   LEU E C     1 
ATOM   8801  O  O     . LEU G 3 92  ? 52.226 35.766  47.608  1.00 51.75  ? 92   LEU E O     1 
ATOM   8802  C  CB    . LEU G 3 92  ? 50.917 38.800  46.812  1.00 49.81  ? 92   LEU E CB    1 
ATOM   8803  C  CG    . LEU G 3 92  ? 51.617 39.240  48.101  1.00 47.71  ? 92   LEU E CG    1 
ATOM   8804  C  CD1   . LEU G 3 92  ? 51.450 40.743  48.273  1.00 51.29  ? 92   LEU E CD1   1 
ATOM   8805  C  CD2   . LEU G 3 92  ? 51.029 38.494  49.292  1.00 43.63  ? 92   LEU E CD2   1 
ATOM   8806  N  N     . GLY G 3 93  ? 49.991 36.026  47.531  1.00 52.84  ? 93   GLY E N     1 
ATOM   8807  C  CA    . GLY G 3 93  ? 49.741 34.956  48.478  1.00 54.97  ? 93   GLY E CA    1 
ATOM   8808  C  C     . GLY G 3 93  ? 50.408 33.663  48.070  1.00 56.72  ? 93   GLY E C     1 
ATOM   8809  O  O     . GLY G 3 93  ? 50.887 32.914  48.918  1.00 55.70  ? 93   GLY E O     1 
ATOM   8810  N  N     . GLN G 3 94  ? 50.442 33.393  46.770  1.00 58.97  ? 94   GLN E N     1 
ATOM   8811  C  CA    . GLN G 3 94  ? 51.070 32.175  46.291  1.00 60.89  ? 94   GLN E CA    1 
ATOM   8812  C  C     . GLN G 3 94  ? 52.578 32.200  46.476  1.00 60.43  ? 94   GLN E C     1 
ATOM   8813  O  O     . GLN G 3 94  ? 53.171 31.171  46.798  1.00 58.81  ? 94   GLN E O     1 
ATOM   8814  C  CB    . GLN G 3 94  ? 50.713 31.921  44.828  1.00 65.68  ? 94   GLN E CB    1 
ATOM   8815  C  CG    . GLN G 3 94  ? 49.377 31.194  44.647  1.00 70.34  ? 94   GLN E CG    1 
ATOM   8816  C  CD    . GLN G 3 94  ? 49.332 29.828  45.348  1.00 68.29  ? 94   GLN E CD    1 
ATOM   8817  O  OE1   . GLN G 3 94  ? 48.317 29.129  45.303  1.00 63.03  ? 94   GLN E OE1   1 
ATOM   8818  N  NE2   . GLN G 3 94  ? 50.436 29.448  45.996  1.00 64.94  ? 94   GLN E NE2   1 
ATOM   8819  N  N     . LEU G 3 95  ? 53.202 33.363  46.281  1.00 57.44  ? 95   LEU E N     1 
ATOM   8820  C  CA    . LEU G 3 95  ? 54.647 33.471  46.477  1.00 54.86  ? 95   LEU E CA    1 
ATOM   8821  C  C     . LEU G 3 95  ? 54.967 33.048  47.900  1.00 58.67  ? 95   LEU E C     1 
ATOM   8822  O  O     . LEU G 3 95  ? 55.895 32.278  48.143  1.00 59.93  ? 95   LEU E O     1 
ATOM   8823  C  CB    . LEU G 3 95  ? 55.141 34.907  46.298  1.00 48.03  ? 95   LEU E CB    1 
ATOM   8824  C  CG    . LEU G 3 95  ? 55.347 35.518  44.916  1.00 41.85  ? 95   LEU E CG    1 
ATOM   8825  C  CD1   . LEU G 3 95  ? 56.089 34.527  44.035  1.00 34.28  ? 95   LEU E CD1   1 
ATOM   8826  C  CD2   . LEU G 3 95  ? 54.011 35.890  44.320  1.00 33.32  ? 95   LEU E CD2   1 
ATOM   8827  N  N     . ASN G 3 96  ? 54.182 33.566  48.836  1.00 59.83  ? 96   ASN E N     1 
ATOM   8828  C  CA    . ASN G 3 96  ? 54.356 33.274  50.251  1.00 60.57  ? 96   ASN E CA    1 
ATOM   8829  C  C     . ASN G 3 96  ? 54.379 31.780  50.574  1.00 60.92  ? 96   ASN E C     1 
ATOM   8830  O  O     . ASN G 3 96  ? 55.348 31.286  51.162  1.00 59.44  ? 96   ASN E O     1 
ATOM   8831  C  CB    . ASN G 3 96  ? 53.253 33.966  51.050  1.00 63.96  ? 96   ASN E CB    1 
ATOM   8832  C  CG    . ASN G 3 96  ? 53.210 35.465  50.800  1.00 69.75  ? 96   ASN E CG    1 
ATOM   8833  O  OD1   . ASN G 3 96  ? 54.125 36.198  51.179  1.00 77.58  ? 96   ASN E OD1   1 
ATOM   8834  N  ND2   . ASN G 3 96  ? 52.149 35.925  50.148  1.00 71.93  ? 96   ASN E ND2   1 
ATOM   8835  N  N     . MET G 3 97  ? 53.325 31.058  50.195  1.00 59.00  ? 97   MET E N     1 
ATOM   8836  C  CA    . MET G 3 97  ? 53.268 29.624  50.473  1.00 59.44  ? 97   MET E CA    1 
ATOM   8837  C  C     . MET G 3 97  ? 54.532 28.927  50.031  1.00 58.78  ? 97   MET E C     1 
ATOM   8838  O  O     . MET G 3 97  ? 54.896 27.891  50.584  1.00 56.27  ? 97   MET E O     1 
ATOM   8839  C  CB    . MET G 3 97  ? 52.110 28.946  49.755  1.00 59.52  ? 97   MET E CB    1 
ATOM   8840  C  CG    . MET G 3 97  ? 52.025 27.462  50.098  1.00 57.66  ? 97   MET E CG    1 
ATOM   8841  S  SD    . MET G 3 97  ? 51.144 26.450  48.889  1.00 70.04  ? 97   MET E SD    1 
ATOM   8842  C  CE    . MET G 3 97  ? 49.467 27.231  48.910  1.00 68.79  ? 97   MET E CE    1 
ATOM   8843  N  N     . LEU G 3 98  ? 55.184 29.492  49.018  1.00 60.14  ? 98   LEU E N     1 
ATOM   8844  C  CA    . LEU G 3 98  ? 56.410 28.923  48.474  1.00 59.67  ? 98   LEU E CA    1 
ATOM   8845  C  C     . LEU G 3 98  ? 57.584 29.169  49.405  1.00 61.69  ? 98   LEU E C     1 
ATOM   8846  O  O     . LEU G 3 98  ? 58.415 28.287  49.620  1.00 60.74  ? 98   LEU E O     1 
ATOM   8847  C  CB    . LEU G 3 98  ? 56.716 29.535  47.108  1.00 57.22  ? 98   LEU E CB    1 
ATOM   8848  C  CG    . LEU G 3 98  ? 57.874 28.866  46.366  1.00 58.70  ? 98   LEU E CG    1 
ATOM   8849  C  CD1   . LEU G 3 98  ? 57.410 27.507  45.870  1.00 53.76  ? 98   LEU E CD1   1 
ATOM   8850  C  CD2   . LEU G 3 98  ? 58.326 29.729  45.196  1.00 53.65  ? 98   LEU E CD2   1 
ATOM   8851  N  N     . HIS G 3 99  ? 57.651 30.372  49.956  1.00 60.67  ? 99   HIS E N     1 
ATOM   8852  C  CA    . HIS G 3 99  ? 58.739 30.714  50.854  1.00 63.50  ? 99   HIS E CA    1 
ATOM   8853  C  C     . HIS G 3 99  ? 58.563 30.083  52.233  1.00 65.43  ? 99   HIS E C     1 
ATOM   8854  O  O     . HIS G 3 99  ? 59.494 29.483  52.780  1.00 63.63  ? 99   HIS E O     1 
ATOM   8855  C  CB    . HIS G 3 99  ? 58.846 32.234  50.973  1.00 70.19  ? 99   HIS E CB    1 
ATOM   8856  C  CG    . HIS G 3 99  ? 59.233 32.908  49.693  1.00 72.92  ? 99   HIS E CG    1 
ATOM   8857  N  ND1   . HIS G 3 99  ? 58.594 32.655  48.498  1.00 75.79  ? 99   HIS E ND1   1 
ATOM   8858  C  CD2   . HIS G 3 99  ? 60.191 33.827  49.422  1.00 71.95  ? 99   HIS E CD2   1 
ATOM   8859  C  CE1   . HIS G 3 99  ? 59.142 33.389  47.546  1.00 78.35  ? 99   HIS E CE1   1 
ATOM   8860  N  NE2   . HIS G 3 99  ? 60.113 34.109  48.080  1.00 74.45  ? 99   HIS E NE2   1 
ATOM   8861  N  N     . ARG G 3 100 ? 57.367 30.225  52.795  1.00 67.59  ? 100  ARG E N     1 
ATOM   8862  C  CA    . ARG G 3 100 ? 57.092 29.659  54.105  1.00 68.12  ? 100  ARG E CA    1 
ATOM   8863  C  C     . ARG G 3 100 ? 57.361 28.162  54.050  1.00 67.79  ? 100  ARG E C     1 
ATOM   8864  O  O     . ARG G 3 100 ? 58.028 27.615  54.928  1.00 66.48  ? 100  ARG E O     1 
ATOM   8865  C  CB    . ARG G 3 100 ? 55.640 29.925  54.507  1.00 72.29  ? 100  ARG E CB    1 
ATOM   8866  C  CG    . ARG G 3 100 ? 55.203 29.235  55.792  1.00 81.55  ? 100  ARG E CG    1 
ATOM   8867  C  CD    . ARG G 3 100 ? 53.818 29.710  56.225  1.00 91.41  ? 100  ARG E CD    1 
ATOM   8868  N  NE    . ARG G 3 100 ? 52.866 29.736  55.110  1.00 102.75 ? 100  ARG E NE    1 
ATOM   8869  C  CZ    . ARG G 3 100 ? 52.204 30.823  54.715  1.00 106.29 ? 100  ARG E CZ    1 
ATOM   8870  N  NH1   . ARG G 3 100 ? 52.385 31.980  55.344  1.00 108.77 ? 100  ARG E NH1   1 
ATOM   8871  N  NH2   . ARG G 3 100 ? 51.366 30.759  53.686  1.00 100.84 ? 100  ARG E NH2   1 
ATOM   8872  N  N     . ARG G 3 101 ? 56.859 27.505  53.008  1.00 65.84  ? 101  ARG E N     1 
ATOM   8873  C  CA    . ARG G 3 101 ? 57.067 26.073  52.874  1.00 67.71  ? 101  ARG E CA    1 
ATOM   8874  C  C     . ARG G 3 101 ? 58.448 25.725  52.347  1.00 69.74  ? 101  ARG E C     1 
ATOM   8875  O  O     . ARG G 3 101 ? 58.671 24.602  51.892  1.00 72.40  ? 101  ARG E O     1 
ATOM   8876  C  CB    . ARG G 3 101 ? 56.002 25.439  51.976  1.00 68.10  ? 101  ARG E CB    1 
ATOM   8877  C  CG    . ARG G 3 101 ? 54.855 24.789  52.742  1.00 69.38  ? 101  ARG E CG    1 
ATOM   8878  C  CD    . ARG G 3 101 ? 54.114 25.812  53.583  1.00 70.09  ? 101  ARG E CD    1 
ATOM   8879  N  NE    . ARG G 3 101 ? 52.851 25.302  54.110  1.00 68.77  ? 101  ARG E NE    1 
ATOM   8880  C  CZ    . ARG G 3 101 ? 52.742 24.486  55.154  1.00 68.56  ? 101  ARG E CZ    1 
ATOM   8881  N  NH1   . ARG G 3 101 ? 53.828 24.077  55.795  1.00 64.64  ? 101  ARG E NH1   1 
ATOM   8882  N  NH2   . ARG G 3 101 ? 51.541 24.088  55.560  1.00 67.28  ? 101  ARG E NH2   1 
ATOM   8883  N  N     . SER G 3 102 ? 59.372 26.681  52.403  1.00 71.18  ? 102  SER E N     1 
ATOM   8884  C  CA    . SER G 3 102 ? 60.743 26.440  51.958  1.00 70.45  ? 102  SER E CA    1 
ATOM   8885  C  C     . SER G 3 102 ? 61.672 26.927  53.061  1.00 70.73  ? 102  SER E C     1 
ATOM   8886  O  O     . SER G 3 102 ? 62.891 26.919  52.916  1.00 69.09  ? 102  SER E O     1 
ATOM   8887  C  CB    . SER G 3 102 ? 61.039 27.193  50.665  1.00 69.19  ? 102  SER E CB    1 
ATOM   8888  O  OG    . SER G 3 102 ? 61.298 28.560  50.931  1.00 72.86  ? 102  SER E OG    1 
ATOM   8889  N  N     . GLY G 3 103 ? 61.072 27.361  54.164  1.00 70.72  ? 103  GLY E N     1 
ATOM   8890  C  CA    . GLY G 3 103 ? 61.839 27.837  55.301  1.00 71.08  ? 103  GLY E CA    1 
ATOM   8891  C  C     . GLY G 3 103 ? 62.363 29.250  55.145  1.00 71.79  ? 103  GLY E C     1 
ATOM   8892  O  O     . GLY G 3 103 ? 63.321 29.641  55.812  1.00 71.56  ? 103  GLY E O     1 
ATOM   8893  N  N     . LEU G 3 104 ? 61.732 30.030  54.275  1.00 71.82  ? 104  LEU E N     1 
ATOM   8894  C  CA    . LEU G 3 104 ? 62.173 31.399  54.046  1.00 73.72  ? 104  LEU E CA    1 
ATOM   8895  C  C     . LEU G 3 104 ? 61.152 32.444  54.462  1.00 76.17  ? 104  LEU E C     1 
ATOM   8896  O  O     . LEU G 3 104 ? 59.966 32.145  54.627  1.00 73.89  ? 104  LEU E O     1 
ATOM   8897  C  CB    . LEU G 3 104 ? 62.520 31.590  52.568  1.00 72.82  ? 104  LEU E CB    1 
ATOM   8898  C  CG    . LEU G 3 104 ? 63.830 30.941  52.103  1.00 71.90  ? 104  LEU E CG    1 
ATOM   8899  C  CD1   . LEU G 3 104 ? 63.816 30.763  50.581  1.00 68.55  ? 104  LEU E CD1   1 
ATOM   8900  C  CD2   . LEU G 3 104 ? 65.016 31.804  52.553  1.00 67.20  ? 104  LEU E CD2   1 
ATOM   8901  N  N     . PRO G 3 105 ? 61.608 33.692  54.646  1.00 78.20  ? 105  PRO E N     1 
ATOM   8902  C  CA    . PRO G 3 105 ? 60.742 34.806  55.042  1.00 78.62  ? 105  PRO E CA    1 
ATOM   8903  C  C     . PRO G 3 105 ? 59.849 35.225  53.878  1.00 79.15  ? 105  PRO E C     1 
ATOM   8904  O  O     . PRO G 3 105 ? 60.339 35.704  52.852  1.00 77.90  ? 105  PRO E O     1 
ATOM   8905  C  CB    . PRO G 3 105 ? 61.742 35.895  55.418  1.00 78.99  ? 105  PRO E CB    1 
ATOM   8906  C  CG    . PRO G 3 105 ? 62.855 35.655  54.433  1.00 79.20  ? 105  PRO E CG    1 
ATOM   8907  C  CD    . PRO G 3 105 ? 63.007 34.141  54.513  1.00 78.38  ? 105  PRO E CD    1 
ATOM   8908  N  N     . ARG G 3 106 ? 58.544 35.037  54.045  1.00 77.87  ? 106  ARG E N     1 
ATOM   8909  C  CA    . ARG G 3 106 ? 57.571 35.390  53.019  1.00 76.59  ? 106  ARG E CA    1 
ATOM   8910  C  C     . ARG G 3 106 ? 57.544 36.898  52.709  1.00 76.82  ? 106  ARG E C     1 
ATOM   8911  O  O     . ARG G 3 106 ? 57.583 37.738  53.610  1.00 75.64  ? 106  ARG E O     1 
ATOM   8912  C  CB    . ARG G 3 106 ? 56.190 34.892  53.457  1.00 78.98  ? 106  ARG E CB    1 
ATOM   8913  C  CG    . ARG G 3 106 ? 55.963 34.961  54.960  1.00 84.76  ? 106  ARG E CG    1 
ATOM   8914  C  CD    . ARG G 3 106 ? 54.867 34.002  55.414  1.00 89.69  ? 106  ARG E CD    1 
ATOM   8915  N  NE    . ARG G 3 106 ? 53.554 34.339  54.869  1.00 95.28  ? 106  ARG E NE    1 
ATOM   8916  C  CZ    . ARG G 3 106 ? 52.895 35.465  55.133  1.00 101.29 ? 106  ARG E CZ    1 
ATOM   8917  N  NH1   . ARG G 3 106 ? 53.424 36.375  55.942  1.00 103.91 ? 106  ARG E NH1   1 
ATOM   8918  N  NH2   . ARG G 3 106 ? 51.704 35.684  54.589  1.00 100.32 ? 106  ARG E NH2   1 
ATOM   8919  N  N     . PRO G 3 107 ? 57.496 37.256  51.415  1.00 76.49  ? 107  PRO E N     1 
ATOM   8920  C  CA    . PRO G 3 107 ? 57.468 38.661  50.993  1.00 74.62  ? 107  PRO E CA    1 
ATOM   8921  C  C     . PRO G 3 107 ? 56.365 39.504  51.627  1.00 72.37  ? 107  PRO E C     1 
ATOM   8922  O  O     . PRO G 3 107 ? 56.529 40.710  51.810  1.00 72.44  ? 107  PRO E O     1 
ATOM   8923  C  CB    . PRO G 3 107 ? 57.345 38.565  49.471  1.00 73.99  ? 107  PRO E CB    1 
ATOM   8924  C  CG    . PRO G 3 107 ? 56.718 37.214  49.253  1.00 75.56  ? 107  PRO E CG    1 
ATOM   8925  C  CD    . PRO G 3 107 ? 57.437 36.361  50.249  1.00 76.71  ? 107  PRO E CD    1 
ATOM   8926  N  N     . SER G 3 108 ? 55.243 38.880  51.965  1.00 67.84  ? 108  SER E N     1 
ATOM   8927  C  CA    . SER G 3 108 ? 54.146 39.613  52.596  1.00 68.29  ? 108  SER E CA    1 
ATOM   8928  C  C     . SER G 3 108 ? 54.623 40.203  53.928  1.00 69.36  ? 108  SER E C     1 
ATOM   8929  O  O     . SER G 3 108 ? 53.996 41.116  54.483  1.00 68.86  ? 108  SER E O     1 
ATOM   8930  C  CB    . SER G 3 108 ? 52.956 38.682  52.858  1.00 66.22  ? 108  SER E CB    1 
ATOM   8931  O  OG    . SER G 3 108 ? 52.468 38.107  51.662  1.00 66.50  ? 108  SER E OG    1 
ATOM   8932  N  N     . ASP G 3 109 ? 55.738 39.673  54.430  1.00 71.01  ? 109  ASP E N     1 
ATOM   8933  C  CA    . ASP G 3 109 ? 56.310 40.107  55.701  1.00 72.38  ? 109  ASP E CA    1 
ATOM   8934  C  C     . ASP G 3 109 ? 57.085 41.409  55.642  1.00 69.24  ? 109  ASP E C     1 
ATOM   8935  O  O     . ASP G 3 109 ? 57.320 42.026  56.675  1.00 66.32  ? 109  ASP E O     1 
ATOM   8936  C  CB    . ASP G 3 109 ? 57.239 39.024  56.286  1.00 82.91  ? 109  ASP E CB    1 
ATOM   8937  C  CG    . ASP G 3 109 ? 56.482 37.909  57.017  1.00 86.81  ? 109  ASP E CG    1 
ATOM   8938  O  OD1   . ASP G 3 109 ? 55.265 38.061  57.274  1.00 85.10  ? 109  ASP E OD1   1 
ATOM   8939  O  OD2   . ASP G 3 109 ? 57.121 36.880  57.348  1.00 87.49  ? 109  ASP E OD2   1 
ATOM   8940  N  N     . SER G 3 110 ? 57.492 41.832  54.451  1.00 67.60  ? 110  SER E N     1 
ATOM   8941  C  CA    . SER G 3 110 ? 58.265 43.068  54.351  1.00 66.47  ? 110  SER E CA    1 
ATOM   8942  C  C     . SER G 3 110 ? 57.419 44.323  54.155  1.00 64.47  ? 110  SER E C     1 
ATOM   8943  O  O     . SER G 3 110 ? 56.384 44.309  53.488  1.00 61.74  ? 110  SER E O     1 
ATOM   8944  C  CB    . SER G 3 110 ? 59.297 42.975  53.223  1.00 68.40  ? 110  SER E CB    1 
ATOM   8945  O  OG    . SER G 3 110 ? 58.706 43.277  51.970  1.00 70.91  ? 110  SER E OG    1 
ATOM   8946  N  N     . ASN G 3 111 ? 57.900 45.410  54.747  1.00 61.02  ? 111  ASN E N     1 
ATOM   8947  C  CA    . ASN G 3 111 ? 57.259 46.715  54.693  1.00 61.62  ? 111  ASN E CA    1 
ATOM   8948  C  C     . ASN G 3 111 ? 56.929 47.103  53.245  1.00 60.63  ? 111  ASN E C     1 
ATOM   8949  O  O     . ASN G 3 111 ? 55.793 47.456  52.918  1.00 54.87  ? 111  ASN E O     1 
ATOM   8950  C  CB    . ASN G 3 111 ? 58.208 47.739  55.340  1.00 68.80  ? 111  ASN E CB    1 
ATOM   8951  C  CG    . ASN G 3 111 ? 57.546 49.082  55.607  1.00 73.77  ? 111  ASN E CG    1 
ATOM   8952  O  OD1   . ASN G 3 111 ? 56.469 49.154  56.217  1.00 71.98  ? 111  ASN E OD1   1 
ATOM   8953  N  ND2   . ASN G 3 111 ? 58.199 50.161  55.167  1.00 71.57  ? 111  ASN E ND2   1 
ATOM   8954  N  N     . ALA G 3 112 ? 57.929 47.015  52.378  1.00 60.46  ? 112  ALA E N     1 
ATOM   8955  C  CA    . ALA G 3 112 ? 57.761 47.364  50.978  1.00 58.00  ? 112  ALA E CA    1 
ATOM   8956  C  C     . ALA G 3 112 ? 56.486 46.782  50.370  1.00 57.32  ? 112  ALA E C     1 
ATOM   8957  O  O     . ALA G 3 112 ? 55.601 47.523  49.940  1.00 56.94  ? 112  ALA E O     1 
ATOM   8958  C  CB    . ALA G 3 112 ? 58.976 46.900  50.185  1.00 54.30  ? 112  ALA E CB    1 
ATOM   8959  N  N     . VAL G 3 113 ? 56.393 45.456  50.349  1.00 55.05  ? 113  VAL E N     1 
ATOM   8960  C  CA    . VAL G 3 113 ? 55.246 44.762  49.769  1.00 56.20  ? 113  VAL E CA    1 
ATOM   8961  C  C     . VAL G 3 113 ? 53.884 45.058  50.402  1.00 58.60  ? 113  VAL E C     1 
ATOM   8962  O  O     . VAL G 3 113 ? 52.931 45.412  49.699  1.00 55.20  ? 113  VAL E O     1 
ATOM   8963  C  CB    . VAL G 3 113 ? 55.461 43.248  49.807  1.00 53.79  ? 113  VAL E CB    1 
ATOM   8964  C  CG1   . VAL G 3 113 ? 54.288 42.541  49.166  1.00 51.78  ? 113  VAL E CG1   1 
ATOM   8965  C  CG2   . VAL G 3 113 ? 56.742 42.899  49.100  1.00 52.02  ? 113  VAL E CG2   1 
ATOM   8966  N  N     . SER G 3 114 ? 53.787 44.902  51.722  1.00 58.30  ? 114  SER E N     1 
ATOM   8967  C  CA    . SER G 3 114 ? 52.526 45.135  52.417  1.00 57.99  ? 114  SER E CA    1 
ATOM   8968  C  C     . SER G 3 114 ? 52.081 46.578  52.289  1.00 57.77  ? 114  SER E C     1 
ATOM   8969  O  O     . SER G 3 114 ? 50.926 46.896  52.551  1.00 58.38  ? 114  SER E O     1 
ATOM   8970  C  CB    . SER G 3 114 ? 52.635 44.752  53.894  1.00 58.53  ? 114  SER E CB    1 
ATOM   8971  O  OG    . SER G 3 114 ? 53.612 45.543  54.536  1.00 73.99  ? 114  SER E OG    1 
ATOM   8972  N  N     . LEU G 3 115 ? 52.988 47.457  51.882  1.00 57.02  ? 115  LEU E N     1 
ATOM   8973  C  CA    . LEU G 3 115 ? 52.629 48.860  51.701  1.00 56.30  ? 115  LEU E CA    1 
ATOM   8974  C  C     . LEU G 3 115 ? 52.086 49.119  50.294  1.00 56.99  ? 115  LEU E C     1 
ATOM   8975  O  O     . LEU G 3 115 ? 51.373 50.099  50.063  1.00 54.30  ? 115  LEU E O     1 
ATOM   8976  C  CB    . LEU G 3 115 ? 53.837 49.757  51.963  1.00 50.81  ? 115  LEU E CB    1 
ATOM   8977  C  CG    . LEU G 3 115 ? 53.695 50.615  53.217  1.00 50.16  ? 115  LEU E CG    1 
ATOM   8978  C  CD1   . LEU G 3 115 ? 54.996 51.339  53.507  1.00 46.39  ? 115  LEU E CD1   1 
ATOM   8979  C  CD2   . LEU G 3 115 ? 52.544 51.586  53.023  1.00 35.82  ? 115  LEU E CD2   1 
ATOM   8980  N  N     . VAL G 3 116 ? 52.423 48.232  49.360  1.00 55.74  ? 116  VAL E N     1 
ATOM   8981  C  CA    . VAL G 3 116 ? 51.968 48.362  47.981  1.00 59.02  ? 116  VAL E CA    1 
ATOM   8982  C  C     . VAL G 3 116 ? 50.548 47.860  47.847  1.00 60.83  ? 116  VAL E C     1 
ATOM   8983  O  O     . VAL G 3 116 ? 49.709 48.500  47.209  1.00 64.40  ? 116  VAL E O     1 
ATOM   8984  C  CB    . VAL G 3 116 ? 52.796 47.520  47.011  1.00 57.57  ? 116  VAL E CB    1 
ATOM   8985  C  CG1   . VAL G 3 116 ? 52.971 48.284  45.709  1.00 50.43  ? 116  VAL E CG1   1 
ATOM   8986  C  CG2   . VAL G 3 116 ? 54.113 47.134  47.641  1.00 62.03  ? 116  VAL E CG2   1 
ATOM   8987  N  N     . MET G 3 117 ? 50.293 46.692  48.431  1.00 60.42  ? 117  MET E N     1 
ATOM   8988  C  CA    . MET G 3 117 ? 48.972 46.092  48.364  1.00 60.22  ? 117  MET E CA    1 
ATOM   8989  C  C     . MET G 3 117 ? 47.930 47.045  48.923  1.00 61.25  ? 117  MET E C     1 
ATOM   8990  O  O     . MET G 3 117 ? 46.822 47.154  48.392  1.00 62.54  ? 117  MET E O     1 
ATOM   8991  C  CB    . MET G 3 117 ? 48.952 44.779  49.137  1.00 62.37  ? 117  MET E CB    1 
ATOM   8992  C  CG    . MET G 3 117 ? 49.799 43.685  48.504  1.00 62.72  ? 117  MET E CG    1 
ATOM   8993  S  SD    . MET G 3 117 ? 48.987 42.727  47.199  1.00 80.31  ? 117  MET E SD    1 
