data_1O0O
# 
_entry.id   1O0O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O0O         
RCSB  RCSB018427   
WWPDB D_1000018427 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1O0F 
;complex with 3',5'-ADP
;
unspecified 
PDB 1O0H 
;complex with 5'-ADP
;
unspecified 
PDB 1O0M 
;complex with uridine-2'-phosphate
;
unspecified 
PDB 1O0N 
;complex with uridine-3'-phosphate
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O0O 
_pdbx_database_status.recvd_initial_deposition_date   2003-02-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leonidas, D.D.'    1 
'Oikonomakos, N.G.' 2 
'Chrysina, E.D.'    3 
'Kosmopoulou, M.N.' 4 
'Vlassi, M.'        5 
# 
_citation.id                        primary 
_citation.title                     
;High-resolution crystal structures of ribonuclease A complexed with adenylic and uridylic nucleotide inhibitors. Implications for structure-based design of ribonucleolytic inhibitors
;
_citation.journal_abbrev            'PROTEIN SCI.' 
_citation.journal_volume            12 
_citation.page_first                2559 
_citation.page_last                 2574 
_citation.year                      2003 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14573867 
_citation.pdbx_database_id_DOI      10.1110/ps.03196603 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Leonidas, D.D.'    1 
primary 'Chavali, G.B.'     2 
primary 'Oikonomakos, N.G.' 3 
primary 'Chrysina, E.D.'    4 
primary 'Kosmopoulou, M.N.' 5 
primary 'Vlassi, M.'        6 
primary 'Frankling, C.'     7 
primary 'Acharya, K.R.'     8 
# 
_cell.entry_id           1O0O 
_cell.length_a           99.852 
_cell.length_b           32.528 
_cell.length_c           72.383 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.11 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1O0O 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Ribonuclease pancreatic'     13708.326 2   3.1.27.5 ? ? ? 
2 non-polymer syn "ADENOSINE-2'-5'-DIPHOSPHATE" 427.201   2   ?        ? ? ? 
3 water       nat water                         18.015    558 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ribonuclease A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS
ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS
ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   THR n 
1 4   ALA n 
1 5   ALA n 
1 6   ALA n 
1 7   LYS n 
1 8   PHE n 
1 9   GLU n 
1 10  ARG n 
1 11  GLN n 
1 12  HIS n 
1 13  MET n 
1 14  ASP n 
1 15  SER n 
1 16  SER n 
1 17  THR n 
1 18  SER n 
1 19  ALA n 
1 20  ALA n 
1 21  SER n 
1 22  SER n 
1 23  SER n 
1 24  ASN n 
1 25  TYR n 
1 26  CYS n 
1 27  ASN n 
1 28  GLN n 
1 29  MET n 
1 30  MET n 
1 31  LYS n 
1 32  SER n 
1 33  ARG n 
1 34  ASN n 
1 35  LEU n 
1 36  THR n 
1 37  LYS n 
1 38  ASP n 
1 39  ARG n 
1 40  CYS n 
1 41  LYS n 
1 42  PRO n 
1 43  VAL n 
1 44  ASN n 
1 45  THR n 
1 46  PHE n 
1 47  VAL n 
1 48  HIS n 
1 49  GLU n 
1 50  SER n 
1 51  LEU n 
1 52  ALA n 
1 53  ASP n 
1 54  VAL n 
1 55  GLN n 
1 56  ALA n 
1 57  VAL n 
1 58  CYS n 
1 59  SER n 
1 60  GLN n 
1 61  LYS n 
1 62  ASN n 
1 63  VAL n 
1 64  ALA n 
1 65  CYS n 
1 66  LYS n 
1 67  ASN n 
1 68  GLY n 
1 69  GLN n 
1 70  THR n 
1 71  ASN n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  SER n 
1 76  TYR n 
1 77  SER n 
1 78  THR n 
1 79  MET n 
1 80  SER n 
1 81  ILE n 
1 82  THR n 
1 83  ASP n 
1 84  CYS n 
1 85  ARG n 
1 86  GLU n 
1 87  THR n 
1 88  GLY n 
1 89  SER n 
1 90  SER n 
1 91  LYS n 
1 92  TYR n 
1 93  PRO n 
1 94  ASN n 
1 95  CYS n 
1 96  ALA n 
1 97  TYR n 
1 98  LYS n 
1 99  THR n 
1 100 THR n 
1 101 GLN n 
1 102 ALA n 
1 103 ASN n 
1 104 LYS n 
1 105 HIS n 
1 106 ILE n 
1 107 ILE n 
1 108 VAL n 
1 109 ALA n 
1 110 CYS n 
1 111 GLU n 
1 112 GLY n 
1 113 ASN n 
1 114 PRO n 
1 115 TYR n 
1 116 VAL n 
1 117 PRO n 
1 118 VAL n 
1 119 HIS n 
1 120 PHE n 
1 121 ASP n 
1 122 ALA n 
1 123 SER n 
1 124 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNAS1_BOVIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS
ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_accession          P61823 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O0O A 1 ? 124 ? P61823 27 ? 150 ? 1 124 
2 1 1O0O B 1 ? 124 ? P61823 27 ? 150 ? 1 124 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A2P non-polymer         . "ADENOSINE-2'-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1O0O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.67 
_exptl_crystal.density_percent_sol   25.77 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'20mM Sodium citrate Buffer, 20% PEG 4000, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-02-21 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'YALE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00061 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00061 
# 
_reflns.entry_id                     1O0O 
_reflns.observed_criterion_sigma_F   0.01 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            1.2 
_reflns.d_resolution_low             30 
_reflns.number_all                   67242 
_reflns.number_obs                   67242 
_reflns.percent_possible_obs         92.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.038 
_reflns.pdbx_netI_over_sigmaI        30.9 
_reflns.B_iso_Wilson_estimate        12.9 
_reflns.pdbx_redundancy              14.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.2 
_reflns_shell.d_res_low              1.22 
_reflns_shell.percent_possible_all   71.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.226 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2545 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1O0O 
_refine.ls_number_reflns_obs                     63814 
_refine.ls_number_reflns_all                     63814 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.001 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.36 
_refine.ls_d_res_high                            1.20 
_refine.ls_percent_reflns_obs                    92.9 
_refine.ls_R_factor_obs                          0.19431 
_refine.ls_R_factor_all                          0.19602 
_refine.ls_R_factor_R_work                       0.19431 
_refine.ls_R_factor_R_free                       0.22824 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3421 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               14.680 
_refine.aniso_B[1][1]                            -0.11 
_refine.aniso_B[2][2]                            0.31 
_refine.aniso_B[3][3]                            -0.20 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.05 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1AFU' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.059 
_refine.pdbx_overall_ESU_R_Free                  0.056 
_refine.overall_SU_ML                            0.046 
_refine.overall_SU_B                             1.953 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1O0O 
_refine_analyze.Luzzati_coordinate_error_obs    0.18 
_refine_analyze.Luzzati_sigma_a_obs             0.14 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.20 
_refine_analyze.Luzzati_sigma_a_free            0.14 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1902 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             558 
_refine_hist.number_atoms_total               2514 
_refine_hist.d_res_high                       1.20 
_refine_hist.d_res_low                        29.36 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.021  ? 2000 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 1626 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.661  1.961  ? 2716 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.863  3.000  ? 3844 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.136  3.000  ? 246  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   12.842 15.000 ? 355  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.092  0.200  ? 302  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.009  0.020  ? 2202 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.004  0.020  ? 368  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.250  0.300  ? 495  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.222  0.300  ? 1706 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.191  0.500  ? 1    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.269  0.500  ? 430  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      0.231  0.500  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.235  0.300  ? 28   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.279  0.300  ? 62   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.295  0.500  ? 73   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.233  1.500  ? 1242 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.927  2.000  ? 2006 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.345  3.000  ? 758  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.540  4.500  ? 710  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       1.337  2.000  ? 2000 'X-RAY DIFFRACTION' ? 
r_sphericity_free        2.409  2.000  ? 558  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      2.701  2.000  ? 1956 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.204 
_refine_ls_shell.d_res_low                        1.236 
_refine_ls_shell.number_reflns_R_work             3868 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               71.2 
_refine_ls_shell.R_factor_R_free                  0.277 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             205 
_refine_ls_shell.number_reflns_obs                3868 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1O0O 
_struct.title                     
;Ribonuclease A in complex with adenosine-2',5'-diphosphate
;
_struct.pdbx_descriptor           'Ribonuclease pancreatic(E.C.3.1.27.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O0O 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'hydrolase, Ribonuclease' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 3  ? MET A 13 ? THR A 3  MET A 13 1 ? 11 
HELX_P HELX_P2 2 ASN A 24 ? ARG A 33 ? ASN A 24 ARG A 33 1 ? 10 
HELX_P HELX_P3 3 SER A 50 ? VAL A 57 ? SER A 50 VAL A 57 1 ? 8  
HELX_P HELX_P4 4 CYS A 58 ? GLN A 60 ? CYS A 58 GLN A 60 5 ? 3  
HELX_P HELX_P5 5 THR B 3  ? MET B 13 ? THR B 3  MET B 13 1 ? 11 
HELX_P HELX_P6 6 ASN B 24 ? ARG B 33 ? ASN B 24 ARG B 33 1 ? 10 
HELX_P HELX_P7 7 SER B 50 ? VAL B 57 ? SER B 50 VAL B 57 1 ? 8  
HELX_P HELX_P8 8 CYS B 58 ? GLN B 60 ? CYS B 58 GLN B 60 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84  SG ? ? A CYS 26 A CYS 84  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf2 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 40 A CYS 95  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf4 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72  SG ? ? A CYS 65 A CYS 72  1_555 ? ? ? ? ? ? ? 2.070 ? 
disulf5 disulf ? ? B CYS 26 SG ? ? ? 1_555 B CYS 84  SG ? ? B CYS 26 B CYS 84  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf6 disulf ? ? B CYS 40 SG ? ? ? 1_555 B CYS 95  SG ? ? B CYS 40 B CYS 95  1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf7 disulf ? ? B CYS 58 SG ? ? ? 1_555 B CYS 110 SG ? ? B CYS 58 B CYS 110 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf8 disulf ? ? B CYS 65 SG ? ? ? 1_555 B CYS 72  SG ? ? B CYS 65 B CYS 72  1_555 ? ? ? ? ? ? ? 2.038 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 92  A . ? TYR 92  A PRO 93  A ? PRO 93  A 1 -2.38 
2 ASN 113 A . ? ASN 113 A PRO 114 A ? PRO 114 A 1 5.03  
3 TYR 92  B . ? TYR 92  B PRO 93  B ? PRO 93  B 1 -0.62 
4 ASN 113 B . ? ASN 113 B PRO 114 B ? PRO 114 B 1 3.57  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 116 ? VAL A 124 ? VAL A 116 VAL A 124 
A 2 TYR A 97  ? GLU A 111 ? TYR A 97  GLU A 111 
A 3 CYS A 72  ? GLN A 74  ? CYS A 72  GLN A 74  
A 4 LYS A 61  ? VAL A 63  ? LYS A 61  VAL A 63  
B 1 VAL A 116 ? VAL A 124 ? VAL A 116 VAL A 124 
B 2 TYR A 97  ? GLU A 111 ? TYR A 97  GLU A 111 
B 3 MET A 79  ? GLU A 86  ? MET A 79  GLU A 86  
B 4 VAL A 43  ? VAL A 47  ? VAL A 43  VAL A 47  
C 1 VAL B 116 ? VAL B 124 ? VAL B 116 VAL B 124 
C 2 TYR B 97  ? GLU B 111 ? TYR B 97  GLU B 111 
C 3 CYS B 72  ? GLN B 74  ? CYS B 72  GLN B 74  
C 4 LYS B 61  ? VAL B 63  ? LYS B 61  VAL B 63  
D 1 VAL B 116 ? VAL B 124 ? VAL B 116 VAL B 124 
D 2 TYR B 97  ? GLU B 111 ? TYR B 97  GLU B 111 
D 3 MET B 79  ? GLU B 86  ? MET B 79  GLU B 86  
D 4 VAL B 43  ? VAL B 47  ? VAL B 43  VAL B 47  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 118 ? O VAL A 118 N ALA A 109 ? N ALA A 109 
A 2 3 O VAL A 108 ? O VAL A 108 N TYR A 73  ? N TYR A 73  
A 3 4 O GLN A 74  ? O GLN A 74  N LYS A 61  ? N LYS A 61  
B 1 2 O VAL A 118 ? O VAL A 118 N ALA A 109 ? N ALA A 109 
B 2 3 O LYS A 98  ? O LYS A 98  N ARG A 85  ? N ARG A 85  
B 3 4 O THR A 82  ? O THR A 82  N PHE A 46  ? N PHE A 46  
C 1 2 O VAL B 118 ? O VAL B 118 N ALA B 109 ? N ALA B 109 
C 2 3 O VAL B 108 ? O VAL B 108 N TYR B 73  ? N TYR B 73  
C 3 4 O GLN B 74  ? O GLN B 74  N LYS B 61  ? N LYS B 61  
D 1 2 O VAL B 118 ? O VAL B 118 N ALA B 109 ? N ALA B 109 
D 2 3 O THR B 100 ? O THR B 100 N ASP B 83  ? N ASP B 83  
D 3 4 O THR B 82  ? O THR B 82  N PHE B 46  ? N PHE B 46  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE A2P A 998' 
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE A2P B 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 GLN A 11  ? GLN A 11   . ? 1_555 ? 
2  AC1 14 HIS A 12  ? HIS A 12   . ? 1_555 ? 
3  AC1 14 LYS A 41  ? LYS A 41   . ? 1_555 ? 
4  AC1 14 HIS A 119 ? HIS A 119  . ? 1_555 ? 
5  AC1 14 PHE A 120 ? PHE A 120  . ? 1_555 ? 
6  AC1 14 HOH E .   ? HOH A 1071 . ? 1_555 ? 
7  AC1 14 HOH E .   ? HOH A 1077 . ? 1_555 ? 
8  AC1 14 HOH E .   ? HOH A 1095 . ? 1_555 ? 
9  AC1 14 HOH E .   ? HOH A 1096 . ? 1_555 ? 
10 AC1 14 HOH E .   ? HOH A 1179 . ? 1_555 ? 
11 AC1 14 HOH E .   ? HOH A 1279 . ? 1_555 ? 
12 AC1 14 THR B 70  ? THR B 70   . ? 4_556 ? 
13 AC1 14 LYS B 91  ? LYS B 91   . ? 3_555 ? 
14 AC1 14 HOH F .   ? HOH B 1097 . ? 4_556 ? 
15 AC2 18 GLN A 69  ? GLN A 69   . ? 4_546 ? 
16 AC2 18 HOH E .   ? HOH A 1219 . ? 4_546 ? 
17 AC2 18 GLN B 11  ? GLN B 11   . ? 1_555 ? 
18 AC2 18 HIS B 12  ? HIS B 12   . ? 1_555 ? 
19 AC2 18 CYS B 65  ? CYS B 65   . ? 1_555 ? 
20 AC2 18 ASN B 67  ? ASN B 67   . ? 1_555 ? 
21 AC2 18 ASN B 71  ? ASN B 71   . ? 1_555 ? 
22 AC2 18 ALA B 109 ? ALA B 109  . ? 1_555 ? 
23 AC2 18 GLU B 111 ? GLU B 111  . ? 1_555 ? 
24 AC2 18 HIS B 119 ? HIS B 119  . ? 1_555 ? 
25 AC2 18 PHE B 120 ? PHE B 120  . ? 1_555 ? 
26 AC2 18 HOH F .   ? HOH B 1041 . ? 1_555 ? 
27 AC2 18 HOH F .   ? HOH B 1042 . ? 1_555 ? 
28 AC2 18 HOH F .   ? HOH B 1043 . ? 1_555 ? 
29 AC2 18 HOH F .   ? HOH B 1147 . ? 1_555 ? 
30 AC2 18 HOH F .   ? HOH B 1148 . ? 1_555 ? 
31 AC2 18 HOH F .   ? HOH B 1151 . ? 1_555 ? 
32 AC2 18 HOH F .   ? HOH B 1254 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1O0O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O0O 
_atom_sites.fract_transf_matrix[1][1]   0.010015 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000018 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.030743 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013815 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 1   ? 35.175 20.890  8.596   1.00 27.94 ? 1    LYS A N     1 
ATOM   2    C CA    . LYS A 1 1   ? 35.111 20.562  10.052  1.00 26.72 ? 1    LYS A CA    1 
ATOM   3    C C     . LYS A 1 1   ? 34.121 19.421  10.293  1.00 24.98 ? 1    LYS A C     1 
ATOM   4    O O     . LYS A 1 1   ? 33.042 19.622  10.847  1.00 25.03 ? 1    LYS A O     1 
ATOM   5    C CB    . LYS A 1 1   ? 34.731 21.800  10.874  1.00 27.87 ? 1    LYS A CB    1 
ATOM   6    C CG    . LYS A 1 1   ? 35.358 23.092  10.380  1.00 29.39 ? 1    LYS A CG    1 
ATOM   7    C CD    . LYS A 1 1   ? 34.591 23.649  9.189   1.00 31.24 ? 1    LYS A CD    1 
ATOM   8    C CE    . LYS A 1 1   ? 35.477 24.458  8.262   1.00 32.10 ? 1    LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 1   ? 36.361 23.590  7.445   1.00 33.03 ? 1    LYS A NZ    1 
ATOM   10   N N     . GLU A 1 2   ? 34.458 18.252  9.758   1.00 22.42 ? 2    GLU A N     1 
ATOM   11   C CA    . GLU A 1 2   ? 33.703 17.018  9.970   1.00 20.63 ? 2    GLU A CA    1 
ATOM   12   C C     . GLU A 1 2   ? 33.707 16.550  11.436  1.00 19.63 ? 2    GLU A C     1 
ATOM   13   O O     . GLU A 1 2   ? 34.769 16.334  12.014  1.00 20.39 ? 2    GLU A O     1 
ATOM   14   C CB    . GLU A 1 2   ? 34.303 15.918  9.085   1.00 20.21 ? 2    GLU A CB    1 
ATOM   15   C CG    . GLU A 1 2   ? 33.526 14.622  9.117   1.00 19.05 ? 2    GLU A CG    1 
ATOM   16   C CD    . GLU A 1 2   ? 34.108 13.546  8.220   1.00 18.89 ? 2    GLU A CD    1 
ATOM   17   O OE1   . GLU A 1 2   ? 35.283 13.183  8.411   1.00 20.09 ? 2    GLU A OE1   1 
ATOM   18   O OE2   . GLU A 1 2   ? 33.369 13.016  7.385   1.00 20.54 ? 2    GLU A OE2   1 
ATOM   19   N N     . THR A 1 3   ? 32.521 16.407  12.025  1.00 18.05 ? 3    THR A N     1 
ATOM   20   C CA    . THR A 1 3   ? 32.400 15.926  13.405  1.00 17.08 ? 3    THR A CA    1 
ATOM   21   C C     . THR A 1 3   ? 32.685 14.420  13.438  1.00 16.12 ? 3    THR A C     1 
ATOM   22   O O     . THR A 1 3   ? 32.634 13.734  12.414  1.00 16.24 ? 3    THR A O     1 
ATOM   23   C CB    . THR A 1 3   ? 30.976 16.172  13.963  1.00 16.75 ? 3    THR A CB    1 
ATOM   24   O OG1   . THR A 1 3   ? 30.029 15.374  13.245  1.00 17.66 ? 3    THR A OG1   1 
ATOM   25   C CG2   . THR A 1 3   ? 30.556 17.633  13.791  1.00 17.70 ? 3    THR A CG2   1 
ATOM   26   N N     . ALA A 1 4   ? 32.918 13.900  14.643  1.00 16.29 ? 4    ALA A N     1 
ATOM   27   C CA    . ALA A 1 4   ? 33.119 12.464  14.845  1.00 15.74 ? 4    ALA A CA    1 
ATOM   28   C C     . ALA A 1 4   ? 31.862 11.703  14.398  1.00 14.48 ? 4    ALA A C     1 
ATOM   29   O O     . ALA A 1 4   ? 31.938 10.646  13.788  1.00 14.68 ? 4    ALA A O     1 
ATOM   30   C CB    . ALA A 1 4   ? 33.448 12.170  16.314  1.00 16.11 ? 4    ALA A CB    1 
ATOM   31   N N     . ALA A 1 5   ? 30.695 12.271  14.706  1.00 14.71 ? 5    ALA A N     1 
ATOM   32   C CA    . ALA A 1 5   ? 29.430 11.649  14.329  1.00 14.33 ? 5    ALA A CA    1 
ATOM   33   C C     . ALA A 1 5   ? 29.339 11.560  12.796  1.00 14.36 ? 5    ALA A C     1 
ATOM   34   O O     . ALA A 1 5   ? 28.888 10.563  12.255  1.00 13.98 ? 5    ALA A O     1 
ATOM   35   C CB    . ALA A 1 5   ? 28.251 12.428  14.880  1.00 14.67 ? 5    ALA A CB    1 
ATOM   36   N N     . ALA A 1 6   ? 29.723 12.658  12.126  1.00 15.37 ? 6    ALA A N     1 
ATOM   37   C CA    . ALA A 1 6   ? 29.688 12.751  10.665  1.00 15.38 ? 6    ALA A CA    1 
ATOM   38   C C     . ALA A 1 6   ? 30.657 11.732  10.051  1.00 14.97 ? 6    ALA A C     1 
ATOM   39   O O     . ALA A 1 6   ? 30.350 11.073  9.069   1.00 15.13 ? 6    ALA A O     1 
ATOM   40   C CB    . ALA A 1 6   ? 30.034 14.160  10.216  1.00 16.99 ? 6    ALA A CB    1 
ATOM   41   N N     . LYS A 1 7   ? 31.826 11.609  10.655  1.00 15.09 ? 7    LYS A N     1 
ATOM   42   C CA    . LYS A 1 7   ? 32.809 10.655  10.193  1.00 15.02 ? 7    LYS A CA    1 
ATOM   43   C C     . LYS A 1 7   ? 32.286 9.224   10.320  1.00 13.93 ? 7    LYS A C     1 
ATOM   44   O O     . LYS A 1 7   ? 32.519 8.415   9.441   1.00 13.50 ? 7    LYS A O     1 
ATOM   45   C CB    . LYS A 1 7   ? 34.119 10.809  10.938  1.00 15.43 ? 7    LYS A CB    1 
ATOM   46   C CG    . LYS A 1 7   ? 35.239 9.908   10.435  1.00 17.27 ? 7    LYS A CG    1 
ATOM   47   C CD    . LYS A 1 7   ? 36.553 10.169  11.140  1.00 18.73 ? 7    LYS A CD    1 
ATOM   48   C CE    . LYS A 1 7   ? 37.665 9.333   10.554  1.00 20.02 ? 7    LYS A CE    1 
ATOM   49   N NZ    . LYS A 1 7   ? 38.970 9.673   11.223  1.00 22.21 ? 7    LYS A NZ    1 
ATOM   50   N N     . PHE A 1 8   ? 31.562 8.907   11.404  1.00 13.02 ? 8    PHE A N     1 
ATOM   51   C CA    . PHE A 1 8   ? 30.999 7.573   11.556  1.00 12.22 ? 8    PHE A CA    1 
ATOM   52   C C     . PHE A 1 8   ? 30.008 7.286   10.397  1.00 11.65 ? 8    PHE A C     1 
ATOM   53   O O     . PHE A 1 8   ? 29.985 6.223   9.868   1.00 12.10 ? 8    PHE A O     1 
ATOM   54   C CB    . PHE A 1 8   ? 30.344 7.421   12.957  1.00 11.38 ? 8    PHE A CB    1 
ATOM   55   C CG    . PHE A 1 8   ? 29.612 6.133   13.129  1.00 10.60 ? 8    PHE A CG    1 
ATOM   56   C CD1   . PHE A 1 8   ? 28.330 5.979   12.623  1.00 11.62 ? 8    PHE A CD1   1 
ATOM   57   C CD2   . PHE A 1 8   ? 30.224 5.045   13.752  1.00 10.93 ? 8    PHE A CD2   1 
ATOM   58   C CE1   . PHE A 1 8   ? 27.677 4.784   12.708  1.00 11.70 ? 8    PHE A CE1   1 
ATOM   59   C CE2   . PHE A 1 8   ? 29.563 3.852   13.848  1.00 11.08 ? 8    PHE A CE2   1 
ATOM   60   C CZ    . PHE A 1 8   ? 28.278 3.730   13.341  1.00 10.83 ? 8    PHE A CZ    1 
ATOM   61   N N     . GLU A 1 9   ? 29.109 8.221   10.114  1.00 12.54 ? 9    GLU A N     1 
ATOM   62   C CA    . GLU A 1 9   ? 28.189 8.088   8.974   1.00 13.37 ? 9    GLU A CA    1 
ATOM   63   C C     . GLU A 1 9   ? 28.938 7.898   7.655   1.00 13.15 ? 9    GLU A C     1 
ATOM   64   O O     . GLU A 1 9   ? 28.577 7.062   6.883   1.00 14.91 ? 9    GLU A O     1 
ATOM   65   C CB    . GLU A 1 9   ? 27.273 9.300   8.921   1.00 14.05 ? 9    GLU A CB    1 
ATOM   66   C CG    . GLU A 1 9   ? 26.282 9.376   10.088  1.00 15.06 ? 9    GLU A CG    1 
ATOM   67   C CD    . GLU A 1 9   ? 25.356 10.577  10.007  1.00 18.19 ? 9    GLU A CD    1 
ATOM   68   O OE1   . GLU A 1 9   ? 24.680 10.718  8.958   1.00 21.69 ? 9    GLU A OE1   1 
ATOM   69   O OE2   . GLU A 1 9   ? 25.281 11.374  10.980  1.00 20.40 ? 9    GLU A OE2   1 
ATOM   70   N N     . ARG A 1 10  ? 30.009 8.633   7.447   1.00 13.58 ? 10   ARG A N     1 
ATOM   71   C CA    . ARG A 1 10  ? 30.731 8.486   6.191   1.00 13.85 ? 10   ARG A CA    1 
ATOM   72   C C     . ARG A 1 10  ? 31.412 7.126   6.096   1.00 13.58 ? 10   ARG A C     1 
ATOM   73   O O     . ARG A 1 10  ? 31.383 6.459   5.045   1.00 14.66 ? 10   ARG A O     1 
ATOM   74   C CB    . ARG A 1 10  ? 31.757 9.593   6.067   1.00 15.04 ? 10   ARG A CB    1 
ATOM   75   C CG    . ARG A 1 10  ? 32.725 9.427   4.880   1.00 16.53 ? 10   ARG A CG    1 
ATOM   76   C CD    . ARG A 1 10  ? 33.536 10.666  4.615   1.00 17.36 ? 10   ARG A CD    1 
ATOM   77   N NE    . ARG A 1 10  ? 34.400 10.987  5.729   1.00 19.03 ? 10   ARG A NE    1 
ATOM   78   C CZ    . ARG A 1 10  ? 35.548 10.384  5.989   1.00 19.32 ? 10   ARG A CZ    1 
ATOM   79   N NH1   . ARG A 1 10  ? 35.978 9.393   5.215   1.00 20.58 ? 10   ARG A NH1   1 
ATOM   80   N NH2   . ARG A 1 10  ? 36.279 10.765  7.022   1.00 20.93 ? 10   ARG A NH2   1 
ATOM   81   N N     . GLN A 1 11  ? 32.024 6.692   7.208   1.00 13.02 ? 11   GLN A N     1 
ATOM   82   C CA    . GLN A 1 11  ? 32.748 5.431   7.205   1.00 13.08 ? 11   GLN A CA    1 
ATOM   83   C C     . GLN A 1 11  ? 31.857 4.208   7.277   1.00 12.60 ? 11   GLN A C     1 
ATOM   84   O O     . GLN A 1 11  ? 32.230 3.134   6.785   1.00 13.79 ? 11   GLN A O     1 
ATOM   85   C CB    . GLN A 1 11  ? 33.738 5.340   8.367   1.00 13.93 ? 11   GLN A CB    1 
ATOM   86   C CG    . GLN A 1 11  ? 34.836 6.358   8.352   1.00 14.56 ? 11   GLN A CG    1 
ATOM   87   C CD    . GLN A 1 11  ? 36.005 5.872   9.170   1.00 17.38 ? 11   GLN A CD    1 
ATOM   88   O OE1   . GLN A 1 11  ? 37.003 5.398   8.614   1.00 19.12 ? 11   GLN A OE1   1 
ATOM   89   N NE2   . GLN A 1 11  ? 35.870 5.910   10.482  1.00 16.25 ? 11   GLN A NE2   1 
ATOM   90   N N     . HIS A 1 12  ? 30.694 4.328   7.930   1.00 12.20 ? 12   HIS A N     1 
ATOM   91   C CA    . HIS A 1 12  ? 29.935 3.132   8.272   1.00 11.70 ? 12   HIS A CA    1 
ATOM   92   C C     . HIS A 1 12  ? 28.476 3.068   7.877   1.00 13.15 ? 12   HIS A C     1 
ATOM   93   O O     . HIS A 1 12  ? 27.916 2.005   7.993   1.00 15.02 ? 12   HIS A O     1 
ATOM   94   C CB    . HIS A 1 12  ? 30.052 2.869   9.790   1.00 11.27 ? 12   HIS A CB    1 
ATOM   95   C CG    . HIS A 1 12  ? 31.471 2.759   10.266  1.00 10.39 ? 12   HIS A CG    1 
ATOM   96   N ND1   . HIS A 1 12  ? 32.314 1.757   9.845   1.00 9.93  ? 12   HIS A ND1   1 
ATOM   97   C CD2   . HIS A 1 12  ? 32.189 3.522   11.125  1.00 10.44 ? 12   HIS A CD2   1 
ATOM   98   C CE1   . HIS A 1 12  ? 33.492 1.897   10.438  1.00 10.81 ? 12   HIS A CE1   1 
ATOM   99   N NE2   . HIS A 1 12  ? 33.441 2.959   11.220  1.00 10.08 ? 12   HIS A NE2   1 
ATOM   100  N N     . MET A 1 13  ? 27.857 4.173   7.454   1.00 12.99 ? 13   MET A N     1 
ATOM   101  C CA    . MET A 1 13  ? 26.439 4.139   7.130   1.00 14.24 ? 13   MET A CA    1 
ATOM   102  C C     . MET A 1 13  ? 26.224 4.014   5.644   1.00 14.59 ? 13   MET A C     1 
ATOM   103  O O     . MET A 1 13  ? 26.800 4.793   4.863   1.00 16.20 ? 13   MET A O     1 
ATOM   104  C CB    . MET A 1 13  ? 25.756 5.411   7.602   1.00 14.14 ? 13   MET A CB    1 
ATOM   105  C CG    . MET A 1 13  ? 25.571 5.451   9.117   1.00 14.79 ? 13   MET A CG    1 
ATOM   106  S SD    . MET A 1 13  ? 24.659 4.026   9.898   1.00 15.96 ? 13   MET A SD    1 
ATOM   107  C CE    . MET A 1 13  ? 23.114 4.239   9.063   1.00 16.03 ? 13   MET A CE    1 
ATOM   108  N N     . ASP A 1 14  ? 25.416 3.040   5.258   1.00 14.43 ? 14   ASP A N     1 
ATOM   109  C CA    . ASP A 1 14  ? 24.985 2.930   3.862   1.00 15.34 ? 14   ASP A CA    1 
ATOM   110  C C     . ASP A 1 14  ? 23.551 2.427   3.830   1.00 15.00 ? 14   ASP A C     1 
ATOM   111  O O     . ASP A 1 14  ? 23.287 1.299   3.537   1.00 15.19 ? 14   ASP A O     1 
ATOM   112  C CB    . ASP A 1 14  ? 25.870 1.979   3.048   1.00 17.26 ? 14   ASP A CB    1 
ATOM   113  C CG    . ASP A 1 14  ? 25.460 1.927   1.575   1.00 20.24 ? 14   ASP A CG    1 
ATOM   114  O OD1   . ASP A 1 14  ? 25.014 2.987   1.075   1.00 23.44 ? 14   ASP A OD1   1 
ATOM   115  O OD2   . ASP A 1 14  ? 25.551 0.889   0.874   1.00 21.08 ? 14   ASP A OD2   1 
ATOM   116  N N     . SER A 1 15  ? 22.628 3.294   4.194   1.00 14.81 ? 15   SER A N     1 
ATOM   117  C CA    . SER A 1 15  ? 21.207 2.919   4.258   1.00 16.06 ? 15   SER A CA    1 
ATOM   118  C C     . SER A 1 15  ? 20.531 2.696   2.886   1.00 17.96 ? 15   SER A C     1 
ATOM   119  O O     . SER A 1 15  ? 19.414 2.146   2.798   1.00 20.93 ? 15   SER A O     1 
ATOM   120  C CB    . SER A 1 15  ? 20.423 4.017   4.985   1.00 15.43 ? 15   SER A CB    1 
ATOM   121  O OG    . SER A 1 15  ? 20.983 4.341   6.228   1.00 15.18 ? 15   SER A OG    1 
ATOM   122  N N     . SER A 1 16  ? 21.179 3.159   1.815   1.00 19.92 ? 16   SER A N     1 
ATOM   123  C CA    . SER A 1 16  ? 20.616 3.156   0.434   1.00 23.29 ? 16   SER A CA    1 
ATOM   124  C C     . SER A 1 16  ? 20.469 1.821   -0.309  1.00 26.25 ? 16   SER A C     1 
ATOM   125  O O     . SER A 1 16  ? 19.682 1.747   -1.252  1.00 28.01 ? 16   SER A O     1 
ATOM   126  C CB    . SER A 1 16  ? 21.442 4.083   -0.491  1.00 23.66 ? 16   SER A CB    1 
ATOM   127  O OG    . SER A 1 16  ? 21.471 5.431   -0.068  1.00 24.98 ? 16   SER A OG    1 
ATOM   128  N N     . THR A 1 17  ? 21.186 0.768   0.065   1.00 29.09 ? 17   THR A N     1 
ATOM   129  C CA    . THR A 1 17  ? 21.121 -0.438  -0.767  1.00 31.31 ? 17   THR A CA    1 
ATOM   130  C C     . THR A 1 17  ? 20.214 -1.547  -0.271  1.00 32.62 ? 17   THR A C     1 
ATOM   131  O O     . THR A 1 17  ? 19.943 -2.485  -1.021  1.00 33.45 ? 17   THR A O     1 
ATOM   132  C CB    . THR A 1 17  ? 22.534 -1.009  -1.059  1.00 31.70 ? 17   THR A CB    1 
ATOM   133  O OG1   . THR A 1 17  ? 23.051 -1.702  0.079   1.00 31.85 ? 17   THR A OG1   1 
ATOM   134  C CG2   . THR A 1 17  ? 23.540 0.101   -1.288  1.00 32.63 ? 17   THR A CG2   1 
ATOM   135  N N     . SER A 1 18  ? 19.749 -1.460  0.972   1.00 33.91 ? 18   SER A N     1 
ATOM   136  C CA    . SER A 1 18  ? 18.899 -2.499  1.554   1.00 34.76 ? 18   SER A CA    1 
ATOM   137  C C     . SER A 1 18  ? 19.667 -3.810  1.629   1.00 34.83 ? 18   SER A C     1 
ATOM   138  O O     . SER A 1 18  ? 19.119 -4.825  2.043   1.00 35.86 ? 18   SER A O     1 
ATOM   139  C CB    . SER A 1 18  ? 17.614 -2.708  0.740   1.00 34.93 ? 18   SER A CB    1 
ATOM   140  O OG    . SER A 1 18  ? 16.795 -1.553  0.746   1.00 36.09 ? 18   SER A OG    1 
ATOM   141  N N     . ALA A 1 19  ? 20.928 -3.776  1.197   1.00 34.78 ? 19   ALA A N     1 
ATOM   142  C CA    . ALA A 1 19  ? 21.810 -4.936  1.195   1.00 34.05 ? 19   ALA A CA    1 
ATOM   143  C C     . ALA A 1 19  ? 21.698 -5.731  -0.106  1.00 33.66 ? 19   ALA A C     1 
ATOM   144  O O     . ALA A 1 19  ? 20.861 -6.619  -0.235  1.00 33.89 ? 19   ALA A O     1 
ATOM   145  C CB    . ALA A 1 19  ? 21.546 -5.820  2.396   1.00 34.50 ? 19   ALA A CB    1 
ATOM   146  N N     . ALA A 1 20  ? 22.553 -5.382  -1.064  1.00 32.55 ? 20   ALA A N     1 
ATOM   147  C CA    . ALA A 1 20  ? 22.629 -6.057  -2.356  1.00 32.02 ? 20   ALA A CA    1 
ATOM   148  C C     . ALA A 1 20  ? 24.054 -5.884  -2.881  1.00 31.39 ? 20   ALA A C     1 
ATOM   149  O O     . ALA A 1 20  ? 24.318 -5.968  -4.080  1.00 31.68 ? 20   ALA A O     1 
ATOM   150  C CB    . ALA A 1 20  ? 21.624 -5.467  -3.316  1.00 32.15 ? 20   ALA A CB    1 
ATOM   151  N N     . SER A 1 21  ? 24.970 -5.636  -1.954  1.00 30.37 ? 21   SER A N     1 
ATOM   152  C CA    . SER A 1 21  ? 26.373 -5.402  -2.258  1.00 29.43 ? 21   SER A CA    1 
ATOM   153  C C     . SER A 1 21  ? 26.946 -6.403  -3.237  1.00 28.74 ? 21   SER A C     1 
ATOM   154  O O     . SER A 1 21  ? 26.976 -7.600  -2.958  1.00 28.81 ? 21   SER A O     1 
ATOM   155  C CB    . SER A 1 21  ? 27.168 -5.442  -0.955  1.00 29.54 ? 21   SER A CB    1 
ATOM   156  O OG    . SER A 1 21  ? 26.621 -4.504  -0.043  1.00 28.81 ? 21   SER A OG    1 
ATOM   157  N N     . SER A 1 22  ? 27.400 -5.899  -4.383  1.00 27.74 ? 22   SER A N     1 
ATOM   158  C CA    . SER A 1 22  ? 28.000 -6.756  -5.401  1.00 26.93 ? 22   SER A CA    1 
ATOM   159  C C     . SER A 1 22  ? 29.375 -7.175  -4.929  1.00 26.02 ? 22   SER A C     1 
ATOM   160  O O     . SER A 1 22  ? 29.860 -6.671  -3.930  1.00 26.59 ? 22   SER A O     1 
ATOM   161  C CB    . SER A 1 22  ? 28.093 -6.043  -6.755  1.00 26.97 ? 22   SER A CB    1 
ATOM   162  O OG    . SER A 1 22  ? 29.099 -5.043  -6.788  1.00 26.89 ? 22   SER A OG    1 
ATOM   163  N N     . SER A 1 23  ? 30.016 -8.084  -5.656  1.00 24.81 ? 23   SER A N     1 
ATOM   164  C CA    . SER A 1 23  ? 31.361 -8.507  -5.284  1.00 23.50 ? 23   SER A CA    1 
ATOM   165  C C     . SER A 1 23  ? 32.318 -7.334  -5.350  1.00 22.40 ? 23   SER A C     1 
ATOM   166  O O     . SER A 1 23  ? 33.389 -7.368  -4.750  1.00 23.05 ? 23   SER A O     1 
ATOM   167  C CB    . SER A 1 23  ? 31.856 -9.643  -6.177  1.00 23.05 ? 23   SER A CB    1 
ATOM   168  O OG    . SER A 1 23  ? 31.635 -9.365  -7.548  1.00 21.67 ? 23   SER A OG    1 
ATOM   169  N N     . ASN A 1 24  ? 31.924 -6.285  -6.061  1.00 22.23 ? 24   ASN A N     1 
ATOM   170  C CA    . ASN A 1 24  ? 32.742 -5.085  -6.179  1.00 22.27 ? 24   ASN A CA    1 
ATOM   171  C C     . ASN A 1 24  ? 32.312 -3.941  -5.245  1.00 21.33 ? 24   ASN A C     1 
ATOM   172  O O     . ASN A 1 24  ? 32.906 -2.883  -5.282  1.00 20.42 ? 24   ASN A O     1 
ATOM   173  C CB    . ASN A 1 24  ? 32.749 -4.591  -7.626  1.00 23.69 ? 24   ASN A CB    1 
ATOM   174  C CG    . ASN A 1 24  ? 33.490 -5.526  -8.548  1.00 26.53 ? 24   ASN A CG    1 
ATOM   175  O OD1   . ASN A 1 24  ? 34.626 -5.922  -8.274  1.00 29.69 ? 24   ASN A OD1   1 
ATOM   176  N ND2   . ASN A 1 24  ? 32.851 -5.895  -9.638  1.00 29.91 ? 24   ASN A ND2   1 
ATOM   177  N N     . TYR A 1 25  ? 31.291 -4.172  -4.415  1.00 20.70 ? 25   TYR A N     1 
ATOM   178  C CA    . TYR A 1 25  ? 30.762 -3.159  -3.494  1.00 19.86 ? 25   TYR A CA    1 
ATOM   179  C C     . TYR A 1 25  ? 31.877 -2.510  -2.671  1.00 18.02 ? 25   TYR A C     1 
ATOM   180  O O     . TYR A 1 25  ? 32.022 -1.303  -2.656  1.00 18.44 ? 25   TYR A O     1 
ATOM   181  C CB    . TYR A 1 25  ? 29.709 -3.778  -2.576  1.00 19.75 ? 25   TYR A CB    1 
ATOM   182  C CG    . TYR A 1 25  ? 29.180 -2.864  -1.498  1.00 20.23 ? 25   TYR A CG    1 
ATOM   183  C CD1   . TYR A 1 25  ? 28.166 -1.948  -1.764  1.00 21.91 ? 25   TYR A CD1   1 
ATOM   184  C CD2   . TYR A 1 25  ? 29.693 -2.935  -0.215  1.00 18.60 ? 25   TYR A CD2   1 
ATOM   185  C CE1   . TYR A 1 25  ? 27.671 -1.117  -0.776  1.00 20.43 ? 25   TYR A CE1   1 
ATOM   186  C CE2   . TYR A 1 25  ? 29.215 -2.123  0.781   1.00 18.83 ? 25   TYR A CE2   1 
ATOM   187  C CZ    . TYR A 1 25  ? 28.200 -1.214  0.502   1.00 18.28 ? 25   TYR A CZ    1 
ATOM   188  O OH    . TYR A 1 25  ? 27.730 -0.420  1.525   1.00 18.58 ? 25   TYR A OH    1 
ATOM   189  N N     . CYS A 1 26  ? 32.694 -3.312  -2.000  1.00 17.33 ? 26   CYS A N     1 
ATOM   190  C CA    . CYS A 1 26  ? 33.725 -2.740  -1.143  1.00 17.38 ? 26   CYS A CA    1 
ATOM   191  C C     . CYS A 1 26  ? 34.763 -1.981  -1.941  1.00 17.59 ? 26   CYS A C     1 
ATOM   192  O O     . CYS A 1 26  ? 35.222 -0.929  -1.519  1.00 17.32 ? 26   CYS A O     1 
ATOM   193  C CB    . CYS A 1 26  ? 34.392 -3.829  -0.322  1.00 16.48 ? 26   CYS A CB    1 
ATOM   194  S SG    . CYS A 1 26  ? 33.319 -4.432  0.986   1.00 15.95 ? 26   CYS A SG    1 
ATOM   195  N N     . ASN A 1 27  ? 35.149 -2.511  -3.103  1.00 18.57 ? 27   ASN A N     1 
ATOM   196  C CA    . ASN A 1 27  ? 36.117 -1.784  -3.928  1.00 19.57 ? 27   ASN A CA    1 
ATOM   197  C C     . ASN A 1 27  ? 35.628 -0.371  -4.237  1.00 20.16 ? 27   ASN A C     1 
ATOM   198  O O     . ASN A 1 27  ? 36.377 0.584   -4.081  1.00 20.19 ? 27   ASN A O     1 
ATOM   199  C CB    . ASN A 1 27  ? 36.422 -2.525  -5.227  1.00 19.91 ? 27   ASN A CB    1 
ATOM   200  C CG    . ASN A 1 27  ? 37.115 -3.825  -4.987  1.00 21.03 ? 27   ASN A CG    1 
ATOM   201  O OD1   . ASN A 1 27  ? 37.917 -3.936  -4.070  1.00 21.42 ? 27   ASN A OD1   1 
ATOM   202  N ND2   . ASN A 1 27  ? 36.793 -4.842  -5.800  1.00 23.16 ? 27   ASN A ND2   1 
ATOM   203  N N     . GLN A 1 28  ? 34.356 -0.254  -4.604  1.00 20.58 ? 28   GLN A N     1 
ATOM   204  C CA    . GLN A 1 28  ? 33.758 1.034   -4.938  1.00 21.94 ? 28   GLN A CA    1 
ATOM   205  C C     . GLN A 1 28  ? 33.455 1.903   -3.709  1.00 21.66 ? 28   GLN A C     1 
ATOM   206  O O     . GLN A 1 28  ? 33.853 3.064   -3.662  1.00 21.95 ? 28   GLN A O     1 
ATOM   207  C CB    . GLN A 1 28  ? 32.487 0.819   -5.727  1.00 23.22 ? 28   GLN A CB    1 
ATOM   208  C CG    . GLN A 1 28  ? 32.734 0.160   -7.079  1.00 26.31 ? 28   GLN A CG    1 
ATOM   209  C CD    . GLN A 1 28  ? 31.472 0.027   -7.907  1.00 30.60 ? 28   GLN A CD    1 
ATOM   210  O OE1   . GLN A 1 28  ? 30.540 -0.685  -7.521  1.00 33.23 ? 28   GLN A OE1   1 
ATOM   211  N NE2   . GLN A 1 28  ? 31.436 0.705   -9.051  1.00 33.33 ? 28   GLN A NE2   1 
ATOM   212  N N     . MET A 1 29  ? 32.726 1.356   -2.728  1.00 21.53 ? 29   MET A N     1 
ATOM   213  C CA    . MET A 1 29  ? 32.481 2.073   -1.465  1.00 21.58 ? 29   MET A CA    1 
ATOM   214  C C     . MET A 1 29  ? 33.734 2.510   -0.707  1.00 20.63 ? 29   MET A C     1 
ATOM   215  O O     . MET A 1 29  ? 33.807 3.638   -0.228  1.00 21.42 ? 29   MET A O     1 
ATOM   216  C CB    . MET A 1 29  ? 31.580 1.254   -0.536  1.00 21.83 ? 29   MET A CB    1 
ATOM   217  C CG    . MET A 1 29  ? 30.178 1.119   -1.041  1.00 23.73 ? 29   MET A CG    1 
ATOM   218  S SD    . MET A 1 29  ? 29.353 2.718   -1.067  1.00 26.98 ? 29   MET A SD    1 
ATOM   219  C CE    . MET A 1 29  ? 29.092 3.045   0.634   1.00 25.71 ? 29   MET A CE    1 
ATOM   220  N N     . MET A 1 30  ? 34.720 1.648   -0.511  1.00 19.97 ? 30   MET A N     1 
ATOM   221  C CA    . MET A 1 30  ? 35.877 2.100   0.225   1.00 20.09 ? 30   MET A CA    1 
ATOM   222  C C     . MET A 1 30  ? 36.510 3.327   -0.437  1.00 21.54 ? 30   MET A C     1 
ATOM   223  O O     . MET A 1 30  ? 37.054 4.195   0.225   1.00 21.75 ? 30   MET A O     1 
ATOM   224  C CB    . MET A 1 30  ? 36.889 0.970   0.361   1.00 19.54 ? 30   MET A CB    1 
ATOM   225  C CG    . MET A 1 30  ? 36.406 -0.177  1.277   1.00 17.98 ? 30   MET A CG    1 
ATOM   226  S SD    . MET A 1 30  ? 36.138 0.312   3.005   1.00 16.01 ? 30   MET A SD    1 
ATOM   227  C CE    . MET A 1 30  ? 37.843 0.490   3.565   1.00 18.19 ? 30   MET A CE    1 
ATOM   228  N N     . LYS A 1 31  ? 36.482 3.350   -1.761  1.00 22.72 ? 31   LYS A N     1 
ATOM   229  C CA    . LYS A 1 31  ? 36.943 4.495   -2.530  1.00 23.26 ? 31   LYS A CA    1 
ATOM   230  C C     . LYS A 1 31  ? 36.003 5.707   -2.437  1.00 22.94 ? 31   LYS A C     1 
ATOM   231  O O     . LYS A 1 31  ? 36.464 6.799   -2.139  1.00 23.02 ? 31   LYS A O     1 
ATOM   232  C CB    . LYS A 1 31  ? 37.164 4.067   -3.985  1.00 23.98 ? 31   LYS A CB    1 
ATOM   233  C CG    . LYS A 1 31  ? 37.601 5.168   -4.950  1.00 26.11 ? 31   LYS A CG    1 
ATOM   234  C CD    . LYS A 1 31  ? 37.861 4.568   -6.342  1.00 28.84 ? 31   LYS A CD    1 
ATOM   235  C CE    . LYS A 1 31  ? 36.514 4.139   -6.957  1.00 30.60 ? 31   LYS A CE    1 
ATOM   236  N NZ    . LYS A 1 31  ? 36.354 2.910   -7.783  1.00 31.77 ? 31   LYS A NZ    1 
ATOM   237  N N     . SER A 1 32  ? 34.715 5.531   -2.704  1.00 23.10 ? 32   SER A N     1 
ATOM   238  C CA    . SER A 1 32  ? 33.798 6.671   -2.692  1.00 23.54 ? 32   SER A CA    1 
ATOM   239  C C     . SER A 1 32  ? 33.756 7.379   -1.324  1.00 22.88 ? 32   SER A C     1 
ATOM   240  O O     . SER A 1 32  ? 33.628 8.603   -1.247  1.00 24.03 ? 32   SER A O     1 
ATOM   241  C CB    . SER A 1 32  ? 32.405 6.221   -3.094  1.00 24.44 ? 32   SER A CB    1 
ATOM   242  O OG    . SER A 1 32  ? 31.912 5.224   -2.235  1.00 26.60 ? 32   SER A OG    1 
ATOM   243  N N     . ARG A 1 33  ? 33.854 6.617   -0.236  1.00 21.83 ? 33   ARG A N     1 
ATOM   244  C CA    . ARG A 1 33  ? 33.816 7.224   1.103   1.00 21.15 ? 33   ARG A CA    1 
ATOM   245  C C     . ARG A 1 33  ? 35.162 7.748   1.597   1.00 22.51 ? 33   ARG A C     1 
ATOM   246  O O     . ARG A 1 33  ? 35.326 8.066   2.777   1.00 22.09 ? 33   ARG A O     1 
ATOM   247  C CB    . ARG A 1 33  ? 33.243 6.235   2.123   1.00 20.73 ? 33   ARG A CB    1 
ATOM   248  C CG    . ARG A 1 33  ? 31.832 5.818   1.809   1.00 18.98 ? 33   ARG A CG    1 
ATOM   249  C CD    . ARG A 1 33  ? 30.860 6.980   1.752   1.00 17.54 ? 33   ARG A CD    1 
ATOM   250  N NE    . ARG A 1 33  ? 29.499 6.556   1.544   1.00 18.18 ? 33   ARG A NE    1 
ATOM   251  C CZ    . ARG A 1 33  ? 28.686 6.110   2.504   1.00 17.16 ? 33   ARG A CZ    1 
ATOM   252  N NH1   . ARG A 1 33  ? 29.116 6.000   3.763   1.00 15.75 ? 33   ARG A NH1   1 
ATOM   253  N NH2   . ARG A 1 33  ? 27.455 5.732   2.211   1.00 18.18 ? 33   ARG A NH2   1 
ATOM   254  N N     . ASN A 1 34  ? 36.136 7.831   0.689   1.00 23.79 ? 34   ASN A N     1 
ATOM   255  C CA    . ASN A 1 34  ? 37.457 8.346   1.019   1.00 25.51 ? 34   ASN A CA    1 
ATOM   256  C C     . ASN A 1 34  ? 38.163 7.559   2.118   1.00 25.88 ? 34   ASN A C     1 
ATOM   257  O O     . ASN A 1 34  ? 38.734 8.140   3.042   1.00 26.88 ? 34   ASN A O     1 
ATOM   258  C CB    . ASN A 1 34  ? 37.369 9.831   1.397   1.00 26.25 ? 34   ASN A CB    1 
ATOM   259  C CG    . ASN A 1 34  ? 38.733 10.493  1.501   1.00 29.35 ? 34   ASN A CG    1 
ATOM   260  O OD1   . ASN A 1 34  ? 39.531 10.168  2.380   1.00 31.94 ? 34   ASN A OD1   1 
ATOM   261  N ND2   . ASN A 1 34  ? 39.005 11.430  0.602   1.00 32.62 ? 34   ASN A ND2   1 
ATOM   262  N N     . LEU A 1 35  ? 38.156 6.237   1.994   1.00 25.74 ? 35   LEU A N     1 
ATOM   263  C CA    . LEU A 1 35  ? 38.800 5.377   2.978   1.00 25.47 ? 35   LEU A CA    1 
ATOM   264  C C     . LEU A 1 35  ? 40.068 4.747   2.386   1.00 26.86 ? 35   LEU A C     1 
ATOM   265  O O     . LEU A 1 35  ? 40.686 3.883   3.003   1.00 27.09 ? 35   LEU A O     1 
ATOM   266  C CB    . LEU A 1 35  ? 37.831 4.289   3.460   1.00 24.40 ? 35   LEU A CB    1 
ATOM   267  C CG    . LEU A 1 35  ? 36.504 4.844   3.988   1.00 21.66 ? 35   LEU A CG    1 
ATOM   268  C CD1   . LEU A 1 35  ? 35.653 3.719   4.555   1.00 20.65 ? 35   LEU A CD1   1 
ATOM   269  C CD2   . LEU A 1 35  ? 36.744 5.888   5.048   1.00 21.60 ? 35   LEU A CD2   1 
ATOM   270  N N     . THR A 1 36  ? 40.451 5.182   1.190   1.00 28.47 ? 36   THR A N     1 
ATOM   271  C CA    . THR A 1 36  ? 41.673 4.681   0.547   1.00 29.49 ? 36   THR A CA    1 
ATOM   272  C C     . THR A 1 36  ? 42.470 5.823   -0.067  1.00 30.51 ? 36   THR A C     1 
ATOM   273  O O     . THR A 1 36  ? 43.165 5.645   -1.075  1.00 30.53 ? 36   THR A O     1 
ATOM   274  C CB    . THR A 1 36  ? 41.352 3.649   -0.535  1.00 29.81 ? 36   THR A CB    1 
ATOM   275  O OG1   . THR A 1 36  ? 40.580 4.252   -1.582  1.00 29.70 ? 36   THR A OG1   1 
ATOM   276  C CG2   . THR A 1 36  ? 40.483 2.532   0.019   1.00 30.36 ? 36   THR A CG2   1 
ATOM   277  N N     . LYS A 1 37  ? 42.360 6.996   0.544   1.00 31.52 ? 37   LYS A N     1 
ATOM   278  C CA    . LYS A 1 37  ? 43.053 8.176   0.055   1.00 32.28 ? 37   LYS A CA    1 
ATOM   279  C C     . LYS A 1 37  ? 44.488 8.204   0.559   1.00 32.54 ? 37   LYS A C     1 
ATOM   280  O O     . LYS A 1 37  ? 45.427 8.371   -0.225  1.00 32.80 ? 37   LYS A O     1 
ATOM   281  C CB    . LYS A 1 37  ? 42.320 9.440   0.505   1.00 32.76 ? 37   LYS A CB    1 
ATOM   282  C CG    . LYS A 1 37  ? 42.967 10.729  0.036   1.00 33.52 ? 37   LYS A CG    1 
ATOM   283  C CD    . LYS A 1 37  ? 42.179 11.949  0.474   1.00 34.65 ? 37   LYS A CD    1 
ATOM   284  C CE    . LYS A 1 37  ? 42.826 13.222  -0.049  1.00 35.37 ? 37   LYS A CE    1 
ATOM   285  N NZ    . LYS A 1 37  ? 42.049 14.438  0.302   1.00 36.19 ? 37   LYS A NZ    1 
ATOM   286  N N     . ASP A 1 38  ? 44.657 8.062   1.872   1.00 32.67 ? 38   ASP A N     1 
ATOM   287  C CA    . ASP A 1 38  ? 45.988 8.090   2.475   1.00 33.12 ? 38   ASP A CA    1 
ATOM   288  C C     . ASP A 1 38  ? 46.627 6.711   2.489   1.00 32.73 ? 38   ASP A C     1 
ATOM   289  O O     . ASP A 1 38  ? 47.835 6.576   2.297   1.00 33.23 ? 38   ASP A O     1 
ATOM   290  C CB    . ASP A 1 38  ? 45.929 8.654   3.895   1.00 33.42 ? 38   ASP A CB    1 
ATOM   291  C CG    . ASP A 1 38  ? 44.902 7.958   4.754   1.00 34.31 ? 38   ASP A CG    1 
ATOM   292  O OD1   . ASP A 1 38  ? 44.782 8.316   5.943   1.00 35.88 ? 38   ASP A OD1   1 
ATOM   293  O OD2   . ASP A 1 38  ? 44.169 7.040   4.322   1.00 35.03 ? 38   ASP A OD2   1 
ATOM   294  N N     . ARG A 1 39  ? 45.806 5.692   2.711   1.00 32.10 ? 39   ARG A N     1 
ATOM   295  C CA    . ARG A 1 39  ? 46.260 4.312   2.727   1.00 31.60 ? 39   ARG A CA    1 
ATOM   296  C C     . ARG A 1 39  ? 45.080 3.367   2.597   1.00 30.53 ? 39   ARG A C     1 
ATOM   297  O O     . ARG A 1 39  ? 43.953 3.821   2.425   1.00 30.57 ? 39   ARG A O     1 
ATOM   298  C CB    . ARG A 1 39  ? 46.937 4.031   4.009   1.00 31.84 ? 39   ARG A CB    1 
ATOM   299  C CG    . ARG A 1 39  ? 46.098 4.300   5.170   1.00 33.22 ? 39   ARG A CG    1 
ATOM   300  C CD    . ARG A 1 39  ? 46.803 3.773   6.217   1.00 34.54 ? 39   ARG A CD    1 
ATOM   301  N NE    . ARG A 1 39  ? 46.808 2.425   6.631   1.00 35.64 ? 39   ARG A NE    1 
ATOM   302  C CZ    . ARG A 1 39  ? 46.212 1.886   7.650   1.00 35.93 ? 39   ARG A CZ    1 
ATOM   303  N NH1   . ARG A 1 39  ? 45.136 2.378   8.275   1.00 36.06 ? 39   ARG A NH1   1 
ATOM   304  N NH2   . ARG A 1 39  ? 46.663 0.687   7.899   1.00 36.22 ? 39   ARG A NH2   1 
ATOM   305  N N     . CYS A 1 40  ? 45.341 2.061   2.659   1.00 29.09 ? 40   CYS A N     1 
ATOM   306  C CA    . CYS A 1 40  ? 44.268 1.070   2.572   1.00 28.06 ? 40   CYS A CA    1 
ATOM   307  C C     . CYS A 1 40  ? 43.761 0.764   3.957   1.00 27.08 ? 40   CYS A C     1 
ATOM   308  O O     . CYS A 1 40  ? 44.424 0.059   4.715   1.00 27.44 ? 40   CYS A O     1 
ATOM   309  C CB    . CYS A 1 40  ? 44.755 -0.250  1.965   1.00 27.93 ? 40   CYS A CB    1 
ATOM   310  S SG    . CYS A 1 40  ? 45.464 -0.156  0.325   1.00 27.92 ? 40   CYS A SG    1 
ATOM   311  N N     . LYS A 1 41  ? 42.587 1.288   4.311   1.00 26.00 ? 41   LYS A N     1 
ATOM   312  C CA    . LYS A 1 41  ? 42.038 0.956   5.606   1.00 24.96 ? 41   LYS A CA    1 
ATOM   313  C C     . LYS A 1 41  ? 41.876 -0.560  5.567   1.00 23.84 ? 41   LYS A C     1 
ATOM   314  O O     . LYS A 1 41  ? 41.136 -1.072  4.729   1.00 24.26 ? 41   LYS A O     1 
ATOM   315  C CB    . LYS A 1 41  ? 40.705 1.655   5.844   1.00 24.57 ? 41   LYS A CB    1 
ATOM   316  C CG    . LYS A 1 41  ? 40.192 1.414   7.244   1.00 23.91 ? 41   LYS A CG    1 
ATOM   317  C CD    . LYS A 1 41  ? 38.977 2.238   7.578   1.00 22.73 ? 41   LYS A CD    1 
ATOM   318  C CE    . LYS A 1 41  ? 38.557 1.947   8.998   1.00 22.70 ? 41   LYS A CE    1 
ATOM   319  N NZ    . LYS A 1 41  ? 37.350 2.683   9.416   1.00 21.17 ? 41   LYS A NZ    1 
ATOM   320  N N     . PRO A 1 42  ? 42.591 -1.280  6.420   1.00 23.80 ? 42   PRO A N     1 
ATOM   321  C CA    . PRO A 1 42  ? 42.563 -2.746  6.425   1.00 23.05 ? 42   PRO A CA    1 
ATOM   322  C C     . PRO A 1 42  ? 41.160 -3.381  6.415   1.00 21.72 ? 42   PRO A C     1 
ATOM   323  O O     . PRO A 1 42  ? 40.864 -4.243  5.576   1.00 22.70 ? 42   PRO A O     1 
ATOM   324  C CB    . PRO A 1 42  ? 43.310 -3.081  7.721   1.00 23.24 ? 42   PRO A CB    1 
ATOM   325  C CG    . PRO A 1 42  ? 44.300 -2.005  7.825   1.00 24.51 ? 42   PRO A CG    1 
ATOM   326  C CD    . PRO A 1 42  ? 43.551 -0.762  7.416   1.00 24.14 ? 42   PRO A CD    1 
ATOM   327  N N     . VAL A 1 43  ? 40.321 -2.970  7.359   1.00 20.49 ? 43   VAL A N     1 
ATOM   328  C CA    . VAL A 1 43  ? 38.980 -3.516  7.451   1.00 19.15 ? 43   VAL A CA    1 
ATOM   329  C C     . VAL A 1 43  ? 37.978 -2.417  7.772   1.00 17.21 ? 43   VAL A C     1 
ATOM   330  O O     . VAL A 1 43  ? 38.291 -1.435  8.452   1.00 18.11 ? 43   VAL A O     1 
ATOM   331  C CB    . VAL A 1 43  ? 38.887 -4.609  8.523   1.00 20.68 ? 43   VAL A CB    1 
ATOM   332  C CG1   . VAL A 1 43  ? 39.829 -5.753  8.218   1.00 21.81 ? 43   VAL A CG1   1 
ATOM   333  C CG2   . VAL A 1 43  ? 39.180 -4.068  9.873   1.00 22.06 ? 43   VAL A CG2   1 
ATOM   334  N N     . ASN A 1 44  ? 36.752 -2.586  7.291   1.00 15.00 ? 44   ASN A N     1 
ATOM   335  C CA    . ASN A 1 44  ? 35.725 -1.597  7.540   1.00 14.35 ? 44   ASN A CA    1 
ATOM   336  C C     . ASN A 1 44  ? 34.356 -2.189  7.307   1.00 14.32 ? 44   ASN A C     1 
ATOM   337  O O     . ASN A 1 44  ? 34.193 -2.936  6.363   1.00 16.94 ? 44   ASN A O     1 
ATOM   338  C CB    . ASN A 1 44  ? 35.899 -0.399  6.603   1.00 13.82 ? 44   ASN A CB    1 
ATOM   339  C CG    . ASN A 1 44  ? 35.008 0.761   6.965   1.00 13.89 ? 44   ASN A CG    1 
ATOM   340  O OD1   . ASN A 1 44  ? 35.236 1.413   7.973   1.00 16.19 ? 44   ASN A OD1   1 
ATOM   341  N ND2   . ASN A 1 44  ? 34.009 1.045   6.121   1.00 12.76 ? 44   ASN A ND2   1 
ATOM   342  N N     . THR A 1 45  ? 33.376 -1.806  8.117   1.00 12.17 ? 45   THR A N     1 
ATOM   343  C CA    . THR A 1 45  ? 32.008 -2.314  7.986   1.00 12.04 ? 45   THR A CA    1 
ATOM   344  C C     . THR A 1 45  ? 31.043 -1.222  7.647   1.00 11.10 ? 45   THR A C     1 
ATOM   345  O O     . THR A 1 45  ? 31.104 -0.123  8.188   1.00 11.43 ? 45   THR A O     1 
ATOM   346  C CB    . THR A 1 45  ? 31.590 -2.961  9.296   1.00 13.31 ? 45   THR A CB    1 
ATOM   347  O OG1   . THR A 1 45  ? 32.497 -4.026  9.571   1.00 15.90 ? 45   THR A OG1   1 
ATOM   348  C CG2   . THR A 1 45  ? 30.200 -3.572  9.201   1.00 13.69 ? 45   THR A CG2   1 
ATOM   349  N N     . PHE A 1 46  ? 30.130 -1.548  6.735   1.00 11.13 ? 46   PHE A N     1 
ATOM   350  C CA    . PHE A 1 46  ? 29.029 -0.663  6.376   1.00 11.58 ? 46   PHE A CA    1 
ATOM   351  C C     . PHE A 1 46  ? 27.705 -1.228  6.889   1.00 12.20 ? 46   PHE A C     1 
ATOM   352  O O     . PHE A 1 46  ? 27.486 -2.422  6.776   1.00 13.32 ? 46   PHE A O     1 
ATOM   353  C CB    . PHE A 1 46  ? 28.943 -0.463  4.847   1.00 12.24 ? 46   PHE A CB    1 
ATOM   354  C CG    . PHE A 1 46  ? 30.093 0.335   4.271   1.00 13.92 ? 46   PHE A CG    1 
ATOM   355  C CD1   . PHE A 1 46  ? 30.106 1.699   4.370   1.00 15.63 ? 46   PHE A CD1   1 
ATOM   356  C CD2   . PHE A 1 46  ? 31.191 -0.291  3.694   1.00 13.29 ? 46   PHE A CD2   1 
ATOM   357  C CE1   . PHE A 1 46  ? 31.163 2.434   3.878   1.00 15.17 ? 46   PHE A CE1   1 
ATOM   358  C CE2   . PHE A 1 46  ? 32.258 0.449   3.171   1.00 14.74 ? 46   PHE A CE2   1 
ATOM   359  C CZ    . PHE A 1 46  ? 32.242 1.812   3.274   1.00 14.93 ? 46   PHE A CZ    1 
ATOM   360  N N     . VAL A 1 47  ? 26.850 -0.362  7.421   1.00 11.94 ? 47   VAL A N     1 
ATOM   361  C CA    . VAL A 1 47  ? 25.551 -0.755  7.982   1.00 12.65 ? 47   VAL A CA    1 
ATOM   362  C C     . VAL A 1 47  ? 24.400 -0.242  7.069   1.00 12.74 ? 47   VAL A C     1 
ATOM   363  O O     . VAL A 1 47  ? 24.327 0.918   6.771   1.00 14.85 ? 47   VAL A O     1 
ATOM   364  C CB    . VAL A 1 47  ? 25.385 -0.263  9.446   1.00 12.63 ? 47   VAL A CB    1 
ATOM   365  C CG1   . VAL A 1 47  ? 24.089 -0.810  10.068  1.00 12.97 ? 47   VAL A CG1   1 
ATOM   366  C CG2   . VAL A 1 47  ? 26.572 -0.670  10.316  1.00 12.86 ? 47   VAL A CG2   1 
ATOM   367  N N     . HIS A 1 48  ? 23.493 -1.148  6.743   1.00 14.26 ? 48   HIS A N     1 
ATOM   368  C CA    . HIS A 1 48  ? 22.386 -0.841  5.837   1.00 15.80 ? 48   HIS A CA    1 
ATOM   369  C C     . HIS A 1 48  ? 21.124 -0.903  6.652   1.00 16.68 ? 48   HIS A C     1 
ATOM   370  O O     . HIS A 1 48  ? 20.368 -1.893  6.567   1.00 19.52 ? 48   HIS A O     1 
ATOM   371  C CB    . HIS A 1 48  ? 22.250 -1.933  4.807   1.00 16.30 ? 48   HIS A CB    1 
ATOM   372  C CG    . HIS A 1 48  ? 23.520 -2.253  4.106   1.00 15.96 ? 48   HIS A CG    1 
ATOM   373  N ND1   . HIS A 1 48  ? 24.231 -1.321  3.374   1.00 15.27 ? 48   HIS A ND1   1 
ATOM   374  C CD2   . HIS A 1 48  ? 24.215 -3.410  4.042   1.00 14.74 ? 48   HIS A CD2   1 
ATOM   375  C CE1   . HIS A 1 48  ? 25.313 -1.908  2.882   1.00 16.18 ? 48   HIS A CE1   1 
ATOM   376  N NE2   . HIS A 1 48  ? 25.326 -3.175  3.268   1.00 16.66 ? 48   HIS A NE2   1 
ATOM   377  N N     . GLU A 1 49  ? 21.065 -0.112  7.676   1.00 15.78 ? 49   GLU A N     1 
ATOM   378  C CA    . GLU A 1 49  ? 19.844 0.175   8.400   1.00 15.37 ? 49   GLU A CA    1 
ATOM   379  C C     . GLU A 1 49  ? 19.684 1.671   8.423   1.00 15.70 ? 49   GLU A C     1 
ATOM   380  O O     . GLU A 1 49  ? 20.596 2.389   7.997   1.00 15.61 ? 49   GLU A O     1 
ATOM   381  C CB    . GLU A 1 49  ? 19.927 -0.376  9.833   1.00 14.64 ? 49   GLU A CB    1 
ATOM   382  C CG    . GLU A 1 49  ? 20.155 -1.862  9.913   1.00 16.17 ? 49   GLU A CG    1 
ATOM   383  C CD    . GLU A 1 49  ? 18.996 -2.720  9.411   1.00 16.48 ? 49   GLU A CD    1 
ATOM   384  O OE1   . GLU A 1 49  ? 17.857 -2.237  9.275   1.00 19.22 ? 49   GLU A OE1   1 
ATOM   385  O OE2   . GLU A 1 49  ? 19.261 -3.895  9.170   1.00 16.94 ? 49   GLU A OE2   1 
ATOM   386  N N     . SER A 1 50  ? 18.518 2.154   8.857   1.00 15.86 ? 50   SER A N     1 
ATOM   387  C CA    . SER A 1 50  ? 18.295 3.556   8.930   1.00 16.68 ? 50   SER A CA    1 
ATOM   388  C C     . SER A 1 50  ? 19.236 4.177   9.946   1.00 16.29 ? 50   SER A C     1 
ATOM   389  O O     . SER A 1 50  ? 19.714 3.514   10.893  1.00 15.93 ? 50   SER A O     1 
ATOM   390  C CB    . SER A 1 50  ? 16.849 3.834   9.317   1.00 16.37 ? 50   SER A CB    1 
ATOM   391  O OG    . SER A 1 50  ? 16.687 3.631   10.715  1.00 17.62 ? 50   SER A OG    1 
ATOM   392  N N     . LEU A 1 51  ? 19.517 5.452   9.769   1.00 16.85 ? 51   LEU A N     1 
ATOM   393  C CA    . LEU A 1 51  ? 20.362 6.197   10.683  1.00 17.35 ? 51   LEU A CA    1 
ATOM   394  C C     . LEU A 1 51  ? 19.767 6.203   12.087  1.00 16.98 ? 51   LEU A C     1 
ATOM   395  O O     . LEU A 1 51  ? 20.486 6.046   13.086  1.00 16.46 ? 51   LEU A O     1 
ATOM   396  C CB    . LEU A 1 51  ? 20.558 7.647   10.231  1.00 18.75 ? 51   LEU A CB    1 
ATOM   397  C CG    . LEU A 1 51  ? 21.456 8.502   11.130  1.00 19.43 ? 51   LEU A CG    1 
ATOM   398  C CD1   . LEU A 1 51  ? 22.874 7.929   11.304  1.00 20.39 ? 51   LEU A CD1   1 
ATOM   399  C CD2   . LEU A 1 51  ? 21.540 9.910   10.590  1.00 21.37 ? 51   LEU A CD2   1 
ATOM   400  N N     . ALA A 1 52  ? 18.452 6.357   12.190  1.00 16.43 ? 52   ALA A N     1 
ATOM   401  C CA    . ALA A 1 52  ? 17.815 6.410   13.503  1.00 16.32 ? 52   ALA A CA    1 
ATOM   402  C C     . ALA A 1 52  ? 18.029 5.096   14.237  1.00 16.17 ? 52   ALA A C     1 
ATOM   403  O O     . ALA A 1 52  ? 18.275 5.078   15.445  1.00 16.17 ? 52   ALA A O     1 
ATOM   404  C CB    . ALA A 1 52  ? 16.321 6.719   13.374  1.00 16.67 ? 52   ALA A CB    1 
ATOM   405  N N     . ASP A 1 53  ? 17.905 3.988   13.525  1.00 14.57 ? 53   ASP A N     1 
ATOM   406  C CA    . ASP A 1 53  ? 18.090 2.668   14.108  1.00 15.48 ? 53   ASP A CA    1 
ATOM   407  C C     . ASP A 1 53  ? 19.521 2.477   14.599  1.00 13.87 ? 53   ASP A C     1 
ATOM   408  O O     . ASP A 1 53  ? 19.734 1.876   15.664  1.00 15.42 ? 53   ASP A O     1 
ATOM   409  C CB    . ASP A 1 53  ? 17.765 1.562   13.112  1.00 15.90 ? 53   ASP A CB    1 