ATOM   8994  C  CE    . MET G 3 117 ? 47.698 43.861  46.642  1.00 67.06  ? 117  MET E CE    1 
ATOM   8995  N  N     . ARG G 3 118 ? 48.295 47.745  49.991  1.00 59.26  ? 118  ARG E N     1 
ATOM   8996  C  CA    . ARG G 3 118 ? 47.385 48.694  50.615  1.00 57.17  ? 118  ARG E CA    1 
ATOM   8997  C  C     . ARG G 3 118 ? 47.134 49.851  49.649  1.00 58.61  ? 118  ARG E C     1 
ATOM   8998  O  O     . ARG G 3 118 ? 46.052 50.446  49.633  1.00 57.90  ? 118  ARG E O     1 
ATOM   8999  C  CB    . ARG G 3 118 ? 47.998 49.197  51.923  1.00 52.93  ? 118  ARG E CB    1 
ATOM   9000  C  CG    . ARG G 3 118 ? 47.083 50.062  52.768  1.00 51.74  ? 118  ARG E CG    1 
ATOM   9001  C  CD    . ARG G 3 118 ? 47.680 50.264  54.149  1.00 56.05  ? 118  ARG E CD    1 
ATOM   9002  N  NE    . ARG G 3 118 ? 46.918 51.224  54.936  1.00 62.36  ? 118  ARG E NE    1 
ATOM   9003  C  CZ    . ARG G 3 118 ? 47.149 51.468  56.219  1.00 64.33  ? 118  ARG E CZ    1 
ATOM   9004  N  NH1   . ARG G 3 118 ? 48.122 50.814  56.846  1.00 65.91  ? 118  ARG E NH1   1 
ATOM   9005  N  NH2   . ARG G 3 118 ? 46.409 52.355  56.875  1.00 60.19  ? 118  ARG E NH2   1 
ATOM   9006  N  N     . ARG G 3 119 ? 48.152 50.151  48.845  1.00 59.73  ? 119  ARG E N     1 
ATOM   9007  C  CA    . ARG G 3 119 ? 48.097 51.213  47.843  1.00 57.62  ? 119  ARG E CA    1 
ATOM   9008  C  C     . ARG G 3 119 ? 47.226 50.741  46.700  1.00 56.49  ? 119  ARG E C     1 
ATOM   9009  O  O     . ARG G 3 119 ? 46.285 51.415  46.311  1.00 56.52  ? 119  ARG E O     1 
ATOM   9010  C  CB    . ARG G 3 119 ? 49.503 51.504  47.330  1.00 57.70  ? 119  ARG E CB    1 
ATOM   9011  C  CG    . ARG G 3 119 ? 49.598 52.466  46.156  1.00 64.94  ? 119  ARG E CG    1 
ATOM   9012  C  CD    . ARG G 3 119 ? 51.076 52.774  45.895  1.00 74.64  ? 119  ARG E CD    1 
ATOM   9013  N  NE    . ARG G 3 119 ? 51.320 53.769  44.851  1.00 77.84  ? 119  ARG E NE    1 
ATOM   9014  C  CZ    . ARG G 3 119 ? 51.326 53.509  43.548  1.00 77.82  ? 119  ARG E CZ    1 
ATOM   9015  N  NH1   . ARG G 3 119 ? 51.098 52.279  43.112  1.00 74.83  ? 119  ARG E NH1   1 
ATOM   9016  N  NH2   . ARG G 3 119 ? 51.574 54.482  42.680  1.00 77.29  ? 119  ARG E NH2   1 
ATOM   9017  N  N     . ILE G 3 120 ? 47.544 49.563  46.179  1.00 54.63  ? 120  ILE E N     1 
ATOM   9018  C  CA    . ILE G 3 120 ? 46.798 48.986  45.072  1.00 54.74  ? 120  ILE E CA    1 
ATOM   9019  C  C     . ILE G 3 120 ? 45.314 48.807  45.383  1.00 54.65  ? 120  ILE E C     1 
ATOM   9020  O  O     . ILE G 3 120 ? 44.460 49.338  44.681  1.00 52.50  ? 120  ILE E O     1 
ATOM   9021  C  CB    . ILE G 3 120 ? 47.373 47.613  44.673  1.00 60.71  ? 120  ILE E CB    1 
ATOM   9022  C  CG1   . ILE G 3 120 ? 48.876 47.729  44.427  1.00 59.97  ? 120  ILE E CG1   1 
ATOM   9023  C  CG2   . ILE G 3 120 ? 46.686 47.106  43.410  1.00 55.67  ? 120  ILE E CG2   1 
ATOM   9024  C  CD1   . ILE G 3 120 ? 49.518 46.424  44.038  1.00 64.65  ? 120  ILE E CD1   1 
ATOM   9025  N  N     . ARG G 3 121 ? 45.011 48.055  46.435  1.00 54.22  ? 121  ARG E N     1 
ATOM   9026  C  CA    . ARG G 3 121 ? 43.622 47.804  46.812  1.00 57.49  ? 121  ARG E CA    1 
ATOM   9027  C  C     . ARG G 3 121 ? 42.797 49.086  46.820  1.00 57.79  ? 121  ARG E C     1 
ATOM   9028  O  O     . ARG G 3 121 ? 41.782 49.177  46.136  1.00 57.14  ? 121  ARG E O     1 
ATOM   9029  C  CB    . ARG G 3 121 ? 43.550 47.118  48.185  1.00 62.87  ? 121  ARG E CB    1 
ATOM   9030  C  CG    . ARG G 3 121 ? 42.173 46.559  48.504  1.00 68.86  ? 121  ARG E CG    1 
ATOM   9031  C  CD    . ARG G 3 121 ? 42.204 45.533  49.629  1.00 80.26  ? 121  ARG E CD    1 
ATOM   9032  N  NE    . ARG G 3 121 ? 42.659 46.104  50.893  1.00 90.84  ? 121  ARG E NE    1 
ATOM   9033  C  CZ    . ARG G 3 121 ? 43.872 45.918  51.404  1.00 93.89  ? 121  ARG E CZ    1 
ATOM   9034  N  NH1   . ARG G 3 121 ? 44.760 45.170  50.754  1.00 90.40  ? 121  ARG E NH1   1 
ATOM   9035  N  NH2   . ARG G 3 121 ? 44.196 46.477  52.567  1.00 93.61  ? 121  ARG E NH2   1 
ATOM   9036  N  N     . LYS G 3 122 ? 43.242 50.077  47.584  1.00 58.24  ? 122  LYS E N     1 
ATOM   9037  C  CA    . LYS G 3 122 ? 42.542 51.355  47.665  1.00 58.98  ? 122  LYS E CA    1 
ATOM   9038  C  C     . LYS G 3 122 ? 42.467 51.990  46.283  1.00 56.89  ? 122  LYS E C     1 
ATOM   9039  O  O     . LYS G 3 122 ? 41.416 52.450  45.840  1.00 53.22  ? 122  LYS E O     1 
ATOM   9040  C  CB    . LYS G 3 122 ? 43.288 52.294  48.618  1.00 60.62  ? 122  LYS E CB    1 
ATOM   9041  C  CG    . LYS G 3 122 ? 42.729 53.713  48.681  1.00 63.93  ? 122  LYS E CG    1 
ATOM   9042  C  CD    . LYS G 3 122 ? 43.704 54.652  49.389  1.00 65.85  ? 122  LYS E CD    1 
ATOM   9043  C  CE    . LYS G 3 122 ? 43.249 56.106  49.302  1.00 73.10  ? 122  LYS E CE    1 
ATOM   9044  N  NZ    . LYS G 3 122 ? 44.298 57.036  49.815  1.00 72.58  ? 122  LYS E NZ    1 
ATOM   9045  N  N     . GLU G 3 123 ? 43.608 52.003  45.612  1.00 58.07  ? 123  GLU E N     1 
ATOM   9046  C  CA    . GLU G 3 123 ? 43.737 52.576  44.277  1.00 65.46  ? 123  GLU E CA    1 
ATOM   9047  C  C     . GLU G 3 123 ? 42.713 51.959  43.319  1.00 67.05  ? 123  GLU E C     1 
ATOM   9048  O  O     . GLU G 3 123 ? 42.092 52.671  42.517  1.00 65.17  ? 123  GLU E O     1 
ATOM   9049  C  CB    . GLU G 3 123 ? 45.163 52.324  43.771  1.00 72.40  ? 123  GLU E CB    1 
ATOM   9050  C  CG    . GLU G 3 123 ? 45.801 53.448  42.971  1.00 76.22  ? 123  GLU E CG    1 
ATOM   9051  C  CD    . GLU G 3 123 ? 47.329 53.332  42.943  1.00 82.54  ? 123  GLU E CD    1 
ATOM   9052  O  OE1   . GLU G 3 123 ? 47.975 53.751  43.932  1.00 79.54  ? 123  GLU E OE1   1 
ATOM   9053  O  OE2   . GLU G 3 123 ? 47.887 52.810  41.945  1.00 81.72  ? 123  GLU E OE2   1 
ATOM   9054  N  N     . ASN G 3 124 ? 42.540 50.637  43.421  1.00 68.23  ? 124  ASN E N     1 
ATOM   9055  C  CA    . ASN G 3 124 ? 41.608 49.890  42.572  1.00 68.74  ? 124  ASN E CA    1 
ATOM   9056  C  C     . ASN G 3 124 ? 40.168 49.985  43.048  1.00 69.81  ? 124  ASN E C     1 
ATOM   9057  O  O     . ASN G 3 124 ? 39.243 49.997  42.234  1.00 67.29  ? 124  ASN E O     1 
ATOM   9058  C  CB    . ASN G 3 124 ? 41.986 48.409  42.504  1.00 73.40  ? 124  ASN E CB    1 
ATOM   9059  C  CG    . ASN G 3 124 ? 43.173 48.148  41.614  1.00 78.80  ? 124  ASN E CG    1 
ATOM   9060  O  OD1   . ASN G 3 124 ? 44.292 48.556  41.914  1.00 79.18  ? 124  ASN E OD1   1 
ATOM   9061  N  ND2   . ASN G 3 124 ? 42.937 47.460  40.505  1.00 80.63  ? 124  ASN E ND2   1 
ATOM   9062  N  N     . VAL G 3 125 ? 39.973 50.036  44.362  1.00 71.16  ? 125  VAL E N     1 
ATOM   9063  C  CA    . VAL G 3 125 ? 38.628 50.118  44.905  1.00 73.90  ? 125  VAL E CA    1 
ATOM   9064  C  C     . VAL G 3 125 ? 37.999 51.428  44.458  1.00 77.32  ? 125  VAL E C     1 
ATOM   9065  O  O     . VAL G 3 125 ? 36.807 51.479  44.172  1.00 76.50  ? 125  VAL E O     1 
ATOM   9066  C  CB    . VAL G 3 125 ? 38.631 50.038  46.450  1.00 75.52  ? 125  VAL E CB    1 
ATOM   9067  C  CG1   . VAL G 3 125 ? 39.119 51.347  47.046  1.00 79.18  ? 125  VAL E CG1   1 
ATOM   9068  C  CG2   . VAL G 3 125 ? 37.240 49.694  46.959  1.00 76.53  ? 125  VAL E CG2   1 
ATOM   9069  N  N     . ASP G 3 126 ? 38.807 52.483  44.383  1.00 81.56  ? 126  ASP E N     1 
ATOM   9070  C  CA    . ASP G 3 126 ? 38.315 53.791  43.956  1.00 86.19  ? 126  ASP E CA    1 
ATOM   9071  C  C     . ASP G 3 126 ? 38.021 53.849  42.454  1.00 87.72  ? 126  ASP E C     1 
ATOM   9072  O  O     . ASP G 3 126 ? 37.090 54.538  42.015  1.00 84.35  ? 126  ASP E O     1 
ATOM   9073  C  CB    . ASP G 3 126 ? 39.324 54.887  44.311  1.00 94.64  ? 126  ASP E CB    1 
ATOM   9074  C  CG    . ASP G 3 126 ? 39.003 55.577  45.626  1.00 102.12 ? 126  ASP E CG    1 
ATOM   9075  O  OD1   . ASP G 3 126 ? 39.586 56.654  45.892  1.00 103.81 ? 126  ASP E OD1   1 
ATOM   9076  O  OD2   . ASP G 3 126 ? 38.173 55.042  46.393  1.00 104.55 ? 126  ASP E OD2   1 
ATOM   9077  N  N     . ALA G 3 127 ? 38.825 53.133  41.671  1.00 91.08  ? 127  ALA E N     1 
ATOM   9078  C  CA    . ALA G 3 127 ? 38.652 53.093  40.224  1.00 94.86  ? 127  ALA E CA    1 
ATOM   9079  C  C     . ALA G 3 127 ? 37.324 52.429  39.882  1.00 96.48  ? 127  ALA E C     1 
ATOM   9080  O  O     . ALA G 3 127 ? 36.797 52.596  38.783  1.00 95.22  ? 127  ALA E O     1 
ATOM   9081  C  CB    . ALA G 3 127 ? 39.802 52.327  39.581  1.00 92.68  ? 127  ALA E CB    1 
ATOM   9082  N  N     . GLY G 3 128 ? 36.793 51.669  40.835  1.00 97.80  ? 128  GLY E N     1 
ATOM   9083  C  CA    . GLY G 3 128 ? 35.530 50.995  40.620  1.00 96.98  ? 128  GLY E CA    1 
ATOM   9084  C  C     . GLY G 3 128 ? 35.636 49.487  40.508  1.00 95.97  ? 128  GLY E C     1 
ATOM   9085  O  O     . GLY G 3 128 ? 34.655 48.827  40.158  1.00 95.24  ? 128  GLY E O     1 
ATOM   9086  N  N     . GLU G 3 129 ? 36.809 48.926  40.790  1.00 94.06  ? 129  GLU E N     1 
ATOM   9087  C  CA    . GLU G 3 129 ? 36.952 47.480  40.704  1.00 91.04  ? 129  GLU E CA    1 
ATOM   9088  C  C     . GLU G 3 129 ? 35.953 46.899  41.693  1.00 88.62  ? 129  GLU E C     1 
ATOM   9089  O  O     . GLU G 3 129 ? 36.110 47.022  42.906  1.00 87.82  ? 129  GLU E O     1 
ATOM   9090  C  CB    . GLU G 3 129 ? 38.370 47.030  41.054  1.00 90.68  ? 129  GLU E CB    1 
ATOM   9091  C  CG    . GLU G 3 129 ? 38.646 45.610  40.576  1.00 92.86  ? 129  GLU E CG    1 
ATOM   9092  C  CD    . GLU G 3 129 ? 39.962 45.053  41.073  1.00 96.74  ? 129  GLU E CD    1 
ATOM   9093  O  OE1   . GLU G 3 129 ? 41.021 45.643  40.761  1.00 97.72  ? 129  GLU E OE1   1 
ATOM   9094  O  OE2   . GLU G 3 129 ? 39.930 44.017  41.777  1.00 97.38  ? 129  GLU E OE2   1 
ATOM   9095  N  N     . ARG G 3 130 ? 34.921 46.263  41.156  1.00 85.00  ? 130  ARG E N     1 
ATOM   9096  C  CA    . ARG G 3 130 ? 33.845 45.702  41.961  1.00 78.32  ? 130  ARG E CA    1 
ATOM   9097  C  C     . ARG G 3 130 ? 33.745 44.193  41.771  1.00 76.26  ? 130  ARG E C     1 
ATOM   9098  O  O     . ARG G 3 130 ? 33.665 43.716  40.641  1.00 76.12  ? 130  ARG E O     1 
ATOM   9099  C  CB    . ARG G 3 130 ? 32.554 46.403  41.531  1.00 68.70  ? 130  ARG E CB    1 
ATOM   9100  C  CG    . ARG G 3 130 ? 31.281 46.056  42.254  1.00 61.20  ? 130  ARG E CG    1 
ATOM   9101  C  CD    . ARG G 3 130 ? 30.208 46.997  41.736  1.00 63.13  ? 130  ARG E CD    1 
ATOM   9102  N  NE    . ARG G 3 130 ? 28.863 46.645  42.173  1.00 70.11  ? 130  ARG E NE    1 
ATOM   9103  C  CZ    . ARG G 3 130 ? 27.777 47.335  41.838  1.00 72.46  ? 130  ARG E CZ    1 
ATOM   9104  N  NH1   . ARG G 3 130 ? 27.887 48.413  41.061  1.00 75.28  ? 130  ARG E NH1   1 
ATOM   9105  N  NH2   . ARG G 3 130 ? 26.582 46.950  42.276  1.00 62.30  ? 130  ARG E NH2   1 
ATOM   9106  N  N     . ALA G 3 131 ? 33.759 43.446  42.873  1.00 74.66  ? 131  ALA E N     1 
ATOM   9107  C  CA    . ALA G 3 131 ? 33.668 41.987  42.810  1.00 71.40  ? 131  ALA E CA    1 
ATOM   9108  C  C     . ALA G 3 131 ? 32.250 41.561  42.481  1.00 71.36  ? 131  ALA E C     1 
ATOM   9109  O  O     . ALA G 3 131 ? 31.294 42.082  43.050  1.00 68.93  ? 131  ALA E O     1 
ATOM   9110  C  CB    . ALA G 3 131 ? 34.088 41.376  44.123  1.00 66.67  ? 131  ALA E CB    1 
ATOM   9111  N  N     . LYS G 3 132 ? 32.117 40.608  41.564  1.00 72.64  ? 132  LYS E N     1 
ATOM   9112  C  CA    . LYS G 3 132 ? 30.805 40.132  41.147  1.00 72.24  ? 132  LYS E CA    1 
ATOM   9113  C  C     . LYS G 3 132 ? 30.532 38.705  41.577  1.00 72.88  ? 132  LYS E C     1 
ATOM   9114  O  O     . LYS G 3 132 ? 31.388 38.047  42.179  1.00 71.39  ? 132  LYS E O     1 
ATOM   9115  C  CB    . LYS G 3 132 ? 30.657 40.250  39.629  1.00 70.67  ? 132  LYS E CB    1 
ATOM   9116  C  CG    . LYS G 3 132 ? 31.910 39.867  38.851  1.00 74.87  ? 132  LYS E CG    1 
ATOM   9117  C  CD    . LYS G 3 132 ? 32.586 41.094  38.220  1.00 77.77  ? 132  LYS E CD    1 
ATOM   9118  C  CE    . LYS G 3 132 ? 31.879 41.549  36.942  1.00 70.26  ? 132  LYS E CE    1 
ATOM   9119  N  NZ    . LYS G 3 132 ? 30.427 41.865  37.141  1.00 62.71  ? 132  LYS E NZ    1 
ATOM   9120  N  N     . GLN G 3 133 ? 29.329 38.237  41.248  1.00 72.84  ? 133  GLN E N     1 
ATOM   9121  C  CA    . GLN G 3 133 ? 28.873 36.894  41.600  1.00 71.46  ? 133  GLN E CA    1 
ATOM   9122  C  C     . GLN G 3 133 ? 27.983 36.266  40.526  1.00 69.54  ? 133  GLN E C     1 
ATOM   9123  O  O     . GLN G 3 133 ? 27.540 36.941  39.595  1.00 68.35  ? 133  GLN E O     1 
ATOM   9124  C  CB    . GLN G 3 133 ? 28.102 36.957  42.916  1.00 70.62  ? 133  GLN E CB    1 
ATOM   9125  C  CG    . GLN G 3 133 ? 27.290 38.227  43.045  1.00 74.56  ? 133  GLN E CG    1 
ATOM   9126  C  CD    . GLN G 3 133 ? 26.056 38.044  43.887  1.00 74.78  ? 133  GLN E CD    1 
ATOM   9127  O  OE1   . GLN G 3 133 ? 26.134 37.878  45.106  1.00 74.18  ? 133  GLN E OE1   1 
ATOM   9128  N  NE2   . GLN G 3 133 ? 24.893 38.065  43.235  1.00 71.45  ? 133  GLN E NE2   1 
ATOM   9129  N  N     . ALA G 3 134 ? 27.717 34.972  40.686  1.00 65.03  ? 134  ALA E N     1 
ATOM   9130  C  CA    . ALA G 3 134 ? 26.888 34.203  39.759  1.00 61.04  ? 134  ALA E CA    1 
ATOM   9131  C  C     . ALA G 3 134 ? 25.553 34.853  39.404  1.00 62.07  ? 134  ALA E C     1 
ATOM   9132  O  O     . ALA G 3 134 ? 25.079 35.752  40.096  1.00 61.38  ? 134  ALA E O     1 
ATOM   9133  C  CB    . ALA G 3 134 ? 26.647 32.816  40.333  1.00 40.57  ? 134  ALA E CB    1 
ATOM   9134  N  N     . LEU G 3 135 ? 24.951 34.383  38.317  1.00 60.77  ? 135  LEU E N     1 
ATOM   9135  C  CA    . LEU G 3 135 ? 23.666 34.904  37.858  1.00 60.83  ? 135  LEU E CA    1 
ATOM   9136  C  C     . LEU G 3 135 ? 22.567 34.054  38.478  1.00 61.77  ? 135  LEU E C     1 
ATOM   9137  O  O     . LEU G 3 135 ? 22.637 32.827  38.459  1.00 60.23  ? 135  LEU E O     1 
ATOM   9138  C  CB    . LEU G 3 135 ? 23.606 34.845  36.330  1.00 64.30  ? 135  LEU E CB    1 
ATOM   9139  C  CG    . LEU G 3 135 ? 22.395 35.343  35.536  1.00 63.61  ? 135  LEU E CG    1 
ATOM   9140  C  CD1   . LEU G 3 135 ? 22.052 36.778  35.886  1.00 57.43  ? 135  LEU E CD1   1 
ATOM   9141  C  CD2   . LEU G 3 135 ? 22.740 35.216  34.056  1.00 66.06  ? 135  LEU E CD2   1 
ATOM   9142  N  N     . ALA G 3 136 ? 21.546 34.706  39.014  1.00 63.84  ? 136  ALA E N     1 
ATOM   9143  C  CA    . ALA G 3 136 ? 20.470 33.997  39.694  1.00 65.04  ? 136  ALA E CA    1 
ATOM   9144  C  C     . ALA G 3 136 ? 19.556 33.111  38.868  1.00 66.94  ? 136  ALA E C     1 
ATOM   9145  O  O     . ALA G 3 136 ? 18.657 33.609  38.190  1.00 70.85  ? 136  ALA E O     1 
ATOM   9146  C  CB    . ALA G 3 136 ? 19.620 34.994  40.488  1.00 62.67  ? 136  ALA E CB    1 
ATOM   9147  N  N     . PHE G 3 137 ? 19.779 31.800  38.930  1.00 66.46  ? 137  PHE E N     1 
ATOM   9148  C  CA    . PHE G 3 137 ? 18.910 30.853  38.232  1.00 66.15  ? 137  PHE E CA    1 
ATOM   9149  C  C     . PHE G 3 137 ? 17.842 30.561  39.286  1.00 64.42  ? 137  PHE E C     1 
ATOM   9150  O  O     . PHE G 3 137 ? 17.929 29.609  40.059  1.00 62.01  ? 137  PHE E O     1 
ATOM   9151  C  CB    . PHE G 3 137 ? 19.693 29.593  37.835  1.00 70.35  ? 137  PHE E CB    1 
ATOM   9152  C  CG    . PHE G 3 137 ? 18.844 28.468  37.265  1.00 71.44  ? 137  PHE E CG    1 
ATOM   9153  C  CD1   . PHE G 3 137 ? 19.430 27.495  36.464  1.00 74.73  ? 137  PHE E CD1   1 
ATOM   9154  C  CD2   . PHE G 3 137 ? 17.496 28.323  37.599  1.00 67.93  ? 137  PHE E CD2   1 
ATOM   9155  C  CE1   . PHE G 3 137 ? 18.700 26.394  36.013  1.00 75.98  ? 137  PHE E CE1   1 
ATOM   9156  C  CE2   . PHE G 3 137 ? 16.753 27.225  37.155  1.00 61.35  ? 137  PHE E CE2   1 
ATOM   9157  C  CZ    . PHE G 3 137 ? 17.358 26.257  36.361  1.00 74.31  ? 137  PHE E CZ    1 
ATOM   9158  N  N     . GLU G 3 138 ? 16.832 31.415  39.313  1.00 64.57  ? 138  GLU E N     1 
ATOM   9159  C  CA    . GLU G 3 138 ? 15.768 31.299  40.286  1.00 66.05  ? 138  GLU E CA    1 
ATOM   9160  C  C     . GLU G 3 138 ? 14.667 30.328  39.890  1.00 66.39  ? 138  GLU E C     1 
ATOM   9161  O  O     . GLU G 3 138 ? 14.848 29.501  39.002  1.00 66.83  ? 138  GLU E O     1 
ATOM   9162  C  CB    . GLU G 3 138 ? 15.215 32.702  40.558  1.00 72.44  ? 138  GLU E CB    1 
ATOM   9163  C  CG    . GLU G 3 138 ? 16.292 33.632  41.146  1.00 77.54  ? 138  GLU E CG    1 
ATOM   9164  C  CD    . GLU G 3 138 ? 15.899 35.099  41.166  1.00 81.84  ? 138  GLU E CD    1 
ATOM   9165  O  OE1   . GLU G 3 138 ? 15.967 35.753  40.103  1.00 90.00  ? 138  GLU E OE1   1 
ATOM   9166  O  OE2   . GLU G 3 138 ? 15.522 35.597  42.248  1.00 73.20  ? 138  GLU E OE2   1 
ATOM   9167  N  N     . ARG G 3 139 ? 13.529 30.430  40.568  1.00 67.71  ? 139  ARG E N     1 
ATOM   9168  C  CA    . ARG G 3 139 ? 12.370 29.562  40.330  1.00 67.06  ? 139  ARG E CA    1 
ATOM   9169  C  C     . ARG G 3 139 ? 11.679 29.792  38.985  1.00 66.51  ? 139  ARG E C     1 
ATOM   9170  O  O     . ARG G 3 139 ? 11.518 28.860  38.196  1.00 65.83  ? 139  ARG E O     1 
ATOM   9171  C  CB    . ARG G 3 139 ? 11.355 29.755  41.460  1.00 63.19  ? 139  ARG E CB    1 
ATOM   9172  C  CG    . ARG G 3 139 ? 9.977  29.194  41.185  1.00 58.69  ? 139  ARG E CG    1 
ATOM   9173  C  CD    . ARG G 3 139 ? 9.871  27.740  41.553  1.00 64.65  ? 139  ARG E CD    1 
ATOM   9174  N  NE    . ARG G 3 139 ? 8.464  27.359  41.631  1.00 77.79  ? 139  ARG E NE    1 
ATOM   9175  C  CZ    . ARG G 3 139 ? 8.020  26.210  42.134  1.00 83.39  ? 139  ARG E CZ    1 
ATOM   9176  N  NH1   . ARG G 3 139 ? 8.877  25.312  42.611  1.00 87.71  ? 139  ARG E NH1   1 
ATOM   9177  N  NH2   . ARG G 3 139 ? 6.714  25.964  42.166  1.00 80.36  ? 139  ARG E NH2   1 
ATOM   9178  N  N     . THR G 3 140 ? 11.258 31.030  38.739  1.00 66.86  ? 140  THR E N     1 
ATOM   9179  C  CA    . THR G 3 140 ? 10.586 31.375  37.490  1.00 68.20  ? 140  THR E CA    1 
ATOM   9180  C  C     . THR G 3 140 ? 11.411 30.874  36.308  1.00 70.60  ? 140  THR E C     1 
ATOM   9181  O  O     . THR G 3 140 ? 10.888 30.664  35.217  1.00 69.83  ? 140  THR E O     1 
ATOM   9182  C  CB    . THR G 3 140 ? 10.410 32.908  37.331  1.00 65.80  ? 140  THR E CB    1 
ATOM   9183  O  OG1   . THR G 3 140 ? 11.685 33.516  37.075  1.00 61.42  ? 140  THR E OG1   1 
ATOM   9184  C  CG2   . THR G 3 140 ? 9.796  33.513  38.589  1.00 57.83  ? 140  THR E CG2   1 
ATOM   9185  N  N     . ASP G 3 141 ? 12.702 30.677  36.537  1.00 72.52  ? 141  ASP E N     1 
ATOM   9186  C  CA    . ASP G 3 141 ? 13.585 30.216  35.486  1.00 73.66  ? 141  ASP E CA    1 