ATOM   410  C CG    . ASP A 1 53  ? 16.292 1.303   13.003  1.00 18.33 ? 53   ASP A CG    1 
ATOM   411  O OD1   . ASP A 1 53  ? 15.500 2.027   13.669  1.00 22.54 ? 53   ASP A OD1   1 
ATOM   412  O OD2   . ASP A 1 53  ? 15.854 0.346   12.328  1.00 19.66 ? 53   ASP A OD2   1 
ATOM   413  N N     . VAL A 1 54  ? 20.523 2.943   13.857  1.00 13.18 ? 54   VAL A N     1 
ATOM   414  C CA    . VAL A 1 54  ? 21.909 2.788   14.314  1.00 12.92 ? 54   VAL A CA    1 
ATOM   415  C C     . VAL A 1 54  ? 22.165 3.723   15.485  1.00 12.92 ? 54   VAL A C     1 
ATOM   416  O O     . VAL A 1 54  ? 22.794 3.312   16.471  1.00 12.46 ? 54   VAL A O     1 
ATOM   417  C CB    . VAL A 1 54  ? 22.898 3.019   13.144  1.00 13.30 ? 54   VAL A CB    1 
ATOM   418  C CG1   . VAL A 1 54  ? 24.337 2.942   13.622  1.00 13.29 ? 54   VAL A CG1   1 
ATOM   419  C CG2   . VAL A 1 54  ? 22.642 1.990   12.078  1.00 15.52 ? 54   VAL A CG2   1 
ATOM   420  N N     . GLN A 1 55  ? 21.652 4.948   15.447  1.00 13.53 ? 55   GLN A N     1 
ATOM   421  C CA    . GLN A 1 55  ? 21.814 5.872   16.556  1.00 13.75 ? 55   GLN A CA    1 
ATOM   422  C C     . GLN A 1 55  ? 21.166 5.339   17.841  1.00 13.15 ? 55   GLN A C     1 
ATOM   423  O O     . GLN A 1 55  ? 21.687 5.561   18.948  1.00 13.76 ? 55   GLN A O     1 
ATOM   424  C CB    . GLN A 1 55  ? 21.208 7.235   16.217  1.00 13.82 ? 55   GLN A CB    1 
ATOM   425  C CG    . GLN A 1 55  ? 22.009 7.998   15.185  1.00 14.38 ? 55   GLN A CG    1 
ATOM   426  C CD    . GLN A 1 55  ? 21.345 9.271   14.703  1.00 14.81 ? 55   GLN A CD    1 
ATOM   427  O OE1   . GLN A 1 55  ? 22.031 10.209  14.300  1.00 17.58 ? 55   GLN A OE1   1 
ATOM   428  N NE2   . GLN A 1 55  ? 20.032 9.289   14.701  1.00 14.83 ? 55   GLN A NE2   1 
ATOM   429  N N     . ALA A 1 56  ? 20.103 4.568   17.678  1.00 12.66 ? 56   ALA A N     1 
ATOM   430  C CA    . ALA A 1 56  ? 19.372 4.026   18.809  1.00 13.01 ? 56   ALA A CA    1 
ATOM   431  C C     . ALA A 1 56  ? 20.233 3.021   19.569  1.00 12.35 ? 56   ALA A C     1 
ATOM   432  O O     . ALA A 1 56  ? 19.985 2.774   20.761  1.00 12.85 ? 56   ALA A O     1 
ATOM   433  C CB    . ALA A 1 56  ? 18.103 3.377   18.351  1.00 13.80 ? 56   ALA A CB    1 
ATOM   434  N N     . VAL A 1 57  ? 21.232 2.423   18.922  1.00 11.72 ? 57   VAL A N     1 
ATOM   435  C CA    . VAL A 1 57  ? 22.090 1.448   19.584  1.00 11.17 ? 57   VAL A CA    1 
ATOM   436  C C     . VAL A 1 57  ? 22.805 2.046   20.787  1.00 10.24 ? 57   VAL A C     1 
ATOM   437  O O     . VAL A 1 57  ? 23.119 1.330   21.764  1.00 11.24 ? 57   VAL A O     1 
ATOM   438  C CB    . VAL A 1 57  ? 23.041 0.776   18.560  1.00 11.28 ? 57   VAL A CB    1 
ATOM   439  C CG1   . VAL A 1 57  ? 23.997 -0.198  19.254  1.00 10.81 ? 57   VAL A CG1   1 
ATOM   440  C CG2   . VAL A 1 57  ? 22.224 0.061   17.484  1.00 12.44 ? 57   VAL A CG2   1 
ATOM   441  N N     . CYS A 1 58  ? 23.040 3.334   20.805  1.00 11.10 ? 58   CYS A N     1 
ATOM   442  C CA    . CYS A 1 58  ? 23.708 3.977   21.928  1.00 11.46 ? 58   CYS A CA    1 
ATOM   443  C C     . CYS A 1 58  ? 22.893 3.879   23.230  1.00 11.13 ? 58   CYS A C     1 
ATOM   444  O O     . CYS A 1 58  ? 23.434 4.177   24.270  1.00 12.19 ? 58   CYS A O     1 
ATOM   445  C CB    . CYS A 1 58  ? 23.994 5.453   21.609  1.00 10.93 ? 58   CYS A CB    1 
ATOM   446  S SG    . CYS A 1 58  ? 25.162 5.715   20.261  1.00 12.37 ? 58   CYS A SG    1 
ATOM   447  N N     . SER A 1 59  ? 21.622 3.455   23.163  1.00 11.54 ? 59   SER A N     1 
ATOM   448  C CA    . SER A 1 59  ? 20.761 3.283   24.322  1.00 12.17 ? 59   SER A CA    1 
ATOM   449  C C     . SER A 1 59  ? 20.480 1.827   24.574  1.00 12.45 ? 59   SER A C     1 
ATOM   450  O O     . SER A 1 59  ? 19.623 1.517   25.418  1.00 13.88 ? 59   SER A O     1 
ATOM   451  C CB    . SER A 1 59  ? 19.408 3.953   24.054  1.00 13.97 ? 59   SER A CB    1 
ATOM   452  O OG    . SER A 1 59  ? 18.601 3.184   23.135  1.00 16.30 ? 59   SER A OG    1 
ATOM   453  N N     . GLN A 1 60  ? 21.167 0.923   23.885  1.00 11.82 ? 60   GLN A N     1 
ATOM   454  C CA    . GLN A 1 60  ? 20.963 -0.512  23.963  1.00 11.44 ? 60   GLN A CA    1 
ATOM   455  C C     . GLN A 1 60  ? 21.965 -1.219  24.890  1.00 10.93 ? 60   GLN A C     1 
ATOM   456  O O     . GLN A 1 60  ? 22.246 -0.677  25.934  1.00 12.90 ? 60   GLN A O     1 
ATOM   457  C CB    . GLN A 1 60  ? 20.828 -1.087  22.541  1.00 10.87 ? 60   GLN A CB    1 
ATOM   458  C CG    . GLN A 1 60  ? 19.563 -0.505  21.850  1.00 12.18 ? 60   GLN A CG    1 
ATOM   459  C CD    . GLN A 1 60  ? 19.332 -0.891  20.420  1.00 13.62 ? 60   GLN A CD    1 
ATOM   460  O OE1   . GLN A 1 60  ? 19.747 -1.938  19.983  1.00 11.77 ? 60   GLN A OE1   1 
ATOM   461  N NE2   . GLN A 1 60  ? 18.556 -0.069  19.708  1.00 14.99 ? 60   GLN A NE2   1 
ATOM   462  N N     . LYS A 1 61  ? 22.432 -2.404  24.558  1.00 10.49 ? 61   LYS A N     1 
ATOM   463  C CA    . LYS A 1 61  ? 23.189 -3.206  25.534  1.00 10.98 ? 61   LYS A CA    1 
ATOM   464  C C     . LYS A 1 61  ? 24.625 -2.716  25.725  1.00 9.56  ? 61   LYS A C     1 
ATOM   465  O O     . LYS A 1 61  ? 25.466 -2.851  24.841  1.00 9.68  ? 61   LYS A O     1 
ATOM   466  C CB    . LYS A 1 61  ? 23.217 -4.678  25.143  1.00 11.76 ? 61   LYS A CB    1 
ATOM   467  C CG    . LYS A 1 61  ? 23.861 -5.546  26.255  1.00 14.33 ? 61   LYS A CG    1 
ATOM   468  C CD    . LYS A 1 61  ? 23.832 -7.026  25.945  1.00 18.08 ? 61   LYS A CD    1 
ATOM   469  C CE    . LYS A 1 61  ? 24.590 -7.838  27.002  1.00 21.49 ? 61   LYS A CE    1 
ATOM   470  N NZ    . LYS A 1 61  ? 24.600 -9.304  26.734  1.00 24.69 ? 61   LYS A NZ    1 
ATOM   471  N N     . ASN A 1 62  ? 24.941 -2.175  26.900  1.00 9.80  ? 62   ASN A N     1 
ATOM   472  C CA    . ASN A 1 62  ? 26.301 -1.681  27.169  1.00 9.45  ? 62   ASN A CA    1 
ATOM   473  C C     . ASN A 1 62  ? 27.251 -2.867  27.314  1.00 9.22  ? 62   ASN A C     1 
ATOM   474  O O     . ASN A 1 62  ? 26.997 -3.775  28.118  1.00 10.62 ? 62   ASN A O     1 
ATOM   475  C CB    . ASN A 1 62  ? 26.264 -0.816  28.439  1.00 10.90 ? 62   ASN A CB    1 
ATOM   476  C CG    . ASN A 1 62  ? 27.550 -0.043  28.750  1.00 11.66 ? 62   ASN A CG    1 
ATOM   477  O OD1   . ASN A 1 62  ? 27.753 0.295   29.930  1.00 14.34 ? 62   ASN A OD1   1 
ATOM   478  N ND2   . ASN A 1 62  ? 28.384 0.275   27.784  1.00 10.64 ? 62   ASN A ND2   1 
ATOM   479  N N     . VAL A 1 63  ? 28.330 -2.879  26.539  1.00 8.32  ? 63   VAL A N     1 
ATOM   480  C CA    . VAL A 1 63  ? 29.350 -3.898  26.568  1.00 8.87  ? 63   VAL A CA    1 
ATOM   481  C C     . VAL A 1 63  ? 30.724 -3.221  26.537  1.00 8.43  ? 63   VAL A C     1 
ATOM   482  O O     . VAL A 1 63  ? 30.880 -2.090  26.069  1.00 9.34  ? 63   VAL A O     1 
ATOM   483  C CB    . VAL A 1 63  ? 29.216 -4.877  25.354  1.00 9.26  ? 63   VAL A CB    1 
ATOM   484  C CG1   . VAL A 1 63  ? 27.892 -5.609  25.394  1.00 10.84 ? 63   VAL A CG1   1 
ATOM   485  C CG2   . VAL A 1 63  ? 29.390 -4.159  24.009  1.00 9.97  ? 63   VAL A CG2   1 
ATOM   486  N N     . ALA A 1 64  ? 31.745 -3.937  26.978  1.00 8.40  ? 64   ALA A N     1 
ATOM   487  C CA    . ALA A 1 64  ? 33.101 -3.422  26.880  1.00 8.22  ? 64   ALA A CA    1 
ATOM   488  C C     . ALA A 1 64  ? 33.559 -3.305  25.439  1.00 8.96  ? 64   ALA A C     1 
ATOM   489  O O     . ALA A 1 64  ? 33.285 -4.185  24.632  1.00 9.23  ? 64   ALA A O     1 
ATOM   490  C CB    . ALA A 1 64  ? 34.050 -4.324  27.655  1.00 9.11  ? 64   ALA A CB    1 
ATOM   491  N N     . CYS A 1 65  ? 34.292 -2.241  25.144  1.00 8.69  ? 65   CYS A N     1 
ATOM   492  C CA    . CYS A 1 65  ? 34.908 -2.039  23.848  1.00 8.36  ? 65   CYS A CA    1 
ATOM   493  C C     . CYS A 1 65  ? 36.164 -2.889  23.790  1.00 8.42  ? 65   CYS A C     1 
ATOM   494  O O     . CYS A 1 65  ? 36.813 -3.152  24.803  1.00 8.55  ? 65   CYS A O     1 
ATOM   495  C CB    . CYS A 1 65  ? 35.316 -0.566  23.681  1.00 8.32  ? 65   CYS A CB    1 
ATOM   496  S SG    . CYS A 1 65  ? 34.019 0.638   23.771  1.00 9.77  ? 65   CYS A SG    1 
ATOM   497  N N     . LYS A 1 66  ? 36.566 -3.257  22.583  1.00 9.00  ? 66   LYS A N     1 
ATOM   498  C CA    . LYS A 1 66  ? 37.801 -4.017  22.427  1.00 10.26 ? 66   LYS A CA    1 
ATOM   499  C C     . LYS A 1 66  ? 38.997 -3.316  23.042  1.00 9.93  ? 66   LYS A C     1 
ATOM   500  O O     . LYS A 1 66  ? 39.886 -3.992  23.552  1.00 10.75 ? 66   LYS A O     1 
ATOM   501  C CB    . LYS A 1 66  ? 38.091 -4.314  20.955  1.00 11.49 ? 66   LYS A CB    1 
ATOM   502  C CG    . LYS A 1 66  ? 37.144 -5.324  20.336  1.00 12.44 ? 66   LYS A CG    1 
ATOM   503  C CD    . LYS A 1 66  ? 37.490 -5.517  18.848  1.00 17.82 ? 66   LYS A CD    1 
ATOM   504  C CE    . LYS A 1 66  ? 36.582 -6.507  18.168  1.00 22.07 ? 66   LYS A CE    1 
ATOM   505  N NZ    . LYS A 1 66  ? 36.952 -6.733  16.742  1.00 26.54 ? 66   LYS A NZ    1 
ATOM   506  N N     . ASN A 1 67  ? 39.072 -1.996  23.001  1.00 10.00 ? 67   ASN A N     1 
ATOM   507  C CA    . ASN A 1 67  ? 40.201 -1.290  23.583  1.00 10.71 ? 67   ASN A CA    1 
ATOM   508  C C     . ASN A 1 67  ? 40.095 -1.128  25.094  1.00 10.58 ? 67   ASN A C     1 
ATOM   509  O O     . ASN A 1 67  ? 40.965 -0.473  25.676  1.00 13.67 ? 67   ASN A O     1 
ATOM   510  C CB    . ASN A 1 67  ? 40.373 0.098   22.940  1.00 11.68 ? 67   ASN A CB    1 
ATOM   511  C CG    . ASN A 1 67  ? 39.201 1.028   23.201  1.00 11.70 ? 67   ASN A CG    1 
ATOM   512  O OD1   . ASN A 1 67  ? 38.331 0.766   24.007  1.00 12.04 ? 67   ASN A OD1   1 
ATOM   513  N ND2   . ASN A 1 67  ? 39.155 2.128   22.428  1.00 14.52 ? 67   ASN A ND2   1 
ATOM   514  N N     . GLY A 1 68  ? 39.058 -1.648  25.738  1.00 10.47 ? 68   GLY A N     1 
ATOM   515  C CA    . GLY A 1 68  ? 38.948 -1.587  27.176  1.00 10.66 ? 68   GLY A CA    1 
ATOM   516  C C     . GLY A 1 68  ? 38.085 -0.439  27.660  1.00 10.46 ? 68   GLY A C     1 
ATOM   517  O O     . GLY A 1 68  ? 37.717 -0.409  28.811  1.00 11.11 ? 68   GLY A O     1 
ATOM   518  N N     . GLN A 1 69  ? 37.753 0.517   26.793  1.00 10.21 ? 69   GLN A N     1 
ATOM   519  C CA    . GLN A 1 69  ? 36.823 1.581   27.187  1.00 9.92  ? 69   GLN A CA    1 
ATOM   520  C C     . GLN A 1 69  ? 35.457 0.965   27.442  1.00 9.75  ? 69   GLN A C     1 
ATOM   521  O O     . GLN A 1 69  ? 35.177 -0.166  26.996  1.00 10.82 ? 69   GLN A O     1 
ATOM   522  C CB    . GLN A 1 69  ? 36.738 2.679   26.132  1.00 11.37 ? 69   GLN A CB    1 
ATOM   523  C CG    . GLN A 1 69  ? 38.059 3.424   25.962  1.00 11.97 ? 69   GLN A CG    1 
ATOM   524  C CD    . GLN A 1 69  ? 38.507 4.118   27.211  1.00 16.22 ? 69   GLN A CD    1 
ATOM   525  O OE1   . GLN A 1 69  ? 39.307 3.570   27.995  1.00 18.70 ? 69   GLN A OE1   1 
ATOM   526  N NE2   . GLN A 1 69  ? 38.024 5.346   27.411  1.00 18.59 ? 69   GLN A NE2   1 
ATOM   527  N N     . THR A 1 70  ? 34.588 1.696   28.135  1.00 9.79  ? 70   THR A N     1 
ATOM   528  C CA    . THR A 1 70  ? 33.320 1.186   28.579  1.00 10.44 ? 70   THR A CA    1 
ATOM   529  C C     . THR A 1 70  ? 32.132 1.682   27.771  1.00 10.39 ? 70   THR A C     1 
ATOM   530  O O     . THR A 1 70  ? 31.005 1.320   28.072  1.00 13.00 ? 70   THR A O     1 
ATOM   531  C CB    . THR A 1 70  ? 33.104 1.560   30.067  1.00 12.09 ? 70   THR A CB    1 
ATOM   532  O OG1   . THR A 1 70  ? 33.060 2.998   30.205  1.00 13.81 ? 70   THR A OG1   1 
ATOM   533  C CG2   . THR A 1 70  ? 34.245 1.032   30.962  1.00 14.13 ? 70   THR A CG2   1 
ATOM   534  N N     . ASN A 1 71  ? 32.355 2.503   26.743  1.00 10.07 ? 71   ASN A N     1 
ATOM   535  C CA    . ASN A 1 71  ? 31.272 3.185   26.019  1.00 8.59  ? 71   ASN A CA    1 
ATOM   536  C C     . ASN A 1 71  ? 30.833 2.480   24.748  1.00 8.41  ? 71   ASN A C     1 
ATOM   537  O O     . ASN A 1 71  ? 30.543 3.137   23.737  1.00 8.83  ? 71   ASN A O     1 
ATOM   538  C CB    . ASN A 1 71  ? 31.664 4.631   25.714  1.00 9.22  ? 71   ASN A CB    1 
ATOM   539  C CG    . ASN A 1 71  ? 32.894 4.728   24.842  1.00 9.09  ? 71   ASN A CG    1 
ATOM   540  O OD1   . ASN A 1 71  ? 33.899 4.060   25.089  1.00 11.43 ? 71   ASN A OD1   1 
ATOM   541  N ND2   . ASN A 1 71  ? 32.836 5.591   23.822  1.00 9.54  ? 71   ASN A ND2   1 
ATOM   542  N N     . CYS A 1 72  ? 30.807 1.145   24.762  1.00 7.80  ? 72   CYS A N     1 
ATOM   543  C CA    . CYS A 1 72  ? 30.324 0.392   23.585  1.00 7.76  ? 72   CYS A CA    1 
ATOM   544  C C     . CYS A 1 72  ? 28.938 -0.200  23.857  1.00 8.25  ? 72   CYS A C     1 
ATOM   545  O O     . CYS A 1 72  ? 28.559 -0.445  25.005  1.00 9.18  ? 72   CYS A O     1 
ATOM   546  C CB    . CYS A 1 72  ? 31.346 -0.640  23.124  1.00 7.48  ? 72   CYS A CB    1 
ATOM   547  S SG    . CYS A 1 72  ? 32.728 0.087   22.249  1.00 9.60  ? 72   CYS A SG    1 
ATOM   548  N N     . TYR A 1 73  ? 28.197 -0.386  22.776  1.00 8.54  ? 73   TYR A N     1 
ATOM   549  C CA    . TYR A 1 73  ? 26.798 -0.788  22.833  1.00 9.80  ? 73   TYR A CA    1 
ATOM   550  C C     . TYR A 1 73  ? 26.519 -1.771  21.722  1.00 9.06  ? 73   TYR A C     1 
ATOM   551  O O     . TYR A 1 73  ? 26.874 -1.533  20.570  1.00 9.42  ? 73   TYR A O     1 
ATOM   552  C CB    . TYR A 1 73  ? 25.859 0.417   22.729  1.00 10.22 ? 73   TYR A CB    1 
ATOM   553  C CG    . TYR A 1 73  ? 26.144 1.399   23.850  1.00 10.50 ? 73   TYR A CG    1 
ATOM   554  C CD1   . TYR A 1 73  ? 27.121 2.358   23.711  1.00 10.91 ? 73   TYR A CD1   1 
ATOM   555  C CD2   . TYR A 1 73  ? 25.456 1.331   25.072  1.00 11.93 ? 73   TYR A CD2   1 
ATOM   556  C CE1   . TYR A 1 73  ? 27.459 3.195   24.752  1.00 11.93 ? 73   TYR A CE1   1 
ATOM   557  C CE2   . TYR A 1 73  ? 25.775 2.184   26.110  1.00 11.70 ? 73   TYR A CE2   1 
ATOM   558  C CZ    . TYR A 1 73  ? 26.785 3.114   25.947  1.00 12.05 ? 73   TYR A CZ    1 
ATOM   559  O OH    . TYR A 1 73  ? 27.144 3.985   26.957  1.00 13.24 ? 73   TYR A OH    1 
ATOM   560  N N     . GLN A 1 74  ? 25.877 -2.869  22.085  1.00 9.27  ? 74   GLN A N     1 
ATOM   561  C CA    . GLN A 1 74  ? 25.519 -3.924  21.162  1.00 9.88  ? 74   GLN A CA    1 
ATOM   562  C C     . GLN A 1 74  ? 24.025 -3.844  20.826  1.00 10.09 ? 74   GLN A C     1 
ATOM   563  O O     . GLN A 1 74  ? 23.155 -3.747  21.714  1.00 11.18 ? 74   GLN A O     1 
ATOM   564  C CB    . GLN A 1 74  ? 25.796 -5.274  21.795  1.00 10.32 ? 74   GLN A CB    1 
ATOM   565  C CG    . GLN A 1 74  ? 25.521 -6.432  20.846  1.00 11.70 ? 74   GLN A CG    1 
ATOM   566  C CD    . GLN A 1 74  ? 26.043 -7.707  21.391  1.00 14.30 ? 74   GLN A CD    1 
ATOM   567  O OE1   . GLN A 1 74  ? 27.183 -7.765  21.865  1.00 16.89 ? 74   GLN A OE1   1 
ATOM   568  N NE2   . GLN A 1 74  ? 25.227 -8.741  21.343  1.00 17.01 ? 74   GLN A NE2   1 
ATOM   569  N N     . SER A 1 75  ? 23.694 -3.923  19.546  1.00 10.33 ? 75   SER A N     1 
ATOM   570  C CA    . SER A 1 75  ? 22.291 -3.862  19.115  1.00 10.64 ? 75   SER A CA    1 
ATOM   571  C C     . SER A 1 75  ? 21.526 -5.112  19.557  1.00 11.33 ? 75   SER A C     1 
ATOM   572  O O     . SER A 1 75  ? 22.013 -6.204  19.473  1.00 11.46 ? 75   SER A O     1 
ATOM   573  C CB    . SER A 1 75  ? 22.188 -3.647  17.607  1.00 11.44 ? 75   SER A CB    1 
ATOM   574  O OG    . SER A 1 75  ? 22.716 -4.745  16.906  1.00 12.48 ? 75   SER A OG    1 
ATOM   575  N N     . TYR A 1 76  ? 20.306 -4.901  20.059  1.00 11.48 ? 76   TYR A N     1 
ATOM   576  C CA    . TYR A 1 76  ? 19.454 -6.015  20.483  1.00 13.07 ? 76   TYR A CA    1 
ATOM   577  C C     . TYR A 1 76  ? 19.031 -6.818  19.273  1.00 13.86 ? 76   TYR A C     1 
ATOM   578  O O     . TYR A 1 76  ? 18.982 -8.035  19.321  1.00 15.46 ? 76   TYR A O     1 
ATOM   579  C CB    . TYR A 1 76  ? 18.222 -5.540  21.245  1.00 12.93 ? 76   TYR A CB    1 
ATOM   580  C CG    . TYR A 1 76  ? 18.569 -4.979  22.588  1.00 11.35 ? 76   TYR A CG    1 
ATOM   581  C CD1   . TYR A 1 76  ? 19.256 -5.756  23.522  1.00 11.34 ? 76   TYR A CD1   1 
ATOM   582  C CD2   . TYR A 1 76  ? 18.238 -3.695  22.922  1.00 11.49 ? 76   TYR A CD2   1 
ATOM   583  C CE1   . TYR A 1 76  ? 19.584 -5.262  24.772  1.00 10.09 ? 76   TYR A CE1   1 
ATOM   584  C CE2   . TYR A 1 76  ? 18.576 -3.179  24.165  1.00 11.47 ? 76   TYR A CE2   1 
ATOM   585  C CZ    . TYR A 1 76  ? 19.260 -3.978  25.078  1.00 10.59 ? 76   TYR A CZ    1 
ATOM   586  O OH    . TYR A 1 76  ? 19.587 -3.463  26.309  1.00 11.63 ? 76   TYR A OH    1 
ATOM   587  N N     . SER A 1 77  ? 18.735 -6.122  18.176  1.00 14.68 ? 77   SER A N     1 
ATOM   588  C CA    . SER A 1 77  ? 18.332 -6.771  16.926  1.00 15.83 ? 77   SER A CA    1 
ATOM   589  C C     . SER A 1 77  ? 19.513 -6.926  15.992  1.00 15.05 ? 77   SER A C     1 
ATOM   590  O O     . SER A 1 77  ? 20.508 -6.182  16.057  1.00 16.39 ? 77   SER A O     1 
ATOM   591  C CB    . SER A 1 77  ? 17.269 -5.966  16.211  1.00 17.02 ? 77   SER A CB    1 
ATOM   592  O OG    . SER A 1 77  ? 16.113 -5.839  17.007  1.00 19.50 ? 77   SER A OG    1 
ATOM   593  N N     . THR A 1 78  ? 19.436 -7.909  15.109  1.00 15.53 ? 78   THR A N     1 
ATOM   594  C CA    . THR A 1 78  ? 20.475 -8.063  14.091  1.00 16.29 ? 78   THR A CA    1 
ATOM   595  C C     . THR A 1 78  ? 20.244 -7.013  13.026  1.00 15.47 ? 78   THR A C     1 
ATOM   596  O O     . THR A 1 78  ? 19.141 -6.500  12.878  1.00 17.51 ? 78   THR A O     1 
ATOM   597  C CB    . THR A 1 78  ? 20.471 -9.436  13.420  1.00 18.04 ? 78   THR A CB    1 
ATOM   598  O OG1   . THR A 1 78  ? 19.262 -9.600  12.667  1.00 20.86 ? 78   THR A OG1   1 
ATOM   599  C CG2   . THR A 1 78  ? 20.501 -10.557 14.425  1.00 19.75 ? 78   THR A CG2   1 
ATOM   600  N N     . MET A 1 79  ? 21.332 -6.660  12.346  1.00 14.81 ? 79   MET A N     1 
ATOM   601  C CA    . MET A 1 79  ? 21.299 -5.617  11.340  1.00 14.86 ? 79   MET A CA    1 
ATOM   602  C C     . MET A 1 79  ? 21.982 -6.087  10.081  1.00 14.82 ? 79   MET A C     1 
ATOM   603  O O     . MET A 1 79  ? 22.887 -6.926  10.123  1.00 14.96 ? 79   MET A O     1 
ATOM   604  C CB    . MET A 1 79  ? 21.973 -4.333  11.843  1.00 14.55 ? 79   MET A CB    1 
ATOM   605  C CG    . MET A 1 79  ? 21.208 -3.677  12.944  1.00 14.40 ? 79   MET A CG    1 
ATOM   606  S SD    . MET A 1 79  ? 21.943 -2.079  13.342  1.00 15.64 ? 79   MET A SD    1 
ATOM   607  C CE    . MET A 1 79  ? 20.685 -1.440  14.400  1.00 14.88 ? 79   MET A CE    1 
ATOM   608  N N     . SER A 1 80  ? 21.510 -5.561  8.951   1.00 15.10 ? 80   SER A N     1 
ATOM   609  C CA    . SER A 1 80  ? 22.123 -5.807  7.650   1.00 15.24 ? 80   SER A CA    1 
ATOM   610  C C     . SER A 1 80  ? 23.429 -5.008  7.557   1.00 13.63 ? 80   SER A C     1 
ATOM   611  O O     . SER A 1 80  ? 23.410 -3.803  7.671   1.00 14.81 ? 80   SER A O     1 
ATOM   612  C CB    . SER A 1 80  ? 21.171 -5.404  6.519   1.00 15.15 ? 80   SER A CB    1 
ATOM   613  O OG    . SER A 1 80  ? 21.822 -5.524  5.260   1.00 16.68 ? 80   SER A OG    1 
ATOM   614  N N     . ILE A 1 81  ? 24.517 -5.727  7.333   1.00 14.54 ? 81   ILE A N     1 
ATOM   615  C CA    . ILE A 1 81  ? 25.851 -5.096  7.224   1.00 14.86 ? 81   ILE A CA    1 
ATOM   616  C C     . ILE A 1 81  ? 26.664 -5.695  6.070   1.00 15.03 ? 81   ILE A C     1 
ATOM   617  O O     . ILE A 1 81  ? 26.367 -6.800  5.585   1.00 16.42 ? 81   ILE A O     1 
ATOM   618  C CB    . ILE A 1 81  ? 26.681 -5.213  8.535   1.00 15.13 ? 81   ILE A CB    1 
ATOM   619  C CG1   . ILE A 1 81  ? 27.066 -6.647  8.781   1.00 15.83 ? 81   ILE A CG1   1 
ATOM   620  C CG2   . ILE A 1 81  ? 25.899 -4.677  9.708   1.00 14.88 ? 81   ILE A CG2   1 
ATOM   621  C CD1   . ILE A 1 81  ? 28.005 -6.856  9.933   1.00 17.65 ? 81   ILE A CD1   1 
ATOM   622  N N     . THR A 1 82  ? 27.734 -4.993  5.695   1.00 14.45 ? 82   THR A N     1 
ATOM   623  C CA    . THR A 1 82  ? 28.704 -5.491  4.720   1.00 14.87 ? 82   THR A CA    1 
ATOM   624  C C     . THR A 1 82  ? 30.104 -5.263  5.294   1.00 14.16 ? 82   THR A C     1 
ATOM   625  O O     . THR A 1 82  ? 30.456 -4.136  5.669   1.00 14.24 ? 82   THR A O     1 
ATOM   626  C CB    . THR A 1 82  ? 28.574 -4.749  3.375   1.00 15.27 ? 82   THR A CB    1 
ATOM   627  O OG1   . THR A 1 82  ? 27.272 -4.990  2.813   1.00 16.38 ? 82   THR A OG1   1 
ATOM   628  C CG2   . THR A 1 82  ? 29.586 -5.281  2.341   1.00 16.99 ? 82   THR A CG2   1 
ATOM   629  N N     . ASP A 1 83  ? 30.873 -6.327  5.379   1.00 14.03 ? 83   ASP A N     1 
ATOM   630  C CA    . ASP A 1 83  ? 32.250 -6.277  5.818   1.00 15.79 ? 83   ASP A CA    1 
ATOM   631  C C     . ASP A 1 83  ? 33.185 -6.189  4.630   1.00 15.57 ? 83   ASP A C     1 
ATOM   632  O O     . ASP A 1 83  ? 33.007 -6.922  3.620   1.00 15.69 ? 83   ASP A O     1 
ATOM   633  C CB    . ASP A 1 83  ? 32.563 -7.515  6.622   1.00 17.35 ? 83   ASP A CB    1 
ATOM   634  C CG    . ASP A 1 83  ? 31.828 -7.539  7.917   1.00 21.45 ? 83   ASP A CG    1 
ATOM   635  O OD1   . ASP A 1 83  ? 31.938 -6.566  8.698   1.00 23.44 ? 83   ASP A OD1   1 
ATOM   636  O OD2   . ASP A 1 83  ? 31.109 -8.489  8.240   1.00 26.33 ? 83   ASP A OD2   1 
ATOM   637  N N     . CYS A 1 84  ? 34.175 -5.302  4.741   1.00 15.48 ? 84   CYS A N     1 
ATOM   638  C CA    . CYS A 1 84  ? 35.161 -5.096  3.699   1.00 16.00 ? 84   CYS A CA    1 
ATOM   639  C C     . CYS A 1 84  ? 36.526 -5.418  4.282   1.00 17.01 ? 84   CYS A C     1 
ATOM   640  O O     . CYS A 1 84  ? 36.925 -4.846  5.312   1.00 17.83 ? 84   CYS A O     1 
ATOM   641  C CB    . CYS A 1 84  ? 35.161 -3.637  3.267   1.00 15.66 ? 84   CYS A CB    1 
ATOM   642  S SG    . CYS A 1 84  ? 33.592 -3.111  2.513   1.00 15.39 ? 84   CYS A SG    1 
ATOM   643  N N     . ARG A 1 85  ? 37.247 -6.335  3.651   1.00 18.54 ? 85   ARG A N     1 
ATOM   644  C CA    . ARG A 1 85  ? 38.577 -6.710  4.129   1.00 20.72 ? 85   ARG A CA    1 
ATOM   645  C C     . ARG A 1 85  ? 39.562 -6.645  2.974   1.00 22.02 ? 85   ARG A C     1 
ATOM   646  O O     . ARG A 1 85  ? 39.309 -7.187  1.898   1.00 21.69 ? 85   ARG A O     1 
ATOM   647  C CB    . ARG A 1 85  ? 38.556 -8.107  4.728   1.00 21.93 ? 85   ARG A CB    1 
ATOM   648  C CG    . ARG A 1 85  ? 39.911 -8.556  5.241   1.00 24.98 ? 85   ARG A CG    1 
ATOM   649  C CD    . ARG A 1 85  ? 39.867 -9.879  5.974   1.00 28.41 ? 85   ARG A CD    1 
ATOM   650  N NE    . ARG A 1 85  ? 39.018 -9.812  7.157   1.00 31.18 ? 85   ARG A NE    1 
ATOM   651  C CZ    . ARG A 1 85  ? 39.368 -9.243  8.305   1.00 32.68 ? 85   ARG A CZ    1 
ATOM   652  N NH1   . ARG A 1 85  ? 40.562 -8.685  8.439   1.00 34.44 ? 85   ARG A NH1   1 
ATOM   653  N NH2   . ARG A 1 85  ? 38.528 -9.237  9.327   1.00 33.62 ? 85   ARG A NH2   1 
ATOM   654  N N     . GLU A 1 86  ? 40.676 -5.956  3.180   1.00 23.45 ? 86   GLU A N     1 
ATOM   655  C CA    . GLU A 1 86  ? 41.678 -5.815  2.134   1.00 24.89 ? 86   GLU A CA    1 
ATOM   656  C C     . GLU A 1 86  ? 42.241 -7.184  1.734   1.00 25.67 ? 86   GLU A C     1 
ATOM   657  O O     . GLU A 1 86  ? 42.548 -8.007  2.602   1.00 26.38 ? 86   GLU A O     1 
ATOM   658  C CB    . GLU A 1 86  ? 42.803 -4.887  2.612   1.00 25.44 ? 86   GLU A CB    1 
ATOM   659  C CG    . GLU A 1 86  ? 43.981 -4.820  1.670   1.00 26.68 ? 86   GLU A CG    1 
ATOM   660  C CD    . GLU A 1 86  ? 44.987 -3.783  2.098   1.00 28.26 ? 86   GLU A CD    1 
ATOM   661  O OE1   . GLU A 1 86  ? 45.301 -3.758  3.308   1.00 30.36 ? 86   GLU A OE1   1 
ATOM   662  O OE2   . GLU A 1 86  ? 45.433 -3.018  1.230   1.00 29.54 ? 86   GLU A OE2   1 
ATOM   663  N N     . THR A 1 87  ? 42.329 -7.438  0.427   1.00 26.43 ? 87   THR A N     1 
ATOM   664  C CA    . THR A 1 87  ? 42.862 -8.716  -0.064  1.00 27.10 ? 87   THR A CA    1 
ATOM   665  C C     . THR A 1 87  ? 44.376 -8.810  0.148   1.00 28.02 ? 87   THR A C     1 
ATOM   666  O O     . THR A 1 87  ? 45.032 -7.846  0.540   1.00 27.92 ? 87   THR A O     1 
ATOM   667  C CB    . THR A 1 87  ? 42.559 -8.932  -1.560  1.00 27.05 ? 87   THR A CB    1 
ATOM   668  O OG1   . THR A 1 87  ? 43.193 -7.912  -2.343  1.00 27.50 ? 87   THR A OG1   1 
ATOM   669  C CG2   . THR A 1 87  ? 41.068 -8.804  -1.862  1.00 27.02 ? 87   THR A CG2   1 
ATOM   670  N N     . GLY A 1 88  ? 44.926 -9.989  -0.112  1.00 29.13 ? 88   GLY A N     1 
ATOM   671  C CA    . GLY A 1 88  ? 46.351 -10.203 0.044   1.00 30.01 ? 88   GLY A CA    1 
ATOM   672  C C     . GLY A 1 88  ? 47.174 -9.584  -1.072  1.00 30.85 ? 88   GLY A C     1 
ATOM   673  O O     . GLY A 1 88  ? 48.370 -9.363  -0.898  1.00 31.82 ? 88   GLY A O     1 
ATOM   674  N N     . SER A 1 89  ? 46.549 -9.287  -2.209  1.00 31.41 ? 89   SER A N     1 
ATOM   675  C CA    . SER A 1 89  ? 47.259 -8.718  -3.355  1.00 32.14 ? 89   SER A CA    1 
ATOM   676  C C     . SER A 1 89  ? 46.966 -7.226  -3.543  1.00 32.30 ? 89   SER A C     1 
ATOM   677  O O     . SER A 1 89  ? 47.415 -6.617  -4.520  1.00 32.50 ? 89   SER A O     1 
ATOM   678  C CB    . SER A 1 89  ? 46.909 -9.483  -4.638  1.00 32.47 ? 89   SER A CB    1 
ATOM   679  O OG    . SER A 1 89  ? 45.533 -9.375  -4.970  1.00 33.63 ? 89   SER A OG    1 
ATOM   680  N N     . SER A 1 90  ? 46.213 -6.649  -2.609  1.00 32.10 ? 90   SER A N     1 
ATOM   681  C CA    . SER A 1 90  ? 45.859 -5.234  -2.657  1.00 31.82 ? 90   SER A CA    1 
ATOM   682  C C     . SER A 1 90  ? 47.098 -4.354  -2.582  1.00 31.89 ? 90   SER A C     1 
ATOM   683  O O     . SER A 1 90  ? 47.860 -4.454  -1.629  1.00 31.71 ? 90   SER A O     1 
ATOM   684  C CB    . SER A 1 90  ? 44.930 -4.889  -1.491  1.00 31.55 ? 90   SER A CB    1 
ATOM   685  O OG    . SER A 1 90  ? 44.689 -3.493  -1.433  1.00 30.85 ? 90   SER A OG    1 
ATOM   686  N N     . LYS A 1 91  ? 47.268 -3.479  -3.573  1.00 32.00 ? 91   LYS A N     1 
ATOM   687  C CA    . LYS A 1 91  ? 48.420 -2.580  -3.628  1.00 32.34 ? 91   LYS A CA    1 
ATOM   688  C C     . LYS A 1 91  ? 48.034 -1.104  -3.770  1.00 32.30 ? 91   LYS A C     1 
ATOM   689  O O     . LYS A 1 91  ? 47.516 -0.676  -4.801  1.00 32.11 ? 91   LYS A O     1 
ATOM   690  C CB    . LYS A 1 91  ? 49.356 -2.988  -4.772  1.00 32.46 ? 91   LYS A CB    1 
ATOM   691  C CG    . LYS A 1 91  ? 49.982 -4.377  -4.609  1.00 32.78 ? 91   LYS A CG    1 
ATOM   692  C CD    . LYS A 1 91  ? 51.179 -4.380  -3.664  1.00 33.39 ? 91   LYS A CD    1 
ATOM   693  C CE    . LYS A 1 91  ? 50.788 -4.149  -2.227  1.00 33.54 ? 91   LYS A CE    1 
ATOM   694  N NZ    . LYS A 1 91  ? 51.927 -4.300  -1.305  1.00 35.10 ? 91   LYS A NZ    1 
ATOM   695  N N     . TYR A 1 92  ? 48.322 -0.332  -2.730  1.00 32.74 ? 92   TYR A N     1 
ATOM   696  C CA    . TYR A 1 92  ? 48.069 1.107   -2.725  1.00 33.23 ? 92   TYR A CA    1 
ATOM   697  C C     . TYR A 1 92  ? 48.720 1.746   -3.953  1.00 33.38 ? 92   TYR A C     1 
ATOM   698  O O     . TYR A 1 92  ? 49.798 1.324   -4.365  1.00 33.50 ? 92   TYR A O     1 
ATOM   699  C CB    . TYR A 1 92  ? 48.654 1.710   -1.447  1.00 33.38 ? 92   TYR A CB    1 
ATOM   700  C CG    . TYR A 1 92  ? 48.420 3.193   -1.243  1.00 33.97 ? 92   TYR A CG    1 
ATOM   701  C CD1   . TYR A 1 92  ? 47.207 3.669   -0.766  1.00 34.56 ? 92   TYR A CD1   1 
ATOM   702  C CD2   . TYR A 1 92  ? 49.427 4.116   -1.503  1.00 34.63 ? 92   TYR A CD2   1 
ATOM   703  C CE1   . TYR A 1 92  ? 46.995 5.027   -0.571  1.00 34.71 ? 92   TYR A CE1   1 
ATOM   704  C CE2   . TYR A 1 92  ? 49.225 5.469   -1.310  1.00 34.79 ? 92   TYR A CE2   1 
ATOM   705  C CZ    . TYR A 1 92  ? 48.012 5.921   -0.842  1.00 35.38 ? 92   TYR A CZ    1 
ATOM   706  O OH    . TYR A 1 92  ? 47.823 7.274   -0.651  1.00 36.11 ? 92   TYR A OH    1 
ATOM   707  N N     . PRO A 1 93  ? 48.085 2.746   -4.557  1.00 33.61 ? 93   PRO A N     1 
ATOM   708  C CA    . PRO A 1 93  ? 46.771 3.258   -4.163  1.00 33.59 ? 93   PRO A CA    1 
ATOM   709  C C     . PRO A 1 93  ? 45.617 2.424   -4.715  1.00 33.48 ? 93   PRO A C     1 
ATOM   710  O O     . PRO A 1 93  ? 44.456 2.834   -4.634  1.00 33.61 ? 93   PRO A O     1 
ATOM   711  C CB    . PRO A 1 93  ? 46.778 4.647   -4.798  1.00 33.69 ? 93   PRO A CB    1 
ATOM   712  C CG    . PRO A 1 93  ? 47.492 4.412   -6.073  1.00 33.85 ? 93   PRO A CG    1 
ATOM   713  C CD    . PRO A 1 93  ? 48.651 3.538   -5.662  1.00 33.71 ? 93   PRO A CD    1 
ATOM   714  N N     . ASN A 1 94  ? 45.942 1.258   -5.262  1.00 33.06 ? 94   ASN A N     1 
ATOM   715  C CA    . ASN A 1 94  ? 44.947 0.356   -5.806  1.00 32.74 ? 94   ASN A CA    1 
ATOM   716  C C     . ASN A 1 94  ? 44.509 -0.641  -4.733  1.00 31.58 ? 94   ASN A C     1 
ATOM   717  O O     . ASN A 1 94  ? 44.765 -1.844  -4.830  1.00 31.53 ? 94   ASN A O     1 
ATOM   718  C CB    . ASN A 1 94  ? 45.514 -0.382  -7.020  1.00 33.15 ? 94   ASN A CB    1 
ATOM   719  C CG    . ASN A 1 94  ? 46.081 0.559   -8.063  1.00 34.57 ? 94   ASN A CG    1 
ATOM   720  O OD1   . ASN A 1 94  ? 47.071 1.248   -7.821  1.00 36.65 ? 94   ASN A OD1   1 
ATOM   721  N ND2   . ASN A 1 94  ? 45.454 0.590   -9.233  1.00 36.32 ? 94   ASN A ND2   1 
ATOM   722  N N     . CYS A 1 95  ? 43.851 -0.137  -3.694  1.00 30.37 ? 95   CYS A N     1 
ATOM   723  C CA    . CYS A 1 95  ? 43.385 -0.996  -2.618  1.00 29.26 ? 95   CYS A CA    1 
ATOM   724  C C     . CYS A 1 95  ? 42.255 -1.892  -3.120  1.00 28.10 ? 95   CYS A C     1 
ATOM   725  O O     . CYS A 1 95  ? 41.339 -1.433  -3.793  1.00 28.26 ? 95   CYS A O     1 
ATOM   726  C CB    . CYS A 1 95  ? 42.934 -0.162  -1.419  1.00 29.03 ? 95   CYS A CB    1 
ATOM   727  S SG    . CYS A 1 95  ? 44.235 0.947   -0.831  1.00 30.15 ? 95   CYS A SG    1 
ATOM   728  N N     . ALA A 1 96  ? 42.348 -3.175  -2.808  1.00 25.94 ? 96   ALA A N     1 
ATOM   729  C CA    . ALA A 1 96  ? 41.364 -4.155  -3.232  1.00 24.57 ? 96   ALA A CA    1 
ATOM   730  C C     . ALA A 1 96  ? 40.781 -4.807  -2.008  1.00 22.57 ? 96   ALA A C     1 
ATOM   731  O O     . ALA A 1 96  ? 41.508 -5.065  -1.049  1.00 22.37 ? 96   ALA A O     1 
ATOM   732  C CB    . ALA A 1 96  ? 42.012 -5.209  -4.115  1.00 24.93 ? 96   ALA A CB    1 
ATOM   733  N N     . TYR A 1 97  ? 39.475 -5.095  -2.065  1.00 20.80 ? 97   TYR A N     1 
ATOM   734  C CA    . TYR A 1 97  ? 38.748 -5.661  -0.917  1.00 19.30 ? 97   TYR A CA    1 
ATOM   735  C C     . TYR A 1 97  ? 37.837 -6.849  -1.260  1.00 18.97 ? 97   TYR A C     1 
ATOM   736  O O     . TYR A 1 97  ? 37.297 -6.974  -2.377  1.00 19.38 ? 97   TYR A O     1 
ATOM   737  C CB    . TYR A 1 97  ? 37.873 -4.591  -0.238  1.00 18.92 ? 97   TYR A CB    1 
ATOM   738  C CG    . TYR A 1 97  ? 38.649 -3.447  0.355   1.00 17.99 ? 97   TYR A CG    1 
ATOM   739  C CD1   . TYR A 1 97  ? 39.067 -2.387  -0.426  1.00 19.11 ? 97   TYR A CD1   1 
ATOM   740  C CD2   . TYR A 1 97  ? 38.984 -3.444  1.697   1.00 18.20 ? 97   TYR A CD2   1 
ATOM   741  C CE1   . TYR A 1 97  ? 39.788 -1.340  0.122   1.00 19.25 ? 97   TYR A CE1   1 
ATOM   742  C CE2   . TYR A 1 97  ? 39.709 -2.408  2.246   1.00 20.11 ? 97   TYR A CE2   1 
ATOM   743  C CZ    . TYR A 1 97  ? 40.114 -1.359  1.448   1.00 21.44 ? 97   TYR A CZ    1 
ATOM   744  O OH    . TYR A 1 97  ? 40.842 -0.307  1.979   1.00 22.76 ? 97   TYR A OH    1 
ATOM   745  N N     . LYS A 1 98  ? 37.665 -7.705  -0.266  1.00 19.30 ? 98   LYS A N     1 
ATOM   746  C CA    . LYS A 1 98  ? 36.709 -8.797  -0.337  1.00 19.46 ? 98   LYS A CA    1 
ATOM   747  C C     . LYS A 1 98  ? 35.414 -8.319  0.348   1.00 18.37 ? 98   LYS A C     1 
ATOM   748  O O     . LYS A 1 98  ? 35.468 -7.837  1.499   1.00 18.77 ? 98   LYS A O     1 
ATOM   749  C CB    . LYS A 1 98  ? 37.259 -10.017 0.381   1.00 20.63 ? 98   LYS A CB    1 
ATOM   750  C CG    . LYS A 1 98  ? 36.385 -11.248 0.365   1.00 23.66 ? 98   LYS A CG    1 
ATOM   751  C CD    . LYS A 1 98  ? 37.080 -12.428 1.046   1.00 27.40 ? 98   LYS A CD    1 
ATOM   752  C CE    . LYS A 1 98  ? 37.286 -12.194 2.535   1.00 29.07 ? 98   LYS A CE    1 
ATOM   753  N NZ    . LYS A 1 98  ? 35.997 -12.032 3.262   1.00 30.40 ? 98   LYS A NZ    1 
ATOM   754  N N     . THR A 1 99  ? 34.282 -8.408  -0.358  1.00 16.94 ? 99   THR A N     1 
ATOM   755  C CA    . THR A 1 99  ? 32.976 -7.975  0.141   1.00 16.72 ? 99   THR A CA    1 
ATOM   756  C C     . THR A 1 99  ? 32.205 -9.155  0.724   1.00 16.85 ? 99   THR A C     1 
ATOM   757  O O     . THR A 1 99  ? 31.987 -10.150 0.026   1.00 17.29 ? 99   THR A O     1 
ATOM   758  C CB    . THR A 1 99  ? 32.152 -7.378  -1.025  1.00 17.59 ? 99   THR A CB    1 
ATOM   759  O OG1   . THR A 1 99  ? 32.764 -6.183  -1.524  1.00 18.76 ? 99   THR A OG1   1 
ATOM   760  C CG2   . THR A 1 99  ? 30.782 -6.949  -0.555  1.00 17.18 ? 99   THR A CG2   1 
ATOM   761  N N     . THR A 1 100 ? 31.754 -9.036  1.981   1.00 16.38 ? 100  THR A N     1 
ATOM   762  C CA    . THR A 1 100 ? 30.944 -10.072 2.614   1.00 17.38 ? 100  THR A CA    1 
ATOM   763  C C     . THR A 1 100 ? 29.715 -9.529  3.349   1.00 17.42 ? 100  THR A C     1 
ATOM   764  O O     . THR A 1 100 ? 29.840 -8.870  4.398   1.00 18.50 ? 100  THR A O     1 
ATOM   765  C CB    . THR A 1 100 ? 31.781 -10.830 3.624   1.00 17.55 ? 100  THR A CB    1 
ATOM   766  O OG1   . THR A 1 100 ? 32.938 -11.386 3.000   1.00 18.92 ? 100  THR A OG1   1 
ATOM   767  C CG2   . THR A 1 100 ? 31.020 -12.014 4.185   1.00 20.17 ? 100  THR A CG2   1 
ATOM   768  N N     . GLN A 1 101 ? 28.532 -9.845  2.844   1.00 18.47 ? 101  GLN A N     1 
ATOM   769  C CA    . GLN A 1 101 ? 27.271 -9.423  3.443   1.00 19.17 ? 101  GLN A CA    1 
ATOM   770  C C     . GLN A 1 101 ? 26.963 -10.311 4.643   1.00 19.10 ? 101  GLN A C     1 
ATOM   771  O O     . GLN A 1 101 ? 27.323 -11.482 4.641   1.00 19.24 ? 101  GLN A O     1 
ATOM   772  C CB    . GLN A 1 101 ? 26.137 -9.579  2.423   1.00 20.13 ? 101  GLN A CB    1 
ATOM   773  C CG    . GLN A 1 101 ? 24.751 -9.339  2.982   1.00 23.61 ? 101  GLN A CG    1 
ATOM   774  C CD    . GLN A 1 101 ? 24.571 -7.919  3.448   1.00 25.21 ? 101  GLN A CD    1 
ATOM   775  O OE1   . GLN A 1 101 ? 23.624 -7.595  4.191   1.00 26.07 ? 101  GLN A OE1   1 
ATOM   776  N NE2   . GLN A 1 101 ? 25.470 -7.053  3.014   1.00 25.58 ? 101  GLN A NE2   1 
ATOM   777  N N     . ALA A 1 102 ? 26.275 -9.748  5.640   1.00 18.95 ? 102  ALA A N     1 
ATOM   778  C CA    . ALA A 1 102 ? 25.877 -10.474 6.831   1.00 18.86 ? 102  ALA A CA    1 
ATOM   779  C C     . ALA A 1 102 ? 24.740 -9.764  7.546   1.00 17.42 ? 102  ALA A C     1 
ATOM   780  O O     . ALA A 1 102 ? 24.382 -8.652  7.231   1.00 17.17 ? 102  ALA A O     1 
ATOM   781  C CB    . ALA A 1 102 ? 27.059 -10.629 7.764   1.00 19.60 ? 102  ALA A CB    1 
ATOM   782  N N     . ASN A 1 103 ? 24.119 -10.499 8.470   1.00 17.85 ? 103  ASN A N     1 
ATOM   783  C CA    . ASN A 1 103 ? 23.060 -10.001 9.340   1.00 17.56 ? 103  ASN A CA    1 
ATOM   784  C C     . ASN A 1 103 ? 23.510 -10.365 10.740  1.00 17.33 ? 103  ASN A C     1 
ATOM   785  O O     . ASN A 1 103 ? 23.425 -11.528 11.145  1.00 18.89 ? 103  ASN A O     1 
ATOM   786  C CB    . ASN A 1 103 ? 21.709 -10.647 9.010   1.00 18.75 ? 103  ASN A CB    1 
ATOM   787  C CG    . ASN A 1 103 ? 21.165 -10.163 7.699   1.00 20.72 ? 103  ASN A CG    1 
ATOM   788  O OD1   . ASN A 1 103 ? 20.706 -9.021  7.575   1.00 23.18 ? 103  ASN A OD1   1 
ATOM   789  N ND2   . ASN A 1 103 ? 21.207 -11.021 6.711   1.00 24.99 ? 103  ASN A ND2   1 
ATOM   790  N N     . LYS A 1 104 ? 24.059 -9.376  11.444  1.00 16.19 ? 104  LYS A N     1 
ATOM   791  C CA    . LYS A 1 104 ? 24.623 -9.593  12.765  1.00 15.67 ? 104  LYS A CA    1 
ATOM   792  C C     . LYS A 1 104 ? 24.304 -8.407  13.671  1.00 14.04 ? 104  LYS A C     1 
ATOM   793  O O     . LYS A 1 104 ? 23.823 -7.361  13.254  1.00 14.50 ? 104  LYS A O     1 
ATOM   794  C CB    . LYS A 1 104 ? 26.138 -9.790  12.678  1.00 16.31 ? 104  LYS A CB    1 
ATOM   795  C CG    . LYS A 1 104 ? 26.610 -10.994 11.911  1.00 18.27 ? 104  LYS A CG    1 
ATOM   796  C CD    . LYS A 1 104 ? 28.101 -11.035 11.844  1.00 18.92 ? 104  LYS A CD    1 
ATOM   797  C CE    . LYS A 1 104 ? 28.558 -12.278 11.131  1.00 19.84 ? 104  LYS A CE    1 
ATOM   798  N NZ    . LYS A 1 104 ? 30.031 -12.316 10.993  1.00 20.33 ? 104  LYS A NZ    1 
ATOM   799  N N     . HIS A 1 105 ? 24.566 -8.623  14.966  1.00 13.62 ? 105  HIS A N     1 
ATOM   800  C CA    . HIS A 1 105 ? 24.431 -7.556  15.947  1.00 13.14 ? 105  HIS A CA    1 
ATOM   801  C C     . HIS A 1 105 ? 25.677 -6.682  15.822  1.00 12.62 ? 105  HIS A C     1 
ATOM   802  O O     . HIS A 1 105 ? 26.797 -7.208  15.736  1.00 15.74 ? 105  HIS A O     1 
ATOM   803  C CB    . HIS A 1 105 ? 24.352 -8.119  17.376  1.00 13.49 ? 105  HIS A CB    1 
ATOM   804  C CG    . HIS A 1 105 ? 23.243 -9.118  17.575  1.00 16.02 ? 105  HIS A CG    1 
ATOM   805  N ND1   . HIS A 1 105 ? 21.936 -8.757  17.830  1.00 16.78 ? 105  HIS A ND1   1 
ATOM   806  C CD2   . HIS A 1 105 ? 23.243 -10.467 17.514  1.00 19.07 ? 105  HIS A CD2   1 
ATOM   807  C CE1   . HIS A 1 105 ? 21.179 -9.836  17.921  1.00 18.30 ? 105  HIS A CE1   1 
ATOM   808  N NE2   . HIS A 1 105 ? 21.949 -10.889 17.743  1.00 19.55 ? 105  HIS A NE2   1 
ATOM   809  N N     . ILE A 1 106 ? 25.478 -5.386  15.804  1.00 11.66 ? 106  ILE A N     1 
ATOM   810  C CA    . ILE A 1 106 ? 26.623 -4.480  15.732  1.00 11.07 ? 106  ILE A CA    1 
ATOM   811  C C     . ILE A 1 106 ? 27.006 -3.961  17.115  1.00 10.02 ? 106  ILE A C     1 
ATOM   812  O O     . ILE A 1 106 ? 26.164 -3.901  18.004  1.00 10.25 ? 106  ILE A O     1 
ATOM   813  C CB    . ILE A 1 106 ? 26.357 -3.280  14.777  1.00 11.36 ? 106  ILE A CB    1 
ATOM   814  C CG1   . ILE A 1 106 ? 25.283 -2.326  15.314  1.00 11.72 ? 106  ILE A CG1   1 
ATOM   815  C CG2   . ILE A 1 106 ? 26.020 -3.765  13.380  1.00 12.71 ? 106  ILE A CG2   1 
ATOM   816  C CD1   . ILE A 1 106 ? 25.171 -1.030  14.533  1.00 12.81 ? 106  ILE A CD1   1 
ATOM   817  N N     . ILE A 1 107 ? 28.285 -3.628  17.272  1.00 9.18  ? 107  ILE A N     1 
ATOM   818  C CA    . ILE A 1 107 ? 28.804 -3.018  18.501  1.00 8.92  ? 107  ILE A CA    1 
ATOM   819  C C     . ILE A 1 107 ? 29.460 -1.701  18.112  1.00 8.30  ? 107  ILE A C     1 
ATOM   820  O O     . ILE A 1 107 ? 30.403 -1.700  17.301  1.00 8.94  ? 107  ILE A O     1 
ATOM   821  C CB    . ILE A 1 107 ? 29.792 -3.916  19.270  1.00 9.20  ? 107  ILE A CB    1 
ATOM   822  C CG1   . ILE A 1 107 ? 29.138 -5.251  19.640  1.00 9.19  ? 107  ILE A CG1   1 
ATOM   823  C CG2   . ILE A 1 107 ? 30.319 -3.174  20.524  1.00 9.12  ? 107  ILE A CG2   1 
ATOM   824  C CD1   . ILE A 1 107 ? 30.082 -6.247  20.226  1.00 11.01 ? 107  ILE A CD1   1 
ATOM   825  N N     . VAL A 1 108 ? 28.928 -0.595  18.610  1.00 8.85  ? 108  VAL A N     1 
ATOM   826  C CA    . VAL A 1 108 ? 29.435 0.721   18.316  1.00 8.60  ? 108  VAL A CA    1 
ATOM   827  C C     . VAL A 1 108 ? 29.862 1.420   19.590  1.00 8.30  ? 108  VAL A C     1 
ATOM   828  O O     . VAL A 1 108 ? 29.313 1.164   20.653  1.00 9.50  ? 108  VAL A O     1 
ATOM   829  C CB    . VAL A 1 108 ? 28.397 1.598   17.562  1.00 9.61  ? 108  VAL A CB    1 
ATOM   830  C CG1   . VAL A 1 108 ? 28.111 0.969   16.210  1.00 10.76 ? 108  VAL A CG1   1 
ATOM   831  C CG2   . VAL A 1 108 ? 27.131 1.801   18.369  1.00 10.36 ? 108  VAL A CG2   1 
ATOM   832  N N     . ALA A 1 109 ? 30.831 2.316   19.470  1.00 8.02  ? 109  ALA A N     1 
ATOM   833  C CA    . ALA A 1 109 ? 31.198 3.187   20.577  1.00 8.99  ? 109  ALA A CA    1 
ATOM   834  C C     . ALA A 1 109 ? 30.435 4.490   20.434  1.00 8.45  ? 109  ALA A C     1 
ATOM   835  O O     . ALA A 1 109 ? 30.384 5.026   19.320  1.00 9.51  ? 109  ALA A O     1 
ATOM   836  C CB    . ALA A 1 109 ? 32.706 3.474   20.580  1.00 9.34  ? 109  ALA A CB    1 
ATOM   837  N N     . CYS A 1 110 ? 29.902 5.036   21.526  1.00 8.39  ? 110  CYS A N     1 
ATOM   838  C CA    . CYS A 1 110 ? 29.144 6.280   21.491  1.00 9.00  ? 110  CYS A CA    1 
ATOM   839  C C     . CYS A 1 110 ? 29.772 7.337   22.386  1.00 9.69  ? 110  CYS A C     1 
ATOM   840  O O     . CYS A 1 110 ? 30.319 7.043   23.447  1.00 9.52  ? 110  CYS A O     1 
ATOM   841  C CB    . CYS A 1 110 ? 27.693 6.027   21.914  1.00 10.81 ? 110  CYS A CB    1 
ATOM   842  S SG    . CYS A 1 110 ? 26.862 4.803   20.869  1.00 11.13 ? 110  CYS A SG    1 
ATOM   843  N N     . GLU A 1 111 ? 29.663 8.593   21.954  1.00 10.19 ? 111  GLU A N     1 
ATOM   844  C CA    . GLU A 1 111 ? 30.196 9.741   22.683  1.00 10.35 ? 111  GLU A CA    1 
ATOM   845  C C     . GLU A 1 111 ? 29.371 10.993  22.400  1.00 10.49 ? 111  GLU A C     1 
ATOM   846  O O     . GLU A 1 111 ? 28.651 11.063  21.408  1.00 11.68 ? 111  GLU A O     1 
ATOM   847  C CB    . GLU A 1 111 ? 31.654 10.050  22.295  1.00 9.55  ? 111  GLU A CB    1 
ATOM   848  C CG    . GLU A 1 111 ? 32.652 8.977   22.732  1.00 10.82 ? 111  GLU A CG    1 
ATOM   849  C CD    . GLU A 1 111 ? 34.081 9.363   22.538  1.00 13.29 ? 111  GLU A CD    1 
ATOM   850  O OE1   . GLU A 1 111 ? 34.911 8.972   23.381  1.00 19.00 ? 111  GLU A OE1   1 
ATOM   851  O OE2   . GLU A 1 111 ? 34.414 9.939   21.492  1.00 15.79 ? 111  GLU A OE2   1 
ATOM   852  N N     . GLY A 1 112 ? 29.543 11.984  23.275  1.00 11.36 ? 112  GLY A N     1 
ATOM   853  C CA    . GLY A 1 112 ? 28.992 13.311  23.043  1.00 12.21 ? 112  GLY A CA    1 
ATOM   854  C C     . GLY A 1 112 ? 27.611 13.599  23.588  1.00 14.37 ? 112  GLY A C     1 
ATOM   855  O O     . GLY A 1 112 ? 26.990 12.785  24.249  1.00 12.97 ? 112  GLY A O     1 
ATOM   856  N N     . ASN A 1 113 ? 27.111 14.783  23.238  1.00 16.32 ? 113  ASN A N     1 
ATOM   857  C CA    . ASN A 1 113 ? 25.764 15.237  23.558  1.00 18.45 ? 113  ASN A CA    1 
ATOM   858  C C     . ASN A 1 113 ? 25.262 15.978  22.306  1.00 18.48 ? 113  ASN A C     1 
ATOM   859  O O     . ASN A 1 113 ? 25.722 17.105  22.057  1.00 20.50 ? 113  ASN A O     1 
ATOM   860  C CB    . ASN A 1 113 ? 25.771 16.158  24.769  1.00 19.92 ? 113  ASN A CB    1 
ATOM   861  C CG    . ASN A 1 113 ? 24.393 16.389  25.316  1.00 23.02 ? 113  ASN A CG    1 
ATOM   862  O OD1   . ASN A 1 113 ? 23.433 16.387  24.567  1.00 25.27 ? 113  ASN A OD1   1 
ATOM   863  N ND2   . ASN A 1 113 ? 24.285 16.532  26.635  1.00 27.44 ? 113  ASN A ND2   1 
ATOM   864  N N     . PRO A 1 114 ? 24.363 15.381  21.518  1.00 19.21 ? 114  PRO A N     1 
ATOM   865  C CA    . PRO A 1 114 ? 23.721 14.098  21.798  1.00 18.54 ? 114  PRO A CA    1 
ATOM   866  C C     . PRO A 1 114 ? 24.714 12.931  21.778  1.00 16.84 ? 114  PRO A C     1 
ATOM   867  O O     . PRO A 1 114 ? 25.806 13.009  21.189  1.00 16.88 ? 114  PRO A O     1 
ATOM   868  C CB    . PRO A 1 114 ? 22.715 13.970  20.636  1.00 19.64 ? 114  PRO A CB    1 
ATOM   869  C CG    . PRO A 1 114 ? 23.378 14.698  19.535  1.00 20.21 ? 114  PRO A CG    1 
ATOM   870  C CD    . PRO A 1 114 ? 23.902 15.908  20.217  1.00 19.66 ? 114  PRO A CD    1 
ATOM   871  N N     . TYR A 1 115 ? 24.332 11.869  22.462  1.00 15.01 ? 115  TYR A N     1 
ATOM   872  C CA    . TYR A 1 115 ? 25.148 10.658  22.579  1.00 13.16 ? 115  TYR A CA    1 
ATOM   873  C C     . TYR A 1 115 ? 24.905 9.842   21.341  1.00 12.52 ? 115  TYR A C     1 
ATOM   874  O O     . TYR A 1 115 ? 23.835 9.252   21.182  1.00 13.89 ? 115  TYR A O     1 
ATOM   875  C CB    . TYR A 1 115 ? 24.706 9.868   23.790  1.00 14.13 ? 115  TYR A CB    1 
ATOM   876  C CG    . TYR A 1 115 ? 25.704 8.859   24.346  1.00 11.74 ? 115  TYR A CG    1 
ATOM   877  C CD1   . TYR A 1 115 ? 26.977 9.244   24.720  1.00 11.52 ? 115  TYR A CD1   1 
ATOM   878  C CD2   . TYR A 1 115 ? 25.320 7.547   24.557  1.00 11.71 ? 115  TYR A CD2   1 
ATOM   879  C CE1   . TYR A 1 115 ? 27.852 8.333   25.283  1.00 11.25 ? 115  TYR A CE1   1 
ATOM   880  C CE2   . TYR A 1 115 ? 26.201 6.639   25.124  1.00 11.43 ? 115  TYR A CE2   1 
ATOM   881  C CZ    . TYR A 1 115 ? 27.458 7.050   25.498  1.00 11.53 ? 115  TYR A CZ    1 
ATOM   882  O OH    . TYR A 1 115 ? 28.337 6.187   26.119  1.00 11.64 ? 115  TYR A OH    1 
ATOM   883  N N     . VAL A 1 116 ? 25.903 9.800   20.446  1.00 11.42 ? 116  VAL A N     1 
ATOM   884  C CA    . VAL A 1 116 ? 25.758 9.177   19.135  1.00 12.29 ? 116  VAL A CA    1 
ATOM   885  C C     . VAL A 1 116 ? 26.947 8.271   18.787  1.00 11.70 ? 116  VAL A C     1 
ATOM   886  O O     . VAL A 1 116 ? 27.992 8.368   19.413  1.00 10.90 ? 116  VAL A O     1 
ATOM   887  C CB    . VAL A 1 116 ? 25.549 10.236  18.010  1.00 13.26 ? 116  VAL A CB    1 
ATOM   888  C CG1   . VAL A 1 116 ? 24.219 10.953  18.197  1.00 14.04 ? 116  VAL A CG1   1 
ATOM   889  C CG2   . VAL A 1 116 ? 26.679 11.210  18.011  1.00 13.30 ? 116  VAL A CG2   1 
ATOM   890  N N     . PRO A 1 117 ? 26.785 7.411   17.784  1.00 11.56 ? 117  PRO A N     1 
ATOM   891  C CA    . PRO A 1 117 ? 27.901 6.541   17.381  1.00 10.60 ? 117  PRO A CA    1 
ATOM   892  C C     . PRO A 1 117 ? 29.077 7.314   16.834  1.00 10.26 ? 117  PRO A C     1 
ATOM   893  O O     . PRO A 1 117 ? 28.867 8.195   15.984  1.00 11.16 ? 117  PRO A O     1 
ATOM   894  C CB    . PRO A 1 117 ? 27.277 5.611   16.338  1.00 11.04 ? 117  PRO A CB    1 
ATOM   895  C CG    . PRO A 1 117 ? 25.787 5.690   16.605  1.00 11.98 ? 117  PRO A CG    1 
ATOM   896  C CD    . PRO A 1 117 ? 25.555 7.115   17.033  1.00 12.37 ? 117  PRO A CD    1 
ATOM   897  N N     . VAL A 1 118 ? 30.282 6.982   17.291  1.00 9.72  ? 118  VAL A N     1 
ATOM   898  C CA    . VAL A 1 118 ? 31.494 7.600   16.795  1.00 9.73  ? 118  VAL A CA    1 
ATOM   899  C C     . VAL A 1 118 ? 32.554 6.592   16.331  1.00 8.99  ? 118  VAL A C     1 
ATOM   900  O O     . VAL A 1 118 ? 33.500 6.978   15.647  1.00 10.14 ? 118  VAL A O     1 
ATOM   901  C CB    . VAL A 1 118 ? 32.094 8.604   17.814  1.00 10.01 ? 118  VAL A CB    1 
ATOM   902  C CG1   . VAL A 1 118 ? 31.183 9.774   18.044  1.00 10.38 ? 118  VAL A CG1   1 
ATOM   903  C CG2   . VAL A 1 118 ? 32.400 7.885   19.131  1.00 10.38 ? 118  VAL A CG2   1 
ATOM   904  N N     . HIS A 1 119 ? 32.409 5.300   16.652  1.00 9.07  ? 119  HIS A N     1 
ATOM   905  C CA    . HIS A 1 119 ? 33.339 4.288   16.136  1.00 8.49  ? 119  HIS A CA    1 
ATOM   906  C C     . HIS A 1 119 ? 32.573 2.994   15.978  1.00 9.06  ? 119  HIS A C     1 
ATOM   907  O O     . HIS A 1 119 ? 31.622 2.716   16.742  1.00 10.11 ? 119  HIS A O     1 
ATOM   908  C CB    . HIS A 1 119 ? 34.524 4.002   17.051  1.00 10.13 ? 119  HIS A CB    1 
ATOM   909  C CG    . HIS A 1 119 ? 35.319 5.210   17.404  1.00 11.58 ? 119  HIS A CG    1 
ATOM   910  N ND1   . HIS A 1 119 ? 36.105 5.885   16.489  1.00 13.60 ? 119  HIS A ND1   1 
ATOM   911  C CD2   . HIS A 1 119 ? 35.447 5.874   18.574  1.00 12.09 ? 119  HIS A CD2   1 
ATOM   912  C CE1   . HIS A 1 119 ? 36.662 6.925   17.084  1.00 13.56 ? 119  HIS A CE1   1 
ATOM   913  N NE2   . HIS A 1 119 ? 36.291 6.933   18.350  1.00 14.27 ? 119  HIS A NE2   1 
ATOM   914  N N     . PHE A 1 120 ? 32.961 2.176   15.009  1.00 8.92  ? 120  PHE A N     1 
ATOM   915  C CA    . PHE A 1 120 ? 32.407 0.855   14.822  1.00 9.32  ? 120  PHE A CA    1 
ATOM   916  C C     . PHE A 1 120 ? 33.376 -0.146  15.409  1.00 9.25  ? 120  PHE A C     1 
ATOM   917  O O     . PHE A 1 120 ? 34.526 -0.249  14.978  1.00 10.83 ? 120  PHE A O     1 
ATOM   918  C CB    . PHE A 1 120 ? 32.175 0.535   13.324  1.00 9.23  ? 120  PHE A CB    1 
ATOM   919  C CG    . PHE A 1 120 ? 31.359 -0.706  13.102  1.00 10.07 ? 120  PHE A CG    1 
ATOM   920  C CD1   . PHE A 1 120 ? 29.987 -0.626  12.914  1.00 11.46 ? 120  PHE A CD1   1 
ATOM   921  C CD2   . PHE A 1 120 ? 31.939 -1.950  13.128  1.00 10.67 ? 120  PHE A CD2   1 
ATOM   922  C CE1   . PHE A 1 120 ? 29.213 -1.764  12.771  1.00 12.63 ? 120  PHE A CE1   1 
ATOM   923  C CE2   . PHE A 1 120 ? 31.170 -3.104  12.986  1.00 11.30 ? 120  PHE A CE2   1 
ATOM   924  C CZ    . PHE A 1 120 ? 29.819 -2.980  12.803  1.00 11.44 ? 120  PHE A CZ    1 
ATOM   925  N N     . ASP A 1 121 ? 32.937 -0.849  16.448  1.00 8.94  ? 121  ASP A N     1 
ATOM   926  C CA    . ASP A 1 121 ? 33.854 -1.729  17.177  1.00 9.29  ? 121  ASP A CA    1 
ATOM   927  C C     . ASP A 1 121 ? 33.887 -3.160  16.680  1.00 10.09 ? 121  ASP A C     1 
ATOM   928  O O     . ASP A 1 121 ? 34.984 -3.737  16.552  1.00 12.08 ? 121  ASP A O     1 
ATOM   929  C CB    . ASP A 1 121 ? 33.525 -1.739  18.660  1.00 9.38  ? 121  ASP A CB    1 
ATOM   930  C CG    . ASP A 1 121 ? 34.723 -2.088  19.540  1.00 9.37  ? 121  ASP A CG    1 
ATOM   931  O OD1   . ASP A 1 121 ? 35.803 -1.494  19.300  1.00 10.44 ? 121  ASP A OD1   1 
ATOM   932  O OD2   . ASP A 1 121 ? 34.628 -2.883  20.497  1.00 10.13 ? 121  ASP A OD2   1 
ATOM   933  N N     . ALA A 1 122 ? 32.724 -3.740  16.392  1.00 10.62 ? 122  ALA A N     1 
ATOM   934  C CA    . ALA A 1 122 ? 32.666 -5.144  16.012  1.00 12.04 ? 122  ALA A CA    1 
ATOM   935  C C     . ALA A 1 122 ? 31.255 -5.527  15.589  1.00 11.58 ? 122  ALA A C     1 
ATOM   936  O O     . ALA A 1 122 ? 30.301 -4.799  15.833  1.00 11.21 ? 122  ALA A O     1 
ATOM   937  C CB    . ALA A 1 122 ? 33.084 -6.019  17.173  1.00 13.82 ? 122  ALA A CB    1 
ATOM   938  N N     . SER A 1 123 ? 31.137 -6.720  15.009  1.00 13.77 ? 123  SER A N     1 
ATOM   939  C CA    . SER A 1 123 ? 29.846 -7.323  14.730  1.00 15.38 ? 123  SER A CA    1 
ATOM   940  C C     . SER A 1 123 ? 29.888 -8.706  15.345  1.00 15.62 ? 123  SER A C     1 
ATOM   941  O O     . SER A 1 123 ? 30.907 -9.363  15.300  1.00 15.82 ? 123  SER A O     1 
ATOM   942  C CB    . SER A 1 123 ? 29.617 -7.424  13.226  1.00 16.64 ? 123  SER A CB    1 
ATOM   943  O OG    . SER A 1 123 ? 30.530 -8.339  12.642  1.00 21.24 ? 123  SER A OG    1 
ATOM   944  N N     . VAL A 1 124 ? 28.787 -9.147  15.913  1.00 15.28 ? 124  VAL A N     1 
ATOM   945  C CA    . VAL A 1 124 ? 28.754 -10.478 16.519  1.00 16.60 ? 124  VAL A CA    1 
ATOM   946  C C     . VAL A 1 124 ? 27.459 -11.222 16.197  1.00 16.17 ? 124  VAL A C     1 
ATOM   947  O O     . VAL A 1 124 ? 26.548 -10.672 15.592  1.00 17.56 ? 124  VAL A O     1 
ATOM   948  C CB    . VAL A 1 124 ? 28.917 -10.402 18.062  1.00 17.05 ? 124  VAL A CB    1 
ATOM   949  C CG1   . VAL A 1 124 ? 30.241 -9.766  18.422  1.00 18.54 ? 124  VAL A CG1   1 
ATOM   950  C CG2   . VAL A 1 124 ? 27.775 -9.633  18.706  1.00 18.12 ? 124  VAL A CG2   1 
ATOM   951  O OXT   . VAL A 1 124 ? 27.340 -12.395 16.586  1.00 18.85 ? 124  VAL A OXT   1 
ATOM   952  N N     . LYS B 1 1   ? 21.651 -17.337 30.205  1.00 23.63 ? 1    LYS B N     1 
ATOM   953  C CA    . LYS B 1 1   ? 20.452 -16.580 29.753  1.00 22.86 ? 1    LYS B CA    1 
ATOM   954  C C     . LYS B 1 1   ? 20.548 -15.119 30.169  1.00 20.84 ? 1    LYS B C     1 
ATOM   955  O O     . LYS B 1 1   ? 21.310 -14.786 31.064  1.00 21.09 ? 1    LYS B O     1 
ATOM   956  C CB    . LYS B 1 1   ? 19.185 -17.205 30.333  1.00 23.82 ? 1    LYS B CB    1 
ATOM   957  C CG    . LYS B 1 1   ? 19.010 -17.033 31.842  1.00 25.16 ? 1    LYS B CG    1 
ATOM   958  C CD    . LYS B 1 1   ? 17.681 -17.580 32.335  1.00 27.29 ? 1    LYS B CD    1 
ATOM   959  C CE    . LYS B 1 1   ? 17.485 -17.291 33.824  1.00 27.15 ? 1    LYS B CE    1 
ATOM   960  N NZ    . LYS B 1 1   ? 16.179 -17.746 34.404  1.00 26.59 ? 1    LYS B NZ    1 
ATOM   961  N N     . GLU B 1 2   ? 19.846 -14.244 29.447  1.00 18.18 ? 2    GLU B N     1 
ATOM   962  C CA    . GLU B 1 2   ? 19.720 -12.839 29.810  1.00 15.94 ? 2    GLU B CA    1 
ATOM   963  C C     . GLU B 1 2   ? 19.370 -12.686 31.285  1.00 15.06 ? 2    GLU B C     1 
ATOM   964  O O     . GLU B 1 2   ? 18.436 -13.309 31.767  1.00 16.66 ? 2    GLU B O     1 
ATOM   965  C CB    . GLU B 1 2   ? 18.642 -12.203 28.934  1.00 14.91 ? 2    GLU B CB    1 
ATOM   966  C CG    . GLU B 1 2   ? 18.466 -10.707 29.156  1.00 13.34 ? 2    GLU B CG    1 
ATOM   967  C CD    . GLU B 1 2   ? 17.389 -10.103 28.284  1.00 12.64 ? 2    GLU B CD    1 
ATOM   968  O OE1   . GLU B 1 2   ? 16.310 -10.720 28.154  1.00 14.34 ? 2    GLU B OE1   1 
ATOM   969  O OE2   . GLU B 1 2   ? 17.608 -9.006  27.751  1.00 13.46 ? 2    GLU B OE2   1 
ATOM   970  N N     . THR B 1 3   ? 20.106 -11.842 32.004  1.00 15.27 ? 3    THR B N     1 
ATOM   971  C CA    . THR B 1 3   ? 19.800 -11.591 33.409  1.00 15.05 ? 3    THR B CA    1 
ATOM   972  C C     . THR B 1 3   ? 18.556 -10.695 33.526  1.00 14.79 ? 3    THR B C     1 
ATOM   973  O O     . THR B 1 3   ? 18.192 -9.974  32.580  1.00 13.20 ? 3    THR B O     1 
ATOM   974  C CB    . THR B 1 3   ? 20.935 -10.889 34.120  1.00 16.04 ? 3    THR B CB    1 
ATOM   975  O OG1   . THR B 1 3   ? 21.050 -9.541  33.627  1.00 15.62 ? 3    THR B OG1   1 
ATOM   976  C CG2   . THR B 1 3   ? 22.301 -11.579 33.884  1.00 17.25 ? 3    THR B CG2   1 
ATOM   977  N N     . ALA B 1 4   ? 17.905 -10.731 34.685  1.00 14.55 ? 4    ALA B N     1 
ATOM   978  C CA    . ALA B 1 4   ? 16.726 -9.903  34.910  1.00 13.18 ? 4    ALA B CA    1 
ATOM   979  C C     . ALA B 1 4   ? 17.072 -8.424  34.823  1.00 11.60 ? 4    ALA B C     1 
ATOM   980  O O     . ALA B 1 4   ? 16.289 -7.633  34.329  1.00 11.32 ? 4    ALA B O     1 
ATOM   981  C CB    . ALA B 1 4   ? 16.095 -10.250 36.267  1.00 14.23 ? 4    ALA B CB    1 
ATOM   982  N N     . ALA B 1 5   ? 18.249 -8.072  35.306  1.00 11.07 ? 5    ALA B N     1 
ATOM   983  C CA    . ALA B 1 5   ? 18.667 -6.680  35.240  1.00 10.69 ? 5    ALA B CA    1 
ATOM   984  C C     . ALA B 1 5   ? 18.833 -6.255  33.776  1.00 9.19  ? 5    ALA B C     1 