ATOM   9187  C  C     . ASP G 3 141 ? 13.689 28.704  35.423  1.00 72.21  ? 141  ASP E C     1 
ATOM   9188  O  O     . ASP G 3 141 ? 14.144 28.155  34.423  1.00 70.35  ? 141  ASP E O     1 
ATOM   9189  C  CB    . ASP G 3 141 ? 14.968 30.841  35.659  1.00 78.10  ? 141  ASP E CB    1 
ATOM   9190  C  CG    . ASP G 3 141 ? 14.906 32.352  35.738  1.00 82.42  ? 141  ASP E CG    1 
ATOM   9191  O  OD1   . ASP G 3 141 ? 14.087 32.941  34.998  1.00 80.28  ? 141  ASP E OD1   1 
ATOM   9192  O  OD2   . ASP G 3 141 ? 15.671 32.950  36.529  1.00 83.57  ? 141  ASP E OD2   1 
ATOM   9193  N  N     . PHE G 3 142 ? 13.286 28.017  36.482  1.00 72.95  ? 142  PHE E N     1 
ATOM   9194  C  CA    . PHE G 3 142 ? 13.338 26.564  36.437  1.00 73.73  ? 142  PHE E CA    1 
ATOM   9195  C  C     . PHE G 3 142 ? 12.062 26.096  35.779  1.00 74.62  ? 142  PHE E C     1 
ATOM   9196  O  O     . PHE G 3 142 ? 11.979 24.962  35.324  1.00 74.37  ? 142  PHE E O     1 
ATOM   9197  C  CB    . PHE G 3 142 ? 13.434 25.942  37.827  1.00 77.64  ? 142  PHE E CB    1 
ATOM   9198  C  CG    . PHE G 3 142 ? 13.419 24.439  37.811  1.00 75.78  ? 142  PHE E CG    1 
ATOM   9199  C  CD1   . PHE G 3 142 ? 14.351 23.732  37.056  1.00 78.80  ? 142  PHE E CD1   1 
ATOM   9200  C  CD2   . PHE G 3 142 ? 12.480 23.731  38.552  1.00 71.85  ? 142  PHE E CD2   1 
ATOM   9201  C  CE1   . PHE G 3 142 ? 14.350 22.341  37.038  1.00 75.96  ? 142  PHE E CE1   1 
ATOM   9202  C  CE2   . PHE G 3 142 ? 12.472 22.337  38.542  1.00 77.05  ? 142  PHE E CE2   1 
ATOM   9203  C  CZ    . PHE G 3 142 ? 13.413 21.642  37.782  1.00 78.67  ? 142  PHE E CZ    1 
ATOM   9204  N  N     . ASP G 3 143 ? 11.067 26.982  35.744  1.00 75.50  ? 143  ASP E N     1 
ATOM   9205  C  CA    . ASP G 3 143 ? 9.776  26.685  35.124  1.00 78.29  ? 143  ASP E CA    1 
ATOM   9206  C  C     . ASP G 3 143 ? 9.867  26.896  33.618  1.00 77.12  ? 143  ASP E C     1 
ATOM   9207  O  O     . ASP G 3 143 ? 9.701  25.957  32.833  1.00 75.48  ? 143  ASP E O     1 
ATOM   9208  C  CB    . ASP G 3 143 ? 8.690  27.596  35.697  1.00 86.32  ? 143  ASP E CB    1 
ATOM   9209  C  CG    . ASP G 3 143 ? 8.313  27.225  37.115  1.00 94.11  ? 143  ASP E CG    1 
ATOM   9210  O  OD1   . ASP G 3 143 ? 9.019  26.375  37.710  1.00 94.80  ? 143  ASP E OD1   1 
ATOM   9211  O  OD2   . ASP G 3 143 ? 7.315  27.783  37.632  1.00 94.47  ? 143  ASP E OD2   1 
ATOM   9212  N  N     . GLN G 3 144 ? 10.119 28.142  33.229  1.00 74.22  ? 144  GLN E N     1 
ATOM   9213  C  CA    . GLN G 3 144 ? 10.252 28.489  31.827  1.00 72.24  ? 144  GLN E CA    1 
ATOM   9214  C  C     . GLN G 3 144 ? 11.080 27.403  31.158  1.00 71.98  ? 144  GLN E C     1 
ATOM   9215  O  O     . GLN G 3 144 ? 10.589 26.682  30.295  1.00 71.32  ? 144  GLN E O     1 
ATOM   9216  C  CB    . GLN G 3 144 ? 10.950 29.841  31.681  1.00 73.33  ? 144  GLN E CB    1 
ATOM   9217  C  CG    . GLN G 3 144 ? 11.181 30.273  30.243  1.00 83.52  ? 144  GLN E CG    1 
ATOM   9218  C  CD    . GLN G 3 144 ? 11.857 31.633  30.136  1.00 90.35  ? 144  GLN E CD    1 
ATOM   9219  O  OE1   . GLN G 3 144 ? 12.165 32.097  29.034  1.00 93.83  ? 144  GLN E OE1   1 
ATOM   9220  N  NE2   . GLN G 3 144 ? 12.090 32.280  31.282  1.00 87.76  ? 144  GLN E NE2   1 
ATOM   9221  N  N     . VAL G 3 145 ? 12.335 27.277  31.569  1.00 71.45  ? 145  VAL E N     1 
ATOM   9222  C  CA    . VAL G 3 145 ? 13.202 26.261  30.996  1.00 72.84  ? 145  VAL E CA    1 
ATOM   9223  C  C     . VAL G 3 145 ? 12.542 24.885  31.052  1.00 77.12  ? 145  VAL E C     1 
ATOM   9224  O  O     . VAL G 3 145 ? 12.678 24.082  30.125  1.00 76.88  ? 145  VAL E O     1 
ATOM   9225  C  CB    . VAL G 3 145 ? 14.565 26.221  31.729  1.00 67.78  ? 145  VAL E CB    1 
ATOM   9226  C  CG1   . VAL G 3 145 ? 15.287 24.899  31.467  1.00 58.78  ? 145  VAL E CG1   1 
ATOM   9227  C  CG2   . VAL G 3 145 ? 15.423 27.370  31.241  1.00 62.13  ? 145  VAL E CG2   1 
ATOM   9228  N  N     . ARG G 3 146 ? 11.815 24.616  32.130  1.00 79.36  ? 146  ARG E N     1 
ATOM   9229  C  CA    . ARG G 3 146 ? 11.150 23.325  32.277  1.00 83.77  ? 146  ARG E CA    1 
ATOM   9230  C  C     . ARG G 3 146 ? 10.141 23.041  31.165  1.00 84.45  ? 146  ARG E C     1 
ATOM   9231  O  O     . ARG G 3 146 ? 10.392 22.209  30.292  1.00 84.47  ? 146  ARG E O     1 
ATOM   9232  C  CB    . ARG G 3 146 ? 10.475 23.233  33.657  1.00 88.46  ? 146  ARG E CB    1 
ATOM   9233  C  CG    . ARG G 3 146 ? 9.007  22.817  33.672  1.00 94.61  ? 146  ARG E CG    1 
ATOM   9234  C  CD    . ARG G 3 146 ? 8.549  22.499  35.087  1.00 100.96 ? 146  ARG E CD    1 
ATOM   9235  N  NE    . ARG G 3 146 ? 9.173  21.273  35.587  1.00 103.86 ? 146  ARG E NE    1 
ATOM   9236  C  CZ    . ARG G 3 146 ? 9.029  20.806  36.826  1.00 103.00 ? 146  ARG E CZ    1 
ATOM   9237  N  NH1   . ARG G 3 146 ? 8.281  21.463  37.706  1.00 100.68 ? 146  ARG E NH1   1 
ATOM   9238  N  NH2   . ARG G 3 146 ? 9.629  19.674  37.182  1.00 100.93 ? 146  ARG E NH2   1 
ATOM   9239  N  N     . SER G 3 147 ? 9.011  23.739  31.187  1.00 83.50  ? 147  SER E N     1 
ATOM   9240  C  CA    . SER G 3 147 ? 7.969  23.533  30.190  1.00 83.66  ? 147  SER E CA    1 
ATOM   9241  C  C     . SER G 3 147 ? 8.477  23.447  28.744  1.00 83.32  ? 147  SER E C     1 
ATOM   9242  O  O     . SER G 3 147 ? 7.870  22.771  27.912  1.00 81.26  ? 147  SER E O     1 
ATOM   9243  C  CB    . SER G 3 147 ? 6.919  24.646  30.298  1.00 84.09  ? 147  SER E CB    1 
ATOM   9244  O  OG    . SER G 3 147 ? 7.468  25.914  29.967  1.00 80.35  ? 147  SER E OG    1 
ATOM   9245  N  N     . LEU G 3 148 ? 9.589  24.115  28.445  1.00 80.82  ? 148  LEU E N     1 
ATOM   9246  C  CA    . LEU G 3 148 ? 10.120 24.108  27.084  1.00 78.34  ? 148  LEU E CA    1 
ATOM   9247  C  C     . LEU G 3 148 ? 11.013 22.917  26.800  1.00 77.06  ? 148  LEU E C     1 
ATOM   9248  O  O     . LEU G 3 148 ? 11.699 22.884  25.784  1.00 74.43  ? 148  LEU E O     1 
ATOM   9249  C  CB    . LEU G 3 148 ? 10.897 25.397  26.799  1.00 73.70  ? 148  LEU E CB    1 
ATOM   9250  C  CG    . LEU G 3 148 ? 10.301 26.687  27.374  1.00 75.59  ? 148  LEU E CG    1 
ATOM   9251  C  CD1   . LEU G 3 148 ? 11.013 27.882  26.743  1.00 73.54  ? 148  LEU E CD1   1 
ATOM   9252  C  CD2   . LEU G 3 148 ? 8.795  26.758  27.121  1.00 73.00  ? 148  LEU E CD2   1 
ATOM   9253  N  N     . MET G 3 149 ? 11.001 21.943  27.700  1.00 77.63  ? 149  MET E N     1 
ATOM   9254  C  CA    . MET G 3 149 ? 11.817 20.739  27.551  1.00 82.28  ? 149  MET E CA    1 
ATOM   9255  C  C     . MET G 3 149 ? 11.041 19.616  28.221  1.00 84.81  ? 149  MET E C     1 
ATOM   9256  O  O     . MET G 3 149 ? 11.453 18.453  28.222  1.00 81.73  ? 149  MET E O     1 
ATOM   9257  C  CB    . MET G 3 149 ? 13.171 20.929  28.246  1.00 85.50  ? 149  MET E CB    1 
ATOM   9258  C  CG    . MET G 3 149 ? 13.885 22.215  27.854  1.00 86.53  ? 149  MET E CG    1 
ATOM   9259  S  SD    . MET G 3 149 ? 15.341 22.573  28.851  1.00 92.86  ? 149  MET E SD    1 
ATOM   9260  C  CE    . MET G 3 149 ? 16.624 22.657  27.568  1.00 88.33  ? 149  MET E CE    1 
ATOM   9261  N  N     . GLU G 3 150 ? 9.911  20.005  28.801  1.00 88.63  ? 150  GLU E N     1 
ATOM   9262  C  CA    . GLU G 3 150 ? 9.006  19.100  29.495  1.00 92.14  ? 150  GLU E CA    1 
ATOM   9263  C  C     . GLU G 3 150 ? 8.339  18.233  28.423  1.00 94.60  ? 150  GLU E C     1 
ATOM   9264  O  O     . GLU G 3 150 ? 7.962  17.081  28.671  1.00 94.81  ? 150  GLU E O     1 
ATOM   9265  C  CB    . GLU G 3 150 ? 7.965  19.936  30.247  1.00 95.01  ? 150  GLU E CB    1 
ATOM   9266  C  CG    . GLU G 3 150 ? 7.015  19.170  31.142  1.00 97.42  ? 150  GLU E CG    1 
ATOM   9267  C  CD    . GLU G 3 150 ? 6.016  20.091  31.825  1.00 99.35  ? 150  GLU E CD    1 
ATOM   9268  O  OE1   . GLU G 3 150 ? 5.219  20.748  31.116  1.00 94.98  ? 150  GLU E OE1   1 
ATOM   9269  O  OE2   . GLU G 3 150 ? 6.032  20.162  33.072  1.00 98.72  ? 150  GLU E OE2   1 
ATOM   9270  N  N     . ASN G 3 151 ? 8.209  18.804  27.226  1.00 95.61  ? 151  ASN E N     1 
ATOM   9271  C  CA    . ASN G 3 151 ? 7.608  18.114  26.092  1.00 94.95  ? 151  ASN E CA    1 
ATOM   9272  C  C     . ASN G 3 151 ? 8.632  17.988  24.967  1.00 94.60  ? 151  ASN E C     1 
ATOM   9273  O  O     . ASN G 3 151 ? 8.572  18.700  23.958  1.00 92.04  ? 151  ASN E O     1 
ATOM   9274  C  CB    . ASN G 3 151 ? 6.368  18.870  25.606  1.00 94.65  ? 151  ASN E CB    1 
ATOM   9275  C  CG    . ASN G 3 151 ? 5.294  18.970  26.675  1.00 94.65  ? 151  ASN E CG    1 
ATOM   9276  O  OD1   . ASN G 3 151 ? 4.887  17.960  27.256  1.00 90.42  ? 151  ASN E OD1   1 
ATOM   9277  N  ND2   . ASN G 3 151 ? 4.828  20.189  26.939  1.00 95.99  ? 151  ASN E ND2   1 
ATOM   9278  N  N     . SER G 3 152 ? 9.581  17.079  25.175  1.00 94.70  ? 152  SER E N     1 
ATOM   9279  C  CA    . SER G 3 152 ? 10.647 16.790  24.220  1.00 95.16  ? 152  SER E CA    1 
ATOM   9280  C  C     . SER G 3 152 ? 11.112 15.374  24.556  1.00 96.21  ? 152  SER E C     1 
ATOM   9281  O  O     . SER G 3 152 ? 10.829 14.875  25.649  1.00 95.34  ? 152  SER E O     1 
ATOM   9282  C  CB    . SER G 3 152 ? 11.804 17.782  24.379  1.00 92.17  ? 152  SER E CB    1 
ATOM   9283  O  OG    . SER G 3 152 ? 12.822 17.547  23.416  1.00 86.46  ? 152  SER E OG    1 
ATOM   9284  N  N     . ASP G 3 153 ? 11.815 14.723  23.635  1.00 97.14  ? 153  ASP E N     1 
ATOM   9285  C  CA    . ASP G 3 153 ? 12.264 13.363  23.893  1.00 100.25 ? 153  ASP E CA    1 
ATOM   9286  C  C     . ASP G 3 153 ? 13.749 13.126  23.668  1.00 99.14  ? 153  ASP E C     1 
ATOM   9287  O  O     . ASP G 3 153 ? 14.215 11.986  23.756  1.00 97.89  ? 153  ASP E O     1 
ATOM   9288  C  CB    . ASP G 3 153 ? 11.456 12.372  23.050  1.00 112.42 ? 153  ASP E CB    1 
ATOM   9289  C  CG    . ASP G 3 153 ? 9.961  12.467  23.311  1.00 120.03 ? 153  ASP E CG    1 
ATOM   9290  O  OD1   . ASP G 3 153 ? 9.323  13.408  22.791  1.00 122.85 ? 153  ASP E OD1   1 
ATOM   9291  O  OD2   . ASP G 3 153 ? 9.426  11.607  24.044  1.00 119.09 ? 153  ASP E OD2   1 
ATOM   9292  N  N     . ARG G 3 154 ? 14.495 14.189  23.381  1.00 97.53  ? 154  ARG E N     1 
ATOM   9293  C  CA    . ARG G 3 154 ? 15.934 14.053  23.162  1.00 94.47  ? 154  ARG E CA    1 
ATOM   9294  C  C     . ARG G 3 154 ? 16.550 13.614  24.488  1.00 93.83  ? 154  ARG E C     1 
ATOM   9295  O  O     . ARG G 3 154 ? 16.459 14.331  25.483  1.00 90.68  ? 154  ARG E O     1 
ATOM   9296  C  CB    . ARG G 3 154 ? 16.543 15.391  22.721  1.00 94.51  ? 154  ARG E CB    1 
ATOM   9297  C  CG    . ARG G 3 154 ? 15.613 16.256  21.871  1.00 96.44  ? 154  ARG E CG    1 
ATOM   9298  C  CD    . ARG G 3 154 ? 16.304 16.866  20.641  1.00 99.90  ? 154  ARG E CD    1 
ATOM   9299  N  NE    . ARG G 3 154 ? 17.386 17.802  20.950  1.00 102.15 ? 154  ARG E NE    1 
ATOM   9300  C  CZ    . ARG G 3 154 ? 18.622 17.446  21.296  1.00 103.51 ? 154  ARG E CZ    1 
ATOM   9301  N  NH1   . ARG G 3 154 ? 18.953 16.163  21.384  1.00 102.67 ? 154  ARG E NH1   1 
ATOM   9302  N  NH2   . ARG G 3 154 ? 19.536 18.377  21.549  1.00 102.11 ? 154  ARG E NH2   1 
ATOM   9303  N  N     . CYS G 3 155 ? 17.156 12.432  24.513  1.00 94.37  ? 155  CYS E N     1 
ATOM   9304  C  CA    . CYS G 3 155 ? 17.765 11.938  25.742  1.00 93.95  ? 155  CYS E CA    1 
ATOM   9305  C  C     . CYS G 3 155 ? 18.611 13.047  26.351  1.00 92.15  ? 155  CYS E C     1 
ATOM   9306  O  O     . CYS G 3 155 ? 18.446 13.386  27.523  1.00 91.26  ? 155  CYS E O     1 
ATOM   9307  C  CB    . CYS G 3 155 ? 18.644 10.712  25.462  1.00 103.83 ? 155  CYS E CB    1 
ATOM   9308  S  SG    . CYS G 3 155 ? 20.443 10.972  25.675  1.00 115.52 ? 155  CYS E SG    1 
ATOM   9309  N  N     . GLN G 3 156 ? 19.507 13.619  25.546  1.00 89.66  ? 156  GLN E N     1 
ATOM   9310  C  CA    . GLN G 3 156 ? 20.380 14.695  26.009  1.00 87.12  ? 156  GLN E CA    1 
ATOM   9311  C  C     . GLN G 3 156 ? 19.551 15.849  26.577  1.00 84.46  ? 156  GLN E C     1 
ATOM   9312  O  O     . GLN G 3 156 ? 19.934 16.467  27.567  1.00 83.38  ? 156  GLN E O     1 
ATOM   9313  C  CB    . GLN G 3 156 ? 21.276 15.171  24.858  1.00 87.45  ? 156  GLN E CB    1 
ATOM   9314  C  CG    . GLN G 3 156 ? 22.130 16.399  25.156  1.00 83.67  ? 156  GLN E CG    1 
ATOM   9315  C  CD    . GLN G 3 156 ? 21.478 17.682  24.668  1.00 89.62  ? 156  GLN E CD    1 
ATOM   9316  O  OE1   . GLN G 3 156 ? 20.380 18.042  25.103  1.00 91.36  ? 156  GLN E OE1   1 
ATOM   9317  N  NE2   . GLN G 3 156 ? 22.150 18.375  23.753  1.00 87.01  ? 156  GLN E NE2   1 
ATOM   9318  N  N     . ASP G 3 157 ? 18.416 16.134  25.952  1.00 81.68  ? 157  ASP E N     1 
ATOM   9319  C  CA    . ASP G 3 157 ? 17.551 17.190  26.445  1.00 81.03  ? 157  ASP E CA    1 
ATOM   9320  C  C     . ASP G 3 157 ? 17.052 16.780  27.823  1.00 79.94  ? 157  ASP E C     1 
ATOM   9321  O  O     . ASP G 3 157 ? 17.118 17.564  28.769  1.00 80.13  ? 157  ASP E O     1 
ATOM   9322  C  CB    . ASP G 3 157 ? 16.359 17.395  25.513  1.00 91.48  ? 157  ASP E CB    1 
ATOM   9323  C  CG    . ASP G 3 157 ? 16.351 18.772  24.872  1.00 101.40 ? 157  ASP E CG    1 
ATOM   9324  O  OD1   . ASP G 3 157 ? 17.321 19.099  24.152  1.00 104.49 ? 157  ASP E OD1   1 
ATOM   9325  O  OD2   . ASP G 3 157 ? 15.376 19.528  25.089  1.00 106.28 ? 157  ASP E OD2   1 
ATOM   9326  N  N     . ILE G 3 158 ? 16.555 15.549  27.934  1.00 79.68  ? 158  ILE E N     1 
ATOM   9327  C  CA    . ILE G 3 158 ? 16.053 15.033  29.211  1.00 78.81  ? 158  ILE E CA    1 
ATOM   9328  C  C     . ILE G 3 158 ? 17.083 15.251  30.315  1.00 77.06  ? 158  ILE E C     1 
ATOM   9329  O  O     . ILE G 3 158 ? 16.788 15.881  31.333  1.00 75.50  ? 158  ILE E O     1 
ATOM   9330  C  CB    . ILE G 3 158 ? 15.716 13.508  29.124  1.00 85.14  ? 158  ILE E CB    1 
ATOM   9331  C  CG1   . ILE G 3 158 ? 14.201 13.311  29.033  1.00 86.61  ? 158  ILE E CG1   1 
ATOM   9332  C  CG2   . ILE G 3 158 ? 16.250 12.761  30.351  1.00 78.27  ? 158  ILE E CG2   1 
ATOM   9333  C  CD1   . ILE G 3 158 ? 13.572 13.906  27.794  1.00 89.92  ? 158  ILE E CD1   1 
ATOM   9334  N  N     . ARG G 3 159 ? 18.287 14.723  30.100  1.00 74.06  ? 159  ARG E N     1 
ATOM   9335  C  CA    . ARG G 3 159 ? 19.376 14.844  31.061  1.00 70.84  ? 159  ARG E CA    1 
ATOM   9336  C  C     . ARG G 3 159 ? 19.520 16.268  31.579  1.00 70.26  ? 159  ARG E C     1 
ATOM   9337  O  O     . ARG G 3 159 ? 19.277 16.548  32.755  1.00 67.73  ? 159  ARG E O     1 
ATOM   9338  C  CB    . ARG G 3 159 ? 20.696 14.440  30.422  1.00 66.11  ? 159  ARG E CB    1 
ATOM   9339  C  CG    . ARG G 3 159 ? 21.851 14.526  31.384  1.00 60.10  ? 159  ARG E CG    1 
ATOM   9340  C  CD    . ARG G 3 159 ? 23.170 14.524  30.651  1.00 56.55  ? 159  ARG E CD    1 
ATOM   9341  N  NE    . ARG G 3 159 ? 23.286 15.691  29.790  1.00 49.83  ? 159  ARG E NE    1 
ATOM   9342  C  CZ    . ARG G 3 159 ? 24.409 16.048  29.179  1.00 52.94  ? 159  ARG E CZ    1 
ATOM   9343  N  NH1   . ARG G 3 159 ? 25.512 15.319  29.340  1.00 50.16  ? 159  ARG E NH1   1 
ATOM   9344  N  NH2   . ARG G 3 159 ? 24.426 17.133  28.406  1.00 45.55  ? 159  ARG E NH2   1 
ATOM   9345  N  N     . ASN G 3 160 ? 19.929 17.162  30.687  1.00 68.16  ? 160  ASN E N     1 
ATOM   9346  C  CA    . ASN G 3 160 ? 20.123 18.554  31.038  1.00 67.01  ? 160  ASN E CA    1 
ATOM   9347  C  C     . ASN G 3 160 ? 19.022 19.114  31.923  1.00 68.69  ? 160  ASN E C     1 
ATOM   9348  O  O     . ASN G 3 160 ? 19.307 19.727  32.951  1.00 69.46  ? 160  ASN E O     1 
ATOM   9349  C  CB    . ASN G 3 160 ? 20.279 19.374  29.767  1.00 63.01  ? 160  ASN E CB    1 
ATOM   9350  C  CG    . ASN G 3 160 ? 21.560 19.032  29.030  1.00 68.78  ? 160  ASN E CG    1 
ATOM   9351  O  OD1   . ASN G 3 160 ? 22.214 18.033  29.340  1.00 66.81  ? 160  ASN E OD1   1 
ATOM   9352  N  ND2   . ASN G 3 160 ? 21.923 19.852  28.046  1.00 58.25  ? 160  ASN E ND2   1 
ATOM   9353  N  N     . LEU G 3 161 ? 17.767 18.896  31.549  1.00 67.63  ? 161  LEU E N     1 
ATOM   9354  C  CA    . LEU G 3 161 ? 16.669 19.398  32.363  1.00 66.70  ? 161  LEU E CA    1 
ATOM   9355  C  C     . LEU G 3 161 ? 16.640 18.662  33.699  1.00 66.58  ? 161  LEU E C     1 
ATOM   9356  O  O     . LEU G 3 161 ? 16.233 19.216  34.713  1.00 67.74  ? 161  LEU E O     1 
ATOM   9357  C  CB    . LEU G 3 161 ? 15.327 19.209  31.647  1.00 71.99  ? 161  LEU E CB    1 
ATOM   9358  C  CG    . LEU G 3 161 ? 14.115 19.901  32.293  1.00 75.99  ? 161  LEU E CG    1 
ATOM   9359  C  CD1   . LEU G 3 161 ? 14.249 21.417  32.136  1.00 72.72  ? 161  LEU E CD1   1 
ATOM   9360  C  CD2   . LEU G 3 161 ? 12.826 19.427  31.637  1.00 74.53  ? 161  LEU E CD2   1 
ATOM   9361  N  N     . ALA G 3 162 ? 17.082 17.412  33.701  1.00 65.52  ? 162  ALA E N     1 
ATOM   9362  C  CA    . ALA G 3 162 ? 17.081 16.621  34.925  1.00 66.22  ? 162  ALA E CA    1 
ATOM   9363  C  C     . ALA G 3 162 ? 18.298 16.903  35.787  1.00 68.89  ? 162  ALA E C     1 
ATOM   9364  O  O     . ALA G 3 162 ? 18.554 16.210  36.768  1.00 68.56  ? 162  ALA E O     1 
ATOM   9365  C  CB    . ALA G 3 162 ? 17.019 15.151  34.588  1.00 59.84  ? 162  ALA E CB    1 
ATOM   9366  N  N     . PHE G 3 163 ? 19.055 17.918  35.398  1.00 69.27  ? 163  PHE E N     1 
ATOM   9367  C  CA    . PHE G 3 163 ? 20.244 18.336  36.131  1.00 65.74  ? 163  PHE E CA    1 
ATOM   9368  C  C     . PHE G 3 163 ? 19.893 19.733  36.599  1.00 65.24  ? 163  PHE E C     1 
ATOM   9369  O  O     . PHE G 3 163 ? 20.172 20.112  37.730  1.00 68.15  ? 163  PHE E O     1 
ATOM   9370  C  CB    . PHE G 3 163 ? 21.453 18.332  35.193  1.00 60.46  ? 163  PHE E CB    1 
ATOM   9371  C  CG    . PHE G 3 163 ? 22.575 19.241  35.609  1.00 65.00  ? 163  PHE E CG    1 
ATOM   9372  C  CD1   . PHE G 3 163 ? 22.441 20.628  35.525  1.00 64.12  ? 163  PHE E CD1   1 
ATOM   9373  C  CD2   . PHE G 3 163 ? 23.810 18.707  35.989  1.00 65.44  ? 163  PHE E CD2   1 
ATOM   9374  C  CE1   . PHE G 3 163 ? 23.524 21.472  35.804  1.00 60.57  ? 163  PHE E CE1   1 
ATOM   9375  C  CE2   . PHE G 3 163 ? 24.900 19.542  36.270  1.00 62.84  ? 163  PHE E CE2   1 
ATOM   9376  C  CZ    . PHE G 3 163 ? 24.757 20.925  36.174  1.00 64.50  ? 163  PHE E CZ    1 
ATOM   9377  N  N     . LEU G 3 164 ? 19.257 20.497  35.721  1.00 62.99  ? 164  LEU E N     1 
ATOM   9378  C  CA    . LEU G 3 164 ? 18.841 21.832  36.088  1.00 60.70  ? 164  LEU E CA    1 
ATOM   9379  C  C     . LEU G 3 164 ? 17.742 21.677  37.116  1.00 60.67  ? 164  LEU E C     1 
ATOM   9380  O  O     . LEU G 3 164 ? 17.125 22.654  37.531  1.00 63.28  ? 164  LEU E O     1 