ATOM   985  O O     . ALA B 1 5   ? 18.465 -5.117  33.391  1.00 9.40  ? 5    ALA B O     1 
ATOM   986  C CB    . ALA B 1 5   ? 19.990 -6.520  35.962  1.00 11.50 ? 5    ALA B CB    1 
ATOM   987  N N     . ALA B 1 6   ? 19.463 -7.118  32.977  1.00 9.41  ? 6    ALA B N     1 
ATOM   988  C CA    . ALA B 1 6   ? 19.657 -6.802  31.564  1.00 9.96  ? 6    ALA B CA    1 
ATOM   989  C C     . ALA B 1 6   ? 18.332 -6.733  30.824  1.00 9.52  ? 6    ALA B C     1 
ATOM   990  O O     . ALA B 1 6   ? 18.158 -5.902  29.929  1.00 9.53  ? 6    ALA B O     1 
ATOM   991  C CB    . ALA B 1 6   ? 20.592 -7.810  30.924  1.00 10.52 ? 6    ALA B CB    1 
ATOM   992  N N     . LYS B 1 7   ? 17.408 -7.622  31.159  1.00 9.97  ? 7    LYS B N     1 
ATOM   993  C CA    . LYS B 1 7   ? 16.077 -7.570  30.568  1.00 9.68  ? 7    LYS B CA    1 
ATOM   994  C C     . LYS B 1 7   ? 15.367 -6.257  30.916  1.00 9.30  ? 7    LYS B C     1 
ATOM   995  O O     . LYS B 1 7   ? 14.692 -5.683  30.081  1.00 9.84  ? 7    LYS B O     1 
ATOM   996  C CB    . LYS B 1 7   ? 15.270 -8.784  31.034  1.00 11.78 ? 7    LYS B CB    1 
ATOM   997  C CG    . LYS B 1 7   ? 13.894 -8.833  30.447  1.00 13.01 ? 7    LYS B CG    1 
ATOM   998  C CD    . LYS B 1 7   ? 13.154 -10.114 30.839  1.00 17.53 ? 7    LYS B CD    1 
ATOM   999  C CE    . LYS B 1 7   ? 11.746 -10.160 30.282  1.00 20.67 ? 7    LYS B CE    1 
ATOM   1000 N NZ    . LYS B 1 7   ? 11.027 -11.405 30.670  1.00 23.05 ? 7    LYS B NZ    1 
ATOM   1001 N N     . PHE B 1 8   ? 15.530 -5.785  32.161  1.00 9.19  ? 8    PHE B N     1 
ATOM   1002 C CA    . PHE B 1 8   ? 14.951 -4.515  32.522  1.00 8.70  ? 8    PHE B CA    1 
ATOM   1003 C C     . PHE B 1 8   ? 15.518 -3.386  31.650  1.00 8.98  ? 8    PHE B C     1 
ATOM   1004 O O     . PHE B 1 8   ? 14.767 -2.532  31.190  1.00 8.97  ? 8    PHE B O     1 
ATOM   1005 C CB    . PHE B 1 8   ? 15.191 -4.212  34.014  1.00 8.95  ? 8    PHE B CB    1 
ATOM   1006 C CG    . PHE B 1 8   ? 14.632 -2.883  34.442  1.00 8.49  ? 8    PHE B CG    1 
ATOM   1007 C CD1   . PHE B 1 8   ? 13.364 -2.773  34.967  1.00 9.23  ? 8    PHE B CD1   1 
ATOM   1008 C CD2   . PHE B 1 8   ? 15.389 -1.721  34.321  1.00 9.35  ? 8    PHE B CD2   1 
ATOM   1009 C CE1   . PHE B 1 8   ? 12.863 -1.535  35.305  1.00 9.92  ? 8    PHE B CE1   1 
ATOM   1010 C CE2   . PHE B 1 8   ? 14.864 -0.468  34.656  1.00 10.35 ? 8    PHE B CE2   1 
ATOM   1011 C CZ    . PHE B 1 8   ? 13.622 -0.386  35.133  1.00 9.70  ? 8    PHE B CZ    1 
ATOM   1012 N N     . GLU B 1 9   ? 16.823 -3.367  31.416  1.00 8.66  ? 9    GLU B N     1 
ATOM   1013 C CA    . GLU B 1 9   ? 17.417 -2.332  30.582  1.00 8.38  ? 9    GLU B CA    1 
ATOM   1014 C C     . GLU B 1 9   ? 16.912 -2.431  29.137  1.00 9.05  ? 9    GLU B C     1 
ATOM   1015 O O     . GLU B 1 9   ? 16.564 -1.418  28.543  1.00 9.12  ? 9    GLU B O     1 
ATOM   1016 C CB    . GLU B 1 9   ? 18.928 -2.372  30.633  1.00 9.70  ? 9    GLU B CB    1 
ATOM   1017 C CG    . GLU B 1 9   ? 19.484 -1.966  31.987  1.00 9.85  ? 9    GLU B CG    1 
ATOM   1018 C CD    . GLU B 1 9   ? 20.970 -1.654  31.944  1.00 13.74 ? 9    GLU B CD    1 
ATOM   1019 O OE1   . GLU B 1 9   ? 21.427 -0.992  30.980  1.00 16.54 ? 9    GLU B OE1   1 
ATOM   1020 O OE2   . GLU B 1 9   ? 21.702 -2.043  32.894  1.00 12.69 ? 9    GLU B OE2   1 
ATOM   1021 N N     . ARG B 1 10  ? 16.800 -3.636  28.608  1.00 8.89  ? 10   ARG B N     1 
ATOM   1022 C CA    . ARG B 1 10  ? 16.331 -3.835  27.252  1.00 9.53  ? 10   ARG B CA    1 
ATOM   1023 C C     . ARG B 1 10  ? 14.883 -3.407  27.101  1.00 9.90  ? 10   ARG B C     1 
ATOM   1024 O O     . ARG B 1 10  ? 14.511 -2.758  26.112  1.00 9.96  ? 10   ARG B O     1 
ATOM   1025 C CB    . ARG B 1 10  ? 16.479 -5.301  26.845  1.00 9.59  ? 10   ARG B CB    1 
ATOM   1026 C CG    . ARG B 1 10  ? 15.892 -5.619  25.480  1.00 9.98  ? 10   ARG B CG    1 
ATOM   1027 C CD    . ARG B 1 10  ? 16.172 -7.061  24.986  1.00 10.68 ? 10   ARG B CD    1 
ATOM   1028 N NE    . ARG B 1 10  ? 15.692 -8.098  25.883  1.00 11.22 ? 10   ARG B NE    1 
ATOM   1029 C CZ    . ARG B 1 10  ? 14.464 -8.594  25.844  1.00 12.72 ? 10   ARG B CZ    1 
ATOM   1030 N NH1   . ARG B 1 10  ? 13.555 -8.109  25.003  1.00 12.54 ? 10   ARG B NH1   1 
ATOM   1031 N NH2   . ARG B 1 10  ? 14.142 -9.544  26.701  1.00 12.50 ? 10   ARG B NH2   1 
ATOM   1032 N N     . GLN B 1 11  ? 14.035 -3.783  28.056  1.00 9.72  ? 11   GLN B N     1 
ATOM   1033 C CA    . GLN B 1 11  ? 12.621 -3.476  27.949  1.00 10.71 ? 11   GLN B CA    1 
ATOM   1034 C C     . GLN B 1 11  ? 12.250 -2.054  28.354  1.00 11.45 ? 11   GLN B C     1 
ATOM   1035 O O     . GLN B 1 11  ? 11.251 -1.527  27.851  1.00 13.49 ? 11   GLN B O     1 
ATOM   1036 C CB    . GLN B 1 11  ? 11.778 -4.465  28.790  1.00 11.75 ? 11   GLN B CB    1 
ATOM   1037 C CG    . GLN B 1 11  ? 11.887 -5.885  28.402  1.00 13.54 ? 11   GLN B CG    1 
ATOM   1038 C CD    . GLN B 1 11  ? 10.794 -6.680  29.062  1.00 15.83 ? 11   GLN B CD    1 
ATOM   1039 O OE1   . GLN B 1 11  ? 9.958  -7.257  28.381  1.00 20.07 ? 11   GLN B OE1   1 
ATOM   1040 N NE2   . GLN B 1 11  ? 10.733 -6.644  30.382  1.00 15.68 ? 11   GLN B NE2   1 
ATOM   1041 N N     . HIS B 1 12  ? 12.999 -1.447  29.277  1.00 10.74 ? 12   HIS B N     1 
ATOM   1042 C CA    . HIS B 1 12  ? 12.511 -0.235  29.930  1.00 11.44 ? 12   HIS B CA    1 
ATOM   1043 C C     . HIS B 1 12  ? 13.418 0.966   29.913  1.00 11.30 ? 12   HIS B C     1 
ATOM   1044 O O     . HIS B 1 12  ? 12.954 2.026   30.321  1.00 13.75 ? 12   HIS B O     1 
ATOM   1045 C CB    . HIS B 1 12  ? 12.104 -0.511  31.377  1.00 11.20 ? 12   HIS B CB    1 
ATOM   1046 C CG    . HIS B 1 12  ? 11.070 -1.570  31.494  1.00 11.86 ? 12   HIS B CG    1 
ATOM   1047 N ND1   . HIS B 1 12  ? 9.806  -1.422  30.978  1.00 11.52 ? 12   HIS B ND1   1 
ATOM   1048 C CD2   . HIS B 1 12  ? 11.110 -2.794  32.054  1.00 11.99 ? 12   HIS B CD2   1 
ATOM   1049 C CE1   . HIS B 1 12  ? 9.107  -2.509  31.225  1.00 12.39 ? 12   HIS B CE1   1 
ATOM   1050 N NE2   . HIS B 1 12  ? 9.881  -3.361  31.865  1.00 11.92 ? 12   HIS B NE2   1 
ATOM   1051 N N     . MET B 1 13  ? 14.680 0.849   29.504  1.00 11.71 ? 13   MET B N     1 
ATOM   1052 C CA    . MET B 1 13  ? 15.565 2.004   29.524  1.00 11.73 ? 13   MET B CA    1 
ATOM   1053 C C     . MET B 1 13  ? 15.802 2.586   28.132  1.00 13.05 ? 13   MET B C     1 
ATOM   1054 O O     . MET B 1 13  ? 16.184 1.880   27.191  1.00 13.90 ? 13   MET B O     1 
ATOM   1055 C CB    . MET B 1 13  ? 16.922 1.648   30.109  1.00 11.51 ? 13   MET B CB    1 
ATOM   1056 C CG    . MET B 1 13  ? 16.894 1.351   31.587  1.00 11.06 ? 13   MET B CG    1 
ATOM   1057 S SD    . MET B 1 13  ? 16.385 2.761   32.646  1.00 11.84 ? 13   MET B SD    1 
ATOM   1058 C CE    . MET B 1 13  ? 17.577 4.067   32.150  1.00 13.25 ? 13   MET B CE    1 
ATOM   1059 N N     . ASP B 1 14  ? 15.615 3.894   28.029  1.00 13.93 ? 14   ASP B N     1 
ATOM   1060 C CA    . ASP B 1 14  ? 15.992 4.608   26.807  1.00 15.19 ? 14   ASP B CA    1 
ATOM   1061 C C     . ASP B 1 14  ? 16.393 5.990   27.236  1.00 16.29 ? 14   ASP B C     1 
ATOM   1062 O O     . ASP B 1 14  ? 15.601 6.945   27.163  1.00 15.96 ? 14   ASP B O     1 
ATOM   1063 C CB    . ASP B 1 14  ? 14.869 4.689   25.787  1.00 16.19 ? 14   ASP B CB    1 
ATOM   1064 C CG    . ASP B 1 14  ? 15.289 5.398   24.514  1.00 17.38 ? 14   ASP B CG    1 
ATOM   1065 O OD1   . ASP B 1 14  ? 16.508 5.512   24.270  1.00 18.48 ? 14   ASP B OD1   1 
ATOM   1066 O OD2   . ASP B 1 14  ? 14.447 5.859   23.712  1.00 19.62 ? 14   ASP B OD2   1 
ATOM   1067 N N     . SER B 1 15  ? 17.630 6.068   27.721  1.00 18.47 ? 15   SER B N     1 
ATOM   1068 C CA    . SER B 1 15  ? 18.232 7.291   28.272  1.00 21.58 ? 15   SER B CA    1 
ATOM   1069 C C     . SER B 1 15  ? 18.853 8.212   27.249  1.00 25.21 ? 15   SER B C     1 
ATOM   1070 O O     . SER B 1 15  ? 19.987 8.677   27.434  1.00 26.94 ? 15   SER B O     1 
ATOM   1071 C CB    . SER B 1 15  ? 19.375 6.954   29.234  1.00 21.19 ? 15   SER B CB    1 
ATOM   1072 O OG    . SER B 1 15  ? 18.972 6.045   30.214  1.00 21.14 ? 15   SER B OG    1 
ATOM   1073 N N     . SER B 1 16  ? 18.134 8.505   26.188  1.00 28.31 ? 16   SER B N     1 
ATOM   1074 C CA    . SER B 1 16  ? 18.681 9.402   25.175  1.00 30.66 ? 16   SER B CA    1 
ATOM   1075 C C     . SER B 1 16  ? 17.670 10.466  24.821  1.00 32.46 ? 16   SER B C     1 
ATOM   1076 O O     . SER B 1 16  ? 17.993 11.652  24.733  1.00 33.20 ? 16   SER B O     1 
ATOM   1077 C CB    . SER B 1 16  ? 19.074 8.616   23.936  1.00 30.88 ? 16   SER B CB    1 
ATOM   1078 O OG    . SER B 1 16  ? 17.945 8.016   23.326  1.00 32.19 ? 16   SER B OG    1 
ATOM   1079 N N     . THR B 1 17  ? 16.436 10.029  24.617  1.00 33.98 ? 17   THR B N     1 
ATOM   1080 C CA    . THR B 1 17  ? 15.358 10.923  24.250  1.00 35.36 ? 17   THR B CA    1 
ATOM   1081 C C     . THR B 1 17  ? 14.859 11.660  25.477  1.00 35.78 ? 17   THR B C     1 
ATOM   1082 O O     . THR B 1 17  ? 14.548 11.044  26.494  1.00 36.33 ? 17   THR B O     1 
ATOM   1083 C CB    . THR B 1 17  ? 14.201 10.125  23.629  1.00 35.67 ? 17   THR B CB    1 
ATOM   1084 O OG1   . THR B 1 17  ? 13.802 9.083   24.524  1.00 36.88 ? 17   THR B OG1   1 
ATOM   1085 C CG2   . THR B 1 17  ? 14.639 9.383   22.375  1.00 36.19 ? 17   THR B CG2   1 
ATOM   1086 N N     . SER B 1 18  ? 14.780 12.980  25.379  1.00 36.13 ? 18   SER B N     1 
ATOM   1087 C CA    . SER B 1 18  ? 14.278 13.789  26.474  1.00 36.26 ? 18   SER B CA    1 
ATOM   1088 C C     . SER B 1 18  ? 12.891 13.284  26.847  1.00 36.24 ? 18   SER B C     1 
ATOM   1089 O O     . SER B 1 18  ? 12.505 13.291  28.011  1.00 35.75 ? 18   SER B O     1 
ATOM   1090 C CB    . SER B 1 18  ? 14.212 15.258  26.058  1.00 36.37 ? 18   SER B CB    1 
ATOM   1091 O OG    . SER B 1 18  ? 13.307 15.447  24.983  1.00 36.93 ? 18   SER B OG    1 
ATOM   1092 N N     . ALA B 1 19  ? 12.154 12.838  25.838  1.00 36.51 ? 19   ALA B N     1 
ATOM   1093 C CA    . ALA B 1 19  ? 10.804 12.332  26.018  1.00 36.68 ? 19   ALA B CA    1 
ATOM   1094 C C     . ALA B 1 19  ? 10.617 11.191  25.022  1.00 36.95 ? 19   ALA B C     1 
ATOM   1095 O O     . ALA B 1 19  ? 11.499 10.343  24.881  1.00 37.28 ? 19   ALA B O     1 
ATOM   1096 C CB    . ALA B 1 19  ? 9.786  13.445  25.779  1.00 36.74 ? 19   ALA B CB    1 
ATOM   1097 N N     . ALA B 1 20  ? 9.482  11.165  24.329  1.00 37.16 ? 20   ALA B N     1 
ATOM   1098 C CA    . ALA B 1 20  ? 9.230  10.137  23.326  1.00 37.18 ? 20   ALA B CA    1 
ATOM   1099 C C     . ALA B 1 20  ? 9.907  10.532  22.018  1.00 37.20 ? 20   ALA B C     1 
ATOM   1100 O O     . ALA B 1 20  ? 11.111 10.334  21.844  1.00 37.79 ? 20   ALA B O     1 
ATOM   1101 C CB    . ALA B 1 20  ? 7.730  9.948   23.121  1.00 37.15 ? 20   ALA B CB    1 
ATOM   1102 N N     . SER B 1 21  ? 9.124  11.105  21.108  1.00 36.95 ? 21   SER B N     1 
ATOM   1103 C CA    . SER B 1 21  ? 9.606  11.549  19.808  1.00 36.59 ? 21   SER B CA    1 
ATOM   1104 C C     . SER B 1 21  ? 8.402  11.801  18.907  1.00 35.86 ? 21   SER B C     1 
ATOM   1105 O O     . SER B 1 21  ? 7.927  12.932  18.786  1.00 36.35 ? 21   SER B O     1 
ATOM   1106 C CB    . SER B 1 21  ? 10.517 10.501  19.167  1.00 36.70 ? 21   SER B CB    1 
ATOM   1107 O OG    . SER B 1 21  ? 10.917 10.923  17.875  1.00 37.48 ? 21   SER B OG    1 
ATOM   1108 N N     . SER B 1 22  ? 7.907  10.739  18.281  1.00 34.83 ? 22   SER B N     1 
ATOM   1109 C CA    . SER B 1 22  ? 7.033  10.976  17.073  1.00 33.75 ? 22   SER B CA    1 
ATOM   1110 C C     . SER B 1 22  ? 6.023  9.930   17.495  1.00 32.38 ? 22   SER B C     1 
ATOM   1111 O O     . SER B 1 22  ? 6.307  9.098   18.363  1.00 32.04 ? 22   SER B O     1 
ATOM   1112 C CB    . SER B 1 22  ? 7.474  10.705  15.638  1.00 33.98 ? 22   SER B CB    1 
ATOM   1113 O OG    . SER B 1 22  ? 8.051  9.413   15.525  1.00 34.53 ? 22   SER B OG    1 
ATOM   1114 N N     . SER B 1 23  ? 4.853  9.956   16.867  1.00 30.68 ? 23   SER B N     1 
ATOM   1115 C CA    . SER B 1 23  ? 3.808  8.988   17.155  1.00 29.58 ? 23   SER B CA    1 
ATOM   1116 C C     . SER B 1 23  ? 4.278  7.584   16.791  1.00 28.14 ? 23   SER B C     1 
ATOM   1117 O O     . SER B 1 23  ? 3.614  6.599   17.107  1.00 27.44 ? 23   SER B O     1 
ATOM   1118 C CB    . SER B 1 23  ? 2.536  9.333   16.380  1.00 29.81 ? 23   SER B CB    1 
ATOM   1119 O OG    . SER B 1 23  ? 2.758  9.250   14.984  1.00 29.71 ? 23   SER B OG    1 
ATOM   1120 N N     . ASN B 1 24  ? 5.431  7.494   16.133  1.00 26.65 ? 24   ASN B N     1 
ATOM   1121 C CA    . ASN B 1 24  ? 5.963  6.208   15.728  1.00 25.44 ? 24   ASN B CA    1 
ATOM   1122 C C     . ASN B 1 24  ? 7.072  5.717   16.670  1.00 23.69 ? 24   ASN B C     1 
ATOM   1123 O O     . ASN B 1 24  ? 7.643  4.668   16.429  1.00 23.05 ? 24   ASN B O     1 
ATOM   1124 C CB    . ASN B 1 24  ? 6.497  6.311   14.297  1.00 26.12 ? 24   ASN B CB    1 
ATOM   1125 C CG    . ASN B 1 24  ? 6.781  4.967   13.676  1.00 27.41 ? 24   ASN B CG    1 
ATOM   1126 O OD1   . ASN B 1 24  ? 5.881  4.147   13.501  1.00 29.93 ? 24   ASN B OD1   1 
ATOM   1127 N ND2   . ASN B 1 24  ? 8.045  4.731   13.324  1.00 29.82 ? 24   ASN B ND2   1 
ATOM   1128 N N     . TYR B 1 25  ? 7.379  6.485   17.714  1.00 22.08 ? 25   TYR B N     1 
ATOM   1129 C CA    . TYR B 1 25  ? 8.421  6.117   18.677  1.00 20.59 ? 25   TYR B CA    1 
ATOM   1130 C C     . TYR B 1 25  ? 8.230  4.694   19.173  1.00 19.13 ? 25   TYR B C     1 
ATOM   1131 O O     . TYR B 1 25  ? 9.160  3.881   19.149  1.00 19.21 ? 25   TYR B O     1 
ATOM   1132 C CB    . TYR B 1 25  ? 8.413  7.067   19.869  1.00 20.27 ? 25   TYR B CB    1 
ATOM   1133 C CG    . TYR B 1 25  ? 9.349  6.632   20.986  1.00 19.35 ? 25   TYR B CG    1 
ATOM   1134 C CD1   . TYR B 1 25  ? 10.702 6.906   20.923  1.00 21.19 ? 25   TYR B CD1   1 
ATOM   1135 C CD2   . TYR B 1 25  ? 8.871  5.953   22.105  1.00 18.77 ? 25   TYR B CD2   1 
ATOM   1136 C CE1   . TYR B 1 25  ? 11.571 6.509   21.937  1.00 20.81 ? 25   TYR B CE1   1 
ATOM   1137 C CE2   . TYR B 1 25  ? 9.729  5.556   23.133  1.00 17.73 ? 25   TYR B CE2   1 
ATOM   1138 C CZ    . TYR B 1 25  ? 11.081 5.832   23.040  1.00 19.21 ? 25   TYR B CZ    1 
ATOM   1139 O OH    . TYR B 1 25  ? 11.935 5.434   24.042  1.00 19.28 ? 25   TYR B OH    1 
ATOM   1140 N N     . CYS B 1 26  ? 7.011  4.381   19.602  1.00 17.69 ? 26   CYS B N     1 
ATOM   1141 C CA    . CYS B 1 26  ? 6.738  3.045   20.134  1.00 16.35 ? 26   CYS B CA    1 
ATOM   1142 C C     . CYS B 1 26  ? 6.881  1.938   19.094  1.00 17.40 ? 26   CYS B C     1 
ATOM   1143 O O     . CYS B 1 26  ? 7.479  0.904   19.359  1.00 17.94 ? 26   CYS B O     1 
ATOM   1144 C CB    . CYS B 1 26  ? 5.373  2.975   20.835  1.00 15.55 ? 26   CYS B CB    1 
ATOM   1145 S SG    . CYS B 1 26  ? 5.374  3.827   22.428  1.00 14.83 ? 26   CYS B SG    1 
ATOM   1146 N N     . ASN B 1 27  ? 6.336  2.153   17.900  1.00 17.92 ? 27   ASN B N     1 
ATOM   1147 C CA    . ASN B 1 27  ? 6.459  1.154   16.849  1.00 18.73 ? 27   ASN B CA    1 
ATOM   1148 C C     . ASN B 1 27  ? 7.932  0.802   16.597  1.00 19.28 ? 27   ASN B C     1 
ATOM   1149 O O     . ASN B 1 27  ? 8.274  -0.371  16.508  1.00 20.72 ? 27   ASN B O     1 
ATOM   1150 C CB    . ASN B 1 27  ? 5.778  1.628   15.560  1.00 18.57 ? 27   ASN B CB    1 
ATOM   1151 C CG    . ASN B 1 27  ? 4.267  1.745   15.701  1.00 18.62 ? 27   ASN B CG    1 
ATOM   1152 O OD1   . ASN B 1 27  ? 3.626  0.935   16.357  1.00 19.49 ? 27   ASN B OD1   1 
ATOM   1153 N ND2   . ASN B 1 27  ? 3.680  2.742   15.025  1.00 21.28 ? 27   ASN B ND2   1 
ATOM   1154 N N     . GLN B 1 28  ? 8.781  1.822   16.544  1.00 20.16 ? 28   GLN B N     1 
ATOM   1155 C CA    . GLN B 1 28  ? 10.210 1.648   16.288  1.00 21.74 ? 28   GLN B CA    1 
ATOM   1156 C C     . GLN B 1 28  ? 10.959 1.091   17.502  1.00 21.50 ? 28   GLN B C     1 
ATOM   1157 O O     . GLN B 1 28  ? 11.861 0.283   17.373  1.00 20.93 ? 28   GLN B O     1 
ATOM   1158 C CB    . GLN B 1 28  ? 10.835 2.988   15.909  1.00 22.62 ? 28   GLN B CB    1 
ATOM   1159 C CG    . GLN B 1 28  ? 12.335 2.940   15.711  1.00 25.98 ? 28   GLN B CG    1 
ATOM   1160 C CD    . GLN B 1 28  ? 12.899 4.226   15.162  1.00 29.80 ? 28   GLN B CD    1 
ATOM   1161 O OE1   . GLN B 1 28  ? 12.625 5.312   15.682  1.00 33.54 ? 28   GLN B OE1   1 
ATOM   1162 N NE2   . GLN B 1 28  ? 13.700 4.113   14.115  1.00 31.62 ? 28   GLN B NE2   1 
ATOM   1163 N N     . MET B 1 29  ? 10.576 1.519   18.693  1.00 21.64 ? 29   MET B N     1 
ATOM   1164 C CA    . MET B 1 29  ? 11.246 1.067   19.906  1.00 21.13 ? 29   MET B CA    1 
ATOM   1165 C C     . MET B 1 29  ? 10.890 -0.355  20.277  1.00 19.55 ? 29   MET B C     1 
ATOM   1166 O O     . MET B 1 29  ? 11.767 -1.117  20.697  1.00 18.81 ? 29   MET B O     1 
ATOM   1167 C CB    . MET B 1 29  ? 10.901 1.989   21.071  1.00 21.97 ? 29   MET B CB    1 
ATOM   1168 C CG    . MET B 1 29  ? 11.592 3.301   21.009  1.00 23.81 ? 29   MET B CG    1 
ATOM   1169 S SD    . MET B 1 29  ? 13.364 3.132   21.206  1.00 25.94 ? 29   MET B SD    1 
ATOM   1170 C CE    . MET B 1 29  ? 13.503 2.770   22.957  1.00 25.99 ? 29   MET B CE    1 
ATOM   1171 N N     . MET B 1 30  ? 9.610  -0.692  20.210  1.00 18.61 ? 30   MET B N     1 
ATOM   1172 C CA    . MET B 1 30  ? 9.170  -2.023  20.571  1.00 18.37 ? 30   MET B CA    1 
ATOM   1173 C C     . MET B 1 30  ? 9.852  -3.019  19.657  1.00 18.59 ? 30   MET B C     1 
ATOM   1174 O O     . MET B 1 30  ? 10.115 -4.163  20.048  1.00 19.55 ? 30   MET B O     1 
ATOM   1175 C CB    . MET B 1 30  ? 7.648  -2.152  20.493  1.00 17.44 ? 30   MET B CB    1 
ATOM   1176 C CG    . MET B 1 30  ? 6.883  -1.324  21.529  1.00 15.59 ? 30   MET B CG    1 
ATOM   1177 S SD    . MET B 1 30  ? 7.225  -1.733  23.230  1.00 14.92 ? 30   MET B SD    1 
ATOM   1178 C CE    . MET B 1 30  ? 6.215  -3.171  23.400  1.00 14.43 ? 30   MET B CE    1 
ATOM   1179 N N     . LYS B 1 31  ? 10.123 -2.603  18.408  1.00 18.66 ? 31   LYS B N     1 
ATOM   1180 C CA    . LYS B 1 31  ? 10.801 -3.472  17.454  1.00 18.33 ? 31   LYS B CA    1 
ATOM   1181 C C     . LYS B 1 31  ? 12.284 -3.601  17.807  1.00 16.76 ? 31   LYS B C     1 
ATOM   1182 O O     . LYS B 1 31  ? 12.816 -4.716  17.881  1.00 18.63 ? 31   LYS B O     1 
ATOM   1183 C CB    . LYS B 1 31  ? 10.638 -2.954  16.016  1.00 19.20 ? 31   LYS B CB    1 
ATOM   1184 C CG    . LYS B 1 31  ? 11.307 -3.837  14.977  1.00 21.34 ? 31   LYS B CG    1 
ATOM   1185 C CD    . LYS B 1 31  ? 11.149 -3.305  13.567  1.00 23.59 ? 31   LYS B CD    1 
ATOM   1186 C CE    . LYS B 1 31  ? 11.884 -4.179  12.561  1.00 26.09 ? 31   LYS B CE    1 
ATOM   1187 N NZ    . LYS B 1 31  ? 11.745 -3.662  11.165  1.00 28.68 ? 31   LYS B NZ    1 
ATOM   1188 N N     . SER B 1 32  ? 12.941 -2.465  18.003  1.00 17.76 ? 32   SER B N     1 
ATOM   1189 C CA    . SER B 1 32  ? 14.385 -2.438  18.285  1.00 17.89 ? 32   SER B CA    1 
ATOM   1190 C C     . SER B 1 32  ? 14.751 -3.205  19.568  1.00 16.18 ? 32   SER B C     1 
ATOM   1191 O O     . SER B 1 32  ? 15.899 -3.626  19.726  1.00 16.68 ? 32   SER B O     1 
ATOM   1192 C CB    . SER B 1 32  ? 14.884 -0.995  18.443  1.00 18.49 ? 32   SER B CB    1 
ATOM   1193 O OG    . SER B 1 32  ? 14.976 -0.281  17.217  1.00 21.68 ? 32   SER B OG    1 
ATOM   1194 N N     . ARG B 1 33  ? 13.799 -3.375  20.491  1.00 14.70 ? 33   ARG B N     1 
ATOM   1195 C CA    . ARG B 1 33  ? 14.067 -4.050  21.775  1.00 13.42 ? 33   ARG B CA    1 
ATOM   1196 C C     . ARG B 1 33  ? 13.576 -5.502  21.799  1.00 13.79 ? 33   ARG B C     1 
ATOM   1197 O O     . ARG B 1 33  ? 13.550 -6.141  22.841  1.00 12.77 ? 33   ARG B O     1 
ATOM   1198 C CB    . ARG B 1 33  ? 13.434 -3.245  22.908  1.00 13.55 ? 33   ARG B CB    1 
ATOM   1199 C CG    . ARG B 1 33  ? 13.931 -1.811  22.990  1.00 12.87 ? 33   ARG B CG    1 
ATOM   1200 C CD    . ARG B 1 33  ? 15.470 -1.708  23.061  1.00 13.11 ? 33   ARG B CD    1 
ATOM   1201 N NE    . ARG B 1 33  ? 15.946 -0.352  23.238  1.00 12.63 ? 33   ARG B NE    1 
ATOM   1202 C CZ    . ARG B 1 33  ? 16.036 0.298   24.379  1.00 11.83 ? 33   ARG B CZ    1 
ATOM   1203 N NH1   . ARG B 1 33  ? 15.718 -0.287  25.541  1.00 11.71 ? 33   ARG B NH1   1 
ATOM   1204 N NH2   . ARG B 1 33  ? 16.491 1.535   24.386  1.00 11.36 ? 33   ARG B NH2   1 
ATOM   1205 N N     . ASN B 1 34  ? 13.209 -6.029  20.635  1.00 15.07 ? 34   ASN B N     1 
ATOM   1206 C CA    . ASN B 1 34  ? 12.774 -7.409  20.450  1.00 16.00 ? 34   ASN B CA    1 
ATOM   1207 C C     . ASN B 1 34  ? 11.481 -7.714  21.186  1.00 16.81 ? 34   ASN B C     1 
ATOM   1208 O O     . ASN B 1 34  ? 11.313 -8.812  21.698  1.00 18.55 ? 34   ASN B O     1 
ATOM   1209 C CB    . ASN B 1 34  ? 13.887 -8.400  20.840  1.00 15.90 ? 34   ASN B CB    1 
ATOM   1210 C CG    . ASN B 1 34  ? 15.098 -8.326  19.907  1.00 15.68 ? 34   ASN B CG    1 
ATOM   1211 O OD1   . ASN B 1 34  ? 14.974 -7.923  18.750  1.00 18.97 ? 34   ASN B OD1   1 
ATOM   1212 N ND2   . ASN B 1 34  ? 16.248 -8.776  20.387  1.00 17.58 ? 34   ASN B ND2   1 
ATOM   1213 N N     . LEU B 1 35  ? 10.582 -6.738  21.239  1.00 16.92 ? 35   LEU B N     1 
ATOM   1214 C CA    . LEU B 1 35  ? 9.308  -6.909  21.940  1.00 17.24 ? 35   LEU B CA    1 
ATOM   1215 C C     . LEU B 1 35  ? 8.160  -7.170  20.962  1.00 19.42 ? 35   LEU B C     1 
ATOM   1216 O O     . LEU B 1 35  ? 7.001  -7.168  21.356  1.00 19.85 ? 35   LEU B O     1 
ATOM   1217 C CB    . LEU B 1 35  ? 9.014  -5.686  22.821  1.00 16.97 ? 35   LEU B CB    1 
ATOM   1218 C CG    . LEU B 1 35  ? 10.103 -5.400  23.853  1.00 16.36 ? 35   LEU B CG    1 
ATOM   1219 C CD1   . LEU B 1 35  ? 9.754  -4.157  24.654  1.00 16.18 ? 35   LEU B CD1   1 
ATOM   1220 C CD2   . LEU B 1 35  ? 10.328 -6.591  24.753  1.00 16.65 ? 35   LEU B CD2   1 
ATOM   1221 N N     . THR B 1 36  ? 8.490  -7.396  19.690  1.00 21.67 ? 36   THR B N     1 
ATOM   1222 C CA    . THR B 1 36  ? 7.489  -7.729  18.667  1.00 23.62 ? 36   THR B CA    1 
ATOM   1223 C C     . THR B 1 36  ? 7.971  -8.925  17.860  1.00 25.30 ? 36   THR B C     1 
ATOM   1224 O O     . THR B 1 36  ? 7.500  -9.151  16.739  1.00 25.93 ? 36   THR B O     1 
ATOM   1225 C CB    . THR B 1 36  ? 7.246  -6.561  17.691  1.00 23.88 ? 36   THR B CB    1 
ATOM   1226 O OG1   . THR B 1 36  ? 8.433  -6.307  16.920  1.00 22.67 ? 36   THR B OG1   1 
ATOM   1227 C CG2   . THR B 1 36  ? 6.929  -5.270  18.432  1.00 24.17 ? 36   THR B CG2   1 
ATOM   1228 N N     . LYS B 1 37  ? 8.897  -9.690  18.433  1.00 27.24 ? 37   LYS B N     1 
ATOM   1229 C CA    . LYS B 1 37  ? 9.485  -10.851 17.761  1.00 28.90 ? 37   LYS B CA    1 
ATOM   1230 C C     . LYS B 1 37  ? 8.487  -11.990 17.530  1.00 29.39 ? 37   LYS B C     1 
ATOM   1231 O O     . LYS B 1 37  ? 8.058  -12.219 16.395  1.00 30.52 ? 37   LYS B O     1 
ATOM   1232 C CB    . LYS B 1 37  ? 10.695 -11.342 18.566  1.00 29.51 ? 37   LYS B CB    1 
ATOM   1233 C CG    . LYS B 1 37  ? 11.805 -11.950 17.733  1.00 30.46 ? 37   LYS B CG    1 
ATOM   1234 C CD    . LYS B 1 37  ? 11.702 -13.470 17.670  1.00 31.81 ? 37   LYS B CD    1 
ATOM   1235 C CE    . LYS B 1 37  ? 11.906 -14.060 19.076  1.00 32.79 ? 37   LYS B CE    1 
ATOM   1236 N NZ    . LYS B 1 37  ? 12.560 -15.402 19.227  1.00 33.86 ? 37   LYS B NZ    1 
ATOM   1237 N N     . ASP B 1 38  ? 8.116  -12.705 18.590  1.00 29.64 ? 38   ASP B N     1 
ATOM   1238 C CA    . ASP B 1 38  ? 7.181  -13.825 18.473  1.00 29.82 ? 38   ASP B CA    1 
ATOM   1239 C C     . ASP B 1 38  ? 5.727  -13.392 18.648  1.00 29.16 ? 38   ASP B C     1 
ATOM   1240 O O     . ASP B 1 38  ? 4.804  -14.100 18.253  1.00 29.17 ? 38   ASP B O     1 
ATOM   1241 C CB    . ASP B 1 38  ? 7.520  -14.899 19.507  1.00 30.40 ? 38   ASP B CB    1 
ATOM   1242 C CG    . ASP B 1 38  ? 8.871  -15.531 19.263  1.00 32.48 ? 38   ASP B CG    1 
ATOM   1243 O OD1   . ASP B 1 38  ? 9.070  -16.083 18.159  1.00 34.92 ? 38   ASP B OD1   1 
ATOM   1244 O OD2   . ASP B 1 38  ? 9.789  -15.539 20.118  1.00 34.71 ? 38   ASP B OD2   1 
ATOM   1245 N N     . ARG B 1 39  ? 5.522  -12.234 19.266  1.00 28.04 ? 39   ARG B N     1 
ATOM   1246 C CA    . ARG B 1 39  ? 4.182  -11.714 19.487  1.00 27.19 ? 39   ARG B CA    1 
ATOM   1247 C C     . ARG B 1 39  ? 4.314  -10.260 19.888  1.00 24.87 ? 39   ARG B C     1 
ATOM   1248 O O     . ARG B 1 39  ? 5.396  -9.817  20.259  1.00 24.25 ? 39   ARG B O     1 
ATOM   1249 C CB    . ARG B 1 39  ? 3.474  -12.499 20.586  1.00 28.01 ? 39   ARG B CB    1 
ATOM   1250 C CG    . ARG B 1 39  ? 4.078  -12.331 21.981  1.00 29.99 ? 39   ARG B CG    1 
ATOM   1251 C CD    . ARG B 1 39  ? 3.532  -13.316 23.011  1.00 32.21 ? 39   ARG B CD    1 
ATOM   1252 N NE    . ARG B 1 39  ? 2.086  -13.203 23.166  1.00 34.46 ? 39   ARG B NE    1 
ATOM   1253 C CZ    . ARG B 1 39  ? 1.189  -13.824 22.400  1.00 35.84 ? 39   ARG B CZ    1 
ATOM   1254 N NH1   . ARG B 1 39  ? -0.106 -13.647 22.626  1.00 36.59 ? 39   ARG B NH1   1 
ATOM   1255 N NH2   . ARG B 1 39  ? 1.575  -14.619 21.407  1.00 36.55 ? 39   ARG B NH2   1 
ATOM   1256 N N     . CYS B 1 40  ? 3.222  -9.509  19.800  1.00 22.90 ? 40   CYS B N     1 
ATOM   1257 C CA    . CYS B 1 40  ? 3.253  -8.102  20.168  1.00 20.99 ? 40   CYS B CA    1 
ATOM   1258 C C     . CYS B 1 40  ? 3.123  -7.982  21.687  1.00 18.73 ? 40   CYS B C     1 
ATOM   1259 O O     . CYS B 1 40  ? 2.081  -8.312  22.234  1.00 18.84 ? 40   CYS B O     1 
ATOM   1260 C CB    . CYS B 1 40  ? 2.089  -7.324  19.523  1.00 21.07 ? 40   CYS B CB    1 
ATOM   1261 S SG    . CYS B 1 40  ? 1.878  -7.540  17.748  1.00 23.85 ? 40   CYS B SG    1 
ATOM   1262 N N     . LYS B 1 41  ? 4.167  -7.523  22.375  1.00 16.35 ? 41   LYS B N     1 
ATOM   1263 C CA    . LYS B 1 41  ? 4.021  -7.277  23.802  1.00 14.76 ? 41   LYS B CA    1 
ATOM   1264 C C     . LYS B 1 41  ? 2.989  -6.133  23.934  1.00 13.63 ? 41   LYS B C     1 
ATOM   1265 O O     . LYS B 1 41  ? 3.187  -5.068  23.378  1.00 14.21 ? 41   LYS B O     1 
ATOM   1266 C CB    . LYS B 1 41  ? 5.338  -6.872  24.431  1.00 14.93 ? 41   LYS B CB    1 
ATOM   1267 C CG    . LYS B 1 41  ? 5.226  -6.702  25.941  1.00 16.14 ? 41   LYS B CG    1 
ATOM   1268 C CD    . LYS B 1 41  ? 6.534  -6.320  26.616  1.00 17.75 ? 41   LYS B CD    1 
ATOM   1269 C CE    . LYS B 1 41  ? 6.360  -6.172  28.134  1.00 21.60 ? 41   LYS B CE    1 
ATOM   1270 N NZ    . LYS B 1 41  ? 7.536  -5.608  28.845  1.00 25.01 ? 41   LYS B NZ    1 
ATOM   1271 N N     . PRO B 1 42  ? 1.873  -6.350  24.622  1.00 13.62 ? 42   PRO B N     1 
ATOM   1272 C CA    . PRO B 1 42  ? 0.805  -5.348  24.656  1.00 13.15 ? 42   PRO B CA    1 
ATOM   1273 C C     . PRO B 1 42  ? 1.109  -4.009  25.296  1.00 12.78 ? 42   PRO B C     1 
ATOM   1274 O O     . PRO B 1 42  ? 0.692  -2.975  24.754  1.00 14.06 ? 42   PRO B O     1 
ATOM   1275 C CB    . PRO B 1 42  ? -0.323 -6.084  25.398  1.00 14.08 ? 42   PRO B CB    1 
ATOM   1276 C CG    . PRO B 1 42  ? -0.059 -7.538  25.164  1.00 13.54 ? 42   PRO B CG    1 
ATOM   1277 C CD    . PRO B 1 42  ? 1.451  -7.602  25.274  1.00 13.34 ? 42   PRO B CD    1 
ATOM   1278 N N     . VAL B 1 43  ? 1.773  -3.998  26.439  1.00 12.09 ? 43   VAL B N     1 
ATOM   1279 C CA    . VAL B 1 43  ? 1.988  -2.768  27.178  1.00 12.03 ? 43   VAL B CA    1 
ATOM   1280 C C     . VAL B 1 43  ? 3.425  -2.717  27.662  1.00 11.82 ? 43   VAL B C     1 
ATOM   1281 O O     . VAL B 1 43  ? 3.962  -3.724  28.148  1.00 12.86 ? 43   VAL B O     1 
ATOM   1282 C CB    . VAL B 1 43  ? 1.032  -2.704  28.403  1.00 12.57 ? 43   VAL B CB    1 
ATOM   1283 C CG1   . VAL B 1 43  ? 1.232  -1.416  29.147  1.00 14.39 ? 43   VAL B CG1   1 
ATOM   1284 C CG2   . VAL B 1 43  ? -0.421 -2.827  27.990  1.00 12.26 ? 43   VAL B CG2   1 
ATOM   1285 N N     . ASN B 1 44  ? 4.051  -1.559  27.522  1.00 10.83 ? 44   ASN B N     1 
ATOM   1286 C CA    . ASN B 1 44  ? 5.433  -1.407  27.953  1.00 11.26 ? 44   ASN B CA    1 
ATOM   1287 C C     . ASN B 1 44  ? 5.804  0.037   28.141  1.00 12.03 ? 44   ASN B C     1 
ATOM   1288 O O     . ASN B 1 44  ? 5.481  0.858   27.282  1.00 15.46 ? 44   ASN B O     1 
ATOM   1289 C CB    . ASN B 1 44  ? 6.364  -1.981  26.882  1.00 12.44 ? 44   ASN B CB    1 
ATOM   1290 C CG    . ASN B 1 44  ? 7.803  -2.084  27.361  1.00 13.75 ? 44   ASN B CG    1 
ATOM   1291 O OD1   . ASN B 1 44  ? 8.112  -2.811  28.310  1.00 15.85 ? 44   ASN B OD1   1 
ATOM   1292 N ND2   . ASN B 1 44  ? 8.704  -1.379  26.708  1.00 11.95 ? 44   ASN B ND2   1 
ATOM   1293 N N     . THR B 1 45  ? 6.560  0.352   29.178  1.00 11.19 ? 45   THR B N     1 
ATOM   1294 C CA    . THR B 1 45  ? 7.019  1.703   29.489  1.00 11.10 ? 45   THR B CA    1 
ATOM   1295 C C     . THR B 1 45  ? 8.515  1.843   29.275  1.00 11.56 ? 45   THR B C     1 
ATOM   1296 O O     . THR B 1 45  ? 9.282  0.953   29.685  1.00 11.33 ? 45   THR B O     1 
ATOM   1297 C CB    . THR B 1 45  ? 6.704  2.016   30.931  1.00 11.82 ? 45   THR B CB    1 
ATOM   1298 O OG1   . THR B 1 45  ? 5.280  2.004   31.117  1.00 14.84 ? 45   THR B OG1   1 
ATOM   1299 C CG2   . THR B 1 45  ? 7.169  3.410   31.327  1.00 12.29 ? 45   THR B CG2   1 
ATOM   1300 N N     . PHE B 1 46  ? 8.946  2.965   28.693  1.00 11.49 ? 46   PHE B N     1 
ATOM   1301 C CA    . PHE B 1 46  ? 10.359 3.308   28.529  1.00 11.74 ? 46   PHE B CA    1 
ATOM   1302 C C     . PHE B 1 46  ? 10.640 4.528   29.400  1.00 12.25 ? 46   PHE B C     1 
ATOM   1303 O O     . PHE B 1 46  ? 9.860  5.491   29.419  1.00 13.39 ? 46   PHE B O     1 
ATOM   1304 C CB    . PHE B 1 46  ? 10.666 3.618   27.063  1.00 13.17 ? 46   PHE B CB    1 
ATOM   1305 C CG    . PHE B 1 46  ? 10.662 2.419   26.177  1.00 12.89 ? 46   PHE B CG    1 
ATOM   1306 C CD1   . PHE B 1 46  ? 11.722 1.538   26.204  1.00 14.52 ? 46   PHE B CD1   1 
ATOM   1307 C CD2   . PHE B 1 46  ? 9.599  2.154   25.327  1.00 12.48 ? 46   PHE B CD2   1 
ATOM   1308 C CE1   . PHE B 1 46  ? 11.731 0.435   25.392  1.00 15.47 ? 46   PHE B CE1   1 
ATOM   1309 C CE2   . PHE B 1 46  ? 9.608  1.050   24.511  1.00 13.55 ? 46   PHE B CE2   1 
ATOM   1310 C CZ    . PHE B 1 46  ? 10.678 0.197   24.532  1.00 15.94 ? 46   PHE B CZ    1 
ATOM   1311 N N     . VAL B 1 47  ? 11.758 4.494   30.122  1.00 12.67 ? 47   VAL B N     1 
ATOM   1312 C CA    . VAL B 1 47  ? 12.145 5.552   31.006  1.00 12.44 ? 47   VAL B CA    1 
ATOM   1313 C C     . VAL B 1 47  ? 13.302 6.306   30.365  1.00 12.65 ? 47   VAL B C     1 
ATOM   1314 O O     . VAL B 1 47  ? 14.297 5.714   29.939  1.00 13.15 ? 47   VAL B O     1 
ATOM   1315 C CB    . VAL B 1 47  ? 12.571 5.005   32.391  1.00 11.88 ? 47   VAL B CB    1 
ATOM   1316 C CG1   . VAL B 1 47  ? 12.899 6.158   33.366  1.00 11.00 ? 47   VAL B CG1   1 
ATOM   1317 C CG2   . VAL B 1 47  ? 11.469 4.105   32.960  1.00 11.49 ? 47   VAL B CG2   1 
ATOM   1318 N N     . HIS B 1 48  ? 13.182 7.633   30.303  1.00 13.26 ? 48   HIS B N     1 
ATOM   1319 C CA    . HIS B 1 48  ? 14.198 8.441   29.610  1.00 14.47 ? 48   HIS B CA    1 
ATOM   1320 C C     . HIS B 1 48  ? 15.335 9.006   30.449  1.00 15.62 ? 48   HIS B C     1 
ATOM   1321 O O     . HIS B 1 48  ? 16.272 9.575   29.900  1.00 17.87 ? 48   HIS B O     1 
ATOM   1322 C CB    . HIS B 1 48  ? 13.511 9.504   28.762  1.00 14.45 ? 48   HIS B CB    1 
ATOM   1323 C CG    . HIS B 1 48  ? 12.525 8.912   27.814  1.00 15.43 ? 48   HIS B CG    1 
ATOM   1324 N ND1   . HIS B 1 48  ? 12.862 7.906   26.926  1.00 16.21 ? 48   HIS B ND1   1 
ATOM   1325 C CD2   . HIS B 1 48  ? 11.203 9.131   27.652  1.00 15.45 ? 48   HIS B CD2   1 
ATOM   1326 C CE1   . HIS B 1 48  ? 11.788 7.555   26.238  1.00 16.74 ? 48   HIS B CE1   1 
ATOM   1327 N NE2   . HIS B 1 48  ? 10.771 8.296   26.647  1.00 15.86 ? 48   HIS B NE2   1 
ATOM   1328 N N     . GLU B 1 49  ? 15.306 8.810   31.749  1.00 14.88 ? 49   GLU B N     1 
ATOM   1329 C CA    . GLU B 1 49  ? 16.337 9.283   32.666  1.00 14.18 ? 49   GLU B CA    1 
ATOM   1330 C C     . GLU B 1 49  ? 17.596 8.431   32.555  1.00 13.72 ? 49   GLU B C     1 
ATOM   1331 O O     . GLU B 1 49  ? 17.610 7.383   31.908  1.00 14.81 ? 49   GLU B O     1 
ATOM   1332 C CB    . GLU B 1 49  ? 15.803 9.229   34.093  1.00 14.05 ? 49   GLU B CB    1 
ATOM   1333 C CG    . GLU B 1 49  ? 14.513 9.996   34.316  1.00 12.66 ? 49   GLU B CG    1 
ATOM   1334 C CD    . GLU B 1 49  ? 14.578 11.492  34.019  1.00 13.69 ? 49   GLU B CD    1 
ATOM   1335 O OE1   . GLU B 1 49  ? 15.676 12.116  34.081  1.00 16.09 ? 49   GLU B OE1   1 
ATOM   1336 O OE2   . GLU B 1 49  ? 13.495 12.063  33.739  1.00 16.85 ? 49   GLU B OE2   1 
ATOM   1337 N N     . SER B 1 50  ? 18.677 8.912   33.143  1.00 12.99 ? 50   SER B N     1 
ATOM   1338 C CA    . SER B 1 50  ? 19.924 8.169   33.099  1.00 12.93 ? 50   SER B CA    1 
ATOM   1339 C C     . SER B 1 50  ? 19.776 6.843   33.844  1.00 12.20 ? 50   SER B C     1 
ATOM   1340 O O     . SER B 1 50  ? 18.943 6.701   34.775  1.00 12.16 ? 50   SER B O     1 
ATOM   1341 C CB    . SER B 1 50  ? 21.057 8.968   33.735  1.00 13.02 ? 50   SER B CB    1 
ATOM   1342 O OG    . SER B 1 50  ? 20.826 9.139   35.107  1.00 13.59 ? 50   SER B OG    1 
ATOM   1343 N N     . LEU B 1 51  ? 20.599 5.871   33.477  1.00 11.78 ? 51   LEU B N     1 
ATOM   1344 C CA    . LEU B 1 51  ? 20.581 4.602   34.163  1.00 11.02 ? 51   LEU B CA    1 
ATOM   1345 C C     . LEU B 1 51  ? 20.912 4.839   35.644  1.00 11.50 ? 51   LEU B C     1 
ATOM   1346 O O     . LEU B 1 51  ? 20.335 4.199   36.528  1.00 11.35 ? 51   LEU B O     1 
ATOM   1347 C CB    . LEU B 1 51  ? 21.591 3.644   33.536  1.00 12.35 ? 51   LEU B CB    1 
ATOM   1348 C CG    . LEU B 1 51  ? 21.653 2.254   34.180  1.00 12.08 ? 51   LEU B CG    1 
ATOM   1349 C CD1   . LEU B 1 51  ? 20.342 1.533   34.058  1.00 12.98 ? 51   LEU B CD1   1 
ATOM   1350 C CD2   . LEU B 1 51  ? 22.784 1.422   33.569  1.00 13.54 ? 51   LEU B CD2   1 
ATOM   1351 N N     . ALA B 1 52  ? 21.871 5.725   35.936  1.00 12.03 ? 52   ALA B N     1 
ATOM   1352 C CA    . ALA B 1 52  ? 22.213 6.016   37.320  1.00 12.56 ? 52   ALA B CA    1 
ATOM   1353 C C     . ALA B 1 52  ? 21.009 6.483   38.142  1.00 11.82 ? 52   ALA B C     1 
ATOM   1354 O O     . ALA B 1 52  ? 20.808 6.057   39.274  1.00 11.75 ? 52   ALA B O     1 
ATOM   1355 C CB    . ALA B 1 52  ? 23.297 7.071   37.346  1.00 13.35 ? 52   ALA B CB    1 
ATOM   1356 N N     . ASP B 1 53  ? 20.247 7.393   37.577  1.00 11.57 ? 53   ASP B N     1 
ATOM   1357 C CA    . ASP B 1 53  ? 19.081 7.940   38.272  1.00 11.05 ? 53   ASP B CA    1 
ATOM   1358 C C     . ASP B 1 53  ? 18.015 6.849   38.490  1.00 10.34 ? 53   ASP B C     1 
ATOM   1359 O O     . ASP B 1 53  ? 17.345 6.828   39.537  1.00 10.30 ? 53   ASP B O     1 
ATOM   1360 C CB    . ASP B 1 53  ? 18.445 9.070   37.475  1.00 12.29 ? 53   ASP B CB    1 
ATOM   1361 C CG    . ASP B 1 53  ? 19.125 10.399  37.680  1.00 14.17 ? 53   ASP B CG    1 
ATOM   1362 O OD1   . ASP B 1 53  ? 20.148 10.476  38.414  1.00 15.76 ? 53   ASP B OD1   1 
ATOM   1363 O OD2   . ASP B 1 53  ? 18.663 11.415  37.109  1.00 16.77 ? 53   ASP B OD2   1 
ATOM   1364 N N     . VAL B 1 54  ? 17.871 5.941   37.530  1.00 9.55  ? 54   VAL B N     1 
ATOM   1365 C CA    . VAL B 1 54  ? 16.879 4.880   37.684  1.00 9.66  ? 54   VAL B CA    1 
ATOM   1366 C C     . VAL B 1 54  ? 17.356 3.863   38.718  1.00 9.30  ? 54   VAL B C     1 
ATOM   1367 O O     . VAL B 1 54  ? 16.563 3.395   39.550  1.00 9.36  ? 54   VAL B O     1 
ATOM   1368 C CB    . VAL B 1 54  ? 16.554 4.229   36.319  1.00 9.95  ? 54   VAL B CB    1 
ATOM   1369 C CG1   . VAL B 1 54  ? 15.630 3.027   36.467  1.00 10.24 ? 54   VAL B CG1   1 
ATOM   1370 C CG2   . VAL B 1 54  ? 15.898 5.253   35.421  1.00 11.08 ? 54   VAL B CG2   1 
ATOM   1371 N N     . GLN B 1 55  ? 18.626 3.497   38.661  1.00 9.66  ? 55   GLN B N     1 
ATOM   1372 C CA    . GLN B 1 55  ? 19.191 2.561   39.636  1.00 10.33 ? 55   GLN B CA    1 
ATOM   1373 C C     . GLN B 1 55  ? 19.083 3.129   41.046  1.00 10.46 ? 55   GLN B C     1 
ATOM   1374 O O     . GLN B 1 55  ? 18.888 2.406   42.005  1.00 10.17 ? 55   GLN B O     1 
ATOM   1375 C CB    . GLN B 1 55  ? 20.644 2.224   39.294  1.00 11.38 ? 55   GLN B CB    1 
ATOM   1376 C CG    . GLN B 1 55  ? 20.750 1.305   38.098  1.00 11.55 ? 55   GLN B CG    1 
ATOM   1377 C CD    . GLN B 1 55  ? 22.183 1.043   37.644  1.00 13.44 ? 55   GLN B CD    1 
ATOM   1378 O OE1   . GLN B 1 55  ? 22.487 0.053   36.930  1.00 14.14 ? 55   GLN B OE1   1 
ATOM   1379 N NE2   . GLN B 1 55  ? 23.067 1.922   38.038  1.00 14.64 ? 55   GLN B NE2   1 
ATOM   1380 N N     . ALA B 1 56  ? 19.194 4.459   41.177  1.00 9.99  ? 56   ALA B N     1 
ATOM   1381 C CA    . ALA B 1 56  ? 19.089 5.118   42.488  1.00 10.32 ? 56   ALA B CA    1 
ATOM   1382 C C     . ALA B 1 56  ? 17.715 4.937   43.142  1.00 9.69  ? 56   ALA B C     1 
ATOM   1383 O O     . ALA B 1 56  ? 17.607 5.053   44.364  1.00 9.42  ? 56   ALA B O     1 
ATOM   1384 C CB    . ALA B 1 56  ? 19.419 6.611   42.360  1.00 10.47 ? 56   ALA B CB    1 
ATOM   1385 N N     . VAL B 1 57  ? 16.695 4.639   42.331  1.00 9.44  ? 57   VAL B N     1 
ATOM   1386 C CA    . VAL B 1 57  ? 15.359 4.423   42.885  1.00 9.13  ? 57   VAL B CA    1 
ATOM   1387 C C     . VAL B 1 57  ? 15.363 3.279   43.913  1.00 8.10  ? 57   VAL B C     1 
ATOM   1388 O O     . VAL B 1 57  ? 14.555 3.281   44.840  1.00 8.47  ? 57   VAL B O     1 
ATOM   1389 C CB    . VAL B 1 57  ? 14.332 4.200   41.749  1.00 9.50  ? 57   VAL B CB    1 
ATOM   1390 C CG1   . VAL B 1 57  ? 12.958 3.847   42.291  1.00 10.13 ? 57   VAL B CG1   1 
ATOM   1391 C CG2   . VAL B 1 57  ? 14.265 5.462   40.895  1.00 9.47  ? 57   VAL B CG2   1 
ATOM   1392 N N     . CYS B 1 58  ? 16.295 2.337   43.769  1.00 9.14  ? 58   CYS B N     1 
ATOM   1393 C CA    . CYS B 1 58  ? 16.386 1.199   44.665  1.00 10.68 ? 58   CYS B CA    1 
ATOM   1394 C C     . CYS B 1 58  ? 16.774 1.600   46.091  1.00 10.58 ? 58   CYS B C     1 
ATOM   1395 O O     . CYS B 1 58  ? 16.806 0.740   46.969  1.00 12.15 ? 58   CYS B O     1 
ATOM   1396 C CB    . CYS B 1 58  ? 17.360 0.162   44.132  1.00 10.16 ? 58   CYS B CB    1 
ATOM   1397 S SG    . CYS B 1 58  ? 16.863 -0.579  42.549  1.00 10.53 ? 58   CYS B SG    1 
ATOM   1398 N N     . SER B 1 59  ? 17.116 2.878   46.297  1.00 10.63 ? 59   SER B N     1 
ATOM   1399 C CA    . SER B 1 59  ? 17.412 3.430   47.628  1.00 12.09 ? 59   SER B CA    1 
ATOM   1400 C C     . SER B 1 59  ? 16.404 4.504   48.038  1.00 10.78 ? 59   SER B C     1 
ATOM   1401 O O     . SER B 1 59  ? 16.675 5.312   48.936  1.00 11.24 ? 59   SER B O     1 
ATOM   1402 C CB    . SER B 1 59  ? 18.834 3.993   47.645  1.00 14.01 ? 59   SER B CB    1 
ATOM   1403 O OG    . SER B 1 59  ? 19.776 2.961   47.387  1.00 19.32 ? 59   SER B OG    1 
ATOM   1404 N N     . GLN B 1 60  ? 15.225 4.501   47.406  1.00 9.52  ? 60   GLN B N     1 
ATOM   1405 C CA    . GLN B 1 60  ? 14.219 5.547   47.639  1.00 9.16  ? 60   GLN B CA    1 
ATOM   1406 C C     . GLN B 1 60  ? 13.032 4.956   48.407  1.00 9.38  ? 60   GLN B C     1 
ATOM   1407 O O     . GLN B 1 60  ? 13.266 4.312   49.425  1.00 10.43 ? 60   GLN B O     1 
ATOM   1408 C CB    . GLN B 1 60  ? 13.900 6.295   46.343  1.00 9.69  ? 60   GLN B CB    1 
ATOM   1409 C CG    . GLN B 1 60  ? 15.169 7.005   45.858  1.00 9.00  ? 60   GLN B CG    1 
ATOM   1410 C CD    . GLN B 1 60  ? 15.070 7.709   44.545  1.00 9.12  ? 60   GLN B CD    1 
ATOM   1411 O OE1   . GLN B 1 60  ? 13.976 8.016   44.050  1.00 10.10 ? 60   GLN B OE1   1 
ATOM   1412 N NE2   . GLN B 1 60  ? 16.235 7.985   43.951  1.00 9.38  ? 60   GLN B NE2   1 
ATOM   1413 N N     . LYS B 1 61  ? 11.779 5.168   48.006  1.00 9.54  ? 61   LYS B N     1 
ATOM   1414 C CA    . LYS B 1 61  ? 10.632 4.815   48.854  1.00 9.62  ? 61   LYS B CA    1 
ATOM   1415 C C     . LYS B 1 61  ? 10.260 3.355   48.729  1.00 9.86  ? 61   LYS B C     1 
ATOM   1416 O O     . LYS B 1 61  ? 9.739  2.912   47.691  1.00 9.56  ? 61   LYS B O     1 
ATOM   1417 C CB    . LYS B 1 61  ? 9.419  5.684   48.516  1.00 10.71 ? 61   LYS B CB    1 
ATOM   1418 C CG    . LYS B 1 61  ? 8.246  5.411   49.428  1.00 12.85 ? 61   LYS B CG    1 
ATOM   1419 C CD    . LYS B 1 61  ? 7.089  6.350   49.206  1.00 19.51 ? 61   LYS B CD    1 
ATOM   1420 C CE    . LYS B 1 61  ? 6.017  6.172   50.283  1.00 22.83 ? 61   LYS B CE    1 
ATOM   1421 N NZ    . LYS B 1 61  ? 5.038  7.281   50.329  1.00 26.62 ? 61   LYS B NZ    1 
ATOM   1422 N N     . ASN B 1 62  ? 10.513 2.568   49.781  1.00 9.84  ? 62   ASN B N     1 
ATOM   1423 C CA    . ASN B 1 62  ? 10.133 1.150   49.771  1.00 10.54 ? 62   ASN B CA    1 
ATOM   1424 C C     . ASN B 1 62  ? 8.621  1.007   49.826  1.00 10.52 ? 62   ASN B C     1 
ATOM   1425 O O     . ASN B 1 62  ? 7.972  1.646   50.623  1.00 11.64 ? 62   ASN B O     1 
ATOM   1426 C CB    . ASN B 1 62  ? 10.810 0.435   50.955  1.00 11.21 ? 62   ASN B CB    1 
ATOM   1427 C CG    . ASN B 1 62  ? 10.585 -1.066  50.964  1.00 11.82 ? 62   ASN B CG    1 
ATOM   1428 O OD1   . ASN B 1 62  ? 10.301 -1.616  52.032  1.00 14.41 ? 62   ASN B OD1   1 
ATOM   1429 N ND2   . ASN B 1 62  ? 10.754 -1.745  49.838  1.00 12.55 ? 62   ASN B ND2   1 
ATOM   1430 N N     . VAL B 1 63  ? 8.077  0.210   48.907  1.00 10.02 ? 63   VAL B N     1 
ATOM   1431 C CA    . VAL B 1 63  ? 6.645  -0.088  48.816  1.00 10.92 ? 63   VAL B CA    1 
ATOM   1432 C C     . VAL B 1 63  ? 6.451  -1.555  48.416  1.00 10.45 ? 63   VAL B C     1 
ATOM   1433 O O     . VAL B 1 63  ? 7.347  -2.193  47.885  1.00 11.65 ? 63   VAL B O     1 
ATOM   1434 C CB    . VAL B 1 63  ? 5.968  0.799   47.754  1.00 11.33 ? 63   VAL B CB    1 
ATOM   1435 C CG1   . VAL B 1 63  ? 6.176  2.295   48.068  1.00 11.40 ? 63   VAL B CG1   1 
ATOM   1436 C CG2   . VAL B 1 63  ? 6.471  0.485   46.345  1.00 12.14 ? 63   VAL B CG2   1 
ATOM   1437 N N     . ALA B 1 64  ? 5.270  -2.108  48.704  1.00 11.66 ? 64   ALA B N     1 
ATOM   1438 C CA    . ALA B 1 64  ? 4.968  -3.464  48.240  1.00 11.50 ? 64   ALA B CA    1 
ATOM   1439 C C     . ALA B 1 64  ? 4.822  -3.466  46.724  1.00 11.48 ? 64   ALA B C     1 
ATOM   1440 O O     . ALA B 1 64  ? 4.383  -2.481  46.113  1.00 11.58 ? 64   ALA B O     1 
ATOM   1441 C CB    . ALA B 1 64  ? 3.667  -3.972  48.863  1.00 12.02 ? 64   ALA B CB    1 
ATOM   1442 N N     . CYS B 1 65  ? 5.175  -4.601  46.132  1.00 11.90 ? 65   CYS B N     1 
ATOM   1443 C CA    . CYS B 1 65  ? 4.990  -4.865  44.722  1.00 11.86 ? 65   CYS B CA    1 
ATOM   1444 C C     . CYS B 1 65  ? 3.587  -5.457  44.467  1.00 12.12 ? 65   CYS B C     1 
ATOM   1445 O O     . CYS B 1 65  ? 2.957  -6.013  45.371  1.00 13.05 ? 65   CYS B O     1 
ATOM   1446 C CB    . CYS B 1 65  ? 5.989  -5.925  44.229  1.00 12.02 ? 65   CYS B CB    1 
ATOM   1447 S SG    . CYS B 1 65  ? 7.729  -5.617  44.497  1.00 14.13 ? 65   CYS B SG    1 
ATOM   1448 N N     . LYS B 1 66  ? 3.111  -5.357  43.233  1.00 12.31 ? 66   LYS B N     1 
ATOM   1449 C CA    . LYS B 1 66  ? 1.814  -5.926  42.869  1.00 12.67 ? 66   LYS B CA    1 
ATOM   1450 C C     . LYS B 1 66  ? 1.695  -7.398  43.265  1.00 12.92 ? 66   LYS B C     1 
ATOM   1451 O O     . LYS B 1 66  ? 0.625  -7.838  43.733  1.00 13.77 ? 66   LYS B O     1 
ATOM   1452 C CB    . LYS B 1 66  ? 1.585  -5.783  41.364  1.00 13.84 ? 66   LYS B CB    1 
ATOM   1453 C CG    . LYS B 1 66  ? 0.212  -6.267  40.907  1.00 15.86 ? 66   LYS B CG    1 
ATOM   1454 C CD    . LYS B 1 66  ? 0.002  -6.071  39.431  1.00 19.17 ? 66   LYS B CD    1 
ATOM   1455 C CE    . LYS B 1 66  ? -1.324 -6.648  39.010  1.00 21.94 ? 66   LYS B CE    1 
ATOM   1456 N NZ    . LYS B 1 66  ? -1.478 -6.577  37.547  1.00 24.61 ? 66   LYS B NZ    1 
ATOM   1457 N N     . ASN B 1 67  ? 2.782  -8.147  43.149  1.00 12.61 ? 67   ASN B N     1 
ATOM   1458 C CA    . ASN B 1 67  ? 2.765  -9.581  43.417  1.00 14.00 ? 67   ASN B CA    1 
ATOM   1459 C C     . ASN B 1 67  ? 2.909  -9.948  44.878  1.00 13.95 ? 67   ASN B C     1 
ATOM   1460 O O     . ASN B 1 67  ? 2.970  -11.142 45.202  1.00 15.42 ? 67   ASN B O     1 
ATOM   1461 C CB    . ASN B 1 67  ? 3.830  -10.294 42.577  1.00 14.84 ? 67   ASN B CB    1 
ATOM   1462 C CG    . ASN B 1 67  ? 5.253  -10.024 43.046  1.00 14.37 ? 67   ASN B CG    1 
ATOM   1463 O OD1   . ASN B 1 67  ? 5.512  -9.292  44.002  1.00 14.52 ? 67   ASN B OD1   1 
ATOM   1464 N ND2   . ASN B 1 67  ? 6.202  -10.662 42.353  1.00 17.01 ? 67   ASN B ND2   1 
ATOM   1465 N N     . GLY B 1 68  ? 2.993  -8.960  45.764  1.00 13.72 ? 68   GLY B N     1 
ATOM   1466 C CA    . GLY B 1 68  ? 3.068  -9.225  47.184  1.00 13.57 ? 68   GLY B CA    1 
ATOM   1467 C C     . GLY B 1 68  ? 4.446  -9.179  47.819  1.00 14.43 ? 68   GLY B C     1 
ATOM   1468 O O     . GLY B 1 68  ? 4.576  -9.100  49.035  1.00 15.40 ? 68   GLY B O     1 
ATOM   1469 N N     . GLN B 1 69  ? 5.477  -9.265  47.003  1.00 13.90 ? 69   GLN B N     1 
ATOM   1470 C CA    . GLN B 1 69  ? 6.827  -9.109  47.511  1.00 13.71 ? 69   GLN B CA    1 
ATOM   1471 C C     . GLN B 1 69  ? 6.995  -7.666  47.960  1.00 12.69 ? 69   GLN B C     1 
ATOM   1472 O O     . GLN B 1 69  ? 6.194  -6.796  47.558  1.00 14.10 ? 69   GLN B O     1 
ATOM   1473 C CB    . GLN B 1 69  ? 7.863  -9.429  46.446  1.00 14.14 ? 69   GLN B CB    1 
ATOM   1474 C CG    . GLN B 1 69  ? 7.889  -10.917 46.154  1.00 17.77 ? 69   GLN B CG    1 
ATOM   1475 C CD    . GLN B 1 69  ? 8.247  -11.729 47.407  1.00 23.08 ? 69   GLN B CD    1 
ATOM   1476 O OE1   . GLN B 1 69  ? 9.335  -11.556 47.961  1.00 27.06 ? 69   GLN B OE1   1 
ATOM   1477 N NE2   . GLN B 1 69  ? 7.350  -12.620 47.839  1.00 26.26 ? 69   GLN B NE2   1 
ATOM   1478 N N     . THR B 1 70  ? 8.024  -7.376  48.741  1.00 12.10 ? 70   THR B N     1 
ATOM   1479 C CA    . THR B 1 70  ? 8.201  -6.024  49.248  1.00 12.92 ? 70   THR B CA    1 
ATOM   1480 C C     . THR B 1 70  ? 9.495  -5.387  48.813  1.00 12.58 ? 70   THR B C     1 
ATOM   1481 O O     . THR B 1 70  ? 9.880  -4.399  49.419  1.00 14.57 ? 70   THR B O     1 
ATOM   1482 C CB    . THR B 1 70  ? 8.124  -5.973  50.777  1.00 14.40 ? 70   THR B CB    1 
ATOM   1483 O OG1   . THR B 1 70  ? 9.153  -6.800  51.329  1.00 16.47 ? 70   THR B OG1   1 
ATOM   1484 C CG2   . THR B 1 70  ? 6.782  -6.545  51.272  1.00 16.64 ? 70   THR B CG2   1 
ATOM   1485 N N     . ASN B 1 71  ? 10.139 -5.905  47.763  1.00 10.57 ? 71   ASN B N     1 
ATOM   1486 C CA    . ASN B 1 71  ? 11.380 -5.340  47.247  1.00 10.21 ? 71   ASN B CA    1 
ATOM   1487 C C     . ASN B 1 71  ? 11.112 -4.312  46.147  1.00 9.40  ? 71   ASN B C     1 
ATOM   1488 O O     . ASN B 1 71  ? 11.893 -4.201  45.203  1.00 10.08 ? 71   ASN B O     1 
ATOM   1489 C CB    . ASN B 1 71  ? 12.307 -6.444  46.746  1.00 10.49 ? 71   ASN B CB    1 
ATOM   1490 C CG    . ASN B 1 71  ? 11.708 -7.241  45.595  1.00 10.05 ? 71   ASN B CG    1 
ATOM   1491 O OD1   . ASN B 1 71  ? 10.553 -7.661  45.651  1.00 11.57 ? 71   ASN B OD1   1 
ATOM   1492 N ND2   . ASN B 1 71  ? 12.510 -7.520  44.570  1.00 10.51 ? 71   ASN B ND2   1 
ATOM   1493 N N     . CYS B 1 72  ? 10.005 -3.578  46.258  1.00 9.18  ? 72   CYS B N     1 
ATOM   1494 C CA    . CYS B 1 72  ? 9.690  -2.523  45.290  1.00 8.71  ? 72   CYS B CA    1 
ATOM   1495 C C     . CYS B 1 72  ? 9.991  -1.164  45.866  1.00 9.24  ? 72   CYS B C     1 
ATOM   1496 O O     . CYS B 1 72  ? 9.967  -0.958  47.061  1.00 9.80  ? 72   CYS B O     1 
ATOM   1497 C CB    . CYS B 1 72  ? 8.244  -2.619  44.789  1.00 9.74  ? 72   CYS B CB    1 
ATOM   1498 S SG    . CYS B 1 72  ? 8.043  -3.885  43.470  1.00 12.06 ? 72   CYS B SG    1 
ATOM   1499 N N     . TYR B 1 73  ? 10.281 -0.250  44.969  1.00 9.59  ? 73   TYR B N     1 
ATOM   1500 C CA    . TYR B 1 73  ? 10.701 1.099   45.311  1.00 9.32  ? 73   TYR B CA    1 
ATOM   1501 C C     . TYR B 1 73  ? 10.074 2.093   44.357  1.00 9.57  ? 73   TYR B C     1 
ATOM   1502 O O     . TYR B 1 73  ? 10.093 1.898   43.123  1.00 9.64  ? 73   TYR B O     1 
ATOM   1503 C CB    . TYR B 1 73  ? 12.229 1.248   45.279  1.00 10.63 ? 73   TYR B CB    1 
ATOM   1504 C CG    . TYR B 1 73  ? 12.884 0.400   46.354  1.00 10.55 ? 73   TYR B CG    1 
ATOM   1505 C CD1   . TYR B 1 73  ? 13.127 -0.941  46.140  1.00 11.49 ? 73   TYR B CD1   1 
ATOM   1506 C CD2   . TYR B 1 73  ? 13.240 0.935   47.575  1.00 12.14 ? 73   TYR B CD2   1 
ATOM   1507 C CE1   . TYR B 1 73  ? 13.691 -1.733  47.130  1.00 12.68 ? 73   TYR B CE1   1 
ATOM   1508 C CE2   . TYR B 1 73  ? 13.810 0.154   48.533  1.00 11.73 ? 73   TYR B CE2   1 
ATOM   1509 C CZ    . TYR B 1 73  ? 14.012 -1.191  48.307  1.00 13.07 ? 73   TYR B CZ    1 
ATOM   1510 O OH    . TYR B 1 73  ? 14.587 -2.023  49.280  1.00 16.47 ? 73   TYR B OH    1 
ATOM   1511 N N     . GLN B 1 74  ? 9.493  3.140   44.930  1.00 8.75  ? 74   GLN B N     1 
ATOM   1512 C CA    . GLN B 1 74  ? 8.917  4.231   44.166  1.00 8.72  ? 74   GLN B CA    1 
ATOM   1513 C C     . GLN B 1 74  ? 9.928  5.386   44.113  1.00 8.41  ? 74   GLN B C     1 
ATOM   1514 O O     . GLN B 1 74  ? 10.498 5.793   45.140  1.00 9.89  ? 74   GLN B O     1 
ATOM   1515 C CB    . GLN B 1 74  ? 7.609  4.706   44.777  1.00 9.80  ? 74   GLN B CB    1 
ATOM   1516 C CG    . GLN B 1 74  ? 6.906  5.809   43.982  1.00 11.63 ? 74   GLN B CG    1 
ATOM   1517 C CD    . GLN B 1 74  ? 5.421  5.846   44.397  1.00 20.19 ? 74   GLN B CD    1 
ATOM   1518 O OE1   . GLN B 1 74  ? 4.560  5.224   43.769  1.00 25.40 ? 74   GLN B OE1   1 
ATOM   1519 N NE2   . GLN B 1 74  ? 5.152  6.514   45.486  1.00 13.80 ? 74   GLN B NE2   1 
ATOM   1520 N N     . SER B 1 75  ? 10.149 5.948   42.935  1.00 8.72  ? 75   SER B N     1 
ATOM   1521 C CA    . SER B 1 75  ? 11.028 7.108   42.783  1.00 8.93  ? 75   SER B CA    1 
ATOM   1522 C C     . SER B 1 75  ? 10.428 8.283   43.565  1.00 8.67  ? 75   SER B C     1 
ATOM   1523 O O     . SER B 1 75  ? 9.231  8.581   43.484  1.00 9.55  ? 75   SER B O     1 
ATOM   1524 C CB    . SER B 1 75  ? 11.232 7.481   41.312  1.00 9.24  ? 75   SER B CB    1 
ATOM   1525 O OG    . SER B 1 75  ? 10.020 7.881   40.690  1.00 9.66  ? 75   SER B OG    1 
ATOM   1526 N N     . TYR B 1 76  ? 11.259 8.994   44.326  1.00 8.75  ? 76   TYR B N     1 
ATOM   1527 C CA    . TYR B 1 76  ? 10.794 10.165  45.035  1.00 8.95  ? 76   TYR B CA    1 
ATOM   1528 C C     . TYR B 1 76  ? 10.347 11.267  44.056  1.00 9.17  ? 76   TYR B C     1 
ATOM   1529 O O     . TYR B 1 76  ? 9.375  11.975  44.313  1.00 9.69  ? 76   TYR B O     1 
ATOM   1530 C CB    . TYR B 1 76  ? 11.894 10.719  45.925  1.00 8.74  ? 76   TYR B CB    1 
ATOM   1531 C CG    . TYR B 1 76  ? 12.355 9.887   47.100  1.00 8.89  ? 76   TYR B CG    1 
ATOM   1532 C CD1   . TYR B 1 76  ? 11.482 9.155   47.885  1.00 9.36  ? 76   TYR B CD1   1 
ATOM   1533 C CD2   . TYR B 1 76  ? 13.687 9.901   47.466  1.00 9.48  ? 76   TYR B CD2   1 
ATOM   1534 C CE1   . TYR B 1 76  ? 11.921 8.474   48.995  1.00 10.07 ? 76   TYR B CE1   1 
ATOM   1535 C CE2   . TYR B 1 76  ? 14.131 9.218   48.555  1.00 9.81  ? 76   TYR B CE2   1 
ATOM   1536 C CZ    . TYR B 1 76  ? 13.253 8.508   49.331  1.00 10.84 ? 76   TYR B CZ    1 
ATOM   1537 O OH    . TYR B 1 76  ? 13.705 7.830   50.443  1.00 10.33 ? 76   TYR B OH    1 
ATOM   1538 N N     . SER B 1 77  ? 11.065 11.407  42.963  1.00 9.76  ? 77   SER B N     1 
ATOM   1539 C CA    . SER B 1 77  ? 10.774 12.442  41.963  1.00 10.34 ? 77   SER B CA    1 
ATOM   1540 C C     . SER B 1 77  ? 10.047 11.831  40.773  1.00 10.75 ? 77   SER B C     1 
ATOM   1541 O O     . SER B 1 77  ? 10.102 10.628  40.551  1.00 10.78 ? 77   SER B O     1 
ATOM   1542 C CB    . SER B 1 77  ? 12.065 13.059  41.425  1.00 11.22 ? 77   SER B CB    1 
ATOM   1543 O OG    . SER B 1 77  ? 12.890 13.550  42.463  1.00 11.76 ? 77   SER B OG    1 
ATOM   1544 N N     . THR B 1 78  ? 9.368  12.664  39.994  1.00 11.21 ? 78   THR B N     1 
ATOM   1545 C CA    . THR B 1 78  ? 8.810  12.203  38.738  1.00 12.09 ? 78   THR B CA    1 
ATOM   1546 C C     . THR B 1 78  ? 9.927  12.106  37.719  1.00 11.89 ? 78   THR B C     1 
ATOM   1547 O O     . THR B 1 78  ? 10.961 12.785  37.842  1.00 13.68 ? 78   THR B O     1 
ATOM   1548 C CB    . THR B 1 78  ? 7.730  13.146  38.195  1.00 13.28 ? 78   THR B CB    1 
ATOM   1549 O OG1   . THR B 1 78  ? 8.288  14.436  37.952  1.00 15.33 ? 78   THR B OG1   1 
ATOM   1550 C CG2   . THR B 1 78  ? 6.619  13.383  39.203  1.00 15.60 ? 78   THR B CG2   1 
ATOM   1551 N N     . MET B 1 79  ? 9.706  11.253  36.733  1.00 11.47 ? 79   MET B N     1 
ATOM   1552 C CA    . MET B 1 79  ? 10.658 10.982  35.689  1.00 11.26 ? 79   MET B CA    1 
ATOM   1553 C C     . MET B 1 79  ? 9.957  11.060  34.335  1.00 11.57 ? 79   MET B C     1 
ATOM   1554 O O     . MET B 1 79  ? 8.766  10.805  34.232  1.00 12.64 ? 79   MET B O     1 
ATOM   1555 C CB    . MET B 1 79  ? 11.262 9.586   35.880  1.00 11.36 ? 79   MET B CB    1 
ATOM   1556 C CG    . MET B 1 79  ? 12.131 9.452   37.106  1.00 10.19 ? 79   MET B CG    1 
ATOM   1557 S SD    . MET B 1 79  ? 12.945 7.858   37.166  1.00 12.18 ? 79   MET B SD    1 
ATOM   1558 C CE    . MET B 1 79  ? 14.133 8.175   38.480  1.00 12.64 ? 79   MET B CE    1 