ATOM   9381  C  CB    . LEU G 3 164 ? 18.322 22.598  34.875  1.00 59.80  ? 164  LEU E CB    1 
ATOM   9382  C  CG    . LEU G 3 164 ? 19.430 22.920  33.870  1.00 61.68  ? 164  LEU E CG    1 
ATOM   9383  C  CD1   . LEU G 3 164 ? 18.879 23.786  32.746  1.00 56.77  ? 164  LEU E CD1   1 
ATOM   9384  C  CD2   . LEU G 3 164 ? 20.579 23.626  34.596  1.00 53.65  ? 164  LEU E CD2   1 
ATOM   9385  N  N     . GLY G 3 165 ? 17.489 20.434  37.511  1.00 59.52  ? 165  GLY E N     1 
ATOM   9386  C  CA    . GLY G 3 165 ? 16.478 20.166  38.516  1.00 57.19  ? 165  GLY E CA    1 
ATOM   9387  C  C     . GLY G 3 165 ? 17.225 19.946  39.813  1.00 56.78  ? 165  GLY E C     1 
ATOM   9388  O  O     . GLY G 3 165 ? 17.183 20.778  40.710  1.00 57.03  ? 165  GLY E O     1 
ATOM   9389  N  N     . ILE G 3 166 ? 17.918 18.818  39.900  1.00 52.93  ? 166  ILE E N     1 
ATOM   9390  C  CA    . ILE G 3 166 ? 18.714 18.490  41.068  1.00 54.09  ? 166  ILE E CA    1 
ATOM   9391  C  C     . ILE G 3 166 ? 19.384 19.755  41.601  1.00 59.50  ? 166  ILE E C     1 
ATOM   9392  O  O     . ILE G 3 166 ? 19.094 20.201  42.712  1.00 61.16  ? 166  ILE E O     1 
ATOM   9393  C  CB    . ILE G 3 166 ? 19.815 17.464  40.697  1.00 50.99  ? 166  ILE E CB    1 
ATOM   9394  C  CG1   . ILE G 3 166 ? 19.218 16.052  40.635  1.00 45.10  ? 166  ILE E CG1   1 
ATOM   9395  C  CG2   . ILE G 3 166 ? 20.992 17.557  41.675  1.00 36.74  ? 166  ILE E CG2   1 
ATOM   9396  C  CD1   . ILE G 3 166 ? 18.953 15.423  41.992  1.00 44.18  ? 166  ILE E CD1   1 
ATOM   9397  N  N     . ALA G 3 167 ? 20.270 20.330  40.788  1.00 59.28  ? 167  ALA E N     1 
ATOM   9398  C  CA    . ALA G 3 167 ? 21.025 21.537  41.144  1.00 57.51  ? 167  ALA E CA    1 
ATOM   9399  C  C     . ALA G 3 167 ? 20.222 22.576  41.918  1.00 57.04  ? 167  ALA E C     1 
ATOM   9400  O  O     . ALA G 3 167 ? 20.668 23.080  42.947  1.00 55.17  ? 167  ALA E O     1 
ATOM   9401  C  CB    . ALA G 3 167 ? 21.614 22.171  39.891  1.00 50.68  ? 167  ALA E CB    1 
ATOM   9402  N  N     . TYR G 3 168 ? 19.039 22.900  41.421  1.00 53.53  ? 168  TYR E N     1 
ATOM   9403  C  CA    . TYR G 3 168 ? 18.199 23.882  42.082  1.00 54.04  ? 168  TYR E CA    1 
ATOM   9404  C  C     . TYR G 3 168 ? 17.549 23.325  43.333  1.00 54.63  ? 168  TYR E C     1 
ATOM   9405  O  O     . TYR G 3 168 ? 17.261 24.055  44.266  1.00 52.20  ? 168  TYR E O     1 
ATOM   9406  C  CB    . TYR G 3 168 ? 17.102 24.350  41.134  1.00 51.00  ? 168  TYR E CB    1 
ATOM   9407  C  CG    . TYR G 3 168 ? 16.128 25.313  41.753  1.00 49.07  ? 168  TYR E CG    1 
ATOM   9408  C  CD1   . TYR G 3 168 ? 16.315 26.686  41.642  1.00 47.88  ? 168  TYR E CD1   1 
ATOM   9409  C  CD2   . TYR G 3 168 ? 15.006 24.853  42.433  1.00 52.59  ? 168  TYR E CD2   1 
ATOM   9410  C  CE1   . TYR G 3 168 ? 15.398 27.587  42.189  1.00 51.13  ? 168  TYR E CE1   1 
ATOM   9411  C  CE2   . TYR G 3 168 ? 14.083 25.741  42.986  1.00 56.19  ? 168  TYR E CE2   1 
ATOM   9412  C  CZ    . TYR G 3 168 ? 14.282 27.107  42.856  1.00 55.18  ? 168  TYR E CZ    1 
ATOM   9413  O  OH    . TYR G 3 168 ? 13.344 27.989  43.350  1.00 54.97  ? 168  TYR E OH    1 
ATOM   9414  N  N     . ASN G 3 169 ? 17.319 22.025  43.355  1.00 58.04  ? 169  ASN E N     1 
ATOM   9415  C  CA    . ASN G 3 169 ? 16.654 21.403  44.492  1.00 59.72  ? 169  ASN E CA    1 
ATOM   9416  C  C     . ASN G 3 169 ? 17.611 20.848  45.545  1.00 58.60  ? 169  ASN E C     1 
ATOM   9417  O  O     . ASN G 3 169 ? 17.208 20.076  46.402  1.00 58.57  ? 169  ASN E O     1 
ATOM   9418  C  CB    . ASN G 3 169 ? 15.722 20.298  43.966  1.00 68.35  ? 169  ASN E CB    1 
ATOM   9419  C  CG    . ASN G 3 169 ? 14.779 19.758  45.027  1.00 74.24  ? 169  ASN E CG    1 
ATOM   9420  O  OD1   . ASN G 3 169 ? 14.081 20.519  45.703  1.00 76.55  ? 169  ASN E OD1   1 
ATOM   9421  N  ND2   . ASN G 3 169 ? 14.743 18.432  45.168  1.00 69.16  ? 169  ASN E ND2   1 
ATOM   9422  N  N     . THR G 3 170 ? 18.876 21.238  45.495  1.00 58.89  ? 170  THR E N     1 
ATOM   9423  C  CA    . THR G 3 170 ? 19.842 20.729  46.474  1.00 61.49  ? 170  THR E CA    1 
ATOM   9424  C  C     . THR G 3 170 ? 20.922 21.752  46.822  1.00 61.60  ? 170  THR E C     1 
ATOM   9425  O  O     . THR G 3 170 ? 21.649 21.602  47.810  1.00 62.97  ? 170  THR E O     1 
ATOM   9426  C  CB    . THR G 3 170 ? 20.573 19.474  45.952  1.00 63.06  ? 170  THR E CB    1 
ATOM   9427  O  OG1   . THR G 3 170 ? 21.628 19.876  45.070  1.00 60.76  ? 170  THR E OG1   1 
ATOM   9428  C  CG2   . THR G 3 170 ? 19.612 18.561  45.209  1.00 57.66  ? 170  THR E CG2   1 
ATOM   9429  N  N     . LEU G 3 171 ? 21.017 22.788  45.999  1.00 57.40  ? 171  LEU E N     1 
ATOM   9430  C  CA    . LEU G 3 171 ? 22.014 23.821  46.179  1.00 55.50  ? 171  LEU E CA    1 
ATOM   9431  C  C     . LEU G 3 171 ? 23.331 23.082  46.272  1.00 57.07  ? 171  LEU E C     1 
ATOM   9432  O  O     . LEU G 3 171 ? 24.234 23.497  46.997  1.00 58.77  ? 171  LEU E O     1 
ATOM   9433  C  CB    . LEU G 3 171 ? 21.772 24.626  47.459  1.00 51.66  ? 171  LEU E CB    1 
ATOM   9434  C  CG    . LEU G 3 171 ? 20.328 24.859  47.909  1.00 46.65  ? 171  LEU E CG    1 
ATOM   9435  C  CD1   . LEU G 3 171 ? 20.285 26.047  48.840  1.00 44.45  ? 171  LEU E CD1   1 
ATOM   9436  C  CD2   . LEU G 3 171 ? 19.419 25.101  46.728  1.00 50.48  ? 171  LEU E CD2   1 
ATOM   9437  N  N     . LEU G 3 172 ? 23.426 21.959  45.561  1.00 57.05  ? 172  LEU E N     1 
ATOM   9438  C  CA    . LEU G 3 172 ? 24.661 21.184  45.556  1.00 57.57  ? 172  LEU E CA    1 
ATOM   9439  C  C     . LEU G 3 172 ? 25.648 21.884  44.637  1.00 55.66  ? 172  LEU E C     1 
ATOM   9440  O  O     . LEU G 3 172 ? 25.246 22.586  43.707  1.00 52.31  ? 172  LEU E O     1 
ATOM   9441  C  CB    . LEU G 3 172 ? 24.407 19.762  45.052  1.00 59.06  ? 172  LEU E CB    1 
ATOM   9442  C  CG    . LEU G 3 172 ? 23.981 18.695  46.069  1.00 55.96  ? 172  LEU E CG    1 
ATOM   9443  C  CD1   . LEU G 3 172 ? 23.238 17.576  45.357  1.00 50.33  ? 172  LEU E CD1   1 
ATOM   9444  C  CD2   . LEU G 3 172 ? 25.213 18.140  46.783  1.00 42.30  ? 172  LEU E CD2   1 
ATOM   9445  N  N     . ARG G 3 173 ? 26.936 21.714  44.915  1.00 56.36  ? 173  ARG E N     1 
ATOM   9446  C  CA    . ARG G 3 173 ? 27.986 22.318  44.099  1.00 60.85  ? 173  ARG E CA    1 
ATOM   9447  C  C     . ARG G 3 173 ? 28.060 21.456  42.845  1.00 61.16  ? 173  ARG E C     1 
ATOM   9448  O  O     . ARG G 3 173 ? 27.618 20.305  42.862  1.00 60.56  ? 173  ARG E O     1 
ATOM   9449  C  CB    . ARG G 3 173 ? 29.326 22.281  44.842  1.00 69.46  ? 173  ARG E CB    1 
ATOM   9450  C  CG    . ARG G 3 173 ? 29.217 22.650  46.317  1.00 73.54  ? 173  ARG E CG    1 
ATOM   9451  C  CD    . ARG G 3 173 ? 30.584 22.801  46.974  1.00 83.49  ? 173  ARG E CD    1 
ATOM   9452  N  NE    . ARG G 3 173 ? 30.719 24.119  47.590  1.00 99.93  ? 173  ARG E NE    1 
ATOM   9453  C  CZ    . ARG G 3 173 ? 30.512 25.262  46.941  1.00 109.78 ? 173  ARG E CZ    1 
ATOM   9454  N  NH1   . ARG G 3 173 ? 30.163 25.245  45.661  1.00 106.57 ? 173  ARG E NH1   1 
ATOM   9455  N  NH2   . ARG G 3 173 ? 30.640 26.425  47.566  1.00 112.92 ? 173  ARG E NH2   1 
ATOM   9456  N  N     . ILE G 3 174 ? 28.600 21.989  41.755  1.00 60.79  ? 174  ILE E N     1 
ATOM   9457  C  CA    . ILE G 3 174 ? 28.659 21.186  40.546  1.00 55.89  ? 174  ILE E CA    1 
ATOM   9458  C  C     . ILE G 3 174 ? 29.554 19.963  40.729  1.00 54.42  ? 174  ILE E C     1 
ATOM   9459  O  O     . ILE G 3 174 ? 29.134 18.842  40.444  1.00 54.12  ? 174  ILE E O     1 
ATOM   9460  C  CB    . ILE G 3 174 ? 29.126 22.007  39.310  1.00 50.45  ? 174  ILE E CB    1 
ATOM   9461  C  CG1   . ILE G 3 174 ? 30.571 22.465  39.493  1.00 43.32  ? 174  ILE E CG1   1 
ATOM   9462  C  CG2   . ILE G 3 174 ? 28.179 23.201  39.076  1.00 36.26  ? 174  ILE E CG2   1 
ATOM   9463  C  CD1   . ILE G 3 174 ? 31.138 23.151  38.253  1.00 38.09  ? 174  ILE E CD1   1 
ATOM   9464  N  N     . ALA G 3 175 ? 30.767 20.153  41.231  1.00 51.23  ? 175  ALA E N     1 
ATOM   9465  C  CA    . ALA G 3 175 ? 31.659 19.013  41.410  1.00 50.85  ? 175  ALA E CA    1 
ATOM   9466  C  C     . ALA G 3 175 ? 30.970 17.930  42.212  1.00 54.39  ? 175  ALA E C     1 
ATOM   9467  O  O     . ALA G 3 175 ? 31.269 16.755  42.053  1.00 54.51  ? 175  ALA E O     1 
ATOM   9468  C  CB    . ALA G 3 175 ? 32.953 19.439  42.107  1.00 35.29  ? 175  ALA E CB    1 
ATOM   9469  N  N     . GLU G 3 176 ? 30.044 18.334  43.073  1.00 57.14  ? 176  GLU E N     1 
ATOM   9470  C  CA    . GLU G 3 176 ? 29.309 17.391  43.913  1.00 61.14  ? 176  GLU E CA    1 
ATOM   9471  C  C     . GLU G 3 176 ? 28.342 16.549  43.090  1.00 59.35  ? 176  GLU E C     1 
ATOM   9472  O  O     . GLU G 3 176 ? 28.059 15.404  43.446  1.00 62.67  ? 176  GLU E O     1 
ATOM   9473  C  CB    . GLU G 3 176 ? 28.515 18.129  44.999  1.00 77.68  ? 176  GLU E CB    1 
ATOM   9474  C  CG    . GLU G 3 176 ? 29.269 18.417  46.294  1.00 90.11  ? 176  GLU E CG    1 
ATOM   9475  C  CD    . GLU G 3 176 ? 28.454 19.270  47.274  1.00 94.27  ? 176  GLU E CD    1 
ATOM   9476  O  OE1   . GLU G 3 176 ? 28.863 19.389  48.451  1.00 87.09  ? 176  GLU E OE1   1 
ATOM   9477  O  OE2   . GLU G 3 176 ? 27.407 19.828  46.869  1.00 100.13 ? 176  GLU E OE2   1 
ATOM   9478  N  N     . ILE G 3 177 ? 27.822 17.113  42.004  1.00 54.77  ? 177  ILE E N     1 
ATOM   9479  C  CA    . ILE G 3 177 ? 26.886 16.376  41.166  1.00 53.85  ? 177  ILE E CA    1 
ATOM   9480  C  C     . ILE G 3 177 ? 27.657 15.387  40.311  1.00 53.51  ? 177  ILE E C     1 
ATOM   9481  O  O     . ILE G 3 177 ? 27.279 14.225  40.177  1.00 50.30  ? 177  ILE E O     1 
ATOM   9482  C  CB    . ILE G 3 177 ? 26.106 17.308  40.247  1.00 55.70  ? 177  ILE E CB    1 
ATOM   9483  C  CG1   . ILE G 3 177 ? 25.440 18.422  41.066  1.00 59.75  ? 177  ILE E CG1   1 
ATOM   9484  C  CG2   . ILE G 3 177 ? 25.056 16.514  39.495  1.00 48.32  ? 177  ILE E CG2   1 
ATOM   9485  C  CD1   . ILE G 3 177 ? 24.298 17.945  41.945  1.00 67.11  ? 177  ILE E CD1   1 
ATOM   9486  N  N     . ALA G 3 178 ? 28.748 15.864  39.733  1.00 52.98  ? 178  ALA E N     1 
ATOM   9487  C  CA    . ALA G 3 178 ? 29.599 15.026  38.909  1.00 56.84  ? 178  ALA E CA    1 
ATOM   9488  C  C     . ALA G 3 178 ? 29.933 13.700  39.607  1.00 62.15  ? 178  ALA E C     1 
ATOM   9489  O  O     . ALA G 3 178 ? 30.052 12.666  38.944  1.00 65.97  ? 178  ALA E O     1 
ATOM   9490  C  CB    . ALA G 3 178 ? 30.887 15.772  38.577  1.00 45.62  ? 178  ALA E CB    1 
ATOM   9491  N  N     . ARG G 3 179 ? 30.073 13.725  40.936  1.00 65.11  ? 179  ARG E N     1 
ATOM   9492  C  CA    . ARG G 3 179 ? 30.429 12.520  41.691  1.00 64.44  ? 179  ARG E CA    1 
ATOM   9493  C  C     . ARG G 3 179 ? 29.301 11.695  42.274  1.00 60.84  ? 179  ARG E C     1 
ATOM   9494  O  O     . ARG G 3 179 ? 29.556 10.679  42.919  1.00 56.02  ? 179  ARG E O     1 
ATOM   9495  C  CB    . ARG G 3 179 ? 31.416 12.853  42.813  1.00 76.24  ? 179  ARG E CB    1 
ATOM   9496  C  CG    . ARG G 3 179 ? 32.843 13.109  42.328  1.00 88.76  ? 179  ARG E CG    1 
ATOM   9497  C  CD    . ARG G 3 179 ? 33.839 13.116  43.484  1.00 95.06  ? 179  ARG E CD    1 
ATOM   9498  N  NE    . ARG G 3 179 ? 33.467 14.082  44.515  1.00 102.49 ? 179  ARG E NE    1 
ATOM   9499  C  CZ    . ARG G 3 179 ? 33.520 15.402  44.362  1.00 106.37 ? 179  ARG E CZ    1 
ATOM   9500  N  NH1   . ARG G 3 179 ? 33.938 15.926  43.214  1.00 103.93 ? 179  ARG E NH1   1 
ATOM   9501  N  NH2   . ARG G 3 179 ? 33.149 16.198  45.357  1.00 105.45 ? 179  ARG E NH2   1 
ATOM   9502  N  N     . ILE G 3 180 ? 28.062 12.117  42.074  1.00 60.58  ? 180  ILE E N     1 
ATOM   9503  C  CA    . ILE G 3 180 ? 26.942 11.330  42.577  1.00 62.06  ? 180  ILE E CA    1 
ATOM   9504  C  C     . ILE G 3 180 ? 26.939 10.043  41.748  1.00 65.92  ? 180  ILE E C     1 
ATOM   9505  O  O     . ILE G 3 180 ? 27.392 10.052  40.604  1.00 67.86  ? 180  ILE E O     1 
ATOM   9506  C  CB    . ILE G 3 180 ? 25.601 12.020  42.309  1.00 52.93  ? 180  ILE E CB    1 
ATOM   9507  C  CG1   . ILE G 3 180 ? 25.649 13.480  42.759  1.00 46.26  ? 180  ILE E CG1   1 
ATOM   9508  C  CG2   . ILE G 3 180 ? 24.495 11.257  43.004  1.00 51.21  ? 180  ILE E CG2   1 
ATOM   9509  C  CD1   . ILE G 3 180 ? 24.422 14.285  42.329  1.00 43.19  ? 180  ILE E CD1   1 
ATOM   9510  N  N     . ARG G 3 181 ? 26.449 8.937   42.297  1.00 67.23  ? 181  ARG E N     1 
ATOM   9511  C  CA    . ARG G 3 181 ? 26.384 7.703   41.506  1.00 68.22  ? 181  ARG E CA    1 
ATOM   9512  C  C     . ARG G 3 181 ? 25.132 6.867   41.801  1.00 69.40  ? 181  ARG E C     1 
ATOM   9513  O  O     . ARG G 3 181 ? 24.571 6.921   42.899  1.00 68.54  ? 181  ARG E O     1 
ATOM   9514  C  CB    . ARG G 3 181 ? 27.673 6.875   41.660  1.00 66.27  ? 181  ARG E CB    1 
ATOM   9515  C  CG    . ARG G 3 181 ? 28.134 6.623   43.076  1.00 61.43  ? 181  ARG E CG    1 
ATOM   9516  C  CD    . ARG G 3 181 ? 29.656 6.792   43.206  1.00 69.49  ? 181  ARG E CD    1 
ATOM   9517  N  NE    . ARG G 3 181 ? 30.426 5.955   42.283  1.00 81.18  ? 181  ARG E NE    1 
ATOM   9518  C  CZ    . ARG G 3 181 ? 31.758 5.925   42.234  1.00 88.29  ? 181  ARG E CZ    1 
ATOM   9519  N  NH1   . ARG G 3 181 ? 32.476 6.681   43.057  1.00 86.97  ? 181  ARG E NH1   1 
ATOM   9520  N  NH2   . ARG G 3 181 ? 32.378 5.156   41.348  1.00 89.27  ? 181  ARG E NH2   1 
ATOM   9521  N  N     . VAL G 3 182 ? 24.690 6.112   40.799  1.00 70.36  ? 182  VAL E N     1 
ATOM   9522  C  CA    . VAL G 3 182 ? 23.482 5.294   40.896  1.00 72.84  ? 182  VAL E CA    1 
ATOM   9523  C  C     . VAL G 3 182 ? 23.499 4.233   42.001  1.00 74.62  ? 182  VAL E C     1 
ATOM   9524  O  O     . VAL G 3 182 ? 22.684 3.305   42.011  1.00 76.05  ? 182  VAL E O     1 
ATOM   9525  C  CB    . VAL G 3 182 ? 23.181 4.616   39.543  1.00 71.81  ? 182  VAL E CB    1 
ATOM   9526  C  CG1   . VAL G 3 182 ? 21.682 4.331   39.422  1.00 60.56  ? 182  VAL E CG1   1 
ATOM   9527  C  CG2   . VAL G 3 182 ? 23.647 5.511   38.408  1.00 69.75  ? 182  VAL E CG2   1 
ATOM   9528  N  N     . LYS G 3 183 ? 24.439 4.377   42.926  1.00 73.50  ? 183  LYS E N     1 
ATOM   9529  C  CA    . LYS G 3 183 ? 24.573 3.479   44.067  1.00 74.91  ? 183  LYS E CA    1 
ATOM   9530  C  C     . LYS G 3 183 ? 23.995 4.289   45.222  1.00 79.00  ? 183  LYS E C     1 
ATOM   9531  O  O     . LYS G 3 183 ? 23.974 3.849   46.380  1.00 79.18  ? 183  LYS E O     1 
ATOM   9532  C  CB    . LYS G 3 183 ? 26.059 3.199   44.319  1.00 69.55  ? 183  LYS E CB    1 
ATOM   9533  C  CG    . LYS G 3 183 ? 26.416 2.783   45.748  1.00 67.13  ? 183  LYS E CG    1 
ATOM   9534  C  CD    . LYS G 3 183 ? 27.881 3.075   46.059  1.00 68.84  ? 183  LYS E CD    1 
ATOM   9535  C  CE    . LYS G 3 183 ? 28.816 2.320   45.113  1.00 72.37  ? 183  LYS E CE    1 
ATOM   9536  N  NZ    . LYS G 3 183 ? 30.252 2.727   45.253  1.00 64.29  ? 183  LYS E NZ    1 
ATOM   9537  N  N     . ASP G 3 184 ? 23.504 5.479   44.880  1.00 80.55  ? 184  ASP E N     1 
ATOM   9538  C  CA    . ASP G 3 184 ? 22.983 6.398   45.874  1.00 77.92  ? 184  ASP E CA    1 
ATOM   9539  C  C     . ASP G 3 184 ? 21.491 6.694   45.883  1.00 78.34  ? 184  ASP E C     1 
ATOM   9540  O  O     . ASP G 3 184 ? 20.837 6.479   46.907  1.00 80.73  ? 184  ASP E O     1 
ATOM   9541  C  CB    . ASP G 3 184 ? 23.777 7.699   45.786  1.00 83.12  ? 184  ASP E CB    1 
ATOM   9542  C  CG    . ASP G 3 184 ? 25.247 7.494   46.104  1.00 94.30  ? 184  ASP E CG    1 
ATOM   9543  O  OD1   . ASP G 3 184 ? 26.079 8.325   45.682  1.00 97.15  ? 184  ASP E OD1   1 
ATOM   9544  O  OD2   . ASP G 3 184 ? 25.567 6.496   46.785  1.00 95.89  ? 184  ASP E OD2   1 
ATOM   9545  N  N     . ILE G 3 185 ? 20.931 7.176   44.776  1.00 77.07  ? 185  ILE E N     1 
ATOM   9546  C  CA    . ILE G 3 185 ? 19.506 7.489   44.806  1.00 75.73  ? 185  ILE E CA    1 
ATOM   9547  C  C     . ILE G 3 185 ? 18.667 6.357   45.396  1.00 79.51  ? 185  ILE E C     1 
ATOM   9548  O  O     . ILE G 3 185 ? 18.669 5.230   44.894  1.00 78.52  ? 185  ILE E O     1 
ATOM   9549  C  CB    . ILE G 3 185 ? 18.924 7.828   43.416  1.00 67.10  ? 185  ILE E CB    1 
ATOM   9550  C  CG1   . ILE G 3 185 ? 19.659 9.016   42.798  1.00 67.82  ? 185  ILE E CG1   1 
ATOM   9551  C  CG2   . ILE G 3 185 ? 17.443 8.209   43.565  1.00 51.89  ? 185  ILE E CG2   1 
ATOM   9552  C  CD1   . ILE G 3 185 ? 19.015 9.514   41.513  1.00 63.47  ? 185  ILE E CD1   1 
ATOM   9553  N  N     . SER G 3 186 ? 17.957 6.679   46.475  1.00 82.49  ? 186  SER E N     1 
ATOM   9554  C  CA    . SER G 3 186 ? 17.084 5.733   47.160  1.00 83.91  ? 186  SER E CA    1 
ATOM   9555  C  C     . SER G 3 186 ? 15.665 6.291   47.095  1.00 85.99  ? 186  SER E C     1 
ATOM   9556  O  O     . SER G 3 186 ? 15.466 7.457   46.742  1.00 85.34  ? 186  SER E O     1 
ATOM   9557  C  CB    . SER G 3 186 ? 17.520 5.565   48.619  1.00 79.99  ? 186  SER E CB    1 
ATOM   9558  O  OG    . SER G 3 186 ? 17.438 6.793   49.320  1.00 74.63  ? 186  SER E OG    1 
ATOM   9559  N  N     . ARG G 3 187 ? 14.679 5.466   47.431  1.00 89.66  ? 187  ARG E N     1 
ATOM   9560  C  CA    . ARG G 3 187 ? 13.290 5.910   47.388  1.00 94.14  ? 187  ARG E CA    1 
ATOM   9561  C  C     . ARG G 3 187 ? 12.756 6.334   48.752  1.00 98.10  ? 187  ARG E C     1 
ATOM   9562  O  O     . ARG G 3 187 ? 13.397 6.121   49.788  1.00 96.56  ? 187  ARG E O     1 
ATOM   9563  C  CB    . ARG G 3 187 ? 12.396 4.805   46.809  1.00 93.01  ? 187  ARG E CB    1 
ATOM   9564  C  CG    . ARG G 3 187 ? 12.689 4.457   45.353  1.00 96.81  ? 187  ARG E CG    1 
ATOM   9565  C  CD    . ARG G 3 187 ? 12.197 5.538   44.382  1.00 100.96 ? 187  ARG E CD    1 
ATOM   9566  N  NE    . ARG G 3 187 ? 12.663 5.283   43.015  1.00 102.98 ? 187  ARG E NE    1 
ATOM   9567  C  CZ    . ARG G 3 187 ? 12.263 5.959   41.942  1.00 102.29 ? 187  ARG E CZ    1 
ATOM   9568  N  NH1   . ARG G 3 187 ? 11.377 6.940   42.069  1.00 96.13  ? 187  ARG E NH1   1 
ATOM   9569  N  NH2   . ARG G 3 187 ? 12.753 5.656   40.744  1.00 97.63  ? 187  ARG E NH2   1 
ATOM   9570  N  N     . THR G 3 188 ? 11.575 6.946   48.728  1.00 102.33 ? 188  THR E N     1 
ATOM   9571  C  CA    . THR G 3 188 ? 10.899 7.417   49.933  1.00 104.35 ? 188  THR E CA    1 
ATOM   9572  C  C     . THR G 3 188 ? 9.559  6.713   50.075  1.00 106.03 ? 188  THR E C     1 
ATOM   9573  O  O     . THR G 3 188 ? 9.004  6.197   49.100  1.00 104.10 ? 188  THR E O     1 