ATOM   1559 N N     . SER B 1 80  ? 10.714 11.380  33.294  1.00 12.20 ? 80   SER B N     1 
ATOM   1560 C CA    . SER B 1 80  ? 10.232 11.389  31.929  1.00 13.07 ? 80   SER B CA    1 
ATOM   1561 C C     . SER B 1 80  ? 10.103 9.949   31.437  1.00 12.63 ? 80   SER B C     1 
ATOM   1562 O O     . SER B 1 80  ? 11.076 9.188   31.446  1.00 13.27 ? 80   SER B O     1 
ATOM   1563 C CB    . SER B 1 80  ? 11.225 12.147  31.046  1.00 14.19 ? 80   SER B CB    1 
ATOM   1564 O OG    . SER B 1 80  ? 10.855 12.025  29.695  1.00 16.23 ? 80   SER B OG    1 
ATOM   1565 N N     . ILE B 1 81  ? 8.911  9.585   30.994  1.00 12.71 ? 81   ILE B N     1 
ATOM   1566 C CA    . ILE B 1 81  ? 8.663  8.233   30.514  1.00 13.22 ? 81   ILE B CA    1 
ATOM   1567 C C     . ILE B 1 81  ? 7.816  8.281   29.231  1.00 13.51 ? 81   ILE B C     1 
ATOM   1568 O O     . ILE B 1 81  ? 7.217  9.317   28.887  1.00 14.27 ? 81   ILE B O     1 
ATOM   1569 C CB    . ILE B 1 81  ? 7.948  7.387   31.583  1.00 13.36 ? 81   ILE B CB    1 
ATOM   1570 C CG1   . ILE B 1 81  ? 6.523  7.895   31.817  1.00 14.03 ? 81   ILE B CG1   1 
ATOM   1571 C CG2   . ILE B 1 81  ? 8.743  7.315   32.889  1.00 13.25 ? 81   ILE B CG2   1 
ATOM   1572 C CD1   . ILE B 1 81  ? 5.699  7.007   32.715  1.00 16.23 ? 81   ILE B CD1   1 
ATOM   1573 N N     . THR B 1 82  ? 7.766  7.161   28.525  1.00 13.27 ? 82   THR B N     1 
ATOM   1574 C CA    . THR B 1 82  ? 6.862  6.983   27.404  1.00 13.96 ? 82   THR B CA    1 
ATOM   1575 C C     . THR B 1 82  ? 6.102  5.697   27.617  1.00 12.93 ? 82   THR B C     1 
ATOM   1576 O O     . THR B 1 82  ? 6.705  4.633   27.843  1.00 13.18 ? 82   THR B O     1 
ATOM   1577 C CB    . THR B 1 82  ? 7.626  6.866   26.085  1.00 14.51 ? 82   THR B CB    1 
ATOM   1578 O OG1   . THR B 1 82  ? 8.307  8.099   25.827  1.00 16.03 ? 82   THR B OG1   1 
ATOM   1579 C CG2   . THR B 1 82  ? 6.659  6.656   24.912  1.00 16.47 ? 82   THR B CG2   1 
ATOM   1580 N N     . ASP B 1 83  ? 4.782  5.784   27.543  1.00 13.44 ? 83   ASP B N     1 
ATOM   1581 C CA    . ASP B 1 83  ? 3.934  4.609   27.611  1.00 13.40 ? 83   ASP B CA    1 
ATOM   1582 C C     . ASP B 1 83  ? 3.616  4.110   26.212  1.00 13.46 ? 83   ASP B C     1 
ATOM   1583 O O     . ASP B 1 83  ? 3.176  4.883   25.359  1.00 14.93 ? 83   ASP B O     1 
ATOM   1584 C CB    . ASP B 1 83  ? 2.630  4.918   28.357  1.00 14.44 ? 83   ASP B CB    1 
ATOM   1585 C CG    . ASP B 1 83  ? 2.835  5.163   29.851  1.00 16.90 ? 83   ASP B CG    1 
ATOM   1586 O OD1   . ASP B 1 83  ? 3.597  4.406   30.494  1.00 20.21 ? 83   ASP B OD1   1 
ATOM   1587 O OD2   . ASP B 1 83  ? 2.250  6.094   30.462  1.00 21.03 ? 83   ASP B OD2   1 
ATOM   1588 N N     . CYS B 1 84  ? 3.833  2.832   25.986  1.00 12.67 ? 84   CYS B N     1 
ATOM   1589 C CA    . CYS B 1 84  ? 3.534  2.197   24.718  1.00 12.24 ? 84   CYS B CA    1 
ATOM   1590 C C     . CYS B 1 84  ? 2.400  1.199   24.979  1.00 12.32 ? 84   CYS B C     1 
ATOM   1591 O O     . CYS B 1 84  ? 2.535  0.338   25.844  1.00 12.77 ? 84   CYS B O     1 
ATOM   1592 C CB    . CYS B 1 84  ? 4.762  1.470   24.163  1.00 13.16 ? 84   CYS B CB    1 
ATOM   1593 S SG    . CYS B 1 84  ? 6.174  2.496   23.749  1.00 14.54 ? 84   CYS B SG    1 
ATOM   1594 N N     . ARG B 1 85  ? 1.291  1.321   24.249  1.00 12.89 ? 85   ARG B N     1 
ATOM   1595 C CA    . ARG B 1 85  ? 0.186  0.401   24.433  1.00 12.66 ? 85   ARG B CA    1 
ATOM   1596 C C     . ARG B 1 85  ? -0.306 0.034   23.048  1.00 13.25 ? 85   ARG B C     1 
ATOM   1597 O O     . ARG B 1 85  ? -0.591 0.895   22.209  1.00 13.10 ? 85   ARG B O     1 
ATOM   1598 C CB    . ARG B 1 85  ? -0.934 0.987   25.302  1.00 12.17 ? 85   ARG B CB    1 
ATOM   1599 C CG    . ARG B 1 85  ? -2.069 0.027   25.566  1.00 11.95 ? 85   ARG B CG    1 
ATOM   1600 C CD    . ARG B 1 85  ? -2.976 0.481   26.655  1.00 11.79 ? 85   ARG B CD    1 
ATOM   1601 N NE    . ARG B 1 85  ? -2.380 0.452   27.983  1.00 10.89 ? 85   ARG B NE    1 
ATOM   1602 C CZ    . ARG B 1 85  ? -2.676 -0.402  28.956  1.00 11.20 ? 85   ARG B CZ    1 
ATOM   1603 N NH1   . ARG B 1 85  ? -2.134 -0.244  30.159  1.00 11.68 ? 85   ARG B NH1   1 
ATOM   1604 N NH2   . ARG B 1 85  ? -3.541 -1.370  28.768  1.00 11.08 ? 85   ARG B NH2   1 
ATOM   1605 N N     . GLU B 1 86  ? -0.411 -1.260  22.814  1.00 13.54 ? 86   GLU B N     1 
ATOM   1606 C CA    . GLU B 1 86  ? -0.880 -1.778  21.549  1.00 14.69 ? 86   GLU B CA    1 
ATOM   1607 C C     . GLU B 1 86  ? -2.292 -1.275  21.239  1.00 14.95 ? 86   GLU B C     1 
ATOM   1608 O O     . GLU B 1 86  ? -3.116 -1.077  22.132  1.00 13.49 ? 86   GLU B O     1 
ATOM   1609 C CB    . GLU B 1 86  ? -0.858 -3.290  21.614  1.00 15.81 ? 86   GLU B CB    1 
ATOM   1610 C CG    . GLU B 1 86  ? -1.408 -4.001  20.401  1.00 17.79 ? 86   GLU B CG    1 
ATOM   1611 C CD    . GLU B 1 86  ? -1.289 -5.501  20.529  1.00 20.53 ? 86   GLU B CD    1 
ATOM   1612 O OE1   . GLU B 1 86  ? -1.577 -6.028  21.637  1.00 23.14 ? 86   GLU B OE1   1 
ATOM   1613 O OE2   . GLU B 1 86  ? -0.917 -6.142  19.515  1.00 20.95 ? 86   GLU B OE2   1 
ATOM   1614 N N     . THR B 1 87  ? -2.564 -1.048  19.963  1.00 15.44 ? 87   THR B N     1 
ATOM   1615 C CA    . THR B 1 87  ? -3.899 -0.585  19.551  1.00 16.86 ? 87   THR B CA    1 
ATOM   1616 C C     . THR B 1 87  ? -4.859 -1.768  19.590  1.00 17.66 ? 87   THR B C     1 
ATOM   1617 O O     . THR B 1 87  ? -4.454 -2.930  19.607  1.00 17.55 ? 87   THR B O     1 
ATOM   1618 C CB    . THR B 1 87  ? -3.897 0.002   18.139  1.00 17.89 ? 87   THR B CB    1 
ATOM   1619 O OG1   . THR B 1 87  ? -3.607 -1.042  17.213  1.00 19.76 ? 87   THR B OG1   1 
ATOM   1620 C CG2   . THR B 1 87  ? -2.814 1.043   17.969  1.00 18.26 ? 87   THR B CG2   1 
ATOM   1621 N N     . GLY B 1 88  ? -6.147 -1.463  19.572  1.00 18.80 ? 88   GLY B N     1 
ATOM   1622 C CA    . GLY B 1 88  ? -7.164 -2.490  19.587  1.00 20.03 ? 88   GLY B CA    1 
ATOM   1623 C C     . GLY B 1 88  ? -7.207 -3.328  18.323  1.00 20.61 ? 88   GLY B C     1 
ATOM   1624 O O     . GLY B 1 88  ? -7.692 -4.455  18.355  1.00 21.64 ? 88   GLY B O     1 
ATOM   1625 N N     . SER B 1 89  ? -6.721 -2.784  17.210  1.00 21.76 ? 89   SER B N     1 
ATOM   1626 C CA    . SER B 1 89  ? -6.726 -3.490  15.927  1.00 22.88 ? 89   SER B CA    1 
ATOM   1627 C C     . SER B 1 89  ? -5.392 -4.167  15.600  1.00 23.03 ? 89   SER B C     1 
ATOM   1628 O O     . SER B 1 89  ? -5.309 -4.981  14.664  1.00 23.08 ? 89   SER B O     1 
ATOM   1629 C CB    . SER B 1 89  ? -7.089 -2.526  14.807  1.00 23.55 ? 89   SER B CB    1 
ATOM   1630 O OG    . SER B 1 89  ? -6.113 -1.514  14.679  1.00 26.94 ? 89   SER B OG    1 
ATOM   1631 N N     . SER B 1 90  ? -4.351 -3.844  16.372  1.00 22.88 ? 90   SER B N     1 
ATOM   1632 C CA    . SER B 1 90  ? -3.024 -4.416  16.155  1.00 23.17 ? 90   SER B CA    1 
ATOM   1633 C C     . SER B 1 90  ? -3.080 -5.927  16.100  1.00 24.19 ? 90   SER B C     1 
ATOM   1634 O O     . SER B 1 90  ? -3.706 -6.559  16.943  1.00 24.81 ? 90   SER B O     1 
ATOM   1635 C CB    . SER B 1 90  ? -2.072 -3.990  17.279  1.00 22.37 ? 90   SER B CB    1 
ATOM   1636 O OG    . SER B 1 90  ? -0.823 -4.677  17.211  1.00 21.55 ? 90   SER B OG    1 
ATOM   1637 N N     . LYS B 1 91  ? -2.401 -6.502  15.115  1.00 25.60 ? 91   LYS B N     1 
ATOM   1638 C CA    . LYS B 1 91  ? -2.363 -7.941  14.959  1.00 26.70 ? 91   LYS B CA    1 
ATOM   1639 C C     . LYS B 1 91  ? -0.996 -8.389  14.459  1.00 26.86 ? 91   LYS B C     1 
ATOM   1640 O O     . LYS B 1 91  ? -0.561 -7.979  13.386  1.00 26.86 ? 91   LYS B O     1 
ATOM   1641 C CB    . LYS B 1 91  ? -3.443 -8.367  13.969  1.00 27.69 ? 91   LYS B CB    1 
ATOM   1642 C CG    . LYS B 1 91  ? -3.573 -9.854  13.802  1.00 29.52 ? 91   LYS B CG    1 
ATOM   1643 C CD    . LYS B 1 91  ? -4.675 -10.184 12.817  1.00 31.92 ? 91   LYS B CD    1 
ATOM   1644 C CE    . LYS B 1 91  ? -4.818 -11.675 12.606  1.00 32.91 ? 91   LYS B CE    1 
ATOM   1645 N NZ    . LYS B 1 91  ? -5.873 -11.968 11.597  1.00 34.30 ? 91   LYS B NZ    1 
ATOM   1646 N N     . TYR B 1 92  ? -0.327 -9.230  15.241  1.00 27.14 ? 92   TYR B N     1 
ATOM   1647 C CA    . TYR B 1 92  ? 0.972  -9.765  14.863  1.00 27.92 ? 92   TYR B CA    1 
ATOM   1648 C C     . TYR B 1 92  ? 0.878  -10.334 13.441  1.00 28.23 ? 92   TYR B C     1 
ATOM   1649 O O     . TYR B 1 92  ? -0.149 -10.906 13.090  1.00 29.04 ? 92   TYR B O     1 
ATOM   1650 C CB    . TYR B 1 92  ? 1.365  -10.867 15.844  1.00 27.90 ? 92   TYR B CB    1 
ATOM   1651 C CG    . TYR B 1 92  ? 2.696  -11.518 15.546  1.00 29.21 ? 92   TYR B CG    1 
ATOM   1652 C CD1   . TYR B 1 92  ? 3.889  -10.859 15.812  1.00 30.00 ? 92   TYR B CD1   1 
ATOM   1653 C CD2   . TYR B 1 92  ? 2.760  -12.794 14.990  1.00 29.91 ? 92   TYR B CD2   1 
ATOM   1654 C CE1   . TYR B 1 92  ? 5.113  -11.450 15.531  1.00 30.70 ? 92   TYR B CE1   1 
ATOM   1655 C CE2   . TYR B 1 92  ? 3.975  -13.396 14.722  1.00 30.68 ? 92   TYR B CE2   1 
ATOM   1656 C CZ    . TYR B 1 92  ? 5.147  -12.723 14.989  1.00 30.88 ? 92   TYR B CZ    1 
ATOM   1657 O OH    . TYR B 1 92  ? 6.356  -13.324 14.720  1.00 31.71 ? 92   TYR B OH    1 
ATOM   1658 N N     . PRO B 1 93  ? 1.920  -10.211 12.619  1.00 28.42 ? 93   PRO B N     1 
ATOM   1659 C CA    . PRO B 1 93  ? 3.197  -9.555  12.927  1.00 28.61 ? 93   PRO B CA    1 
ATOM   1660 C C     . PRO B 1 93  ? 3.238  -8.030  12.811  1.00 28.45 ? 93   PRO B C     1 
ATOM   1661 O O     . PRO B 1 93  ? 4.232  -7.405  13.201  1.00 29.59 ? 93   PRO B O     1 
ATOM   1662 C CB    . PRO B 1 93  ? 4.116  -10.169 11.869  1.00 28.73 ? 93   PRO B CB    1 
ATOM   1663 C CG    . PRO B 1 93  ? 3.226  -10.281 10.699  1.00 28.50 ? 93   PRO B CG    1 
ATOM   1664 C CD    . PRO B 1 93  ? 1.954  -10.834 11.281  1.00 28.53 ? 93   PRO B CD    1 
ATOM   1665 N N     . ASN B 1 94  ? 2.170  -7.451  12.287  1.00 27.88 ? 94   ASN B N     1 
ATOM   1666 C CA    . ASN B 1 94  ? 2.022  -6.022  12.104  1.00 27.28 ? 94   ASN B CA    1 
ATOM   1667 C C     . ASN B 1 94  ? 1.680  -5.342  13.439  1.00 26.01 ? 94   ASN B C     1 
ATOM   1668 O O     . ASN B 1 94  ? 0.585  -4.810  13.603  1.00 25.95 ? 94   ASN B O     1 
ATOM   1669 C CB    . ASN B 1 94  ? 0.883  -5.822  11.103  1.00 27.92 ? 94   ASN B CB    1 
ATOM   1670 C CG    . ASN B 1 94  ? 1.214  -6.380  9.726   1.00 29.80 ? 94   ASN B CG    1 
ATOM   1671 O OD1   . ASN B 1 94  ? 0.573  -7.321  9.246   1.00 32.27 ? 94   ASN B OD1   1 
ATOM   1672 N ND2   . ASN B 1 94  ? 2.230  -5.816  9.094   1.00 31.30 ? 94   ASN B ND2   1 
ATOM   1673 N N     . CYS B 1 95  ? 2.588  -5.408  14.414  1.00 24.54 ? 95   CYS B N     1 
ATOM   1674 C CA    . CYS B 1 95  ? 2.341  -4.793  15.721  1.00 23.51 ? 95   CYS B CA    1 
ATOM   1675 C C     . CYS B 1 95  ? 2.213  -3.284  15.615  1.00 22.38 ? 95   CYS B C     1 
ATOM   1676 O O     . CYS B 1 95  ? 3.055  -2.634  15.010  1.00 23.66 ? 95   CYS B O     1 
ATOM   1677 C CB    . CYS B 1 95  ? 3.471  -5.131  16.681  1.00 23.94 ? 95   CYS B CB    1 
ATOM   1678 S SG    . CYS B 1 95  ? 3.641  -6.904  16.926  1.00 24.22 ? 95   CYS B SG    1 
ATOM   1679 N N     . ALA B 1 96  ? 1.160  -2.724  16.207  1.00 20.21 ? 96   ALA B N     1 
ATOM   1680 C CA    . ALA B 1 96  ? 0.926  -1.302  16.149  1.00 19.03 ? 96   ALA B CA    1 
ATOM   1681 C C     . ALA B 1 96  ? 0.684  -0.803  17.557  1.00 17.31 ? 96   ALA B C     1 
ATOM   1682 O O     . ALA B 1 96  ? -0.076 -1.411  18.303  1.00 16.83 ? 96   ALA B O     1 
ATOM   1683 C CB    . ALA B 1 96  ? -0.282 -1.012  15.266  1.00 18.96 ? 96   ALA B CB    1 
ATOM   1684 N N     . TYR B 1 97  ? 1.298  0.327   17.876  1.00 15.65 ? 97   TYR B N     1 
ATOM   1685 C CA    . TYR B 1 97  ? 1.264  0.902   19.220  1.00 15.51 ? 97   TYR B CA    1 
ATOM   1686 C C     . TYR B 1 97  ? 0.931  2.382   19.196  1.00 15.83 ? 97   TYR B C     1 
ATOM   1687 O O     . TYR B 1 97  ? 1.243  3.087   18.239  1.00 17.62 ? 97   TYR B O     1 
ATOM   1688 C CB    . TYR B 1 97  ? 2.647  0.756   19.896  1.00 15.18 ? 97   TYR B CB    1 
ATOM   1689 C CG    . TYR B 1 97  ? 3.038  -0.656  20.170  1.00 15.91 ? 97   TYR B CG    1 
ATOM   1690 C CD1   . TYR B 1 97  ? 2.687  -1.257  21.379  1.00 15.26 ? 97   TYR B CD1   1 
ATOM   1691 C CD2   . TYR B 1 97  ? 3.751  -1.391  19.241  1.00 16.52 ? 97   TYR B CD2   1 
ATOM   1692 C CE1   . TYR B 1 97  ? 3.021  -2.545  21.631  1.00 14.59 ? 97   TYR B CE1   1 
ATOM   1693 C CE2   . TYR B 1 97  ? 4.099  -2.692  19.493  1.00 15.53 ? 97   TYR B CE2   1 
ATOM   1694 C CZ    . TYR B 1 97  ? 3.733  -3.259  20.683  1.00 15.31 ? 97   TYR B CZ    1 
ATOM   1695 O OH    . TYR B 1 97  ? 4.061  -4.557  20.912  1.00 15.55 ? 97   TYR B OH    1 
ATOM   1696 N N     . LYS B 1 98  ? 0.327  2.844   20.284  1.00 16.06 ? 98   LYS B N     1 
ATOM   1697 C CA    . LYS B 1 98  ? 0.104  4.259   20.520  1.00 16.80 ? 98   LYS B CA    1 
ATOM   1698 C C     . LYS B 1 98  ? 1.175  4.730   21.510  1.00 16.50 ? 98   LYS B C     1 
ATOM   1699 O O     . LYS B 1 98  ? 1.415  4.081   22.551  1.00 15.92 ? 98   LYS B O     1 
ATOM   1700 C CB    . LYS B 1 98  ? -1.284 4.465   21.130  1.00 17.47 ? 98   LYS B CB    1 
ATOM   1701 C CG    . LYS B 1 98  ? -1.876 5.842   21.046  1.00 22.42 ? 98   LYS B CG    1 
ATOM   1702 C CD    . LYS B 1 98  ? -1.114 6.850   21.839  1.00 24.62 ? 98   LYS B CD    1 
ATOM   1703 C CE    . LYS B 1 98  ? -1.738 8.227   21.672  1.00 26.16 ? 98   LYS B CE    1 
ATOM   1704 N NZ    . LYS B 1 98  ? -0.987 9.278   22.371  1.00 28.53 ? 98   LYS B NZ    1 
ATOM   1705 N N     . THR B 1 99  ? 1.808  5.849   21.187  1.00 16.09 ? 99   THR B N     1 
ATOM   1706 C CA    . THR B 1 99  ? 2.843  6.456   21.995  1.00 16.76 ? 99   THR B CA    1 
ATOM   1707 C C     . THR B 1 99  ? 2.288  7.593   22.831  1.00 16.82 ? 99   THR B C     1 
ATOM   1708 O O     . THR B 1 99  ? 1.677  8.522   22.263  1.00 17.88 ? 99   THR B O     1 
ATOM   1709 C CB    . THR B 1 99  ? 3.933  7.024   21.059  1.00 17.02 ? 99   THR B CB    1 
ATOM   1710 O OG1   . THR B 1 99  ? 4.557  5.970   20.312  1.00 17.86 ? 99   THR B OG1   1 
ATOM   1711 C CG2   . THR B 1 99  ? 5.050  7.673   21.853  1.00 17.48 ? 99   THR B CG2   1 
ATOM   1712 N N     . THR B 1 100 ? 2.505  7.557   24.146  1.00 16.86 ? 100  THR B N     1 
ATOM   1713 C CA    . THR B 1 100 ? 2.067  8.636   25.022  1.00 16.96 ? 100  THR B CA    1 
ATOM   1714 C C     . THR B 1 100 ? 3.191  9.039   25.943  1.00 16.47 ? 100  THR B C     1 
ATOM   1715 O O     . THR B 1 100 ? 3.703  8.206   26.702  1.00 17.11 ? 100  THR B O     1 
ATOM   1716 C CB    . THR B 1 100 ? 0.853  8.219   25.871  1.00 17.28 ? 100  THR B CB    1 
ATOM   1717 O OG1   . THR B 1 100 ? -0.211 7.739   25.028  1.00 16.69 ? 100  THR B OG1   1 
ATOM   1718 C CG2   . THR B 1 100 ? 0.254  9.420   26.608  1.00 18.34 ? 100  THR B CG2   1 
ATOM   1719 N N     . GLN B 1 101 ? 3.574  10.309  25.912  1.00 16.83 ? 101  GLN B N     1 
ATOM   1720 C CA    . GLN B 1 101 ? 4.615  10.832  26.773  1.00 17.62 ? 101  GLN B CA    1 
ATOM   1721 C C     . GLN B 1 101 ? 4.005  11.214  28.100  1.00 16.59 ? 101  GLN B C     1 
ATOM   1722 O O     . GLN B 1 101 ? 2.857  11.660  28.153  1.00 16.82 ? 101  GLN B O     1 
ATOM   1723 C CB    . GLN B 1 101 ? 5.260  12.071  26.156  1.00 18.44 ? 101  GLN B CB    1 
ATOM   1724 C CG    . GLN B 1 101 ? 5.599  11.926  24.676  1.00 22.38 ? 101  GLN B CG    1 
ATOM   1725 C CD    . GLN B 1 101 ? 6.100  13.209  24.043  1.00 26.89 ? 101  GLN B CD    1 
ATOM   1726 O OE1   . GLN B 1 101 ? 5.406  14.231  24.070  1.00 30.35 ? 101  GLN B OE1   1 
ATOM   1727 N NE2   . GLN B 1 101 ? 7.287  13.160  23.454  1.00 30.07 ? 101  GLN B NE2   1 
ATOM   1728 N N     . ALA B 1 102 ? 4.779  11.057  29.177  1.00 16.54 ? 102  ALA B N     1 
ATOM   1729 C CA    . ALA B 1 102 ? 4.306  11.408  30.502  1.00 16.79 ? 102  ALA B CA    1 
ATOM   1730 C C     . ALA B 1 102 ? 5.475  11.684  31.456  1.00 16.18 ? 102  ALA B C     1 
ATOM   1731 O O     . ALA B 1 102 ? 6.630  11.420  31.142  1.00 15.92 ? 102  ALA B O     1 
ATOM   1732 C CB    . ALA B 1 102 ? 3.419  10.302  31.060  1.00 17.91 ? 102  ALA B CB    1 
ATOM   1733 N N     . ASN B 1 103 ? 5.133  12.250  32.605  1.00 17.02 ? 103  ASN B N     1 
ATOM   1734 C CA    . ASN B 1 103 ? 6.094  12.547  33.662  1.00 17.43 ? 103  ASN B CA    1 
ATOM   1735 C C     . ASN B 1 103 ? 5.483  12.019  34.950  1.00 15.85 ? 103  ASN B C     1 
ATOM   1736 O O     . ASN B 1 103 ? 4.533  12.621  35.468  1.00 16.24 ? 103  ASN B O     1 
ATOM   1737 C CB    . ASN B 1 103 ? 6.343  14.044  33.769  1.00 18.48 ? 103  ASN B CB    1 
ATOM   1738 C CG    . ASN B 1 103 ? 7.188  14.576  32.645  1.00 21.80 ? 103  ASN B CG    1 
ATOM   1739 O OD1   . ASN B 1 103 ? 8.374  14.281  32.551  1.00 23.75 ? 103  ASN B OD1   1 
ATOM   1740 N ND2   . ASN B 1 103 ? 6.581  15.378  31.783  1.00 25.85 ? 103  ASN B ND2   1 
ATOM   1741 N N     . LYS B 1 104 ? 6.002  10.890  35.450  1.00 14.07 ? 104  LYS B N     1 
ATOM   1742 C CA    . LYS B 1 104 ? 5.424  10.226  36.616  1.00 13.24 ? 104  LYS B CA    1 
ATOM   1743 C C     . LYS B 1 104 ? 6.497  9.569   37.458  1.00 11.95 ? 104  LYS B C     1 
ATOM   1744 O O     . LYS B 1 104 ? 7.636  9.422   37.039  1.00 11.52 ? 104  LYS B O     1 
ATOM   1745 C CB    . LYS B 1 104 ? 4.412  9.163   36.194  1.00 14.27 ? 104  LYS B CB    1 
ATOM   1746 C CG    . LYS B 1 104 ? 3.190  9.751   35.498  1.00 17.80 ? 104  LYS B CG    1 
ATOM   1747 C CD    . LYS B 1 104 ? 2.146  8.711   35.291  1.00 22.79 ? 104  LYS B CD    1 
ATOM   1748 C CE    . LYS B 1 104 ? 0.936  9.296   34.608  1.00 24.78 ? 104  LYS B CE    1 
ATOM   1749 N NZ    . LYS B 1 104 ? -0.098 8.264   34.421  1.00 27.75 ? 104  LYS B NZ    1 
ATOM   1750 N N     . HIS B 1 105 ? 6.115  9.219   38.665  1.00 11.81 ? 105  HIS B N     1 
ATOM   1751 C CA    . HIS B 1 105 ? 6.992  8.447   39.527  1.00 10.93 ? 105  HIS B CA    1 
ATOM   1752 C C     . HIS B 1 105 ? 7.042  7.004   39.000  1.00 11.05 ? 105  HIS B C     1 
ATOM   1753 O O     . HIS B 1 105 ? 6.043  6.501   38.515  1.00 13.51 ? 105  HIS B O     1 
ATOM   1754 C CB    . HIS B 1 105 ? 6.453  8.422   40.951  1.00 11.18 ? 105  HIS B CB    1 
ATOM   1755 C CG    . HIS B 1 105 ? 6.377  9.770   41.602  1.00 11.37 ? 105  HIS B CG    1 
ATOM   1756 N ND1   . HIS B 1 105 ? 5.324  10.653  41.444  1.00 14.32 ? 105  HIS B ND1   1 
ATOM   1757 C CD2   . HIS B 1 105 ? 7.261  10.387  42.429  1.00 11.98 ? 105  HIS B CD2   1 
ATOM   1758 C CE1   . HIS B 1 105 ? 5.582  11.755  42.143  1.00 13.33 ? 105  HIS B CE1   1 
ATOM   1759 N NE2   . HIS B 1 105 ? 6.745  11.615  42.749  1.00 14.96 ? 105  HIS B NE2   1 
ATOM   1760 N N     . ILE B 1 106 ? 8.165  6.327   39.045  1.00 10.54 ? 106  ILE B N     1 
ATOM   1761 C CA    . ILE B 1 106 ? 8.194  4.932   38.627  1.00 9.72  ? 106  ILE B CA    1 
ATOM   1762 C C     . ILE B 1 106 ? 8.287  4.030   39.867  1.00 9.29  ? 106  ILE B C     1 
ATOM   1763 O O     . ILE B 1 106 ? 8.811  4.443   40.898  1.00 10.27 ? 106  ILE B O     1 
ATOM   1764 C CB    . ILE B 1 106 ? 9.327  4.645   37.652  1.00 10.00 ? 106  ILE B CB    1 
ATOM   1765 C CG1   . ILE B 1 106 ? 10.697 4.837   38.298  1.00 10.67 ? 106  ILE B CG1   1 
ATOM   1766 C CG2   . ILE B 1 106 ? 9.166  5.538   36.462  1.00 12.24 ? 106  ILE B CG2   1 
ATOM   1767 C CD1   . ILE B 1 106 ? 11.842 4.399   37.434  1.00 12.37 ? 106  ILE B CD1   1 
ATOM   1768 N N     . ILE B 1 107 ? 7.739  2.816   39.753  1.00 9.10  ? 107  ILE B N     1 
ATOM   1769 C CA    . ILE B 1 107 ? 7.866  1.814   40.809  1.00 9.60  ? 107  ILE B CA    1 
ATOM   1770 C C     . ILE B 1 107 ? 8.506  0.587   40.186  1.00 9.33  ? 107  ILE B C     1 
ATOM   1771 O O     . ILE B 1 107 ? 7.992  0.052   39.186  1.00 10.43 ? 107  ILE B O     1 
ATOM   1772 C CB    . ILE B 1 107 ? 6.503  1.458   41.433  1.00 10.87 ? 107  ILE B CB    1 
ATOM   1773 C CG1   . ILE B 1 107 ? 5.842  2.706   41.995  1.00 12.19 ? 107  ILE B CG1   1 
ATOM   1774 C CG2   . ILE B 1 107 ? 6.670  0.380   42.505  1.00 11.82 ? 107  ILE B CG2   1 
ATOM   1775 C CD1   . ILE B 1 107 ? 4.490  2.434   42.669  1.00 12.49 ? 107  ILE B CD1   1 
ATOM   1776 N N     . VAL B 1 108 ? 9.644  0.186   40.729  1.00 9.64  ? 108  VAL B N     1 
ATOM   1777 C CA    . VAL B 1 108 ? 10.429 -0.928  40.227  1.00 9.45  ? 108  VAL B CA    1 
ATOM   1778 C C     . VAL B 1 108 ? 10.751 -1.887  41.362  1.00 9.54  ? 108  VAL B C     1 
ATOM   1779 O O     . VAL B 1 108 ? 10.871 -1.495  42.500  1.00 10.16 ? 108  VAL B O     1 
ATOM   1780 C CB    . VAL B 1 108 ? 11.747 -0.421  39.564  1.00 10.04 ? 108  VAL B CB    1 
ATOM   1781 C CG1   . VAL B 1 108 ? 11.447 0.450   38.370  1.00 10.63 ? 108  VAL B CG1   1 
ATOM   1782 C CG2   . VAL B 1 108 ? 12.623 0.306   40.550  1.00 12.49 ? 108  VAL B CG2   1 
ATOM   1783 N N     . ALA B 1 109 ? 10.939 -3.148  41.025  1.00 9.92  ? 109  ALA B N     1 
ATOM   1784 C CA    . ALA B 1 109 ? 11.421 -4.149  41.969  1.00 9.29  ? 109  ALA B CA    1 
ATOM   1785 C C     . ALA B 1 109 ? 12.925 -4.198  41.819  1.00 9.24  ? 109  ALA B C     1 
ATOM   1786 O O     . ALA B 1 109 ? 13.426 -4.152  40.685  1.00 10.92 ? 109  ALA B O     1 
ATOM   1787 C CB    . ALA B 1 109 ? 10.832 -5.521  41.642  1.00 10.47 ? 109  ALA B CB    1 
ATOM   1788 N N     . CYS B 1 110 ? 13.637 -4.305  42.929  1.00 8.88  ? 110  CYS B N     1 
ATOM   1789 C CA    . CYS B 1 110 ? 15.094 -4.275  42.917  1.00 9.70  ? 110  CYS B CA    1 
ATOM   1790 C C     . CYS B 1 110 ? 15.649 -5.566  43.513  1.00 9.85  ? 110  CYS B C     1 
ATOM   1791 O O     . CYS B 1 110 ? 15.078 -6.118  44.483  1.00 9.58  ? 110  CYS B O     1 
ATOM   1792 C CB    . CYS B 1 110 ? 15.631 -3.082  43.709  1.00 9.14  ? 110  CYS B CB    1 
ATOM   1793 S SG    . CYS B 1 110 ? 15.124 -1.515  43.012  1.00 10.69 ? 110  CYS B SG    1 
ATOM   1794 N N     . GLU B 1 111 ? 16.742 -6.061  42.945  1.00 10.43 ? 111  GLU B N     1 
ATOM   1795 C CA    . GLU B 1 111 ? 17.332 -7.296  43.450  1.00 11.33 ? 111  GLU B CA    1 
ATOM   1796 C C     . GLU B 1 111 ? 18.740 -7.455  42.911  1.00 11.51 ? 111  GLU B C     1 
ATOM   1797 O O     . GLU B 1 111 ? 19.092 -6.869  41.871  1.00 11.92 ? 111  GLU B O     1 
ATOM   1798 C CB    . GLU B 1 111 ? 16.439 -8.478  43.079  1.00 13.60 ? 111  GLU B CB    1 
ATOM   1799 C CG    . GLU B 1 111 ? 16.310 -8.857  41.668  1.00 20.48 ? 111  GLU B CG    1 
ATOM   1800 C CD    . GLU B 1 111 ? 15.553 -10.161 41.506  1.00 24.15 ? 111  GLU B CD    1 
ATOM   1801 O OE1   . GLU B 1 111 ? 14.541 -10.391 42.226  1.00 23.90 ? 111  GLU B OE1   1 
ATOM   1802 O OE2   . GLU B 1 111 ? 15.969 -10.965 40.636  1.00 28.78 ? 111  GLU B OE2   1 
ATOM   1803 N N     . GLY B 1 112 ? 19.538 -8.258  43.608  1.00 12.21 ? 112  GLY B N     1 
ATOM   1804 C CA    . GLY B 1 112 ? 20.855 -8.646  43.147  1.00 13.29 ? 112  GLY B CA    1 
ATOM   1805 C C     . GLY B 1 112 ? 21.961 -7.765  43.650  1.00 13.77 ? 112  GLY B C     1 
ATOM   1806 O O     . GLY B 1 112 ? 21.756 -6.793  44.380  1.00 13.50 ? 112  GLY B O     1 
ATOM   1807 N N     . ASN B 1 113 ? 23.168 -8.105  43.192  1.00 15.97 ? 113  ASN B N     1 
ATOM   1808 C CA    . ASN B 1 113 ? 24.383 -7.374  43.512  1.00 17.38 ? 113  ASN B CA    1 
ATOM   1809 C C     . ASN B 1 113 ? 25.102 -7.105  42.182  1.00 16.21 ? 113  ASN B C     1 
ATOM   1810 O O     . ASN B 1 113 ? 25.662 -8.051  41.586  1.00 18.79 ? 113  ASN B O     1 
ATOM   1811 C CB    . ASN B 1 113 ? 25.268 -8.226  44.410  1.00 19.49 ? 113  ASN B CB    1 
ATOM   1812 C CG    . ASN B 1 113 ? 26.479 -7.494  44.909  1.00 22.85 ? 113  ASN B CG    1 
ATOM   1813 O OD1   . ASN B 1 113 ? 27.271 -8.045  45.681  1.00 26.35 ? 113  ASN B OD1   1 
ATOM   1814 N ND2   . ASN B 1 113 ? 26.629 -6.250  44.510  1.00 26.59 ? 113  ASN B ND2   1 
ATOM   1815 N N     . PRO B 1 114 ? 25.141 -5.868  41.700  1.00 14.82 ? 114  PRO B N     1 
ATOM   1816 C CA    . PRO B 1 114 ? 24.604 -4.686  42.381  1.00 14.44 ? 114  PRO B CA    1 
ATOM   1817 C C     . PRO B 1 114 ? 23.090 -4.708  42.464  1.00 13.05 ? 114  PRO B C     1 
ATOM   1818 O O     . PRO B 1 114 ? 22.422 -5.308  41.655  1.00 12.31 ? 114  PRO B O     1 
ATOM   1819 C CB    . PRO B 1 114 ? 25.066 -3.533  41.498  1.00 15.91 ? 114  PRO B CB    1 
ATOM   1820 C CG    . PRO B 1 114 ? 25.182 -4.165  40.157  1.00 16.75 ? 114  PRO B CG    1 
ATOM   1821 C CD    . PRO B 1 114 ? 25.794 -5.507  40.428  1.00 15.59 ? 114  PRO B CD    1 
ATOM   1822 N N     . TYR B 1 115 ? 22.561 -3.997  43.451  1.00 11.78 ? 115  TYR B N     1 
ATOM   1823 C CA    . TYR B 1 115 ? 21.128 -3.961  43.745  1.00 10.49 ? 115  TYR B CA    1 
ATOM   1824 C C     . TYR B 1 115 ? 20.463 -2.989  42.806  1.00 10.44 ? 115  TYR B C     1 
ATOM   1825 O O     . TYR B 1 115 ? 20.559 -1.759  42.986  1.00 12.33 ? 115  TYR B O     1 
ATOM   1826 C CB    . TYR B 1 115 ? 20.977 -3.544  45.195  1.00 11.58 ? 115  TYR B CB    1 
ATOM   1827 C CG    . TYR B 1 115 ? 19.619 -3.706  45.799  1.00 9.60  ? 115  TYR B CG    1 
ATOM   1828 C CD1   . TYR B 1 115 ? 19.050 -4.960  45.949  1.00 11.01 ? 115  TYR B CD1   1 
ATOM   1829 C CD2   . TYR B 1 115 ? 18.888 -2.598  46.231  1.00 9.93  ? 115  TYR B CD2   1 
ATOM   1830 C CE1   . TYR B 1 115 ? 17.820 -5.119  46.559  1.00 10.74 ? 115  TYR B CE1   1 
ATOM   1831 C CE2   . TYR B 1 115 ? 17.658 -2.743  46.844  1.00 10.46 ? 115  TYR B CE2   1 
ATOM   1832 C CZ    . TYR B 1 115 ? 17.128 -4.001  47.008  1.00 10.22 ? 115  TYR B CZ    1 
ATOM   1833 O OH    . TYR B 1 115 ? 15.896 -4.149  47.618  1.00 11.36 ? 115  TYR B OH    1 
ATOM   1834 N N     . VAL B 1 116 ? 19.814 -3.518  41.772  1.00 10.19 ? 116  VAL B N     1 
ATOM   1835 C CA    . VAL B 1 116 ? 19.339 -2.711  40.650  1.00 10.77 ? 116  VAL B CA    1 
ATOM   1836 C C     . VAL B 1 116 ? 17.939 -3.130  40.238  1.00 9.59  ? 116  VAL B C     1 
ATOM   1837 O O     . VAL B 1 116 ? 17.460 -4.203  40.667  1.00 9.73  ? 116  VAL B O     1 
ATOM   1838 C CB    . VAL B 1 116 ? 20.271 -2.855  39.418  1.00 11.56 ? 116  VAL B CB    1 
ATOM   1839 C CG1   . VAL B 1 116 ? 21.652 -2.332  39.739  1.00 11.33 ? 116  VAL B CG1   1 
ATOM   1840 C CG2   . VAL B 1 116 ? 20.297 -4.288  38.938  1.00 10.93 ? 116  VAL B CG2   1 
ATOM   1841 N N     . PRO B 1 117 ? 17.237 -2.334  39.419  1.00 10.19 ? 117  PRO B N     1 
ATOM   1842 C CA    . PRO B 1 117 ? 15.901 -2.742  38.971  1.00 10.86 ? 117  PRO B CA    1 
ATOM   1843 C C     . PRO B 1 117 ? 15.883 -4.004  38.126  1.00 10.28 ? 117  PRO B C     1 
ATOM   1844 O O     . PRO B 1 117 ? 16.702 -4.150  37.225  1.00 10.99 ? 117  PRO B O     1 
ATOM   1845 C CB    . PRO B 1 117 ? 15.396 -1.516  38.186  1.00 11.12 ? 117  PRO B CB    1 
ATOM   1846 C CG    . PRO B 1 117 ? 16.185 -0.379  38.762  1.00 12.45 ? 117  PRO B CG    1 
ATOM   1847 C CD    . PRO B 1 117 ? 17.549 -0.956  39.000  1.00 11.50 ? 117  PRO B CD    1 
ATOM   1848 N N     . VAL B 1 118 ? 14.919 -4.880  38.407  1.00 10.54 ? 118  VAL B N     1 
ATOM   1849 C CA    . VAL B 1 118 ? 14.731 -6.118  37.670  1.00 10.96 ? 118  VAL B CA    1 
ATOM   1850 C C     . VAL B 1 118 ? 13.303 -6.287  37.165  1.00 11.37 ? 118  VAL B C     1 
ATOM   1851 O O     . VAL B 1 118 ? 12.993 -7.270  36.506  1.00 13.24 ? 118  VAL B O     1 
ATOM   1852 C CB    . VAL B 1 118 ? 15.130 -7.337  38.553  1.00 11.84 ? 118  VAL B CB    1 
ATOM   1853 C CG1   . VAL B 1 118 ? 16.609 -7.318  38.845  1.00 12.62 ? 118  VAL B CG1   1 
ATOM   1854 C CG2   . VAL B 1 118 ? 14.274 -7.451  39.830  1.00 11.73 ? 118  VAL B CG2   1 
ATOM   1855 N N     . HIS B 1 119 ? 12.428 -5.333  37.446  1.00 10.22 ? 119  HIS B N     1 
ATOM   1856 C CA    . HIS B 1 119 ? 11.034 -5.421  37.001  1.00 11.05 ? 119  HIS B CA    1 
ATOM   1857 C C     . HIS B 1 119 ? 10.413 -4.046  37.107  1.00 10.40 ? 119  HIS B C     1 
ATOM   1858 O O     . HIS B 1 119 ? 10.676 -3.312  38.086  1.00 10.55 ? 119  HIS B O     1 
ATOM   1859 C CB    . HIS B 1 119 ? 10.278 -6.427  37.888  1.00 11.88 ? 119  HIS B CB    1 
ATOM   1860 C CG    . HIS B 1 119 ? 8.797  -6.246  37.933  1.00 15.54 ? 119  HIS B CG    1 
ATOM   1861 N ND1   . HIS B 1 119 ? 7.954  -6.670  36.933  1.00 17.37 ? 119  HIS B ND1   1 
ATOM   1862 C CD2   . HIS B 1 119 ? 8.010  -5.741  38.908  1.00 17.11 ? 119  HIS B CD2   1 
ATOM   1863 C CE1   . HIS B 1 119 ? 6.705  -6.393  37.272  1.00 17.19 ? 119  HIS B CE1   1 
ATOM   1864 N NE2   . HIS B 1 119 ? 6.713  -5.838  38.473  1.00 18.71 ? 119  HIS B NE2   1 
ATOM   1865 N N     . PHE B 1 120 ? 9.592  -3.684  36.126  1.00 10.54 ? 120  PHE B N     1 
ATOM   1866 C CA    . PHE B 1 120 ? 8.859  -2.432  36.149  1.00 10.64 ? 120  PHE B CA    1 
ATOM   1867 C C     . PHE B 1 120 ? 7.458  -2.740  36.668  1.00 10.93 ? 120  PHE B C     1 
ATOM   1868 O O     . PHE B 1 120 ? 6.705  -3.495  36.036  1.00 12.95 ? 120  PHE B O     1 
ATOM   1869 C CB    . PHE B 1 120 ? 8.793  -1.812  34.742  1.00 10.91 ? 120  PHE B CB    1 
ATOM   1870 C CG    . PHE B 1 120 ? 8.284  -0.385  34.734  1.00 11.71 ? 120  PHE B CG    1 
ATOM   1871 C CD1   . PHE B 1 120 ? 6.942  -0.085  34.717  1.00 14.35 ? 120  PHE B CD1   1 
ATOM   1872 C CD2   . PHE B 1 120 ? 9.184  0.667   34.824  1.00 13.96 ? 120  PHE B CD2   1 
ATOM   1873 C CE1   . PHE B 1 120 ? 6.524  1.260   34.732  1.00 15.24 ? 120  PHE B CE1   1 
ATOM   1874 C CE2   . PHE B 1 120 ? 8.775  1.979   34.831  1.00 15.54 ? 120  PHE B CE2   1 
ATOM   1875 C CZ    . PHE B 1 120 ? 7.453  2.266   34.815  1.00 14.94 ? 120  PHE B CZ    1 
ATOM   1876 N N     . ASP B 1 121 ? 7.110  -2.205  37.826  1.00 11.28 ? 121  ASP B N     1 
ATOM   1877 C CA    . ASP B 1 121 ? 5.820  -2.537  38.443  1.00 11.62 ? 121  ASP B CA    1 
ATOM   1878 C C     . ASP B 1 121 ? 4.701  -1.601  38.006  1.00 12.50 ? 121  ASP B C     1 
ATOM   1879 O O     . ASP B 1 121 ? 3.612  -2.073  37.664  1.00 15.62 ? 121  ASP B O     1 
ATOM   1880 C CB    . ASP B 1 121 ? 5.942  -2.542  39.969  1.00 12.70 ? 121  ASP B CB    1 
ATOM   1881 C CG    . ASP B 1 121 ? 5.042  -3.562  40.648  1.00 12.48 ? 121  ASP B CG    1 
ATOM   1882 O OD1   . ASP B 1 121 ? 5.081  -4.753  40.231  1.00 14.28 ? 121  ASP B OD1   1 
ATOM   1883 O OD2   . ASP B 1 121 ? 4.371  -3.261  41.655  1.00 13.77 ? 121  ASP B OD2   1 
ATOM   1884 N N     . ALA B 1 122 ? 4.942  -0.294  37.950  1.00 11.36 ? 122  ALA B N     1 
ATOM   1885 C CA    . ALA B 1 122 ? 3.914  0.663   37.568  1.00 11.98 ? 122  ALA B CA    1 
ATOM   1886 C C     . ALA B 1 122 ? 4.515  2.072   37.534  1.00 11.71 ? 122  ALA B C     1 
ATOM   1887 O O     . ALA B 1 122 ? 5.639  2.299   38.010  1.00 11.78 ? 122  ALA B O     1 
ATOM   1888 C CB    . ALA B 1 122 ? 2.772  0.635   38.590  1.00 13.41 ? 122  ALA B CB    1 
ATOM   1889 N N     . SER B 1 123 ? 3.759  3.044   37.030  1.00 12.34 ? 123  SER B N     1 
ATOM   1890 C CA    . SER B 1 123 ? 4.085  4.470   37.173  1.00 13.22 ? 123  SER B CA    1 
ATOM   1891 C C     . SER B 1 123 ? 2.915  5.140   37.854  1.00 13.28 ? 123  SER B C     1 
ATOM   1892 O O     . SER B 1 123 ? 1.746  4.755   37.587  1.00 15.13 ? 123  SER B O     1 
ATOM   1893 C CB    . SER B 1 123 ? 4.345  5.135   35.830  1.00 13.54 ? 123  SER B CB    1 
ATOM   1894 O OG    . SER B 1 123 ? 3.210  5.144   35.005  1.00 18.60 ? 123  SER B OG    1 
ATOM   1895 N N     . VAL B 1 124 ? 3.156  6.058   38.778  1.00 12.68 ? 124  VAL B N     1 
ATOM   1896 C CA    . VAL B 1 124 ? 2.085  6.754   39.465  1.00 14.31 ? 124  VAL B CA    1 
ATOM   1897 C C     . VAL B 1 124 ? 2.295  8.273   39.501  1.00 14.06 ? 124  VAL B C     1 
ATOM   1898 O O     . VAL B 1 124 ? 3.351  8.765   39.135  1.00 15.55 ? 124  VAL B O     1 
ATOM   1899 C CB    . VAL B 1 124 ? 1.895  6.233   40.925  1.00 15.47 ? 124  VAL B CB    1 
ATOM   1900 C CG1   . VAL B 1 124 ? 1.584  4.764   40.909  1.00 16.57 ? 124  VAL B CG1   1 
ATOM   1901 C CG2   . VAL B 1 124 ? 3.091  6.517   41.804  1.00 16.74 ? 124  VAL B CG2   1 
ATOM   1902 O OXT   . VAL B 1 124 ? 1.362  8.997   39.925  1.00 16.11 ? 124  VAL B OXT   1 
HETATM 1903 P P1    . A2P C 2 .   ? 36.359 3.609   13.442  1.00 12.74 ? 998  A2P A P1    1 
HETATM 1904 O O1P   . A2P C 2 .   ? 36.727 4.959   13.977  1.00 17.06 ? 998  A2P A O1P   1 
HETATM 1905 O O2P   . A2P C 2 .   ? 37.206 3.214   12.304  1.00 19.95 ? 998  A2P A O2P   1 
HETATM 1906 O O3P   . A2P C 2 .   ? 34.880 3.501   13.326  1.00 12.41 ? 998  A2P A O3P   1 
HETATM 1907 P P2    . A2P C 2 .   ? 42.144 2.305   13.332  1.00 26.92 ? 998  A2P A P2    1 
HETATM 1908 O O4P   . A2P C 2 .   ? 41.844 3.650   12.731  1.00 29.87 ? 998  A2P A O4P   1 
HETATM 1909 O O5P   . A2P C 2 .   ? 43.387 2.367   14.184  1.00 28.88 ? 998  A2P A O5P   1 
HETATM 1910 O O6P   . A2P C 2 .   ? 42.102 1.289   12.226  1.00 29.67 ? 998  A2P A O6P   1 
HETATM 1911 O "O5'" . A2P C 2 .   ? 40.897 1.924   14.270  1.00 23.67 ? 998  A2P A "O5'" 1 
HETATM 1912 C "C5'" . A2P C 2 .   ? 40.842 0.693   14.969  1.00 20.53 ? 998  A2P A "C5'" 1 
HETATM 1913 C "C4'" . A2P C 2 .   ? 39.561 0.668   15.802  1.00 17.36 ? 998  A2P A "C4'" 1 
HETATM 1914 O "O4'" . A2P C 2 .   ? 39.511 1.724   16.783  1.00 17.70 ? 998  A2P A "O4'" 1 
HETATM 1915 C "C3'" . A2P C 2 .   ? 38.300 0.868   14.960  1.00 15.58 ? 998  A2P A "C3'" 1 
HETATM 1916 O "O3'" . A2P C 2 .   ? 37.198 0.168   15.518  1.00 17.21 ? 998  A2P A "O3'" 1 
HETATM 1917 C "C2'" . A2P C 2 .   ? 38.089 2.369   15.024  1.00 14.04 ? 998  A2P A "C2'" 1 
HETATM 1918 O "O2'" . A2P C 2 .   ? 36.737 2.710   14.736  1.00 13.29 ? 998  A2P A "O2'" 1 
HETATM 1919 C "C1'" . A2P C 2 .   ? 38.466 2.657   16.463  1.00 14.60 ? 998  A2P A "C1'" 1 
HETATM 1920 N N9    . A2P C 2 .   ? 39.021 3.998   16.742  1.00 14.57 ? 998  A2P A N9    1 
HETATM 1921 C C8    . A2P C 2 .   ? 39.665 4.807   15.850  1.00 14.56 ? 998  A2P A C8    1 
HETATM 1922 N N7    . A2P C 2 .   ? 40.109 5.951   16.423  1.00 15.49 ? 998  A2P A N7    1 
HETATM 1923 C C5    . A2P C 2 .   ? 39.732 5.843   17.703  1.00 16.02 ? 998  A2P A C5    1 
HETATM 1924 C C6    . A2P C 2 .   ? 39.890 6.678   18.892  1.00 15.63 ? 998  A2P A C6    1 
HETATM 1925 N N6    . A2P C 2 .   ? 40.505 7.875   18.795  1.00 16.48 ? 998  A2P A N6    1 
HETATM 1926 N N1    . A2P C 2 .   ? 39.393 6.239   20.042  1.00 14.69 ? 998  A2P A N1    1 
HETATM 1927 C C2    . A2P C 2 .   ? 38.751 5.065   20.133  1.00 13.97 ? 998  A2P A C2    1 
HETATM 1928 N N3    . A2P C 2 .   ? 38.537 4.224   19.115  1.00 14.35 ? 998  A2P A N3    1 
HETATM 1929 C C4    . A2P C 2 .   ? 39.049 4.569   17.934  1.00 14.31 ? 998  A2P A C4    1 
HETATM 1930 P P1    . A2P D 2 .   ? 5.568  -11.725 36.328  1.00 41.93 ? 999  A2P B P1    1 
HETATM 1931 O O1P   . A2P D 2 .   ? 4.960  -10.576 37.102  1.00 42.45 ? 999  A2P B O1P   1 
HETATM 1932 O O2P   . A2P D 2 .   ? 5.462  -11.553 34.836  1.00 42.49 ? 999  A2P B O2P   1 
HETATM 1933 O O3P   . A2P D 2 .   ? 5.134  -13.065 36.856  1.00 42.23 ? 999  A2P B O3P   1 
HETATM 1934 P P2    . A2P D 2 .   ? 8.447  -6.507  33.489  1.00 23.57 ? 999  A2P B P2    1 
HETATM 1935 O O4P   . A2P D 2 .   ? 7.009  -6.048  33.673  1.00 25.39 ? 999  A2P B O4P   1 
HETATM 1936 O O5P   . A2P D 2 .   ? 9.425  -5.401  33.823  1.00 15.29 ? 999  A2P B O5P   1 
HETATM 1937 O O6P   . A2P D 2 .   ? 8.474  -7.195  32.152  1.00 24.91 ? 999  A2P B O6P   1 
HETATM 1938 O "O5'" . A2P D 2 .   ? 8.708  -7.719  34.526  1.00 26.14 ? 999  A2P B "O5'" 1 
HETATM 1939 C "C5'" . A2P D 2 .   ? 9.931  -8.472  34.449  1.00 29.91 ? 999  A2P B "C5'" 1 
HETATM 1940 C "C4'" . A2P D 2 .   ? 9.913  -9.783  35.252  1.00 33.08 ? 999  A2P B "C4'" 1 
HETATM 1941 O "O4'" . A2P D 2 .   ? 10.017 -9.515  36.658  1.00 33.98 ? 999  A2P B "O4'" 1 
HETATM 1942 C "C3'" . A2P D 2 .   ? 8.665  -10.642 35.085  1.00 35.10 ? 999  A2P B "C3'" 1 
HETATM 1943 O "O3'" . A2P D 2 .   ? 9.047  -11.993 34.885  1.00 37.02 ? 999  A2P B "O3'" 1 
HETATM 1944 C "C2'" . A2P D 2 .   ? 7.928  -10.519 36.401  1.00 35.76 ? 999  A2P B "C2'" 1 
HETATM 1945 O "O2'" . A2P D 2 .   ? 7.137  -11.675 36.671  1.00 38.73 ? 999  A2P B "O2'" 1 
HETATM 1946 C "C1'" . A2P D 2 .   ? 9.087  -10.337 37.376  1.00 33.57 ? 999  A2P B "C1'" 1 
HETATM 1947 N N9    . A2P D 2 .   ? 8.726  -9.738  38.690  1.00 30.76 ? 999  A2P B N9    1 
HETATM 1948 C C8    . A2P D 2 .   ? 7.519  -9.273  39.063  1.00 30.22 ? 999  A2P B C8    1 
HETATM 1949 N N7    . A2P D 2 .   ? 7.565  -8.803  40.339  1.00 28.25 ? 999  A2P B N7    1 
HETATM 1950 C C5    . A2P D 2 .   ? 8.808  -8.962  40.795  1.00 27.49 ? 999  A2P B C5    1 
HETATM 1951 C C6    . A2P D 2 .   ? 9.528  -8.675  42.066  1.00 27.26 ? 999  A2P B C6    1 
HETATM 1952 N N6    . A2P D 2 .   ? 8.873  -8.123  43.114  1.00 26.34 ? 999  A2P B N6    1 
HETATM 1953 N N1    . A2P D 2 .   ? 10.829 -8.997  42.151  1.00 26.74 ? 999  A2P B N1    1 
HETATM 1954 C C2    . A2P D 2 .   ? 11.465 -9.549  41.106  1.00 27.37 ? 999  A2P B C2    1 
HETATM 1955 N N3    . A2P D 2 .   ? 10.865 -9.832  39.930  1.00 26.96 ? 999  A2P B N3    1 
HETATM 1956 C C4    . A2P D 2 .   ? 9.574  -9.572  39.711  1.00 28.09 ? 999  A2P B C4    1 
HETATM 1957 O O     . HOH E 3 .   ? 43.626 6.603   18.822  1.00 30.79 ? 999  HOH A O     1 
HETATM 1958 O O     . HOH E 3 .   ? 14.810 -13.194 14.627  1.00 36.42 ? 1000 HOH A O     1 
HETATM 1959 O O     . HOH E 3 .   ? 17.148 -12.194 13.885  1.00 35.54 ? 1001 HOH A O     1 
HETATM 1960 O O     . HOH E 3 .   ? 17.172 -9.926  15.213  1.00 33.95 ? 1002 HOH A O     1 
HETATM 1961 O O     . HOH E 3 .   ? 16.272 -7.181  12.767  1.00 34.47 ? 1003 HOH A O     1 
HETATM 1962 O O     . HOH E 3 .   ? 19.217 -7.954  9.930   1.00 26.59 ? 1004 HOH A O     1 
HETATM 1963 O O     . HOH E 3 .   ? 17.797 -6.234  8.788   1.00 33.60 ? 1005 HOH A O     1 
HETATM 1964 O O     . HOH E 3 .   ? 15.941 -3.739  10.867  1.00 34.92 ? 1006 HOH A O     1 
HETATM 1965 O O     . HOH E 3 .   ? 13.196 0.268   12.012  1.00 42.79 ? 1007 HOH A O     1 
HETATM 1966 O O     . HOH E 3 .   ? 17.658 -2.033  12.761  1.00 27.43 ? 1008 HOH A O     1 
HETATM 1967 O O     . HOH E 3 .   ? 16.650 0.127   9.584   1.00 20.82 ? 1009 HOH A O     1 
HETATM 1968 O O     . HOH E 3 .   ? 18.122 1.238   5.451   1.00 26.92 ? 1010 HOH A O     1 
HETATM 1969 O O     . HOH E 3 .   ? 17.970 -3.012  5.892   1.00 43.16 ? 1011 HOH A O     1 
HETATM 1970 O O     . HOH E 3 .   ? 19.101 -8.298  5.444   1.00 34.60 ? 1012 HOH A O     1 
HETATM 1971 O O     . HOH E 3 .   ? 22.387 -10.186 4.867   1.00 42.31 ? 1013 HOH A O     1 
HETATM 1972 O O     . HOH E 3 .   ? 25.035 -12.912 2.798   1.00 37.03 ? 1014 HOH A O     1 
HETATM 1973 O O     . HOH E 3 .   ? 24.173 -13.807 7.995   1.00 32.35 ? 1015 HOH A O     1 
HETATM 1974 O O     . HOH E 3 .   ? 24.719 -13.736 12.878  1.00 42.78 ? 1016 HOH A O     1 
HETATM 1975 O O     . HOH E 3 .   ? 26.675 -14.121 14.261  1.00 28.65 ? 1017 HOH A O     1 
HETATM 1976 O O     . HOH E 3 .   ? 24.227 -12.003 15.294  1.00 31.82 ? 1018 HOH A O     1 
HETATM 1977 O O     . HOH E 3 .   ? 20.912 18.027  18.826  1.00 41.05 ? 1019 HOH A O     1 
HETATM 1978 O O     . HOH E 3 .   ? 21.713 -12.397 26.646  1.00 28.69 ? 1020 HOH A O     1 
HETATM 1979 O O     . HOH E 3 .   ? 22.077 -9.702  27.896  1.00 20.15 ? 1021 HOH A O     1 
HETATM 1980 O O     . HOH E 3 .   ? 22.985 -10.149 24.673  1.00 44.58 ? 1022 HOH A O     1 
HETATM 1981 O O     . HOH E 3 .   ? 22.775 20.219  23.297  1.00 43.83 ? 1023 HOH A O     1 
HETATM 1982 O O     . HOH E 3 .   ? 22.421 -8.652  21.086  1.00 22.25 ? 1024 HOH A O     1 
HETATM 1983 O O     . HOH E 3 .   ? 20.124 -9.953  21.078  1.00 43.12 ? 1025 HOH A O     1 
HETATM 1984 O O     . HOH E 3 .   ? 18.291 -3.397  18.050  1.00 19.26 ? 1026 HOH A O     1 
HETATM 1985 O O     . HOH E 3 .   ? 17.894 0.224   16.849  1.00 16.56 ? 1027 HOH A O     1 
HETATM 1986 O O     . HOH E 3 .   ? 17.401 7.022   17.261  1.00 22.71 ? 1028 HOH A O     1 
HETATM 1987 O O     . HOH E 3 .   ? 18.503 9.617   16.812  1.00 25.37 ? 1029 HOH A O     1 
HETATM 1988 O O     . HOH E 3 .   ? 16.427 11.135  17.260  1.00 35.40 ? 1030 HOH A O     1 
HETATM 1989 O O     . HOH E 3 .   ? 14.029 3.607   10.895  1.00 35.62 ? 1031 HOH A O     1 
HETATM 1990 O O     . HOH E 3 .   ? 43.637 -1.658  14.820  1.00 41.40 ? 1032 HOH A O     1 
HETATM 1991 O O     . HOH E 3 .   ? 25.212 -3.832  30.170  1.00 28.82 ? 1033 HOH A O     1 
HETATM 1992 O O     . HOH E 3 .   ? 25.949 -3.548  32.353  1.00 30.68 ? 1034 HOH A O     1 
HETATM 1993 O O     . HOH E 3 .   ? 27.976 -2.929  31.242  1.00 40.06 ? 1035 HOH A O     1 
HETATM 1994 O O     . HOH E 3 .   ? 28.436 -1.342  33.503  1.00 35.23 ? 1036 HOH A O     1 
HETATM 1995 O O     . HOH E 3 .   ? 31.320 -1.001  32.164  1.00 45.94 ? 1037 HOH A O     1 
HETATM 1996 O O     . HOH E 3 .   ? 31.718 -1.662  29.443  1.00 22.42 ? 1038 HOH A O     1 
HETATM 1997 O O     . HOH E 3 .   ? 31.750 -3.470  30.428  1.00 28.60 ? 1039 HOH A O     1 
HETATM 1998 O O     . HOH E 3 .   ? 30.888 -6.178  28.932  1.00 15.67 ? 1040 HOH A O     1 
HETATM 1999 O O     . HOH E 3 .   ? 32.347 -6.831  24.992  1.00 11.18 ? 1041 HOH A O     1 
HETATM 2000 O O     . HOH E 3 .   ? 33.252 -4.926  21.760  1.00 10.27 ? 1042 HOH A O     1 
HETATM 2001 O O     . HOH E 3 .   ? 29.133 -9.372  22.673  1.00 14.01 ? 1043 HOH A O     1 
HETATM 2002 O O     . HOH E 3 .   ? 30.469 -13.444 17.430  1.00 32.41 ? 1044 HOH A O     1 
HETATM 2003 O O     . HOH E 3 .   ? 33.352 19.769  15.859  1.00 45.57 ? 1045 HOH A O     1 
HETATM 2004 O O     . HOH E 3 .   ? 33.601 -9.968  16.382  1.00 28.18 ? 1046 HOH A O     1 
HETATM 2005 O O     . HOH E 3 .   ? 33.997 -8.055  14.538  1.00 25.59 ? 1047 HOH A O     1 
HETATM 2006 O O     . HOH E 3 .   ? 38.480 -6.221  14.466  1.00 43.30 ? 1048 HOH A O     1 
HETATM 2007 O O     . HOH E 3 .   ? 40.532 -5.533  12.622  1.00 45.96 ? 1049 HOH A O     1 
HETATM 2008 O O     . HOH E 3 .   ? 42.264 -3.201  11.143  1.00 37.69 ? 1050 HOH A O     1 
HETATM 2009 O O     . HOH E 3 .   ? 45.153 -3.647  11.760  1.00 43.72 ? 1051 HOH A O     1 
HETATM 2010 O O     . HOH E 3 .   ? 46.180 -5.053  8.885   1.00 36.09 ? 1052 HOH A O     1 
HETATM 2011 O O     . HOH E 3 .   ? 44.205 -6.140  9.289   1.00 41.50 ? 1053 HOH A O     1 
HETATM 2012 O O     . HOH E 3 .   ? 45.440 -5.830  5.081   1.00 36.96 ? 1054 HOH A O     1 
HETATM 2013 O O     . HOH E 3 .   ? 47.176 -4.107  6.931   1.00 41.12 ? 1055 HOH A O     1 
HETATM 2014 O O     . HOH E 3 .   ? 47.743 -1.720  7.262   1.00 39.52 ? 1056 HOH A O     1 
HETATM 2015 O O     . HOH E 3 .   ? 46.641 -1.333  4.012   1.00 33.09 ? 1057 HOH A O     1 
HETATM 2016 O O     . HOH E 3 .   ? 46.825 -7.483  2.885   1.00 43.23 ? 1058 HOH A O     1 
HETATM 2017 O O     . HOH E 3 .   ? 42.504 -13.499 5.031   1.00 45.42 ? 1059 HOH A O     1 
HETATM 2018 O O     . HOH E 3 .   ? 40.151 -10.305 1.767   1.00 40.48 ? 1060 HOH A O     1 
HETATM 2019 O O     . HOH E 3 .   ? 34.986 -9.462  3.696   1.00 22.65 ? 1061 HOH A O     1 
HETATM 2020 O O     . HOH E 3 .   ? 33.399 21.245  7.216   1.00 31.80 ? 1062 HOH A O     1 
HETATM 2021 O O     . HOH E 3 .   ? 30.834 -11.111 8.585   1.00 41.95 ? 1063 HOH A O     1 
HETATM 2022 O O     . HOH E 3 .   ? 30.201 -10.113 6.839   1.00 35.40 ? 1064 HOH A O     1 
HETATM 2023 O O     . HOH E 3 .   ? 31.780 -6.423  11.338  1.00 37.83 ? 1065 HOH A O     1 
HETATM 2024 O O     . HOH E 3 .   ? 33.989 -4.649  12.488  1.00 35.21 ? 1066 HOH A O     1 
HETATM 2025 O O     . HOH E 3 .   ? 34.510 -1.212  10.766  1.00 16.83 ? 1067 HOH A O     1 
HETATM 2026 O O     . HOH E 3 .   ? 35.752 -0.102  12.531  1.00 29.85 ? 1068 HOH A O     1 
HETATM 2027 O O     . HOH E 3 .   ? 38.301 -1.089  11.529  1.00 34.82 ? 1069 HOH A O     1 
HETATM 2028 O O     . HOH E 3 .   ? 37.986 -3.071  13.346  1.00 32.98 ? 1070 HOH A O     1 
HETATM 2029 O O     . HOH E 3 .   ? 37.498 -2.401  16.458  1.00 26.81 ? 1071 HOH A O     1 
HETATM 2030 O O     . HOH E 3 .   ? 39.822 -3.152  17.115  1.00 33.09 ? 1072 HOH A O     1 
HETATM 2031 O O     . HOH E 3 .   ? 40.008 -1.143  19.490  1.00 27.11 ? 1073 HOH A O     1 
HETATM 2032 O O     . HOH E 3 .   ? 41.941 -1.954  20.792  1.00 40.96 ? 1074 HOH A O     1 
HETATM 2033 O O     . HOH E 3 .   ? 43.698 1.138   21.996  1.00 40.85 ? 1075 HOH A O     1 
HETATM 2034 O O     . HOH E 3 .   ? 41.480 2.436   20.559  1.00 28.99 ? 1076 HOH A O     1 
HETATM 2035 O O     . HOH E 3 .   ? 43.428 3.068   16.686  1.00 40.09 ? 1077 HOH A O     1 
HETATM 2036 O O     . HOH E 3 .   ? 38.558 8.929   14.105  1.00 27.00 ? 1078 HOH A O     1 
HETATM 2037 O O     . HOH E 3 .   ? 36.373 10.167  14.877  1.00 29.54 ? 1079 HOH A O     1 
HETATM 2038 O O     . HOH E 3 .   ? 36.211 10.345  17.488  1.00 34.84 ? 1080 HOH A O     1 
HETATM 2039 O O     . HOH E 3 .   ? 34.123 11.466  19.374  1.00 20.75 ? 1081 HOH A O     1 
HETATM 2040 O O     . HOH E 3 .   ? 32.192 13.303  19.779  1.00 19.81 ? 1082 HOH A O     1 
HETATM 2041 O O     . HOH E 3 .   ? 32.788 15.763  18.971  1.00 29.82 ? 1083 HOH A O     1 
HETATM 2042 O O     . HOH E 3 .   ? 33.848 15.782  16.479  1.00 25.09 ? 1084 HOH A O     1 
HETATM 2043 O O     . HOH E 3 .   ? 36.320 14.536  16.484  1.00 31.55 ? 1085 HOH A O     1 
HETATM 2044 O O     . HOH E 3 .   ? 36.715 12.861  14.341  1.00 28.97 ? 1086 HOH A O     1 
HETATM 2045 O O     . HOH E 3 .   ? 36.437 14.127  12.117  1.00 35.33 ? 1087 HOH A O     1 
HETATM 2046 O O     . HOH E 3 .   ? 37.412 13.797  9.658   1.00 29.78 ? 1088 HOH A O     1 
HETATM 2047 O O     . HOH E 3 .   ? 39.477 12.097  10.140  1.00 36.91 ? 1089 HOH A O     1 
HETATM 2048 O O     . HOH E 3 .   ? 40.408 11.962  12.381  1.00 38.34 ? 1090 HOH A O     1 
HETATM 2049 O O     . HOH E 3 .   ? 41.091 8.046   9.376   1.00 45.16 ? 1091 HOH A O     1 
HETATM 2050 O O     . HOH E 3 .   ? 39.291 8.805   6.577   1.00 45.84 ? 1092 HOH A O     1 
HETATM 2051 O O     . HOH E 3 .   ? 42.260 5.281   5.175   1.00 39.49 ? 1093 HOH A O     1 
HETATM 2052 O O     . HOH E 3 .   ? 41.027 -0.855  9.336   1.00 29.61 ? 1094 HOH A O     1 
HETATM 2053 O O     . HOH E 3 .   ? 39.651 4.538   12.072  1.00 33.84 ? 1095 HOH A O     1 
HETATM 2054 O O     . HOH E 3 .   ? 33.900 6.134   12.538  1.00 14.03 ? 1096 HOH A O     1 
HETATM 2055 O O     . HOH E 3 .   ? 34.087 8.861   13.888  1.00 16.67 ? 1097 HOH A O     1 
HETATM 2056 O O     . HOH E 3 .   ? 27.100 8.995   13.958  1.00 14.45 ? 1098 HOH A O     1 
HETATM 2057 O O     . HOH E 3 .   ? 24.837 10.564  13.837  1.00 18.47 ? 1099 HOH A O     1 
HETATM 2058 O O     . HOH E 3 .   ? 24.783 13.131  15.190  1.00 22.68 ? 1100 HOH A O     1 
HETATM 2059 O O     . HOH E 3 .   ? 26.207 14.841  16.842  1.00 23.94 ? 1101 HOH A O     1 
HETATM 2060 O O     . HOH E 3 .   ? 28.148 15.878  15.859  1.00 39.68 ? 1102 HOH A O     1 
HETATM 2061 O O     . HOH E 3 .   ? 27.458 16.057  13.329  1.00 36.34 ? 1103 HOH A O     1 
HETATM 2062 O O     . HOH E 3 .   ? 27.551 -15.583 10.760  1.00 38.28 ? 1104 HOH A O     1 
HETATM 2063 O O     . HOH E 3 .   ? 30.200 -14.901 10.521  1.00 23.45 ? 1105 HOH A O     1 
HETATM 2064 O O     . HOH E 3 .   ? 30.910 16.834  7.551   1.00 43.13 ? 1106 HOH A O     1 
HETATM 2065 O O     . HOH E 3 .   ? 21.739 1.452   -6.579  1.00 30.57 ? 1107 HOH A O     1 
HETATM 2066 O O     . HOH E 3 .   ? 31.190 13.880  6.257   1.00 28.29 ? 1108 HOH A O     1 
HETATM 2067 O O     . HOH E 3 .   ? 18.263 -2.038  -3.673  1.00 37.09 ? 1109 HOH A O     1 
HETATM 2068 O O     . HOH E 3 .   ? 29.090 12.431  6.992   1.00 23.40 ? 1110 HOH A O     1 
HETATM 2069 O O     . HOH E 3 .   ? 26.588 13.832  10.477  1.00 47.73 ? 1111 HOH A O     1 
HETATM 2070 O O     . HOH E 3 .   ? 25.047 14.699  12.970  1.00 35.21 ? 1112 HOH A O     1 
HETATM 2071 O O     . HOH E 3 .   ? 23.599 15.781  10.171  1.00 33.06 ? 1113 HOH A O     1 
HETATM 2072 O O     . HOH E 3 .   ? 22.839 12.786  10.696  1.00 27.01 ? 1114 HOH A O     1 
HETATM 2073 O O     . HOH E 3 .   ? 23.864 13.022  8.031   1.00 39.24 ? 1115 HOH A O     1 
HETATM 2074 O O     . HOH E 3 .   ? 23.830 8.041   7.435   1.00 25.71 ? 1116 HOH A O     1 
HETATM 2075 O O     . HOH E 3 .   ? 21.904 6.590   7.123   1.00 23.08 ? 1117 HOH A O     1 
HETATM 2076 O O     . HOH E 3 .   ? 23.822 6.031   4.579   1.00 19.86 ? 1118 HOH A O     1 
HETATM 2077 O O     . HOH E 3 .   ? 23.507 5.103   1.258   1.00 21.95 ? 1119 HOH A O     1 
HETATM 2078 O O     . HOH E 3 .   ? 30.681 -10.834 -2.134  1.00 22.53 ? 1120 HOH A O     1 
HETATM 2079 O O     . HOH E 3 .   ? 20.232 0.799   -3.815  1.00 33.03 ? 1121 HOH A O     1 
HETATM 2080 O O     . HOH E 3 .   ? 21.634 -2.116  -4.085  1.00 40.59 ? 1122 HOH A O     1 
HETATM 2081 O O     . HOH E 3 .   ? 25.262 -0.282  -3.873  1.00 41.20 ? 1123 HOH A O     1 
HETATM 2082 O O     . HOH E 3 .   ? 26.912 -3.122  -5.135  1.00 29.00 ? 1124 HOH A O     1 
HETATM 2083 O O     . HOH E 3 .   ? 28.963 -1.268  -5.475  1.00 36.87 ? 1125 HOH A O     1 
HETATM 2084 O O     . HOH E 3 .   ? 29.589 1.819   -4.621  1.00 38.68 ? 1126 HOH A O     1 
HETATM 2085 O O     . HOH E 3 .   ? 31.055 4.766   -4.241  1.00 36.57 ? 1127 HOH A O     1 
HETATM 2086 O O     . HOH E 3 .   ? 33.940 4.354   -6.105  1.00 38.49 ? 1128 HOH A O     1 
HETATM 2087 O O     . HOH E 3 .   ? 34.676 7.395   -6.238  1.00 34.87 ? 1129 HOH A O     1 
HETATM 2088 O O     . HOH E 3 .   ? 36.499 9.215   -5.012  1.00 40.88 ? 1130 HOH A O     1 
HETATM 2089 O O     . HOH E 3 .   ? 39.834 7.207   -0.586  1.00 33.64 ? 1131 HOH A O     1 
HETATM 2090 O O     . HOH E 3 .   ? 43.550 5.266   -3.475  1.00 30.19 ? 1132 HOH A O     1 
HETATM 2091 O O     . HOH E 3 .   ? 45.156 7.656   -4.515  1.00 37.79 ? 1133 HOH A O     1 
HETATM 2092 O O     . HOH E 3 .   ? 48.181 7.511   -4.461  1.00 42.15 ? 1134 HOH A O     1 
HETATM 2093 O O     . HOH E 3 .   ? 50.481 6.628   -6.224  1.00 36.47 ? 1135 HOH A O     1 
HETATM 2094 O O     . HOH E 3 .   ? 49.881 8.614   0.029   0.50 30.36 ? 1136 HOH A O     1 
HETATM 2095 O O     . HOH E 3 .   ? 48.505 10.061  2.778   1.00 44.62 ? 1137 HOH A O     1 
HETATM 2096 O O     . HOH E 3 .   ? 47.589 10.634  5.403   1.00 37.63 ? 1138 HOH A O     1 
HETATM 2097 O O     . HOH E 3 .   ? 41.155 17.376  1.044   1.00 42.12 ? 1139 HOH A O     1 
HETATM 2098 O O     . HOH E 3 .   ? 42.288 16.353  5.478   1.00 36.24 ? 1140 HOH A O     1 
HETATM 2099 O O     . HOH E 3 .   ? 40.252 15.491  7.841   1.00 35.62 ? 1141 HOH A O     1 
HETATM 2100 O O     . HOH E 3 .   ? 37.387 18.325  7.660   1.00 47.59 ? 1142 HOH A O     1 
HETATM 2101 O O     . HOH E 3 .   ? 37.534 -12.097 6.017   1.00 39.96 ? 1143 HOH A O     1 
HETATM 2102 O O     . HOH E 3 .   ? 34.154 18.718  6.216   1.00 40.10 ? 1144 HOH A O     1 
HETATM 2103 O O     . HOH E 3 .   ? 36.473 12.818  3.740   1.00 37.19 ? 1145 HOH A O     1 
HETATM 2104 O O     . HOH E 3 .   ? 29.044 6.210   -1.330  1.00 31.59 ? 1146 HOH A O     1 
HETATM 2105 O O     . HOH E 3 .   ? 26.885 5.277   -0.558  1.00 28.00 ? 1147 HOH A O     1 
HETATM 2106 O O     . HOH E 3 .   ? 24.927 -3.198  -1.469  1.00 38.23 ? 1148 HOH A O     1 
HETATM 2107 O O     . HOH E 3 .   ? 24.383 -5.610  0.243   1.00 30.99 ? 1149 HOH A O     1 
HETATM 2108 O O     . HOH E 3 .   ? 29.130 -3.287  -8.905  1.00 27.64 ? 1150 HOH A O     1 
HETATM 2109 O O     . HOH E 3 .   ? 31.614 -0.698  -11.955 1.00 34.16 ? 1151 HOH A O     1 
HETATM 2110 O O     . HOH E 3 .   ? 35.231 2.871   -10.177 1.00 47.41 ? 1152 HOH A O     1 
HETATM 2111 O O     . HOH E 3 .   ? 35.478 -2.265  -8.487  1.00 38.05 ? 1153 HOH A O     1 
HETATM 2112 O O     . HOH E 3 .   ? 34.059 -6.263  -11.873 1.00 43.13 ? 1154 HOH A O     1 
HETATM 2113 O O     . HOH E 3 .   ? 32.994 -8.265  -10.100 1.00 28.01 ? 1155 HOH A O     1 
HETATM 2114 O O     . HOH E 3 .   ? 13.274 6.871   11.187  1.00 43.92 ? 1156 HOH A O     1 
HETATM 2115 O O     . HOH E 3 .   ? 36.607 -9.950  -4.356  1.00 29.10 ? 1157 HOH A O     1 
HETATM 2116 O O     . HOH E 3 .   ? 34.332 -9.340  -3.128  1.00 20.26 ? 1158 HOH A O     1 
HETATM 2117 O O     . HOH E 3 .   ? 17.186 4.515   3.343   1.00 28.42 ? 1159 HOH A O     1 
HETATM 2118 O O     . HOH E 3 .   ? 34.938 -5.522  -3.326  1.00 18.64 ? 1160 HOH A O     1 
HETATM 2119 O O     . HOH E 3 .   ? 38.153 -7.616  -4.832  1.00 29.44 ? 1161 HOH A O     1 
HETATM 2120 O O     . HOH E 3 .   ? 44.510 -11.209 -3.194  1.00 38.83 ? 1162 HOH A O     1 
HETATM 2121 O O     . HOH E 3 .   ? 45.712 -12.626 -6.108  1.00 47.71 ? 1163 HOH A O     1 
HETATM 2122 O O     . HOH E 3 .   ? 45.659 -3.509  -6.801  1.00 30.83 ? 1164 HOH A O     1 
HETATM 2123 O O     . HOH E 3 .   ? 40.628 -2.043  -6.570  1.00 39.93 ? 1165 HOH A O     1 
HETATM 2124 O O     . HOH E 3 .   ? 38.922 0.722   -3.852  1.00 35.53 ? 1166 HOH A O     1 
HETATM 2125 O O     . HOH E 3 .   ? 41.028 2.581   -3.763  1.00 40.13 ? 1167 HOH A O     1 
HETATM 2126 O O     . HOH E 3 .   ? 51.845 0.442   -2.711  1.00 36.96 ? 1168 HOH A O     1 
HETATM 2127 O O     . HOH E 3 .   ? 48.024 -1.335  -0.047  1.00 33.84 ? 1169 HOH A O     1 
HETATM 2128 O O     . HOH E 3 .   ? 45.209 -0.551  15.988  1.00 46.07 ? 1170 HOH A O     1 
HETATM 2129 O O     . HOH E 3 .   ? 44.155 -2.768  25.332  1.00 42.55 ? 1171 HOH A O     1 
HETATM 2130 O O     . HOH E 3 .   ? 43.721 -0.464  24.644  1.00 34.61 ? 1172 HOH A O     1 
HETATM 2131 O O     . HOH E 3 .   ? 41.032 -6.425  22.394  1.00 18.77 ? 1173 HOH A O     1 
HETATM 2132 O O     . HOH E 3 .   ? 36.516 -9.756  17.788  1.00 33.98 ? 1174 HOH A O     1 
HETATM 2133 O O     . HOH E 3 .   ? 35.845 -11.942 16.788  1.00 42.64 ? 1175 HOH A O     1 