ATOM   9574  C  CB    . THR G 3 188 ? 10.661 8.951   49.880  1.00 103.17 ? 188  THR E CB    1 
ATOM   9575  O  OG1   . THR G 3 188 ? 11.870 9.632   50.239  1.00 100.01 ? 188  THR E OG1   1 
ATOM   9576  C  CG2   . THR G 3 188 ? 9.538  9.373   50.826  1.00 100.86 ? 188  THR E CG2   1 
ATOM   9577  N  N     . ASP G 3 189 ? 9.056  6.679   51.303  1.00 108.03 ? 189  ASP E N     1 
ATOM   9578  C  CA    . ASP G 3 189 ? 7.769  6.063   51.587  1.00 109.93 ? 189  ASP E CA    1 
ATOM   9579  C  C     . ASP G 3 189 ? 6.725  6.800   50.744  1.00 109.11 ? 189  ASP E C     1 
ATOM   9580  O  O     . ASP G 3 189 ? 5.888  6.175   50.076  1.00 108.37 ? 189  ASP E O     1 
ATOM   9581  C  CB    . ASP G 3 189 ? 7.440  6.209   53.078  1.00 118.33 ? 189  ASP E CB    1 
ATOM   9582  C  CG    . ASP G 3 189 ? 8.628  6.709   53.893  1.00 124.63 ? 189  ASP E CG    1 
ATOM   9583  O  OD1   . ASP G 3 189 ? 9.666  6.011   53.931  1.00 125.93 ? 189  ASP E OD1   1 
ATOM   9584  O  OD2   . ASP G 3 189 ? 8.523  7.804   54.492  1.00 125.60 ? 189  ASP E OD2   1 
ATOM   9585  N  N     . GLY G 3 190 ? 6.804  8.133   50.775  1.00 107.20 ? 190  GLY E N     1 
ATOM   9586  C  CA    . GLY G 3 190 ? 5.883  8.976   50.028  1.00 104.12 ? 190  GLY E CA    1 
ATOM   9587  C  C     . GLY G 3 190 ? 6.206  9.083   48.547  1.00 103.32 ? 190  GLY E C     1 
ATOM   9588  O  O     . GLY G 3 190 ? 5.423  9.637   47.771  1.00 103.00 ? 190  GLY E O     1 
ATOM   9589  N  N     . GLY G 3 191 ? 7.360  8.553   48.154  1.00 101.49 ? 191  GLY E N     1 
ATOM   9590  C  CA    . GLY G 3 191 ? 7.753  8.597   46.758  1.00 97.87  ? 191  GLY E CA    1 
ATOM   9591  C  C     . GLY G 3 191 ? 8.688  9.744   46.420  1.00 97.13  ? 191  GLY E C     1 
ATOM   9592  O  O     . GLY G 3 191 ? 8.463  10.481  45.455  1.00 97.61  ? 191  GLY E O     1 
ATOM   9593  N  N     . ARG G 3 192 ? 9.737  9.902   47.218  1.00 93.66  ? 192  ARG E N     1 
ATOM   9594  C  CA    . ARG G 3 192 ? 10.714 10.960  46.991  1.00 90.95  ? 192  ARG E CA    1 
ATOM   9595  C  C     . ARG G 3 192 ? 12.094 10.322  46.929  1.00 89.19  ? 192  ARG E C     1 
ATOM   9596  O  O     . ARG G 3 192 ? 12.348 9.316   47.591  1.00 89.01  ? 192  ARG E O     1 
ATOM   9597  C  CB    . ARG G 3 192 ? 10.660 11.994  48.126  1.00 94.80  ? 192  ARG E CB    1 
ATOM   9598  C  CG    . ARG G 3 192 ? 9.310  12.710  48.270  1.00 92.74  ? 192  ARG E CG    1 
ATOM   9599  C  CD    . ARG G 3 192 ? 9.334  13.753  49.386  1.00 90.40  ? 192  ARG E CD    1 
ATOM   9600  N  NE    . ARG G 3 192 ? 8.075  14.492  49.479  1.00 89.20  ? 192  ARG E NE    1 
ATOM   9601  C  CZ    . ARG G 3 192 ? 6.930  13.980  49.929  1.00 89.95  ? 192  ARG E CZ    1 
ATOM   9602  N  NH1   . ARG G 3 192 ? 6.877  12.716  50.335  1.00 89.77  ? 192  ARG E NH1   1 
ATOM   9603  N  NH2   . ARG G 3 192 ? 5.833  14.730  49.975  1.00 83.02  ? 192  ARG E NH2   1 
ATOM   9604  N  N     . MET G 3 193 ? 12.983 10.892  46.125  1.00 85.54  ? 193  MET E N     1 
ATOM   9605  C  CA    . MET G 3 193 ? 14.329 10.346  46.003  1.00 83.22  ? 193  MET E CA    1 
ATOM   9606  C  C     . MET G 3 193 ? 15.311 11.030  46.952  1.00 81.16  ? 193  MET E C     1 
ATOM   9607  O  O     . MET G 3 193 ? 15.447 12.257  46.964  1.00 82.76  ? 193  MET E O     1 
ATOM   9608  C  CB    . MET G 3 193 ? 14.838 10.489  44.568  1.00 84.41  ? 193  MET E CB    1 
ATOM   9609  C  CG    . MET G 3 193 ? 13.903 9.948   43.514  1.00 86.38  ? 193  MET E CG    1 
ATOM   9610  S  SD    . MET G 3 193 ? 14.582 10.156  41.855  1.00 92.89  ? 193  MET E SD    1 
ATOM   9611  C  CE    . MET G 3 193 ? 15.041 8.458   41.450  1.00 92.85  ? 193  MET E CE    1 
ATOM   9612  N  N     . LEU G 3 194 ? 15.986 10.228  47.761  1.00 75.64  ? 194  LEU E N     1 
ATOM   9613  C  CA    . LEU G 3 194 ? 16.976 10.751  48.686  1.00 74.02  ? 194  LEU E CA    1 
ATOM   9614  C  C     . LEU G 3 194 ? 18.312 10.554  47.961  1.00 74.60  ? 194  LEU E C     1 
ATOM   9615  O  O     . LEU G 3 194 ? 18.429 9.654   47.127  1.00 75.32  ? 194  LEU E O     1 
ATOM   9616  C  CB    . LEU G 3 194 ? 16.941 9.952   49.998  1.00 75.13  ? 194  LEU E CB    1 
ATOM   9617  C  CG    . LEU G 3 194 ? 17.848 10.376  51.164  1.00 77.29  ? 194  LEU E CG    1 
ATOM   9618  C  CD1   . LEU G 3 194 ? 17.438 11.770  51.653  1.00 75.08  ? 194  LEU E CD1   1 
ATOM   9619  C  CD2   . LEU G 3 194 ? 17.748 9.354   52.300  1.00 68.53  ? 194  LEU E CD2   1 
ATOM   9620  N  N     . ILE G 3 195 ? 19.307 11.390  48.250  1.00 73.30  ? 195  ILE E N     1 
ATOM   9621  C  CA    . ILE G 3 195 ? 20.607 11.250  47.595  1.00 70.46  ? 195  ILE E CA    1 
ATOM   9622  C  C     . ILE G 3 195 ? 21.750 11.266  48.594  1.00 68.66  ? 195  ILE E C     1 
ATOM   9623  O  O     . ILE G 3 195 ? 22.258 12.326  48.944  1.00 68.71  ? 195  ILE E O     1 
ATOM   9624  C  CB    . ILE G 3 195 ? 20.879 12.388  46.584  1.00 67.44  ? 195  ILE E CB    1 
ATOM   9625  C  CG1   . ILE G 3 195 ? 19.707 12.543  45.613  1.00 61.60  ? 195  ILE E CG1   1 
ATOM   9626  C  CG2   . ILE G 3 195 ? 22.163 12.093  45.812  1.00 69.77  ? 195  ILE E CG2   1 
ATOM   9627  C  CD1   . ILE G 3 195 ? 19.966 13.580  44.534  1.00 53.54  ? 195  ILE E CD1   1 
ATOM   9628  N  N     . HIS G 3 196 ? 22.158 10.096  49.059  1.00 68.20  ? 196  HIS E N     1 
ATOM   9629  C  CA    . HIS G 3 196 ? 23.261 10.037  50.004  1.00 73.31  ? 196  HIS E CA    1 
ATOM   9630  C  C     . HIS G 3 196 ? 24.459 10.679  49.317  1.00 73.75  ? 196  HIS E C     1 
ATOM   9631  O  O     . HIS G 3 196 ? 24.553 10.652  48.091  1.00 69.59  ? 196  HIS E O     1 
ATOM   9632  C  CB    . HIS G 3 196 ? 23.568 8.578   50.349  1.00 86.01  ? 196  HIS E CB    1 
ATOM   9633  C  CG    . HIS G 3 196 ? 24.756 8.399   51.243  1.00 99.14  ? 196  HIS E CG    1 
ATOM   9634  N  ND1   . HIS G 3 196 ? 26.016 8.849   50.907  1.00 103.20 ? 196  HIS E ND1   1 
ATOM   9635  C  CD2   . HIS G 3 196 ? 24.881 7.793   52.448  1.00 102.52 ? 196  HIS E CD2   1 
ATOM   9636  C  CE1   . HIS G 3 196 ? 26.867 8.526   51.866  1.00 103.67 ? 196  HIS E CE1   1 
ATOM   9637  N  NE2   . HIS G 3 196 ? 26.204 7.885   52.813  1.00 103.49 ? 196  HIS E NE2   1 
ATOM   9638  N  N     . ILE G 3 197 ? 25.353 11.287  50.088  1.00 76.98  ? 197  ILE E N     1 
ATOM   9639  C  CA    . ILE G 3 197 ? 26.545 11.890  49.500  1.00 82.89  ? 197  ILE E CA    1 
ATOM   9640  C  C     . ILE G 3 197 ? 27.753 11.644  50.409  1.00 89.32  ? 197  ILE E C     1 
ATOM   9641  O  O     . ILE G 3 197 ? 27.784 12.092  51.555  1.00 86.29  ? 197  ILE E O     1 
ATOM   9642  C  CB    . ILE G 3 197 ? 26.360 13.432  49.210  1.00 78.16  ? 197  ILE E CB    1 
ATOM   9643  C  CG1   . ILE G 3 197 ? 27.062 14.285  50.264  1.00 87.99  ? 197  ILE E CG1   1 
ATOM   9644  C  CG2   . ILE G 3 197 ? 24.882 13.790  49.159  1.00 57.21  ? 197  ILE E CG2   1 
ATOM   9645  C  CD1   . ILE G 3 197 ? 27.131 15.757  49.900  1.00 87.65  ? 197  ILE E CD1   1 
ATOM   9646  N  N     . GLY G 3 198 ? 28.734 10.905  49.893  1.00 98.72  ? 198  GLY E N     1 
ATOM   9647  C  CA    . GLY G 3 198 ? 29.926 10.599  50.668  1.00 111.18 ? 198  GLY E CA    1 
ATOM   9648  C  C     . GLY G 3 198 ? 31.199 11.212  50.108  1.00 120.42 ? 198  GLY E C     1 
ATOM   9649  O  O     . GLY G 3 198 ? 31.146 12.047  49.204  1.00 120.05 ? 198  GLY E O     1 
ATOM   9650  N  N     . ARG G 3 199 ? 32.344 10.796  50.647  1.00 128.37 ? 199  ARG E N     1 
ATOM   9651  C  CA    . ARG G 3 199 ? 33.651 11.298  50.215  1.00 138.21 ? 199  ARG E CA    1 
ATOM   9652  C  C     . ARG G 3 199 ? 33.711 12.814  50.038  1.00 143.76 ? 199  ARG E C     1 
ATOM   9653  O  O     . ARG G 3 199 ? 34.381 13.314  49.133  1.00 142.79 ? 199  ARG E O     1 
ATOM   9654  C  CB    . ARG G 3 199 ? 34.077 10.635  48.902  1.00 142.54 ? 199  ARG E CB    1 
ATOM   9655  C  CG    . ARG G 3 199 ? 34.548 9.195   49.018  1.00 142.97 ? 199  ARG E CG    1 
ATOM   9656  C  CD    . ARG G 3 199 ? 35.354 8.823   47.780  1.00 143.00 ? 199  ARG E CD    1 
ATOM   9657  N  NE    . ARG G 3 199 ? 34.593 9.047   46.552  1.00 142.01 ? 199  ARG E NE    1 
ATOM   9658  C  CZ    . ARG G 3 199 ? 35.133 9.214   45.347  1.00 138.56 ? 199  ARG E CZ    1 
ATOM   9659  N  NH1   . ARG G 3 199 ? 36.452 9.188   45.194  1.00 135.67 ? 199  ARG E NH1   1 
ATOM   9660  N  NH2   . ARG G 3 199 ? 34.353 9.411   44.290  1.00 135.23 ? 199  ARG E NH2   1 
ATOM   9661  N  N     . THR G 3 200 ? 33.019 13.544  50.906  1.00 149.83 ? 200  THR E N     1 
ATOM   9662  C  CA    . THR G 3 200 ? 33.003 15.001  50.823  1.00 154.34 ? 200  THR E CA    1 
ATOM   9663  C  C     . THR G 3 200 ? 34.311 15.631  51.288  1.00 154.95 ? 200  THR E C     1 
ATOM   9664  O  O     . THR G 3 200 ? 34.778 15.364  52.396  1.00 154.88 ? 200  THR E O     1 
ATOM   9665  C  CB    . THR G 3 200 ? 31.853 15.595  51.665  1.00 158.02 ? 200  THR E CB    1 
ATOM   9666  O  OG1   . THR G 3 200 ? 30.595 15.206  51.098  1.00 161.10 ? 200  THR E OG1   1 
ATOM   9667  C  CG2   . THR G 3 200 ? 31.945 17.120  51.698  1.00 156.86 ? 200  THR E CG2   1 
ATOM   9668  N  N     . LYS G 3 201 ? 34.896 16.465  50.430  1.00 155.15 ? 201  LYS E N     1 
ATOM   9669  C  CA    . LYS G 3 201 ? 36.142 17.155  50.755  1.00 154.60 ? 201  LYS E CA    1 
ATOM   9670  C  C     . LYS G 3 201 ? 35.869 18.223  51.810  1.00 154.96 ? 201  LYS E C     1 
ATOM   9671  O  O     . LYS G 3 201 ? 35.937 19.425  51.538  1.00 154.23 ? 201  LYS E O     1 
ATOM   9672  C  CB    . LYS G 3 201 ? 36.754 17.804  49.504  1.00 150.21 ? 201  LYS E CB    1 
ATOM   9673  C  CG    . LYS G 3 201 ? 37.673 16.892  48.690  1.00 146.20 ? 201  LYS E CG    1 
ATOM   9674  C  CD    . LYS G 3 201 ? 36.911 15.815  47.929  1.00 141.44 ? 201  LYS E CD    1 
ATOM   9675  C  CE    . LYS G 3 201 ? 37.869 14.850  47.234  1.00 137.69 ? 201  LYS E CE    1 
ATOM   9676  N  NZ    . LYS G 3 201 ? 38.854 15.537  46.347  1.00 131.58 ? 201  LYS E NZ    1 
ATOM   9677  N  N     . THR G 3 202 ? 35.551 17.760  53.014  1.00 155.54 ? 202  THR E N     1 
ATOM   9678  C  CA    . THR G 3 202 ? 35.256 18.624  54.152  1.00 154.69 ? 202  THR E CA    1 
ATOM   9679  C  C     . THR G 3 202 ? 35.302 17.737  55.397  1.00 152.81 ? 202  THR E C     1 
ATOM   9680  O  O     . THR G 3 202 ? 34.556 16.759  55.489  1.00 152.78 ? 202  THR E O     1 
ATOM   9681  C  CB    . THR G 3 202 ? 33.838 19.244  54.038  1.00 156.96 ? 202  THR E CB    1 
ATOM   9682  O  OG1   . THR G 3 202 ? 33.664 19.828  52.739  1.00 157.56 ? 202  THR E OG1   1 
ATOM   9683  C  CG2   . THR G 3 202 ? 33.642 20.318  55.103  1.00 156.55 ? 202  THR E CG2   1 
ATOM   9684  N  N     . LEU G 3 203 ? 36.178 18.059  56.344  1.00 149.47 ? 203  LEU E N     1 
ATOM   9685  C  CA    . LEU G 3 203 ? 36.275 17.256  57.558  1.00 145.96 ? 203  LEU E CA    1 
ATOM   9686  C  C     . LEU G 3 203 ? 35.045 17.471  58.436  1.00 145.14 ? 203  LEU E C     1 
ATOM   9687  O  O     . LEU G 3 203 ? 34.286 16.534  58.702  1.00 144.37 ? 203  LEU E O     1 
ATOM   9688  C  CB    . LEU G 3 203 ? 37.541 17.611  58.342  1.00 137.85 ? 203  LEU E CB    1 
ATOM   9689  C  CG    . LEU G 3 203 ? 37.735 16.798  59.629  1.00 132.89 ? 203  LEU E CG    1 
ATOM   9690  C  CD1   . LEU G 3 203 ? 37.801 15.310  59.305  1.00 132.94 ? 203  LEU E CD1   1 
ATOM   9691  C  CD2   . LEU G 3 203 ? 39.004 17.250  60.330  1.00 126.69 ? 203  LEU E CD2   1 
ATOM   9692  N  N     . VAL G 3 204 ? 34.860 18.710  58.884  1.00 143.99 ? 204  VAL E N     1 
ATOM   9693  C  CA    . VAL G 3 204 ? 33.718 19.082  59.717  1.00 141.59 ? 204  VAL E CA    1 
ATOM   9694  C  C     . VAL G 3 204 ? 32.700 19.789  58.824  1.00 142.14 ? 204  VAL E C     1 
ATOM   9695  O  O     . VAL G 3 204 ? 32.622 21.021  58.789  1.00 140.61 ? 204  VAL E O     1 
ATOM   9696  C  CB    . VAL G 3 204 ? 34.149 20.020  60.881  1.00 134.64 ? 204  VAL E CB    1 
ATOM   9697  C  CG1   . VAL G 3 204 ? 32.927 20.603  61.579  1.00 130.51 ? 204  VAL E CG1   1 
ATOM   9698  C  CG2   . VAL G 3 204 ? 34.996 19.242  61.884  1.00 129.12 ? 204  VAL E CG2   1 
ATOM   9699  N  N     . SER G 3 205 ? 31.932 18.987  58.094  1.00 142.36 ? 205  SER E N     1 
ATOM   9700  C  CA    . SER G 3 205 ? 30.922 19.497  57.180  1.00 142.42 ? 205  SER E CA    1 
ATOM   9701  C  C     . SER G 3 205 ? 29.776 20.195  57.896  1.00 142.71 ? 205  SER E C     1 
ATOM   9702  O  O     . SER G 3 205 ? 28.999 19.565  58.615  1.00 143.40 ? 205  SER E O     1 
ATOM   9703  C  CB    . SER G 3 205 ? 30.363 18.358  56.324  1.00 139.28 ? 205  SER E CB    1 
ATOM   9704  O  OG    . SER G 3 205 ? 31.378 17.770  55.533  1.00 136.56 ? 205  SER E OG    1 
ATOM   9705  N  N     . THR G 3 206 ? 29.684 21.505  57.698  1.00 141.39 ? 206  THR E N     1 
ATOM   9706  C  CA    . THR G 3 206 ? 28.617 22.296  58.290  1.00 137.51 ? 206  THR E CA    1 
ATOM   9707  C  C     . THR G 3 206 ? 27.511 22.350  57.239  1.00 135.07 ? 206  THR E C     1 
ATOM   9708  O  O     . THR G 3 206 ? 26.715 23.288  57.186  1.00 134.41 ? 206  THR E O     1 
ATOM   9709  C  CB    . THR G 3 206 ? 29.101 23.722  58.626  1.00 135.26 ? 206  THR E CB    1 
ATOM   9710  O  OG1   . THR G 3 206 ? 29.578 24.360  57.437  1.00 135.82 ? 206  THR E OG1   1 
ATOM   9711  C  CG2   . THR G 3 206 ? 30.226 23.671  59.654  1.00 132.01 ? 206  THR E CG2   1 
ATOM   9712  N  N     . ALA G 3 207 ? 27.488 21.318  56.400  1.00 132.07 ? 207  ALA E N     1 
ATOM   9713  C  CA    . ALA G 3 207 ? 26.510 21.191  55.328  1.00 127.23 ? 207  ALA E CA    1 
ATOM   9714  C  C     . ALA G 3 207 ? 25.762 19.865  55.443  1.00 124.24 ? 207  ALA E C     1 
ATOM   9715  O  O     . ALA G 3 207 ? 25.893 19.149  56.441  1.00 124.31 ? 207  ALA E O     1 
ATOM   9716  C  CB    . ALA G 3 207 ? 27.210 21.278  53.978  1.00 124.86 ? 207  ALA E CB    1 
ATOM   9717  N  N     . GLY G 3 208 ? 24.988 19.541  54.412  1.00 119.15 ? 208  GLY E N     1 
ATOM   9718  C  CA    . GLY G 3 208 ? 24.219 18.307  54.418  1.00 113.48 ? 208  GLY E CA    1 
ATOM   9719  C  C     . GLY G 3 208 ? 24.976 17.019  54.114  1.00 108.57 ? 208  GLY E C     1 
ATOM   9720  O  O     . GLY G 3 208 ? 26.207 17.011  53.963  1.00 107.84 ? 208  GLY E O     1 
ATOM   9721  N  N     . VAL G 3 209 ? 24.222 15.920  54.040  1.00 101.71 ? 209  VAL E N     1 
ATOM   9722  C  CA    . VAL G 3 209 ? 24.768 14.598  53.750  1.00 92.76  ? 209  VAL E CA    1 
ATOM   9723  C  C     . VAL G 3 209 ? 23.704 13.782  53.029  1.00 89.03  ? 209  VAL E C     1 
ATOM   9724  O  O     . VAL G 3 209 ? 24.016 12.797  52.367  1.00 90.39  ? 209  VAL E O     1 
ATOM   9725  C  CB    . VAL G 3 209 ? 25.204 13.858  55.049  1.00 88.45  ? 209  VAL E CB    1 
ATOM   9726  C  CG1   . VAL G 3 209 ? 25.614 12.425  54.735  1.00 81.34  ? 209  VAL E CG1   1 
ATOM   9727  C  CG2   . VAL G 3 209 ? 26.359 14.604  55.714  1.00 90.39  ? 209  VAL E CG2   1 
ATOM   9728  N  N     . GLU G 3 210 ? 22.448 14.204  53.156  1.00 84.57  ? 210  GLU E N     1 
ATOM   9729  C  CA    . GLU G 3 210 ? 21.328 13.522  52.502  1.00 83.11  ? 210  GLU E CA    1 
ATOM   9730  C  C     . GLU G 3 210 ? 20.247 14.495  52.044  1.00 78.32  ? 210  GLU E C     1 
ATOM   9731  O  O     . GLU G 3 210 ? 19.389 14.900  52.830  1.00 77.31  ? 210  GLU E O     1 
ATOM   9732  C  CB    . GLU G 3 210 ? 20.704 12.484  53.439  1.00 92.99  ? 210  GLU E CB    1 
ATOM   9733  C  CG    . GLU G 3 210 ? 21.449 11.159  53.483  1.00 105.93 ? 210  GLU E CG    1 
ATOM   9734  C  CD    . GLU G 3 210 ? 20.979 10.260  54.611  1.00 116.89 ? 210  GLU E CD    1 
ATOM   9735  O  OE1   . GLU G 3 210 ? 21.539 9.149   54.767  1.00 118.64 ? 210  GLU E OE1   1 
ATOM   9736  O  OE2   . GLU G 3 210 ? 20.048 10.667  55.343  1.00 121.62 ? 210  GLU E OE2   1 
ATOM   9737  N  N     . LYS G 3 211 ? 20.286 14.864  50.769  1.00 73.48  ? 211  LYS E N     1 
ATOM   9738  C  CA    . LYS G 3 211 ? 19.306 15.789  50.218  1.00 69.09  ? 211  LYS E CA    1 
ATOM   9739  C  C     . LYS G 3 211 ? 18.215 15.003  49.489  1.00 67.93  ? 211  LYS E C     1 
ATOM   9740  O  O     . LYS G 3 211 ? 18.492 13.973  48.869  1.00 67.54  ? 211  LYS E O     1 
ATOM   9741  C  CB    . LYS G 3 211 ? 20.004 16.763  49.269  1.00 69.65  ? 211  LYS E CB    1 
ATOM   9742  C  CG    . LYS G 3 211 ? 21.333 17.280  49.829  1.00 67.48  ? 211  LYS E CG    1 
ATOM   9743  C  CD    . LYS G 3 211 ? 21.411 18.810  49.851  1.00 72.13  ? 211  LYS E CD    1 
ATOM   9744  C  CE    . LYS G 3 211 ? 22.738 19.292  50.460  1.00 71.40  ? 211  LYS E CE    1 
ATOM   9745  N  NZ    . LYS G 3 211 ? 22.902 20.787  50.443  1.00 69.97  ? 211  LYS E NZ    1 
ATOM   9746  N  N     . ALA G 3 212 ? 16.978 15.486  49.562  1.00 65.55  ? 212  ALA E N     1 
ATOM   9747  C  CA    . ALA G 3 212 ? 15.859 14.803  48.920  1.00 63.97  ? 212  ALA E CA    1 
ATOM   9748  C  C     . ALA G 3 212 ? 15.208 15.588  47.778  1.00 66.50  ? 212  ALA E C     1 
ATOM   9749  O  O     . ALA G 3 212 ? 14.931 16.785  47.907  1.00 70.80  ? 212  ALA E O     1 
ATOM   9750  C  CB    . ALA G 3 212 ? 14.818 14.469  49.960  1.00 56.09  ? 212  ALA E CB    1 
ATOM   9751  N  N     . LEU G 3 213 ? 14.947 14.903  46.668  1.00 65.96  ? 213  LEU E N     1 
ATOM   9752  C  CA    . LEU G 3 213 ? 14.321 15.530  45.508  1.00 65.57  ? 213  LEU E CA    1 
ATOM   9753  C  C     . LEU G 3 213 ? 12.829 15.664  45.715  1.00 64.95  ? 213  LEU E C     1 
ATOM   9754  O  O     . LEU G 3 213 ? 12.244 14.893  46.455  1.00 62.67  ? 213  LEU E O     1 
ATOM   9755  C  CB    . LEU G 3 213 ? 14.571 14.694  44.253  1.00 67.61  ? 213  LEU E CB    1 
ATOM   9756  C  CG    . LEU G 3 213 ? 15.960 14.807  43.626  1.00 68.62  ? 213  LEU E CG    1 
ATOM   9757  C  CD1   . LEU G 3 213 ? 16.140 16.219  43.091  1.00 66.97  ? 213  LEU E CD1   1 
ATOM   9758  C  CD2   . LEU G 3 213 ? 17.028 14.470  44.656  1.00 66.05  ? 213  LEU E CD2   1 
ATOM   9759  N  N     . SER G 3 214 ? 12.216 16.644  45.060  1.00 69.04  ? 214  SER E N     1 
ATOM   9760  C  CA    . SER G 3 214 ? 10.772 16.841  45.168  1.00 74.74  ? 214  SER E CA    1 
ATOM   9761  C  C     . SER G 3 214 ? 10.084 15.854  44.226  1.00 80.00  ? 214  SER E C     1 
ATOM   9762  O  O     . SER G 3 214 ? 10.750 15.080  43.535  1.00 80.72  ? 214  SER E O     1 
ATOM   9763  C  CB    . SER G 3 214 ? 10.379 18.263  44.751  1.00 72.66  ? 214  SER E CB    1 
ATOM   9764  O  OG    . SER G 3 214 ? 9.832  18.287  43.438  1.00 71.62  ? 214  SER E OG    1 
ATOM   9765  N  N     . LEU G 3 215 ? 8.754  15.881  44.195  1.00 82.29  ? 215  LEU E N     1 
ATOM   9766  C  CA    . LEU G 3 215 ? 8.022  14.990  43.301  1.00 81.78  ? 215  LEU E CA    1 
ATOM   9767  C  C     . LEU G 3 215 ? 8.486  15.310  41.893  1.00 78.99  ? 215  LEU E C     1 
ATOM   9768  O  O     . LEU G 3 215 ? 9.192  14.518  41.261  1.00 75.88  ? 215  LEU E O     1 
ATOM   9769  C  CB    . LEU G 3 215 ? 6.512  15.235  43.390  1.00 87.75  ? 215  LEU E CB    1 
ATOM   9770  C  CG    . LEU G 3 215 ? 5.782  14.882  44.687  1.00 91.48  ? 215  LEU E CG    1 
ATOM   9771  C  CD1   . LEU G 3 215 ? 4.311  15.249  44.537  1.00 92.17  ? 215  LEU E CD1   1 
ATOM   9772  C  CD2   . LEU G 3 215 ? 5.946  13.396  44.992  1.00 91.19  ? 215  LEU E CD2   1 
ATOM   9773  N  N     . GLY G 3 216 ? 8.090  16.491  41.423  1.00 76.60  ? 216  GLY E N     1 
ATOM   9774  C  CA    . GLY G 3 216 ? 8.454  16.931  40.091  1.00 76.31  ? 216  GLY E CA    1 
ATOM   9775  C  C     . GLY G 3 216 ? 9.892  16.604  39.734  1.00 78.24  ? 216  GLY E C     1 
ATOM   9776  O  O     . GLY G 3 216 ? 10.165 15.971  38.713  1.00 76.68  ? 216  GLY E O     1 
ATOM   9777  N  N     . VAL G 3 217 ? 10.819 17.024  40.583  1.00 77.74  ? 217  VAL E N     1 
ATOM   9778  C  CA    . VAL G 3 217 ? 12.222 16.772  40.322  1.00 78.33  ? 217  VAL E CA    1 
ATOM   9779  C  C     . VAL G 3 217 ? 12.514 15.268  40.322  1.00 79.95  ? 217  VAL E C     1 
ATOM   9780  O  O     . VAL G 3 217 ? 13.181 14.773  39.411  1.00 80.48  ? 217  VAL E O     1 
ATOM   9781  C  CB    . VAL G 3 217 ? 13.109 17.500  41.354  1.00 77.13  ? 217  VAL E CB    1 
ATOM   9782  C  CG1   . VAL G 3 217 ? 14.478 17.806  40.748  1.00 73.57  ? 217  VAL E CG1   1 
ATOM   9783  C  CG2   . VAL G 3 217 ? 12.427 18.786  41.800  1.00 75.32  ? 217  VAL E CG2   1 
ATOM   9784  N  N     . THR G 3 218 ? 12.018 14.540  41.324  1.00 79.60  ? 218  THR E N     1 
ATOM   9785  C  CA    . THR G 3 218 ? 12.235 13.085  41.383  1.00 81.56  ? 218  THR E CA    1 
ATOM   9786  C  C     . THR G 3 218 ? 11.793 12.505  40.042  1.00 80.59  ? 218  THR E C     1 
ATOM   9787  O  O     . THR G 3 218 ? 12.517 11.735  39.400  1.00 79.17  ? 218  THR E O     1 
ATOM   9788  C  CB    . THR G 3 218 ? 11.401 12.403  42.522  1.00 83.56  ? 218  THR E CB    1 
ATOM   9789  O  OG1   . THR G 3 218 ? 12.171 12.353  43.732  1.00 84.48  ? 218  THR E OG1   1 
ATOM   9790  C  CG2   . THR G 3 218 ? 11.001 10.983  42.126  1.00 75.18  ? 218  THR E CG2   1 
ATOM   9791  N  N     . LYS G 3 219 ? 10.589 12.896  39.639  1.00 79.10  ? 219  LYS E N     1 
ATOM   9792  C  CA    . LYS G 3 219 ? 10.003 12.471  38.381  1.00 78.55  ? 219  LYS E CA    1 
ATOM   9793  C  C     . LYS G 3 219 ? 11.076 12.563  37.297  1.00 78.54  ? 219  LYS E C     1 
ATOM   9794  O  O     . LYS G 3 219 ? 11.622 11.552  36.853  1.00 79.65  ? 219  LYS E O     1 
ATOM   9795  C  CB    . LYS G 3 219 ? 8.844  13.405  38.039  1.00 79.43  ? 219  LYS E CB    1 
ATOM   9796  C  CG    . LYS G 3 219 ? 7.838  12.879  37.046  1.00 88.76  ? 219  LYS E CG    1 
ATOM   9797  C  CD    . LYS G 3 219 ? 6.797  13.957  36.756  1.00 94.73  ? 219  LYS E CD    1 
ATOM   9798  C  CE    . LYS G 3 219 ? 5.517  13.375  36.162  1.00 98.03  ? 219  LYS E CE    1 
ATOM   9799  N  NZ    . LYS G 3 219 ? 4.783  12.513  37.137  1.00 96.12  ? 219  LYS E NZ    1 
ATOM   9800  N  N     . LEU G 3 220 ? 11.390 13.793  36.904  1.00 75.83  ? 220  LEU E N     1 
ATOM   9801  C  CA    . LEU G 3 220 ? 12.372 14.068  35.864  1.00 71.58  ? 220  LEU E CA    1 
ATOM   9802  C  C     . LEU G 3 220 ? 13.667 13.269  36.000  1.00 72.07  ? 220  LEU E C     1 
ATOM   9803  O  O     . LEU G 3 220 ? 14.290 12.912  34.998  1.00 69.94  ? 220  LEU E O     1 
ATOM   9804  C  CB    . LEU G 3 220 ? 12.676 15.566  35.839  1.00 71.56  ? 220  LEU E CB    1 
ATOM   9805  C  CG    . LEU G 3 220 ? 11.465 16.460  36.150  1.00 74.61  ? 220  LEU E CG    1 
ATOM   9806  C  CD1   . LEU G 3 220 ? 11.810 17.912  35.857  1.00 72.73  ? 220  LEU E CD1   1 
ATOM   9807  C  CD2   . LEU G 3 220 ? 10.254 16.034  35.321  1.00 73.68  ? 220  LEU E CD2   1 
ATOM   9808  N  N     . VAL G 3 221 ? 14.075 12.979  37.230  1.00 71.27  ? 221  VAL E N     1 
ATOM   9809  C  CA    . VAL G 3 221 ? 15.299 12.219  37.427  1.00 73.83  ? 221  VAL E CA    1 
ATOM   9810  C  C     . VAL G 3 221 ? 15.068 10.768  37.024  1.00 76.90  ? 221  VAL E C     1 
ATOM   9811  O  O     . VAL G 3 221 ? 15.859 10.189  36.269  1.00 76.05  ? 221  VAL E O     1 
ATOM   9812  C  CB    . VAL G 3 221 ? 15.762 12.261  38.886  1.00 71.45  ? 221  VAL E CB    1 
ATOM   9813  C  CG1   . VAL G 3 221 ? 17.129 11.598  39.013  1.00 60.40  ? 221  VAL E CG1   1 
ATOM   9814  C  CG2   . VAL G 3 221 ? 15.817 13.696  39.362  1.00 68.33  ? 221  VAL E CG2   1 
ATOM   9815  N  N     . GLU G 3 222 ? 13.980 10.187  37.530  1.00 79.96  ? 222  GLU E N     1 
ATOM   9816  C  CA    . GLU G 3 222 ? 13.621 8.801   37.217  1.00 82.39  ? 222  GLU E CA    1 
ATOM   9817  C  C     . GLU G 3 222 ? 13.722 8.620   35.695  1.00 81.80  ? 222  GLU E C     1 
ATOM   9818  O  O     . GLU G 3 222 ? 14.492 7.790   35.189  1.00 79.96  ? 222  GLU E O     1 
ATOM   9819  C  CB    . GLU G 3 222 ? 12.179 8.506   37.660  1.00 86.45  ? 222  GLU E CB    1 
ATOM   9820  C  CG    . GLU G 3 222 ? 11.838 8.882   39.094  1.00 95.87  ? 222  GLU E CG    1 
ATOM   9821  C  CD    . GLU G 3 222 ? 10.331 8.900   39.347  1.00 103.52 ? 222  GLU E CD    1 
ATOM   9822  O  OE1   . GLU G 3 222 ? 9.612  9.650   38.647  1.00 100.84 ? 222  GLU E OE1   1 
ATOM   9823  O  OE2   . GLU G 3 222 ? 9.863  8.167   40.245  1.00 108.16 ? 222  GLU E OE2   1 
ATOM   9824  N  N     . ARG G 3 223 ? 12.929 9.417   34.982  1.00 77.95  ? 223  ARG E N     1 
ATOM   9825  C  CA    . ARG G 3 223 ? 12.891 9.393   33.533  1.00 76.32  ? 223  ARG E CA    1 
ATOM   9826  C  C     . ARG G 3 223 ? 14.297 9.289   32.942  1.00 77.27  ? 223  ARG E C     1 
ATOM   9827  O  O     . ARG G 3 223 ? 14.535 8.481   32.043  1.00 76.72  ? 223  ARG E O     1 
ATOM   9828  C  CB    . ARG G 3 223 ? 12.186 10.654  33.030  1.00 78.44  ? 223  ARG E CB    1 
ATOM   9829  C  CG    . ARG G 3 223 ? 12.140 10.827  31.520  1.00 85.88  ? 223  ARG E CG    1 
ATOM   9830  C  CD    . ARG G 3 223 ? 11.303 12.053  31.162  1.00 93.15  ? 223  ARG E CD    1 
ATOM   9831  N  NE    . ARG G 3 223 ? 11.372 12.393  29.744  1.00 106.89 ? 223  ARG E NE    1 
ATOM   9832  C  CZ    . ARG G 3 223 ? 10.907 11.626  28.761  1.00 113.10 ? 223  ARG E CZ    1 
ATOM   9833  N  NH1   . ARG G 3 223 ? 10.329 10.460  29.035  1.00 115.03 ? 223  ARG E NH1   1 
ATOM   9834  N  NH2   . ARG G 3 223 ? 11.024 12.022  27.496  1.00 110.83 ? 223  ARG E NH2   1 
ATOM   9835  N  N     . TRP G 3 224 ? 15.230 10.092  33.449  1.00 77.13  ? 224  TRP E N     1 
ATOM   9836  C  CA    . TRP G 3 224 ? 16.595 10.053  32.930  1.00 76.99  ? 224  TRP E CA    1 
ATOM   9837  C  C     . TRP G 3 224 ? 17.293 8.747   33.263  1.00 76.72  ? 224  TRP E C     1 
ATOM   9838  O  O     . TRP G 3 224 ? 18.051 8.225   32.453  1.00 75.87  ? 224  TRP E O     1 
ATOM   9839  C  CB    . TRP G 3 224 ? 17.428 11.236  33.456  1.00 76.75  ? 224  TRP E CB    1 
ATOM   9840  C  CG    . TRP G 3 224 ? 18.924 11.031  33.317  1.00 77.58  ? 224  TRP E CG    1 
ATOM   9841  C  CD1   . TRP G 3 224 ? 19.797 10.661  34.304  1.00 75.10  ? 224  TRP E CD1   1 
ATOM   9842  C  CD2   . TRP G 3 224 ? 19.695 11.095  32.112  1.00 78.07  ? 224  TRP E CD2   1 
ATOM   9843  N  NE1   . TRP G 3 224 ? 21.061 10.486  33.790  1.00 72.18  ? 224  TRP E NE1   1 
ATOM   9844  C  CE2   . TRP G 3 224 ? 21.027 10.743  32.446  1.00 76.98  ? 224  TRP E CE2   1 
ATOM   9845  C  CE3   . TRP G 3 224 ? 19.392 11.409  30.784  1.00 76.36  ? 224  TRP E CE3   1 
ATOM   9846  C  CZ2   . TRP G 3 224 ? 22.054 10.696  31.497  1.00 74.31  ? 224  TRP E CZ2   1 
ATOM   9847  C  CZ3   . TRP G 3 224 ? 20.418 11.363  29.836  1.00 76.39  ? 224  TRP E CZ3   1 
ATOM   9848  C  CH2   . TRP G 3 224 ? 21.732 11.008  30.201  1.00 74.95  ? 224  TRP E CH2   1 
ATOM   9849  N  N     . ILE G 3 225 ? 17.033 8.215   34.449  1.00 76.98  ? 225  ILE E N     1 
ATOM   9850  C  CA    . ILE G 3 225 ? 17.669 6.972   34.869  1.00 80.62  ? 225  ILE E CA    1 
ATOM   9851  C  C     . ILE G 3 225 ? 17.435 5.820   33.884  1.00 84.79  ? 225  ILE E C     1 
ATOM   9852  O  O     . ILE G 3 225 ? 18.337 5.003   33.650  1.00 85.85  ? 225  ILE E O     1 
ATOM   9853  C  CB    . ILE G 3 225 ? 17.158 6.520   36.251  1.00 79.72  ? 225  ILE E CB    1 
ATOM   9854  C  CG1   . ILE G 3 225 ? 16.941 7.742   37.148  1.00 79.31  ? 225  ILE E CG1   1 
ATOM   9855  C  CG2   . ILE G 3 225 ? 18.174 5.554   36.894  1.00 66.32  ? 225  ILE E CG2   1 
ATOM   9856  C  CD1   . ILE G 3 225 ? 16.211 7.421   38.447  1.00 69.24  ? 225  ILE E CD1   1 
ATOM   9857  N  N     . SER G 3 226 ? 16.231 5.748   33.316  1.00 86.13  ? 226  SER E N     1 
ATOM   9858  C  CA    . SER G 3 226 ? 15.886 4.682   32.369  1.00 85.08  ? 226  SER E CA    1 
ATOM   9859  C  C     . SER G 3 226 ? 16.407 4.957   30.951  1.00 83.90  ? 226  SER E C     1 
ATOM   9860  O  O     . SER G 3 226 ? 17.133 4.146   30.375  1.00 84.78  ? 226  SER E O     1 
ATOM   9861  C  CB    . SER G 3 226 ? 14.363 4.489   32.325  1.00 85.93  ? 226  SER E CB    1 
ATOM   9862  O  OG    . SER G 3 226 ? 13.715 5.584   31.683  1.00 81.11  ? 226  SER E OG    1 
ATOM   9863  N  N     . VAL G 3 227 ? 16.023 6.104   30.400  1.00 80.22  ? 227  VAL E N     1 
ATOM   9864  C  CA    . VAL G 3 227 ? 16.433 6.506   29.063  1.00 76.59  ? 227  VAL E CA    1 
ATOM   9865  C  C     . VAL G 3 227 ? 17.962 6.515   28.888  1.00 76.53  ? 227  VAL E C     1 
ATOM   9866  O  O     . VAL G 3 227 ? 18.474 6.345   27.779  1.00 75.48  ? 227  VAL E O     1 
ATOM   9867  C  CB    . VAL G 3 227 ? 15.843 7.903   28.733  1.00 71.68  ? 227  VAL E CB    1 
ATOM   9868  C  CG1   . VAL G 3 227 ? 16.382 8.425   27.393  1.00 63.22  ? 227  VAL E CG1   1 
ATOM   9869  C  CG2   . VAL G 3 227 ? 14.319 7.811   28.703  1.00 65.22  ? 227  VAL E CG2   1 
ATOM   9870  N  N     . SER G 3 228 ? 18.694 6.710   29.977  1.00 76.16  ? 228  SER E N     1 
ATOM   9871  C  CA    . SER G 3 228 ? 20.150 6.721   29.903  1.00 78.65  ? 228  SER E CA    1 
ATOM   9872  C  C     . SER G 3 228 ? 20.651 5.359   30.340  1.00 80.01  ? 228  SER E C     1 
ATOM   9873  O  O     . SER G 3 228 ? 21.793 4.985   30.065  1.00 77.58  ? 228  SER E O     1 
ATOM   9874  C  CB    . SER G 3 228 ? 20.736 7.790   30.829  1.00 83.01  ? 228  SER E CB    1 
ATOM   9875  O  OG    . SER G 3 228 ? 20.611 7.415   32.194  1.00 82.27  ? 228  SER E OG    1 
ATOM   9876  N  N     . GLY G 3 229 ? 19.780 4.632   31.034  1.00 81.79  ? 229  GLY E N     1 
ATOM   9877  C  CA    . GLY G 3 229 ? 20.118 3.307   31.517  1.00 84.87  ? 229  GLY E CA    1 
ATOM   9878  C  C     . GLY G 3 229 ? 21.447 3.255   32.244  1.00 86.86  ? 229  GLY E C     1 
ATOM   9879  O  O     . GLY G 3 229 ? 22.430 2.716   31.731  1.00 86.78  ? 229  GLY E O     1 
ATOM   9880  N  N     . VAL G 3 230 ? 21.480 3.819   33.443  1.00 87.31  ? 230  VAL E N     1 
ATOM   9881  C  CA    . VAL G 3 230 ? 22.699 3.822   34.230  1.00 86.22  ? 230  VAL E CA    1 
ATOM   9882  C  C     . VAL G 3 230 ? 22.499 2.843   35.372  1.00 86.46  ? 230  VAL E C     1 
ATOM   9883  O  O     . VAL G 3 230 ? 23.456 2.417   36.030  1.00 81.62  ? 230  VAL E O     1 
ATOM   9884  C  CB    . VAL G 3 230 ? 22.981 5.218   34.792  1.00 86.13  ? 230  VAL E CB    1 
ATOM   9885  C  CG1   . VAL G 3 230 ? 24.413 5.297   35.287  1.00 85.71  ? 230  VAL E CG1   1 
ATOM   9886  C  CG2   . VAL G 3 230 ? 22.723 6.263   33.721  1.00 75.44  ? 230  VAL E CG2   1 
ATOM   9887  N  N     . ALA G 3 231 ? 21.236 2.486   35.592  1.00 88.13  ? 231  ALA E N     1 
ATOM   9888  C  CA    . ALA G 3 231 ? 20.867 1.548   36.648  1.00 92.85  ? 231  ALA E CA    1 
ATOM   9889  C  C     . ALA G 3 231 ? 21.674 0.251   36.522  1.00 96.41  ? 231  ALA E C     1 
ATOM   9890  O  O     . ALA G 3 231 ? 22.186 -0.263  37.526  1.00 96.16  ? 231  ALA E O     1 
ATOM   9891  C  CB    . ALA G 3 231 ? 19.356 1.248   36.586  1.00 84.70  ? 231  ALA E CB    1 
ATOM   9892  N  N     . ASP G 3 232 ? 21.781 -0.258  35.288  1.00 98.48  ? 232  ASP E N     1 
ATOM   9893  C  CA    . ASP G 3 232 ? 22.519 -1.489  34.979  1.00 100.67 ? 232  ASP E CA    1 
ATOM   9894  C  C     . ASP G 3 232 ? 23.596 -1.800  36.019  1.00 100.65 ? 232  ASP E C     1 
ATOM   9895  O  O     . ASP G 3 232 ? 23.668 -2.915  36.543  1.00 100.00 ? 232  ASP E O     1 
ATOM   9896  C  CB    . ASP G 3 232 ? 23.169 -1.384  33.591  1.00 110.18 ? 232  ASP E CB    1 
ATOM   9897  C  CG    . ASP G 3 232 ? 22.472 -2.248  32.541  1.00 115.60 ? 232  ASP E CG    1 
ATOM   9898  O  OD1   . ASP G 3 232 ? 22.399 -3.485  32.728  1.00 115.71 ? 232  ASP E OD1   1 
ATOM   9899  O  OD2   . ASP G 3 232 ? 22.004 -1.689  31.525  1.00 117.78 ? 232  ASP E OD2   1 
ATOM   9900  N  N     . ASP G 3 233 ? 24.435 -0.809  36.307  1.00 98.89  ? 233  ASP E N     1 
ATOM   9901  C  CA    . ASP G 3 233 ? 25.492 -0.974  37.291  1.00 97.72  ? 233  ASP E CA    1 
ATOM   9902  C  C     . ASP G 3 233 ? 25.319 0.063   38.391  1.00 99.11  ? 233  ASP E C     1 
ATOM   9903  O  O     . ASP G 3 233 ? 24.840 1.171   38.141  1.00 99.59  ? 233  ASP E O     1 
ATOM   9904  C  CB    . ASP G 3 233 ? 26.866 -0.808  36.634  1.00 96.67  ? 233  ASP E CB    1 
ATOM   9905  C  CG    . ASP G 3 233 ? 28.017 -1.018  37.613  1.00 99.07  ? 233  ASP E CG    1 
ATOM   9906  O  OD1   . ASP G 3 233 ? 28.131 -0.248  38.594  1.00 98.05  ? 233  ASP E OD1   1 
ATOM   9907  O  OD2   . ASP G 3 233 ? 28.814 -1.958  37.400  1.00 97.97  ? 233  ASP E OD2   1 
ATOM   9908  N  N     . PRO G 3 234 ? 25.693 -0.295  39.632  1.00 98.91  ? 234  PRO E N     1 
ATOM   9909  C  CA    . PRO G 3 234 ? 25.583 0.608   40.783  1.00 96.73  ? 234  PRO E CA    1 
ATOM   9910  C  C     . PRO G 3 234 ? 26.667 1.688   40.773  1.00 94.11  ? 234  PRO E C     1 
ATOM   9911  O  O     . PRO G 3 234 ? 26.358 2.879   40.741  1.00 92.84  ? 234  PRO E O     1 
ATOM   9912  C  CB    . PRO G 3 234 ? 25.714 -0.341  41.974  1.00 97.95  ? 234  PRO E CB    1 
ATOM   9913  C  CG    . PRO G 3 234 ? 26.668 -1.388  41.455  1.00 98.28  ? 234  PRO E CG    1 
ATOM   9914  C  CD    . PRO G 3 234 ? 26.124 -1.642  40.060  1.00 99.53  ? 234  PRO E CD    1 
ATOM   9915  N  N     . ASN G 3 235 ? 27.930 1.264   40.791  1.00 91.00  ? 235  ASN E N     1 
ATOM   9916  C  CA    . ASN G 3 235 ? 29.060 2.193   40.779  1.00 88.96  ? 235  ASN E CA    1 
ATOM   9917  C  C     . ASN G 3 235 ? 28.988 3.162   39.602  1.00 88.14  ? 235  ASN E C     1 
ATOM   9918  O  O     . ASN G 3 235 ? 29.887 3.984   39.388  1.00 86.69  ? 235  ASN E O     1 
ATOM   9919  C  CB    . ASN G 3 235 ? 30.389 1.431   40.719  1.00 87.21  ? 235  ASN E CB    1 
ATOM   9920  C  CG    . ASN G 3 235 ? 30.743 0.771   42.031  1.00 86.98  ? 235  ASN E CG    1 
ATOM   9921  O  OD1   . ASN G 3 235 ? 31.916 0.515   42.312  1.00 79.96  ? 235  ASN E OD1   1 
ATOM   9922  N  ND2   . ASN G 3 235 ? 29.731 0.485   42.842  1.00 88.90  ? 235  ASN E ND2   1 
ATOM   9923  N  N     . ASN G 3 236 ? 27.913 3.052   38.836  1.00 86.06  ? 236  ASN E N     1 
ATOM   9924  C  CA    . ASN G 3 236 ? 27.708 3.908   37.686  1.00 82.69  ? 236  ASN E CA    1 
ATOM   9925  C  C     . ASN G 3 236 ? 27.389 5.338   38.117  1.00 80.47  ? 236  ASN E C     1 
ATOM   9926  O  O     . ASN G 3 236 ? 26.525 5.555   38.967  1.00 77.98  ? 236  ASN E O     1 
ATOM   9927  C  CB    . ASN G 3 236 ? 26.567 3.347   36.838  1.00 84.82  ? 236  ASN E CB    1 
ATOM   9928  C  CG    . ASN G 3 236 ? 27.033 2.875   35.481  1.00 85.25  ? 236  ASN E CG    1 
ATOM   9929  O  OD1   . ASN G 3 236 ? 28.114 2.298   35.348  1.00 82.29  ? 236  ASN E OD1   1 
ATOM   9930  N  ND2   . ASN G 3 236 ? 26.214 3.107   34.463  1.00 83.19  ? 236  ASN E ND2   1 
ATOM   9931  N  N     . TYR G 3 237 ? 28.108 6.303   37.544  1.00 77.71  ? 237  TYR E N     1 
ATOM   9932  C  CA    . TYR G 3 237 ? 27.885 7.717   37.837  1.00 73.20  ? 237  TYR E CA    1 
ATOM   9933  C  C     . TYR G 3 237 ? 26.567 8.126   37.189  1.00 70.73  ? 237  TYR E C     1 
ATOM   9934  O  O     . TYR G 3 237 ? 26.359 7.892   35.999  1.00 68.31  ? 237  TYR E O     1 
ATOM   9935  C  CB    . TYR G 3 237 ? 29.015 8.566   37.259  1.00 75.77  ? 237  TYR E CB    1 
ATOM   9936  C  CG    . TYR G 3 237 ? 30.306 8.518   38.037  1.00 82.33  ? 237  TYR E CG    1 
ATOM   9937  C  CD1   . TYR G 3 237 ? 31.444 9.167   37.564  1.00 84.59  ? 237  TYR E CD1   1 
ATOM   9938  C  CD2   . TYR G 3 237 ? 30.388 7.859   39.261  1.00 85.23  ? 237  TYR E CD2   1 
ATOM   9939  C  CE1   . TYR G 3 237 ? 32.634 9.169   38.292  1.00 86.96  ? 237  TYR E CE1   1 
ATOM   9940  C  CE2   . TYR G 3 237 ? 31.575 7.854   39.997  1.00 85.38  ? 237  TYR E CE2   1 
ATOM   9941  C  CZ    . TYR G 3 237 ? 32.693 8.510   39.508  1.00 85.57  ? 237  TYR E CZ    1 
ATOM   9942  O  OH    . TYR G 3 237 ? 33.864 8.506   40.235  1.00 82.87  ? 237  TYR E OH    1 
ATOM   9943  N  N     . LEU G 3 238 ? 25.680 8.735   37.967  1.00 66.98  ? 238  LEU E N     1 
ATOM   9944  C  CA    . LEU G 3 238 ? 24.389 9.140   37.444  1.00 63.95  ? 238  LEU E CA    1 
ATOM   9945  C  C     . LEU G 3 238 ? 24.556 9.904   36.139  1.00 65.91  ? 238  LEU E C     1 
ATOM   9946  O  O     . LEU G 3 238 ? 24.386 9.341   35.067  1.00 65.84  ? 238  LEU E O     1 
ATOM   9947  C  CB    . LEU G 3 238 ? 23.644 9.996   38.468  1.00 63.62  ? 238  LEU E CB    1 
ATOM   9948  C  CG    . LEU G 3 238 ? 22.165 10.282  38.169  1.00 66.19  ? 238  LEU E CG    1 
ATOM   9949  C  CD1   . LEU G 3 238 ? 21.558 11.059  39.322  1.00 58.91  ? 238  LEU E CD1   1 
ATOM   9950  C  CD2   . LEU G 3 238 ? 22.023 11.069  36.866  1.00 72.07  ? 238  LEU E CD2   1 
ATOM   9951  N  N     . PHE G 3 239 ? 24.891 11.184  36.225  1.00 68.17  ? 239  PHE E N     1 
ATOM   9952  C  CA    . PHE G 3 239 ? 25.061 11.996  35.027  1.00 70.09  ? 239  PHE E CA    1 
ATOM   9953  C  C     . PHE G 3 239 ? 26.322 11.654  34.231  1.00 72.87  ? 239  PHE E C     1 
ATOM   9954  O  O     . PHE G 3 239 ? 27.433 11.628  34.775  1.00 68.62  ? 239  PHE E O     1 
ATOM   9955  C  CB    . PHE G 3 239 ? 25.056 13.478  35.396  1.00 63.81  ? 239  PHE E CB    1 
ATOM   9956  C  CG    . PHE G 3 239 ? 23.719 13.973  35.836  1.00 61.51  ? 239  PHE E CG    1 
ATOM   9957  C  CD1   . PHE G 3 239 ? 23.439 14.168  37.173  1.00 60.07  ? 239  PHE E CD1   1 
ATOM   9958  C  CD2   . PHE G 3 239 ? 22.721 14.216  34.903  1.00 64.69  ? 239  PHE E CD2   1 
ATOM   9959  C  CE1   . PHE G 3 239 ? 22.173 14.600  37.580  1.00 65.51  ? 239  PHE E CE1   1 