HETATM 2134 O O     . HOH E 3 .   ? 31.521 -11.370 13.467  1.00 30.22 ? 1176 HOH A O     1 
HETATM 2135 O O     . HOH E 3 .   ? 43.232 -5.391  15.812  1.00 37.84 ? 1177 HOH A O     1 
HETATM 2136 O O     . HOH E 3 .   ? 37.705 -0.453  20.879  1.00 11.67 ? 1178 HOH A O     1 
HETATM 2137 O O     . HOH E 3 .   ? 36.822 2.162   20.097  1.00 16.27 ? 1179 HOH A O     1 
HETATM 2138 O O     . HOH E 3 .   ? 35.531 1.019   18.088  1.00 14.54 ? 1180 HOH A O     1 
HETATM 2139 O O     . HOH E 3 .   ? 36.020 3.369   22.502  1.00 16.10 ? 1181 HOH A O     1 
HETATM 2140 O O     . HOH E 3 .   ? 35.093 5.792   21.914  1.00 14.15 ? 1182 HOH A O     1 
HETATM 2141 O O     . HOH E 3 .   ? 37.257 7.401   23.004  1.00 20.75 ? 1183 HOH A O     1 
HETATM 2142 O O     . HOH E 3 .   ? 36.067 6.171   25.546  1.00 17.05 ? 1184 HOH A O     1 
HETATM 2143 O O     . HOH E 3 .   ? 30.811 4.545   29.271  1.00 19.01 ? 1185 HOH A O     1 
HETATM 2144 O O     . HOH E 3 .   ? 28.428 3.592   29.446  1.00 29.36 ? 1186 HOH A O     1 
HETATM 2145 O O     . HOH E 3 .   ? 29.245 2.494   30.845  1.00 34.71 ? 1187 HOH A O     1 
HETATM 2146 O O     . HOH E 3 .   ? 31.012 2.263   32.736  1.00 40.79 ? 1188 HOH A O     1 
HETATM 2147 O O     . HOH E 3 .   ? 26.321 2.508   33.231  1.00 33.69 ? 1189 HOH A O     1 
HETATM 2148 O O     . HOH E 3 .   ? 25.516 0.617   31.612  1.00 19.26 ? 1190 HOH A O     1 
HETATM 2149 O O     . HOH E 3 .   ? 28.130 -6.203  29.327  1.00 20.16 ? 1191 HOH A O     1 
HETATM 2150 O O     . HOH E 3 .   ? 22.296 1.589   27.509  1.00 25.08 ? 1192 HOH A O     1 
HETATM 2151 O O     . HOH E 3 .   ? 24.093 1.892   29.654  1.00 29.47 ? 1193 HOH A O     1 
HETATM 2152 O O     . HOH E 3 .   ? 24.971 4.353   28.612  1.00 25.24 ? 1194 HOH A O     1 
HETATM 2153 O O     . HOH E 3 .   ? 26.571 3.115   29.907  1.00 41.08 ? 1195 HOH A O     1 
HETATM 2154 O O     . HOH E 3 .   ? 23.098 4.334   26.969  1.00 22.33 ? 1196 HOH A O     1 
HETATM 2155 O O     . HOH E 3 .   ? 18.813 -0.966  26.803  1.00 15.66 ? 1197 HOH A O     1 
HETATM 2156 O O     . HOH E 3 .   ? 16.882 1.546   21.210  1.00 25.88 ? 1198 HOH A O     1 
HETATM 2157 O O     . HOH E 3 .   ? 20.449 6.490   21.689  1.00 22.52 ? 1199 HOH A O     1 
HETATM 2158 O O     . HOH E 3 .   ? 21.444 9.091   22.435  1.00 23.17 ? 1200 HOH A O     1 
HETATM 2159 O O     . HOH E 3 .   ? 22.132 12.348  24.325  1.00 21.46 ? 1201 HOH A O     1 
HETATM 2160 O O     . HOH E 3 .   ? 19.359 14.206  19.620  1.00 38.44 ? 1202 HOH A O     1 
HETATM 2161 O O     . HOH E 3 .   ? 20.466 10.299  18.775  1.00 26.80 ? 1203 HOH A O     1 
HETATM 2162 O O     . HOH E 3 .   ? 22.429 8.238   19.111  1.00 18.28 ? 1204 HOH A O     1 
HETATM 2163 O O     . HOH E 3 .   ? 22.092 13.661  15.791  1.00 28.21 ? 1205 HOH A O     1 
HETATM 2164 O O     . HOH E 3 .   ? 21.120 12.751  13.211  1.00 24.80 ? 1206 HOH A O     1 
HETATM 2165 O O     . HOH E 3 .   ? 24.702 17.125  16.792  1.00 34.08 ? 1207 HOH A O     1 
HETATM 2166 O O     . HOH E 3 .   ? 27.289 14.526  19.501  1.00 19.22 ? 1208 HOH A O     1 
HETATM 2167 O O     . HOH E 3 .   ? 29.541 12.892  19.267  1.00 16.76 ? 1209 HOH A O     1 
HETATM 2168 O O     . HOH E 3 .   ? 30.477 14.168  16.871  1.00 19.33 ? 1210 HOH A O     1 
HETATM 2169 O O     . HOH E 3 .   ? 29.728 16.768  17.971  1.00 43.17 ? 1211 HOH A O     1 
HETATM 2170 O O     . HOH E 3 .   ? 28.255 17.118  19.826  1.00 26.65 ? 1212 HOH A O     1 
HETATM 2171 O O     . HOH E 3 .   ? 29.288 16.814  22.619  1.00 24.72 ? 1213 HOH A O     1 
HETATM 2172 O O     . HOH E 3 .   ? 23.866 -11.922 20.219  1.00 41.50 ? 1214 HOH A O     1 
HETATM 2173 O O     . HOH E 3 .   ? 21.752 17.177  23.001  1.00 44.05 ? 1215 HOH A O     1 
HETATM 2174 O O     . HOH E 3 .   ? 25.482 13.041  26.605  1.00 16.85 ? 1216 HOH A O     1 
HETATM 2175 O O     . HOH E 3 .   ? 26.871 -10.492 28.841  1.00 30.38 ? 1217 HOH A O     1 
HETATM 2176 O O     . HOH E 3 .   ? 41.054 4.319   28.995  1.00 27.39 ? 1218 HOH A O     1 
HETATM 2177 O O     . HOH E 3 .   ? 39.918 6.172   28.229  1.00 27.56 ? 1219 HOH A O     1 
HETATM 2178 O O     . HOH E 3 .   ? 34.196 8.230   25.857  1.00 10.93 ? 1220 HOH A O     1 
HETATM 2179 O O     . HOH E 3 .   ? 37.700 9.228   22.299  1.00 36.99 ? 1221 HOH A O     1 
HETATM 2180 O O     . HOH E 3 .   ? 36.739 8.764   20.455  1.00 22.03 ? 1222 HOH A O     1 
HETATM 2181 O O     . HOH E 3 .   ? 34.065 -9.178  18.869  1.00 21.88 ? 1223 HOH A O     1 
HETATM 2182 O O     . HOH E 3 .   ? 42.267 -0.247  29.524  1.00 32.01 ? 1224 HOH A O     1 
HETATM 2183 O O     . HOH E 3 .   ? 41.001 1.473   27.893  1.00 24.36 ? 1225 HOH A O     1 
HETATM 2184 O O     . HOH E 3 .   ? 31.338 7.844   26.027  1.00 10.01 ? 1226 HOH A O     1 
HETATM 2185 O O     . HOH E 3 .   ? 38.114 1.116   30.979  1.00 24.67 ? 1227 HOH A O     1 
HETATM 2186 O O     . HOH E 3 .   ? 36.881 0.454   33.217  1.00 20.41 ? 1228 HOH A O     1 
HETATM 2187 O O     . HOH E 3 .   ? 34.955 -1.458  33.300  1.00 16.54 ? 1229 HOH A O     1 
HETATM 2188 O O     . HOH E 3 .   ? 24.005 14.742  28.212  1.00 41.76 ? 1230 HOH A O     1 
HETATM 2189 O O     . HOH E 3 .   ? 22.780 -6.456  22.742  1.00 33.49 ? 1231 HOH A O     1 
HETATM 2190 O O     . HOH E 3 .   ? 16.813 3.285   5.880   1.00 29.46 ? 1232 HOH A O     1 
HETATM 2191 O O     . HOH E 3 .   ? 23.477 -7.916  -4.501  1.00 31.65 ? 1233 HOH A O     1 
HETATM 2192 O O     . HOH E 3 .   ? 19.666 10.515  21.396  1.00 30.64 ? 1234 HOH A O     1 
HETATM 2193 O O     . HOH E 3 .   ? 24.732 -8.544  -0.722  1.00 35.01 ? 1235 HOH A O     1 
HETATM 2194 O O     . HOH E 3 .   ? 25.198 -13.006 18.633  1.00 34.43 ? 1236 HOH A O     1 
HETATM 2195 O O     . HOH E 3 .   ? 35.040 -4.048  10.345  1.00 32.71 ? 1237 HOH A O     1 
HETATM 2196 O O     . HOH E 3 .   ? 42.987 -6.895  6.703   1.00 35.01 ? 1238 HOH A O     1 
HETATM 2197 O O     . HOH E 3 .   ? 39.179 -7.684  12.342  1.00 37.69 ? 1239 HOH A O     1 
HETATM 2198 O O     . HOH E 3 .   ? 34.996 18.303  15.089  1.00 38.56 ? 1240 HOH A O     1 
HETATM 2199 O O     . HOH E 3 .   ? 34.657 14.674  4.787   1.00 39.30 ? 1241 HOH A O     1 
HETATM 2200 O O     . HOH E 3 .   ? 38.380 -5.739  12.003  1.00 38.01 ? 1242 HOH A O     1 
HETATM 2201 O O     . HOH E 3 .   ? 45.312 -9.792  5.844   1.00 38.53 ? 1243 HOH A O     1 
HETATM 2202 O O     . HOH E 3 .   ? 30.784 -9.848  9.379   1.00 36.68 ? 1244 HOH A O     1 
HETATM 2203 O O     . HOH E 3 .   ? 42.517 -10.587 -5.202  1.00 37.73 ? 1245 HOH A O     1 
HETATM 2204 O O     . HOH E 3 .   ? 18.928 -4.883  -1.530  1.00 36.94 ? 1246 HOH A O     1 
HETATM 2205 O O     . HOH E 3 .   ? 20.575 14.648  24.217  1.00 35.55 ? 1247 HOH A O     1 
HETATM 2206 O O     . HOH E 3 .   ? 46.610 13.801  5.764   1.00 41.06 ? 1248 HOH A O     1 
HETATM 2207 O O     . HOH E 3 .   ? 40.443 -8.177  15.851  1.00 39.18 ? 1249 HOH A O     1 
HETATM 2208 O O     . HOH E 3 .   ? 18.481 10.550  12.805  1.00 34.63 ? 1250 HOH A O     1 
HETATM 2209 O O     . HOH E 3 .   ? 17.740 -2.348  -1.703  1.00 41.76 ? 1251 HOH A O     1 
HETATM 2210 O O     . HOH E 3 .   ? 52.306 -6.079  0.004   1.00 36.80 ? 1252 HOH A O     1 
HETATM 2211 O O     . HOH E 3 .   ? 20.617 13.029  17.553  1.00 37.09 ? 1253 HOH A O     1 
HETATM 2212 O O     . HOH E 3 .   ? 43.496 17.088  -1.555  1.00 43.44 ? 1254 HOH A O     1 
HETATM 2213 O O     . HOH E 3 .   ? 14.629 -0.446  4.504   1.00 42.19 ? 1255 HOH A O     1 
HETATM 2214 O O     . HOH E 3 .   ? 37.458 -10.207 13.756  1.00 26.95 ? 1256 HOH A O     1 
HETATM 2215 O O     . HOH E 3 .   ? 41.998 -11.632 8.874   1.00 27.31 ? 1257 HOH A O     1 
HETATM 2216 O O     . HOH E 3 .   ? 46.808 -12.071 8.275   1.00 27.65 ? 1258 HOH A O     1 
HETATM 2217 O O     . HOH E 3 .   ? 43.494 -15.908 11.316  1.00 26.26 ? 1259 HOH A O     1 
HETATM 2218 O O     . HOH E 3 .   ? 49.838 -9.416  5.076   1.00 26.53 ? 1260 HOH A O     1 
HETATM 2219 O O     . HOH E 3 .   ? 49.250 -6.121  8.494   1.00 27.65 ? 1261 HOH A O     1 
HETATM 2220 O O     . HOH E 3 .   ? 49.669 -11.686 8.319   1.00 26.61 ? 1262 HOH A O     1 
HETATM 2221 O O     . HOH E 3 .   ? 49.626 -9.404  9.884   1.00 27.91 ? 1263 HOH A O     1 
HETATM 2222 O O     . HOH E 3 .   ? 47.987 -3.239  8.696   1.00 25.91 ? 1264 HOH A O     1 
HETATM 2223 O O     . HOH E 3 .   ? 49.517 -1.409  9.591   1.00 29.80 ? 1265 HOH A O     1 
HETATM 2224 O O     . HOH E 3 .   ? 41.893 -14.315 -3.481  1.00 27.61 ? 1266 HOH A O     1 
HETATM 2225 O O     . HOH E 3 .   ? 38.564 -12.119 -3.073  1.00 27.72 ? 1267 HOH A O     1 
HETATM 2226 O O     . HOH E 3 .   ? 39.682 17.188  -4.041  1.00 28.18 ? 1268 HOH A O     1 
HETATM 2227 O O     . HOH E 3 .   ? 42.096 14.809  -7.021  1.00 28.81 ? 1269 HOH A O     1 
HETATM 2228 O O     . HOH E 3 .   ? 46.245 17.192  -9.820  1.00 27.44 ? 1270 HOH A O     1 
HETATM 2229 O O     . HOH E 3 .   ? 13.756 1.968   5.960   1.00 26.67 ? 1271 HOH A O     1 
HETATM 2230 O O     . HOH E 3 .   ? 12.984 -3.279  4.396   1.00 27.21 ? 1272 HOH A O     1 
HETATM 2231 O O     . HOH E 3 .   ? 11.197 5.812   7.147   1.00 26.18 ? 1273 HOH A O     1 
HETATM 2232 O O     . HOH E 3 .   ? 37.972 -5.617  -9.070  1.00 28.08 ? 1274 HOH A O     1 
HETATM 2233 O O     . HOH E 3 .   ? 37.038 -2.313  -9.190  1.00 27.31 ? 1275 HOH A O     1 
HETATM 2234 O O     . HOH E 3 .   ? 33.150 2.181   -8.237  1.00 27.66 ? 1276 HOH A O     1 
HETATM 2235 O O     . HOH E 3 .   ? 38.058 8.090   -10.787 1.00 28.02 ? 1277 HOH A O     1 
HETATM 2236 O O     . HOH E 3 .   ? 40.706 9.505   16.035  1.00 24.31 ? 1278 HOH A O     1 
HETATM 2237 O O     . HOH E 3 .   ? 42.080 1.328   10.010  1.00 26.94 ? 1279 HOH A O     1 
HETATM 2238 O O     . HOH E 3 .   ? 15.994 -10.029 10.093  1.00 28.32 ? 1280 HOH A O     1 
HETATM 2239 O O     . HOH E 3 .   ? 50.493 -1.366  -1.276  1.00 24.91 ? 1281 HOH A O     1 
HETATM 2240 O O     . HOH F 3 .   ? -1.117 -8.568  10.485  1.00 39.68 ? 1000 HOH B O     1 
HETATM 2241 O O     . HOH F 3 .   ? -2.224 -6.245  10.517  1.00 36.90 ? 1001 HOH B O     1 
HETATM 2242 O O     . HOH F 3 .   ? -1.629 -4.536  12.799  1.00 33.32 ? 1002 HOH B O     1 
HETATM 2243 O O     . HOH F 3 .   ? 1.198  -2.495  11.434  1.00 38.73 ? 1003 HOH B O     1 
HETATM 2244 O O     . HOH F 3 .   ? -1.598 -0.634  11.911  1.00 45.70 ? 1004 HOH B O     1 
HETATM 2245 O O     . HOH F 3 .   ? -3.794 0.025   14.620  1.00 27.70 ? 1005 HOH B O     1 
HETATM 2246 O O     . HOH F 3 .   ? -1.477 2.527   14.143  1.00 35.38 ? 1006 HOH B O     1 
HETATM 2247 O O     . HOH F 3 .   ? -2.493 4.390   12.956  1.00 37.28 ? 1007 HOH B O     1 
HETATM 2248 O O     . HOH F 3 .   ? -5.321 3.393   15.883  1.00 33.24 ? 1008 HOH B O     1 
HETATM 2249 O O     . HOH F 3 .   ? -7.674 0.645   17.760  1.00 32.01 ? 1009 HOH B O     1 
HETATM 2250 O O     . HOH F 3 .   ? -8.073 -6.154  14.433  1.00 27.11 ? 1010 HOH B O     1 
HETATM 2251 O O     . HOH F 3 .   ? -6.442 -7.248  17.393  1.00 26.05 ? 1011 HOH B O     1 
HETATM 2252 O O     . HOH F 3 .   ? 6.680  -10.639 50.814  1.00 32.30 ? 1012 HOH B O     1 
HETATM 2253 O O     . HOH F 3 .   ? -3.269 -8.625  19.237  1.00 32.19 ? 1013 HOH B O     1 
HETATM 2254 O O     . HOH F 3 .   ? -1.727 -10.107 17.688  1.00 31.34 ? 1014 HOH B O     1 
HETATM 2255 O O     . HOH F 3 .   ? 0.325  -10.958 19.723  1.00 29.63 ? 1015 HOH B O     1 
HETATM 2256 O O     . HOH F 3 .   ? -0.316 -9.943  22.090  1.00 28.24 ? 1016 HOH B O     1 
HETATM 2257 O O     . HOH F 3 .   ? 1.866  -15.854 19.193  1.00 37.58 ? 1017 HOH B O     1 
HETATM 2258 O O     . HOH F 3 .   ? 5.999  -15.730 12.788  1.00 42.19 ? 1018 HOH B O     1 
HETATM 2259 O O     . HOH F 3 .   ? 9.343  -17.957 16.086  1.00 46.05 ? 1019 HOH B O     1 
HETATM 2260 O O     . HOH F 3 .   ? 14.892 -9.693  16.337  1.00 33.46 ? 1020 HOH B O     1 
HETATM 2261 O O     . HOH F 3 .   ? 14.366 -2.332  12.019  1.00 36.68 ? 1021 HOH B O     1 
HETATM 2262 O O     . HOH F 3 .   ? 13.299 -0.265  14.863  1.00 25.88 ? 1022 HOH B O     1 
HETATM 2263 O O     . HOH F 3 .   ? 14.644 -2.638  15.006  1.00 23.85 ? 1023 HOH B O     1 
HETATM 2264 O O     . HOH F 3 .   ? 17.264 -2.221  15.576  1.00 19.77 ? 1024 HOH B O     1 
HETATM 2265 O O     . HOH F 3 .   ? 17.671 -14.621 18.696  1.00 47.70 ? 1025 HOH B O     1 
HETATM 2266 O O     . HOH F 3 .   ? 14.697 -16.407 16.976  1.00 42.88 ? 1026 HOH B O     1 
HETATM 2267 O O     . HOH F 3 .   ? 14.785 -14.076 21.870  1.00 41.60 ? 1027 HOH B O     1 
HETATM 2268 O O     . HOH F 3 .   ? 12.401 -13.408 22.472  1.00 38.97 ? 1028 HOH B O     1 
HETATM 2269 O O     . HOH F 3 .   ? 13.378 19.227  25.354  1.00 35.32 ? 1029 HOH B O     1 
HETATM 2270 O O     . HOH F 3 .   ? 16.349 -11.677 25.476  1.00 37.33 ? 1030 HOH B O     1 
HETATM 2271 O O     . HOH F 3 .   ? 19.296 -12.396 24.713  1.00 45.47 ? 1031 HOH B O     1 
HETATM 2272 O O     . HOH F 3 .   ? 20.029 -8.011  27.297  1.00 13.57 ? 1032 HOH B O     1 
HETATM 2273 O O     . HOH F 3 .   ? 20.254 -9.072  24.813  1.00 33.23 ? 1033 HOH B O     1 
HETATM 2274 O O     . HOH F 3 .   ? 18.398 -9.424  23.095  1.00 37.43 ? 1034 HOH B O     1 
HETATM 2275 O O     . HOH F 3 .   ? 16.518 -9.767  22.885  1.00 29.56 ? 1035 HOH B O     1 
HETATM 2276 O O     . HOH F 3 .   ? 11.158 -9.785  25.876  1.00 27.63 ? 1036 HOH B O     1 
HETATM 2277 O O     . HOH F 3 .   ? 9.026  -10.799 25.443  1.00 34.40 ? 1037 HOH B O     1 
HETATM 2278 O O     . HOH F 3 .   ? 7.630  -9.630  24.905  1.00 42.05 ? 1038 HOH B O     1 
HETATM 2279 O O     . HOH F 3 .   ? 8.385  -9.544  27.444  1.00 46.01 ? 1039 HOH B O     1 
HETATM 2280 O O     . HOH F 3 .   ? 8.488  -11.668 28.614  1.00 47.39 ? 1040 HOH B O     1 
HETATM 2281 O O     . HOH F 3 .   ? 5.363  -11.208 31.843  1.00 45.00 ? 1041 HOH B O     1 
HETATM 2282 O O     . HOH F 3 .   ? 6.937  -8.623  33.576  1.00 33.80 ? 1042 HOH B O     1 
HETATM 2283 O O     . HOH F 3 .   ? 6.919  -4.766  31.499  1.00 40.39 ? 1043 HOH B O     1 
HETATM 2284 O O     . HOH F 3 .   ? 6.001  -1.631  31.357  1.00 17.47 ? 1044 HOH B O     1 
HETATM 2285 O O     . HOH F 3 .   ? 3.128  -5.054  30.669  1.00 22.09 ? 1045 HOH B O     1 
HETATM 2286 O O     . HOH F 3 .   ? -1.932 -6.432  43.994  1.00 16.49 ? 1046 HOH B O     1 
HETATM 2287 O O     . HOH F 3 .   ? -3.818 -8.760  43.645  1.00 37.61 ? 1047 HOH B O     1 
HETATM 2288 O O     . HOH F 3 .   ? 2.539  19.333  29.341  1.00 35.95 ? 1048 HOH B O     1 
HETATM 2289 O O     . HOH F 3 .   ? 4.658  -14.644 27.412  1.00 37.40 ? 1049 HOH B O     1 
HETATM 2290 O O     . HOH F 3 .   ? 7.504  -9.838  22.085  1.00 26.78 ? 1050 HOH B O     1 
HETATM 2291 O O     . HOH F 3 .   ? 9.425  -11.075 21.902  1.00 32.57 ? 1051 HOH B O     1 
HETATM 2292 O O     . HOH F 3 .   ? 11.006 -6.999  17.709  1.00 23.62 ? 1052 HOH B O     1 
HETATM 2293 O O     . HOH F 3 .   ? 8.695  -5.671  14.062  1.00 39.80 ? 1053 HOH B O     1 
HETATM 2294 O O     . HOH F 3 .   ? 7.223  -8.366  14.261  1.00 36.75 ? 1054 HOH B O     1 
HETATM 2295 O O     . HOH F 3 .   ? 5.801  -3.910  11.652  1.00 46.91 ? 1055 HOH B O     1 
HETATM 2296 O O     . HOH F 3 .   ? 7.994  -2.410  10.767  1.00 35.47 ? 1056 HOH B O     1 
HETATM 2297 O O     . HOH F 3 .   ? 9.221  -0.823  12.208  1.00 42.25 ? 1057 HOH B O     1 
HETATM 2298 O O     . HOH F 3 .   ? 15.300 1.757   16.600  1.00 46.94 ? 1058 HOH B O     1 
HETATM 2299 O O     . HOH F 3 .   ? 14.672 4.246   18.262  1.00 39.50 ? 1059 HOH B O     1 
HETATM 2300 O O     . HOH F 3 .   ? 16.111 4.933   21.038  1.00 24.92 ? 1060 HOH B O     1 
HETATM 2301 O O     . HOH F 3 .   ? 17.680 5.746   22.011  1.00 32.31 ? 1061 HOH B O     1 
HETATM 2302 O O     . HOH F 3 .   ? 17.637 6.865   19.949  1.00 24.11 ? 1062 HOH B O     1 
HETATM 2303 O O     . HOH F 3 .   ? 16.594 11.916  19.907  1.00 44.94 ? 1063 HOH B O     1 
HETATM 2304 O O     . HOH F 3 .   ? 16.251 -18.627 20.013  1.00 41.46 ? 1064 HOH B O     1 
HETATM 2305 O O     . HOH F 3 .   ? 15.047 12.787  21.963  1.00 41.19 ? 1065 HOH B O     1 
HETATM 2306 O O     . HOH F 3 .   ? 13.201 12.652  20.023  1.00 41.44 ? 1066 HOH B O     1 
HETATM 2307 O O     . HOH F 3 .   ? 12.540 11.169  16.421  1.00 35.51 ? 1067 HOH B O     1 
HETATM 2308 O O     . HOH F 3 .   ? 13.440 8.122   15.647  1.00 32.49 ? 1068 HOH B O     1 
HETATM 2309 O O     . HOH F 3 .   ? 4.779  12.531  15.483  1.00 39.59 ? 1069 HOH B O     1 
HETATM 2310 O O     . HOH F 3 .   ? 1.516  -17.436 16.752  1.00 38.16 ? 1070 HOH B O     1 
HETATM 2311 O O     . HOH F 3 .   ? -3.399 12.437  20.657  1.00 37.94 ? 1071 HOH B O     1 
HETATM 2312 O O     . HOH F 3 .   ? 4.512  11.143  51.838  1.00 32.85 ? 1072 HOH B O     1 
HETATM 2313 O O     . HOH F 3 .   ? -1.509 8.306   15.203  1.00 42.64 ? 1073 HOH B O     1 
HETATM 2314 O O     . HOH F 3 .   ? -3.223 9.284   13.319  1.00 42.83 ? 1074 HOH B O     1 
HETATM 2315 O O     . HOH F 3 .   ? 1.257  7.153   18.703  1.00 22.61 ? 1075 HOH B O     1 
HETATM 2316 O O     . HOH F 3 .   ? 4.040  4.280   17.933  1.00 20.34 ? 1076 HOH B O     1 
HETATM 2317 O O     . HOH F 3 .   ? 0.826  3.234   15.641  1.00 29.05 ? 1077 HOH B O     1 
HETATM 2318 O O     . HOH F 3 .   ? 6.097  -2.758  16.261  1.00 27.93 ? 1078 HOH B O     1 
HETATM 2319 O O     . HOH F 3 .   ? 12.594 -13.328 29.051  1.00 40.26 ? 1079 HOH B O     1 
HETATM 2320 O O     . HOH F 3 .   ? 14.991 -12.683 29.527  1.00 26.65 ? 1080 HOH B O     1 
HETATM 2321 O O     . HOH F 3 .   ? 15.837 16.530  28.520  1.00 43.16 ? 1081 HOH B O     1 
HETATM 2322 O O     . HOH F 3 .   ? 17.582 -15.472 28.121  1.00 34.06 ? 1082 HOH B O     1 
HETATM 2323 O O     . HOH F 3 .   ? 23.452 -13.220 30.618  1.00 22.76 ? 1083 HOH B O     1 
HETATM 2324 O O     . HOH F 3 .   ? 22.413 -10.634 30.554  1.00 17.66 ? 1084 HOH B O     1 
HETATM 2325 O O     . HOH F 3 .   ? 24.427 -8.945  31.630  1.00 20.14 ? 1085 HOH B O     1 
HETATM 2326 O O     . HOH F 3 .   ? 23.336 -7.885  33.843  1.00 22.86 ? 1086 HOH B O     1 
HETATM 2327 O O     . HOH F 3 .   ? 23.653 -5.726  34.174  1.00 36.91 ? 1087 HOH B O     1 
HETATM 2328 O O     . HOH F 3 .   ? 22.005 -4.859  32.562  1.00 18.02 ? 1088 HOH B O     1 
HETATM 2329 O O     . HOH F 3 .   ? 22.462 -4.756  29.873  1.00 18.28 ? 1089 HOH B O     1 
HETATM 2330 O O     . HOH F 3 .   ? 20.238 -5.338  28.289  1.00 11.51 ? 1090 HOH B O     1 
HETATM 2331 O O     . HOH F 3 .   ? 23.013 -2.024  29.057  1.00 24.62 ? 1091 HOH B O     1 
HETATM 2332 O O     . HOH F 3 .   ? 19.689 13.835  37.072  1.00 39.69 ? 1092 HOH B O     1 
HETATM 2333 O O     . HOH F 3 .   ? 18.307 3.286   51.798  1.00 47.78 ? 1093 HOH B O     1 
HETATM 2334 O O     . HOH F 3 .   ? -5.533 -9.891  15.559  1.00 34.67 ? 1094 HOH B O     1 
HETATM 2335 O O     . HOH F 3 .   ? -3.161 -14.483 19.336  1.00 39.76 ? 1095 HOH B O     1 
HETATM 2336 O O     . HOH F 3 .   ? 9.604  8.186   51.948  1.00 24.83 ? 1096 HOH B O     1 
HETATM 2337 O O     . HOH F 3 .   ? 9.499  -9.727  49.706  1.00 20.69 ? 1097 HOH B O     1 
HETATM 2338 O O     . HOH F 3 .   ? 14.928 -11.649 44.105  1.00 23.66 ? 1098 HOH B O     1 
HETATM 2339 O O     . HOH F 3 .   ? 18.623 -10.238 41.222  1.00 23.76 ? 1099 HOH B O     1 
HETATM 2340 O O     . HOH F 3 .   ? 24.375 -1.652  32.835  1.00 18.50 ? 1100 HOH B O     1 
HETATM 2341 O O     . HOH F 3 .   ? 24.940 -0.622  35.586  1.00 21.69 ? 1101 HOH B O     1 
HETATM 2342 O O     . HOH F 3 .   ? 25.107 -2.162  37.566  1.00 25.14 ? 1102 HOH B O     1 
HETATM 2343 O O     . HOH F 3 .   ? 27.540 -3.268  37.394  1.00 25.33 ? 1103 HOH B O     1 
HETATM 2344 O O     . HOH F 3 .   ? 20.545 -20.058 33.061  1.00 22.99 ? 1104 HOH B O     1 
HETATM 2345 O O     . HOH F 3 .   ? 25.254 -0.446  39.765  1.00 30.68 ? 1105 HOH B O     1 
HETATM 2346 O O     . HOH F 3 .   ? 23.274 0.812   41.844  1.00 34.17 ? 1106 HOH B O     1 
HETATM 2347 O O     . HOH F 3 .   ? 20.542 0.290   41.568  1.00 23.83 ? 1107 HOH B O     1 
HETATM 2348 O O     . HOH F 3 .   ? 21.333 0.054   45.056  1.00 27.69 ? 1108 HOH B O     1 
HETATM 2349 O O     . HOH F 3 .   ? 20.199 2.307   44.688  1.00 21.07 ? 1109 HOH B O     1 
HETATM 2350 O O     . HOH F 3 .   ? 20.931 6.803   46.602  1.00 23.46 ? 1110 HOH B O     1 
HETATM 2351 O O     . HOH F 3 .   ? 18.823 8.256   45.439  1.00 15.24 ? 1111 HOH B O     1 
HETATM 2352 O O     . HOH F 3 .   ? 21.819 9.285   40.331  1.00 22.56 ? 1112 HOH B O     1 
HETATM 2353 O O     . HOH F 3 .   ? 23.866 10.601  38.489  1.00 29.08 ? 1113 HOH B O     1 
HETATM 2354 O O     . HOH F 3 .   ? 22.979 10.788  35.740  1.00 24.98 ? 1114 HOH B O     1 
HETATM 2355 O O     . HOH F 3 .   ? 23.841 6.864   33.988  1.00 19.66 ? 1115 HOH B O     1 
HETATM 2356 O O     . HOH F 3 .   ? 22.880 4.435   29.855  1.00 30.99 ? 1116 HOH B O     1 
HETATM 2357 O O     . HOH F 3 .   ? 20.593 3.814   30.047  1.00 25.75 ? 1117 HOH B O     1 
HETATM 2358 O O     . HOH F 3 .   ? 20.301 1.228   30.295  1.00 25.82 ? 1118 HOH B O     1 
HETATM 2359 O O     . HOH F 3 .   ? 18.993 3.556   27.639  1.00 18.44 ? 1119 HOH B O     1 
HETATM 2360 O O     . HOH F 3 .   ? 18.415 12.457  22.806  1.00 30.15 ? 1120 HOH B O     1 
HETATM 2361 O O     . HOH F 3 .   ? 21.872 2.496   49.127  1.00 28.06 ? 1121 HOH B O     1 
HETATM 2362 O O     . HOH F 3 .   ? 19.199 12.744  27.315  1.00 39.84 ? 1122 HOH B O     1 
HETATM 2363 O O     . HOH F 3 .   ? 17.473 11.833  29.886  1.00 35.01 ? 1123 HOH B O     1 
HETATM 2364 O O     . HOH F 3 .   ? 15.420 -19.393 30.857  1.00 40.39 ? 1124 HOH B O     1 
HETATM 2365 O O     . HOH F 3 .   ? 13.144 14.483  34.659  1.00 34.63 ? 1125 HOH B O     1 
HETATM 2366 O O     . HOH F 3 .   ? 13.630 13.207  37.143  1.00 15.19 ? 1126 HOH B O     1 
HETATM 2367 O O     . HOH F 3 .   ? 15.655 11.245  37.564  1.00 15.92 ? 1127 HOH B O     1 
HETATM 2368 O O     . HOH F 3 .   ? 15.397 11.041  40.393  1.00 14.69 ? 1128 HOH B O     1 
HETATM 2369 O O     . HOH F 3 .   ? 15.526 13.522  41.428  1.00 14.43 ? 1129 HOH B O     1 
HETATM 2370 O O     . HOH F 3 .   ? 13.447 9.963   42.141  1.00 10.52 ? 1130 HOH B O     1 
HETATM 2371 O O     . HOH F 3 .   ? 17.004 9.028   41.309  1.00 11.91 ? 1131 HOH B O     1 
HETATM 2372 O O     . HOH F 3 .   ? 22.874 5.368   40.917  1.00 22.52 ? 1132 HOH B O     1 
HETATM 2373 O O     . HOH F 3 .   ? 24.094 2.999   40.077  1.00 26.87 ? 1133 HOH B O     1 
HETATM 2374 O O     . HOH F 3 .   ? 24.671 3.651   37.721  1.00 34.62 ? 1134 HOH B O     1 
HETATM 2375 O O     . HOH F 3 .   ? 25.915 1.800   36.336  1.00 38.72 ? 1135 HOH B O     1 
HETATM 2376 O O     . HOH F 3 .   ? 23.118 -3.844  36.363  1.00 17.16 ? 1136 HOH B O     1 
HETATM 2377 O O     . HOH F 3 .   ? 23.955 -6.054  37.399  1.00 19.58 ? 1137 HOH B O     1 
HETATM 2378 O O     . HOH F 3 .   ? 26.568 7.690   35.910  1.00 26.48 ? 1138 HOH B O     1 
HETATM 2379 O O     . HOH F 3 .   ? 25.680 5.226   35.044  1.00 38.12 ? 1139 HOH B O     1 
HETATM 2380 O O     . HOH F 3 .   ? 21.299 -11.529 37.770  1.00 30.24 ? 1140 HOH B O     1 
HETATM 2381 O O     . HOH F 3 .   ? 20.173 -9.493  37.189  1.00 23.21 ? 1141 HOH B O     1 
HETATM 2382 O O     . HOH F 3 .   ? 20.158 -7.982  39.493  1.00 15.20 ? 1142 HOH B O     1 
HETATM 2383 O O     . HOH F 3 .   ? 22.755 -7.384  39.771  1.00 19.18 ? 1143 HOH B O     1 
HETATM 2384 O O     . HOH F 3 .   ? 23.434 -10.357 41.324  1.00 31.18 ? 1144 HOH B O     1 
HETATM 2385 O O     . HOH F 3 .   ? 16.890 -12.088 39.480  1.00 25.19 ? 1145 HOH B O     1 
HETATM 2386 O O     . HOH F 3 .   ? 14.279 -11.544 38.908  1.00 22.96 ? 1146 HOH B O     1 
HETATM 2387 O O     . HOH F 3 .   ? 12.803 -11.937 41.394  1.00 27.98 ? 1147 HOH B O     1 
HETATM 2388 O O     . HOH F 3 .   ? 12.480 -9.971  37.646  1.00 22.38 ? 1148 HOH B O     1 
HETATM 2389 O O     . HOH F 3 .   ? 13.448 -11.137 34.125  1.00 36.35 ? 1149 HOH B O     1 
HETATM 2390 O O     . HOH F 3 .   ? 13.528 -7.992  33.980  1.00 15.29 ? 1150 HOH B O     1 
HETATM 2391 O O     . HOH F 3 .   ? 12.013 -5.955  32.810  1.00 16.05 ? 1151 HOH B O     1 
HETATM 2392 O O     . HOH F 3 .   ? 18.512 -3.074  35.440  1.00 10.12 ? 1152 HOH B O     1 
HETATM 2393 O O     . HOH F 3 .   ? 21.048 -2.173  35.680  1.00 12.19 ? 1153 HOH B O     1 
HETATM 2394 O O     . HOH F 3 .   ? 24.250 -7.110  29.721  1.00 29.90 ? 1154 HOH B O     1 
HETATM 2395 O O     . HOH F 3 .   ? 22.316 -14.985 33.471  1.00 30.91 ? 1155 HOH B O     1 
HETATM 2396 O O     . HOH F 3 .   ? 19.038 -12.647 36.805  1.00 29.09 ? 1156 HOH B O     1 
HETATM 2397 O O     . HOH F 3 .   ? 14.377 -14.097 37.208  1.00 42.96 ? 1157 HOH B O     1 
HETATM 2398 O O     . HOH F 3 .   ? 11.551 -14.331 32.323  1.00 38.35 ? 1158 HOH B O     1 
HETATM 2399 O O     . HOH F 3 .   ? 7.548  -13.330 40.799  1.00 46.78 ? 1159 HOH B O     1 
HETATM 2400 O O     . HOH F 3 .   ? 5.216  -12.416 40.182  1.00 31.81 ? 1160 HOH B O     1 
HETATM 2401 O O     . HOH F 3 .   ? 3.886  -14.044 41.997  1.00 37.63 ? 1161 HOH B O     1 
HETATM 2402 O O     . HOH F 3 .   ? 1.670  -12.768 43.993  1.00 37.24 ? 1162 HOH B O     1 
HETATM 2403 O O     . HOH F 3 .   ? -0.552 -10.217 44.435  1.00 23.74 ? 1163 HOH B O     1 
HETATM 2404 O O     . HOH F 3 .   ? -1.630 -16.276 26.287  1.00 46.16 ? 1164 HOH B O     1 
HETATM 2405 O O     . HOH F 3 .   ? 6.793  -13.968 43.819  1.00 36.50 ? 1165 HOH B O     1 
HETATM 2406 O O     . HOH F 3 .   ? 11.375 -5.263  51.603  1.00 28.25 ? 1166 HOH B O     1 
HETATM 2407 O O     . HOH F 3 .   ? 13.298 -4.407  49.907  1.00 16.64 ? 1167 HOH B O     1 
HETATM 2408 O O     . HOH F 3 .   ? 13.543 -3.026  53.499  1.00 26.00 ? 1168 HOH B O     1 
HETATM 2409 O O     . HOH F 3 .   ? 14.188 -0.866  51.964  1.00 27.42 ? 1169 HOH B O     1 
HETATM 2410 O O     . HOH F 3 .   ? 13.469 1.778   53.123  1.00 29.72 ? 1170 HOH B O     1 
HETATM 2411 O O     . HOH F 3 .   ? 15.040 2.949   50.991  1.00 26.81 ? 1171 HOH B O     1 
HETATM 2412 O O     . HOH F 3 .   ? 16.948 1.477   51.463  1.00 28.82 ? 1172 HOH B O     1 
HETATM 2413 O O     . HOH F 3 .   ? 17.848 -0.031  49.434  1.00 21.16 ? 1173 HOH B O     1 
HETATM 2414 O O     . HOH F 3 .   ? 17.285 -2.594  49.970  1.00 19.71 ? 1174 HOH B O     1 
HETATM 2415 O O     . HOH F 3 .   ? 16.603 4.923   51.938  1.00 38.73 ? 1175 HOH B O     1 
HETATM 2416 O O     . HOH F 3 .   ? 16.134 8.766   51.333  1.00 11.89 ? 1176 HOH B O     1 
HETATM 2417 O O     . HOH F 3 .   ? 17.987 7.624   49.589  1.00 12.85 ? 1177 HOH B O     1 
HETATM 2418 O O     . HOH F 3 .   ? 20.671 4.397   50.753  1.00 22.31 ? 1178 HOH B O     1 
HETATM 2419 O O     . HOH F 3 .   ? 11.925 6.478   52.051  1.00 18.28 ? 1179 HOH B O     1 
HETATM 2420 O O     . HOH F 3 .   ? 11.345 3.658   52.258  1.00 14.82 ? 1180 HOH B O     1 
HETATM 2421 O O     . HOH F 3 .   ? 8.752  3.096   52.902  1.00 27.10 ? 1181 HOH B O     1 
HETATM 2422 O O     . HOH F 3 .   ? 6.156  4.610   53.141  1.00 34.59 ? 1182 HOH B O     1 
HETATM 2423 O O     . HOH F 3 .   ? 7.254  7.530   53.249  1.00 39.40 ? 1183 HOH B O     1 
HETATM 2424 O O     . HOH F 3 .   ? 7.599  9.504   51.996  1.00 43.32 ? 1184 HOH B O     1 
HETATM 2425 O O     . HOH F 3 .   ? 5.766  10.099  50.121  1.00 33.94 ? 1185 HOH B O     1 
HETATM 2426 O O     . HOH F 3 .   ? -2.712 8.901   24.926  1.00 31.22 ? 1186 HOH B O     1 
HETATM 2427 O O     . HOH F 3 .   ? 4.060  6.331   48.258  1.00 37.39 ? 1187 HOH B O     1 
HETATM 2428 O O     . HOH F 3 .   ? 3.508  4.160   45.701  1.00 16.16 ? 1188 HOH B O     1 
HETATM 2429 O O     . HOH F 3 .   ? -3.304 2.143   22.556  1.00 16.45 ? 1189 HOH B O     1 
HETATM 2430 O O     . HOH F 3 .   ? 5.381  2.246   51.511  1.00 17.80 ? 1190 HOH B O     1 
HETATM 2431 O O     . HOH F 3 .   ? 9.958  -0.461  54.485  1.00 25.68 ? 1191 HOH B O     1 
HETATM 2432 O O     . HOH F 3 .   ? -2.566 -8.465  21.708  1.00 25.46 ? 1192 HOH B O     1 
HETATM 2433 O O     . HOH F 3 .   ? 4.921  -7.387  41.300  1.00 15.83 ? 1193 HOH B O     1 
HETATM 2434 O O     . HOH F 3 .   ? 3.708  -5.998  37.939  1.00 32.31 ? 1194 HOH B O     1 
HETATM 2435 O O     . HOH F 3 .   ? 2.126  -4.314  38.017  1.00 38.39 ? 1195 HOH B O     1 
HETATM 2436 O O     . HOH F 3 .   ? -0.069 -4.630  36.229  0.50 29.09 ? 1196 HOH B O     1 
HETATM 2437 O O     . HOH F 3 .   ? 0.973  -1.590  36.454  1.00 40.18 ? 1197 HOH B O     1 
HETATM 2438 O O     . HOH F 3 .   ? 1.289  1.785   35.820  1.00 22.82 ? 1198 HOH B O     1 
HETATM 2439 O O     . HOH F 3 .   ? -0.301 3.225   38.662  1.00 23.32 ? 1199 HOH B O     1 
HETATM 2440 O O     . HOH F 3 .   ? 0.205  6.475   35.849  0.50 28.39 ? 1200 HOH B O     1 
HETATM 2441 O O     . HOH F 3 .   ? 1.623  6.932   32.785  1.00 30.52 ? 1201 HOH B O     1 
HETATM 2442 O O     . HOH F 3 .   ? 3.808  3.218   32.926  1.00 24.55 ? 1202 HOH B O     1 
HETATM 2443 O O     . HOH F 3 .   ? 0.138  1.357   31.393  1.00 23.95 ? 1203 HOH B O     1 
HETATM 2444 O O     . HOH F 3 .   ? -0.328 2.314   28.760  1.00 17.39 ? 1204 HOH B O     1 
HETATM 2445 O O     . HOH F 3 .   ? 2.322  1.601   28.970  1.00 28.60 ? 1205 HOH B O     1 
HETATM 2446 O O     . HOH F 3 .   ? -0.928 4.718   27.477  1.00 17.38 ? 1206 HOH B O     1 
HETATM 2447 O O     . HOH F 3 .   ? -0.108 5.021   24.856  1.00 15.75 ? 1207 HOH B O     1 
HETATM 2448 O O     . HOH F 3 .   ? -2.791 4.281   24.211  1.00 17.27 ? 1208 HOH B O     1 
HETATM 2449 O O     . HOH F 3 .   ? 2.020  12.162  24.414  1.00 25.96 ? 1209 HOH B O     1 
HETATM 2450 O O     . HOH F 3 .   ? 0.421  11.674  29.533  1.00 36.14 ? 1210 HOH B O     1 
HETATM 2451 O O     . HOH F 3 .   ? 0.199  12.833  31.659  1.00 28.66 ? 1211 HOH B O     1 
HETATM 2452 O O     . HOH F 3 .   ? 1.951  12.737  32.904  1.00 38.58 ? 1212 HOH B O     1 
HETATM 2453 O O     . HOH F 3 .   ? -0.066 11.937  36.189  0.50 35.19 ? 1213 HOH B O     1 
HETATM 2454 O O     . HOH F 3 .   ? 3.021  14.906  36.071  1.00 47.82 ? 1214 HOH B O     1 
HETATM 2455 O O     . HOH F 3 .   ? 4.141  15.769  31.566  1.00 34.91 ? 1215 HOH B O     1 
HETATM 2456 O O     . HOH F 3 .   ? 8.189  14.817  29.925  1.00 44.72 ? 1216 HOH B O     1 
HETATM 2457 O O     . HOH F 3 .   ? 8.355  12.211  28.603  1.00 24.85 ? 1217 HOH B O     1 
HETATM 2458 O O     . HOH F 3 .   ? 8.388  10.931  26.729  1.00 30.63 ? 1218 HOH B O     1 
HETATM 2459 O O     . HOH F 3 .   ? 11.688 16.730  28.567  1.00 45.37 ? 1219 HOH B O     1 
HETATM 2460 O O     . HOH F 3 .   ? 9.927  14.391  35.170  1.00 34.66 ? 1220 HOH B O     1 
HETATM 2461 O O     . HOH F 3 .   ? 9.096  -13.778 38.901  1.00 34.63 ? 1221 HOH B O     1 
HETATM 2462 O O     . HOH F 3 .   ? 9.340  15.466  41.106  1.00 21.64 ? 1222 HOH B O     1 
HETATM 2463 O O     . HOH F 3 .   ? 5.071  15.993  41.561  1.00 39.85 ? 1223 HOH B O     1 
HETATM 2464 O O     . HOH F 3 .   ? 6.831  14.044  44.347  1.00 38.09 ? 1224 HOH B O     1 
HETATM 2465 O O     . HOH F 3 .   ? 8.079  12.052  46.672  1.00 14.07 ? 1225 HOH B O     1 
HETATM 2466 O O     . HOH F 3 .   ? 6.026  10.232  46.715  1.00 17.92 ? 1226 HOH B O     1 
HETATM 2467 O O     . HOH F 3 .   ? 3.916  11.240  45.157  1.00 35.80 ? 1227 HOH B O     1 
HETATM 2468 O O     . HOH F 3 .   ? 3.444  9.318   43.934  1.00 33.45 ? 1228 HOH B O     1 
HETATM 2469 O O     . HOH F 3 .   ? 0.923  9.521   42.596  1.00 30.12 ? 1229 HOH B O     1 
HETATM 2470 O O     . HOH F 3 .   ? 0.133  7.006   28.744  1.00 25.57 ? 1230 HOH B O     1 
HETATM 2471 O O     . HOH F 3 .   ? 6.797  8.153   44.990  1.00 19.52 ? 1231 HOH B O     1 
HETATM 2472 O O     . HOH F 3 .   ? 16.504 -17.201 36.858  1.00 33.00 ? 1232 HOH B O     1 
HETATM 2473 O O     . HOH F 3 .   ? 18.324 11.511  34.433  1.00 14.94 ? 1233 HOH B O     1 
HETATM 2474 O O     . HOH F 3 .   ? 20.409 11.022  30.774  1.00 31.62 ? 1234 HOH B O     1 
HETATM 2475 O O     . HOH F 3 .   ? 10.922 15.823  37.696  1.00 25.35 ? 1235 HOH B O     1 
HETATM 2476 O O     . HOH F 3 .   ? 14.610 -16.008 34.948  1.00 34.34 ? 1236 HOH B O     1 
HETATM 2477 O O     . HOH F 3 .   ? 16.095 -14.225 34.585  1.00 46.00 ? 1237 HOH B O     1 
HETATM 2478 O O     . HOH F 3 .   ? 26.818 -4.434  45.779  1.00 24.07 ? 1238 HOH B O     1 
HETATM 2479 O O     . HOH F 3 .   ? 27.483 -9.917  41.200  1.00 21.98 ? 1239 HOH B O     1 
HETATM 2480 O O     . HOH F 3 .   ? -1.684 -2.350  32.129  1.00 17.12 ? 1240 HOH B O     1 
HETATM 2481 O O     . HOH F 3 .   ? 1.953  12.270  40.034  1.00 40.07 ? 1241 HOH B O     1 
HETATM 2482 O O     . HOH F 3 .   ? 5.516  8.153   48.095  1.00 34.20 ? 1242 HOH B O     1 
HETATM 2483 O O     . HOH F 3 .   ? 20.573 -10.989 40.269  1.00 36.18 ? 1243 HOH B O     1 
HETATM 2484 O O     . HOH F 3 .   ? -2.132 -11.052 42.545  1.00 35.60 ? 1244 HOH B O     1 
HETATM 2485 O O     . HOH F 3 .   ? 14.548 10.875  31.001  1.00 29.83 ? 1245 HOH B O     1 
HETATM 2486 O O     . HOH F 3 .   ? 13.173 -11.368 23.071  1.00 35.17 ? 1246 HOH B O     1 
HETATM 2487 O O     . HOH F 3 .   ? 2.008  -11.019 25.479  1.00 36.09 ? 1247 HOH B O     1 
HETATM 2488 O O     . HOH F 3 .   ? 2.463  14.246  27.089  1.00 35.87 ? 1248 HOH B O     1 
HETATM 2489 O O     . HOH F 3 .   ? 2.861  13.066  37.471  1.00 34.45 ? 1249 HOH B O     1 
HETATM 2490 O O     . HOH F 3 .   ? 22.196 12.211  38.120  1.00 31.90 ? 1250 HOH B O     1 
HETATM 2491 O O     . HOH F 3 .   ? 5.294  -12.194 49.775  1.00 37.66 ? 1251 HOH B O     1 
HETATM 2492 O O     . HOH F 3 .   ? -0.905 -2.008  38.996  1.00 36.79 ? 1252 HOH B O     1 
HETATM 2493 O O     . HOH F 3 .   ? 6.503  -16.675 16.713  1.00 37.44 ? 1253 HOH B O     1 
HETATM 2494 O O     . HOH F 3 .   ? 3.254  -12.477 37.402  1.00 40.23 ? 1254 HOH B O     1 
HETATM 2495 O O     . HOH F 3 .   ? 11.528 7.377   17.091  1.00 34.48 ? 1255 HOH B O     1 
HETATM 2496 O O     . HOH F 3 .   ? -3.789 -8.161  37.352  1.00 39.09 ? 1256 HOH B O     1 
HETATM 2497 O O     . HOH F 3 .   ? 21.776 4.167   45.355  1.00 38.04 ? 1257 HOH B O     1 
HETATM 2498 O O     . HOH F 3 .   ? -0.458 -18.261 18.241  1.00 39.75 ? 1258 HOH B O     1 
HETATM 2499 O O     . HOH F 3 .   ? 7.365  17.634  31.589  1.00 39.45 ? 1259 HOH B O     1 
HETATM 2500 O O     . HOH F 3 .   ? 16.053 -14.615 30.631  1.00 37.26 ? 1260 HOH B O     1 
HETATM 2501 O O     . HOH F 3 .   ? 3.160  13.781  41.914  1.00 39.22 ? 1261 HOH B O     1 
HETATM 2502 O O     . HOH F 3 .   ? 4.878  -12.199 28.666  1.00 41.59 ? 1262 HOH B O     1 
HETATM 2503 O O     . HOH F 3 .   ? 17.264 17.103  23.486  1.00 36.02 ? 1263 HOH B O     1 
HETATM 2504 O O     . HOH F 3 .   ? -2.611 -3.607  39.416  1.00 39.82 ? 1264 HOH B O     1 
HETATM 2505 O O     . HOH F 3 .   ? 23.196 3.852   47.090  1.00 26.95 ? 1265 HOH B O     1 
HETATM 2506 O O     . HOH F 3 .   ? 4.579  17.267  33.993  1.00 28.10 ? 1266 HOH B O     1 
HETATM 2507 O O     . HOH F 3 .   ? 1.604  16.915  34.925  1.00 27.36 ? 1267 HOH B O     1 
HETATM 2508 O O     . HOH F 3 .   ? -3.791 -2.532  37.859  1.00 28.48 ? 1268 HOH B O     1 
HETATM 2509 O O     . HOH F 3 .   ? 3.623  -0.989  13.104  1.00 25.70 ? 1269 HOH B O     1 
HETATM 2510 O O     . HOH F 3 .   ? -4.475 -2.849  10.384  1.00 26.27 ? 1270 HOH B O     1 
HETATM 2511 O O     . HOH F 3 .   ? -1.397 -11.998 23.675  1.00 27.57 ? 1271 HOH B O     1 
HETATM 2512 O O     . HOH F 3 .   ? 9.068  -15.654 12.256  1.00 28.55 ? 1272 HOH B O     1 
HETATM 2513 O O     . HOH F 3 .   ? 1.180  -15.252 13.489  1.00 26.56 ? 1273 HOH B O     1 
HETATM 2514 O O     . HOH F 3 .   ? 0.925  11.095  13.884  1.00 28.70 ? 1274 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 1   ? 0.3564 0.3542 0.3508 -0.0001 0.0006  0.0001  1    LYS A N     
2    C CA    . LYS A 1   ? 0.3405 0.3331 0.3414 -0.0018 0.0032  0.0014  1    LYS A CA    
3    C C     . LYS A 1   ? 0.3220 0.3100 0.3170 0.0029  0.0061  0.0006  1    LYS A C     
4    O O     . LYS A 1   ? 0.3225 0.3033 0.3249 0.0004  0.0096  0.0031  1    LYS A O     
5    C CB    . LYS A 1   ? 0.3545 0.3502 0.3541 0.0023  0.0021  -0.0017 1    LYS A CB    
6    C CG    . LYS A 1   ? 0.3703 0.3689 0.3773 -0.0012 0.0019  -0.0015 1    LYS A CG    
7    C CD    . LYS A 1   ? 0.3972 0.3976 0.3919 -0.0003 -0.0039 0.0005  1    LYS A CD    
8    C CE    . LYS A 1   ? 0.4081 0.4048 0.4068 -0.0030 0.0000  -0.0010 1    LYS A CE    
9    N NZ    . LYS A 1   ? 0.4126 0.4258 0.4163 0.0022  0.0000  -0.0019 1    LYS A NZ    
10   N N     . GLU A 2   ? 0.2932 0.2783 0.2803 -0.0022 0.0101  0.0066  2    GLU A N     
11   C CA    . GLU A 2   ? 0.2720 0.2594 0.2523 0.0000  0.0079  0.0054  2    GLU A CA    
12   C C     . GLU A 2   ? 0.2556 0.2462 0.2440 -0.0001 0.0122  0.0087  2    GLU A C     
13   O O     . GLU A 2   ? 0.2667 0.2599 0.2479 -0.0037 0.0153  0.0156  2    GLU A O     
14   C CB    . GLU A 2   ? 0.2601 0.2503 0.2575 -0.0002 0.0075  0.0061  2    GLU A CB    
15   C CG    . GLU A 2   ? 0.2496 0.2391 0.2348 0.0048  0.0079  0.0106  2    GLU A CG    
16   C CD    . GLU A 2   ? 0.2525 0.2450 0.2200 0.0023  0.0108  0.0186  2    GLU A CD    
17   O OE1   . GLU A 2   ? 0.2605 0.2466 0.2559 0.0159  0.0292  0.0094  2    GLU A OE1   
18   O OE2   . GLU A 2   ? 0.2568 0.2604 0.2629 0.0219  0.0017  0.0111  2    GLU A OE2   
19   N N     . THR A 3   ? 0.2440 0.2137 0.2280 0.0001  0.0084  0.0119  3    THR A N     
20   C CA    . THR A 3   ? 0.2291 0.2013 0.2184 0.0000  0.0100  0.0126  3    THR A CA    
21   C C     . THR A 3   ? 0.2138 0.1900 0.2087 -0.0015 0.0049  0.0142  3    THR A C     
22   O O     . THR A 3   ? 0.2260 0.1906 0.2004 0.0016  0.0135  0.0286  3    THR A O     
23   C CB    . THR A 3   ? 0.2286 0.1962 0.2114 0.0105  0.0063  0.0140  3    THR A CB    
24   O OG1   . THR A 3   ? 0.2391 0.2081 0.2235 0.0064  0.0157  0.0191  3    THR A OG1   
25   C CG2   . THR A 3   ? 0.2429 0.2058 0.2236 0.0088  0.0080  0.0005  3    THR A CG2   
26   N N     . ALA A 4   ? 0.2181 0.2036 0.1970 -0.0004 0.0097  0.0095  4    ALA A N     
27   C CA    . ALA A 4   ? 0.2033 0.1995 0.1950 -0.0044 0.0080  0.0139  4    ALA A CA    
28   C C     . ALA A 4   ? 0.1913 0.1906 0.1682 -0.0028 0.0074  0.0222  4    ALA A C     
29   O O     . ALA A 4   ? 0.1884 0.1987 0.1704 0.0003  0.0131  0.0304  4    ALA A O     
30   C CB    . ALA A 4   ? 0.2116 0.2082 0.1924 -0.0015 0.0050  0.0122  4    ALA A CB    
31   N N     . ALA A 5   ? 0.1990 0.1959 0.1640 0.0020  0.0117  0.0177  5    ALA A N     
32   C CA    . ALA A 5   ? 0.1879 0.1896 0.1669 0.0087  0.0095  0.0122  5    ALA A CA    
33   C C     . ALA A 5   ? 0.1944 0.1896 0.1616 0.0058  0.0060  0.0187  5    ALA A C     
34   O O     . ALA A 5   ? 0.1884 0.1890 0.1537 0.0185  0.0119  0.0218  5    ALA A O     
35   C CB    . ALA A 5   ? 0.1894 0.1997 0.1681 0.0053  0.0106  0.0085  5    ALA A CB    
36   N N     . ALA A 6   ? 0.2178 0.1940 0.1720 0.0086  0.0069  0.0191  6    ALA A N     
37   C CA    . ALA A 6   ? 0.2117 0.1976 0.1747 0.0049  0.0072  0.0063  6    ALA A CA    
38   C C     . ALA A 6   ? 0.2049 0.1780 0.1859 0.0022  0.0064  0.0161  6    ALA A C     
39   O O     . ALA A 6   ? 0.2124 0.1821 0.1803 0.0085  0.0139  0.0207  6    ALA A O     
40   C CB    . ALA A 6   ? 0.2334 0.2096 0.2024 0.0080  0.0049  0.0074  6    ALA A CB    
41   N N     . LYS A 7   ? 0.2046 0.1828 0.1858 0.0056  0.0142  0.0187  7    LYS A N     
42   C CA    . LYS A 7   ? 0.2022 0.1867 0.1815 0.0047  0.0145  0.0123  7    LYS A CA    
43   C C     . LYS A 7   ? 0.1806 0.1784 0.1700 0.0075  0.0170  0.0203  7    LYS A C     
44   O O     . LYS A 7   ? 0.1857 0.1642 0.1628 0.0056  0.0117  0.0231  7    LYS A O     
45   C CB    . LYS A 7   ? 0.2082 0.1852 0.1927 -0.0029 0.0163  0.0235  7    LYS A CB    
46   C CG    . LYS A 7   ? 0.2185 0.2141 0.2235 -0.0007 0.0074  0.0130  7    LYS A CG    
47   C CD    . LYS A 7   ? 0.2342 0.2305 0.2466 -0.0035 0.0034  0.0079  7    LYS A CD    
48   C CE    . LYS A 7   ? 0.2351 0.2587 0.2669 -0.0068 0.0018  0.0010  7    LYS A CE    
49   N NZ    . LYS A 7   ? 0.2423 0.2925 0.3090 -0.0076 -0.0092 -0.0065 7    LYS A NZ    
50   N N     . PHE A 8   ? 0.1745 0.1690 0.1512 0.0022  0.0141  0.0220  8    PHE A N     
51   C CA    . PHE A 8   ? 0.1595 0.1613 0.1433 0.0090  0.0107  0.0099  8    PHE A CA    
52   C C     . PHE A 8   ? 0.1511 0.1596 0.1316 0.0131  0.0130  0.0266  8    PHE A C     
53   O O     . PHE A 8   ? 0.1584 0.1760 0.1251 0.0102  0.0011  0.0219  8    PHE A O     
54   C CB    . PHE A 8   ? 0.1509 0.1524 0.1291 0.0120  0.0076  0.0210  8    PHE A CB    
55   C CG    . PHE A 8   ? 0.1386 0.1490 0.1151 0.0077  0.0136  0.0092  8    PHE A CG    
56   C CD1   . PHE A 8   ? 0.1523 0.1694 0.1198 0.0186  0.0035  0.0147  8    PHE A CD1   
57   C CD2   . PHE A 8   ? 0.1351 0.1509 0.1290 -0.0002 -0.0037 0.0187  8    PHE A CD2   
58   C CE1   . PHE A 8   ? 0.1352 0.1741 0.1350 0.0110  0.0025  0.0021  8    PHE A CE1   
59   C CE2   . PHE A 8   ? 0.1388 0.1489 0.1333 0.0009  0.0016  0.0129  8    PHE A CE2   
60   C CZ    . PHE A 8   ? 0.1270 0.1587 0.1257 0.0022  0.0198  0.0143  8    PHE A CZ    
61   N N     . GLU A 9   ? 0.1578 0.1716 0.1470 0.0234  0.0123  0.0192  9    GLU A N     
62   C CA    . GLU A 9   ? 0.1740 0.1760 0.1576 0.0210  0.0100  0.0147  9    GLU A CA    
63   C C     . GLU A 9   ? 0.1755 0.1734 0.1503 0.0195  0.0017  0.0254  9    GLU A C     
64   O O     . GLU A 9   ? 0.1982 0.2019 0.1663 0.0221  0.0114  0.0238  9    GLU A O     
65   C CB    . GLU A 9   ? 0.1760 0.1872 0.1707 0.0304  0.0042  0.0157  9    GLU A CB    
66   C CG    . GLU A 9   ? 0.1958 0.1968 0.1796 0.0200  0.0084  0.0171  9    GLU A CG    
67   C CD    . GLU A 9   ? 0.2226 0.2344 0.2338 0.0261  -0.0030 0.0120  9    GLU A CD    
68   O OE1   . GLU A 9   ? 0.2639 0.3071 0.2531 0.0328  -0.0084 0.0164  9    GLU A OE1   
69   O OE2   . GLU A 9   ? 0.2872 0.2535 0.2345 0.0449  -0.0153 0.0157  9    GLU A OE2   
70   N N     . ARG A 10  ? 0.1891 0.1814 0.1454 0.0173  0.0141  0.0223  10   ARG A N     
71   C CA    . ARG A 10  ? 0.1895 0.1841 0.1525 0.0134  0.0132  0.0113  10   ARG A CA    
72   C C     . ARG A 10  ? 0.1861 0.1758 0.1539 0.0068  0.0028  0.0131  10   ARG A C     
73   O O     . ARG A 10  ? 0.2061 0.1849 0.1658 0.0229  0.0232  0.0141  10   ARG A O     
74   C CB    . ARG A 10  ? 0.2089 0.1926 0.1698 0.0108  0.0140  0.0143  10   ARG A CB    
75   C CG    . ARG A 10  ? 0.2253 0.2100 0.1926 0.0107  0.0246  0.0105  10   ARG A CG    
76   C CD    . ARG A 10  ? 0.2310 0.2144 0.2141 0.0053  0.0291  0.0101  10   ARG A CD    
77   N NE    . ARG A 10  ? 0.2523 0.2336 0.2369 -0.0149 0.0227  0.0204  10   ARG A NE    
78   C CZ    . ARG A 10  ? 0.2613 0.2391 0.2336 -0.0057 0.0224  0.0253  10   ARG A CZ    
79   N NH1   . ARG A 10  ? 0.2703 0.2524 0.2590 0.0044  0.0140  0.0057  10   ARG A NH1   
80   N NH2   . ARG A 10  ? 0.2742 0.2508 0.2701 -0.0079 0.0207  0.0137  10   ARG A NH2   
81   N N     . GLN A 11  ? 0.1719 0.1833 0.1393 0.0130  0.0168  0.0194  11   GLN A N     
82   C CA    . GLN A 11  ? 0.1723 0.1763 0.1483 0.0078  0.0118  0.0107  11   GLN A CA    
83   C C     . GLN A 11  ? 0.1605 0.1720 0.1462 0.0074  0.0057  0.0116  11   GLN A C     
84   O O     . GLN A 11  ? 0.1753 0.1820 0.1664 0.0099  0.0195  0.0194  11   GLN A O     
85   C CB    . GLN A 11  ? 0.1755 0.1873 0.1665 0.0040  0.0039  0.0107  11   GLN A CB    
86   C CG    . GLN A 11  ? 0.1882 0.1929 0.1721 -0.0037 0.0204  0.0077  11   GLN A CG    
87   C CD    . GLN A 11  ? 0.2041 0.2371 0.2192 -0.0091 0.0072  0.0061  11   GLN A CD    
88   O OE1   . GLN A 11  ? 0.2355 0.2504 0.2403 0.0174  0.0164  -0.0016 11   GLN A OE1   
89   N NE2   . GLN A 11  ? 0.1854 0.2228 0.2091 -0.0081 0.0272  0.0041  11   GLN A NE2   
90   N N     . HIS A 12  ? 0.1501 0.1738 0.1393 0.0095  0.0044  0.0065  12   HIS A N     
91   C CA    . HIS A 12  ? 0.1413 0.1702 0.1329 0.0102  0.0021  0.0036  12   HIS A CA    
92   C C     . HIS A 12  ? 0.1528 0.1908 0.1557 0.0122  0.0002  0.0098  12   HIS A C     
93   O O     . HIS A 12  ? 0.1700 0.2157 0.1847 0.0044  -0.0121 0.0065  12   HIS A O     
94   C CB    . HIS A 12  ? 0.1418 0.1673 0.1189 0.0064  0.0053  0.0046  12   HIS A CB    
95   C CG    . HIS A 12  ? 0.1377 0.1431 0.1140 -0.0018 0.0009  0.0080  12   HIS A CG    
96   N ND1   . HIS A 12  ? 0.1220 0.1484 0.1066 -0.0024 -0.0054 0.0212  12   HIS A ND1   
97   C CD2   . HIS A 12  ? 0.1461 0.1270 0.1234 -0.0036 0.0147  0.0077  12   HIS A CD2   
98   C CE1   . HIS A 12  ? 0.1194 0.1571 0.1340 0.0056  0.0018  0.0137  12   HIS A CE1   
99   N NE2   . HIS A 12  ? 0.1303 0.1312 0.1215 -0.0137 0.0046  0.0132  12   HIS A NE2   
100  N N     . MET A 13  ? 0.1535 0.2021 0.1378 0.0092  0.0058  0.0185  13   MET A N     
101  C CA    . MET A 13  ? 0.1713 0.2115 0.1581 0.0071  -0.0021 0.0107  13   MET A CA    
102  C C     . MET A 13  ? 0.1739 0.2191 0.1612 0.0112  -0.0062 0.0173  13   MET A C     
103  O O     . MET A 13  ? 0.1939 0.2556 0.1659 0.0096  0.0024  0.0160  13   MET A O     
104  C CB    . MET A 13  ? 0.1789 0.2086 0.1496 0.0062  0.0038  0.0122  13   MET A CB    
105  C CG    . MET A 13  ? 0.1772 0.2352 0.1493 0.0125  0.0070  0.0116  13   MET A CG    
106  S SD    . MET A 13  ? 0.1752 0.2840 0.1470 0.0166  0.0056  0.0270  13   MET A SD    
107  C CE    . MET A 13  ? 0.1884 0.2507 0.1699 0.0184  0.0048  0.0088  13   MET A CE    
108  N N     . ASP A 14  ? 0.1821 0.2241 0.1418 0.0119  0.0019  0.0127  14   ASP A N     
109  C CA    . ASP A 14  ? 0.1967 0.2253 0.1606 0.0120  -0.0090 0.0155  14   ASP A CA    
110  C C     . ASP A 14  ? 0.1907 0.2235 0.1556 0.0146  -0.0012 0.0146  14   ASP A C     
111  O O     . ASP A 14  ? 0.1795 0.2322 0.1653 0.0265  -0.0078 0.0042  14   ASP A O     
112  C CB    . ASP A 14  ? 0.2171 0.2447 0.1938 0.0141  -0.0070 0.0064  14   ASP A CB    
113  C CG    . ASP A 14  ? 0.2673 0.2739 0.2275 0.0110  -0.0135 0.0098  14   ASP A CG    
114  O OD1   . ASP A 14  ? 0.3353 0.3285 0.2266 0.0283  -0.0040 0.0195  14   ASP A OD1   
115  O OD2   . ASP A 14  ? 0.2595 0.3170 0.2244 0.0159  -0.0286 -0.0012 14   ASP A OD2   
116  N N     . SER A 15  ? 0.1778 0.2173 0.1676 0.0154  -0.0066 0.0109  15   SER A N     
117  C CA    . SER A 15  ? 0.1888 0.2194 0.2019 0.0051  0.0007  0.0093  15   SER A CA    
118  C C     . SER A 15  ? 0.2070 0.2472 0.2279 0.0051  -0.0058 -0.0043 15   SER A C     
119  O O     . SER A 15  ? 0.2455 0.2853 0.2645 -0.0156 0.0100  -0.0001 15   SER A O     
120  C CB    . SER A 15  ? 0.1868 0.2144 0.1850 0.0043  -0.0001 0.0074  15   SER A CB    
121  O OG    . SER A 15  ? 0.1841 0.2082 0.1843 0.0038  -0.0005 0.0077  15   SER A OG    
122  N N     . SER A 16  ? 0.2431 0.2701 0.2437 0.0031  -0.0073 0.0101  16   SER A N     
123  C CA    . SER A 16  ? 0.2885 0.3115 0.2848 0.0026  -0.0090 0.0055  16   SER A CA    
124  C C     . SER A 16  ? 0.3295 0.3407 0.3271 -0.0008 -0.0043 0.0007  16   SER A C     
125  O O     . SER A 16  ? 0.3552 0.3694 0.3395 0.0005  -0.0135 -0.0040 16   SER A O     
126  C CB    . SER A 16  ? 0.2899 0.3193 0.2896 0.0004  -0.0018 0.0048  16   SER A CB    
127  O OG    . SER A 16  ? 0.2988 0.3322 0.3182 0.0011  0.0029  0.0069  16   SER A OG    
128  N N     . THR A 17  ? 0.3641 0.3737 0.3672 0.0051  -0.0040 0.0011  17   THR A N     
129  C CA    . THR A 17  ? 0.3964 0.3965 0.3966 0.0026  -0.0021 -0.0034 17   THR A CA    
130  C C     . THR A 17  ? 0.4135 0.4125 0.4134 0.0005  0.0003  0.0003  17   THR A C     
131  O O     . THR A 17  ? 0.4243 0.4230 0.4234 0.0007  -0.0011 -0.0008 17   THR A O     
132  C CB    . THR A 17  ? 0.3997 0.4029 0.4019 0.0030  -0.0016 -0.0025 17   THR A CB    
133  O OG1   . THR A 17  ? 0.4078 0.4012 0.4012 0.0088  0.0007  -0.0013 17   THR A OG1   
134  C CG2   . THR A 17  ? 0.4138 0.4107 0.4151 -0.0001 -0.0017 0.0009  17   THR A CG2   
135  N N     . SER A 18  ? 0.4307 0.4323 0.4252 -0.0001 0.0016  -0.0010 18   SER A N     
136  C CA    . SER A 18  ? 0.4402 0.4395 0.4411 -0.0010 -0.0005 0.0000  18   SER A CA    
137  C C     . SER A 18  ? 0.4397 0.4413 0.4421 -0.0004 -0.0011 -0.0003 18   SER A C     
138  O O     . SER A 18  ? 0.4538 0.4549 0.4536 0.0007  -0.0007 0.0025  18   SER A O     
139  C CB    . SER A 18  ? 0.4423 0.4438 0.4410 0.0003  -0.0011 -0.0009 18   SER A CB    
140  O OG    . SER A 18  ? 0.4597 0.4525 0.4589 0.0045  0.0008  0.0013  18   SER A OG    
141  N N     . ALA A 19  ? 0.4409 0.4396 0.4408 0.0003  -0.0004 -0.0004 19   ALA A N     
142  C CA    . ALA A 19  ? 0.4323 0.4327 0.4286 -0.0015 -0.0006 -0.0009 19   ALA A CA    
143  C C     . ALA A 19  ? 0.4266 0.4272 0.4251 -0.0017 0.0012  0.0004  19   ALA A C     
144  O O     . ALA A 19  ? 0.4296 0.4312 0.4268 -0.0035 0.0019  -0.0002 19   ALA A O     
145  C CB    . ALA A 19  ? 0.4377 0.4362 0.4368 -0.0022 -0.0027 0.0004  19   ALA A CB    
146  N N     . ALA A 20  ? 0.4139 0.4135 0.4091 -0.0003 0.0002  -0.0017 20   ALA A N     
147  C CA    . ALA A 20  ? 0.4052 0.4066 0.4045 -0.0013 0.0002  0.0001  20   ALA A CA    
148  C C     . ALA A 20  ? 0.3985 0.4003 0.3937 -0.0011 -0.0015 -0.0006 20   ALA A C     
149  O O     . ALA A 20  ? 0.3990 0.4084 0.3961 -0.0025 0.0018  -0.0033 20   ALA A O     
150  C CB    . ALA A 20  ? 0.4065 0.4086 0.4062 0.0000  0.0007  -0.0005 20   ALA A CB    
151  N N     . SER A 21  ? 0.3856 0.3863 0.3818 -0.0012 0.0001  0.0000  21   SER A N     
152  C CA    . SER A 21  ? 0.3757 0.3748 0.3677 0.0012  -0.0003 -0.0024 21   SER A CA    
153  C C     . SER A 21  ? 0.3672 0.3658 0.3587 -0.0003 -0.0001 -0.0014 21   SER A C     
154  O O     . SER A 21  ? 0.3735 0.3682 0.3529 0.0017  -0.0004 -0.0014 21   SER A O     
155  C CB    . SER A 21  ? 0.3778 0.3762 0.3681 0.0017  0.0002  -0.0044 21   SER A CB    
156  O OG    . SER A 21  ? 0.3719 0.3677 0.3548 -0.0023 0.0012  -0.0041 21   SER A OG    
157  N N     . SER A 22  ? 0.3535 0.3530 0.3474 0.0012  -0.0011 -0.0032 22   SER A N     
158  C CA    . SER A 22  ? 0.3419 0.3434 0.3376 0.0014  0.0009  -0.0018 22   SER A CA    
159  C C     . SER A 22  ? 0.3276 0.3350 0.3259 0.0006  0.0041  -0.0047 22   SER A C     
160  O O     . SER A 22  ? 0.3334 0.3519 0.3247 0.0058  0.0041  -0.0035 22   SER A O     
161  C CB    . SER A 22  ? 0.3392 0.3452 0.3401 0.0001  -0.0009 0.0008  22   SER A CB    
162  O OG    . SER A 22  ? 0.3376 0.3439 0.3399 0.0004  -0.0065 -0.0046 22   SER A OG    
163  N N     . SER A 23  ? 0.3146 0.3207 0.3071 0.0008  -0.0004 -0.0055 23   SER A N     
164  C CA    . SER A 23  ? 0.3009 0.3050 0.2869 -0.0004 0.0011  -0.0060 23   SER A CA    
165  C C     . SER A 23  ? 0.2849 0.2951 0.2711 0.0040  0.0097  -0.0112 23   SER A C     
166  O O     . SER A 23  ? 0.2942 0.3084 0.2729 0.0074  0.0055  -0.0196 23   SER A O     
167  C CB    . SER A 23  ? 0.2984 0.3010 0.2764 -0.0048 0.0009  -0.0015 23   SER A CB    
168  O OG    . SER A 23  ? 0.2832 0.2926 0.2475 -0.0068 -0.0049 -0.0312 23   SER A OG    
169  N N     . ASN A 24  ? 0.2817 0.2988 0.2642 0.0030  0.0061  -0.0128 24   ASN A N     
170  C CA    . ASN A 24  ? 0.2842 0.2944 0.2674 0.0024  0.0079  -0.0074 24   ASN A CA    
171  C C     . ASN A 24  ? 0.2717 0.2889 0.2496 0.0044  0.0092  -0.0060 24   ASN A C     
172  O O     . ASN A 24  ? 0.2743 0.2855 0.2158 0.0124  0.0270  -0.0038 24   ASN A O     
173  C CB    . ASN A 24  ? 0.2995 0.3151 0.2855 -0.0009 0.0038  -0.0009 24   ASN A CB    
174  C CG    . ASN A 24  ? 0.3342 0.3331 0.3406 0.0059  0.0126  -0.0067 24   ASN A CG    
175  O OD1   . ASN A 24  ? 0.3590 0.3829 0.3858 0.0040  -0.0073 0.0011  24   ASN A OD1   
176  N ND2   . ASN A 24  ? 0.3792 0.3824 0.3748 0.0037  -0.0057 -0.0026 24   ASN A ND2   
177  N N     . TYR A 25  ? 0.2652 0.2807 0.2405 0.0061  0.0076  -0.0050 25   TYR A N     
178  C CA    . TYR A 25  ? 0.2532 0.2665 0.2346 0.0072  0.0021  -0.0021 25   TYR A CA    
179  C C     . TYR A 25  ? 0.2301 0.2576 0.1968 0.0087  0.0147  0.0026  25   TYR A C     
180  O O     . TYR A 25  ? 0.2465 0.2679 0.1859 0.0190  0.0154  0.0009  25   TYR A O     
181  C CB    . TYR A 25  ? 0.2479 0.2693 0.2328 0.0083  0.0001  -0.0083 25   TYR A CB    
182  C CG    . TYR A 25  ? 0.2575 0.2863 0.2245 0.0083  -0.0027 -0.0049 25   TYR A CG    
183  C CD1   . TYR A 25  ? 0.2752 0.3067 0.2503 0.0167  -0.0007 -0.0087 25   TYR A CD1   
184  C CD2   . TYR A 25  ? 0.2373 0.2587 0.2104 0.0002  -0.0024 -0.0008 25   TYR A CD2   
185  C CE1   . TYR A 25  ? 0.2540 0.2892 0.2329 0.0162  -0.0097 0.0031  25   TYR A CE1   
186  C CE2   . TYR A 25  ? 0.2314 0.2727 0.2112 0.0148  -0.0012 -0.0056 25   TYR A CE2   
187  C CZ    . TYR A 25  ? 0.2177 0.2736 0.2032 0.0138  0.0079  -0.0113 25   TYR A CZ    
188  O OH    . TYR A 25  ? 0.2126 0.3038 0.1896 0.0242  0.0161  -0.0091 25   TYR A OH    
189  N N     . CYS A 26  ? 0.2244 0.2379 0.1960 0.0077  0.0186  0.0034  26   CYS A N     
190  C CA    . CYS A 26  ? 0.2178 0.2330 0.2096 0.0040  0.0173  0.0011  26   CYS A CA    
191  C C     . CYS A 26  ? 0.2205 0.2400 0.2076 0.0027  0.0179  0.0000  26   CYS A C     
192  O O     . CYS A 26  ? 0.2373 0.2325 0.1881 0.0100  0.0400  0.0011  26   CYS A O     
193  C CB    . CYS A 26  ? 0.2042 0.2312 0.1908 -0.0032 0.0196  -0.0006 26   CYS A CB    
194  S SG    . CYS A 26  ? 0.1971 0.2450 0.1639 -0.0121 0.0045  -0.0065 26   CYS A SG    
195  N N     . ASN A 27  ? 0.2406 0.2463 0.2185 0.0054  0.0231  -0.0009 27   ASN A N     
196  C CA    . ASN A 27  ? 0.2505 0.2581 0.2346 -0.0003 0.0157  0.0018  27   ASN A CA    
197  C C     . ASN A 27  ? 0.2711 0.2652 0.2295 -0.0009 0.0160  0.0014  27   ASN A C     
198  O O     . ASN A 27  ? 0.2806 0.2661 0.2201 -0.0025 0.0274  0.0049  27   ASN A O     
199  C CB    . ASN A 27  ? 0.2505 0.2684 0.2376 0.0009  0.0133  0.0004  27   ASN A CB    
200  C CG    . ASN A 27  ? 0.2644 0.2743 0.2604 0.0068  0.0161  -0.0048 27   ASN A CG    
201  O OD1   . ASN A 27  ? 0.2525 0.2925 0.2687 0.0222  0.0317  -0.0246 27   ASN A OD1   
202  N ND2   . ASN A 27  ? 0.2988 0.2856 0.2952 0.0028  0.0026  -0.0098 27   ASN A ND2   
203  N N     . GLN A 28  ? 0.2781 0.2678 0.2360 -0.0009 0.0189  -0.0001 28   GLN A N     
204  C CA    . GLN A 28  ? 0.2939 0.2826 0.2570 0.0047  0.0140  -0.0002 28   GLN A CA    
205  C C     . GLN A 28  ? 0.2914 0.2844 0.2472 0.0028  0.0170  0.0025  28   GLN A C     
206  O O     . GLN A 28  ? 0.3159 0.2915 0.2265 0.0086  0.0346  0.0126  28   GLN A O     
207  C CB    . GLN A 28  ? 0.2965 0.2985 0.2870 0.0051  0.0118  0.0016  28   GLN A CB    
208  C CG    . GLN A 28  ? 0.3451 0.3373 0.3173 0.0061  0.0140  -0.0053 28   GLN A CG    
209  C CD    . GLN A 28  ? 0.3794 0.3918 0.3914 0.0015  -0.0066 -0.0026 28   GLN A CD    
210  O OE1   . GLN A 28  ? 0.4102 0.4175 0.4348 -0.0038 0.0090  0.0071  28   GLN A OE1   
211  N NE2   . GLN A 28  ? 0.4277 0.4249 0.4138 0.0013  0.0006  0.0070  28   GLN A NE2   
212  N N     . MET A 29  ? 0.2853 0.2795 0.2532 0.0044  0.0197  0.0042  29   MET A N     
213  C CA    . MET A 29  ? 0.2844 0.2748 0.2606 0.0078  0.0159  0.0034  29   MET A CA    
214  C C     . MET A 29  ? 0.2818 0.2611 0.2408 0.0001  0.0234  0.0082  29   MET A C     
215  O O     . MET A 29  ? 0.3066 0.2655 0.2415 0.0030  0.0265  0.0159  29   MET A O     
216  C CB    . MET A 29  ? 0.2892 0.2770 0.2629 0.0074  0.0134  0.0013  29   MET A CB    
217  C CG    . MET A 29  ? 0.3042 0.3107 0.2867 0.0091  0.0061  0.0018  29   MET A CG    
218  S SD    . MET A 29  ? 0.3575 0.3666 0.3008 0.0636  0.0106  0.0149  29   MET A SD    
219  C CE    . MET A 29  ? 0.3252 0.3351 0.3163 0.0084  0.0084  0.0029  29   MET A CE    
220  N N     . MET A 30  ? 0.2722 0.2557 0.2306 0.0078  0.0239  0.0110  30   MET A N     
221  C CA    . MET A 30  ? 0.2697 0.2521 0.2414 0.0030  0.0226  0.0058  30   MET A CA    
222  C C     . MET A 30  ? 0.2877 0.2702 0.2604 -0.0007 0.0200  0.0087  30   MET A C     
223  O O     . MET A 30  ? 0.2985 0.2761 0.2517 -0.0048 0.0312  0.0108  30   MET A O     
224  C CB    . MET A 30  ? 0.2620 0.2505 0.2296 0.0012  0.0222  0.0070  30   MET A CB    
225  C CG    . MET A 30  ? 0.2394 0.2320 0.2118 0.0070  0.0259  0.0020  30   MET A CG    
226  S SD    . MET A 30  ? 0.1970 0.2143 0.1970 0.0029  0.0494  0.0087  30   MET A SD    
227  C CE    . MET A 30  ? 0.2131 0.2354 0.2425 -0.0045 0.0190  -0.0052 30   MET A CE    
228  N N     . LYS A 31  ? 0.3043 0.2841 0.2748 0.0014  0.0158  0.0017  31   LYS A N     
229  C CA    . LYS A 31  ? 0.3051 0.2931 0.2855 0.0018  0.0136  0.0036  31   LYS A CA    
230  C C     . LYS A 31  ? 0.3057 0.2952 0.2707 0.0007  0.0156  0.0028  31   LYS A C     
231  O O     . LYS A 31  ? 0.3159 0.2977 0.2610 0.0047  0.0368  -0.0035 31   LYS A O     
232  C CB    . LYS A 31  ? 0.3119 0.3059 0.2933 0.0002  0.0113  0.0015  31   LYS A CB    
233  C CG    . LYS A 31  ? 0.3389 0.3278 0.3252 -0.0001 0.0077  0.0113  31   LYS A CG    
234  C CD    . LYS A 31  ? 0.3734 0.3674 0.3548 0.0029  0.0057  -0.0028 31   LYS A CD    
235  C CE    . LYS A 31  ? 0.3827 0.3907 0.3891 -0.0007 0.0005  0.0018  31   LYS A CE    
236  N NZ    . LYS A 31  ? 0.4095 0.4002 0.3973 0.0006  0.0022  -0.0029 31   LYS A NZ    
237  N N     . SER A 32  ? 0.3095 0.2949 0.2733 0.0060  0.0128  0.0038  32   SER A N     
238  C CA    . SER A 32  ? 0.3131 0.2959 0.2852 0.0041  0.0098  0.0023  32   SER A CA    
239  C C     . SER A 32  ? 0.3097 0.2884 0.2710 0.0056  0.0110  0.0069  32   SER A C     
240  O O     . SER A 32  ? 0.3378 0.2995 0.2758 0.0088  0.0236  0.0148  32   SER A O     
241  C CB    . SER A 32  ? 0.3211 0.3076 0.2998 0.0064  0.0024  -0.0030 32   SER A CB    
242  O OG    . SER A 32  ? 0.3526 0.3272 0.3307 0.0061  0.0085  0.0040  32   SER A OG    
243  N N     . ARG A 33  ? 0.2964 0.2708 0.2623 0.0055  0.0163  0.0090  33   ARG A N     
244  C CA    . ARG A 33  ? 0.2851 0.2618 0.2565 0.0049  0.0136  0.0073  33   ARG A CA    
245  C C     . ARG A 33  ? 0.2949 0.2787 0.2816 0.0029  0.0122  0.0058  33   ARG A C     
246  O O     . ARG A 33  ? 0.2866 0.2731 0.2795 0.0035  0.0249  0.0140  33   ARG A O     
247  C CB    . ARG A 33  ? 0.2830 0.2573 0.2472 0.0032  0.0141  0.0104  33   ARG A CB    
248  C CG    . ARG A 33  ? 0.2750 0.2336 0.2125 0.0085  0.0126  0.0142  33   ARG A CG    
249  C CD    . ARG A 33  ? 0.2665 0.2281 0.1716 0.0084  0.0157  0.0253  33   ARG A CD    
250  N NE    . ARG A 33  ? 0.2682 0.2334 0.1891 0.0172  0.0156  0.0258  33   ARG A NE    
251  C CZ    . ARG A 33  ? 0.2340 0.2407 0.1771 0.0121  0.0129  0.0058  33   ARG A CZ    
252  N NH1   . ARG A 33  ? 0.2106 0.2175 0.1703 0.0236  0.0040  0.0149  33   ARG A NH1   
253  N NH2   . ARG A 33  ? 0.2544 0.2680 0.1680 0.0088  0.0047  0.0198  33   ARG A NH2   
254  N N     . ASN A 34  ? 0.3105 0.2989 0.2941 0.0013  0.0163  0.0055  34   ASN A N     
255  C CA    . ASN A 34  ? 0.3252 0.3228 0.3211 0.0006  0.0077  0.0008  34   ASN A CA    
256  C C     . ASN A 34  ? 0.3281 0.3281 0.3269 0.0000  0.0068  0.0007  34   ASN A C     
257  O O     . ASN A 34  ? 0.3419 0.3368 0.3423 -0.0048 0.0040  0.0015  34   ASN A O     
258  C CB    . ASN A 34  ? 0.3386 0.3291 0.3296 0.0017  0.0091  -0.0005 34   ASN A CB    
259  C CG    . ASN A 34  ? 0.3644 0.3743 0.3764 -0.0052 0.0011  -0.0042 34   ASN A CG    
260  O OD1   . ASN A 34  ? 0.4023 0.4061 0.4050 0.0013  -0.0051 0.0032  34   ASN A OD1   
261  N ND2   . ASN A 34  ? 0.4219 0.4050 0.4124 -0.0066 0.0032  0.0065  34   ASN A ND2   
262  N N     . LEU A 35  ? 0.3216 0.3278 0.3285 -0.0013 0.0088  0.0006  35   LEU A N     
263  C CA    . LEU A 35  ? 0.3174 0.3206 0.3295 -0.0026 0.0071  0.0026  35   LEU A CA    
264  C C     . LEU A 35  ? 0.3311 0.3397 0.3496 0.0005  0.0075  -0.0003 35   LEU A C     
265  O O     . LEU A 35  ? 0.3255 0.3472 0.3565 -0.0031 0.0113  0.0038  35   LEU A O     
266  C CB    . LEU A 35  ? 0.2996 0.3073 0.3199 0.0036  0.0092  0.0021  35   LEU A CB    
267  C CG    . LEU A 35  ? 0.2800 0.2685 0.2744 -0.0019 0.0148  0.0110  35   LEU A CG    
268  C CD1   . LEU A 35  ? 0.2568 0.2588 0.2688 -0.0038 0.0092  0.0029  35   LEU A CD1   
269  C CD2   . LEU A 35  ? 0.2681 0.2727 0.2796 -0.0017 0.0107  0.0109  35   LEU A CD2   
270  N N     . THR A 36  ? 0.3556 0.3596 0.3663 0.0002  0.0060  0.0008  36   THR A N     
271  C CA    . THR A 36  ? 0.3682 0.3734 0.3788 0.0005  0.0062  -0.0017 36   THR A CA    
272  C C     . THR A 36  ? 0.3849 0.3842 0.3899 -0.0020 0.0053  0.0009  36   THR A C     
273  O O     . THR A 36  ? 0.3846 0.3787 0.3964 -0.0056 0.0078  -0.0017 36   THR A O     
274  C CB    . THR A 36  ? 0.3727 0.3777 0.3821 -0.0008 0.0064  -0.0034 36   THR A CB    
275  O OG1   . THR A 36  ? 0.3716 0.3752 0.3815 -0.0023 0.0097  -0.0063 36   THR A OG1   
276  C CG2   . THR A 36  ? 0.3836 0.3821 0.3876 -0.0011 0.0065  0.0003  36   THR A CG2   
277  N N     . LYS A 37  ? 0.3980 0.3980 0.4015 -0.0014 0.0041  -0.0025 37   LYS A N     
278  C CA    . LYS A 37  ? 0.4107 0.4058 0.4098 -0.0015 0.0023  0.0000  37   LYS A CA    
279  C C     . LYS A 37  ? 0.4122 0.4094 0.4145 -0.0002 0.0019  -0.0009 37   LYS A C     
280  O O     . LYS A 37  ? 0.4172 0.4121 0.4167 0.0002  0.0056  -0.0021 37   LYS A O     
281  C CB    . LYS A 37  ? 0.4153 0.4125 0.4169 0.0006  0.0025  -0.0002 37   LYS A CB    
282  C CG    . LYS A 37  ? 0.4246 0.4231 0.4258 -0.0032 0.0024  0.0011  37   LYS A CG    
283  C CD    . LYS A 37  ? 0.4400 0.4372 0.4391 0.0019  0.0017  -0.0016 37   LYS A CD    
284  C CE    . LYS A 37  ? 0.4459 0.4461 0.4518 -0.0020 0.0005  0.0012  37   LYS A CE    
285  N NZ    . LYS A 37  ? 0.4631 0.4545 0.4574 0.0038  0.0014  -0.0006 37   LYS A NZ    
286  N N     . ASP A 38  ? 0.4153 0.4108 0.4151 -0.0008 0.0024  -0.0008 38   ASP A N     
287  C CA    . ASP A 38  ? 0.4187 0.4174 0.4223 0.0000  0.0008  -0.0008 38   ASP A CA    
288  C C     . ASP A 38  ? 0.4128 0.4126 0.4182 -0.0012 0.0015  -0.0020 38   ASP A C     
289  O O     . ASP A 38  ? 0.4175 0.4194 0.4254 0.0003  0.0040  -0.0047 38   ASP A O     
290  C CB    . ASP A 38  ? 0.4236 0.4207 0.4255 -0.0002 0.0007  -0.0023 38   ASP A CB    
291  C CG    . ASP A 38  ? 0.4303 0.4347 0.4386 -0.0002 0.0025  0.0015  38   ASP A CG    
292  O OD1   . ASP A 38  ? 0.4530 0.4585 0.4516 -0.0018 -0.0008 -0.0039 38   ASP A OD1   
293  O OD2   . ASP A 38  ? 0.4378 0.4432 0.4499 -0.0025 0.0002  -0.0044 38   ASP A OD2   
294  N N     . ARG A 39  ? 0.4054 0.4051 0.4091 0.0000  0.0027  -0.0008 39   ARG A N     
295  C CA    . ARG A 39  ? 0.3965 0.3990 0.4049 -0.0024 0.0019  -0.0008 39   ARG A CA    
296  C C     . ARG A 39  ? 0.3832 0.3838 0.3928 0.0001  0.0019  -0.0005 39   ARG A C     
297  O O     . ARG A 39  ? 0.3780 0.3856 0.3978 -0.0006 0.0086  -0.0047 39   ARG A O     
298  C CB    . ARG A 39  ? 0.4003 0.4018 0.4073 -0.0011 -0.0016 0.0016  39   ARG A CB    
299  C CG    . ARG A 39  ? 0.4176 0.4208 0.4236 0.0003  0.0031  -0.0015 39   ARG A CG    
300  C CD    . ARG A 39  ? 0.4383 0.4380 0.4358 0.0019  -0.0039 0.0009  39   ARG A CD    
301  N NE    . ARG A 39  ? 0.4543 0.4461 0.4535 -0.0050 -0.0020 -0.0002 39   ARG A NE    
302  C CZ    . ARG A 39  ? 0.4552 0.4566 0.4531 -0.0011 -0.0004 -0.0006 39   ARG A CZ    
303  N NH1   . ARG A 39  ? 0.4531 0.4557 0.4612 0.0005  -0.0017 -0.0044 39   ARG A NH1   
304  N NH2   . ARG A 39  ? 0.4570 0.4562 0.4627 0.0015  -0.0005 -0.0029 39   ARG A NH2   
305  N N     . CYS A 40  ? 0.3619 0.3682 0.3749 -0.0048 0.0051  -0.0026 40   CYS A N     
306  C CA    . CYS A 40  ? 0.3495 0.3565 0.3601 -0.0025 0.0047  -0.0016 40   CYS A CA    
307  C C     . CYS A 40  ? 0.3332 0.3432 0.3523 0.0003  0.0023  -0.0011 40   CYS A C     
308  O O     . CYS A 40  ? 0.3336 0.3505 0.3582 -0.0045 0.0033  -0.0008 40   CYS A O     
309  C CB    . CYS A 40  ? 0.3456 0.3590 0.3565 -0.0014 0.0087  -0.0013 40   CYS A CB    
310  S SG    . CYS A 40  ? 0.3228 0.3645 0.3733 -0.0107 0.0393  -0.0031 40   CYS A SG    
311  N N     . LYS A 41  ? 0.3230 0.3303 0.3343 -0.0018 0.0037  -0.0030 41   LYS A N     
312  C CA    . LYS A 41  ? 0.3076 0.3164 0.3242 0.0010  0.0009  -0.0041 41   LYS A CA    
313  C C     . LYS A 41  ? 0.2916 0.3064 0.3076 -0.0009 0.0047  -0.0069 41   LYS A C     
314  O O     . LYS A 41  ? 0.2923 0.3186 0.3109 0.0015  -0.0002 -0.0120 41   LYS A O     
315  C CB    . LYS A 41  ? 0.3020 0.3131 0.3185 -0.0023 0.0011  -0.0034 41   LYS A CB    
316  C CG    . LYS A 41  ? 0.2932 0.2978 0.3173 0.0023  0.0025  -0.0025 41   LYS A CG    
317  C CD    . LYS A 41  ? 0.2759 0.2863 0.3013 -0.0008 -0.0015 -0.0058 41   LYS A CD    
318  C CE    . LYS A 41  ? 0.2685 0.2924 0.3013 0.0075  -0.0038 -0.0019 41   LYS A CE    
319  N NZ    . LYS A 41  ? 0.2433 0.2725 0.2883 -0.0017 0.0021  0.0027  41   LYS A NZ    
320  N N     . PRO A 42  ? 0.2906 0.3046 0.3088 -0.0020 0.0003  -0.0095 42   PRO A N     
321  C CA    . PRO A 42  ? 0.2807 0.2948 0.3001 0.0003  0.0016  -0.0052 42   PRO A CA    
322  C C     . PRO A 42  ? 0.2635 0.2786 0.2831 0.0030  -0.0026 -0.0082 42   PRO A C     
323  O O     . PRO A 42  ? 0.2687 0.2915 0.3020 0.0088  -0.0042 -0.0146 42   PRO A O     
324  C CB    . PRO A 42  ? 0.2833 0.2952 0.3043 0.0047  -0.0005 -0.0031 42   PRO A CB    
325  C CG    . PRO A 42  ? 0.3069 0.3093 0.3150 -0.0023 -0.0015 -0.0033 42   PRO A CG    
326  C CD    . PRO A 42  ? 0.2969 0.3099 0.3104 -0.0029 -0.0024 -0.0065 42   PRO A CD    
327  N N     . VAL A 43  ? 0.2428 0.2613 0.2741 0.0024  -0.0056 -0.0074 43   VAL A N     
328  C CA    . VAL A 43  ? 0.2320 0.2430 0.2522 0.0038  -0.0054 -0.0107 43   VAL A CA    
329  C C     . VAL A 43  ? 0.1961 0.2254 0.2323 0.0007  -0.0122 -0.0051 43   VAL A C     
330  O O     . VAL A 43  ? 0.1987 0.2401 0.2491 0.0103  -0.0185 -0.0128 43   VAL A O     
331  C CB    . VAL A 43  ? 0.2477 0.2659 0.2719 0.0047  -0.0029 -0.0032 43   VAL A CB    
332  C CG1   . VAL A 43  ? 0.2751 0.2710 0.2825 0.0077  -0.0006 -0.0045 43   VAL A CG1   
333  C CG2   . VAL A 43  ? 0.2736 0.2828 0.2819 0.0048  -0.0016 -0.0073 43   VAL A CG2   
334  N N     . ASN A 44  ? 0.1717 0.1947 0.2034 -0.0078 -0.0086 -0.0061 44   ASN A N     
335  C CA    . ASN A 44  ? 0.1684 0.1877 0.1892 -0.0043 -0.0021 0.0015  44   ASN A CA    
336  C C     . ASN A 44  ? 0.1619 0.1952 0.1868 -0.0029 -0.0020 -0.0048 44   ASN A C     
337  O O     . ASN A 44  ? 0.1862 0.2457 0.2115 -0.0050 0.0112  -0.0235 44   ASN A O     
338  C CB    . ASN A 44  ? 0.1565 0.1856 0.1830 -0.0024 0.0020  0.0042  44   ASN A CB    
339  C CG    . ASN A 44  ? 0.1639 0.1921 0.1716 0.0056  0.0057  0.0104  44   ASN A CG    
340  O OD1   . ASN A 44  ? 0.1799 0.2223 0.2128 0.0145  0.0032  -0.0093 44   ASN A OD1   
341  N ND2   . ASN A 44  ? 0.1391 0.1874 0.1584 -0.0049 0.0166  0.0021  44   ASN A ND2   
342  N N     . THR A 45  ? 0.1414 0.1783 0.1427 -0.0104 -0.0104 -0.0040 45   THR A N     
343  C CA    . THR A 45  ? 0.1426 0.1666 0.1483 -0.0071 -0.0039 -0.0036 45   THR A CA    
344  C C     . THR A 45  ? 0.1325 0.1619 0.1272 -0.0091 -0.0026 0.0041  45   THR A C     
345  O O     . THR A 45  ? 0.1374 0.1603 0.1363 -0.0048 -0.0066 0.0025  45   THR A O     
346  C CB    . THR A 45  ? 0.1669 0.1821 0.1565 -0.0131 0.0028  0.0005  45   THR A CB    
347  O OG1   . THR A 45  ? 0.2073 0.1973 0.1992 -0.0132 -0.0031 0.0074  45   THR A OG1   
348  C CG2   . THR A 45  ? 0.1742 0.1863 0.1594 -0.0171 -0.0070 0.0044  45   THR A CG2   
349  N N     . PHE A 46  ? 0.1307 0.1655 0.1264 -0.0103 -0.0069 -0.0009 46   PHE A N     
350  C CA    . PHE A 46  ? 0.1374 0.1762 0.1262 -0.0011 0.0000  0.0048  46   PHE A CA    
351  C C     . PHE A 46  ? 0.1397 0.1890 0.1346 -0.0027 -0.0117 0.0014  46   PHE A C     
352  O O     . PHE A 46  ? 0.1449 0.2055 0.1556 -0.0069 0.0056  0.0007  46   PHE A O     
353  C CB    . PHE A 46  ? 0.1494 0.1893 0.1263 0.0030  -0.0116 0.0024  46   PHE A CB    
354  C CG    . PHE A 46  ? 0.1536 0.2217 0.1535 0.0043  -0.0095 0.0091  46   PHE A CG    
355  C CD1   . PHE A 46  ? 0.1875 0.2350 0.1711 0.0090  0.0083  0.0047  46   PHE A CD1   
356  C CD2   . PHE A 46  ? 0.1665 0.2023 0.1361 0.0035  -0.0006 0.0144  46   PHE A CD2   
357  C CE1   . PHE A 46  ? 0.2039 0.2097 0.1626 0.0053  -0.0026 0.0183  46   PHE A CE1   
358  C CE2   . PHE A 46  ? 0.1678 0.2128 0.1792 0.0088  0.0035  0.0121  46   PHE A CE2   
359  C CZ    . PHE A 46  ? 0.1863 0.2102 0.1708 -0.0051 0.0017  0.0186  46   PHE A CZ    
360  N N     . VAL A 47  ? 0.1351 0.1924 0.1263 -0.0006 -0.0117 0.0079  47   VAL A N     
361  C CA    . VAL A 47  ? 0.1444 0.2018 0.1342 -0.0079 -0.0015 0.0021  47   VAL A CA    
362  C C     . VAL A 47  ? 0.1465 0.2045 0.1329 -0.0002 0.0112  -0.0123 47   VAL A C     
363  O O     . VAL A 47  ? 0.1614 0.2440 0.1588 0.0053  -0.0019 0.0022  47   VAL A O     
364  C CB    . VAL A 47  ? 0.1448 0.2015 0.1333 -0.0062 -0.0027 0.0000  47   VAL A CB    
365  C CG1   . VAL A 47  ? 0.1344 0.2231 0.1352 0.0022  0.0021  -0.0028 47   VAL A CG1   
366  C CG2   . VAL A 47  ? 0.1459 0.1968 0.1458 -0.0060 -0.0046 0.0102  47   VAL A CG2   
367  N N     . HIS A 48  ? 0.1674 0.2234 0.1509 -0.0059 0.0011  -0.0010 48   HIS A N     
368  C CA    . HIS A 48  ? 0.1853 0.2312 0.1838 0.0005  -0.0075 0.0040  48   HIS A CA    
369  C C     . HIS A 48  ? 0.1974 0.2378 0.1984 -0.0021 -0.0032 0.0048  48   HIS A C     
370  O O     . HIS A 48  ? 0.2448 0.2725 0.2244 -0.0121 -0.0140 0.0023  48   HIS A O     
371  C CB    . HIS A 48  ? 0.1915 0.2359 0.1918 0.0039  -0.0028 0.0029  48   HIS A CB    
372  C CG    . HIS A 48  ? 0.1906 0.2368 0.1789 -0.0001 -0.0081 0.0001  48   HIS A CG    
373  N ND1   . HIS A 48  ? 0.1898 0.2082 0.1821 0.0213  -0.0012 -0.0039 48   HIS A ND1   
374  C CD2   . HIS A 48  ? 0.1983 0.2038 0.1579 -0.0149 -0.0023 -0.0085 48   HIS A CD2   
375  C CE1   . HIS A 48  ? 0.1802 0.2381 0.1964 0.0094  0.0206  -0.0092 48   HIS A CE1   
376  N NE2   . HIS A 48  ? 0.1820 0.2514 0.1996 -0.0163 -0.0050 0.0002  48   HIS A NE2   
377  N N     . GLU A 49  ? 0.1802 0.2247 0.1944 0.0058  -0.0059 0.0081  49   GLU A N     
378  C CA    . GLU A 49  ? 0.1802 0.2294 0.1741 -0.0001 0.0003  0.0144  49   GLU A CA    
379  C C     . GLU A 49  ? 0.1808 0.2362 0.1796 0.0010  -0.0027 0.0137  49   GLU A C     
380  O O     . GLU A 49  ? 0.1828 0.2284 0.1819 0.0103  -0.0054 0.0268  49   GLU A O     
381  C CB    . GLU A 49  ? 0.1683 0.2273 0.1604 -0.0115 -0.0035 0.0092  49   GLU A CB    
382  C CG    . GLU A 49  ? 0.1973 0.2357 0.1813 -0.0088 -0.0120 0.0083  49   GLU A CG    
383  C CD    . GLU A 49  ? 0.2095 0.2474 0.1689 -0.0031 0.0022  0.0035  49   GLU A CD    
384  O OE1   . GLU A 49  ? 0.2137 0.2951 0.2214 -0.0124 -0.0011 0.0044  49   GLU A OE1   
385  O OE2   . GLU A 49  ? 0.2016 0.2450 0.1968 -0.0212 -0.0036 0.0051  49   GLU A OE2   
386  N N     . SER A 50  ? 0.1924 0.2401 0.1699 0.0079  -0.0048 0.0156  50   SER A N     
387  C CA    . SER A 50  ? 0.2061 0.2422 0.1854 0.0063  -0.0007 0.0143  50   SER A CA    
388  C C     . SER A 50  ? 0.1974 0.2359 0.1853 0.0107  -0.0049 0.0148  50   SER A C     
389  O O     . SER A 50  ? 0.1897 0.2448 0.1705 0.0261  0.0022  0.0341  50   SER A O     
390  C CB    . SER A 50  ? 0.2076 0.2337 0.1805 0.0097  -0.0013 0.0167  50   SER A CB    
391  O OG    . SER A 50  ? 0.2079 0.2761 0.1853 0.0217  0.0020  0.0288  50   SER A OG    
392  N N     . LEU A 51  ? 0.2155 0.2347 0.1900 0.0129  -0.0011 0.0234  51   LEU A N     
393  C CA    . LEU A 51  ? 0.2227 0.2303 0.2062 0.0114  0.0040  0.0101  51   LEU A CA    
394  C C     . LEU A 51  ? 0.2155 0.2343 0.1954 0.0149  -0.0040 0.0168  51   LEU A C     
395  O O     . LEU A 51  ? 0.2126 0.2393 0.1731 0.0385  -0.0100 0.0172  51   LEU A O     
396  C CB    . LEU A 51  ? 0.2483 0.2388 0.2251 0.0067  0.0074  0.0144  51   LEU A CB    
397  C CG    . LEU A 51  ? 0.2610 0.2524 0.2247 0.0088  0.0088  0.0096  51   LEU A CG    
398  C CD1   . LEU A 51  ? 0.2627 0.2772 0.2348 0.0046  0.0137  0.0127  51   LEU A CD1   
399  C CD2   . LEU A 51  ? 0.2833 0.2635 0.2651 0.0086  0.0045  0.0079  51   LEU A CD2   
400  N N     . ALA A 52  ? 0.2122 0.2252 0.1866 0.0275  -0.0054 0.0201  52   ALA A N     
401  C CA    . ALA A 52  ? 0.2048 0.2154 0.1999 0.0204  0.0018  0.0086  52   ALA A CA    
402  C C     . ALA A 52  ? 0.1973 0.2224 0.1944 0.0208  -0.0020 0.0144  52   ALA A C     
403  O O     . ALA A 52  ? 0.1883 0.2488 0.1774 0.0278  0.0079  0.0122  52   ALA A O     
404  C CB    . ALA A 52  ? 0.2063 0.2166 0.2105 0.0191  -0.0062 0.0062  52   ALA A CB    
405  N N     . ASP A 53  ? 0.1706 0.2171 0.1655 0.0180  0.0000  0.0167  53   ASP A N     
406  C CA    . ASP A 53  ? 0.1725 0.2206 0.1950 0.0186  0.0044  0.0127  53   ASP A CA    
407  C C     . ASP A 53  ? 0.1506 0.2084 0.1677 0.0154  0.0042  0.0194  53   ASP A C     
408  O O     . ASP A 53  ? 0.1689 0.2524 0.1645 0.0302  0.0062  0.0269  53   ASP A O     
409  C CB    . ASP A 53  ? 0.1814 0.2281 0.1943 0.0166  0.0067  0.0180  53   ASP A CB    
410  C CG    . ASP A 53  ? 0.2073 0.2621 0.2268 0.0077  0.0011  0.0085  53   ASP A CG    
411  O OD1   . ASP A 53  ? 0.2623 0.3178 0.2760 0.0173  -0.0018 -0.0163 53   ASP A OD1   
412  O OD2   . ASP A 53  ? 0.2287 0.2802 0.2377 -0.0078 0.0095  0.0140  53   ASP A OD2   
413  N N     . VAL A 54  ? 0.1376 0.2191 0.1439 0.0243  -0.0060 0.0278  54   VAL A N     
414  C CA    . VAL A 54  ? 0.1428 0.1929 0.1552 0.0207  0.0018  0.0210  54   VAL A CA    
415  C C     . VAL A 54  ? 0.1515 0.1769 0.1622 0.0209  0.0064  0.0194  54   VAL A C     
416  O O     . VAL A 54  ? 0.1398 0.1999 0.1336 0.0175  0.0020  0.0193  54   VAL A O     
417  C CB    . VAL A 54  ? 0.1506 0.1907 0.1637 0.0114  0.0097  0.0262  54   VAL A CB    
418  C CG1   . VAL A 54  ? 0.1482 0.2134 0.1433 0.0090  -0.0026 0.0107  54   VAL A CG1   
419  C CG2   . VAL A 54  ? 0.1848 0.2152 0.1896 0.0066  0.0000  0.0232  54   VAL A CG2   
420  N N     . GLN A 55  ? 0.1630 0.1900 0.1611 0.0326  -0.0005 0.0250  55   GLN A N     
421  C CA    . GLN A 55  ? 0.1628 0.1867 0.1727 0.0155  0.0084  0.0147  55   GLN A CA    
422  C C     . GLN A 55  ? 0.1572 0.1873 0.1548 0.0242  0.0059  0.0071  55   GLN A C     
423  O O     . GLN A 55  ? 0.1666 0.1982 0.1578 0.0197  0.0000  0.0125  55   GLN A O     
424  C CB    . GLN A 55  ? 0.1705 0.1940 0.1603 0.0222  0.0023  0.0141  55   GLN A CB    
425  C CG    . GLN A 55  ? 0.1605 0.2077 0.1781 0.0234  0.0091  0.0161  55   GLN A CG    
426  C CD    . GLN A 55  ? 0.1730 0.2114 0.1781 0.0178  -0.0088 0.0079  55   GLN A CD    
427  O OE1   . GLN A 55  ? 0.2164 0.2399 0.2115 0.0165  0.0045  0.0169  55   GLN A OE1   
428  N NE2   . GLN A 55  ? 0.1706 0.2118 0.1808 0.0448  -0.0008 0.0380  55   GLN A NE2   
429  N N     . ALA A 56  ? 0.1541 0.1972 0.1294 0.0211  0.0029  0.0154  56   ALA A N     
430  C CA    . ALA A 56  ? 0.1546 0.1869 0.1527 0.0216  0.0127  0.0156  56   ALA A CA    
431  C C     . ALA A 56  ? 0.1332 0.1922 0.1436 0.0200  -0.0048 0.0066  56   ALA A C     
432  O O     . ALA A 56  ? 0.1375 0.2016 0.1488 0.0208  0.0082  0.0194  56   ALA A O     
433  C CB    . ALA A 56  ? 0.1708 0.2095 0.1439 0.0146  0.0012  0.0210  56   ALA A CB    
434  N N     . VAL A 57  ? 0.1368 0.1798 0.1286 0.0234  -0.0042 0.0213  57   VAL A N     
435  C CA    . VAL A 57  ? 0.1253 0.1567 0.1422 0.0157  -0.0019 0.0205  57   VAL A CA    
436  C C     . VAL A 57  ? 0.0991 0.1488 0.1409 0.0120  -0.0022 0.0175  57   VAL A C     
437  O O     . VAL A 57  ? 0.1219 0.1676 0.1373 0.0099  0.0041  0.0294  57   VAL A O     
438  C CB    . VAL A 57  ? 0.1268 0.1624 0.1393 0.0190  -0.0015 0.0184  57   VAL A CB    
439  C CG1   . VAL A 57  ? 0.1252 0.1426 0.1428 0.0091  0.0107  0.0161  57   VAL A CG1   
440  C CG2   . VAL A 57  ? 0.1491 0.1809 0.1425 0.0061  0.0023  0.0164  57   VAL A CG2   
441  N N     . CYS A 58  ? 0.1331 0.1481 0.1404 0.0146  0.0055  0.0226  58   CYS A N     
442  C CA    . CYS A 58  ? 0.1344 0.1466 0.1543 0.0109  0.0076  0.0202  58   CYS A CA    
443  C C     . CYS A 58  ? 0.1287 0.1431 0.1509 0.0040  0.0060  0.0143  58   CYS A C     
444  O O     . CYS A 58  ? 0.1396 0.1728 0.1507 0.0080  0.0058  0.0183  58   CYS A O     
445  C CB    . CYS A 58  ? 0.1287 0.1396 0.1469 0.0082  0.0135  0.0246  58   CYS A CB    
446  S SG    . CYS A 58  ? 0.1432 0.1772 0.1492 0.0173  0.0121  0.0319  58   CYS A SG    
447  N N     . SER A 59  ? 0.1260 0.1794 0.1328 0.0142  0.0095  0.0230  59   SER A N     
448  C CA    . SER A 59  ? 0.1447 0.1792 0.1384 0.0069  0.0096  0.0076  59   SER A CA    
449  C C     . SER A 59  ? 0.1410 0.1876 0.1444 0.0046  -0.0011 0.0103  59   SER A C     
450  O O     . SER A 59  ? 0.1549 0.2113 0.1611 0.0054  0.0116  0.0081  59   SER A O     
451  C CB    . SER A 59  ? 0.1593 0.1931 0.1783 0.0125  0.0285  -0.0054 59   SER A CB    
452  O OG    . SER A 59  ? 0.1909 0.2233 0.2051 -0.0043 0.0040  0.0097  59   SER A OG    
453  N N     . GLN A 60  ? 0.1320 0.1816 0.1353 0.0036  -0.0020 0.0160  60   GLN A N     
454  C CA    . GLN A 60  ? 0.1243 0.1745 0.1356 0.0066  -0.0003 0.0096  60   GLN A CA    
455  C C     . GLN A 60  ? 0.1074 0.1633 0.1443 -0.0068 -0.0036 0.0165  60   GLN A C     
456  O O     . GLN A 60  ? 0.1465 0.1953 0.1481 0.0024  -0.0127 0.0194  60   GLN A O     
457  C CB    . GLN A 60  ? 0.1127 0.1635 0.1367 0.0007  0.0053  0.0098  60   GLN A CB    
458  C CG    . GLN A 60  ? 0.1234 0.1862 0.1530 -0.0052 0.0056  0.0181  60   GLN A CG    
459  C CD    . GLN A 60  ? 0.1366 0.2112 0.1694 -0.0035 -0.0175 0.0208  60   GLN A CD    
460  O OE1   . GLN A 60  ? 0.1288 0.1854 0.1330 -0.0074 -0.0123 0.0195  60   GLN A OE1   
461  N NE2   . GLN A 60  ? 0.1559 0.2474 0.1660 0.0031  -0.0173 0.0409  60   GLN A NE2   
462  N N     . LYS A 61  ? 0.1184 0.1727 0.1073 -0.0078 -0.0157 0.0133  61   LYS A N     
463  C CA    . LYS A 61  ? 0.1189 0.1653 0.1330 -0.0030 -0.0117 0.0153  61   LYS A CA    
464  C C     . LYS A 61  ? 0.1029 0.1332 0.1268 0.0006  -0.0110 0.0117  61   LYS A C     
465  O O     . LYS A 61  ? 0.1086 0.1423 0.1167 -0.0015 -0.0061 0.0084  61   LYS A O     
466  C CB    . LYS A 61  ? 0.1224 0.1777 0.1467 -0.0143 -0.0078 0.0132  61   LYS A CB    
467  C CG    . LYS A 61  ? 0.1530 0.2037 0.1876 0.0007  -0.0100 0.0107  61   LYS A CG    
468  C CD    . LYS A 61  ? 0.2233 0.2250 0.2385 -0.0052 -0.0003 -0.0003 61   LYS A CD    
469  C CE    . LYS A 61  ? 0.2652 0.2728 0.2782 0.0022  -0.0049 0.0083  61   LYS A CE    
470  N NZ    . LYS A 61  ? 0.3080 0.2951 0.3347 0.0141  0.0015  0.0042  61   LYS A NZ    
471  N N     . ASN A 62  ? 0.1101 0.1429 0.1192 0.0019  0.0056  0.0112  62   ASN A N     
472  C CA    . ASN A 62  ? 0.1125 0.1218 0.1248 -0.0003 0.0038  0.0091  62   ASN A CA    
473  C C     . ASN A 62  ? 0.1158 0.1183 0.1161 -0.0047 -0.0045 0.0121  62   ASN A C     
474  O O     . ASN A 62  ? 0.1302 0.1366 0.1366 0.0028  0.0036  0.0128  62   ASN A O     
475  C CB    . ASN A 62  ? 0.1238 0.1517 0.1384 0.0010  0.0092  0.0078  62   ASN A CB    
476  C CG    . ASN A 62  ? 0.1475 0.1472 0.1484 -0.0060 -0.0007 -0.0065 62   ASN A CG    
477  O OD1   . ASN A 62  ? 0.1697 0.2104 0.1644 -0.0216 -0.0002 -0.0159 62   ASN A OD1   
478  N ND2   . ASN A 62  ? 0.1350 0.1191 0.1502 0.0120  0.0023  0.0039  62   ASN A ND2   
479  N N     . VAL A 63  ? 0.1007 0.1049 0.1104 -0.0007 -0.0089 0.0070  63   VAL A N     
480  C CA    . VAL A 63  ? 0.1055 0.1089 0.1227 -0.0034 -0.0029 -0.0007 63   VAL A CA    
481  C C     . VAL A 63  ? 0.0980 0.1032 0.1191 0.0003  -0.0028 0.0029  63   VAL A C     
482  O O     . VAL A 63  ? 0.1051 0.1149 0.1346 0.0071  -0.0026 0.0097  63   VAL A O     
483  C CB    . VAL A 63  ? 0.1094 0.1210 0.1214 0.0035  -0.0020 0.0003  63   VAL A CB    
484  C CG1   . VAL A 63  ? 0.1294 0.1428 0.1393 -0.0185 -0.0063 -0.0037 63   VAL A CG1   
485  C CG2   . VAL A 63  ? 0.1252 0.1240 0.1296 -0.0076 -0.0017 0.0006  63   VAL A CG2   
486  N N     . ALA A 64  ? 0.0950 0.1006 0.1233 -0.0026 -0.0140 -0.0019 64   ALA A N     
487  C CA    . ALA A 64  ? 0.0977 0.0838 0.1306 0.0012  -0.0125 0.0033  64   ALA A CA    
488  C C     . ALA A 64  ? 0.1028 0.0994 0.1379 0.0034  -0.0090 -0.0010 64   ALA A C     
489  O O     . ALA A 64  ? 0.1133 0.1031 0.1342 -0.0019 -0.0102 0.0003  64   ALA A O     
490  C CB    . ALA A 64  ? 0.1049 0.1116 0.1296 -0.0010 -0.0108 0.0024  64   ALA A CB    
491  N N     . CYS A 65  ? 0.1100 0.0861 0.1340 0.0064  -0.0104 0.0016  65   CYS A N     
492  C CA    . CYS A 65  ? 0.1061 0.0838 0.1276 -0.0027 -0.0098 -0.0043 65   CYS A CA    
493  C C     . CYS A 65  ? 0.1020 0.0890 0.1289 -0.0022 -0.0098 0.0057  65   CYS A C     
494  O O     . CYS A 65  ? 0.1090 0.0951 0.1207 0.0007  -0.0065 0.0050  65   CYS A O     
495  C CB    . CYS A 65  ? 0.0978 0.0788 0.1393 -0.0111 -0.0058 0.0038  65   CYS A CB    
496  S SG    . CYS A 65  ? 0.1116 0.1010 0.1584 0.0041  -0.0088 0.0024  65   CYS A SG    
497  N N     . LYS A 66  ? 0.1136 0.0943 0.1338 0.0022  -0.0089 0.0085  66   LYS A N     
498  C CA    . LYS A 66  ? 0.1221 0.1075 0.1601 0.0048  -0.0026 0.0030  66   LYS A CA    
499  C C     . LYS A 66  ? 0.1136 0.1081 0.1555 0.0140  -0.0027 0.0105  66   LYS A C     
500  O O     . LYS A 66  ? 0.1208 0.1335 0.1539 0.0053  -0.0058 0.0074  66   LYS A O     
501  C CB    . LYS A 66  ? 0.1460 0.1282 0.1621 0.0049  -0.0032 0.0169  66   LYS A CB    
502  C CG    . LYS A 66  ? 0.1554 0.1477 0.1695 0.0099  -0.0102 0.0027  66   LYS A CG    
503  C CD    . LYS A 66  ? 0.2457 0.2306 0.2006 0.0053  -0.0050 0.0066  66   LYS A CD    
504  C CE    . LYS A 66  ? 0.2723 0.2756 0.2908 -0.0028 -0.0089 -0.0043 66   LYS A CE    
505  N NZ    . LYS A 66  ? 0.3436 0.3471 0.3175 -0.0042 0.0028  0.0020  66   LYS A NZ    
506  N N     . ASN A 67  ? 0.1151 0.1047 0.1600 0.0031  -0.0060 0.0098  67   ASN A N     
507  C CA    . ASN A 67  ? 0.1218 0.1212 0.1638 -0.0007 -0.0079 0.0107  67   ASN A CA    
508  C C     . ASN A 67  ? 0.1203 0.1157 0.1658 0.0015  -0.0065 0.0125  67   ASN A C     
509  O O     . ASN A 67  ? 0.1577 0.1701 0.1913 -0.0082 -0.0203 0.0016  67   ASN A O     
510  C CB    . ASN A 67  ? 0.1372 0.1331 0.1736 -0.0105 -0.0094 0.0138  67   ASN A CB    
511  C CG    . ASN A 67  ? 0.1428 0.1243 0.1774 -0.0101 -0.0200 0.0072  67   ASN A CG    
512  O OD1   . ASN A 67  ? 0.1532 0.1366 0.1676 0.0059  -0.0123 0.0063  67   ASN A OD1   
513  N ND2   . ASN A 67  ? 0.1828 0.1496 0.2192 -0.0135 0.0013  0.0370  67   ASN A ND2   
514  N N     . GLY A 68  ? 0.1251 0.1114 0.1611 0.0016  -0.0130 0.0095  68   GLY A N     
515  C CA    . GLY A 68  ? 0.1362 0.1127 0.1559 -0.0003 -0.0076 0.0031  68   GLY A CA    
516  C C     . GLY A 68  ? 0.1404 0.1126 0.1443 0.0010  -0.0175 0.0031  68   GLY A C     
517  O O     . GLY A 68  ? 0.1509 0.1142 0.1570 0.0059  -0.0101 0.0077  68   GLY A O     
518  N N     . GLN A 69  ? 0.1295 0.1065 0.1516 0.0023  -0.0097 0.0083  69   GLN A N     
519  C CA    . GLN A 69  ? 0.1353 0.1040 0.1377 0.0048  -0.0176 0.0024  69   GLN A CA    
520  C C     . GLN A 69  ? 0.1367 0.1054 0.1281 -0.0038 -0.0158 0.0038  69   GLN A C     
521  O O     . GLN A 69  ? 0.1373 0.1136 0.1600 -0.0045 -0.0187 -0.0108 69   GLN A O     
522  C CB    . GLN A 69  ? 0.1594 0.1120 0.1606 0.0013  -0.0295 0.0060  69   GLN A CB    
523  C CG    . GLN A 69  ? 0.1611 0.1178 0.1756 -0.0041 -0.0099 0.0156  69   GLN A CG    
524  C CD    . GLN A 69  ? 0.2158 0.1969 0.2034 0.0058  -0.0082 0.0029  69   GLN A CD    
525  O OE1   . GLN A 69  ? 0.2424 0.2263 0.2417 0.0016  -0.0236 0.0007  69   GLN A OE1   
526  N NE2   . GLN A 69  ? 0.2504 0.2062 0.2496 0.0052  -0.0056 -0.0083 69   GLN A NE2   
527  N N     . THR A 70  ? 0.1455 0.1064 0.1201 -0.0027 -0.0259 -0.0055 70   THR A N     
528  C CA    . THR A 70  ? 0.1535 0.1145 0.1285 0.0045  -0.0106 0.0097  70   THR A CA    
529  C C     . THR A 70  ? 0.1348 0.1324 0.1276 -0.0041 -0.0094 0.0053  70   THR A C     
530  O O     . THR A 70  ? 0.1640 0.1760 0.1538 -0.0213 -0.0115 0.0263  70   THR A O     
531  C CB    . THR A 70  ? 0.1677 0.1423 0.1491 0.0026  -0.0123 0.0082  70   THR A CB    
532  O OG1   . THR A 70  ? 0.1994 0.1614 0.1636 0.0088  -0.0154 -0.0168 70   THR A OG1   
533  C CG2   . THR A 70  ? 0.1854 0.1827 0.1687 0.0055  -0.0149 0.0067  70   THR A CG2   
534  N N     . ASN A 71  ? 0.1351 0.1172 0.1301 0.0027  -0.0104 0.0086  71   ASN A N     
535  C CA    . ASN A 71  ? 0.1143 0.1003 0.1117 0.0021  -0.0046 0.0019  71   ASN A CA    
536  C C     . ASN A 71  ? 0.1164 0.0960 0.1068 0.0030  -0.0067 0.0033  71   ASN A C     
537  O O     . ASN A 71  ? 0.1253 0.1026 0.1076 0.0032  -0.0011 0.0014  71   ASN A O     
538  C CB    . ASN A 71  ? 0.1294 0.1025 0.1185 0.0036  -0.0064 -0.0018 71   ASN A CB    
539  C CG    . ASN A 71  ? 0.1216 0.0983 0.1253 0.0017  -0.0062 -0.0016 71   ASN A CG    
540  O OD1   . ASN A 71  ? 0.1342 0.1336 0.1661 0.0052  0.0004  0.0128  71   ASN A OD1   
541  N ND2   . ASN A 71  ? 0.1297 0.0992 0.1333 0.0051  0.0000  0.0046  71   ASN A ND2   
542  N N     . CYS A 72  ? 0.0994 0.0899 0.1068 0.0040  -0.0183 0.0085  72   CYS A N     
543  C CA    . CYS A 72  ? 0.0941 0.0988 0.1017 0.0052  -0.0052 0.0078  72   CYS A CA    
544  C C     . CYS A 72  ? 0.1038 0.1033 0.1061 -0.0043 -0.0012 0.0069  72   CYS A C     
545  O O     . CYS A 72  ? 0.1127 0.1184 0.1177 0.0012  0.0008  0.0041  72   CYS A O     
546  C CB    . CYS A 72  ? 0.0784 0.0949 0.1106 -0.0025 -0.0070 0.0075  72   CYS A CB    
547  S SG    . CYS A 72  ? 0.1078 0.1126 0.1441 0.0056  0.0015  0.0132  72   CYS A SG    
548  N N     . TYR A 73  ? 0.0976 0.1132 0.1136 0.0006  -0.0047 0.0077  73   TYR A N     
549  C CA    . TYR A 73  ? 0.1161 0.1281 0.1280 -0.0031 -0.0041 0.0067  73   TYR A CA    
550  C C     . TYR A 73  ? 0.1037 0.1196 0.1208 -0.0018 -0.0027 -0.0003 73   TYR A C     
551  O O     . TYR A 73  ? 0.1101 0.1278 0.1200 -0.0050 0.0017  0.0064  73   TYR A O     
552  C CB    . TYR A 73  ? 0.1062 0.1389 0.1430 0.0073  -0.0079 0.0134  73   TYR A CB    
553  C CG    . TYR A 73  ? 0.1241 0.1337 0.1411 0.0179  -0.0108 0.0135  73   TYR A CG    
554  C CD1   . TYR A 73  ? 0.1254 0.1276 0.1614 0.0255  -0.0061 0.0144  73   TYR A CD1   
555  C CD2   . TYR A 73  ? 0.1457 0.1311 0.1762 0.0179  0.0082  0.0067  73   TYR A CD2   
556  C CE1   . TYR A 73  ? 0.1540 0.1313 0.1677 0.0220  -0.0063 0.0186  73   TYR A CE1   
557  C CE2   . TYR A 73  ? 0.1519 0.1452 0.1473 0.0246  -0.0003 0.0115  73   TYR A CE2   
558  C CZ    . TYR A 73  ? 0.1564 0.1243 0.1771 0.0131  -0.0097 0.0135  73   TYR A CZ    
559  O OH    . TYR A 73  ? 0.1814 0.1536 0.1678 0.0208  0.0008  0.0074  73   TYR A OH    
560  N N     . GLN A 74  ? 0.1060 0.1305 0.1157 -0.0099 -0.0102 0.0096  74   GLN A N     
561  C CA    . GLN A 74  ? 0.1078 0.1376 0.1297 -0.0081 -0.0021 0.0031  74   GLN A CA    
562  C C     . GLN A 74  ? 0.1123 0.1454 0.1257 -0.0062 -0.0022 0.0058  74   GLN A C     
563  O O     . GLN A 74  ? 0.1214 0.1716 0.1318 -0.0040 -0.0057 0.0112  74   GLN A O     
564  C CB    . GLN A 74  ? 0.1129 0.1388 0.1403 0.0023  -0.0037 -0.0014 74   GLN A CB    
565  C CG    . GLN A 74  ? 0.1398 0.1535 0.1512 -0.0156 0.0070  -0.0096 74   GLN A CG    
566  C CD    . GLN A 74  ? 0.1786 0.1674 0.1971 -0.0059 0.0048  -0.0199 74   GLN A CD    
567  O OE1   . GLN A 74  ? 0.2098 0.2035 0.2282 0.0143  -0.0211 -0.0065 74   GLN A OE1   
568  N NE2   . GLN A 74  ? 0.2092 0.1922 0.2446 -0.0231 0.0077  0.0070  74   GLN A NE2   
569  N N     . SER A 75  ? 0.1046 0.1597 0.1281 -0.0120 -0.0101 0.0086  75   SER A N     
570  C CA    . SER A 75  ? 0.1191 0.1589 0.1260 -0.0058 -0.0116 0.0046  75   SER A CA    
571  C C     . SER A 75  ? 0.1330 0.1711 0.1262 -0.0074 -0.0084 -0.0002 75   SER A C     
572  O O     . SER A 75  ? 0.1221 0.1758 0.1374 -0.0184 0.0031  -0.0018 75   SER A O     
573  C CB    . SER A 75  ? 0.1325 0.1724 0.1296 -0.0023 -0.0144 0.0151  75   SER A CB    
574  O OG    . SER A 75  ? 0.1262 0.1976 0.1502 -0.0178 -0.0090 -0.0013 75   SER A OG    
575  N N     . TYR A 76  ? 0.1200 0.1879 0.1282 -0.0074 -0.0143 0.0035  76   TYR A N     
576  C CA    . TYR A 76  ? 0.1486 0.1918 0.1561 -0.0113 -0.0032 -0.0003 76   TYR A CA    
577  C C     . TYR A 76  ? 0.1544 0.2088 0.1633 -0.0120 -0.0028 0.0013  76   TYR A C     
578  O O     . TYR A 76  ? 0.1878 0.2206 0.1787 -0.0135 -0.0013 -0.0102 76   TYR A O     
579  C CB    . TYR A 76  ? 0.1517 0.1934 0.1459 -0.0097 0.0005  0.0006  76   TYR A CB    
580  C CG    . TYR A 76  ? 0.1111 0.1896 0.1303 -0.0144 -0.0065 0.0069  76   TYR A CG    
581  C CD1   . TYR A 76  ? 0.1202 0.1707 0.1400 -0.0036 0.0059  0.0047  76   TYR A CD1   
582  C CD2   . TYR A 76  ? 0.1202 0.1757 0.1404 -0.0120 0.0075  0.0214  76   TYR A CD2   
583  C CE1   . TYR A 76  ? 0.1124 0.1534 0.1174 -0.0118 -0.0019 0.0146  76   TYR A CE1   
584  C CE2   . TYR A 76  ? 0.1172 0.1724 0.1460 -0.0110 0.0067  0.0142  76   TYR A CE2   
585  C CZ    . TYR A 76  ? 0.1105 0.1434 0.1484 -0.0091 -0.0051 0.0105  76   TYR A CZ    
586  O OH    . TYR A 76  ? 0.1349 0.1636 0.1433 -0.0089 0.0040  0.0109  76   TYR A OH    
587  N N     . SER A 77  ? 0.1667 0.2209 0.1702 -0.0198 -0.0055 0.0040  77   SER A N     
588  C CA    . SER A 77  ? 0.1881 0.2237 0.1897 -0.0151 -0.0003 -0.0047 77   SER A CA    
589  C C     . SER A 77  ? 0.1781 0.2157 0.1778 -0.0222 -0.0013 -0.0037 77   SER A C     
590  O O     . SER A 77  ? 0.1868 0.2438 0.1918 -0.0342 -0.0013 -0.0224 77   SER A O     
591  C CB    . SER A 77  ? 0.2083 0.2385 0.1998 -0.0059 -0.0024 -0.0058 77   SER A CB    
592  O OG    . SER A 77  ? 0.2186 0.2910 0.2311 -0.0059 0.0025  -0.0060 77   SER A OG    
593  N N     . THR A 78  ? 0.1871 0.2198 0.1831 -0.0186 0.0064  -0.0105 78   THR A N     
594  C CA    . THR A 78  ? 0.2028 0.2245 0.1913 -0.0086 0.0025  -0.0055 78   THR A CA    
595  C C     . THR A 78  ? 0.1947 0.2171 0.1759 -0.0091 0.0052  -0.0071 78   THR A C     
596  O O     . THR A 78  ? 0.2091 0.2699 0.1863 -0.0227 0.0037  0.0051  78   THR A O     
597  C CB    . THR A 78  ? 0.2256 0.2372 0.2226 -0.0060 0.0068  -0.0103 78   THR A CB    
598  O OG1   . THR A 78  ? 0.2611 0.2838 0.2474 -0.0254 -0.0128 -0.0144 78   THR A OG1   
599  C CG2   . THR A 78  ? 0.2594 0.2467 0.2441 -0.0048 -0.0082 -0.0076 78   THR A CG2   
600  N N     . MET A 79  ? 0.1766 0.2185 0.1675 -0.0227 -0.0034 -0.0006 79   MET A N     
601  C CA    . MET A 79  ? 0.1754 0.2112 0.1779 -0.0111 -0.0048 -0.0021 79   MET A CA    
602  C C     . MET A 79  ? 0.1807 0.2069 0.1751 -0.0137 -0.0048 -0.0047 79   MET A C     
603  O O     . MET A 79  ? 0.1880 0.2240 0.1563 -0.0079 -0.0080 -0.0104 79   MET A O     
604  C CB    . MET A 79  ? 0.1760 0.2121 0.1648 -0.0114 -0.0053 -0.0009 79   MET A CB    
605  C CG    . MET A 79  ? 0.1484 0.2353 0.1633 0.0001  -0.0077 0.0099  79   MET A CG    
606  S SD    . MET A 79  ? 0.1461 0.2830 0.1649 -0.0174 -0.0170 -0.0039 79   MET A SD    
607  C CE    . MET A 79  ? 0.1770 0.2207 0.1674 0.0025  -0.0083 0.0153  79   MET A CE    
608  N N     . SER A 80  ? 0.1765 0.2218 0.1753 -0.0128 -0.0086 -0.0066 80   SER A N     
609  C CA    . SER A 80  ? 0.1844 0.2106 0.1836 -0.0139 0.0018  -0.0074 80   SER A CA    
610  C C     . SER A 80  ? 0.1828 0.1937 0.1414 -0.0103 -0.0030 -0.0025 80   SER A C     
611  O O     . SER A 80  ? 0.1746 0.2198 0.1680 -0.0219 -0.0086 -0.0072 80   SER A O     
612  C CB    . SER A 80  ? 0.1799 0.2111 0.1844 -0.0198 0.0028  -0.0050 80   SER A CB    
613  O OG    . SER A 80  ? 0.2161 0.2236 0.1937 -0.0197 0.0060  -0.0127 80   SER A OG    
614  N N     . ILE A 81  ? 0.1773 0.2160 0.1590 -0.0183 -0.0113 -0.0148 81   ILE A N     
615  C CA    . ILE A 81  ? 0.1838 0.2113 0.1695 -0.0204 0.0011  -0.0139 81   ILE A CA    
616  C C     . ILE A 81  ? 0.1791 0.2087 0.1831 -0.0277 0.0046  -0.0155 81   ILE A C     
617  O O     . ILE A 81  ? 0.2045 0.2299 0.1893 -0.0321 0.0089  -0.0307 81   ILE A O     
618  C CB    . ILE A 81  ? 0.1890 0.2181 0.1676 -0.0144 0.0020  -0.0109 81   ILE A CB    
619  C CG1   . ILE A 81  ? 0.2093 0.2254 0.1667 -0.0115 0.0050  -0.0179 81   ILE A CG1   
620  C CG2   . ILE A 81  ? 0.1899 0.2145 0.1607 -0.0161 -0.0019 -0.0185 81   ILE A CG2   
621  C CD1   . ILE A 81  ? 0.2275 0.2304 0.2126 0.0014  -0.0017 0.0018  81   ILE A CD1   
622  N N     . THR A 82  ? 0.1790 0.2074 0.1625 -0.0322 0.0136  -0.0174 82   THR A N     
623  C CA    . THR A 82  ? 0.1789 0.2089 0.1768 -0.0174 0.0051  -0.0136 82   THR A CA    
624  C C     . THR A 82  ? 0.1807 0.1992 0.1578 -0.0180 -0.0005 -0.0141 82   THR A C     
625  O O     . THR A 82  ? 0.1787 0.1966 0.1655 -0.0285 0.0081  -0.0091 82   THR A O     
626  C CB    . THR A 82  ? 0.1880 0.2130 0.1788 -0.0086 -0.0006 -0.0178 82   THR A CB    
627  O OG1   . THR A 82  ? 0.1930 0.2373 0.1919 -0.0245 0.0108  -0.0328 82   THR A OG1   
628  C CG2   . THR A 82  ? 0.1968 0.2374 0.2111 0.0031  0.0059  -0.0112 82   THR A CG2   
629  N N     . ASP A 83  ? 0.1892 0.1868 0.1570 -0.0244 -0.0014 -0.0227 83   ASP A N     
630  C CA    . ASP A 83  ? 0.2019 0.2084 0.1895 -0.0060 -0.0011 -0.0080 83   ASP A CA    
631  C C     . ASP A 83  ? 0.2025 0.2061 0.1829 -0.0085 -0.0017 -0.0131 83   ASP A C     
632  O O     . ASP A 83  ? 0.2052 0.2081 0.1827 -0.0196 0.0038  -0.0174 83   ASP A O     
633  C CB    . ASP A 83  ? 0.2266 0.2182 0.2142 -0.0063 -0.0047 -0.0058 83   ASP A CB    
634  C CG    . ASP A 83  ? 0.2836 0.2808 0.2505 0.0027  0.0064  -0.0095 83   ASP A CG    
635  O OD1   . ASP A 83  ? 0.3247 0.2726 0.2933 -0.0177 0.0055  -0.0112 83   ASP A OD1   
636  O OD2   . ASP A 83  ? 0.3435 0.3264 0.3303 -0.0171 0.0083  0.0062  83   ASP A OD2   
637  N N     . CYS A 84  ? 0.1966 0.2044 0.1871 -0.0095 -0.0010 -0.0079 84   CYS A N     
638  C CA    . CYS A 84  ? 0.1978 0.2128 0.1970 -0.0038 -0.0033 -0.0043 84   CYS A CA    
639  C C     . CYS A 84  ? 0.2042 0.2291 0.2127 -0.0003 -0.0032 -0.0021 84   CYS A C     
640  O O     . CYS A 84  ? 0.2041 0.2451 0.2283 -0.0033 -0.0078 -0.0140 84   CYS A O     
641  C CB    . CYS A 84  ? 0.1865 0.2136 0.1948 -0.0080 0.0020  -0.0018 84   CYS A CB    
642  S SG    . CYS A 84  ? 0.1803 0.2311 0.1734 0.0000  0.0067  0.0040  84   CYS A SG    
643  N N     . ARG A 85  ? 0.2228 0.2463 0.2353 0.0031  -0.0081 -0.0079 85   ARG A N     
644  C CA    . ARG A 85  ? 0.2522 0.2689 0.2660 0.0056  -0.0064 -0.0037 85   ARG A CA    
645  C C     . ARG A 85  ? 0.2724 0.2830 0.2810 0.0019  0.0002  -0.0035 85   ARG A C     
646  O O     . ARG A 85  ? 0.2557 0.2893 0.2788 0.0027  -0.0038 -0.0092 85   ARG A O     
647  C CB    . ARG A 85  ? 0.2754 0.2803 0.2775 -0.0012 0.0010  -0.0011 85   ARG A CB    
648  C CG    . ARG A 85  ? 0.3047 0.3218 0.3223 0.0071  -0.0014 -0.0038 85   ARG A CG    
649  C CD    . ARG A 85  ? 0.3627 0.3489 0.3676 0.0010  -0.0047 0.0078  85   ARG A CD    
650  N NE    . ARG A 85  ? 0.3932 0.3977 0.3936 0.0001  0.0046  0.0037  85   ARG A NE    
651  C CZ    . ARG A 85  ? 0.4164 0.4125 0.4127 0.0004  -0.0013 -0.0021 85   ARG A CZ    
652  N NH1   . ARG A 85  ? 0.4301 0.4344 0.4440 -0.0045 -0.0002 0.0023  85   ARG A NH1   
653  N NH2   . ARG A 85  ? 0.4270 0.4266 0.4237 0.0009  0.0030  0.0019  85   ARG A NH2   
654  N N     . GLU A 86  ? 0.2872 0.3014 0.3022 0.0016  -0.0047 -0.0040 86   GLU A N     
655  C CA    . GLU A 86  ? 0.3084 0.3172 0.3200 0.0002  0.0004  -0.0014 86   GLU A CA    
656  C C     . GLU A 86  ? 0.3168 0.3261 0.3324 0.0019  0.0000  -0.0028 86   GLU A C     
657  O O     . GLU A 86  ? 0.3218 0.3318 0.3486 0.0093  -0.0054 -0.0048 86   GLU A O     
658  C CB    . GLU A 86  ? 0.3144 0.3245 0.3275 0.0002  -0.0037 -0.0040 86   GLU A CB    
659  C CG    . GLU A 86  ? 0.3320 0.3399 0.3418 0.0009  0.0032  -0.0027 86   GLU A CG    
660  C CD    . GLU A 86  ? 0.3393 0.3582 0.3763 0.0038  -0.0031 -0.0041 86   GLU A CD    
661  O OE1   . GLU A 86  ? 0.3598 0.3990 0.3946 -0.0007 -0.0035 -0.0085 86   GLU A OE1   
662  O OE2   . GLU A 86  ? 0.3487 0.3661 0.4075 0.0048  0.0029  -0.0005 86   GLU A OE2   
663  N N     . THR A 87  ? 0.3285 0.3361 0.3396 0.0034  0.0012  -0.0023 87   THR A N     
664  C CA    . THR A 87  ? 0.3388 0.3398 0.3509 0.0023  0.0013  -0.0032 87   THR A CA    
665  C C     . THR A 87  ? 0.3462 0.3537 0.3648 0.0011  0.0013  -0.0029 87   THR A C     
666  O O     . THR A 87  ? 0.3384 0.3531 0.3691 0.0069  0.0019  -0.0057 87   THR A O     
667  C CB    . THR A 87  ? 0.3390 0.3389 0.3497 0.0049  0.0030  -0.0026 87   THR A CB    
668  O OG1   . THR A 87  ? 0.3332 0.3419 0.3695 0.0055  0.0115  -0.0060 87   THR A OG1   
669  C CG2   . THR A 87  ? 0.3418 0.3419 0.3430 -0.0004 0.0012  -0.0064 87   THR A CG2   
670  N N     . GLY A 88  ? 0.3645 0.3646 0.3776 0.0018  0.0003  -0.0024 88   GLY A N     
671  C CA    . GLY A 88  ? 0.3750 0.3793 0.3857 0.0022  -0.0006 -0.0025 88   GLY A CA    
672  C C     . GLY A 88  ? 0.3878 0.3895 0.3949 0.0003  0.0017  -0.0019 88   GLY A C     
673  O O     . GLY A 88  ? 0.3933 0.4054 0.4100 -0.0003 -0.0023 -0.0019 88   GLY A O     
674  N N     . SER A 89  ? 0.3957 0.3956 0.4020 0.0024  0.0011  -0.0015 89   SER A N     
675  C CA    . SER A 89  ? 0.4071 0.4053 0.4086 0.0010  0.0019  0.0002  89   SER A CA    
676  C C     . SER A 89  ? 0.4102 0.4063 0.4106 0.0016  0.0043  0.0000  89   SER A C     
677  O O     . SER A 89  ? 0.4133 0.4090 0.4122 0.0039  0.0070  0.0013  89   SER A O     
678  C CB    . SER A 89  ? 0.4119 0.4093 0.4123 0.0003  0.0011  -0.0014 89   SER A CB    
679  O OG    . SER A 89  ? 0.4245 0.4241 0.4289 0.0031  0.0001  -0.0012 89   SER A OG    
680  N N     . SER A 90  ? 0.4049 0.4041 0.4104 0.0018  0.0046  0.0000  90   SER A N     
681  C CA    . SER A 90  ? 0.3991 0.4027 0.4072 0.0008  0.0040  -0.0015 90   SER A CA    
682  C C     . SER A 90  ? 0.3994 0.4038 0.4082 0.0032  0.0037  -0.0024 90   SER A C     
683  O O     . SER A 90  ? 0.3911 0.4017 0.4118 0.0042  0.0061  -0.0045 90   SER A O     
684  C CB    . SER A 90  ? 0.3953 0.3978 0.4055 0.0010  0.0042  -0.0011 90   SER A CB    
685  O OG    . SER A 90  ? 0.3739 0.3917 0.4062 -0.0022 0.0114  -0.0042 90   SER A OG    
686  N N     . LYS A 91  ? 0.4000 0.4059 0.4100 0.0015  0.0044  -0.0017 91   LYS A N     
687  C CA    . LYS A 91  ? 0.4064 0.4091 0.4129 -0.0001 0.0027  -0.0007 91   LYS A CA    
688  C C     . LYS A 91  ? 0.4036 0.4099 0.4137 -0.0013 0.0024  0.0008  91   LYS A C     
689  O O     . LYS A 91  ? 0.3987 0.4043 0.4170 -0.0014 0.0063  -0.0016 91   LYS A O     
690  C CB    . LYS A 91  ? 0.4085 0.4107 0.4142 0.0006  0.0032  0.0000  91   LYS A CB    
691  C CG    . LYS A 91  ? 0.4119 0.4138 0.4194 0.0023  0.0034  -0.0020 91   LYS A CG    
692  C CD    . LYS A 91  ? 0.4224 0.4224 0.4239 0.0033  -0.0007 -0.0011 91   LYS A CD    
693  C CE    . LYS A 91  ? 0.4268 0.4206 0.4267 0.0001  0.0023  -0.0007 91   LYS A CE    
694  N NZ    . LYS A 91  ? 0.4374 0.4500 0.4463 0.0026  -0.0021 -0.0019 91   LYS A NZ    
695  N N     . TYR A 92  ? 0.4107 0.4132 0.4198 -0.0005 0.0044  -0.0007 92   TYR A N     
696  C CA    . TYR A 92  ? 0.4187 0.4185 0.4253 0.0007  0.0020  0.0012  92   TYR A CA    
697  C C     . TYR A 92  ? 0.4202 0.4200 0.4280 -0.0007 0.0027  0.0013  92   TYR A C     
698  O O     . TYR A 92  ? 0.4209 0.4172 0.4344 -0.0010 0.0054  0.0016  92   TYR A O     
699  C CB    . TYR A 92  ? 0.4200 0.4214 0.4269 0.0004  0.0014  0.0008  92   TYR A CB    
700  C CG    . TYR A 92  ? 0.4295 0.4247 0.4364 0.0004  0.0018  -0.0012 92   TYR A CG    
701  C CD1   . TYR A 92  ? 0.4335 0.4339 0.4455 -0.0014 0.0042  -0.0010 92   TYR A CD1   
702  C CD2   . TYR A 92  ? 0.4339 0.4369 0.4448 -0.0025 0.0032  0.0013  92   TYR A CD2   
703  C CE1   . TYR A 92  ? 0.4362 0.4363 0.4464 0.0004  0.0041  -0.0011 92   TYR A CE1   
704  C CE2   . TYR A 92  ? 0.4389 0.4356 0.4470 -0.0015 0.0017  -0.0012 92   TYR A CE2   
705  C CZ    . TYR A 92  ? 0.4454 0.4420 0.4568 -0.0011 0.0039  -0.0006 92   TYR A CZ    
706  O OH    . TYR A 92  ? 0.4584 0.4452 0.4683 0.0016  0.0072  -0.0028 92   TYR A OH    
707  N N     . PRO A 93  ? 0.4233 0.4240 0.4297 0.0006  0.0022  0.0009  93   PRO A N     
708  C CA    . PRO A 93  ? 0.4232 0.4243 0.4287 0.0010  0.0024  -0.0003 93   PRO A CA    
709  C C     . PRO A 93  ? 0.4217 0.4218 0.4284 0.0013  0.0029  -0.0014 93   PRO A C     
710  O O     . PRO A 93  ? 0.4167 0.4261 0.4339 0.0009  0.0040  0.0003  93   PRO A O     
711  C CB    . PRO A 93  ? 0.4261 0.4247 0.4292 0.0007  0.0014  -0.0004 93   PRO A CB    
712  C CG    . PRO A 93  ? 0.4284 0.4258 0.4318 0.0007  0.0014  0.0011  93   PRO A CG    
713  C CD    . PRO A 93  ? 0.4263 0.4250 0.4294 -0.0007 0.0024  0.0011  93   PRO A CD    
714  N N     . ASN A 94  ? 0.4147 0.4177 0.4237 0.0013  0.0032  -0.0006 94   ASN A N     
715  C CA    . ASN A 94  ? 0.4148 0.4128 0.4162 0.0005  0.0031  0.0002  94   ASN A CA    
716  C C     . ASN A 94  ? 0.3984 0.3995 0.4020 0.0017  0.0054  -0.0019 94   ASN A C     
717  O O     . ASN A 94  ? 0.3961 0.3977 0.4039 0.0005  0.0071  -0.0032 94   ASN A O     
718  C CB    . ASN A 94  ? 0.4193 0.4185 0.4214 0.0011  0.0027  -0.0020 94   ASN A CB    
719  C CG    . ASN A 94  ? 0.4428 0.4332 0.4372 -0.0004 0.0023  0.0036  94   ASN A CG    
720  O OD1   . ASN A 94  ? 0.4613 0.4609 0.4700 -0.0044 -0.0027 -0.0011 94   ASN A OD1   
721  N ND2   . ASN A 94  ? 0.4663 0.4605 0.4529 -0.0021 -0.0050 0.0020  94   ASN A ND2   
722  N N     . CYS A 95  ? 0.3850 0.3827 0.3860 0.0000  0.0034  0.0003  95   CYS A N     
723  C CA    . CYS A 95  ? 0.3675 0.3710 0.3731 -0.0032 0.0037  -0.0016 95   CYS A CA    
724  C C     . CYS A 95  ? 0.3527 0.3560 0.3588 0.0007  0.0059  0.0000  95   CYS A C     
725  O O     . CYS A 95  ? 0.3524 0.3629 0.3582 -0.0021 0.0055  0.0003  95   CYS A O     
726  C CB    . CYS A 95  ? 0.3628 0.3688 0.3714 -0.0060 0.0035  -0.0007 95   CYS A CB    
727  S SG    . CYS A 95  ? 0.3621 0.3953 0.3881 -0.0456 0.0229  0.0119  95   CYS A SG    
728  N N     . ALA A 96  ? 0.3239 0.3335 0.3281 -0.0009 0.0066  -0.0034 96   ALA A N     
729  C CA    . ALA A 96  ? 0.3096 0.3124 0.3115 0.0000  0.0078  -0.0002 96   ALA A CA    
730  C C     . ALA A 96  ? 0.2841 0.2845 0.2889 0.0013  0.0057  -0.0048 96   ALA A C     
731  O O     . ALA A 96  ? 0.2685 0.2879 0.2933 -0.0003 0.0129  -0.0125 96   ALA A O     
732  C CB    . ALA A 96  ? 0.3146 0.3155 0.3170 0.0008  0.0066  -0.0037 96   ALA A CB    
733  N N     . TYR A 97  ? 0.2580 0.2666 0.2654 0.0050  0.0100  -0.0058 97   TYR A N     
734  C CA    . TYR A 97  ? 0.2352 0.2505 0.2473 0.0056  0.0062  -0.0058 97   TYR A CA    
735  C C     . TYR A 97  ? 0.2343 0.2457 0.2407 0.0058  0.0048  -0.0095 97   TYR A C     
736  O O     . TYR A 97  ? 0.2455 0.2508 0.2397 0.0044  0.0070  -0.0106 97   TYR A O     
737  C CB    . TYR A 97  ? 0.2283 0.2456 0.2449 0.0056  0.0103  -0.0071 97   TYR A CB    
738  C CG    . TYR A 97  ? 0.2026 0.2317 0.2491 0.0124  0.0127  -0.0077 97   TYR A CG    
739  C CD1   . TYR A 97  ? 0.2426 0.2411 0.2423 0.0100  0.0176  -0.0109 97   TYR A CD1   
740  C CD2   . TYR A 97  ? 0.2129 0.2388 0.2398 0.0127  0.0235  -0.0044 97   TYR A CD2   
741  C CE1   . TYR A 97  ? 0.2281 0.2404 0.2628 0.0011  0.0255  -0.0068 97   TYR A CE1   
742  C CE2   . TYR A 97  ? 0.2358 0.2546 0.2736 0.0034  0.0049  -0.0072 97   TYR A CE2   
743  C CZ    . TYR A 97  ? 0.2600 0.2737 0.2807 -0.0009 0.0124  -0.0031 97   TYR A CZ    
744  O OH    . TYR A 97  ? 0.2738 0.2845 0.3062 -0.0023 0.0204  -0.0201 97   TYR A OH    
745  N N     . LYS A 98  ? 0.2371 0.2498 0.2464 0.0072  0.0049  -0.0066 98   LYS A N     
746  C CA    . LYS A 98  ? 0.2458 0.2524 0.2411 0.0022  0.0045  -0.0093 98   LYS A CA    
747  C C     . LYS A 98  ? 0.2311 0.2453 0.2215 0.0046  0.0017  -0.0103 98   LYS A C     
748  O O     . LYS A 98  ? 0.2330 0.2585 0.2214 0.0084  0.0028  -0.0190 98   LYS A O     
749  C CB    . LYS A 98  ? 0.2608 0.2684 0.2545 0.0077  0.0001  -0.0072 98   LYS A CB    
750  C CG    . LYS A 98  ? 0.3005 0.3041 0.2941 -0.0068 0.0000  -0.0076 98   LYS A CG    
751  C CD    . LYS A 98  ? 0.3489 0.3393 0.3526 0.0046  -0.0002 0.0034  98   LYS A CD    
752  C CE    . LYS A 98  ? 0.3687 0.3705 0.3651 -0.0002 -0.0001 -0.0008 98   LYS A CE    
753  N NZ    . LYS A 98  ? 0.3797 0.3856 0.3894 0.0047  0.0061  -0.0029 98   LYS A NZ    
754  N N     . THR A 99  ? 0.2212 0.2211 0.2011 0.0034  0.0054  -0.0172 99   THR A N     
755  C CA    . THR A 99  ? 0.2136 0.2232 0.1983 -0.0016 0.0025  -0.0079 99   THR A CA    
756  C C     . THR A 99  ? 0.2208 0.2197 0.1995 -0.0020 0.0024  -0.0106 99   THR A C     
757  O O     . THR A 99  ? 0.2276 0.2275 0.2019 -0.0018 -0.0017 -0.0223 99   THR A O     
758  C CB    . THR A 99  ? 0.2246 0.2423 0.2013 0.0006  -0.0035 -0.0170 99   THR A CB    
759  O OG1   . THR A 99  ? 0.2353 0.2772 0.2002 0.0023  0.0060  -0.0159 99   THR A OG1   
760  C CG2   . THR A 99  ? 0.2182 0.2384 0.1961 -0.0028 -0.0020 -0.0053 99   THR A CG2   
761  N N     . THR A 100 ? 0.2181 0.2136 0.1906 -0.0048 0.0005  -0.0081 100  THR A N     
762  C CA    . THR A 100 ? 0.2168 0.2274 0.2161 -0.0072 0.0042  -0.0116 100  THR A CA    
763  C C     . THR A 100 ? 0.2233 0.2346 0.2038 -0.0034 0.0027  -0.0157 100  THR A C     
764  O O     . THR A 100 ? 0.2429 0.2338 0.2259 -0.0088 -0.0013 -0.0312 100  THR A O     
765  C CB    . THR A 100 ? 0.2365 0.2164 0.2139 -0.0022 0.0026  -0.0149 100  THR A CB    
766  O OG1   . THR A 100 ? 0.2260 0.2451 0.2477 -0.0044 0.0031  -0.0036 100  THR A OG1   
767  C CG2   . THR A 100 ? 0.2585 0.2549 0.2528 -0.0039 0.0003  0.0032  100  THR A CG2   
768  N N     . GLN A 101 ? 0.2313 0.2381 0.2322 -0.0091 0.0027  -0.0214 101  GLN A N     
769  C CA    . GLN A 101 ? 0.2392 0.2497 0.2394 -0.0046 0.0007  -0.0089 101  GLN A CA    
770  C C     . GLN A 101 ? 0.2352 0.2481 0.2423 -0.0075 0.0046  -0.0081 101  GLN A C     
771  O O     . GLN A 101 ? 0.2384 0.2624 0.2302 -0.0058 0.0050  -0.0008 101  GLN A O     
772  C CB    . GLN A 101 ? 0.2625 0.2574 0.2447 -0.0054 -0.0072 -0.0109 101  GLN A CB    
773  C CG    . GLN A 101 ? 0.2944 0.3110 0.2916 -0.0026 0.0022  -0.0035 101  GLN A CG    
774  C CD    . GLN A 101 ? 0.3164 0.3252 0.3162 -0.0036 -0.0040 -0.0168 101  GLN A CD    
775  O OE1   . GLN A 101 ? 0.3227 0.3701 0.2973 -0.0023 -0.0060 -0.0080 101  GLN A OE1   
776  N NE2   . GLN A 101 ? 0.3356 0.3347 0.3014 -0.0165 -0.0051 -0.0042 101  GLN A NE2   
777  N N     . ALA A 102 ? 0.2402 0.2508 0.2287 -0.0098 0.0002  -0.0099 102  ALA A N     
778  C CA    . ALA A 102 ? 0.2390 0.2453 0.2321 -0.0048 0.0009  -0.0076 102  ALA A CA    
779  C C     . ALA A 102 ? 0.2180 0.2326 0.2110 -0.0108 -0.0009 -0.0055 102  ALA A C     
780  O O     . ALA A 102 ? 0.2140 0.2426 0.1954 -0.0235 0.0142  -0.0125 102  ALA A O     
781  C CB    . ALA A 102 ? 0.2447 0.2559 0.2441 0.0006  0.0018  0.0005  102  ALA A CB    
782  N N     . ASN A 103 ? 0.2231 0.2400 0.2151 -0.0108 0.0033  -0.0067 103  ASN A N     
783  C CA    . ASN A 103 ? 0.2202 0.2325 0.2143 -0.0160 0.0004  -0.0056 103  ASN A CA    
784  C C     . ASN A 103 ? 0.2255 0.2249 0.2078 -0.0185 0.0023  -0.0047 103  ASN A C     