ATOM   9960  C  CE2   . PHE G 3 239 ? 21.453 14.648  35.300  1.00 62.45  ? 239  PHE E CE2   1 
ATOM   9961  C  CZ    . PHE G 3 239 ? 21.181 14.841  36.639  1.00 61.44  ? 239  PHE E CZ    1 
ATOM   9962  N  N     . CYS G 3 240 ? 26.137 11.404  32.934  1.00 76.13  ? 240  CYS E N     1 
ATOM   9963  C  CA    . CYS G 3 240 ? 27.244 11.048  32.046  1.00 75.94  ? 240  CYS E CA    1 
ATOM   9964  C  C     . CYS G 3 240 ? 27.204 11.756  30.685  1.00 74.55  ? 240  CYS E C     1 
ATOM   9965  O  O     . CYS G 3 240 ? 26.490 12.747  30.489  1.00 74.85  ? 240  CYS E O     1 
ATOM   9966  C  CB    . CYS G 3 240 ? 27.248 9.542   31.805  1.00 75.34  ? 240  CYS E CB    1 
ATOM   9967  S  SG    . CYS G 3 240 ? 25.803 8.997   30.847  1.00 74.63  ? 240  CYS E SG    1 
ATOM   9968  N  N     . ARG G 3 241 ? 27.968 11.200  29.749  1.00 71.84  ? 241  ARG E N     1 
ATOM   9969  C  CA    . ARG G 3 241 ? 28.104 11.719  28.391  1.00 70.82  ? 241  ARG E CA    1 
ATOM   9970  C  C     . ARG G 3 241 ? 27.005 11.257  27.413  1.00 72.30  ? 241  ARG E C     1 
ATOM   9971  O  O     . ARG G 3 241 ? 26.365 10.221  27.616  1.00 70.07  ? 241  ARG E O     1 
ATOM   9972  C  CB    . ARG G 3 241 ? 29.475 11.297  27.876  1.00 66.62  ? 241  ARG E CB    1 
ATOM   9973  C  CG    . ARG G 3 241 ? 30.054 12.125  26.759  1.00 69.30  ? 241  ARG E CG    1 
ATOM   9974  C  CD    . ARG G 3 241 ? 31.456 11.604  26.481  1.00 70.87  ? 241  ARG E CD    1 
ATOM   9975  N  NE    . ARG G 3 241 ? 32.228 12.469  25.599  1.00 79.77  ? 241  ARG E NE    1 
ATOM   9976  C  CZ    . ARG G 3 241 ? 33.522 12.295  25.352  1.00 85.89  ? 241  ARG E CZ    1 
ATOM   9977  N  NH1   . ARG G 3 241 ? 34.172 11.283  25.923  1.00 83.55  ? 241  ARG E NH1   1 
ATOM   9978  N  NH2   . ARG G 3 241 ? 34.171 13.138  24.551  1.00 87.13  ? 241  ARG E NH2   1 
ATOM   9979  N  N     . VAL G 3 242 ? 26.806 12.036  26.348  1.00 73.67  ? 242  VAL E N     1 
ATOM   9980  C  CA    . VAL G 3 242 ? 25.803 11.745  25.309  1.00 73.27  ? 242  VAL E CA    1 
ATOM   9981  C  C     . VAL G 3 242 ? 26.306 12.240  23.930  1.00 76.03  ? 242  VAL E C     1 
ATOM   9982  O  O     . VAL G 3 242 ? 26.289 13.448  23.659  1.00 77.81  ? 242  VAL E O     1 
ATOM   9983  C  CB    . VAL G 3 242 ? 24.435 12.424  25.657  1.00 63.72  ? 242  VAL E CB    1 
ATOM   9984  C  CG1   . VAL G 3 242 ? 23.537 12.472  24.449  1.00 59.83  ? 242  VAL E CG1   1 
ATOM   9985  C  CG2   . VAL G 3 242 ? 23.741 11.653  26.754  1.00 56.30  ? 242  VAL E CG2   1 
ATOM   9986  N  N     . ARG G 3 243 ? 26.738 11.311  23.066  1.00 74.53  ? 243  ARG E N     1 
ATOM   9987  C  CA    . ARG G 3 243 ? 27.274 11.658  21.742  1.00 73.56  ? 243  ARG E CA    1 
ATOM   9988  C  C     . ARG G 3 243 ? 26.252 12.277  20.803  1.00 76.02  ? 243  ARG E C     1 
ATOM   9989  O  O     . ARG G 3 243 ? 25.045 12.118  20.991  1.00 77.83  ? 243  ARG E O     1 
ATOM   9990  C  CB    . ARG G 3 243 ? 27.892 10.438  21.054  1.00 63.25  ? 243  ARG E CB    1 
ATOM   9991  C  CG    . ARG G 3 243 ? 29.069 9.786   21.774  1.00 59.59  ? 243  ARG E CG    1 
ATOM   9992  C  CD    . ARG G 3 243 ? 28.627 9.068   23.047  1.00 60.91  ? 243  ARG E CD    1 
ATOM   9993  N  NE    . ARG G 3 243 ? 29.661 8.227   23.666  1.00 68.66  ? 243  ARG E NE    1 
ATOM   9994  C  CZ    . ARG G 3 243 ? 30.982 8.433   23.595  1.00 72.55  ? 243  ARG E CZ    1 
ATOM   9995  N  NH1   . ARG G 3 243 ? 31.480 9.465   22.911  1.00 66.50  ? 243  ARG E NH1   1 
ATOM   9996  N  NH2   . ARG G 3 243 ? 31.814 7.610   24.240  1.00 63.62  ? 243  ARG E NH2   1 
ATOM   9997  N  N     . LYS G 3 244 ? 26.766 12.955  19.777  1.00 76.93  ? 244  LYS E N     1 
ATOM   9998  C  CA    . LYS G 3 244 ? 25.975 13.672  18.766  1.00 77.93  ? 244  LYS E CA    1 
ATOM   9999  C  C     . LYS G 3 244 ? 24.694 13.053  18.199  1.00 79.84  ? 244  LYS E C     1 
ATOM   10000 O  O     . LYS G 3 244 ? 23.955 13.721  17.469  1.00 75.13  ? 244  LYS E O     1 
ATOM   10001 C  CB    . LYS G 3 244 ? 26.889 14.074  17.604  1.00 73.00  ? 244  LYS E CB    1 
ATOM   10002 C  CG    . LYS G 3 244 ? 27.715 12.940  17.008  1.00 76.33  ? 244  LYS E CG    1 
ATOM   10003 C  CD    . LYS G 3 244 ? 28.783 13.489  16.062  1.00 80.39  ? 244  LYS E CD    1 
ATOM   10004 C  CE    . LYS G 3 244 ? 28.154 14.310  14.944  1.00 81.31  ? 244  LYS E CE    1 
ATOM   10005 N  NZ    . LYS G 3 244 ? 29.154 15.100  14.178  1.00 83.89  ? 244  LYS E NZ    1 
ATOM   10006 N  N     . ASN G 3 245 ? 24.428 11.792  18.525  1.00 81.57  ? 245  ASN E N     1 
ATOM   10007 C  CA    . ASN G 3 245 ? 23.225 11.128  18.039  1.00 82.98  ? 245  ASN E CA    1 
ATOM   10008 C  C     . ASN G 3 245 ? 22.107 11.205  19.072  1.00 83.43  ? 245  ASN E C     1 
ATOM   10009 O  O     . ASN G 3 245 ? 21.010 11.692  18.781  1.00 82.85  ? 245  ASN E O     1 
ATOM   10010 C  CB    . ASN G 3 245 ? 23.528 9.666   17.699  1.00 79.72  ? 245  ASN E CB    1 
ATOM   10011 C  CG    . ASN G 3 245 ? 24.138 8.907   18.858  1.00 82.05  ? 245  ASN E CG    1 
ATOM   10012 O  OD1   . ASN G 3 245 ? 23.488 8.678   19.868  1.00 82.73  ? 245  ASN E OD1   1 
ATOM   10013 N  ND2   . ASN G 3 245 ? 25.397 8.512   18.712  1.00 82.31  ? 245  ASN E ND2   1 
ATOM   10014 N  N     . GLY G 3 246 ? 22.403 10.733  20.282  1.00 84.12  ? 246  GLY E N     1 
ATOM   10015 C  CA    . GLY G 3 246 ? 21.427 10.743  21.358  1.00 84.01  ? 246  GLY E CA    1 
ATOM   10016 C  C     . GLY G 3 246 ? 21.476 9.473   22.193  1.00 83.69  ? 246  GLY E C     1 
ATOM   10017 O  O     . GLY G 3 246 ? 20.441 8.992   22.665  1.00 81.15  ? 246  GLY E O     1 
ATOM   10018 N  N     . VAL G 3 247 ? 22.682 8.934   22.379  1.00 83.27  ? 247  VAL E N     1 
ATOM   10019 C  CA    . VAL G 3 247 ? 22.873 7.708   23.154  1.00 83.47  ? 247  VAL E CA    1 
ATOM   10020 C  C     . VAL G 3 247 ? 23.702 7.920   24.423  1.00 85.93  ? 247  VAL E C     1 
ATOM   10021 O  O     . VAL G 3 247 ? 24.914 8.166   24.364  1.00 85.93  ? 247  VAL E O     1 
ATOM   10022 C  CB    . VAL G 3 247 ? 23.567 6.601   22.312  1.00 77.72  ? 247  VAL E CB    1 
ATOM   10023 C  CG1   . VAL G 3 247 ? 23.670 5.315   23.129  1.00 70.43  ? 247  VAL E CG1   1 
ATOM   10024 C  CG2   . VAL G 3 247 ? 22.792 6.346   21.033  1.00 72.75  ? 247  VAL E CG2   1 
ATOM   10025 N  N     . ALA G 3 248 ? 23.035 7.817   25.568  1.00 86.05  ? 248  ALA E N     1 
ATOM   10026 C  CA    . ALA G 3 248 ? 23.697 7.966   26.855  1.00 85.60  ? 248  ALA E CA    1 
ATOM   10027 C  C     . ALA G 3 248 ? 24.750 6.871   26.958  1.00 85.96  ? 248  ALA E C     1 
ATOM   10028 O  O     . ALA G 3 248 ? 24.433 5.681   26.836  1.00 86.69  ? 248  ALA E O     1 
ATOM   10029 C  CB    . ALA G 3 248 ? 22.679 7.821   27.983  1.00 86.19  ? 248  ALA E CB    1 
ATOM   10030 N  N     . ALA G 3 249 ? 25.997 7.274   27.182  1.00 84.48  ? 249  ALA E N     1 
ATOM   10031 C  CA    . ALA G 3 249 ? 27.101 6.323   27.284  1.00 82.85  ? 249  ALA E CA    1 
ATOM   10032 C  C     . ALA G 3 249 ? 27.625 6.188   28.711  1.00 83.21  ? 249  ALA E C     1 
ATOM   10033 O  O     . ALA G 3 249 ? 28.752 6.578   29.009  1.00 81.78  ? 249  ALA E O     1 
ATOM   10034 C  CB    . ALA G 3 249 ? 28.240 6.743   26.343  1.00 78.54  ? 249  ALA E CB    1 
ATOM   10035 N  N     . PRO G 3 250 ? 26.811 5.622   29.614  1.00 83.35  ? 250  PRO E N     1 
ATOM   10036 C  CA    . PRO G 3 250 ? 27.222 5.449   31.006  1.00 82.58  ? 250  PRO E CA    1 
ATOM   10037 C  C     . PRO G 3 250 ? 28.646 4.940   31.182  1.00 80.72  ? 250  PRO E C     1 
ATOM   10038 O  O     . PRO G 3 250 ? 29.252 4.390   30.261  1.00 78.97  ? 250  PRO E O     1 
ATOM   10039 C  CB    . PRO G 3 250 ? 26.185 4.472   31.540  1.00 83.41  ? 250  PRO E CB    1 
ATOM   10040 C  CG    . PRO G 3 250 ? 24.946 4.927   30.837  1.00 83.42  ? 250  PRO E CG    1 
ATOM   10041 C  CD    . PRO G 3 250 ? 25.441 5.116   29.412  1.00 83.32  ? 250  PRO E CD    1 
ATOM   10042 N  N     . SER G 3 251 ? 29.167 5.147   32.385  1.00 79.56  ? 251  SER E N     1 
ATOM   10043 C  CA    . SER G 3 251 ? 30.512 4.727   32.763  1.00 79.14  ? 251  SER E CA    1 
ATOM   10044 C  C     . SER G 3 251 ? 30.565 4.682   34.289  1.00 78.64  ? 251  SER E C     1 
ATOM   10045 O  O     . SER G 3 251 ? 29.565 4.955   34.960  1.00 78.93  ? 251  SER E O     1 
ATOM   10046 C  CB    . SER G 3 251 ? 31.558 5.723   32.233  1.00 79.22  ? 251  SER E CB    1 
ATOM   10047 O  OG    . SER G 3 251 ? 32.868 5.416   32.705  1.00 69.10  ? 251  SER E OG    1 
ATOM   10048 N  N     . ALA G 3 252 ? 31.728 4.334   34.832  1.00 76.66  ? 252  ALA E N     1 
ATOM   10049 C  CA    . ALA G 3 252 ? 31.906 4.270   36.274  1.00 74.73  ? 252  ALA E CA    1 
ATOM   10050 C  C     . ALA G 3 252 ? 33.389 4.416   36.598  1.00 76.50  ? 252  ALA E C     1 
ATOM   10051 O  O     . ALA G 3 252 ? 33.869 3.962   37.640  1.00 76.63  ? 252  ALA E O     1 
ATOM   10052 C  CB    . ALA G 3 252 ? 31.361 2.959   36.809  1.00 66.04  ? 252  ALA E CB    1 
ATOM   10053 N  N     . THR G 3 253 ? 34.109 5.062   35.685  1.00 78.44  ? 253  THR E N     1 
ATOM   10054 C  CA    . THR G 3 253 ? 35.539 5.313   35.850  1.00 81.12  ? 253  THR E CA    1 
ATOM   10055 C  C     . THR G 3 253 ? 35.843 6.775   35.522  1.00 80.21  ? 253  THR E C     1 
ATOM   10056 O  O     . THR G 3 253 ? 36.914 7.289   35.852  1.00 78.42  ? 253  THR E O     1 
ATOM   10057 C  CB    . THR G 3 253 ? 36.387 4.405   34.932  1.00 81.29  ? 253  THR E CB    1 
ATOM   10058 O  OG1   . THR G 3 253 ? 35.879 4.468   33.591  1.00 83.61  ? 253  THR E OG1   1 
ATOM   10059 C  CG2   . THR G 3 253 ? 36.351 2.965   35.432  1.00 75.14  ? 253  THR E CG2   1 
ATOM   10060 N  N     . SER G 3 254 ? 34.893 7.436   34.869  1.00 78.73  ? 254  SER E N     1 
ATOM   10061 C  CA    . SER G 3 254 ? 35.044 8.839   34.506  1.00 76.88  ? 254  SER E CA    1 
ATOM   10062 C  C     . SER G 3 254 ? 33.702 9.556   34.580  1.00 75.09  ? 254  SER E C     1 
ATOM   10063 O  O     . SER G 3 254 ? 32.684 9.040   34.115  1.00 72.27  ? 254  SER E O     1 
ATOM   10064 C  CB    . SER G 3 254 ? 35.644 8.971   33.101  1.00 77.55  ? 254  SER E CB    1 
ATOM   10065 O  OG    . SER G 3 254 ? 37.037 8.672   33.104  1.00 71.53  ? 254  SER E OG    1 
ATOM   10066 N  N     . GLN G 3 255 ? 33.715 10.749  35.171  1.00 74.43  ? 255  GLN E N     1 
ATOM   10067 C  CA    . GLN G 3 255 ? 32.503 11.546  35.340  1.00 72.03  ? 255  GLN E CA    1 
ATOM   10068 C  C     . GLN G 3 255 ? 32.373 12.721  34.376  1.00 68.80  ? 255  GLN E C     1 
ATOM   10069 O  O     . GLN G 3 255 ? 33.363 13.231  33.841  1.00 65.28  ? 255  GLN E O     1 
ATOM   10070 C  CB    . GLN G 3 255 ? 32.402 12.051  36.789  1.00 80.52  ? 255  GLN E CB    1 
ATOM   10071 C  CG    . GLN G 3 255 ? 33.682 12.688  37.332  1.00 88.69  ? 255  GLN E CG    1 
ATOM   10072 C  CD    . GLN G 3 255 ? 33.648 12.918  38.843  1.00 87.39  ? 255  GLN E CD    1 
ATOM   10073 O  OE1   . GLN G 3 255 ? 32.765 13.609  39.364  1.00 83.16  ? 255  GLN E OE1   1 
ATOM   10074 N  NE2   . GLN G 3 255 ? 34.622 12.343  39.549  1.00 81.85  ? 255  GLN E NE2   1 
ATOM   10075 N  N     . LEU G 3 256 ? 31.124 13.128  34.166  1.00 66.38  ? 256  LEU E N     1 
ATOM   10076 C  CA    . LEU G 3 256 ? 30.762 14.230  33.283  1.00 62.27  ? 256  LEU E CA    1 
ATOM   10077 C  C     . LEU G 3 256 ? 31.417 15.502  33.823  1.00 65.64  ? 256  LEU E C     1 
ATOM   10078 O  O     . LEU G 3 256 ? 30.881 16.144  34.728  1.00 69.34  ? 256  LEU E O     1 
ATOM   10079 C  CB    . LEU G 3 256 ? 29.239 14.373  33.287  1.00 47.49  ? 256  LEU E CB    1 
ATOM   10080 C  CG    . LEU G 3 256 ? 28.547 14.935  32.050  1.00 48.55  ? 256  LEU E CG    1 
ATOM   10081 C  CD1   . LEU G 3 256 ? 27.064 15.164  32.348  1.00 46.60  ? 256  LEU E CD1   1 
ATOM   10082 C  CD2   . LEU G 3 256 ? 29.201 16.230  31.645  1.00 53.71  ? 256  LEU E CD2   1 
ATOM   10083 N  N     . SER G 3 257 ? 32.567 15.867  33.261  1.00 67.94  ? 257  SER E N     1 
ATOM   10084 C  CA    . SER G 3 257 ? 33.322 17.046  33.705  1.00 68.12  ? 257  SER E CA    1 
ATOM   10085 C  C     . SER G 3 257 ? 32.495 18.222  34.220  1.00 68.31  ? 257  SER E C     1 
ATOM   10086 O  O     . SER G 3 257 ? 31.353 18.456  33.799  1.00 67.16  ? 257  SER E O     1 
ATOM   10087 C  CB    . SER G 3 257 ? 34.237 17.561  32.585  1.00 64.56  ? 257  SER E CB    1 
ATOM   10088 O  OG    . SER G 3 257 ? 33.631 18.646  31.895  1.00 52.18  ? 257  SER E OG    1 
ATOM   10089 N  N     . THR G 3 258 ? 33.107 18.967  35.134  1.00 66.10  ? 258  THR E N     1 
ATOM   10090 C  CA    . THR G 3 258 ? 32.479 20.136  35.724  1.00 63.57  ? 258  THR E CA    1 
ATOM   10091 C  C     . THR G 3 258 ? 32.336 21.170  34.612  1.00 61.29  ? 258  THR E C     1 
ATOM   10092 O  O     . THR G 3 258 ? 31.332 21.888  34.544  1.00 59.64  ? 258  THR E O     1 
ATOM   10093 C  CB    . THR G 3 258 ? 33.355 20.728  36.841  1.00 64.11  ? 258  THR E CB    1 
ATOM   10094 O  OG1   . THR G 3 258 ? 34.302 21.637  36.266  1.00 67.35  ? 258  THR E OG1   1 
ATOM   10095 C  CG2   . THR G 3 258 ? 34.114 19.611  37.573  1.00 51.73  ? 258  THR E CG2   1 
ATOM   10096 N  N     . ARG G 3 259 ? 33.354 21.236  33.746  1.00 59.72  ? 259  ARG E N     1 
ATOM   10097 C  CA    . ARG G 3 259 ? 33.366 22.161  32.605  1.00 55.71  ? 259  ARG E CA    1 
ATOM   10098 C  C     . ARG G 3 259 ? 32.108 21.924  31.810  1.00 54.08  ? 259  ARG E C     1 
ATOM   10099 O  O     . ARG G 3 259 ? 31.473 22.859  31.317  1.00 50.07  ? 259  ARG E O     1 
ATOM   10100 C  CB    . ARG G 3 259 ? 34.542 21.879  31.679  1.00 47.13  ? 259  ARG E CB    1 
ATOM   10101 C  CG    . ARG G 3 259 ? 34.597 22.838  30.508  1.00 40.40  ? 259  ARG E CG    1 
ATOM   10102 C  CD    . ARG G 3 259 ? 35.147 24.171  30.963  1.00 45.85  ? 259  ARG E CD    1 
ATOM   10103 N  NE    . ARG G 3 259 ? 34.841 25.255  30.044  1.00 47.84  ? 259  ARG E NE    1 
ATOM   10104 C  CZ    . ARG G 3 259 ? 33.612 25.715  29.836  1.00 55.40  ? 259  ARG E CZ    1 
ATOM   10105 N  NH1   . ARG G 3 259 ? 32.583 25.166  30.485  1.00 51.78  ? 259  ARG E NH1   1 
ATOM   10106 N  NH2   . ARG G 3 259 ? 33.413 26.737  29.003  1.00 48.15  ? 259  ARG E NH2   1 
ATOM   10107 N  N     . ALA G 3 260 ? 31.779 20.641  31.689  1.00 51.49  ? 260  ALA E N     1 
ATOM   10108 C  CA    . ALA G 3 260 ? 30.613 20.195  30.962  1.00 51.44  ? 260  ALA E CA    1 
ATOM   10109 C  C     . ALA G 3 260 ? 29.334 20.588  31.694  1.00 54.56  ? 260  ALA E C     1 
ATOM   10110 O  O     . ALA G 3 260 ? 28.435 21.207  31.114  1.00 50.37  ? 260  ALA E O     1 
ATOM   10111 C  CB    . ALA G 3 260 ? 30.682 18.708  30.785  1.00 42.60  ? 260  ALA E CB    1 
ATOM   10112 N  N     . LEU G 3 261 ? 29.242 20.229  32.970  1.00 57.68  ? 261  LEU E N     1 
ATOM   10113 C  CA    . LEU G 3 261 ? 28.051 20.576  33.731  1.00 56.90  ? 261  LEU E CA    1 
ATOM   10114 C  C     . LEU G 3 261 ? 27.882 22.085  33.692  1.00 57.92  ? 261  LEU E C     1 
ATOM   10115 O  O     . LEU G 3 261 ? 26.758 22.590  33.664  1.00 59.23  ? 261  LEU E O     1 
ATOM   10116 C  CB    . LEU G 3 261 ? 28.172 20.068  35.162  1.00 52.07  ? 261  LEU E CB    1 
ATOM   10117 C  CG    . LEU G 3 261 ? 28.297 18.545  35.211  1.00 52.99  ? 261  LEU E CG    1 
ATOM   10118 C  CD1   . LEU G 3 261 ? 28.417 18.054  36.656  1.00 50.81  ? 261  LEU E CD1   1 
ATOM   10119 C  CD2   . LEU G 3 261 ? 27.073 17.947  34.543  1.00 54.57  ? 261  LEU E CD2   1 
ATOM   10120 N  N     . GLU G 3 262 ? 29.001 22.803  33.674  1.00 56.47  ? 262  GLU E N     1 
ATOM   10121 C  CA    . GLU G 3 262 ? 28.941 24.252  33.597  1.00 57.68  ? 262  GLU E CA    1 
ATOM   10122 C  C     . GLU G 3 262 ? 28.144 24.583  32.341  1.00 60.02  ? 262  GLU E C     1 
ATOM   10123 O  O     . GLU G 3 262 ? 27.142 25.302  32.392  1.00 59.04  ? 262  GLU E O     1 
ATOM   10124 C  CB    . GLU G 3 262 ? 30.340 24.859  33.482  1.00 65.69  ? 262  GLU E CB    1 
ATOM   10125 C  CG    . GLU G 3 262 ? 31.179 24.778  34.745  1.00 75.19  ? 262  GLU E CG    1 
ATOM   10126 C  CD    . GLU G 3 262 ? 32.350 25.747  34.725  1.00 84.26  ? 262  GLU E CD    1 
ATOM   10127 O  OE1   . GLU G 3 262 ? 32.109 26.974  34.693  1.00 87.79  ? 262  GLU E OE1   1 
ATOM   10128 O  OE2   . GLU G 3 262 ? 33.512 25.286  34.735  1.00 86.17  ? 262  GLU E OE2   1 
ATOM   10129 N  N     . GLY G 3 263 ? 28.593 24.031  31.216  1.00 58.63  ? 263  GLY E N     1 
ATOM   10130 C  CA    . GLY G 3 263 ? 27.926 24.255  29.943  1.00 56.43  ? 263  GLY E CA    1 
ATOM   10131 C  C     . GLY G 3 263 ? 26.429 23.989  29.930  1.00 55.75  ? 263  GLY E C     1 
ATOM   10132 O  O     . GLY G 3 263 ? 25.663 24.782  29.379  1.00 56.02  ? 263  GLY E O     1 
ATOM   10133 N  N     . ILE G 3 264 ? 25.999 22.878  30.518  1.00 53.06  ? 264  ILE E N     1 
ATOM   10134 C  CA    . ILE G 3 264 ? 24.578 22.566  30.545  1.00 51.52  ? 264  ILE E CA    1 
ATOM   10135 C  C     . ILE G 3 264 ? 23.828 23.830  30.944  1.00 53.03  ? 264  ILE E C     1 
ATOM   10136 O  O     . ILE G 3 264 ? 22.743 24.110  30.436  1.00 50.96  ? 264  ILE E O     1 
ATOM   10137 C  CB    . ILE G 3 264 ? 24.270 21.439  31.553  1.00 51.91  ? 264  ILE E CB    1 
ATOM   10138 C  CG1   . ILE G 3 264 ? 25.048 20.179  31.162  1.00 50.21  ? 264  ILE E CG1   1 
ATOM   10139 C  CG2   . ILE G 3 264 ? 22.768 21.154  31.589  1.00 41.02  ? 264  ILE E CG2   1 
ATOM   10140 C  CD1   . ILE G 3 264 ? 24.886 19.013  32.133  1.00 48.71  ? 264  ILE E CD1   1 
ATOM   10141 N  N     . PHE G 3 265 ? 24.424 24.591  31.860  1.00 57.99  ? 265  PHE E N     1 
ATOM   10142 C  CA    . PHE G 3 265 ? 23.833 25.850  32.326  1.00 62.97  ? 265  PHE E CA    1 
ATOM   10143 C  C     . PHE G 3 265 ? 23.968 26.852  31.192  1.00 63.66  ? 265  PHE E C     1 
ATOM   10144 O  O     . PHE G 3 265 ? 22.974 27.362  30.676  1.00 61.34  ? 265  PHE E O     1 
ATOM   10145 C  CB    . PHE G 3 265 ? 24.579 26.395  33.560  1.00 65.33  ? 265  PHE E CB    1 
ATOM   10146 C  CG    . PHE G 3 265 ? 23.969 26.003  34.876  1.00 63.06  ? 265  PHE E CG    1 
ATOM   10147 C  CD1   . PHE G 3 265 ? 22.674 26.386  35.200  1.00 61.65  ? 265  PHE E CD1   1 
ATOM   10148 C  CD2   . PHE G 3 265 ? 24.698 25.265  35.804  1.00 59.70  ? 265  PHE E CD2   1 
ATOM   10149 C  CE1   . PHE G 3 265 ? 22.114 26.037  36.436  1.00 53.41  ? 265  PHE E CE1   1 
ATOM   10150 C  CE2   . PHE G 3 265 ? 24.142 24.914  37.044  1.00 55.19  ? 265  PHE E CE2   1 
ATOM   10151 C  CZ    . PHE G 3 265 ? 22.848 25.303  37.355  1.00 50.81  ? 265  PHE E CZ    1 
ATOM   10152 N  N     . GLU G 3 266 ? 25.218 27.118  30.820  1.00 63.87  ? 266  GLU E N     1 