785  O O     . ASN A 103 ? 0.2582 0.2273 0.2321 -0.0287 -0.0088 -0.0120 103  ASN A O     
786  C CB    . ASN A 103 ? 0.2314 0.2492 0.2316 -0.0175 -0.0015 -0.0046 103  ASN A CB    
787  C CG    . ASN A 103 ? 0.2593 0.2721 0.2556 -0.0155 -0.0101 0.0002  103  ASN A CG    
788  O OD1   . ASN A 103 ? 0.2991 0.3047 0.2768 -0.0077 -0.0166 0.0031  103  ASN A OD1   
789  N ND2   . ASN A 103 ? 0.3314 0.3146 0.3032 0.0046  0.0023  -0.0156 103  ASN A ND2   
790  N N     . LYS A 104 ? 0.2002 0.2183 0.1965 -0.0252 0.0087  -0.0048 104  LYS A N     
791  C CA    . LYS A 104 ? 0.2004 0.1990 0.1957 -0.0131 0.0062  -0.0011 104  LYS A CA    
792  C C     . LYS A 104 ? 0.1734 0.1815 0.1784 -0.0168 -0.0032 0.0008  104  LYS A C     
793  O O     . LYS A 104 ? 0.1865 0.2052 0.1592 -0.0226 -0.0040 -0.0034 104  LYS A O     
794  C CB    . LYS A 104 ? 0.2142 0.2062 0.1990 -0.0026 -0.0022 0.0009  104  LYS A CB    
795  C CG    . LYS A 104 ? 0.2427 0.2269 0.2244 -0.0008 0.0026  -0.0073 104  LYS A CG    
796  C CD    . LYS A 104 ? 0.2519 0.2312 0.2358 0.0042  0.0031  0.0045  104  LYS A CD    
797  C CE    . LYS A 104 ? 0.2499 0.2574 0.2463 0.0080  -0.0012 -0.0077 104  LYS A CE    
798  N NZ    . LYS A 104 ? 0.2536 0.2575 0.2611 0.0048  0.0139  0.0079  104  LYS A NZ    
799  N N     . HIS A 105 ? 0.1740 0.1756 0.1676 -0.0133 -0.0020 0.0065  105  HIS A N     
800  C CA    . HIS A 105 ? 0.1596 0.1776 0.1620 -0.0154 -0.0033 0.0017  105  HIS A CA    
801  C C     . HIS A 105 ? 0.1476 0.1744 0.1575 -0.0113 -0.0102 -0.0037 105  HIS A C     
802  O O     . HIS A 105 ? 0.1764 0.1811 0.2404 -0.0171 0.0099  0.0010  105  HIS A O     
803  C CB    . HIS A 105 ? 0.1661 0.1824 0.1638 -0.0164 0.0002  0.0083  105  HIS A CB    
804  C CG    . HIS A 105 ? 0.1973 0.2141 0.1970 -0.0196 -0.0009 0.0089  105  HIS A CG    
805  N ND1   . HIS A 105 ? 0.2060 0.2253 0.2062 -0.0299 0.0013  0.0061  105  HIS A ND1   
806  C CD2   . HIS A 105 ? 0.2385 0.2289 0.2571 -0.0065 0.0019  0.0007  105  HIS A CD2   
807  C CE1   . HIS A 105 ? 0.2304 0.2287 0.2360 -0.0237 0.0122  0.0050  105  HIS A CE1   
808  N NE2   . HIS A 105 ? 0.2483 0.2270 0.2674 -0.0213 0.0098  0.0150  105  HIS A NE2   
809  N N     . ILE A 106 ? 0.1274 0.1713 0.1440 -0.0214 -0.0064 -0.0068 106  ILE A N     
810  C CA    . ILE A 106 ? 0.1222 0.1547 0.1434 -0.0169 -0.0041 -0.0030 106  ILE A CA    
811  C C     . ILE A 106 ? 0.1145 0.1400 0.1259 -0.0066 0.0025  -0.0010 106  ILE A C     
812  O O     . ILE A 106 ? 0.1155 0.1552 0.1186 -0.0137 -0.0037 0.0005  106  ILE A O     
813  C CB    . ILE A 106 ? 0.1379 0.1761 0.1174 -0.0169 -0.0110 -0.0002 106  ILE A CB    
814  C CG1   . ILE A 106 ? 0.1309 0.1647 0.1496 -0.0159 -0.0130 0.0121  106  ILE A CG1   
815  C CG2   . ILE A 106 ? 0.1487 0.1881 0.1461 -0.0095 -0.0142 -0.0034 106  ILE A CG2   
816  C CD1   . ILE A 106 ? 0.1545 0.1721 0.1599 -0.0078 -0.0045 0.0207  106  ILE A CD1   
817  N N     . ILE A 107 ? 0.1044 0.1292 0.1149 -0.0173 -0.0030 0.0040  107  ILE A N     
818  C CA    . ILE A 107 ? 0.1074 0.1215 0.1098 -0.0121 -0.0062 0.0014  107  ILE A CA    
819  C C     . ILE A 107 ? 0.1016 0.1100 0.1035 -0.0043 -0.0048 0.0018  107  ILE A C     
820  O O     . ILE A 107 ? 0.1131 0.1138 0.1126 -0.0002 0.0046  -0.0018 107  ILE A O     
821  C CB    . ILE A 107 ? 0.1163 0.1148 0.1182 -0.0089 -0.0117 0.0005  107  ILE A CB    
822  C CG1   . ILE A 107 ? 0.1124 0.1179 0.1187 -0.0101 -0.0091 -0.0062 107  ILE A CG1   
823  C CG2   . ILE A 107 ? 0.1111 0.1131 0.1224 -0.0084 0.0011  -0.0028 107  ILE A CG2   
824  C CD1   . ILE A 107 ? 0.1365 0.1294 0.1524 -0.0009 0.0040  0.0041  107  ILE A CD1   
825  N N     . VAL A 108 ? 0.1061 0.1147 0.1155 -0.0030 -0.0083 0.0069  108  VAL A N     
826  C CA    . VAL A 108 ? 0.1066 0.1056 0.1146 0.0019  -0.0040 0.0023  108  VAL A CA    
827  C C     . VAL A 108 ? 0.1076 0.0936 0.1141 0.0047  0.0009  0.0038  108  VAL A C     
828  O O     . VAL A 108 ? 0.1173 0.1240 0.1196 -0.0024 0.0003  0.0019  108  VAL A O     
829  C CB    . VAL A 108 ? 0.1171 0.1184 0.1295 -0.0002 -0.0068 0.0113  108  VAL A CB    
830  C CG1   . VAL A 108 ? 0.1297 0.1413 0.1376 0.0008  -0.0076 0.0159  108  VAL A CG1   
831  C CG2   . VAL A 108 ? 0.1276 0.1306 0.1354 0.0044  -0.0091 0.0040  108  VAL A CG2   
832  N N     . ALA A 109 ? 0.1032 0.0938 0.1075 0.0012  0.0003  0.0062  109  ALA A N     
833  C CA    . ALA A 109 ? 0.1192 0.1054 0.1170 0.0014  0.0008  0.0041  109  ALA A CA    
834  C C     . ALA A 109 ? 0.1123 0.1051 0.1034 0.0097  0.0045  0.0132  109  ALA A C     
835  O O     . ALA A 109 ? 0.1299 0.1175 0.1138 0.0053  0.0049  0.0082  109  ALA A O     
836  C CB    . ALA A 109 ? 0.1255 0.1020 0.1272 0.0019  -0.0087 0.0046  109  ALA A CB    
837  N N     . CYS A 110 ? 0.1058 0.0993 0.1134 0.0212  0.0012  0.0167  110  CYS A N     
838  C CA    . CYS A 110 ? 0.1253 0.1083 0.1084 0.0203  0.0025  0.0174  110  CYS A CA    
839  C C     . CYS A 110 ? 0.1265 0.1138 0.1277 0.0172  0.0105  0.0057  110  CYS A C     
840  O O     . CYS A 110 ? 0.1217 0.1123 0.1276 0.0096  0.0044  0.0031  110  CYS A O     
841  C CB    . CYS A 110 ? 0.1354 0.1368 0.1383 0.0206  0.0000  0.0137  110  CYS A CB    
842  S SG    . CYS A 110 ? 0.1316 0.1525 0.1385 0.0101  0.0081  0.0107  110  CYS A SG    
843  N N     . GLU A 111 ? 0.1399 0.1164 0.1308 0.0189  0.0089  0.0122  111  GLU A N     
844  C CA    . GLU A 111 ? 0.1395 0.1224 0.1312 0.0130  0.0009  0.0102  111  GLU A CA    
845  C C     . GLU A 111 ? 0.1351 0.1208 0.1426 0.0164  -0.0001 0.0122  111  GLU A C     
846  O O     . GLU A 111 ? 0.1612 0.1390 0.1436 0.0213  0.0124  0.0064  111  GLU A O     
847  C CB    . GLU A 111 ? 0.1306 0.1152 0.1170 0.0036  0.0023  0.0058  111  GLU A CB    
848  C CG    . GLU A 111 ? 0.1479 0.1242 0.1390 0.0094  0.0085  0.0070  111  GLU A CG    
849  C CD    . GLU A 111 ? 0.1752 0.1628 0.1668 -0.0090 0.0135  0.0019  111  GLU A CD    
850  O OE1   . GLU A 111 ? 0.2074 0.2771 0.2374 -0.0161 -0.0049 0.0107  111  GLU A OE1   
851  O OE2   . GLU A 111 ? 0.1970 0.2032 0.1996 0.0034  0.0119  0.0156  111  GLU A OE2   
852  N N     . GLY A 112 ? 0.1633 0.1292 0.1389 0.0256  -0.0022 0.0108  112  GLY A N     
853  C CA    . GLY A 112 ? 0.1691 0.1377 0.1569 0.0163  0.0060  0.0123  112  GLY A CA    
854  C C     . GLY A 112 ? 0.1911 0.1661 0.1886 0.0158  0.0134  0.0139  112  GLY A C     
855  O O     . GLY A 112 ? 0.1845 0.1412 0.1670 0.0232  0.0189  0.0124  112  GLY A O     
856  N N     . ASN A 113 ? 0.2112 0.1860 0.2228 0.0261  0.0218  0.0199  113  ASN A N     
857  C CA    . ASN A 113 ? 0.2304 0.2269 0.2435 0.0148  0.0121  0.0106  113  ASN A CA    
858  C C     . ASN A 113 ? 0.2310 0.2235 0.2474 0.0161  0.0154  0.0138  113  ASN A C     
859  O O     . ASN A 113 ? 0.2636 0.2364 0.2787 0.0187  0.0220  0.0256  113  ASN A O     
860  C CB    . ASN A 113 ? 0.2570 0.2402 0.2593 0.0151  0.0066  0.0080  113  ASN A CB    
861  C CG    . ASN A 113 ? 0.2850 0.2879 0.3016 0.0080  0.0140  -0.0058 113  ASN A CG    
862  O OD1   . ASN A 113 ? 0.3040 0.3242 0.3319 0.0286  0.0078  -0.0109 113  ASN A OD1   
863  N ND2   . ASN A 113 ? 0.3560 0.3565 0.3298 0.0013  0.0055  -0.0021 113  ASN A ND2   
864  N N     . PRO A 114 ? 0.2418 0.2360 0.2521 0.0147  0.0137  0.0128  114  PRO A N     
865  C CA    . PRO A 114 ? 0.2330 0.2244 0.2470 0.0187  0.0151  0.0078  114  PRO A CA    
866  C C     . PRO A 114 ? 0.2080 0.1999 0.2316 0.0217  0.0140  0.0165  114  PRO A C     
867  O O     . PRO A 114 ? 0.2244 0.1942 0.2226 0.0307  0.0300  0.0367  114  PRO A O     
868  C CB    . PRO A 114 ? 0.2445 0.2399 0.2618 0.0146  0.0116  0.0094  114  PRO A CB    
869  C CG    . PRO A 114 ? 0.2543 0.2601 0.2532 0.0110  0.0033  0.0128  114  PRO A CG    
870  C CD    . PRO A 114 ? 0.2478 0.2405 0.2585 0.0144  0.0056  0.0189  114  PRO A CD    
871  N N     . TYR A 115 ? 0.1801 0.1895 0.2005 0.0330  0.0217  0.0194  115  TYR A N     
872  C CA    . TYR A 115 ? 0.1550 0.1668 0.1782 0.0279  0.0090  0.0147  115  TYR A CA    
873  C C     . TYR A 115 ? 0.1576 0.1462 0.1718 0.0297  0.0120  0.0213  115  TYR A C     
874  O O     . TYR A 115 ? 0.1662 0.1893 0.1721 0.0234  0.0102  0.0152  115  TYR A O     
875  C CB    . TYR A 115 ? 0.1721 0.1808 0.1838 0.0236  0.0091  0.0147  115  TYR A CB    
876  C CG    . TYR A 115 ? 0.1585 0.1383 0.1493 0.0247  0.0210  -0.0003 115  TYR A CG    
877  C CD1   . TYR A 115 ? 0.1652 0.1485 0.1237 0.0251  0.0217  0.0029  115  TYR A CD1   
878  C CD2   . TYR A 115 ? 0.1569 0.1537 0.1342 0.0009  0.0169  0.0006  115  TYR A CD2   
879  C CE1   . TYR A 115 ? 0.1468 0.1414 0.1391 0.0238  0.0179  -0.0056 115  TYR A CE1   
880  C CE2   . TYR A 115 ? 0.1542 0.1413 0.1385 0.0128  0.0187  0.0049  115  TYR A CE2   
881  C CZ    . TYR A 115 ? 0.1509 0.1554 0.1315 0.0235  0.0145  0.0045  115  TYR A CZ    
882  O OH    . TYR A 115 ? 0.1606 0.1413 0.1402 0.0239  0.0027  0.0020  115  TYR A OH    
883  N N     . VAL A 116 ? 0.1331 0.1458 0.1548 0.0304  0.0095  0.0368  116  VAL A N     
884  C CA    . VAL A 116 ? 0.1494 0.1578 0.1598 0.0264  0.0078  0.0215  116  VAL A CA    
885  C C     . VAL A 116 ? 0.1434 0.1534 0.1478 0.0179  0.0096  0.0163  116  VAL A C     
886  O O     . VAL A 116 ? 0.1379 0.1396 0.1367 0.0062  0.0120  0.0154  116  VAL A O     
887  C CB    . VAL A 116 ? 0.1655 0.1640 0.1742 0.0315  0.0011  0.0224  116  VAL A CB    
888  C CG1   . VAL A 116 ? 0.1785 0.1686 0.1862 0.0243  0.0112  0.0234  116  VAL A CG1   
889  C CG2   . VAL A 116 ? 0.1760 0.1640 0.1653 0.0282  0.0095  0.0151  116  VAL A CG2   
890  N N     . PRO A 117 ? 0.1410 0.1554 0.1426 0.0109  -0.0037 0.0203  117  PRO A N     
891  C CA    . PRO A 117 ? 0.1335 0.1363 0.1327 0.0055  -0.0013 0.0215  117  PRO A CA    
892  C C     . PRO A 117 ? 0.1240 0.1338 0.1317 0.0088  0.0003  0.0189  117  PRO A C     
893  O O     . PRO A 117 ? 0.1427 0.1481 0.1331 0.0103  0.0000  0.0158  117  PRO A O     
894  C CB    . PRO A 117 ? 0.1382 0.1486 0.1324 0.0016  -0.0045 0.0150  117  PRO A CB    
895  C CG    . PRO A 117 ? 0.1432 0.1798 0.1320 -0.0045 -0.0092 0.0138  117  PRO A CG    
896  C CD    . PRO A 117 ? 0.1461 0.1774 0.1465 0.0104  -0.0014 0.0237  117  PRO A CD    
897  N N     . VAL A 118 ? 0.1157 0.1268 0.1267 0.0110  0.0034  0.0198  118  VAL A N     
898  C CA    . VAL A 118 ? 0.1151 0.1255 0.1289 0.0076  0.0067  0.0121  118  VAL A CA    
899  C C     . VAL A 118 ? 0.1145 0.1195 0.1075 0.0058  0.0018  0.0051  118  VAL A C     
900  O O     . VAL A 118 ? 0.1302 0.1302 0.1247 0.0020  0.0100  0.0063  118  VAL A O     
901  C CB    . VAL A 118 ? 0.1227 0.1276 0.1298 0.0074  0.0134  0.0145  118  VAL A CB    
902  C CG1   . VAL A 118 ? 0.1340 0.1286 0.1315 0.0077  0.0080  0.0136  118  VAL A CG1   
903  C CG2   . VAL A 118 ? 0.1353 0.1357 0.1231 0.0048  -0.0027 0.0049  118  VAL A CG2   
904  N N     . HIS A 119 ? 0.1193 0.1088 0.1162 0.0134  0.0097  -0.0015 119  HIS A N     
905  C CA    . HIS A 119 ? 0.1095 0.1127 0.1002 0.0074  0.0099  0.0033  119  HIS A CA    
906  C C     . HIS A 119 ? 0.1175 0.1186 0.1081 0.0034  0.0081  0.0151  119  HIS A C     
907  O O     . HIS A 119 ? 0.1220 0.1352 0.1268 0.0006  0.0093  0.0078  119  HIS A O     
908  C CB    . HIS A 119 ? 0.1097 0.1390 0.1360 -0.0006 0.0102  0.0086  119  HIS A CB    
909  C CG    . HIS A 119 ? 0.1360 0.1552 0.1486 -0.0018 0.0041  -0.0011 119  HIS A CG    
910  N ND1   . HIS A 119 ? 0.1596 0.1672 0.1899 -0.0083 0.0008  0.0108  119  HIS A ND1   
911  C CD2   . HIS A 119 ? 0.1628 0.1469 0.1493 0.0045  -0.0046 0.0050  119  HIS A CD2   
912  C CE1   . HIS A 119 ? 0.1572 0.1691 0.1888 -0.0032 0.0000  0.0047  119  HIS A CE1   
913  N NE2   . HIS A 119 ? 0.1566 0.1800 0.2054 -0.0079 0.0028  -0.0079 119  HIS A NE2   
914  N N     . PHE A 120 ? 0.1100 0.1065 0.1224 0.0046  0.0060  0.0042  120  PHE A N     
915  C CA    . PHE A 120 ? 0.1229 0.1139 0.1173 -0.0008 0.0093  0.0093  120  PHE A CA    
916  C C     . PHE A 120 ? 0.1078 0.1171 0.1264 -0.0049 0.0096  -0.0028 120  PHE A C     
917  O O     . PHE A 120 ? 0.1255 0.1403 0.1456 0.0071  0.0039  0.0041  120  PHE A O     
918  C CB    . PHE A 120 ? 0.1207 0.1132 0.1168 -0.0060 0.0080  0.0103  120  PHE A CB    
919  C CG    . PHE A 120 ? 0.1391 0.1328 0.1107 -0.0184 0.0019  0.0041  120  PHE A CG    
920  C CD1   . PHE A 120 ? 0.1502 0.1556 0.1295 -0.0058 0.0056  0.0078  120  PHE A CD1   
921  C CD2   . PHE A 120 ? 0.1456 0.1311 0.1285 -0.0077 -0.0084 -0.0005 120  PHE A CD2   
922  C CE1   . PHE A 120 ? 0.1568 0.1861 0.1367 -0.0177 0.0006  0.0058  120  PHE A CE1   
923  C CE2   . PHE A 120 ? 0.1605 0.1410 0.1278 -0.0083 -0.0096 0.0093  120  PHE A CE2   
924  C CZ    . PHE A 120 ? 0.1443 0.1657 0.1244 -0.0289 0.0088  0.0030  120  PHE A CZ    
925  N N     . ASP A 121 ? 0.1022 0.1178 0.1197 -0.0027 0.0080  -0.0002 121  ASP A N     
926  C CA    . ASP A 121 ? 0.1127 0.1154 0.1245 -0.0035 -0.0018 0.0046  121  ASP A CA    
927  C C     . ASP A 121 ? 0.1152 0.1299 0.1380 0.0032  -0.0056 0.0048  121  ASP A C     
928  O O     . ASP A 121 ? 0.1476 0.1427 0.1685 0.0075  0.0089  -0.0058 121  ASP A O     
929  C CB    . ASP A 121 ? 0.1050 0.1170 0.1342 0.0030  -0.0016 0.0036  121  ASP A CB    
930  C CG    . ASP A 121 ? 0.1104 0.1233 0.1221 -0.0005 -0.0033 0.0124  121  ASP A CG    
931  O OD1   . ASP A 121 ? 0.1321 0.1288 0.1357 -0.0071 -0.0145 0.0178  121  ASP A OD1   
932  O OD2   . ASP A 121 ? 0.1285 0.1238 0.1326 -0.0018 -0.0002 0.0041  121  ASP A OD2   
933  N N     . ALA A 122 ? 0.1369 0.1267 0.1397 -0.0040 -0.0071 -0.0049 122  ALA A N     
934  C CA    . ALA A 122 ? 0.1583 0.1460 0.1529 -0.0019 0.0028  -0.0055 122  ALA A CA    
935  C C     . ALA A 122 ? 0.1581 0.1358 0.1459 -0.0054 0.0009  -0.0071 122  ALA A C     
936  O O     . ALA A 122 ? 0.1469 0.1390 0.1398 -0.0041 0.0009  -0.0030 122  ALA A O     
937  C CB    . ALA A 122 ? 0.1848 0.1547 0.1856 0.0027  0.0016  -0.0061 122  ALA A CB    
938  N N     . SER A 123 ? 0.1746 0.1594 0.1892 -0.0007 0.0038  -0.0189 123  SER A N     
939  C CA    . SER A 123 ? 0.1967 0.1861 0.2015 -0.0071 0.0003  -0.0053 123  SER A CA    
940  C C     . SER A 123 ? 0.2014 0.1945 0.1975 -0.0059 -0.0047 -0.0059 123  SER A C     
941  O O     . SER A 123 ? 0.2185 0.1620 0.2203 -0.0072 -0.0032 -0.0080 123  SER A O     
942  C CB    . SER A 123 ? 0.2122 0.2093 0.2108 -0.0119 -0.0062 0.0030  123  SER A CB    
943  O OG    . SER A 123 ? 0.2783 0.2652 0.2632 -0.0041 0.0007  -0.0215 123  SER A OG    
944  N N     . VAL A 124 ? 0.2025 0.1844 0.1937 -0.0091 -0.0020 -0.0083 124  VAL A N     
945  C CA    . VAL A 124 ? 0.2173 0.2047 0.2087 -0.0069 -0.0016 -0.0003 124  VAL A CA    
946  C C     . VAL A 124 ? 0.2184 0.1856 0.2102 -0.0142 -0.0039 0.0104  124  VAL A C     
947  O O     . VAL A 124 ? 0.2290 0.2029 0.2351 -0.0194 -0.0206 0.0000  124  VAL A O     
948  C CB    . VAL A 124 ? 0.2328 0.2066 0.2082 -0.0054 -0.0032 -0.0033 124  VAL A CB    
949  C CG1   . VAL A 124 ? 0.2322 0.2360 0.2359 0.0015  -0.0008 -0.0067 124  VAL A CG1   
950  C CG2   . VAL A 124 ? 0.2354 0.2345 0.2183 -0.0019 0.0016  0.0024  124  VAL A CG2   
951  O OXT   . VAL A 124 ? 0.2655 0.2004 0.2501 -0.0087 -0.0039 0.0078  124  VAL A OXT   
952  N N     . LYS B 1   ? 0.2988 0.2912 0.3078 0.0070  -0.0029 -0.0043 1    LYS B N     
953  C CA    . LYS B 1   ? 0.2981 0.2743 0.2959 0.0043  -0.0042 -0.0030 1    LYS B CA    
954  C C     . LYS B 1   ? 0.2698 0.2479 0.2738 0.0098  -0.0077 0.0030  1    LYS B C     
955  O O     . LYS B 1   ? 0.2745 0.2405 0.2860 0.0174  -0.0122 -0.0011 1    LYS B O     
956  C CB    . LYS B 1   ? 0.3060 0.2926 0.3063 0.0042  -0.0017 -0.0009 1    LYS B CB    
957  C CG    . LYS B 1   ? 0.3284 0.3112 0.3161 0.0028  -0.0013 0.0013  1    LYS B CG    
958  C CD    . LYS B 1   ? 0.3426 0.3448 0.3493 -0.0004 0.0011  -0.0001 1    LYS B CD    
959  C CE    . LYS B 1   ? 0.3436 0.3412 0.3468 -0.0031 0.0034  0.0020  1    LYS B CE    
960  N NZ    . LYS B 1   ? 0.3314 0.3238 0.3548 0.0030  -0.0015 -0.0039 1    LYS B NZ    
961  N N     . GLU B 2   ? 0.2393 0.2113 0.2398 0.0070  -0.0113 -0.0086 2    GLU B N     
962  C CA    . GLU B 2   ? 0.2062 0.1841 0.2153 0.0092  -0.0042 0.0034  2    GLU B CA    
963  C C     . GLU B 2   ? 0.1955 0.1668 0.2096 0.0155  -0.0107 0.0001  2    GLU B C     
964  O O     . GLU B 2   ? 0.2317 0.1650 0.2361 0.0057  -0.0069 -0.0003 2    GLU B O     
965  C CB    . GLU B 2   ? 0.2005 0.1749 0.1907 0.0050  -0.0038 -0.0058 2    GLU B CB    
966  C CG    . GLU B 2   ? 0.1738 0.1599 0.1732 0.0041  -0.0040 0.0022  2    GLU B CG    
967  C CD    . GLU B 2   ? 0.1643 0.1540 0.1620 0.0080  0.0004  -0.0032 2    GLU B CD    
968  O OE1   . GLU B 2   ? 0.1831 0.1646 0.1970 0.0059  -0.0091 -0.0044 2    GLU B OE1   
969  O OE2   . GLU B 2   ? 0.1700 0.1670 0.1743 0.0000  -0.0088 -0.0013 2    GLU B OE2   
970  N N     . THR B 3   ? 0.2081 0.1677 0.2043 0.0120  -0.0072 0.0004  3    THR B N     
971  C CA    . THR B 3   ? 0.2080 0.1662 0.1973 0.0136  -0.0057 0.0074  3    THR B CA    
972  C C     . THR B 3   ? 0.2081 0.1641 0.1896 0.0085  -0.0007 0.0002  3    THR B C     
973  O O     . THR B 3   ? 0.1896 0.1436 0.1683 0.0212  -0.0046 -0.0077 3    THR B O     
974  C CB    . THR B 3   ? 0.2194 0.1771 0.2129 0.0157  -0.0091 0.0079  3    THR B CB    
975  O OG1   . THR B 3   ? 0.2208 0.1608 0.2117 0.0249  -0.0159 0.0030  3    THR B OG1   
976  C CG2   . THR B 3   ? 0.2293 0.1960 0.2301 0.0186  -0.0136 0.0011  3    THR B CG2   
977  N N     . ALA B 4   ? 0.2080 0.1637 0.1812 0.0011  -0.0029 0.0070  4    ALA B N     
978  C CA    . ALA B 4   ? 0.1900 0.1446 0.1661 -0.0078 0.0071  0.0032  4    ALA B CA    
979  C C     . ALA B 4   ? 0.1630 0.1322 0.1454 -0.0037 0.0061  0.0042  4    ALA B C     
980  O O     . ALA B 4   ? 0.1532 0.1320 0.1446 -0.0067 -0.0012 0.0092  4    ALA B O     
981  C CB    . ALA B 4   ? 0.2078 0.1562 0.1766 -0.0011 0.0157  0.0085  4    ALA B CB    
982  N N     . ALA B 5   ? 0.1654 0.1167 0.1385 0.0140  -0.0098 0.0048  5    ALA B N     
983  C CA    . ALA B 5   ? 0.1496 0.1226 0.1338 0.0014  -0.0013 -0.0077 5    ALA B CA    
984  C C     . ALA B 5   ? 0.1152 0.1034 0.1303 0.0070  -0.0003 -0.0035 5    ALA B C     
985  O O     . ALA B 5   ? 0.1206 0.1090 0.1272 0.0050  -0.0053 -0.0009 5    ALA B O     
986  C CB    . ALA B 5   ? 0.1567 0.1303 0.1498 0.0109  -0.0080 0.0031  5    ALA B CB    
987  N N     . ALA B 6   ? 0.1168 0.1187 0.1219 0.0145  -0.0053 -0.0033 6    ALA B N     
988  C CA    . ALA B 6   ? 0.1205 0.1305 0.1272 0.0020  -0.0009 -0.0004 6    ALA B CA    
989  C C     . ALA B 6   ? 0.1194 0.1226 0.1193 -0.0077 0.0013  -0.0035 6    ALA B C     
990  O O     . ALA B 6   ? 0.1141 0.1275 0.1205 -0.0017 0.0007  0.0033  6    ALA B O     
991  C CB    . ALA B 6   ? 0.1222 0.1415 0.1356 0.0128  -0.0062 -0.0031 6    ALA B CB    
992  N N     . LYS B 7   ? 0.1358 0.1175 0.1255 -0.0032 -0.0074 0.0013  7    LYS B N     
993  C CA    . LYS B 7   ? 0.1231 0.1182 0.1266 -0.0093 0.0028  -0.0014 7    LYS B CA    
994  C C     . LYS B 7   ? 0.1163 0.1107 0.1264 -0.0081 0.0044  0.0056  7    LYS B C     
995  O O     . LYS B 7   ? 0.1222 0.1268 0.1247 -0.0097 -0.0013 0.0013  7    LYS B O     
996  C CB    . LYS B 7   ? 0.1488 0.1378 0.1610 -0.0111 0.0001  -0.0036 7    LYS B CB    
997  C CG    . LYS B 7   ? 0.1578 0.1588 0.1773 -0.0205 0.0048  -0.0149 7    LYS B CG    
998  C CD    . LYS B 7   ? 0.2215 0.2046 0.2398 -0.0197 0.0011  0.0035  7    LYS B CD    
999  C CE    . LYS B 7   ? 0.2442 0.2571 0.2841 -0.0097 -0.0036 -0.0056 7    LYS B CE    
1000 N NZ    . LYS B 7   ? 0.2754 0.2786 0.3215 -0.0194 -0.0003 0.0009  7    LYS B NZ    
1001 N N     . PHE B 8   ? 0.1115 0.1181 0.1194 0.0010  0.0054  0.0047  8    PHE B N     
1002 C CA    . PHE B 8   ? 0.0989 0.1193 0.1124 0.0021  0.0076  0.0047  8    PHE B CA    
1003 C C     . PHE B 8   ? 0.1032 0.1220 0.1159 -0.0045 0.0026  0.0048  8    PHE B C     
1004 O O     . PHE B 8   ? 0.1095 0.1184 0.1129 0.0009  -0.0017 0.0069  8    PHE B O     
1005 C CB    . PHE B 8   ? 0.1123 0.1147 0.1128 0.0038  0.0035  0.0082  8    PHE B CB    
1006 C CG    . PHE B 8   ? 0.1093 0.1115 0.1017 0.0104  -0.0060 0.0082  8    PHE B CG    
1007 C CD1   . PHE B 8   ? 0.1222 0.1058 0.1224 0.0062  0.0004  0.0021  8    PHE B CD1   
1008 C CD2   . PHE B 8   ? 0.1152 0.1239 0.1160 0.0044  -0.0142 -0.0006 8    PHE B CD2   
1009 C CE1   . PHE B 8   ? 0.1217 0.1242 0.1309 0.0028  -0.0084 -0.0029 8    PHE B CE1   
1010 C CE2   . PHE B 8   ? 0.1414 0.1306 0.1211 -0.0078 -0.0031 0.0099  8    PHE B CE2   
1011 C CZ    . PHE B 8   ? 0.1331 0.1135 0.1219 0.0079  -0.0056 -0.0040 8    PHE B CZ    
1012 N N     . GLU B 9   ? 0.0975 0.1149 0.1167 0.0023  0.0024  0.0073  9    GLU B N     
1013 C CA    . GLU B 9   ? 0.0997 0.1052 0.1134 -0.0056 0.0078  0.0053  9    GLU B CA    
1014 C C     . GLU B 9   ? 0.0971 0.1190 0.1276 0.0042  0.0061  0.0098  9    GLU B C     
1015 O O     . GLU B 9   ? 0.1127 0.1165 0.1170 -0.0036 0.0024  0.0112  9    GLU B O     
1016 C CB    . GLU B 9   ? 0.1032 0.1321 0.1330 -0.0016 -0.0014 0.0083  9    GLU B CB    
1017 C CG    . GLU B 9   ? 0.1147 0.1143 0.1453 -0.0009 -0.0095 0.0066  9    GLU B CG    
1018 C CD    . GLU B 9   ? 0.1537 0.1882 0.1802 -0.0156 -0.0090 0.0142  9    GLU B CD    
1019 O OE1   . GLU B 9   ? 0.1738 0.2474 0.2071 -0.0186 0.0029  0.0142  9    GLU B OE1   
1020 O OE2   . GLU B 9   ? 0.1320 0.1910 0.1591 -0.0013 0.0048  0.0058  9    GLU B OE2   
1021 N N     . ARG B 10  ? 0.0964 0.1250 0.1162 -0.0056 0.0103  0.0070  10   ARG B N     
1022 C CA    . ARG B 10  ? 0.1151 0.1251 0.1216 0.0001  0.0062  0.0108  10   ARG B CA    
1023 C C     . ARG B 10  ? 0.1213 0.1280 0.1267 -0.0041 0.0068  0.0078  10   ARG B C     
1024 O O     . ARG B 10  ? 0.1211 0.1372 0.1200 -0.0018 -0.0002 0.0019  10   ARG B O     
1025 C CB    . ARG B 10  ? 0.1101 0.1291 0.1251 -0.0037 0.0142  0.0114  10   ARG B CB    
1026 C CG    . ARG B 10  ? 0.1144 0.1405 0.1241 -0.0075 0.0105  0.0068  10   ARG B CG    
1027 C CD    . ARG B 10  ? 0.1168 0.1444 0.1444 -0.0113 -0.0020 0.0024  10   ARG B CD    
1028 N NE    . ARG B 10  ? 0.1309 0.1517 0.1437 -0.0073 0.0045  0.0042  10   ARG B NE    
1029 C CZ    . ARG B 10  ? 0.1554 0.1638 0.1639 -0.0083 -0.0084 -0.0065 10   ARG B CZ    
1030 N NH1   . ARG B 10  ? 0.1374 0.1630 0.1758 -0.0140 0.0046  -0.0002 10   ARG B NH1   
1031 N NH2   . ARG B 10  ? 0.1388 0.1751 0.1608 -0.0225 0.0021  -0.0003 10   ARG B NH2   
1032 N N     . GLN B 11  ? 0.0996 0.1397 0.1296 -0.0028 0.0035  0.0060  11   GLN B N     
1033 C CA    . GLN B 11  ? 0.1214 0.1556 0.1298 -0.0015 0.0024  0.0080  11   GLN B CA    
1034 C C     . GLN B 11  ? 0.1375 0.1627 0.1346 0.0036  -0.0075 0.0069  11   GLN B C     
1035 O O     . GLN B 11  ? 0.1631 0.1854 0.1640 0.0231  -0.0110 -0.0011 11   GLN B O     
1036 C CB    . GLN B 11  ? 0.1324 0.1773 0.1364 -0.0026 0.0077  0.0102  11   GLN B CB    
1037 C CG    . GLN B 11  ? 0.1632 0.1965 0.1546 -0.0146 -0.0055 0.0030  11   GLN B CG    
1038 C CD    . GLN B 11  ? 0.1932 0.2140 0.1943 -0.0247 0.0087  0.0023  11   GLN B CD    
1039 O OE1   . GLN B 11  ? 0.2428 0.2844 0.2352 -0.0454 -0.0213 0.0027  11   GLN B OE1   
1040 N NE2   . GLN B 11  ? 0.1721 0.2259 0.1977 -0.0234 0.0028  0.0082  11   GLN B NE2   
1041 N N     . HIS B 12  ? 0.1341 0.1451 0.1286 0.0042  -0.0148 0.0066  12   HIS B N     
1042 C CA    . HIS B 12  ? 0.1424 0.1492 0.1431 0.0015  -0.0070 0.0093  12   HIS B CA    
1043 C C     . HIS B 12  ? 0.1421 0.1462 0.1410 -0.0043 -0.0073 0.0062  12   HIS B C     
1044 O O     . HIS B 12  ? 0.1574 0.1653 0.1996 0.0002  0.0051  -0.0011 12   HIS B O     
1045 C CB    . HIS B 12  ? 0.1460 0.1395 0.1399 0.0095  -0.0027 0.0131  12   HIS B CB    
1046 C CG    . HIS B 12  ? 0.1469 0.1603 0.1435 0.0092  0.0003  0.0075  12   HIS B CG    
1047 N ND1   . HIS B 12  ? 0.1395 0.1609 0.1370 0.0053  0.0008  0.0123  12   HIS B ND1   
1048 C CD2   . HIS B 12  ? 0.1545 0.1595 0.1414 0.0082  0.0118  0.0063  12   HIS B CD2   
1049 C CE1   . HIS B 12  ? 0.1323 0.1771 0.1612 -0.0004 -0.0092 0.0088  12   HIS B CE1   
1050 N NE2   . HIS B 12  ? 0.1597 0.1533 0.1396 0.0083  0.0110  0.0247  12   HIS B NE2   
1051 N N     . MET B 13  ? 0.1467 0.1544 0.1436 -0.0027 -0.0101 0.0097  13   MET B N     
1052 C CA    . MET B 13  ? 0.1482 0.1513 0.1459 -0.0053 0.0003  0.0075  13   MET B CA    
1053 C C     . MET B 13  ? 0.1679 0.1641 0.1637 -0.0020 0.0075  0.0103  13   MET B C     
1054 O O     . MET B 13  ? 0.1865 0.1777 0.1640 0.0020  0.0002  0.0151  13   MET B O     
1055 C CB    . MET B 13  ? 0.1473 0.1464 0.1436 -0.0058 0.0077  0.0150  13   MET B CB    
1056 C CG    . MET B 13  ? 0.1510 0.1291 0.1400 -0.0019 0.0033  0.0078  13   MET B CG    
1057 S SD    . MET B 13  ? 0.1616 0.1343 0.1537 0.0050  0.0021  0.0079  13   MET B SD    
1058 C CE    . MET B 13  ? 0.1759 0.1500 0.1775 -0.0061 0.0019  0.0015  13   MET B CE    
1059 N N     . ASP B 14  ? 0.1854 0.1725 0.1710 -0.0015 0.0149  0.0223  14   ASP B N     
1060 C CA    . ASP B 14  ? 0.1975 0.1964 0.1833 -0.0027 0.0155  0.0172  14   ASP B CA    
1061 C C     . ASP B 14  ? 0.2099 0.2039 0.2049 0.0003  0.0138  0.0143  14   ASP B C     
1062 O O     . ASP B 14  ? 0.1937 0.1977 0.2149 -0.0057 0.0165  0.0303  14   ASP B O     
1063 C CB    . ASP B 14  ? 0.2085 0.2076 0.1990 0.0050  0.0117  0.0157  14   ASP B CB    
1064 C CG    . ASP B 14  ? 0.2158 0.2294 0.2150 0.0082  0.0081  0.0221  14   ASP B CG    
1065 O OD1   . ASP B 14  ? 0.2350 0.2308 0.2363 0.0130  0.0097  0.0309  14   ASP B OD1   
1066 O OD2   . ASP B 14  ? 0.2618 0.2557 0.2280 -0.0027 -0.0051 0.0462  14   ASP B OD2   
1067 N N     . SER B 15  ? 0.2234 0.2451 0.2331 0.0002  0.0101  0.0121  15   SER B N     
1068 C CA    . SER B 15  ? 0.2709 0.2754 0.2736 -0.0022 0.0013  -0.0001 15   SER B CA    
1069 C C     . SER B 15  ? 0.3186 0.3178 0.3213 -0.0065 0.0070  0.0059  15   SER B C     
1070 O O     . SER B 15  ? 0.3306 0.3453 0.3477 -0.0103 0.0056  0.0112  15   SER B O     
1071 C CB    . SER B 15  ? 0.2595 0.2724 0.2732 -0.0031 0.0031  -0.0012 15   SER B CB    
1072 O OG    . SER B 15  ? 0.2694 0.2757 0.2581 -0.0040 -0.0062 0.0054  15   SER B OG    
1073 N N     . SER B 16  ? 0.3568 0.3591 0.3595 -0.0049 -0.0021 0.0062  16   SER B N     
1074 C CA    . SER B 16  ? 0.3900 0.3881 0.3869 -0.0061 0.0019  0.0054  16   SER B CA    
1075 C C     . SER B 16  ? 0.4127 0.4090 0.4114 -0.0001 -0.0005 0.0020  16   SER B C     
1076 O O     . SER B 16  ? 0.4238 0.4145 0.4232 -0.0023 0.0008  0.0026  16   SER B O     
1077 C CB    . SER B 16  ? 0.3946 0.3897 0.3887 -0.0032 0.0010  0.0031  16   SER B CB    
1078 O OG    . SER B 16  ? 0.4088 0.4124 0.4017 -0.0079 -0.0029 0.0006  16   SER B OG    
1079 N N     . THR B 17  ? 0.4275 0.4316 0.4319 -0.0030 -0.0005 0.0026  17   THR B N     
1080 C CA    . THR B 17  ? 0.4470 0.4474 0.4491 0.0011  0.0002  0.0023  17   THR B CA    
1081 C C     . THR B 17  ? 0.4538 0.4523 0.4530 0.0007  0.0002  0.0008  17   THR B C     
1082 O O     . THR B 17  ? 0.4620 0.4582 0.4601 0.0005  0.0001  0.0045  17   THR B O     
1083 C CB    . THR B 17  ? 0.4514 0.4513 0.4524 -0.0004 -0.0011 0.0004  17   THR B CB    
1084 O OG1   . THR B 17  ? 0.4677 0.4636 0.4699 -0.0023 0.0013  0.0067  17   THR B OG1   
1085 C CG2   . THR B 17  ? 0.4578 0.4594 0.4578 0.0011  0.0005  -0.0019 17   THR B CG2   
1086 N N     . SER B 18  ? 0.4593 0.4561 0.4573 0.0001  0.0006  0.0016  18   SER B N     
1087 C CA    . SER B 18  ? 0.4601 0.4587 0.4586 0.0001  0.0000  0.0004  18   SER B CA    
1088 C C     . SER B 18  ? 0.4600 0.4581 0.4586 -0.0007 0.0003  -0.0001 18   SER B C     
1089 O O     . SER B 18  ? 0.4556 0.4501 0.4525 -0.0030 0.0004  0.0016  18   SER B O     
1090 C CB    . SER B 18  ? 0.4607 0.4604 0.4606 -0.0012 -0.0001 0.0003  18   SER B CB    
1091 O OG    . SER B 18  ? 0.4693 0.4694 0.4644 0.0001  -0.0018 0.0017  18   SER B OG    
1092 N N     . ALA B 19  ? 0.4633 0.4626 0.4612 -0.0003 -0.0006 0.0007  19   ALA B N     
1093 C CA    . ALA B 19  ? 0.4644 0.4642 0.4650 0.0000  0.0000  0.0003  19   ALA B CA    
1094 C C     . ALA B 19  ? 0.4681 0.4678 0.4678 0.0002  -0.0010 -0.0003 19   ALA B C     
1095 O O     . ALA B 19  ? 0.4712 0.4726 0.4725 0.0008  -0.0001 -0.0010 19   ALA B O     
1096 C CB    . ALA B 19  ? 0.4656 0.4653 0.4649 0.0000  0.0000  0.0005  19   ALA B CB    
1097 N N     . ALA B 20  ? 0.4699 0.4712 0.4705 0.0003  -0.0011 0.0003  20   ALA B N     
1098 C CA    . ALA B 20  ? 0.4700 0.4717 0.4707 0.0003  -0.0009 0.0003  20   ALA B CA    
1099 C C     . ALA B 20  ? 0.4697 0.4720 0.4717 0.0007  -0.0010 0.0010  20   ALA B C     
1100 O O     . ALA B 20  ? 0.4756 0.4802 0.4799 0.0019  -0.0011 0.0020  20   ALA B O     
1101 C CB    . ALA B 20  ? 0.4696 0.4715 0.4704 -0.0001 0.0000  0.0004  20   ALA B CB    
1102 N N     . SER B 21  ? 0.4676 0.4694 0.4666 0.0010  -0.0008 0.0001  21   SER B N     
1103 C CA    . SER B 21  ? 0.4623 0.4639 0.4640 0.0007  -0.0003 0.0003  21   SER B CA    
1104 C C     . SER B 21  ? 0.4555 0.4529 0.4540 0.0000  0.0002  -0.0005 21   SER B C     
1105 O O     . SER B 21  ? 0.4603 0.4595 0.4611 0.0018  0.0021  0.0016  21   SER B O     
1106 C CB    . SER B 21  ? 0.4641 0.4651 0.4651 0.0002  0.0009  0.0000  21   SER B CB    
1107 O OG    . SER B 21  ? 0.4786 0.4762 0.4692 -0.0008 0.0001  0.0022  21   SER B OG    
1108 N N     . SER B 22  ? 0.4398 0.4417 0.4418 0.0008  -0.0007 0.0023  22   SER B N     
1109 C CA    . SER B 22  ? 0.4284 0.4268 0.4272 -0.0009 0.0014  0.0017  22   SER B CA    
1110 C C     . SER B 22  ? 0.4088 0.4128 0.4084 0.0007  -0.0020 0.0027  22   SER B C     
1111 O O     . SER B 22  ? 0.4050 0.4073 0.4049 0.0020  -0.0028 0.0042  22   SER B O     
1112 C CB    . SER B 22  ? 0.4323 0.4294 0.4292 -0.0002 0.0019  0.0011  22   SER B CB    
1113 O OG    . SER B 22  ? 0.4415 0.4361 0.4343 0.0047  0.0056  0.0061  22   SER B OG    
1114 N N     . SER B 23  ? 0.3894 0.3889 0.3874 0.0003  0.0006  0.0042  23   SER B N     
1115 C CA    . SER B 23  ? 0.3763 0.3746 0.3730 0.0025  -0.0011 0.0030  23   SER B CA    
1116 C C     . SER B 23  ? 0.3536 0.3613 0.3543 -0.0001 -0.0013 0.0042  23   SER B C     
1117 O O     . SER B 23  ? 0.3489 0.3534 0.3400 0.0044  -0.0062 0.0128  23   SER B O     
1118 C CB    . SER B 23  ? 0.3785 0.3807 0.3732 0.0007  -0.0011 0.0023  23   SER B CB    
1119 O OG    . SER B 23  ? 0.3823 0.3762 0.3702 0.0041  -0.0030 0.0069  23   SER B OG    
1120 N N     . ASN B 24  ? 0.3432 0.3372 0.3321 0.0021  -0.0035 0.0071  24   ASN B N     
1121 C CA    . ASN B 24  ? 0.3231 0.3284 0.3150 0.0027  -0.0029 0.0074  24   ASN B CA    
1122 C C     . ASN B 24  ? 0.3069 0.3028 0.2903 0.0018  0.0006  0.0103  24   ASN B C     
1123 O O     . ASN B 24  ? 0.3045 0.3041 0.2671 0.0096  -0.0043 0.0207  24   ASN B O     
1124 C CB    . ASN B 24  ? 0.3334 0.3373 0.3215 0.0020  -0.0008 0.0082  24   ASN B CB    
1125 C CG    . ASN B 24  ? 0.3549 0.3520 0.3343 0.0029  -0.0022 0.0050  24   ASN B CG    
1126 O OD1   . ASN B 24  ? 0.3779 0.3828 0.3765 -0.0059 -0.0054 0.0071  24   ASN B OD1   
1127 N ND2   . ASN B 24  ? 0.3731 0.3869 0.3729 0.0047  0.0050  0.0009  24   ASN B ND2   
1128 N N     . TYR B 25  ? 0.2801 0.2827 0.2758 0.0063  -0.0032 0.0187  25   TYR B N     
1129 C CA    . TYR B 25  ? 0.2590 0.2676 0.2558 0.0035  0.0027  0.0149  25   TYR B CA    
1130 C C     . TYR B 25  ? 0.2371 0.2556 0.2339 0.0060  0.0022  0.0134  25   TYR B C     
1131 O O     . TYR B 25  ? 0.2500 0.2679 0.2119 0.0149  0.0158  0.0292  25   TYR B O     
1132 C CB    . TYR B 25  ? 0.2555 0.2571 0.2576 0.0058  -0.0044 0.0201  25   TYR B CB    
1133 C CG    . TYR B 25  ? 0.2459 0.2568 0.2322 -0.0021 -0.0016 0.0169  25   TYR B CG    
1134 C CD1   . TYR B 25  ? 0.2609 0.2884 0.2556 -0.0011 -0.0001 0.0243  25   TYR B CD1   
1135 C CD2   . TYR B 25  ? 0.2453 0.2414 0.2263 -0.0058 -0.0043 0.0148  25   TYR B CD2   
1136 C CE1   . TYR B 25  ? 0.2531 0.2803 0.2573 -0.0067 -0.0022 0.0223  25   TYR B CE1   
1137 C CE2   . TYR B 25  ? 0.2286 0.2330 0.2119 -0.0009 0.0009  0.0137  25   TYR B CE2   
1138 C CZ    . TYR B 25  ? 0.2394 0.2533 0.2372 0.0062  0.0000  0.0145  25   TYR B CZ    
1139 O OH    . TYR B 25  ? 0.2365 0.2518 0.2443 -0.0039 -0.0009 0.0243  25   TYR B OH    
1140 N N     . CYS B 26  ? 0.2258 0.2347 0.2115 0.0056  0.0019  0.0179  26   CYS B N     
1141 C CA    . CYS B 26  ? 0.2036 0.2178 0.1996 0.0071  0.0008  0.0117  26   CYS B CA    
1142 C C     . CYS B 26  ? 0.2254 0.2283 0.2074 0.0139  -0.0015 0.0060  26   CYS B C     
1143 O O     . CYS B 26  ? 0.2424 0.2434 0.1956 0.0253  0.0014  0.0142  26   CYS B O     
1144 C CB    . CYS B 26  ? 0.1895 0.2162 0.1851 0.0068  -0.0029 0.0124  26   CYS B CB    
1145 S SG    . CYS B 26  ? 0.1789 0.2103 0.1742 0.0035  -0.0018 0.0290  26   CYS B SG    
1146 N N     . ASN B 27  ? 0.2323 0.2387 0.2097 0.0133  -0.0035 0.0085  27   ASN B N     
1147 C CA    . ASN B 27  ? 0.2455 0.2488 0.2170 0.0084  -0.0032 0.0077  27   ASN B CA    
1148 C C     . ASN B 27  ? 0.2588 0.2621 0.2116 0.0110  -0.0006 0.0042  27   ASN B C     
1149 O O     . ASN B 27  ? 0.2827 0.2776 0.2269 0.0170  0.0014  0.0145  27   ASN B O     
1150 C CB    . ASN B 27  ? 0.2414 0.2522 0.2118 0.0116  -0.0004 0.0098  27   ASN B CB    
1151 C CG    . ASN B 27  ? 0.2284 0.2533 0.2257 0.0113  -0.0083 0.0145  27   ASN B CG    
1152 O OD1   . ASN B 27  ? 0.2450 0.2770 0.2185 0.0085  -0.0082 0.0141  27   ASN B OD1   
1153 N ND2   . ASN B 27  ? 0.2748 0.2674 0.2663 0.0150  -0.0106 0.0238  27   ASN B ND2   
1154 N N     . GLN B 28  ? 0.2684 0.2692 0.2285 0.0131  -0.0044 0.0110  28   GLN B N     
1155 C CA    . GLN B 28  ? 0.2781 0.2862 0.2615 0.0076  0.0025  0.0083  28   GLN B CA    
1156 C C     . GLN B 28  ? 0.2780 0.2840 0.2545 0.0076  0.0026  0.0088  28   GLN B C     
1157 O O     . GLN B 28  ? 0.2625 0.2971 0.2357 0.0101  0.0082  0.0134  28   GLN B O     
1158 C CB    . GLN B 28  ? 0.2907 0.2929 0.2759 0.0036  0.0004  0.0077  28   GLN B CB    
1159 C CG    . GLN B 28  ? 0.3193 0.3427 0.3249 0.0079  -0.0005 -0.0010 28   GLN B CG    
1160 C CD    . GLN B 28  ? 0.3759 0.3759 0.3802 -0.0046 0.0008  0.0056  28   GLN B CD    
1161 O OE1   . GLN B 28  ? 0.4310 0.4106 0.4326 0.0010  -0.0001 -0.0086 28   GLN B OE1   
1162 N NE2   . GLN B 28  ? 0.3989 0.4080 0.3944 0.0000  0.0089  0.0027  28   GLN B NE2   
1163 N N     . MET B 29  ? 0.2758 0.2876 0.2587 0.0128  0.0061  0.0077  29   MET B N     
1164 C CA    . MET B 29  ? 0.2667 0.2765 0.2595 0.0092  0.0000  0.0057  29   MET B CA    
1165 C C     . MET B 29  ? 0.2481 0.2637 0.2310 0.0152  0.0031  0.0020  29   MET B C     
1166 O O     . MET B 29  ? 0.2368 0.2662 0.2115 0.0273  0.0041  0.0110  29   MET B O     
1167 C CB    . MET B 29  ? 0.2783 0.2912 0.2651 0.0145  0.0005  0.0036  29   MET B CB    
1168 C CG    . MET B 29  ? 0.3026 0.3077 0.2941 0.0099  -0.0015 0.0028  29   MET B CG    
1169 S SD    . MET B 29  ? 0.3234 0.3580 0.3041 0.0458  0.0236  0.0230  29   MET B SD    
1170 C CE    . MET B 29  ? 0.3256 0.3467 0.3152 0.0080  0.0007  0.0054  29   MET B CE    
1171 N N     . MET B 30  ? 0.2409 0.2582 0.2079 0.0165  0.0016  0.0023  30   MET B N     
1172 C CA    . MET B 30  ? 0.2309 0.2520 0.2150 0.0147  0.0058  -0.0023 30   MET B CA    
1173 C C     . MET B 30  ? 0.2461 0.2559 0.2042 0.0132  0.0133  -0.0013 30   MET B C     
1174 O O     . MET B 30  ? 0.2604 0.2832 0.1992 0.0346  0.0200  0.0104  30   MET B O     
1175 C CB    . MET B 30  ? 0.2297 0.2425 0.1905 0.0143  0.0128  0.0022  30   MET B CB    
1176 C CG    . MET B 30  ? 0.1864 0.2287 0.1769 0.0178  0.0048  0.0052  30   MET B CG    
1177 S SD    . MET B 30  ? 0.1849 0.2285 0.1532 0.0300  0.0006  0.0085  30   MET B SD    
1178 C CE    . MET B 30  ? 0.1664 0.2106 0.1710 0.0294  0.0019  -0.0060 30   MET B CE    
1179 N N     . LYS B 31  ? 0.2410 0.2598 0.2079 0.0130  0.0083  0.0076  31   LYS B N     
1180 C CA    . LYS B 31  ? 0.2283 0.2494 0.2186 0.0063  0.0031  0.0029  31   LYS B CA    
1181 C C     . LYS B 31  ? 0.2151 0.2393 0.1824 0.0115  0.0020  0.0077  31   LYS B C     
1182 O O     . LYS B 31  ? 0.2459 0.2596 0.2022 0.0189  0.0008  -0.0038 31   LYS B O     
1183 C CB    . LYS B 31  ? 0.2402 0.2568 0.2325 0.0057  0.0006  0.0069  31   LYS B CB    
1184 C CG    . LYS B 31  ? 0.2726 0.2827 0.2554 0.0042  0.0048  -0.0004 31   LYS B CG    
1185 C CD    . LYS B 31  ? 0.3044 0.3102 0.2814 0.0020  -0.0036 0.0089  31   LYS B CD    
1186 C CE    . LYS B 31  ? 0.3326 0.3304 0.3281 0.0032  0.0028  -0.0068 31   LYS B CE    
1187 N NZ    . LYS B 31  ? 0.3748 0.3676 0.3473 0.0007  -0.0050 0.0034  31   LYS B NZ    
1188 N N     . SER B 32  ? 0.2190 0.2467 0.2089 0.0135  0.0088  0.0100  32   SER B N     
1189 C CA    . SER B 32  ? 0.2175 0.2465 0.2156 0.0108  0.0051  0.0095  32   SER B CA    
1190 C C     . SER B 32  ? 0.1947 0.2264 0.1935 0.0063  0.0114  0.0082  32   SER B C     
1191 O O     . SER B 32  ? 0.2012 0.2412 0.1914 0.0116  0.0138  0.0171  32   SER B O     
1192 C CB    . SER B 32  ? 0.2281 0.2520 0.2223 0.0088  0.0089  0.0123  32   SER B CB    
1193 O OG    . SER B 32  ? 0.2855 0.2916 0.2463 0.0022  0.0061  0.0158  32   SER B OG    
1194 N N     . ARG B 33  ? 0.1824 0.2137 0.1624 0.0115  0.0067  0.0084  33   ARG B N     
1195 C CA    . ARG B 33  ? 0.1633 0.1935 0.1528 0.0137  0.0076  0.0026  33   ARG B CA    
1196 C C     . ARG B 33  ? 0.1564 0.2019 0.1656 0.0130  0.0018  -0.0005 33   ARG B C     
1197 O O     . ARG B 33  ? 0.1421 0.1834 0.1595 -0.0023 0.0091  0.0011  33   ARG B O     
1198 C CB    . ARG B 33  ? 0.1573 0.1990 0.1583 0.0106  0.0014  0.0008  33   ARG B CB    
1199 C CG    . ARG B 33  ? 0.1447 0.1992 0.1450 0.0164  0.0086  0.0130  33   ARG B CG    
1200 C CD    . ARG B 33  ? 0.1442 0.1904 0.1633 0.0220  0.0167  0.0088  33   ARG B CD    
1201 N NE    . ARG B 33  ? 0.1400 0.1841 0.1555 0.0034  0.0250  0.0236  33   ARG B NE    
1202 C CZ    . ARG B 33  ? 0.1244 0.1595 0.1655 0.0016  -0.0077 0.0237  33   ARG B CZ    
1203 N NH1   . ARG B 33  ? 0.1353 0.1463 0.1633 -0.0085 0.0051  0.0283  33   ARG B NH1   
1204 N NH2   . ARG B 33  ? 0.1290 0.1685 0.1338 -0.0078 0.0042  0.0271  33   ARG B NH2   
1205 N N     . ASN B 34  ? 0.1835 0.2120 0.1769 0.0128  0.0001  -0.0078 34   ASN B N     
1206 C CA    . ASN B 34  ? 0.1938 0.2204 0.1934 0.0088  0.0062  -0.0055 34   ASN B CA    
1207 C C     . ASN B 34  ? 0.2061 0.2283 0.2041 0.0076  0.0050  -0.0088 34   ASN B C     
1208 O O     . ASN B 34  ? 0.2062 0.2411 0.2572 0.0059  0.0198  -0.0166 34   ASN B O     
1209 C CB    . ASN B 34  ? 0.1993 0.2146 0.1899 0.0059  0.0094  -0.0043 34   ASN B CB    
1210 C CG    . ASN B 34  ? 0.1832 0.2054 0.2071 0.0155  0.0034  -0.0056 34   ASN B CG    
1211 O OD1   . ASN B 34  ? 0.2377 0.2585 0.2244 0.0238  0.0199  -0.0020 34   ASN B OD1   
1212 N ND2   . ASN B 34  ? 0.1849 0.2270 0.2559 0.0072  0.0072  -0.0029 34   ASN B ND2   
1213 N N     . LEU B 35  ? 0.2128 0.2322 0.1980 0.0107  0.0026  -0.0136 35   LEU B N     
1214 C CA    . LEU B 35  ? 0.2119 0.2324 0.2106 0.0030  0.0010  -0.0113 35   LEU B CA    
1215 C C     . LEU B 35  ? 0.2382 0.2601 0.2396 0.0041  -0.0049 -0.0133 35   LEU B C     
1216 O O     . LEU B 35  ? 0.2310 0.2818 0.2412 0.0040  -0.0106 -0.0245 35   LEU B O     
1217 C CB    . LEU B 35  ? 0.2070 0.2296 0.2078 0.0058  -0.0015 -0.0092 35   LEU B CB    
1218 C CG    . LEU B 35  ? 0.1929 0.2261 0.2026 0.0065  0.0016  -0.0170 35   LEU B CG    
1219 C CD1   . LEU B 35  ? 0.1946 0.2095 0.2104 -0.0091 -0.0012 -0.0123 35   LEU B CD1   
1220 C CD2   . LEU B 35  ? 0.2134 0.2204 0.1986 0.0042  -0.0044 -0.0227 35   LEU B CD2   
1221 N N     . THR B 36  ? 0.2656 0.2940 0.2636 0.0085  -0.0001 -0.0113 36   THR B N     
1222 C CA    . THR B 36  ? 0.2953 0.3090 0.2929 0.0051  -0.0062 -0.0075 36   THR B CA    
1223 C C     . THR B 36  ? 0.3205 0.3265 0.3141 0.0050  -0.0001 -0.0097 36   THR B C     
1224 O O     . THR B 36  ? 0.3264 0.3380 0.3208 0.0054  -0.0087 -0.0128 36   THR B O     
1225 C CB    . THR B 36  ? 0.3027 0.3102 0.2945 0.0026  -0.0046 -0.0069 36   THR B CB    
1226 O OG1   . THR B 36  ? 0.2933 0.3029 0.2651 0.0147  -0.0134 -0.0186 36   THR B OG1   
1227 C CG2   . THR B 36  ? 0.3019 0.3129 0.3034 0.0078  -0.0033 -0.0065 36   THR B CG2   
1228 N N     . LYS B 37  ? 0.3420 0.3506 0.3422 0.0034  -0.0037 -0.0049 37   LYS B N     
1229 C CA    . LYS B 37  ? 0.3678 0.3659 0.3641 0.0037  -0.0001 -0.0038 37   LYS B CA    
1230 C C     . LYS B 37  ? 0.3722 0.3718 0.3727 0.0026  0.0006  -0.0013 37   LYS B C     
1231 O O     . LYS B 37  ? 0.3901 0.3866 0.3828 0.0038  -0.0004 -0.0017 37   LYS B O     
1232 C CB    . LYS B 37  ? 0.3736 0.3737 0.3737 0.0016  -0.0023 -0.0015 37   LYS B CB    
1233 C CG    . LYS B 37  ? 0.3834 0.3882 0.3854 0.0022  0.0007  0.0008  37   LYS B CG    
1234 C CD    . LYS B 37  ? 0.4045 0.3962 0.4077 -0.0007 -0.0008 -0.0014 37   LYS B CD    
1235 C CE    . LYS B 37  ? 0.4184 0.4161 0.4111 -0.0009 -0.0009 -0.0011 37   LYS B CE    
1236 N NZ    . LYS B 37  ? 0.4324 0.4238 0.4303 0.0026  -0.0013 -0.0004 37   LYS B NZ    
1237 N N     . ASP B 38  ? 0.3771 0.3744 0.3744 0.0020  -0.0004 -0.0010 38   ASP B N     
1238 C CA    . ASP B 38  ? 0.3779 0.3763 0.3787 0.0013  0.0000  -0.0020 38   ASP B CA    
1239 C C     . ASP B 38  ? 0.3730 0.3644 0.3705 0.0009  -0.0012 -0.0055 38   ASP B C     
1240 O O     . ASP B 38  ? 0.3746 0.3622 0.3715 0.0016  -0.0023 -0.0097 38   ASP B O     
1241 C CB    . ASP B 38  ? 0.3888 0.3826 0.3836 0.0007  -0.0012 -0.0009 38   ASP B CB    
1242 C CG    . ASP B 38  ? 0.4051 0.4104 0.4184 0.0041  0.0018  -0.0007 38   ASP B CG    
1243 O OD1   . ASP B 38  ? 0.4467 0.4496 0.4303 0.0001  0.0021  -0.0061 38   ASP B OD1   
1244 O OD2   . ASP B 38  ? 0.4361 0.4418 0.4407 -0.0018 -0.0096 -0.0042 38   ASP B OD2   
1245 N N     . ARG B 39  ? 0.3563 0.3535 0.3555 0.0037  -0.0014 -0.0048 39   ARG B N     
1246 C CA    . ARG B 39  ? 0.3477 0.3415 0.3436 0.0017  -0.0027 -0.0041 39   ARG B CA    
1247 C C     . ARG B 39  ? 0.3147 0.3173 0.3128 0.0067  -0.0029 -0.0047 39   ARG B C     
1248 O O     . ARG B 39  ? 0.3074 0.3050 0.3088 0.0178  -0.0075 -0.0113 39   ARG B O     
1249 C CB    . ARG B 39  ? 0.3565 0.3519 0.3556 0.0018  0.0001  -0.0021 39   ARG B CB    
1250 C CG    . ARG B 39  ? 0.3823 0.3827 0.3742 0.0020  -0.0056 -0.0036 39   ARG B CG    
1251 C CD    . ARG B 39  ? 0.4160 0.4048 0.4028 -0.0006 0.0000  0.0041  39   ARG B CD    
1252 N NE    . ARG B 39  ? 0.4316 0.4391 0.4384 0.0008  0.0031  -0.0006 39   ARG B NE    
1253 C CZ    . ARG B 39  ? 0.4522 0.4567 0.4528 -0.0020 -0.0034 -0.0022 39   ARG B CZ    
1254 N NH1   . ARG B 39  ? 0.4564 0.4718 0.4618 -0.0002 -0.0003 0.0002  39   ARG B NH1   
1255 N NH2   . ARG B 39  ? 0.4647 0.4615 0.4623 0.0008  0.0017  -0.0021 39   ARG B NH2   
1256 N N     . CYS B 40  ? 0.2978 0.2928 0.2795 0.0035  -0.0060 -0.0076 40   CYS B N     
1257 C CA    . CYS B 40  ? 0.2705 0.2770 0.2498 0.0055  -0.0073 -0.0099 40   CYS B CA    
1258 C C     . CYS B 40  ? 0.2390 0.2444 0.2282 0.0021  -0.0097 -0.0141 40   CYS B C     
1259 O O     . CYS B 40  ? 0.2453 0.2524 0.2181 -0.0081 -0.0137 -0.0276 40   CYS B O     
1260 C CB    . CYS B 40  ? 0.2756 0.2812 0.2435 0.0021  -0.0130 -0.0130 40   CYS B CB    
1261 S SG    . CYS B 40  ? 0.3200 0.3464 0.2395 0.0249  -0.0475 -0.0462 40   CYS B SG    
1262 N N     . LYS B 41  ? 0.2001 0.2172 0.2038 0.0133  -0.0037 -0.0108 41   LYS B N     
1263 C CA    . LYS B 41  ? 0.1798 0.1949 0.1858 0.0086  -0.0049 -0.0059 41   LYS B CA    
1264 C C     . LYS B 41  ? 0.1585 0.1895 0.1695 0.0070  -0.0053 -0.0092 41   LYS B C     
1265 O O     . LYS B 41  ? 0.1679 0.1935 0.1784 0.0107  0.0058  -0.0065 41   LYS B O     
1266 C CB    . LYS B 41  ? 0.1783 0.1929 0.1959 0.0110  -0.0043 -0.0135 41   LYS B CB    
1267 C CG    . LYS B 41  ? 0.1880 0.2232 0.2020 0.0054  -0.0003 -0.0061 41   LYS B CG    
1268 C CD    . LYS B 41  ? 0.2101 0.2290 0.2350 -0.0011 -0.0062 -0.0123 41   LYS B CD    
1269 C CE    . LYS B 41  ? 0.2816 0.2803 0.2584 0.0027  -0.0003 0.0051  41   LYS B CE    
1270 N NZ    . LYS B 41  ? 0.3117 0.3167 0.3216 -0.0080 -0.0056 -0.0027 41   LYS B NZ    
1271 N N     . PRO B 42  ? 0.1607 0.1696 0.1869 0.0035  -0.0029 -0.0086 42   PRO B N     
1272 C CA    . PRO B 42  ? 0.1571 0.1688 0.1736 0.0082  -0.0117 -0.0057 42   PRO B CA    
1273 C C     . PRO B 42  ? 0.1475 0.1641 0.1737 0.0032  -0.0017 0.0006  42   PRO B C     
1274 O O     . PRO B 42  ? 0.1815 0.1745 0.1781 0.0108  -0.0092 0.0049  42   PRO B O     
1275 C CB    . PRO B 42  ? 0.1718 0.1753 0.1878 0.0028  -0.0115 -0.0079 42   PRO B CB    
1276 C CG    . PRO B 42  ? 0.1629 0.1701 0.1815 0.0054  -0.0044 0.0096  42   PRO B CG    
1277 C CD    . PRO B 42  ? 0.1556 0.1707 0.1805 -0.0005 -0.0025 -0.0094 42   PRO B CD    
1278 N N     . VAL B 43  ? 0.1450 0.1537 0.1607 0.0101  -0.0062 0.0018  43   VAL B N     
1279 C CA    . VAL B 43  ? 0.1420 0.1480 0.1670 0.0056  -0.0042 0.0081  43   VAL B CA    
1280 C C     . VAL B 43  ? 0.1363 0.1544 0.1581 0.0024  -0.0011 0.0032  43   VAL B C     
1281 O O     . VAL B 43  ? 0.1495 0.1534 0.1857 0.0084  -0.0002 0.0023  43   VAL B O     
1282 C CB    . VAL B 43  ? 0.1474 0.1601 0.1699 0.0098  -0.0052 -0.0027 43   VAL B CB    
1283 C CG1   . VAL B 43  ? 0.1619 0.1835 0.2013 0.0063  0.0004  -0.0195 43   VAL B CG1   
1284 C CG2   . VAL B 43  ? 0.1525 0.1454 0.1676 0.0010  0.0069  0.0094  43   VAL B CG2   
1285 N N     . ASN B 44  ? 0.1326 0.1359 0.1430 0.0102  -0.0007 0.0112  44   ASN B N     
1286 C CA    . ASN B 44  ? 0.1387 0.1495 0.1393 0.0121  -0.0069 0.0033  44   ASN B CA    
1287 C C     . ASN B 44  ? 0.1491 0.1484 0.1593 0.0069  -0.0103 0.0068  44   ASN B C     
1288 O O     . ASN B 44  ? 0.2019 0.1780 0.2075 0.0031  -0.0255 0.0201  44   ASN B O     
1289 C CB    . ASN B 44  ? 0.1540 0.1573 0.1610 0.0112  0.0058  0.0038  44   ASN B CB    
1290 C CG    . ASN B 44  ? 0.1639 0.2061 0.1523 0.0084  -0.0073 0.0161  44   ASN B CG    
1291 O OD1   . ASN B 44  ? 0.1849 0.2256 0.1917 0.0025  -0.0082 0.0448  44   ASN B OD1   
1292 N ND2   . ASN B 44  ? 0.1234 0.1969 0.1336 0.0029  -0.0042 -0.0037 44   ASN B ND2   
1293 N N     . THR B 45  ? 0.1443 0.1364 0.1443 0.0054  -0.0088 0.0094  45   THR B N     
1294 C CA    . THR B 45  ? 0.1451 0.1369 0.1397 0.0016  -0.0067 0.0098  45   THR B CA    
1295 C C     . THR B 45  ? 0.1451 0.1440 0.1501 0.0013  -0.0060 0.0052  45   THR B C     
1296 O O     . THR B 45  ? 0.1340 0.1433 0.1532 0.0097  -0.0016 0.0153  45   THR B O     
1297 C CB    . THR B 45  ? 0.1518 0.1481 0.1492 -0.0018 -0.0009 0.0130  45   THR B CB    
1298 O OG1   . THR B 45  ? 0.1668 0.2047 0.1921 0.0084  0.0068  -0.0028 45   THR B OG1   
1299 C CG2   . THR B 45  ? 0.1736 0.1470 0.1463 0.0046  0.0019  0.0089  45   THR B CG2   
1300 N N     . PHE B 46  ? 0.1453 0.1450 0.1462 0.0070  -0.0051 0.0100  46   PHE B N     
1301 C CA    . PHE B 46  ? 0.1394 0.1513 0.1554 0.0060  -0.0017 0.0085  46   PHE B CA    
1302 C C     . PHE B 46  ? 0.1458 0.1553 0.1643 0.0021  -0.0028 0.0135  46   PHE B C     
1303 O O     . PHE B 46  ? 0.1567 0.1733 0.1787 0.0141  -0.0155 0.0032  46   PHE B O     
1304 C CB    . PHE B 46  ? 0.1646 0.1686 0.1671 -0.0014 -0.0029 0.0089  46   PHE B CB    
1305 C CG    . PHE B 46  ? 0.1522 0.1879 0.1494 0.0013  -0.0036 0.0066  46   PHE B CG    
1306 C CD1   . PHE B 46  ? 0.1813 0.1969 0.1734 0.0123  -0.0024 0.0099  46   PHE B CD1   
1307 C CD2   . PHE B 46  ? 0.1607 0.1705 0.1426 -0.0025 -0.0104 0.0081  46   PHE B CD2   
1308 C CE1   . PHE B 46  ? 0.1865 0.2192 0.1820 0.0133  0.0034  -0.0076 46   PHE B CE1   
1309 C CE2   . PHE B 46  ? 0.1761 0.1820 0.1565 -0.0069 -0.0086 -0.0004 46   PHE B CE2   
1310 C CZ    . PHE B 46  ? 0.1945 0.2308 0.1801 0.0081  0.0037  -0.0022 46   PHE B CZ    
1311 N N     . VAL B 47  ? 0.1525 0.1672 0.1614 0.0055  -0.0079 0.0109  47   VAL B N     
1312 C CA    . VAL B 47  ? 0.1495 0.1616 0.1613 0.0058  -0.0054 0.0129  47   VAL B CA    
1313 C C     . VAL B 47  ? 0.1535 0.1630 0.1641 0.0066  -0.0011 0.0145  47   VAL B C     
1314 O O     . VAL B 47  ? 0.1572 0.1749 0.1675 0.0047  0.0044  0.0178  47   VAL B O     
1315 C CB    . VAL B 47  ? 0.1402 0.1558 0.1552 0.0065  -0.0052 0.0104  47   VAL B CB    
1316 C CG1   . VAL B 47  ? 0.1255 0.1394 0.1530 -0.0074 -0.0107 0.0236  47   VAL B CG1   
1317 C CG2   . VAL B 47  ? 0.1347 0.1354 0.1663 0.0052  -0.0111 0.0072  47   VAL B CG2   
1318 N N     . HIS B 48  ? 0.1685 0.1640 0.1711 -0.0033 0.0072  0.0124  48   HIS B N     
1319 C CA    . HIS B 48  ? 0.1832 0.1823 0.1842 -0.0058 0.0045  0.0153  48   HIS B CA    
1320 C C     . HIS B 48  ? 0.1997 0.1935 0.2001 -0.0136 0.0006  0.0085  48   HIS B C     
1321 O O     . HIS B 48  ? 0.2213 0.2293 0.2280 -0.0197 0.0165  0.0043  48   HIS B O     
1322 C CB    . HIS B 48  ? 0.1810 0.1787 0.1892 0.0011  0.0095  0.0137  48   HIS B CB    
1323 C CG    . HIS B 48  ? 0.1999 0.1954 0.1910 0.0082  -0.0016 0.0128  48   HIS B CG    
1324 N ND1   . HIS B 48  ? 0.2014 0.2031 0.2114 0.0094  0.0060  0.0088  48   HIS B ND1   
1325 C CD2   . HIS B 48  ? 0.1978 0.1890 0.2001 0.0083  -0.0033 0.0136  48   HIS B CD2   
1326 C CE1   . HIS B 48  ? 0.2152 0.2087 0.2120 0.0021  0.0015  0.0050  48   HIS B CE1   
1327 N NE2   . HIS B 48  ? 0.1930 0.2060 0.2036 0.0001  0.0000  0.0085  48   HIS B NE2   
1328 N N     . GLU B 49  ? 0.1939 0.1822 0.1893 -0.0124 0.0073  0.0084  49   GLU B N     
1329 C CA    . GLU B 49  ? 0.1850 0.1646 0.1888 -0.0079 0.0087  0.0099  49   GLU B CA    
1330 C C     . GLU B 49  ? 0.1843 0.1638 0.1732 -0.0088 0.0058  0.0075  49   GLU B C     
1331 O O     . GLU B 49  ? 0.1898 0.1655 0.2072 -0.0031 0.0096  0.0036  49   GLU B O     
1332 C CB    . GLU B 49  ? 0.1773 0.1674 0.1892 -0.0092 0.0106  0.0095  49   GLU B CB    
1333 C CG    . GLU B 49  ? 0.1570 0.1509 0.1731 -0.0207 0.0113  0.0079  49   GLU B CG    
1334 C CD    . GLU B 49  ? 0.1804 0.1586 0.1812 -0.0108 -0.0091 0.0037  49   GLU B CD    
1335 O OE1   . GLU B 49  ? 0.1780 0.1958 0.2373 -0.0045 -0.0034 0.0071  49   GLU B OE1   
1336 O OE2   . GLU B 49  ? 0.2042 0.1913 0.2445 0.0118  -0.0039 -0.0049 49   GLU B OE2   
1337 N N     . SER B 50  ? 0.1648 0.1462 0.1826 -0.0095 0.0157  0.0098  50   SER B N     
1338 C CA    . SER B 50  ? 0.1621 0.1505 0.1786 -0.0075 0.0092  0.0015  50   SER B CA    
1339 C C     . SER B 50  ? 0.1412 0.1442 0.1779 -0.0085 0.0162  0.0028  50   SER B C     
1340 O O     . SER B 50  ? 0.1514 0.1427 0.1678 -0.0030 0.0194  -0.0007 50   SER B O     
1341 C CB    . SER B 50  ? 0.1525 0.1543 0.1877 -0.0035 0.0095  0.0017  50   SER B CB    
1342 O OG    . SER B 50  ? 0.1701 0.1547 0.1915 -0.0229 0.0158  0.0010  50   SER B OG    
1343 N N     . LEU B 51  ? 0.1401 0.1342 0.1732 -0.0063 0.0206  0.0130  51   LEU B N     
1344 C CA    . LEU B 51  ? 0.1339 0.1233 0.1615 -0.0054 0.0140  0.0023  51   LEU B CA    
1345 C C     . LEU B 51  ? 0.1328 0.1368 0.1671 -0.0052 0.0090  0.0041  51   LEU B C     
1346 O O     . LEU B 51  ? 0.1397 0.1354 0.1561 -0.0007 0.0158  -0.0002 51   LEU B O     
1347 C CB    . LEU B 51  ? 0.1460 0.1427 0.1804 0.0020  0.0166  -0.0038 51   LEU B CB    
1348 C CG    . LEU B 51  ? 0.1448 0.1341 0.1800 0.0016  0.0072  -0.0092 51   LEU B CG    
1349 C CD1   . LEU B 51  ? 0.1585 0.1463 0.1885 -0.0078 0.0047  0.0128  51   LEU B CD1   
1350 C CD2   . LEU B 51  ? 0.1611 0.1573 0.1960 -0.0009 0.0114  -0.0145 51   LEU B CD2   
1351 N N     . ALA B 52  ? 0.1310 0.1449 0.1812 -0.0034 0.0154  -0.0011 52   ALA B N     
1352 C CA    . ALA B 52  ? 0.1367 0.1528 0.1877 -0.0096 0.0092  -0.0056 52   ALA B CA    
1353 C C     . ALA B 52  ? 0.1281 0.1412 0.1797 -0.0132 0.0008  -0.0078 52   ALA B C     
1354 O O     . ALA B 52  ? 0.1364 0.1330 0.1770 -0.0069 0.0014  -0.0097 52   ALA B O     
1355 C CB    . ALA B 52  ? 0.1353 0.1697 0.2021 -0.0151 0.0085  -0.0027 52   ALA B CB    
1356 N N     . ASP B 53  ? 0.1278 0.1226 0.1892 -0.0214 0.0087  0.0028  53   ASP B N     
1357 C CA    . ASP B 53  ? 0.1317 0.1251 0.1627 -0.0127 0.0013  -0.0082 53   ASP B CA    
1358 C C     . ASP B 53  ? 0.1357 0.1088 0.1482 -0.0049 0.0000  0.0021  53   ASP B C     
1359 O O     . ASP B 53  ? 0.1305 0.1177 0.1430 -0.0025 0.0015  0.0011  53   ASP B O     
1360 C CB    . ASP B 53  ? 0.1443 0.1491 0.1735 -0.0102 0.0080  0.0075  53   ASP B CB    
1361 C CG    . ASP B 53  ? 0.1870 0.1645 0.1866 -0.0035 0.0039  0.0127  53   ASP B CG    
1362 O OD1   . ASP B 53  ? 0.1989 0.1615 0.2383 -0.0191 0.0002  -0.0065 53   ASP B OD1   
1363 O OD2   . ASP B 53  ? 0.2362 0.1650 0.2360 -0.0069 0.0060  0.0102  53   ASP B OD2   
1364 N N     . VAL B 54  ? 0.1144 0.1015 0.1468 -0.0238 0.0111  -0.0027 54   VAL B N     
1365 C CA    . VAL B 54  ? 0.1038 0.1092 0.1540 -0.0133 -0.0006 0.0037  54   VAL B CA    
1366 C C     . VAL B 54  ? 0.1072 0.1125 0.1336 -0.0034 -0.0008 -0.0027 54   VAL B C     
1367 O O     . VAL B 54  ? 0.1170 0.1104 0.1280 -0.0004 0.0018  0.0010  54   VAL B O     
1368 C CB    . VAL B 54  ? 0.1200 0.1175 0.1404 -0.0074 0.0050  0.0107  54   VAL B CB    
1369 C CG1   . VAL B 54  ? 0.1348 0.1119 0.1422 -0.0099 -0.0067 0.0089  54   VAL B CG1   
1370 C CG2   . VAL B 54  ? 0.1271 0.1309 0.1630 -0.0035 0.0025  0.0078  54   VAL B CG2   
1371 N N     . GLN B 55  ? 0.1053 0.1176 0.1438 -0.0042 0.0030  -0.0049 55   GLN B N     
1372 C CA    . GLN B 55  ? 0.1213 0.1219 0.1493 -0.0019 -0.0048 -0.0074 55   GLN B CA    