ATOM   10153 C  CA    . GLU G 3 266 ? 25.554 28.052  29.752  1.00 67.41  ? 266  GLU E CA    1 
ATOM   10154 C  C     . GLU G 3 266 ? 24.576 27.950  28.576  1.00 68.30  ? 266  GLU E C     1 
ATOM   10155 O  O     . GLU G 3 266 ? 23.906 28.929  28.216  1.00 65.16  ? 266  GLU E O     1 
ATOM   10156 C  CB    . GLU G 3 266 ? 26.993 27.782  29.292  1.00 72.50  ? 266  GLU E CB    1 
ATOM   10157 C  CG    . GLU G 3 266 ? 27.465 28.596  28.098  1.00 84.61  ? 266  GLU E CG    1 
ATOM   10158 C  CD    . GLU G 3 266 ? 28.929 29.009  28.218  1.00 91.31  ? 266  GLU E CD    1 
ATOM   10159 O  OE1   . GLU G 3 266 ? 29.748 28.191  28.704  1.00 90.78  ? 266  GLU E OE1   1 
ATOM   10160 O  OE2   . GLU G 3 266 ? 29.262 30.150  27.818  1.00 91.35  ? 266  GLU E OE2   1 
ATOM   10161 N  N     . ALA G 3 267 ? 24.492 26.753  28.000  1.00 67.36  ? 267  ALA E N     1 
ATOM   10162 C  CA    . ALA G 3 267 ? 23.611 26.479  26.872  1.00 65.63  ? 267  ALA E CA    1 
ATOM   10163 C  C     . ALA G 3 267 ? 22.136 26.800  27.153  1.00 66.77  ? 267  ALA E C     1 
ATOM   10164 O  O     . ALA G 3 267 ? 21.489 27.519  26.393  1.00 67.72  ? 267  ALA E O     1 
ATOM   10165 C  CB    . ALA G 3 267 ? 23.754 25.020  26.465  1.00 58.47  ? 267  ALA E CB    1 
ATOM   10166 N  N     . THR G 3 268 ? 21.608 26.265  28.244  1.00 64.74  ? 268  THR E N     1 
ATOM   10167 C  CA    . THR G 3 268 ? 20.216 26.494  28.597  1.00 63.10  ? 268  THR E CA    1 
ATOM   10168 C  C     . THR G 3 268 ? 19.821 27.963  28.614  1.00 66.12  ? 268  THR E C     1 
ATOM   10169 O  O     . THR G 3 268 ? 18.675 28.303  28.321  1.00 64.68  ? 268  THR E O     1 
ATOM   10170 C  CB    . THR G 3 268 ? 19.883 25.914  29.976  1.00 61.30  ? 268  THR E CB    1 
ATOM   10171 O  OG1   . THR G 3 268 ? 20.234 24.519  30.014  1.00 64.05  ? 268  THR E OG1   1 
ATOM   10172 C  CG2   . THR G 3 268 ? 18.385 26.091  30.270  1.00 50.57  ? 268  THR E CG2   1 
ATOM   10173 N  N     . HIS G 3 269 ? 20.760 28.834  28.972  1.00 68.54  ? 269  HIS E N     1 
ATOM   10174 C  CA    . HIS G 3 269 ? 20.474 30.263  29.027  1.00 73.09  ? 269  HIS E CA    1 
ATOM   10175 C  C     . HIS G 3 269 ? 20.456 30.847  27.625  1.00 75.55  ? 269  HIS E C     1 
ATOM   10176 O  O     . HIS G 3 269 ? 19.639 31.723  27.309  1.00 73.03  ? 269  HIS E O     1 
ATOM   10177 C  CB    . HIS G 3 269 ? 21.518 30.984  29.876  1.00 77.05  ? 269  HIS E CB    1 
ATOM   10178 C  CG    . HIS G 3 269 ? 21.263 32.451  30.023  1.00 78.70  ? 269  HIS E CG    1 
ATOM   10179 N  ND1   . HIS G 3 269 ? 21.872 33.397  29.228  1.00 78.10  ? 269  HIS E ND1   1 
ATOM   10180 C  CD2   . HIS G 3 269 ? 20.442 33.132  30.857  1.00 76.72  ? 269  HIS E CD2   1 
ATOM   10181 C  CE1   . HIS G 3 269 ? 21.440 34.598  29.566  1.00 77.86  ? 269  HIS E CE1   1 
ATOM   10182 N  NE2   . HIS G 3 269 ? 20.571 34.465  30.552  1.00 76.33  ? 269  HIS E NE2   1 
ATOM   10183 N  N     . ARG G 3 270 ? 21.374 30.356  26.797  1.00 76.38  ? 270  ARG E N     1 
ATOM   10184 C  CA    . ARG G 3 270 ? 21.496 30.771  25.401  1.00 78.02  ? 270  ARG E CA    1 
ATOM   10185 C  C     . ARG G 3 270 ? 20.179 30.480  24.682  1.00 74.25  ? 270  ARG E C     1 
ATOM   10186 O  O     . ARG G 3 270 ? 19.629 31.338  23.986  1.00 70.94  ? 270  ARG E O     1 
ATOM   10187 C  CB    . ARG G 3 270 ? 22.649 29.995  24.754  1.00 89.17  ? 270  ARG E CB    1 
ATOM   10188 C  CG    . ARG G 3 270 ? 22.795 30.101  23.240  1.00 94.26  ? 270  ARG E CG    1 
ATOM   10189 C  CD    . ARG G 3 270 ? 24.109 29.429  22.814  1.00 103.65 ? 270  ARG E CD    1 
ATOM   10190 N  NE    . ARG G 3 270 ? 24.258 28.095  23.408  1.00 112.20 ? 270  ARG E NE    1 
ATOM   10191 C  CZ    . ARG G 3 270 ? 25.425 27.493  23.640  1.00 114.92 ? 270  ARG E CZ    1 
ATOM   10192 N  NH1   . ARG G 3 270 ? 26.567 28.097  23.333  1.00 115.34 ? 270  ARG E NH1   1 
ATOM   10193 N  NH2   . ARG G 3 270 ? 25.452 26.285  24.188  1.00 112.23 ? 270  ARG E NH2   1 
ATOM   10194 N  N     . LEU G 3 271 ? 19.676 29.265  24.885  1.00 71.53  ? 271  LEU E N     1 
ATOM   10195 C  CA    . LEU G 3 271 ? 18.431 28.806  24.288  1.00 69.12  ? 271  LEU E CA    1 
ATOM   10196 C  C     . LEU G 3 271 ? 17.214 29.669  24.635  1.00 69.79  ? 271  LEU E C     1 
ATOM   10197 O  O     . LEU G 3 271 ? 16.140 29.494  24.064  1.00 69.92  ? 271  LEU E O     1 
ATOM   10198 C  CB    . LEU G 3 271 ? 18.191 27.353  24.703  1.00 62.60  ? 271  LEU E CB    1 
ATOM   10199 C  CG    . LEU G 3 271 ? 16.917 26.611  24.289  1.00 64.60  ? 271  LEU E CG    1 
ATOM   10200 C  CD1   . LEU G 3 271 ? 17.195 25.114  24.322  1.00 66.31  ? 271  LEU E CD1   1 
ATOM   10201 C  CD2   . LEU G 3 271 ? 15.757 26.965  25.215  1.00 58.39  ? 271  LEU E CD2   1 
ATOM   10202 N  N     . ILE G 3 272 ? 17.366 30.608  25.559  1.00 69.84  ? 272  ILE E N     1 
ATOM   10203 C  CA    . ILE G 3 272 ? 16.236 31.449  25.915  1.00 69.03  ? 272  ILE E CA    1 
ATOM   10204 C  C     . ILE G 3 272 ? 16.452 32.939  25.671  1.00 72.52  ? 272  ILE E C     1 
ATOM   10205 O  O     . ILE G 3 272 ? 15.530 33.640  25.237  1.00 70.71  ? 272  ILE E O     1 
ATOM   10206 C  CB    . ILE G 3 272 ? 15.823 31.240  27.387  1.00 63.66  ? 272  ILE E CB    1 
ATOM   10207 C  CG1   . ILE G 3 272 ? 15.247 29.835  27.560  1.00 59.15  ? 272  ILE E CG1   1 
ATOM   10208 C  CG2   . ILE G 3 272 ? 14.803 32.299  27.803  1.00 62.47  ? 272  ILE E CG2   1 
ATOM   10209 C  CD1   . ILE G 3 272 ? 14.395 29.663  28.811  1.00 55.24  ? 272  ILE E CD1   1 
ATOM   10210 N  N     . TYR G 3 273 ? 17.655 33.436  25.947  1.00 74.30  ? 273  TYR E N     1 
ATOM   10211 C  CA    . TYR G 3 273 ? 17.915 34.857  25.746  1.00 76.58  ? 273  TYR E CA    1 
ATOM   10212 C  C     . TYR G 3 273 ? 18.904 35.082  24.614  1.00 77.14  ? 273  TYR E C     1 
ATOM   10213 O  O     . TYR G 3 273 ? 19.212 36.226  24.259  1.00 75.96  ? 273  TYR E O     1 
ATOM   10214 C  CB    . TYR G 3 273 ? 18.423 35.504  27.041  1.00 77.93  ? 273  TYR E CB    1 
ATOM   10215 C  CG    . TYR G 3 273 ? 17.601 35.124  28.248  1.00 77.54  ? 273  TYR E CG    1 
ATOM   10216 C  CD1   . TYR G 3 273 ? 17.845 33.928  28.924  1.00 75.15  ? 273  TYR E CD1   1 
ATOM   10217 C  CD2   . TYR G 3 273 ? 16.538 35.923  28.679  1.00 76.13  ? 273  TYR E CD2   1 
ATOM   10218 C  CE1   . TYR G 3 273 ? 17.052 33.529  29.995  1.00 74.28  ? 273  TYR E CE1   1 
ATOM   10219 C  CE2   . TYR G 3 273 ? 15.732 35.532  29.753  1.00 75.59  ? 273  TYR E CE2   1 
ATOM   10220 C  CZ    . TYR G 3 273 ? 15.996 34.329  30.404  1.00 73.09  ? 273  TYR E CZ    1 
ATOM   10221 O  OH    . TYR G 3 273 ? 15.200 33.905  31.448  1.00 66.85  ? 273  TYR E OH    1 
ATOM   10222 N  N     . GLY G 3 274 ? 19.402 33.989  24.048  1.00 76.36  ? 274  GLY E N     1 
ATOM   10223 C  CA    . GLY G 3 274 ? 20.329 34.115  22.942  1.00 77.87  ? 274  GLY E CA    1 
ATOM   10224 C  C     . GLY G 3 274 ? 21.794 33.936  23.272  1.00 79.05  ? 274  GLY E C     1 
ATOM   10225 O  O     . GLY G 3 274 ? 22.160 33.097  24.091  1.00 77.93  ? 274  GLY E O     1 
ATOM   10226 N  N     . ALA G 3 275 ? 22.635 34.730  22.617  1.00 80.54  ? 275  ALA E N     1 
ATOM   10227 C  CA    . ALA G 3 275 ? 24.077 34.656  22.816  1.00 82.74  ? 275  ALA E CA    1 
ATOM   10228 C  C     . ALA G 3 275 ? 24.575 35.773  23.722  1.00 84.56  ? 275  ALA E C     1 
ATOM   10229 O  O     . ALA G 3 275 ? 23.841 36.717  24.034  1.00 81.78  ? 275  ALA E O     1 
ATOM   10230 C  CB    . ALA G 3 275 ? 24.794 34.714  21.470  1.00 78.97  ? 275  ALA E CB    1 
ATOM   10231 N  N     . LYS G 3 276 ? 25.832 35.651  24.136  1.00 87.63  ? 276  LYS E N     1 
ATOM   10232 C  CA    . LYS G 3 276 ? 26.458 36.626  25.014  1.00 91.88  ? 276  LYS E CA    1 
ATOM   10233 C  C     . LYS G 3 276 ? 26.964 37.828  24.249  1.00 94.41  ? 276  LYS E C     1 
ATOM   10234 O  O     . LYS G 3 276 ? 27.269 37.737  23.062  1.00 91.89  ? 276  LYS E O     1 
ATOM   10235 C  CB    . LYS G 3 276 ? 27.623 35.978  25.773  1.00 91.02  ? 276  LYS E CB    1 
ATOM   10236 C  CG    . LYS G 3 276 ? 27.189 35.107  26.940  1.00 86.45  ? 276  LYS E CG    1 
ATOM   10237 C  CD    . LYS G 3 276 ? 28.152 33.955  27.183  1.00 84.29  ? 276  LYS E CD    1 
ATOM   10238 C  CE    . LYS G 3 276 ? 29.576 34.428  27.415  1.00 83.76  ? 276  LYS E CE    1 
ATOM   10239 N  NZ    . LYS G 3 276 ? 30.486 33.256  27.600  1.00 86.26  ? 276  LYS E NZ    1 
ATOM   10240 N  N     . ASP G 3 277 ? 27.043 38.957  24.945  1.00 98.34  ? 277  ASP E N     1 
ATOM   10241 C  CA    . ASP G 3 277 ? 27.543 40.187  24.353  1.00 104.91 ? 277  ASP E CA    1 
ATOM   10242 C  C     . ASP G 3 277 ? 29.007 39.944  24.006  1.00 107.05 ? 277  ASP E C     1 
ATOM   10243 O  O     . ASP G 3 277 ? 29.620 38.985  24.491  1.00 108.11 ? 277  ASP E O     1 
ATOM   10244 C  CB    . ASP G 3 277 ? 27.431 41.348  25.353  1.00 115.02 ? 277  ASP E CB    1 
ATOM   10245 C  CG    . ASP G 3 277 ? 25.992 41.632  25.769  1.00 121.84 ? 277  ASP E CG    1 
ATOM   10246 O  OD1   . ASP G 3 277 ? 25.246 40.662  26.028  1.00 123.22 ? 277  ASP E OD1   1 
ATOM   10247 O  OD2   . ASP G 3 277 ? 25.611 42.821  25.852  1.00 123.61 ? 277  ASP E OD2   1 
ATOM   10248 N  N     . ASP G 3 278 ? 29.569 40.810  23.172  1.00 107.87 ? 278  ASP E N     1 
ATOM   10249 C  CA    . ASP G 3 278 ? 30.961 40.664  22.777  1.00 108.98 ? 278  ASP E CA    1 
ATOM   10250 C  C     . ASP G 3 278 ? 31.871 41.231  23.869  1.00 108.28 ? 278  ASP E C     1 
ATOM   10251 O  O     . ASP G 3 278 ? 33.074 40.948  23.900  1.00 108.73 ? 278  ASP E O     1 
ATOM   10252 C  CB    . ASP G 3 278 ? 31.201 41.376  21.440  1.00 116.19 ? 278  ASP E CB    1 
ATOM   10253 C  CG    . ASP G 3 278 ? 30.083 41.116  20.428  1.00 120.01 ? 278  ASP E CG    1 
ATOM   10254 O  OD1   . ASP G 3 278 ? 29.727 39.935  20.203  1.00 122.59 ? 278  ASP E OD1   1 
ATOM   10255 O  OD2   . ASP G 3 278 ? 29.561 42.100  19.858  1.00 116.03 ? 278  ASP E OD2   1 
ATOM   10256 N  N     . SER G 3 279 ? 31.286 42.027  24.764  1.00 105.13 ? 279  SER E N     1 
ATOM   10257 C  CA    . SER G 3 279 ? 32.035 42.617  25.867  1.00 100.89 ? 279  SER E CA    1 
ATOM   10258 C  C     . SER G 3 279 ? 32.339 41.506  26.864  1.00 100.61 ? 279  SER E C     1 
ATOM   10259 O  O     . SER G 3 279 ? 31.462 41.097  27.638  1.00 99.36  ? 279  SER E O     1 
ATOM   10260 C  CB    . SER G 3 279 ? 31.216 43.708  26.552  1.00 95.56  ? 279  SER E CB    1 
ATOM   10261 O  OG    . SER G 3 279 ? 31.962 44.307  27.599  1.00 91.51  ? 279  SER E OG    1 
ATOM   10262 N  N     . GLY G 3 280 ? 33.588 41.036  26.834  1.00 99.55  ? 280  GLY E N     1 
ATOM   10263 C  CA    . GLY G 3 280 ? 34.036 39.946  27.691  1.00 95.10  ? 280  GLY E CA    1 
ATOM   10264 C  C     . GLY G 3 280 ? 33.695 39.918  29.174  1.00 92.98  ? 280  GLY E C     1 
ATOM   10265 O  O     . GLY G 3 280 ? 34.482 39.384  29.963  1.00 92.16  ? 280  GLY E O     1 
ATOM   10266 N  N     . GLN G 3 281 ? 32.542 40.465  29.563  1.00 90.09  ? 281  GLN E N     1 
ATOM   10267 C  CA    . GLN G 3 281 ? 32.146 40.460  30.967  1.00 86.17  ? 281  GLN E CA    1 
ATOM   10268 C  C     . GLN G 3 281 ? 31.893 39.042  31.464  1.00 82.41  ? 281  GLN E C     1 
ATOM   10269 O  O     . GLN G 3 281 ? 31.492 38.157  30.704  1.00 80.79  ? 281  GLN E O     1 
ATOM   10270 C  CB    . GLN G 3 281 ? 30.889 41.297  31.187  1.00 91.28  ? 281  GLN E CB    1 
ATOM   10271 C  CG    . GLN G 3 281 ? 31.065 42.781  30.953  1.00 99.51  ? 281  GLN E CG    1 
ATOM   10272 C  CD    . GLN G 3 281 ? 29.895 43.590  31.484  1.00 105.16 ? 281  GLN E CD    1 
ATOM   10273 O  OE1   . GLN G 3 281 ? 29.772 43.818  32.690  1.00 108.83 ? 281  GLN E OE1   1 
ATOM   10274 N  NE2   . GLN G 3 281 ? 29.024 44.022  30.583  1.00 100.72 ? 281  GLN E NE2   1 
ATOM   10275 N  N     . ARG G 3 282 ? 32.144 38.842  32.752  1.00 77.06  ? 282  ARG E N     1 
ATOM   10276 C  CA    . ARG G 3 282 ? 31.974 37.550  33.398  1.00 71.33  ? 282  ARG E CA    1 
ATOM   10277 C  C     . ARG G 3 282 ? 30.564 37.438  33.993  1.00 68.50  ? 282  ARG E C     1 
ATOM   10278 O  O     . ARG G 3 282 ? 29.951 38.438  34.381  1.00 63.51  ? 282  ARG E O     1 
ATOM   10279 C  CB    . ARG G 3 282 ? 33.045 37.400  34.480  1.00 65.96  ? 282  ARG E CB    1 
ATOM   10280 C  CG    . ARG G 3 282 ? 33.289 35.995  34.961  1.00 67.44  ? 282  ARG E CG    1 
ATOM   10281 C  CD    . ARG G 3 282 ? 34.779 35.753  35.141  1.00 67.09  ? 282  ARG E CD    1 
ATOM   10282 N  NE    . ARG G 3 282 ? 35.054 34.897  36.291  1.00 75.95  ? 282  ARG E NE    1 
ATOM   10283 C  CZ    . ARG G 3 282 ? 36.238 34.352  36.555  1.00 80.04  ? 282  ARG E CZ    1 
ATOM   10284 N  NH1   . ARG G 3 282 ? 37.270 34.572  35.743  1.00 74.00  ? 282  ARG E NH1   1 
ATOM   10285 N  NH2   . ARG G 3 282 ? 36.390 33.585  37.632  1.00 74.71  ? 282  ARG E NH2   1 
ATOM   10286 N  N     . TYR G 3 283 ? 30.056 36.215  34.049  1.00 67.73  ? 283  TYR E N     1 
ATOM   10287 C  CA    . TYR G 3 283 ? 28.721 35.956  34.562  1.00 68.10  ? 283  TYR E CA    1 
ATOM   10288 C  C     . TYR G 3 283 ? 27.667 36.633  33.701  1.00 69.71  ? 283  TYR E C     1 
ATOM   10289 O  O     . TYR G 3 283 ? 26.881 37.446  34.192  1.00 68.98  ? 283  TYR E O     1 
ATOM   10290 C  CB    . TYR G 3 283 ? 28.563 36.452  35.998  1.00 66.14  ? 283  TYR E CB    1 
ATOM   10291 C  CG    . TYR G 3 283 ? 29.449 35.768  37.010  1.00 64.11  ? 283  TYR E CG    1 
ATOM   10292 C  CD1   . TYR G 3 283 ? 30.598 36.395  37.490  1.00 62.96  ? 283  TYR E CD1   1 
ATOM   10293 C  CD2   . TYR G 3 283 ? 29.137 34.501  37.493  1.00 63.94  ? 283  TYR E CD2   1 
ATOM   10294 C  CE1   . TYR G 3 283 ? 31.411 35.786  38.421  1.00 60.43  ? 283  TYR E CE1   1 
ATOM   10295 C  CE2   . TYR G 3 283 ? 29.948 33.880  38.429  1.00 66.78  ? 283  TYR E CE2   1 
ATOM   10296 C  CZ    . TYR G 3 283 ? 31.083 34.530  38.887  1.00 63.85  ? 283  TYR E CZ    1 
ATOM   10297 O  OH    . TYR G 3 283 ? 31.899 33.919  39.808  1.00 63.04  ? 283  TYR E OH    1 
ATOM   10298 N  N     . LEU G 3 284 ? 27.656 36.309  32.413  1.00 68.82  ? 284  LEU E N     1 
ATOM   10299 C  CA    . LEU G 3 284 ? 26.665 36.878  31.514  1.00 68.77  ? 284  LEU E CA    1 
ATOM   10300 C  C     . LEU G 3 284 ? 25.617 35.832  31.167  1.00 66.61  ? 284  LEU E C     1 
ATOM   10301 O  O     . LEU G 3 284 ? 24.732 36.062  30.345  1.00 67.44  ? 284  LEU E O     1 
ATOM   10302 C  CB    . LEU G 3 284 ? 27.331 37.416  30.248  1.00 74.10  ? 284  LEU E CB    1 
ATOM   10303 C  CG    . LEU G 3 284 ? 27.930 38.804  30.470  1.00 71.72  ? 284  LEU E CG    1 
ATOM   10304 C  CD1   . LEU G 3 284 ? 28.639 39.273  29.204  1.00 73.08  ? 284  LEU E CD1   1 
ATOM   10305 C  CD2   . LEU G 3 284 ? 26.812 39.777  30.871  1.00 65.88  ? 284  LEU E CD2   1 
ATOM   10306 N  N     . ALA G 3 285 ? 25.718 34.684  31.821  1.00 63.12  ? 285  ALA E N     1 
ATOM   10307 C  CA    . ALA G 3 285 ? 24.787 33.601  31.600  1.00 60.95  ? 285  ALA E CA    1 
ATOM   10308 C  C     . ALA G 3 285 ? 25.039 32.546  32.657  1.00 61.88  ? 285  ALA E C     1 
ATOM   10309 O  O     . ALA G 3 285 ? 26.190 32.201  32.934  1.00 61.33  ? 285  ALA E O     1 
ATOM   10310 C  CB    . ALA G 3 285 ? 25.002 33.020  30.229  1.00 59.28  ? 285  ALA E CB    1 
ATOM   10311 N  N     . TRP G 3 286 ? 23.958 32.046  33.245  1.00 59.73  ? 286  TRP E N     1 
ATOM   10312 C  CA    . TRP G 3 286 ? 24.027 31.016  34.272  1.00 58.93  ? 286  TRP E CA    1 
ATOM   10313 C  C     . TRP G 3 286 ? 25.313 30.179  34.307  1.00 58.05  ? 286  TRP E C     1 
ATOM   10314 O  O     . TRP G 3 286 ? 25.843 29.762  33.277  1.00 54.71  ? 286  TRP E O     1 
ATOM   10315 C  CB    . TRP G 3 286 ? 22.833 30.083  34.127  1.00 58.71  ? 286  TRP E CB    1 
ATOM   10316 C  CG    . TRP G 3 286 ? 21.543 30.800  34.260  1.00 62.70  ? 286  TRP E CG    1 
ATOM   10317 C  CD1   . TRP G 3 286 ? 21.265 31.798  35.131  1.00 58.32  ? 286  TRP E CD1   1 
ATOM   10318 C  CD2   . TRP G 3 286 ? 20.335 30.551  33.534  1.00 67.89  ? 286  TRP E CD2   1 
ATOM   10319 N  NE1   . TRP G 3 286 ? 19.961 32.195  35.003  1.00 59.19  ? 286  TRP E NE1   1 
ATOM   10320 C  CE2   . TRP G 3 286 ? 19.363 31.444  34.030  1.00 66.31  ? 286  TRP E CE2   1 
ATOM   10321 C  CE3   . TRP G 3 286 ? 19.979 29.658  32.515  1.00 68.63  ? 286  TRP E CE3   1 
ATOM   10322 C  CZ2   . TRP G 3 286 ? 18.057 31.478  33.545  1.00 68.62  ? 286  TRP E CZ2   1 
ATOM   10323 C  CZ3   . TRP G 3 286 ? 18.678 29.688  32.028  1.00 69.44  ? 286  TRP E CZ3   1 
ATOM   10324 C  CH2   . TRP G 3 286 ? 17.730 30.595  32.547  1.00 72.76  ? 286  TRP E CH2   1 
ATOM   10325 N  N     . SER G 3 287 ? 25.800 29.948  35.523  1.00 59.08  ? 287  SER E N     1 
ATOM   10326 C  CA    . SER G 3 287 ? 27.000 29.160  35.778  1.00 55.30  ? 287  SER E CA    1 
ATOM   10327 C  C     . SER G 3 287 ? 26.686 28.146  36.877  1.00 52.08  ? 287  SER E C     1 
ATOM   10328 O  O     . SER G 3 287 ? 25.518 27.934  37.208  1.00 46.93  ? 287  SER E O     1 
ATOM   10329 C  CB    . SER G 3 287 ? 28.155 30.068  36.212  1.00 59.85  ? 287  SER E CB    1 
ATOM   10330 O  OG    . SER G 3 287 ? 27.706 31.386  36.484  1.00 57.62  ? 287  SER E OG    1 
ATOM   10331 N  N     . GLY G 3 288 ? 27.726 27.529  37.434  1.00 50.54  ? 288  GLY E N     1 
ATOM   10332 C  CA    . GLY G 3 288 ? 27.546 26.536  38.485  1.00 54.62  ? 288  GLY E CA    1 
ATOM   10333 C  C     . GLY G 3 288 ? 26.766 27.010  39.711  1.00 56.99  ? 288  GLY E C     1 
ATOM   10334 O  O     . GLY G 3 288 ? 25.794 26.366  40.128  1.00 55.18  ? 288  GLY E O     1 
ATOM   10335 N  N     . HIS G 3 289 ? 27.182 28.131  40.299  1.00 58.60  ? 289  HIS E N     1 
ATOM   10336 C  CA    . HIS G 3 289 ? 26.499 28.668  41.469  1.00 58.02  ? 289  HIS E CA    1 
ATOM   10337 C  C     . HIS G 3 289 ? 25.188 29.383  41.145  1.00 56.46  ? 289  HIS E C     1 
ATOM   10338 O  O     . HIS G 3 289 ? 24.506 29.877  42.045  1.00 54.54  ? 289  HIS E O     1 
ATOM   10339 C  CB    . HIS G 3 289 ? 27.412 29.633  42.228  1.00 66.69  ? 289  HIS E CB    1 
ATOM   10340 C  CG    . HIS G 3 289 ? 28.402 28.952  43.118  1.00 74.22  ? 289  HIS E CG    1 
ATOM   10341 N  ND1   . HIS G 3 289 ? 29.693 28.676  42.725  1.00 76.47  ? 289  HIS E ND1   1 
ATOM   10342 C  CD2   . HIS G 3 289 ? 28.280 28.467  44.376  1.00 81.47  ? 289  HIS E CD2   1 
ATOM   10343 C  CE1   . HIS G 3 289 ? 30.325 28.052  43.702  1.00 79.32  ? 289  HIS E CE1   1 
ATOM   10344 N  NE2   . HIS G 3 289 ? 29.489 27.913  44.715  1.00 86.54  ? 289  HIS E NE2   1 
ATOM   10345 N  N     . SER G 3 290 ? 24.834 29.442  39.867  1.00 52.72  ? 290  SER E N     1 
ATOM   10346 C  CA    . SER G 3 290 ? 23.610 30.112  39.470  1.00 50.