1373 C C     . GLN B 55  ? 0.1199 0.1257 0.1516 -0.0078 -0.0019 -0.0052 55   GLN B C     
1374 O O     . GLN B 55  ? 0.1276 0.1174 0.1411 0.0027  0.0002  -0.0062 55   GLN B O     
1375 C CB    . GLN B 55  ? 0.1314 0.1404 0.1604 0.0005  -0.0015 -0.0043 55   GLN B CB    
1376 C CG    . GLN B 55  ? 0.1321 0.1442 0.1623 -0.0018 0.0000  -0.0119 55   GLN B CG    
1377 C CD    . GLN B 55  ? 0.1474 0.1560 0.2068 0.0000  0.0070  -0.0223 55   GLN B CD    
1378 O OE1   . GLN B 55  ? 0.1658 0.1720 0.1992 0.0126  0.0038  -0.0120 55   GLN B OE1   
1379 N NE2   . GLN B 55  ? 0.1347 0.1868 0.2347 0.0015  0.0040  -0.0562 55   GLN B NE2   
1380 N N     . ALA B 56  ? 0.1218 0.1128 0.1449 -0.0147 0.0026  -0.0085 56   ALA B N     
1381 C CA    . ALA B 56  ? 0.1261 0.1222 0.1437 -0.0090 -0.0001 -0.0065 56   ALA B CA    
1382 C C     . ALA B 56  ? 0.1248 0.1108 0.1323 -0.0077 -0.0049 -0.0026 56   ALA B C     
1383 O O     . ALA B 56  ? 0.1134 0.1124 0.1319 -0.0044 -0.0049 -0.0097 56   ALA B O     
1384 C CB    . ALA B 56  ? 0.1394 0.1078 0.1502 -0.0087 0.0025  -0.0112 56   ALA B CB    
1385 N N     . VAL B 57  ? 0.1229 0.1072 0.1283 -0.0026 0.0000  -0.0028 57   VAL B N     
1386 C CA    . VAL B 57  ? 0.1176 0.0977 0.1316 -0.0022 0.0004  0.0009  57   VAL B CA    
1387 C C     . VAL B 57  ? 0.0985 0.0885 0.1206 -0.0022 -0.0079 -0.0060 57   VAL B C     
1388 O O     . VAL B 57  ? 0.1087 0.0986 0.1146 -0.0006 -0.0060 -0.0023 57   VAL B O     
1389 C CB    . VAL B 57  ? 0.1247 0.0953 0.1408 0.0016  0.0004  0.0009  57   VAL B CB    
1390 C CG1   . VAL B 57  ? 0.1226 0.1201 0.1422 -0.0042 -0.0025 -0.0028 57   VAL B CG1   
1391 C CG2   . VAL B 57  ? 0.1184 0.1012 0.1402 -0.0021 -0.0060 0.0044  57   VAL B CG2   
1392 N N     . CYS B 58  ? 0.1057 0.1028 0.1385 -0.0001 -0.0024 0.0000  58   CYS B N     
1393 C CA    . CYS B 58  ? 0.1333 0.1212 0.1510 0.0080  -0.0032 0.0035  58   CYS B CA    
1394 C C     . CYS B 58  ? 0.1306 0.1186 0.1526 0.0045  -0.0059 0.0000  58   CYS B C     
1395 O O     . CYS B 58  ? 0.1677 0.1402 0.1538 0.0088  -0.0077 0.0034  58   CYS B O     
1396 C CB    . CYS B 58  ? 0.1292 0.1040 0.1528 -0.0006 0.0016  0.0040  58   CYS B CB    
1397 S SG    . CYS B 58  ? 0.1524 0.1013 0.1461 0.0013  0.0025  0.0004  58   CYS B SG    
1398 N N     . SER B 59  ? 0.1241 0.1249 0.1546 -0.0035 -0.0192 -0.0121 59   SER B N     
1399 C CA    . SER B 59  ? 0.1463 0.1470 0.1658 0.0033  -0.0133 -0.0139 59   SER B CA    
1400 C C     . SER B 59  ? 0.1297 0.1296 0.1502 0.0017  -0.0144 -0.0155 59   SER B C     
1401 O O     . SER B 59  ? 0.1445 0.1273 0.1550 0.0001  -0.0229 -0.0106 59   SER B O     
1402 C CB    . SER B 59  ? 0.1650 0.1876 0.1794 -0.0029 -0.0158 -0.0183 59   SER B CB    
1403 O OG    . SER B 59  ? 0.2166 0.2558 0.2615 0.0137  -0.0095 -0.0163 59   SER B OG    
1404 N N     . GLN B 60  ? 0.1205 0.1021 0.1388 0.0011  -0.0148 -0.0047 60   GLN B N     
1405 C CA    . GLN B 60  ? 0.1155 0.0987 0.1335 0.0054  -0.0069 -0.0064 60   GLN B CA    
1406 C C     . GLN B 60  ? 0.1146 0.1050 0.1366 -0.0048 -0.0115 -0.0034 60   GLN B C     
1407 O O     . GLN B 60  ? 0.1276 0.1233 0.1452 -0.0056 -0.0070 0.0050  60   GLN B O     
1408 C CB    . GLN B 60  ? 0.1133 0.1092 0.1453 0.0024  -0.0129 -0.0034 60   GLN B CB    
1409 C CG    . GLN B 60  ? 0.1060 0.0988 0.1370 0.0013  -0.0076 -0.0108 60   GLN B CG    
1410 C CD    . GLN B 60  ? 0.1090 0.0940 0.1434 -0.0043 -0.0078 -0.0095 60   GLN B CD    
1411 O OE1   . GLN B 60  ? 0.1111 0.1262 0.1462 -0.0125 -0.0079 0.0030  60   GLN B OE1   
1412 N NE2   . GLN B 60  ? 0.1071 0.0923 0.1569 -0.0074 -0.0051 0.0054  60   GLN B NE2   
1413 N N     . LYS B 61  ? 0.1156 0.1161 0.1308 0.0001  -0.0065 0.0022  61   LYS B N     
1414 C CA    . LYS B 61  ? 0.1220 0.1182 0.1252 -0.0010 -0.0040 -0.0063 61   LYS B CA    
1415 C C     . LYS B 61  ? 0.1197 0.1180 0.1366 -0.0054 -0.0101 -0.0017 61   LYS B C     
1416 O O     . LYS B 61  ? 0.1252 0.1129 0.1252 -0.0100 -0.0082 -0.0047 61   LYS B O     
1417 C CB    . LYS B 61  ? 0.1346 0.1260 0.1461 0.0001  -0.0041 -0.0053 61   LYS B CB    
1418 C CG    . LYS B 61  ? 0.1491 0.1629 0.1760 -0.0100 0.0007  0.0015  61   LYS B CG    
1419 C CD    . LYS B 61  ? 0.2290 0.2494 0.2629 0.0195  0.0011  0.0040  61   LYS B CD    
1420 C CE    . LYS B 61  ? 0.2832 0.2923 0.2916 -0.0069 0.0093  0.0011  61   LYS B CE    
1421 N NZ    . LYS B 61  ? 0.3300 0.3332 0.3481 0.0085  -0.0003 -0.0014 61   LYS B NZ    
1422 N N     . ASN B 62  ? 0.1237 0.1238 0.1263 -0.0105 -0.0069 -0.0076 62   ASN B N     
1423 C CA    . ASN B 62  ? 0.1329 0.1349 0.1325 -0.0060 -0.0025 -0.0010 62   ASN B CA    
1424 C C     . ASN B 62  ? 0.1338 0.1314 0.1342 -0.0068 -0.0037 -0.0003 62   ASN B C     
1425 O O     . ASN B 62  ? 0.1448 0.1459 0.1515 -0.0114 0.0031  -0.0024 62   ASN B O     
1426 C CB    . ASN B 62  ? 0.1440 0.1386 0.1432 -0.0053 -0.0106 0.0021  62   ASN B CB    
1427 C CG    . ASN B 62  ? 0.1455 0.1451 0.1585 -0.0223 -0.0082 0.0162  62   ASN B CG    
1428 O OD1   . ASN B 62  ? 0.1937 0.1761 0.1775 -0.0263 -0.0036 0.0153  62   ASN B OD1   
1429 N ND2   . ASN B 62  ? 0.1653 0.1308 0.1807 -0.0025 -0.0251 0.0233  62   ASN B ND2   
1430 N N     . VAL B 63  ? 0.1140 0.1291 0.1376 -0.0168 0.0004  -0.0051 63   VAL B N     
1431 C CA    . VAL B 63  ? 0.1322 0.1381 0.1443 -0.0151 -0.0014 0.0010  63   VAL B CA    
1432 C C     . VAL B 63  ? 0.1230 0.1292 0.1446 -0.0171 0.0005  0.0045  63   VAL B C     
1433 O O     . VAL B 63  ? 0.1383 0.1410 0.1633 -0.0131 -0.0021 0.0006  63   VAL B O     
1434 C CB    . VAL B 63  ? 0.1199 0.1460 0.1644 -0.0180 -0.0058 0.0048  63   VAL B CB    
1435 C CG1   . VAL B 63  ? 0.1312 0.1424 0.1595 -0.0106 -0.0067 0.0116  63   VAL B CG1   
1436 C CG2   . VAL B 63  ? 0.1432 0.1505 0.1672 -0.0122 -0.0093 -0.0002 63   VAL B CG2   
1437 N N     . ALA B 64  ? 0.1439 0.1361 0.1629 -0.0181 -0.0002 0.0103  64   ALA B N     
1438 C CA    . ALA B 64  ? 0.1447 0.1326 0.1596 -0.0110 -0.0053 0.0090  64   ALA B CA    
1439 C C     . ALA B 64  ? 0.1353 0.1407 0.1599 -0.0035 -0.0063 0.0143  64   ALA B C     
1440 O O     . ALA B 64  ? 0.1477 0.1283 0.1636 -0.0095 -0.0109 0.0012  64   ALA B O     
1441 C CB    . ALA B 64  ? 0.1481 0.1412 0.1673 -0.0111 -0.0014 0.0124  64   ALA B CB    
1442 N N     . CYS B 65  ? 0.1497 0.1358 0.1665 -0.0115 -0.0089 0.0050  65   CYS B N     
1443 C CA    . CYS B 65  ? 0.1457 0.1347 0.1699 -0.0147 -0.0029 0.0075  65   CYS B CA    
1444 C C     . CYS B 65  ? 0.1419 0.1543 0.1642 -0.0092 -0.0008 0.0019  65   CYS B C     
1445 O O     . CYS B 65  ? 0.1577 0.1513 0.1868 -0.0166 0.0005  0.0110  65   CYS B O     
1446 C CB    . CYS B 65  ? 0.1403 0.1428 0.1733 -0.0174 -0.0026 0.0047  65   CYS B CB    
1447 S SG    . CYS B 65  ? 0.1629 0.1409 0.2329 -0.0176 -0.0172 0.0060  65   CYS B SG    
1448 N N     . LYS B 66  ? 0.1471 0.1438 0.1766 -0.0152 -0.0056 0.0038  66   LYS B N     
1449 C CA    . LYS B 66  ? 0.1506 0.1494 0.1811 -0.0110 -0.0028 0.0046  66   LYS B CA    
1450 C C     . LYS B 66  ? 0.1533 0.1550 0.1825 -0.0120 0.0057  0.0078  66   LYS B C     
1451 O O     . LYS B 66  ? 0.1562 0.1708 0.1959 -0.0179 -0.0028 0.0152  66   LYS B O     
1452 C CB    . LYS B 66  ? 0.1637 0.1722 0.1897 -0.0199 0.0001  0.0046  66   LYS B CB    
1453 C CG    . LYS B 66  ? 0.1844 0.1985 0.2194 -0.0168 -0.0054 0.0026  66   LYS B CG    
1454 C CD    . LYS B 66  ? 0.2565 0.2359 0.2358 -0.0050 -0.0053 0.0052  66   LYS B CD    
1455 C CE    . LYS B 66  ? 0.2697 0.2770 0.2866 -0.0005 -0.0039 -0.0026 66   LYS B CE    
1456 N NZ    . LYS B 66  ? 0.3163 0.3199 0.2989 -0.0005 -0.0104 0.0015  66   LYS B NZ    
1457 N N     . ASN B 67  ? 0.1562 0.1315 0.1914 -0.0209 0.0004  0.0026  67   ASN B N     
1458 C CA    . ASN B 67  ? 0.1776 0.1520 0.2023 -0.0130 -0.0004 0.0034  67   ASN B CA    
1459 C C     . ASN B 67  ? 0.1663 0.1608 0.2027 -0.0076 0.0048  0.0046  67   ASN B C     
1460 O O     . ASN B 67  ? 0.1940 0.1703 0.2213 -0.0001 0.0006  0.0171  67   ASN B O     
1461 C CB    . ASN B 67  ? 0.1929 0.1569 0.2138 -0.0144 0.0026  0.0018  67   ASN B CB    
1462 C CG    . ASN B 67  ? 0.1907 0.1506 0.2047 -0.0023 0.0006  0.0112  67   ASN B CG    
1463 O OD1   . ASN B 67  ? 0.1791 0.1687 0.2036 -0.0034 0.0055  0.0105  67   ASN B OD1   
1464 N ND2   . ASN B 67  ? 0.2047 0.2038 0.2376 0.0119  0.0050  0.0051  67   ASN B ND2   
1465 N N     . GLY B 68  ? 0.1618 0.1681 0.1911 -0.0088 -0.0021 0.0086  68   GLY B N     
1466 C CA    . GLY B 68  ? 0.1639 0.1672 0.1844 -0.0028 0.0018  0.0057  68   GLY B CA    
1467 C C     . GLY B 68  ? 0.1783 0.1713 0.1984 -0.0037 -0.0018 0.0071  68   GLY B C     
1468 O O     . GLY B 68  ? 0.1745 0.2053 0.2053 0.0045  0.0078  0.0109  68   GLY B O     
1469 N N     . GLN B 69  ? 0.1675 0.1593 0.2013 -0.0060 -0.0027 0.0072  69   GLN B N     
1470 C CA    . GLN B 69  ? 0.1664 0.1606 0.1936 -0.0055 -0.0057 0.0040  69   GLN B CA    
1471 C C     . GLN B 69  ? 0.1554 0.1465 0.1800 -0.0053 0.0019  0.0126  69   GLN B C     
1472 O O     . GLN B 69  ? 0.1699 0.1648 0.2009 -0.0020 -0.0055 0.0149  69   GLN B O     
1473 C CB    . GLN B 69  ? 0.1662 0.1639 0.2071 0.0009  -0.0048 0.0016  69   GLN B CB    
1474 C CG    . GLN B 69  ? 0.2271 0.1934 0.2545 -0.0022 0.0037  -0.0141 69   GLN B CG    
1475 C CD    . GLN B 69  ? 0.3063 0.2694 0.3012 0.0079  0.0007  0.0072  69   GLN B CD    
1476 O OE1   . GLN B 69  ? 0.3484 0.3375 0.3421 -0.0045 -0.0121 -0.0002 69   GLN B OE1   
1477 N NE2   . GLN B 69  ? 0.3246 0.3243 0.3489 -0.0038 0.0153  0.0058  69   GLN B NE2   
1478 N N     . THR B 70  ? 0.1632 0.1370 0.1592 -0.0028 0.0058  0.0186  70   THR B N     
1479 C CA    . THR B 70  ? 0.1667 0.1572 0.1670 -0.0049 0.0073  0.0026  70   THR B CA    
1480 C C     . THR B 70  ? 0.1663 0.1454 0.1663 -0.0113 0.0122  0.0055  70   THR B C     
1481 O O     . THR B 70  ? 0.2030 0.1636 0.1869 -0.0139 0.0214  -0.0109 70   THR B O     
1482 C CB    . THR B 70  ? 0.1893 0.1827 0.1749 0.0034  0.0038  0.0022  70   THR B CB    
1483 O OG1   . THR B 70  ? 0.2278 0.2087 0.1891 0.0024  -0.0028 0.0112  70   THR B OG1   
1484 C CG2   . THR B 70  ? 0.2113 0.2104 0.2106 -0.0070 0.0044  -0.0020 70   THR B CG2   
1485 N N     . ASN B 71  ? 0.1415 0.1264 0.1336 -0.0074 0.0020  0.0138  71   ASN B N     
1486 C CA    . ASN B 71  ? 0.1275 0.1232 0.1373 -0.0084 -0.0070 0.0094  71   ASN B CA    
1487 C C     . ASN B 71  ? 0.1141 0.1079 0.1350 -0.0010 -0.0055 0.0065  71   ASN B C     
1488 O O     . ASN B 71  ? 0.1335 0.1135 0.1357 -0.0030 0.0013  0.0060  71   ASN B O     
1489 C CB    . ASN B 71  ? 0.1266 0.1292 0.1427 -0.0029 -0.0012 0.0165  71   ASN B CB    
1490 C CG    . ASN B 71  ? 0.1231 0.0986 0.1600 0.0036  0.0070  0.0068  71   ASN B CG    
1491 O OD1   . ASN B 71  ? 0.1416 0.1351 0.1627 -0.0098 0.0061  -0.0006 71   ASN B OD1   
1492 N ND2   . ASN B 71  ? 0.1455 0.1090 0.1445 -0.0046 -0.0039 0.0155  71   ASN B ND2   
1493 N N     . CYS B 72  ? 0.1134 0.0924 0.1429 -0.0019 -0.0025 0.0130  72   CYS B N     
1494 C CA    . CYS B 72  ? 0.1073 0.0978 0.1255 -0.0099 -0.0060 0.0009  72   CYS B CA    
1495 C C     . CYS B 72  ? 0.1103 0.1088 0.1317 -0.0085 0.0030  -0.0035 72   CYS B C     
1496 O O     . CYS B 72  ? 0.1258 0.1107 0.1358 -0.0049 -0.0046 0.0007  72   CYS B O     
1497 C CB    . CYS B 72  ? 0.1188 0.1044 0.1466 -0.0212 -0.0017 -0.0058 72   CYS B CB    
1498 S SG    . CYS B 72  ? 0.1421 0.1311 0.1847 -0.0124 -0.0035 -0.0129 72   CYS B SG    
1499 N N     . TYR B 73  ? 0.1230 0.1076 0.1337 -0.0092 -0.0052 0.0078  73   TYR B N     
1500 C CA    . TYR B 73  ? 0.1212 0.1043 0.1285 -0.0062 -0.0005 0.0061  73   TYR B CA    
1501 C C     . TYR B 73  ? 0.1244 0.1043 0.1349 -0.0012 -0.0005 0.0029  73   TYR B C     
1502 O O     . TYR B 73  ? 0.1231 0.1140 0.1292 0.0005  -0.0092 -0.0021 73   TYR B O     
1503 C CB    . TYR B 73  ? 0.1334 0.1232 0.1470 -0.0067 -0.0004 0.0080  73   TYR B CB    
1504 C CG    . TYR B 73  ? 0.1260 0.1307 0.1441 -0.0111 -0.0028 0.0144  73   TYR B CG    
1505 C CD1   . TYR B 73  ? 0.1370 0.1476 0.1519 -0.0077 0.0005  0.0164  73   TYR B CD1   
1506 C CD2   . TYR B 73  ? 0.1395 0.1498 0.1717 -0.0132 -0.0108 0.0083  73   TYR B CD2   
1507 C CE1   . TYR B 73  ? 0.1483 0.1457 0.1876 -0.0018 -0.0054 0.0186  73   TYR B CE1   
1508 C CE2   . TYR B 73  ? 0.1395 0.1719 0.1341 -0.0116 0.0036  0.0095  73   TYR B CE2   
1509 C CZ    . TYR B 73  ? 0.1636 0.1621 0.1708 0.0019  -0.0093 0.0332  73   TYR B CZ    
1510 O OH    . TYR B 73  ? 0.1946 0.2085 0.2226 -0.0047 -0.0225 0.0472  73   TYR B OH    
1511 N N     . GLN B 74  ? 0.1083 0.0973 0.1268 -0.0007 -0.0098 0.0040  74   GLN B N     
1512 C CA    . GLN B 74  ? 0.1052 0.0967 0.1292 -0.0077 -0.0117 -0.0004 74   GLN B CA    
1513 C C     . GLN B 74  ? 0.1002 0.0908 0.1284 -0.0019 -0.0061 -0.0079 74   GLN B C     
1514 O O     . GLN B 74  ? 0.1226 0.1175 0.1356 -0.0098 -0.0071 -0.0051 74   GLN B O     
1515 C CB    . GLN B 74  ? 0.1202 0.1172 0.1349 -0.0050 -0.0046 -0.0041 74   GLN B CB    
1516 C CG    . GLN B 74  ? 0.1589 0.1157 0.1671 -0.0027 -0.0091 -0.0161 74   GLN B CG    
1517 C CD    . GLN B 74  ? 0.2372 0.2736 0.2562 0.0115  0.0106  -0.0059 74   GLN B CD    
1518 O OE1   . GLN B 74  ? 0.3039 0.3255 0.3356 -0.0138 -0.0018 -0.0134 74   GLN B OE1   
1519 N NE2   . GLN B 74  ? 0.1537 0.1549 0.2155 -0.0030 -0.0061 -0.0050 74   GLN B NE2   
1520 N N     . SER B 75  ? 0.1094 0.0907 0.1310 -0.0113 -0.0132 -0.0066 75   SER B N     
1521 C CA    . SER B 75  ? 0.1037 0.0976 0.1378 -0.0071 -0.0057 -0.0028 75   SER B CA    
1522 C C     . SER B 75  ? 0.1056 0.0909 0.1326 0.0054  -0.0085 0.0002  75   SER B C     
1523 O O     . SER B 75  ? 0.1090 0.1113 0.1425 -0.0044 -0.0065 -0.0019 75   SER B O     
1524 C CB    . SER B 75  ? 0.1079 0.1001 0.1430 -0.0052 -0.0104 -0.0009 75   SER B CB    
1525 O OG    . SER B 75  ? 0.1163 0.1116 0.1391 -0.0077 -0.0084 0.0037  75   SER B OG    
1526 N N     . TYR B 76  ? 0.1023 0.0945 0.1356 -0.0054 -0.0078 -0.0060 76   TYR B N     
1527 C CA    . TYR B 76  ? 0.1121 0.0941 0.1338 -0.0055 -0.0069 -0.0043 76   TYR B CA    
1528 C C     . TYR B 76  ? 0.1105 0.1005 0.1373 0.0004  -0.0102 -0.0094 76   TYR B C     
1529 O O     . TYR B 76  ? 0.1151 0.1103 0.1428 0.0024  -0.0088 -0.0098 76   TYR B O     
1530 C CB    . TYR B 76  ? 0.1113 0.0877 0.1328 -0.0059 -0.0059 -0.0067 76   TYR B CB    
1531 C CG    . TYR B 76  ? 0.1070 0.0907 0.1398 0.0068  -0.0027 -0.0102 76   TYR B CG    
1532 C CD1   . TYR B 76  ? 0.1090 0.1073 0.1393 -0.0068 -0.0094 -0.0160 76   TYR B CD1   
1533 C CD2   . TYR B 76  ? 0.1060 0.1145 0.1397 0.0017  -0.0057 -0.0079 76   TYR B CD2   
1534 C CE1   . TYR B 76  ? 0.1313 0.1097 0.1416 -0.0104 -0.0018 -0.0153 76   TYR B CE1   
1535 C CE2   . TYR B 76  ? 0.1192 0.1192 0.1340 -0.0004 -0.0080 -0.0079 76   TYR B CE2   
1536 C CZ    . TYR B 76  ? 0.1345 0.1399 0.1373 -0.0004 -0.0036 -0.0035 76   TYR B CZ    
1537 O OH    . TYR B 76  ? 0.1370 0.1182 0.1370 -0.0046 -0.0038 -0.0024 76   TYR B OH    
1538 N N     . SER B 77  ? 0.1238 0.1063 0.1405 0.0091  -0.0070 -0.0011 77   SER B N     
1539 C CA    . SER B 77  ? 0.1389 0.1139 0.1398 0.0075  -0.0026 -0.0043 77   SER B CA    
1540 C C     . SER B 77  ? 0.1370 0.1186 0.1527 0.0082  -0.0095 -0.0003 77   SER B C     
1541 O O     . SER B 77  ? 0.1420 0.1133 0.1541 -0.0026 -0.0045 0.0034  77   SER B O     
1542 C CB    . SER B 77  ? 0.1481 0.1210 0.1570 -0.0028 0.0009  0.0078  77   SER B CB    
1543 O OG    . SER B 77  ? 0.1566 0.1265 0.1636 -0.0030 -0.0013 0.0019  77   SER B OG    
1544 N N     . THR B 78  ? 0.1565 0.1034 0.1661 0.0100  -0.0112 0.0051  78   THR B N     
1545 C CA    . THR B 78  ? 0.1515 0.1381 0.1696 0.0055  -0.0119 0.0071  78   THR B CA    
1546 C C     . THR B 78  ? 0.1476 0.1382 0.1657 0.0053  -0.0109 0.0122  78   THR B C     
1547 O O     . THR B 78  ? 0.1683 0.1505 0.2008 0.0065  -0.0042 -0.0010 78   THR B O     
1548 C CB    . THR B 78  ? 0.1723 0.1567 0.1755 0.0076  -0.0118 0.0135  78   THR B CB    
1549 O OG1   . THR B 78  ? 0.1895 0.1647 0.2279 0.0130  -0.0033 0.0130  78   THR B OG1   
1550 C CG2   . THR B 78  ? 0.1878 0.1948 0.2101 0.0114  -0.0113 0.0010  78   THR B CG2   
1551 N N     . MET B 79  ? 0.1380 0.1331 0.1645 -0.0002 -0.0086 0.0133  79   MET B N     
1552 C CA    . MET B 79  ? 0.1390 0.1280 0.1605 0.0027  -0.0059 0.0058  79   MET B CA    
1553 C C     . MET B 79  ? 0.1456 0.1270 0.1669 0.0011  -0.0031 0.0125  79   MET B C     
1554 O O     . MET B 79  ? 0.1506 0.1542 0.1753 0.0035  -0.0045 0.0132  79   MET B O     
1555 C CB    . MET B 79  ? 0.1370 0.1305 0.1639 0.0109  -0.0020 0.0103  79   MET B CB    
1556 C CG    . MET B 79  ? 0.1365 0.1047 0.1459 0.0013  0.0027  0.0089  79   MET B CG    
1557 S SD    . MET B 79  ? 0.1491 0.1224 0.1911 -0.0016 -0.0018 0.0163  79   MET B SD    
1558 C CE    . MET B 79  ? 0.1576 0.1346 0.1879 0.0137  -0.0001 0.0179  79   MET B CE    
1559 N N     . SER B 80  ? 0.1483 0.1502 0.1649 0.0034  -0.0016 0.0099  80   SER B N     
1560 C CA    . SER B 80  ? 0.1646 0.1549 0.1771 0.0020  0.0026  0.0072  80   SER B CA    
1561 C C     . SER B 80  ? 0.1668 0.1492 0.1640 -0.0040 0.0013  0.0073  80   SER B C     
1562 O O     . SER B 80  ? 0.1689 0.1629 0.1721 0.0016  -0.0040 0.0102  80   SER B O     
1563 C CB    . SER B 80  ? 0.1751 0.1715 0.1924 0.0006  0.0083  0.0075  80   SER B CB    
1564 O OG    . SER B 80  ? 0.2189 0.1903 0.2075 -0.0018 0.0004  0.0100  80   SER B OG    
1565 N N     . ILE B 81  ? 0.1615 0.1514 0.1700 0.0048  -0.0041 0.0138  81   ILE B N     
1566 C CA    . ILE B 81  ? 0.1733 0.1628 0.1662 0.0045  -0.0083 0.0086  81   ILE B CA    
1567 C C     . ILE B 81  ? 0.1777 0.1649 0.1705 0.0092  -0.0079 0.0067  81   ILE B C     
1568 O O     . ILE B 81  ? 0.1810 0.1787 0.1823 0.0147  -0.0107 0.0089  81   ILE B O     
1569 C CB    . ILE B 81  ? 0.1700 0.1642 0.1732 0.0115  -0.0061 0.0062  81   ILE B CB    
1570 C CG1   . ILE B 81  ? 0.1652 0.1891 0.1787 -0.0007 -0.0077 0.0094  81   ILE B CG1   
1571 C CG2   . ILE B 81  ? 0.1732 0.1563 0.1740 0.0105  -0.0085 0.0159  81   ILE B CG2   
1572 C CD1   . ILE B 81  ? 0.2082 0.2004 0.2080 -0.0054 0.0011  0.0012  81   ILE B CD1   
1573 N N     . THR B 82  ? 0.1661 0.1643 0.1736 0.0060  -0.0121 0.0128  82   THR B N     
1574 C CA    . THR B 82  ? 0.1781 0.1740 0.1781 0.0066  -0.0128 0.0098  82   THR B CA    
1575 C C     . THR B 82  ? 0.1641 0.1630 0.1641 0.0135  -0.0077 0.0132  82   THR B C     
1576 O O     . THR B 82  ? 0.1613 0.1696 0.1695 0.0165  -0.0105 0.0103  82   THR B O     
1577 C CB    . THR B 82  ? 0.1831 0.1775 0.1907 0.0080  -0.0117 0.0085  82   THR B CB    
1578 O OG1   . THR B 82  ? 0.2107 0.1950 0.2032 -0.0018 0.0050  0.0196  82   THR B OG1   
1579 C CG2   . THR B 82  ? 0.2127 0.2182 0.1947 0.0039  -0.0079 0.0137  82   THR B CG2   
1580 N N     . ASP B 83  ? 0.1674 0.1702 0.1729 0.0094  -0.0019 0.0127  83   ASP B N     
1581 C CA    . ASP B 83  ? 0.1652 0.1685 0.1751 0.0084  -0.0091 0.0100  83   ASP B CA    
1582 C C     . ASP B 83  ? 0.1648 0.1720 0.1745 0.0139  -0.0096 0.0114  83   ASP B C     
1583 O O     . ASP B 83  ? 0.1935 0.1839 0.1896 0.0166  -0.0191 0.0178  83   ASP B O     
1584 C CB    . ASP B 83  ? 0.1829 0.1779 0.1878 0.0092  -0.0034 0.0054  83   ASP B CB    
1585 C CG    . ASP B 83  ? 0.2143 0.2107 0.2169 -0.0079 -0.0092 -0.0077 83   ASP B CG    
1586 O OD1   . ASP B 83  ? 0.2617 0.2527 0.2536 0.0125  -0.0015 -0.0012 83   ASP B OD1   
1587 O OD2   . ASP B 83  ? 0.2605 0.2751 0.2633 0.0091  0.0075  -0.0171 83   ASP B OD2   
1588 N N     . CYS B 84  ? 0.1524 0.1602 0.1687 0.0020  -0.0084 0.0123  84   CYS B N     
1589 C CA    . CYS B 84  ? 0.1448 0.1561 0.1642 0.0044  -0.0075 0.0131  84   CYS B CA    
1590 C C     . CYS B 84  ? 0.1429 0.1627 0.1625 0.0063  -0.0089 0.0081  84   CYS B C     
1591 O O     . CYS B 84  ? 0.1593 0.1551 0.1706 0.0037  -0.0108 0.0092  84   CYS B O     
1592 C CB    . CYS B 84  ? 0.1535 0.1799 0.1665 0.0052  -0.0027 0.0088  84   CYS B CB    
1593 S SG    . CYS B 84  ? 0.1649 0.2167 0.1708 0.0062  -0.0003 0.0189  84   CYS B SG    
1594 N N     . ARG B 85  ? 0.1525 0.1685 0.1687 0.0101  -0.0101 0.0087  85   ARG B N     
1595 C CA    . ARG B 85  ? 0.1495 0.1689 0.1625 0.0110  -0.0025 0.0057  85   ARG B CA    
1596 C C     . ARG B 85  ? 0.1504 0.1782 0.1747 0.0084  -0.0045 0.0075  85   ARG B C     
1597 O O     . ARG B 85  ? 0.1495 0.1937 0.1545 0.0123  -0.0038 0.0058  85   ARG B O     
1598 C CB    . ARG B 85  ? 0.1441 0.1613 0.1568 0.0116  -0.0075 0.0052  85   ARG B CB    
1599 C CG    . ARG B 85  ? 0.1471 0.1502 0.1565 0.0114  -0.0073 0.0074  85   ARG B CG    
1600 C CD    . ARG B 85  ? 0.1530 0.1431 0.1518 0.0157  -0.0040 0.0028  85   ARG B CD    
1601 N NE    . ARG B 85  ? 0.1320 0.1314 0.1504 0.0063  -0.0063 -0.0040 85   ARG B NE    
1602 C CZ    . ARG B 85  ? 0.1309 0.1444 0.1503 0.0167  0.0044  -0.0055 85   ARG B CZ    
1603 N NH1   . ARG B 85  ? 0.1564 0.1344 0.1526 0.0102  -0.0131 -0.0014 85   ARG B NH1   
1604 N NH2   . ARG B 85  ? 0.1315 0.1304 0.1591 0.0218  -0.0040 0.0082  85   ARG B NH2   
1605 N N     . GLU B 86  ? 0.1645 0.1848 0.1651 0.0118  -0.0120 0.0022  86   GLU B N     
1606 C CA    . GLU B 86  ? 0.1850 0.1923 0.1809 0.0081  -0.0061 -0.0017 86   GLU B CA    
1607 C C     . GLU B 86  ? 0.1823 0.2001 0.1855 0.0072  -0.0053 -0.0034 86   GLU B C     
1608 O O     . GLU B 86  ? 0.1649 0.1749 0.1728 0.0063  -0.0051 -0.0014 86   GLU B O     
1609 C CB    . GLU B 86  ? 0.2078 0.1968 0.1960 0.0086  -0.0020 0.0004  86   GLU B CB    
1610 C CG    . GLU B 86  ? 0.2353 0.2313 0.2092 0.0054  -0.0033 -0.0010 86   GLU B CG    
1611 C CD    . GLU B 86  ? 0.2728 0.2481 0.2590 0.0100  0.0011  -0.0062 86   GLU B CD    
1612 O OE1   . GLU B 86  ? 0.3275 0.2789 0.2728 -0.0094 0.0000  -0.0054 86   GLU B OE1   
1613 O OE2   . GLU B 86  ? 0.2921 0.2660 0.2379 0.0214  -0.0147 -0.0137 86   GLU B OE2   
1614 N N     . THR B 87  ? 0.1873 0.2101 0.1892 0.0113  -0.0102 -0.0061 87   THR B N     
1615 C CA    . THR B 87  ? 0.2001 0.2269 0.2133 0.0074  -0.0112 0.0027  87   THR B CA    
1616 C C     . THR B 87  ? 0.2159 0.2271 0.2277 0.0042  -0.0125 0.0003  87   THR B C     
1617 O O     . THR B 87  ? 0.2001 0.2331 0.2335 -0.0015 -0.0123 -0.0038 87   THR B O     
1618 C CB    . THR B 87  ? 0.2201 0.2362 0.2234 0.0083  -0.0140 0.0092  87   THR B CB    
1619 O OG1   . THR B 87  ? 0.2462 0.2640 0.2405 0.0121  -0.0210 0.0005  87   THR B OG1   
1620 C CG2   . THR B 87  ? 0.2341 0.2393 0.2202 0.0084  -0.0095 0.0103  87   THR B CG2   
1621 N N     . GLY B 88  ? 0.2270 0.2447 0.2423 0.0076  -0.0082 0.0012  88   GLY B N     
1622 C CA    . GLY B 88  ? 0.2444 0.2572 0.2594 0.0022  -0.0044 0.0007  88   GLY B CA    
1623 C C     . GLY B 88  ? 0.2514 0.2657 0.2658 0.0000  -0.0072 -0.0005 88   GLY B C     
1624 O O     . GLY B 88  ? 0.2611 0.2772 0.2839 -0.0024 -0.0086 0.0031  88   GLY B O     
1625 N N     . SER B 89  ? 0.2683 0.2819 0.2765 -0.0002 -0.0093 0.0025  89   SER B N     
1626 C CA    . SER B 89  ? 0.2873 0.2936 0.2881 0.0003  -0.0047 0.0000  89   SER B CA    
1627 C C     . SER B 89  ? 0.2895 0.2990 0.2865 -0.0002 -0.0068 -0.0041 89   SER B C     
1628 O O     . SER B 89  ? 0.2907 0.3064 0.2795 -0.0018 -0.0117 -0.0050 89   SER B O     
1629 C CB    . SER B 89  ? 0.2964 0.3035 0.2948 0.0023  -0.0060 0.0017  89   SER B CB    
1630 O OG    . SER B 89  ? 0.3330 0.3447 0.3459 -0.0112 -0.0102 0.0094  89   SER B OG    
1631 N N     . SER B 90  ? 0.2866 0.3005 0.2821 -0.0005 -0.0085 -0.0054 90   SER B N     
1632 C CA    . SER B 90  ? 0.2884 0.3051 0.2867 0.0007  -0.0078 -0.0023 90   SER B CA    
1633 C C     . SER B 90  ? 0.2997 0.3154 0.3037 -0.0001 -0.0058 -0.0008 90   SER B C     
1634 O O     . SER B 90  ? 0.3043 0.3292 0.3091 0.0004  -0.0091 0.0000  90   SER B O     
1635 C CB    . SER B 90  ? 0.2785 0.2952 0.2761 0.0054  -0.0067 -0.0046 90   SER B CB    
1636 O OG    . SER B 90  ? 0.2589 0.3041 0.2557 0.0054  -0.0163 -0.0130 90   SER B OG    
1637 N N     . LYS B 91  ? 0.3201 0.3314 0.3209 -0.0005 -0.0048 -0.0042 91   LYS B N     
1638 C CA    . LYS B 91  ? 0.3364 0.3408 0.3370 -0.0002 -0.0003 -0.0020 91   LYS B CA    
1639 C C     . LYS B 91  ? 0.3387 0.3412 0.3405 -0.0013 -0.0010 -0.0042 91   LYS B C     
1640 O O     . LYS B 91  ? 0.3406 0.3361 0.3437 -0.0080 -0.0011 -0.0055 91   LYS B O     
1641 C CB    . LYS B 91  ? 0.3451 0.3579 0.3491 -0.0008 -0.0015 -0.0018 91   LYS B CB    
1642 C CG    . LYS B 91  ? 0.3746 0.3694 0.3774 0.0006  0.0037  0.0028  91   LYS B CG    
1643 C CD    . LYS B 91  ? 0.4025 0.4087 0.4014 0.0000  -0.0035 -0.0018 91   LYS B CD    
1644 C CE    . LYS B 91  ? 0.4203 0.4148 0.4150 -0.0019 0.0011  0.0003  91   LYS B CE    
1645 N NZ    . LYS B 91  ? 0.4324 0.4391 0.4315 -0.0027 -0.0029 0.0000  91   LYS B NZ    
1646 N N     . TYR B 92  ? 0.3461 0.3449 0.3402 -0.0026 -0.0007 -0.0038 92   TYR B N     
1647 C CA    . TYR B 92  ? 0.3551 0.3540 0.3514 -0.0001 -0.0008 -0.0044 92   TYR B CA    
1648 C C     . TYR B 92  ? 0.3612 0.3585 0.3526 -0.0009 -0.0014 -0.0056 92   TYR B C     
1649 O O     . TYR B 92  ? 0.3695 0.3732 0.3604 -0.0044 -0.0023 -0.0053 92   TYR B O     
1650 C CB    . TYR B 92  ? 0.3585 0.3552 0.3464 -0.0016 -0.0003 -0.0057 92   TYR B CB    
1651 C CG    . TYR B 92  ? 0.3690 0.3686 0.3719 0.0043  0.0012  -0.0035 92   TYR B CG    
1652 C CD1   . TYR B 92  ? 0.3822 0.3813 0.3763 0.0005  -0.0019 -0.0070 92   TYR B CD1   
1653 C CD2   . TYR B 92  ? 0.3864 0.3741 0.3760 0.0008  -0.0013 -0.0061 92   TYR B CD2   
1654 C CE1   . TYR B 92  ? 0.3866 0.3895 0.3904 0.0025  -0.0040 -0.0020 92   TYR B CE1   
1655 C CE2   . TYR B 92  ? 0.3883 0.3877 0.3896 0.0030  0.0012  -0.0044 92   TYR B CE2   
1656 C CZ    . TYR B 92  ? 0.3927 0.3910 0.3893 0.0018  0.0008  -0.0040 92   TYR B CZ    
1657 O OH    . TYR B 92  ? 0.3997 0.4002 0.4048 0.0055  0.0006  -0.0067 92   TYR B OH    
1658 N N     . PRO B 93  ? 0.3645 0.3611 0.3542 0.0003  -0.0005 -0.0059 93   PRO B N     
1659 C CA    . PRO B 93  ? 0.3638 0.3654 0.3576 0.0007  0.0012  -0.0047 93   PRO B CA    
1660 C C     . PRO B 93  ? 0.3625 0.3631 0.3554 0.0002  0.0000  -0.0044 93   PRO B C     
1661 O O     . PRO B 93  ? 0.3728 0.3768 0.3745 -0.0037 0.0008  -0.0039 93   PRO B O     
1662 C CB    . PRO B 93  ? 0.3640 0.3684 0.3592 0.0008  0.0005  -0.0057 93   PRO B CB    
1663 C CG    . PRO B 93  ? 0.3649 0.3632 0.3548 0.0011  0.0008  -0.0027 93   PRO B CG    
1664 C CD    . PRO B 93  ? 0.3674 0.3620 0.3546 -0.0008 -0.0003 -0.0077 93   PRO B CD    
1665 N N     . ASN B 94  ? 0.3576 0.3562 0.3454 0.0006  0.0012  -0.0048 94   ASN B N     
1666 C CA    . ASN B 94  ? 0.3483 0.3505 0.3375 0.0006  0.0004  -0.0047 94   ASN B CA    
1667 C C     . ASN B 94  ? 0.3294 0.3380 0.3207 0.0024  -0.0032 -0.0051 94   ASN B C     
1668 O O     . ASN B 94  ? 0.3305 0.3367 0.3184 0.0018  -0.0064 -0.0144 94   ASN B O     
1669 C CB    . ASN B 94  ? 0.3556 0.3555 0.3495 0.0012  -0.0030 -0.0017 94   ASN B CB    
1670 C CG    . ASN B 94  ? 0.3843 0.3841 0.3638 0.0016  -0.0001 -0.0022 94   ASN B CG    
1671 O OD1   . ASN B 94  ? 0.4201 0.4034 0.4023 -0.0028 -0.0026 -0.0096 94   ASN B OD1   
1672 N ND2   . ASN B 94  ? 0.4024 0.4017 0.3851 -0.0030 0.0052  -0.0009 94   ASN B ND2   
1673 N N     . CYS B 95  ? 0.3104 0.3216 0.3004 0.0037  0.0033  -0.0088 95   CYS B N     
1674 C CA    . CYS B 95  ? 0.2978 0.3077 0.2877 0.0018  0.0012  -0.0063 95   CYS B CA    
1675 C C     . CYS B 95  ? 0.2828 0.2956 0.2719 0.0010  0.0059  -0.0068 95   CYS B C     
1676 O O     . CYS B 95  ? 0.2933 0.3031 0.3022 -0.0081 0.0140  -0.0056 95   CYS B O     
1677 C CB    . CYS B 95  ? 0.2981 0.3235 0.2877 0.0022  0.0000  -0.0096 95   CYS B CB    
1678 S SG    . CYS B 95  ? 0.3381 0.3470 0.2348 0.0235  -0.0208 -0.0349 95   CYS B SG    
1679 N N     . ALA B 96  ? 0.2556 0.2726 0.2395 0.0003  -0.0011 -0.0026 96   ALA B N     
1680 C CA    . ALA B 96  ? 0.2417 0.2604 0.2207 0.0000  0.0014  -0.0039 96   ALA B CA    
1681 C C     . ALA B 96  ? 0.2198 0.2393 0.1983 0.0053  -0.0036 0.0012  96   ALA B C     
1682 O O     . ALA B 96  ? 0.2039 0.2381 0.1975 0.0030  -0.0039 -0.0121 96   ALA B O     
1683 C CB    . ALA B 96  ? 0.2399 0.2516 0.2285 0.0029  0.0004  0.0000  96   ALA B CB    
1684 N N     . TYR B 97  ? 0.2031 0.2236 0.1678 0.0096  -0.0053 0.0088  97   TYR B N     
1685 C CA    . TYR B 97  ? 0.1961 0.2144 0.1785 0.0106  -0.0041 0.0043  97   TYR B CA    
1686 C C     . TYR B 97  ? 0.2031 0.2131 0.1852 0.0060  -0.0042 0.0083  97   TYR B C     
1687 O O     . TYR B 97  ? 0.2338 0.2366 0.1990 0.0118  0.0017  0.0126  97   TYR B O     
1688 C CB    . TYR B 97  ? 0.1902 0.2165 0.1699 0.0111  -0.0029 0.0054  97   TYR B CB    
1689 C CG    . TYR B 97  ? 0.1956 0.2273 0.1815 0.0189  0.0003  0.0094  97   TYR B CG    
1690 C CD1   . TYR B 97  ? 0.1978 0.2196 0.1625 0.0029  -0.0021 -0.0006 97   TYR B CD1   
1691 C CD2   . TYR B 97  ? 0.2271 0.2322 0.1685 0.0098  -0.0052 0.0000  97   TYR B CD2   
1692 C CE1   . TYR B 97  ? 0.1590 0.2118 0.1832 0.0125  0.0024  0.0005  97   TYR B CE1   
1693 C CE2   . TYR B 97  ? 0.1875 0.2220 0.1804 0.0122  0.0013  -0.0068 97   TYR B CE2   
1694 C CZ    . TYR B 97  ? 0.1953 0.2186 0.1676 0.0038  0.0040  -0.0154 97   TYR B CZ    
1695 O OH    . TYR B 97  ? 0.1967 0.2195 0.1746 0.0171  -0.0040 -0.0047 97   TYR B OH    
1696 N N     . LYS B 98  ? 0.1993 0.2152 0.1955 0.0135  -0.0100 0.0050  98   LYS B N     
1697 C CA    . LYS B 98  ? 0.2122 0.2207 0.2052 0.0071  -0.0035 0.0034  98   LYS B CA    
1698 C C     . LYS B 98  ? 0.2114 0.2206 0.1949 0.0102  -0.0078 0.0126  98   LYS B C     
1699 O O     . LYS B 98  ? 0.1927 0.2233 0.1887 0.0107  -0.0117 0.0210  98   LYS B O     
1700 C CB    . LYS B 98  ? 0.2071 0.2392 0.2173 0.0039  -0.0071 0.0005  98   LYS B CB    
1701 C CG    . LYS B 98  ? 0.2913 0.2737 0.2869 0.0088  0.0022  0.0017  98   LYS B CG    
1702 C CD    . LYS B 98  ? 0.3091 0.3104 0.3156 -0.0006 0.0004  -0.0004 98   LYS B CD    
1703 C CE    . LYS B 98  ? 0.3288 0.3229 0.3422 0.0106  0.0041  0.0053  98   LYS B CE    
1704 N NZ    . LYS B 98  ? 0.3553 0.3648 0.3636 0.0037  -0.0071 -0.0012 98   LYS B NZ    
1705 N N     . THR B 99  ? 0.2035 0.2163 0.1915 0.0104  -0.0127 0.0153  99   THR B N     
1706 C CA    . THR B 99  ? 0.2142 0.2171 0.2053 0.0073  -0.0086 0.0152  99   THR B CA    
1707 C C     . THR B 99  ? 0.2124 0.2146 0.2121 0.0139  -0.0090 0.0187  99   THR B C     
1708 O O     . THR B 99  ? 0.2318 0.2243 0.2231 0.0246  -0.0189 0.0359  99   THR B O     
1709 C CB    . THR B 99  ? 0.2144 0.2197 0.2122 0.0079  -0.0080 0.0214  99   THR B CB    
1710 O OG1   . THR B 99  ? 0.2298 0.2367 0.2118 0.0058  -0.0023 0.0296  99   THR B OG1   
1711 C CG2   . THR B 99  ? 0.2255 0.2132 0.2252 -0.0018 -0.0052 0.0178  99   THR B CG2   
1712 N N     . THR B 100 ? 0.2101 0.2152 0.2151 0.0074  -0.0042 0.0108  100  THR B N     
1713 C CA    . THR B 100 ? 0.2118 0.2116 0.2207 0.0086  -0.0051 0.0123  100  THR B CA    
1714 C C     . THR B 100 ? 0.2082 0.2017 0.2158 0.0072  -0.0051 0.0110  100  THR B C     
1715 O O     . THR B 100 ? 0.2125 0.2010 0.2365 0.0128  -0.0196 0.0194  100  THR B O     
1716 C CB    . THR B 100 ? 0.2101 0.2220 0.2242 0.0076  -0.0021 0.0070  100  THR B CB    
1717 O OG1   . THR B 100 ? 0.2067 0.1962 0.2312 0.0119  -0.0070 0.0151  100  THR B OG1   
1718 C CG2   . THR B 100 ? 0.2253 0.2283 0.2431 -0.0008 -0.0021 0.0029  100  THR B CG2   
1719 N N     . GLN B 101 ? 0.2089 0.2072 0.2232 0.0045  -0.0084 0.0140  101  GLN B N     
1720 C CA    . GLN B 101 ? 0.2267 0.2151 0.2278 0.0047  -0.0039 0.0038  101  GLN B CA    
1721 C C     . GLN B 101 ? 0.2035 0.2091 0.2175 0.0082  -0.0064 0.0075  101  GLN B C     
1722 O O     . GLN B 101 ? 0.2090 0.2109 0.2188 0.0148  -0.0030 0.0113  101  GLN B O     
1723 C CB    . GLN B 101 ? 0.2303 0.2249 0.2452 -0.0018 -0.0020 0.0087  101  GLN B CB    
1724 C CG    . GLN B 101 ? 0.2886 0.2857 0.2759 0.0047  0.0012  -0.0089 101  GLN B CG    
1725 C CD    . GLN B 101 ? 0.3499 0.3302 0.3414 -0.0096 -0.0017 0.0045  101  GLN B CD    
1726 O OE1   . GLN B 101 ? 0.3823 0.3706 0.3999 0.0077  0.0020  0.0018  101  GLN B OE1   
1727 N NE2   . GLN B 101 ? 0.3761 0.3850 0.3813 -0.0024 0.0055  0.0002  101  GLN B NE2   
1728 N N     . ALA B 102 ? 0.2076 0.2097 0.2111 0.0111  -0.0086 0.0096  102  ALA B N     
1729 C CA    . ALA B 102 ? 0.2098 0.2130 0.2152 0.0078  -0.0092 0.0067  102  ALA B CA    
1730 C C     . ALA B 102 ? 0.2015 0.2027 0.2105 0.0033  -0.0047 0.0106  102  ALA B C     
1731 O O     . ALA B 102 ? 0.2025 0.1820 0.2202 0.0089  -0.0038 0.0103  102  ALA B O     
1732 C CB    . ALA B 102 ? 0.2253 0.2308 0.2241 0.0068  -0.0065 0.0088  102  ALA B CB    
1733 N N     . ASN B 103 ? 0.2192 0.2131 0.2141 0.0076  -0.0040 0.0127  103  ASN B N     
1734 C CA    . ASN B 103 ? 0.2205 0.2203 0.2212 0.0029  0.0017  0.0115  103  ASN B CA    
1735 C C     . ASN B 103 ? 0.2016 0.1936 0.2069 0.0080  -0.0015 0.0131  103  ASN B C     
1736 O O     . ASN B 103 ? 0.2085 0.1896 0.2187 0.0125  0.0030  0.0230  103  ASN B O     
1737 C CB    . ASN B 103 ? 0.2367 0.2268 0.2384 0.0023  -0.0011 0.0107  103  ASN B CB    
1738 C CG    . ASN B 103 ? 0.2788 0.2757 0.2737 -0.0021 0.0110  0.0054  103  ASN B CG    
1739 O OD1   . ASN B 103 ? 0.2963 0.2888 0.3174 0.0110  -0.0004 0.0160  103  ASN B OD1   
1740 N ND2   . ASN B 103 ? 0.3387 0.3279 0.3156 0.0120  -0.0089 0.0137  103  ASN B ND2   
1741 N N     . LYS B 104 ? 0.1813 0.1714 0.1819 0.0093  0.0000  0.0148  104  LYS B N     
1742 C CA    . LYS B 104 ? 0.1651 0.1697 0.1681 0.0061  -0.0108 0.0083  104  LYS B CA    
1743 C C     . LYS B 104 ? 0.1406 0.1526 0.1607 0.0104  -0.0105 0.0000  104  LYS B C     
1744 O O     . LYS B 104 ? 0.1389 0.1451 0.1536 0.0054  0.0011  0.0065  104  LYS B O     
1745 C CB    . LYS B 104 ? 0.1786 0.1882 0.1753 -0.0001 -0.0120 0.0023  104  LYS B CB    
1746 C CG    . LYS B 104 ? 0.2305 0.2279 0.2180 0.0131  -0.0150 0.0086  104  LYS B CG    
1747 C CD    . LYS B 104 ? 0.2853 0.2826 0.2977 -0.0049 -0.0071 0.0019  104  LYS B CD    
1748 C CE    . LYS B 104 ? 0.3024 0.3204 0.3184 0.0070  -0.0091 0.0073  104  LYS B CE    
1749 N NZ    . LYS B 104 ? 0.3550 0.3379 0.3614 -0.0109 -0.0067 0.0041  104  LYS B NZ    
1750 N N     . HIS B 105 ? 0.1326 0.1455 0.1705 0.0031  -0.0098 0.0082  105  HIS B N     
1751 C CA    . HIS B 105 ? 0.1258 0.1293 0.1599 0.0067  -0.0097 0.0012  105  HIS B CA    
1752 C C     . HIS B 105 ? 0.1359 0.1256 0.1582 -0.0126 -0.0209 -0.0063 105  HIS B C     
1753 O O     . HIS B 105 ? 0.1596 0.1529 0.2008 -0.0021 -0.0159 -0.0072 105  HIS B O     
1754 C CB    . HIS B 105 ? 0.1380 0.1234 0.1632 0.0101  -0.0096 -0.0029 105  HIS B CB    
1755 C CG    . HIS B 105 ? 0.1359 0.1390 0.1569 0.0110  -0.0027 -0.0039 105  HIS B CG    
1756 N ND1   . HIS B 105 ? 0.1762 0.1649 0.2030 0.0038  -0.0051 -0.0072 105  HIS B ND1   
1757 C CD2   . HIS B 105 ? 0.1480 0.1294 0.1778 -0.0101 -0.0078 -0.0053 105  HIS B CD2   
1758 C CE1   . HIS B 105 ? 0.1718 0.1379 0.1966 0.0287  0.0034  -0.0055 105  HIS B CE1   
1759 N NE2   . HIS B 105 ? 0.1905 0.1691 0.2086 0.0007  -0.0084 -0.0009 105  HIS B NE2   
1760 N N     . ILE B 106 ? 0.1316 0.1066 0.1620 -0.0052 -0.0149 0.0100  106  ILE B N     
1761 C CA    . ILE B 106 ? 0.1177 0.1111 0.1404 -0.0028 -0.0148 0.0047  106  ILE B CA    
1762 C C     . ILE B 106 ? 0.1189 0.1076 0.1264 -0.0057 -0.0145 -0.0008 106  ILE B C     
1763 O O     . ILE B 106 ? 0.1439 0.1131 0.1331 -0.0066 -0.0140 0.0001  106  ILE B O     
1764 C CB    . ILE B 106 ? 0.1371 0.1048 0.1379 -0.0030 -0.0080 0.0073  106  ILE B CB    
1765 C CG1   . ILE B 106 ? 0.1363 0.1245 0.1446 -0.0057 -0.0052 0.0081  106  ILE B CG1   
1766 C CG2   . ILE B 106 ? 0.1603 0.1476 0.1569 -0.0036 -0.0040 0.0147  106  ILE B CG2   
1767 C CD1   . ILE B 106 ? 0.1512 0.1579 0.1607 -0.0036 -0.0038 0.0097  106  ILE B CD1   
1768 N N     . ILE B 107 ? 0.1160 0.1101 0.1197 -0.0142 -0.0211 0.0016  107  ILE B N     
1769 C CA    . ILE B 107 ? 0.1230 0.1152 0.1264 -0.0033 -0.0116 -0.0002 107  ILE B CA    
1770 C C     . ILE B 107 ? 0.1242 0.1141 0.1160 0.0017  -0.0070 0.0041  107  ILE B C     
1771 O O     . ILE B 107 ? 0.1418 0.1243 0.1300 -0.0046 -0.0102 0.0002  107  ILE B O     
1772 C CB    . ILE B 107 ? 0.1372 0.1355 0.1402 -0.0059 -0.0063 -0.0039 107  ILE B CB    
1773 C CG1   . ILE B 107 ? 0.1392 0.1535 0.1704 -0.0054 -0.0078 -0.0148 107  ILE B CG1   
1774 C CG2   . ILE B 107 ? 0.1577 0.1400 0.1512 -0.0133 -0.0026 -0.0067 107  ILE B CG2   
1775 C CD1   . ILE B 107 ? 0.1633 0.1467 0.1643 -0.0059 0.0042  -0.0120 107  ILE B CD1   
1776 N N     . VAL B 108 ? 0.1247 0.1000 0.1415 0.0050  -0.0080 0.0029  108  VAL B N     
1777 C CA    . VAL B 108 ? 0.1306 0.0945 0.1337 0.0011  -0.0083 0.0033  108  VAL B CA    
1778 C C     . VAL B 108 ? 0.1295 0.1066 0.1262 0.0058  -0.0089 0.0049  108  VAL B C     
1779 O O     . VAL B 108 ? 0.1520 0.1086 0.1254 -0.0064 -0.0017 0.0079  108  VAL B O     
1780 C CB    . VAL B 108 ? 0.1351 0.1076 0.1385 0.0091  0.0000  0.0069  108  VAL B CB    
1781 C CG1   . VAL B 108 ? 0.1519 0.1080 0.1436 0.0021  0.0016  -0.0029 108  VAL B CG1   
1782 C CG2   . VAL B 108 ? 0.1553 0.1432 0.1759 0.0013  -0.0073 0.0096  108  VAL B CG2   
1783 N N     . ALA B 109 ? 0.1412 0.1034 0.1323 0.0007  -0.0102 0.0049  109  ALA B N     
1784 C CA    . ALA B 109 ? 0.1304 0.1018 0.1206 -0.0011 -0.0068 0.0071  109  ALA B CA    
1785 C C     . ALA B 109 ? 0.1341 0.0998 0.1172 -0.0096 -0.0028 0.0052  109  ALA B C     
1786 O O     . ALA B 109 ? 0.1482 0.1316 0.1350 -0.0105 0.0025  0.0023  109  ALA B O     
1787 C CB    . ALA B 109 ? 0.1424 0.1165 0.1387 -0.0024 -0.0034 0.0011  109  ALA B CB    
1788 N N     . CYS B 110 ? 0.1290 0.0858 0.1223 -0.0026 -0.0088 0.0123  110  CYS B N     
1789 C CA    . CYS B 110 ? 0.1317 0.1079 0.1289 -0.0083 0.0009  0.0008  110  CYS B CA    
1790 C C     . CYS B 110 ? 0.1320 0.1131 0.1291 -0.0005 -0.0010 -0.0006 110  CYS B C     
1791 O O     . CYS B 110 ? 0.1219 0.1105 0.1312 -0.0002 0.0017  0.0073  110  CYS B O     
1792 C CB    . CYS B 110 ? 0.1215 0.0961 0.1296 -0.0001 -0.0021 0.0000  110  CYS B CB    
1793 S SG    . CYS B 110 ? 0.1529 0.0995 0.1535 -0.0019 -0.0068 0.0047  110  CYS B SG    
1794 N N     . GLU B 111 ? 0.1456 0.1200 0.1307 -0.0031 0.0044  0.0081  111  GLU B N     
1795 C CA    . GLU B 111 ? 0.1538 0.1343 0.1424 0.0035  0.0060  0.0068  111  GLU B CA    
1796 C C     . GLU B 111 ? 0.1586 0.1367 0.1417 0.0060  0.0131  0.0094  111  GLU B C     
1797 O O     . GLU B 111 ? 0.1651 0.1362 0.1515 0.0051  0.0137  0.0026  111  GLU B O     
1798 C CB    . GLU B 111 ? 0.1748 0.1476 0.1941 0.0013  0.0079  0.0129  111  GLU B CB    
1799 C CG    . GLU B 111 ? 0.2638 0.2625 0.2518 0.0048  0.0064  0.0023  111  GLU B CG    
1800 C CD    . GLU B 111 ? 0.3042 0.2987 0.3146 -0.0084 0.0029  0.0008  111  GLU B CD    
1801 O OE1   . GLU B 111 ? 0.3152 0.3084 0.2843 0.0030  0.0089  0.0087  111  GLU B OE1   
1802 O OE2   . GLU B 111 ? 0.3766 0.3650 0.3518 0.0105  0.0109  -0.0102 111  GLU B OE2   
1803 N N     . GLY B 112 ? 0.1698 0.1453 0.1486 0.0165  0.0184  0.0072  112  GLY B N     
1804 C CA    . GLY B 112 ? 0.1813 0.1609 0.1625 0.0168  0.0157  0.0014  112  GLY B CA    
1805 C C     . GLY B 112 ? 0.1857 0.1697 0.1678 0.0030  0.0207  0.0106  112  GLY B C     
1806 O O     . GLY B 112 ? 0.1714 0.1815 0.1598 -0.0030 0.0202  0.0123  112  GLY B O     
1807 N N     . ASN B 113 ? 0.1992 0.2040 0.2034 0.0063  0.0246  -0.0011 113  ASN B N     
1808 C CA    . ASN B 113 ? 0.2154 0.2258 0.2191 0.0027  0.0219  -0.0025 113  ASN B CA    
1809 C C     . ASN B 113 ? 0.1952 0.2059 0.2147 0.0058  0.0294  -0.0052 113  ASN B C     
1810 O O     . ASN B 113 ? 0.2405 0.2187 0.2545 0.0175  0.0350  -0.0057 113  ASN B O     
1811 C CB    . ASN B 113 ? 0.2438 0.2533 0.2434 0.0035  0.0193  0.0091  113  ASN B CB    
1812 C CG    . ASN B 113 ? 0.2697 0.3061 0.2921 -0.0009 0.0102  0.0005  113  ASN B CG    
1813 O OD1   . ASN B 113 ? 0.3152 0.3607 0.3251 0.0057  -0.0049 0.0127  113  ASN B OD1   
1814 N ND2   . ASN B 113 ? 0.3295 0.3325 0.3481 -0.0041 -0.0039 0.0165  113  ASN B ND2   
1815 N N     . PRO B 114 ? 0.1762 0.2019 0.1849 0.0054  0.0241  0.0009  114  PRO B N     
1816 C CA    . PRO B 114 ? 0.1688 0.1910 0.1886 -0.0020 0.0085  -0.0015 114  PRO B CA    
1817 C C     . PRO B 114 ? 0.1500 0.1788 0.1671 -0.0006 0.0077  -0.0027 114  PRO B C     
1818 O O     . PRO B 114 ? 0.1514 0.1618 0.1543 -0.0045 0.0151  -0.0097 114  PRO B O     
1819 C CB    . PRO B 114 ? 0.1904 0.2054 0.2085 -0.0067 0.0120  0.0013  114  PRO B CB    
1820 C CG    . PRO B 114 ? 0.2133 0.2139 0.2091 -0.0025 0.0112  0.0061  114  PRO B CG    
1821 C CD    . PRO B 114 ? 0.1932 0.2095 0.1897 -0.0010 0.0290  0.0018  114  PRO B CD    
1822 N N     . TYR B 115 ? 0.1392 0.1541 0.1541 -0.0071 0.0084  -0.0106 115  TYR B N     
1823 C CA    . TYR B 115 ? 0.1269 0.1409 0.1307 -0.0089 0.0069  -0.0020 115  TYR B CA    
1824 C C     . TYR B 115 ? 0.1366 0.1260 0.1339 -0.0095 0.0076  -0.0076 115  TYR B C     
1825 O O     . TYR B 115 ? 0.1717 0.1418 0.1548 -0.0074 0.0019  -0.0063 115  TYR B O     
1826 C CB    . TYR B 115 ? 0.1437 0.1470 0.1492 -0.0048 0.0050  -0.0051 115  TYR B CB    
1827 C CG    . TYR B 115 ? 0.1288 0.1189 0.1171 -0.0017 0.0001  -0.0004 115  TYR B CG    
1828 C CD1   . TYR B 115 ? 0.1630 0.1331 0.1221 -0.0084 0.0103  0.0033  115  TYR B CD1   
1829 C CD2   . TYR B 115 ? 0.1388 0.1198 0.1184 -0.0056 -0.0035 -0.0024 115  TYR B CD2   
1830 C CE1   . TYR B 115 ? 0.1470 0.1318 0.1291 -0.0043 0.0108  0.0011  115  TYR B CE1   
1831 C CE2   . TYR B 115 ? 0.1377 0.1236 0.1359 0.0047  0.0051  0.0010  115  TYR B CE2   
1832 C CZ    . TYR B 115 ? 0.1298 0.1264 0.1321 -0.0076 0.0120  0.0124  115  TYR B CZ    
1833 O OH    . TYR B 115 ? 0.1377 0.1495 0.1444 -0.0009 0.0092  0.0015  115  TYR B OH    
1834 N N     . VAL B 116 ? 0.1425 0.1166 0.1280 -0.0089 -0.0048 -0.0021 116  VAL B N     
1835 C CA    . VAL B 116 ? 0.1505 0.1271 0.1314 -0.0085 0.0045  -0.0017 116  VAL B CA    
1836 C C     . VAL B 116 ? 0.1467 0.0988 0.1187 -0.0136 -0.0061 -0.0028 116  VAL B C     
1837 O O     . VAL B 116 ? 0.1364 0.1126 0.1205 -0.0076 0.0053  0.0043  116  VAL B O     
1838 C CB    . VAL B 116 ? 0.1529 0.1460 0.1402 -0.0172 0.0073  0.0022  116  VAL B CB    
1839 C CG1   . VAL B 116 ? 0.1526 0.1271 0.1506 -0.0156 0.0073  0.0057  116  VAL B CG1   
1840 C CG2   . VAL B 116 ? 0.1428 0.1478 0.1245 -0.0044 0.0038  0.0064  116  VAL B CG2   
1841 N N     . PRO B 117 ? 0.1470 0.1048 0.1354 -0.0113 0.0008  0.0105  117  PRO B N     
1842 C CA    . PRO B 117 ? 0.1514 0.1263 0.1347 -0.0077 0.0000  0.0075  117  PRO B CA    
1843 C C     . PRO B 117 ? 0.1341 0.1226 0.1337 -0.0043 0.0010  0.0027  117  PRO B C     
1844 O O     . PRO B 117 ? 0.1452 0.1354 0.1367 -0.0062 0.0040  0.0072  117  PRO B O     
1845 C CB    . PRO B 117 ? 0.1590 0.1295 0.1337 -0.0023 -0.0038 0.0140  117  PRO B CB    
1846 C CG    . PRO B 117 ? 0.1839 0.1343 0.1549 -0.0070 0.0018  0.0225  117  PRO B CG    
1847 C CD    . PRO B 117 ? 0.1695 0.1161 0.1512 -0.0195 0.0053  0.0038  117  PRO B CD    
1848 N N     . VAL B 118 ? 0.1455 0.1337 0.1210 -0.0102 0.0042  -0.0036 118  VAL B N     
1849 C CA    . VAL B 118 ? 0.1518 0.1344 0.1301 -0.0053 0.0015  -0.0060 118  VAL B CA    
1850 C C     . VAL B 118 ? 0.1583 0.1308 0.1427 -0.0111 -0.0027 0.0009  118  VAL B C     
1851 O O     . VAL B 118 ? 0.1803 0.1589 0.1638 -0.0093 -0.0042 -0.0196 118  VAL B O     
1852 C CB    . VAL B 118 ? 0.1563 0.1441 0.1494 -0.0067 0.0029  -0.0025 118  VAL B CB    
1853 C CG1   . VAL B 118 ? 0.1661 0.1615 0.1516 0.0021  -0.0009 0.0023  118  VAL B CG1   
1854 C CG2   . VAL B 118 ? 0.1690 0.1282 0.1484 0.0015  0.0002  -0.0024 118  VAL B CG2   
1855 N N     . HIS B 119 ? 0.1444 0.1207 0.1230 -0.0061 -0.0060 0.0089  119  HIS B N     
1856 C CA    . HIS B 119 ? 0.1543 0.1322 0.1329 -0.0047 -0.0022 -0.0027 119  HIS B CA    
1857 C C     . HIS B 119 ? 0.1428 0.1220 0.1305 -0.0031 -0.0010 -0.0100 119  HIS B C     
1858 O O     . HIS B 119 ? 0.1530 0.1152 0.1325 -0.0043 -0.0121 -0.0081 119  HIS B O     
1859 C CB    . HIS B 119 ? 0.1587 0.1402 0.1525 -0.0057 -0.0077 0.0043  119  HIS B CB    
1860 C CG    . HIS B 119 ? 0.1963 0.1943 0.1995 -0.0015 0.0048  0.0120  119  HIS B CG    
1861 N ND1   . HIS B 119 ? 0.2175 0.2095 0.2329 -0.0102 -0.0021 0.0322  119  HIS B ND1   
1862 C CD2   . HIS B 119 ? 0.2335 0.2003 0.2163 0.0003  0.0093  0.0123  119  HIS B CD2   
1863 C CE1   . HIS B 119 ? 0.2236 0.2128 0.2166 -0.0048 0.0028  0.0061  119  HIS B CE1   
1864 N NE2   . HIS B 119 ? 0.2431 0.2308 0.2368 -0.0169 0.0045  0.0032  119  HIS B NE2   
1865 N N     . PHE B 120 ? 0.1482 0.1187 0.1334 -0.0102 -0.0041 -0.0072 120  PHE B N     
1866 C CA    . PHE B 120 ? 0.1349 0.1354 0.1337 -0.0126 -0.0082 0.0002  120  PHE B CA    
1867 C C     . PHE B 120 ? 0.1404 0.1319 0.1429 -0.0149 -0.0005 -0.0016 120  PHE B C     
1868 O O     . PHE B 120 ? 0.1615 0.1685 0.1620 -0.0208 -0.0011 -0.0102 120  PHE B O     
1869 C CB    . PHE B 120 ? 0.1445 0.1469 0.1229 -0.0052 -0.0133 -0.0007 120  PHE B CB    
1870 C CG    . PHE B 120 ? 0.1625 0.1571 0.1254 -0.0011 -0.0029 0.0064  120  PHE B CG    
1871 C CD1   . PHE B 120 ? 0.1880 0.1858 0.1713 0.0056  0.0067  0.0065  120  PHE B CD1   
1872 C CD2   . PHE B 120 ? 0.1963 0.1591 0.1750 -0.0043 -0.0014 0.0000  120  PHE B CD2   
1873 C CE1   . PHE B 120 ? 0.1987 0.2051 0.1750 0.0109  0.0008  -0.0016 120  PHE B CE1   
1874 C CE2   . PHE B 120 ? 0.2077 0.1790 0.2035 -0.0040 -0.0031 -0.0002 120  PHE B CE2   
1875 C CZ    . PHE B 120 ? 0.2096 0.1764 0.1817 0.0224  0.0115  0.0049  120  PHE B CZ    
1876 N N     . ASP B 121 ? 0.1480 0.1274 0.1529 -0.0131 0.0055  0.0058  121  ASP B N     
1877 C CA    . ASP B 121 ? 0.1472 0.1385 0.1557 -0.0146 0.0030  -0.0033 121  ASP B CA    
1878 C C     . ASP B 121 ? 0.1523 0.1532 0.1692 -0.0134 -0.0066 -0.0092 121  ASP B C     
1879 O O     . ASP B 121 ? 0.1659 0.1855 0.2420 -0.0186 -0.0042 -0.0087 121  ASP B O     
1880 C CB    . ASP B 121 ? 0.1674 0.1516 0.1634 -0.0135 0.0085  0.0014  121  ASP B CB    
1881 C CG    . ASP B 121 ? 0.1644 0.1494 0.1602 -0.0144 -0.0017 -0.0114 121  ASP B CG    
1882 O OD1   . ASP B 121 ? 0.1940 0.1581 0.1903 -0.0204 0.0085  -0.0006 121  ASP B OD1   
1883 O OD2   . ASP B 121 ? 0.1704 0.1685 0.1842 -0.0131 0.0082  0.0057  121  ASP B OD2   
1884 N N     . ALA B 122 ? 0.1375 0.1438 0.1503 -0.0065 -0.0014 -0.0027 122  ALA B N     
1885 C CA    . ALA B 122 ? 0.1483 0.1436 0.1633 -0.0065 -0.0026 -0.0060 122  ALA B CA    
1886 C C     . ALA B 122 ? 0.1454 0.1400 0.1593 -0.0083 -0.0080 0.0003  122  ALA B C     
1887 O O     . ALA B 122 ? 0.1445 0.1532 0.1497 -0.0093 -0.0164 0.0036  122  ALA B O     
1888 C CB    . ALA B 122 ? 0.1698 0.1642 0.1753 -0.0007 -0.0056 0.0033  122  ALA B CB    
1889 N N     . SER B 123 ? 0.1528 0.1497 0.1660 -0.0116 -0.0153 0.0027  123  SER B N     
1890 C CA    . SER B 123 ? 0.1671 0.1578 0.1771 -0.0091 -0.0067 0.0007  123  SER B CA    
1891 C C     . SER B 123 ? 0.1516 0.1686 0.1843 -0.0154 -0.0086 -0.0027 123  SER B C     
1892 O O     . SER B 123 ? 0.1555 0.2070 0.2121 -0.0068 -0.0046 -0.0078 123  SER B O     
1893 C CB    . SER B 123 ? 0.1771 0.1551 0.1822 -0.0091 0.0076  -0.0031 123  SER B CB    
1894 O OG    . SER B 123 ? 0.2321 0.2299 0.2446 0.0033  -0.0153 0.0131  123  SER B OG    
1895 N N     . VAL B 124 ? 0.1459 0.1691 0.1667 0.0073  -0.0085 -0.0004 124  VAL B N     
1896 C CA    . VAL B 124 ? 0.1650 0.1916 0.1870 0.0031  0.0011  -0.0019 124  VAL B CA    
1897 C C     . VAL B 124 ? 0.1626 0.1851 0.1863 0.0121  0.0076  0.0013  124  VAL B C     
1898 O O     . VAL B 124 ? 0.1876 0.1899 0.2130 0.0104  0.0112  0.0099  124  VAL B O     
1899 C CB    . VAL B 124 ? 0.1852 0.2073 0.1952 0.0028  -0.0012 -0.0046 124  VAL B CB    
1900 C CG1   . VAL B 124 ? 0.2111 0.2233 0.1952 -0.0096 -0.0018 0.0040  124  VAL B CG1   
1901 C CG2   . VAL B 124 ? 0.2114 0.2210 0.2035 -0.0008 0.0015  -0.0056 124  VAL B CG2   
1902 O OXT   . VAL B 124 ? 0.1931 0.2104 0.2085 0.0272  0.0132  -0.0030 124  VAL B OXT   
1903 P P1    . A2P C .   ? 0.1337 0.1855 0.1649 -0.0250 0.0068  0.0127  998  A2P A P1    
1904 O O1P   . A2P C .   ? 0.2376 0.1946 0.2157 -0.0293 0.0120  -0.0008 998  A2P A O1P   
1905 O O2P   . A2P C .   ? 0.2325 0.2906 0.2348 0.0178  0.0113  -0.0033 998  A2P A O2P   
1906 O O3P   . A2P C .   ? 0.1406 0.1810 0.1498 -0.0172 -0.0017 0.0020  998  A2P A O3P   
1907 P P2    . A2P C .   ? 0.2649 0.3644 0.3934 -0.0147 0.0177  -0.0056 998  A2P A P2    
1908 O O4P   . A2P C .   ? 0.3499 0.3825 0.4024 -0.0045 0.0040  0.0077  998  A2P A O4P   
1909 O O5P   . A2P C .   ? 0.3330 0.3836 0.3805 -0.0044 -0.0069 -0.0020 998  A2P A O5P   
1910 O O6P   . A2P C .   ? 0.3652 0.3774 0.3846 -0.0029 0.0022  -0.0055 998  A2P A O6P   
1911 O "O5'" . A2P C .   ? 0.2589 0.3081 0.3323 -0.0057 0.0067  0.0030  998  A2P A "O5'" 
1912 C "C5'" . A2P C .   ? 0.2278 0.2752 0.2770 0.0042  -0.0018 -0.0131 998  A2P A "C5'" 
1913 C "C4'" . A2P C .   ? 0.2025 0.2192 0.2378 0.0065  -0.0153 -0.0043 998  A2P A "C4'" 
1914 O "O4'" . A2P C .   ? 0.2057 0.2214 0.2452 0.0090  -0.0243 -0.0032 998  A2P A "O4'" 
1915 C "C3'" . A2P C .   ? 0.1744 0.1953 0.2221 0.0146  -0.0010 -0.0024 998  A2P A "C3'" 
1916 O "O3'" . A2P C .   ? 0.2145 0.2020 0.2375 -0.0004 -0.0117 0.0009  998  A2P A "O3'" 
1917 C "C2'" . A2P C .   ? 0.1523 0.1871 0.1939 0.0137  -0.0076 -0.0032 998  A2P A "C2'" 
1918 O "O2'" . A2P C .   ? 0.1467 0.1869 0.1710 0.0200  0.0067  0.0081  998  A2P A "O2'" 
1919 C "C1'" . A2P C .   ? 0.1667 0.1952 0.1925 0.0005  -0.0149 0.0068  998  A2P A "C1'" 
1920 N N9    . A2P C .   ? 0.1781 0.1992 0.1763 -0.0040 0.0067  -0.0074 998  A2P A N9    
1921 C C8    . A2P C .   ? 0.2016 0.1792 0.1722 -0.0200 0.0111  -0.0102 998  A2P A C8    
1922 N N7    . A2P C .   ? 0.2195 0.1921 0.1767 -0.0160 -0.0135 -0.0144 998  A2P A N7    
1923 C C5    . A2P C .   ? 0.2215 0.1923 0.1947 -0.0088 0.0027  -0.0011 998  A2P A C5    
1924 C C6    . A2P C .   ? 0.2156 0.1824 0.1957 -0.0143 -0.0053 0.0017  998  A2P A C6    
1925 N N6    . A2P C .   ? 0.2481 0.1709 0.2071 -0.0198 0.0132  -0.0095 998  A2P A N6    
1926 N N1    . A2P C .   ? 0.1957 0.1730 0.1892 0.0068  0.0027  -0.0058 998  A2P A N1    
1927 C C2    . A2P C .   ? 0.1819 0.1753 0.1735 -0.0086 -0.0050 -0.0105 998  A2P A C2    
1928 N N3    . A2P C .   ? 0.2061 0.1557 0.1833 -0.0151 -0.0080 -0.0033 998  A2P A N3    
1929 C C4    . A2P C .   ? 0.1824 0.1900 0.1711 -0.0084 -0.0073 0.0037  998  A2P A C4    
1930 P P1    . A2P D .   ? 0.5219 0.5355 0.5355 -0.0015 -0.0021 0.0012  999  A2P B P1    
1931 O O1P   . A2P D .   ? 0.5386 0.5365 0.5377 0.0002  -0.0005 0.0005  999  A2P B O1P   
1932 O O2P   . A2P D .   ? 0.5378 0.5408 0.5358 -0.0023 -0.0003 0.0011  999  A2P B O2P   
1933 O O3P   . A2P D .   ? 0.5365 0.5340 0.5338 -0.0019 0.0002  0.0009  999  A2P B O3P   
1934 P P2    . A2P D .   ? 0.3159 0.2848 0.2946 -0.0321 0.0287  -0.0156 999  A2P B P2    
1935 O O4P   . A2P D .   ? 0.3187 0.3331 0.3127 -0.0030 0.0026  -0.0007 999  A2P B O4P   
1936 O O5P   . A2P D .   ? 0.2197 0.1717 0.1895 -0.0154 0.0173  -0.0161 999  A2P B O5P   
1937 O O6P   . A2P D .   ? 0.3384 0.3109 0.2969 -0.0157 -0.0081 -0.0108 999  A2P B O6P   
1938 O "O5'" . A2P D .   ? 0.3578 0.3164 0.3187 -0.0137 -0.0023 0.0020  999  A2P B "O5'" 
1939 C "C5'" . A2P D .   ? 0.3741 0.3808 0.3814 -0.0007 0.0045  -0.0069 999  A2P B "C5'" 
1940 C "C4'" . A2P D .   ? 0.4302 0.4112 0.4154 0.0015  -0.0004 0.0047  999  A2P B "C4'" 
1941 O "O4'" . A2P D .   ? 0.4367 0.4347 0.4195 -0.0025 -0.0027 0.0004  999  A2P B "O4'" 
1942 C "C3'" . A2P D .   ? 0.4411 0.4474 0.4448 -0.0045 -0.0028 -0.0008 999  A2P B "C3'" 
1943 O "O3'" . A2P D .   ? 0.4713 0.4599 0.4751 -0.0008 -0.0012 -0.0024 999  A2P B "O3'" 
1944 C "C2'" . A2P D .   ? 0.4509 0.4605 0.4471 0.0019  -0.0039 0.0003  999  A2P B "C2'" 
1945 O "O2'" . A2P D .   ? 0.4981 0.4859 0.4872 -0.0088 0.0007  0.0036  999  A2P B "O2'" 
1946 C "C1'" . A2P D .   ? 0.4305 0.4226 0.4222 0.0013  0.0044  -0.0026 999  A2P B "C1'" 
1947 N N9    . A2P D .   ? 0.3909 0.3854 0.3922 -0.0036 -0.0058 0.0106  999  A2P B N9    
1948 C C8    . A2P D .   ? 0.3883 0.3812 0.3788 -0.0080 -0.0040 0.0023  999  A2P B C8    
1949 N N7    . A2P D .   ? 0.3653 0.3423 0.3657 -0.0031 0.0050  0.0099  999  A2P B N7    
1950 C C5    . A2P D .   ? 0.3658 0.3276 0.3509 -0.0119 -0.0023 0.0047  999  A2P B C5    
1951 C C6    . A2P D .   ? 0.3595 0.3336 0.3425 -0.0041 0.0040  0.0013  999  A2P B C6    
1952 N N6    . A2P D .   ? 0.3313 0.3316 0.3376 -0.0096 -0.0033 -0.0039 999  A2P B N6    
1953 N N1    . A2P D .   ? 0.3676 0.3135 0.3349 -0.0112 -0.0031 0.0028  999  A2P B N1    
1954 C C2    . A2P D .   ? 0.3486 0.3336 0.3577 -0.0016 0.0052  0.0081  999  A2P B C2    
1955 N N3    . A2P D .   ? 0.3499 0.3322 0.3422 -0.0082 0.0083  0.0088  999  A2P B N3    
1956 C C4    . A2P D .   ? 0.3604 0.3431 0.3637 -0.0009 0.0064  0.0153  999  A2P B C4    
1957 O O     . HOH E .   ? 0.3892 0.3904 0.3901 0.0072  0.0073  -0.0046 999  HOH A O     
1958 O O     . HOH E .   ? 0.4653 0.4648 0.4537 -0.0043 -0.0013 0.0038  1000 HOH A O     
1959 O O     . HOH E .   ? 0.4434 0.4554 0.4514 0.0038  0.0021  0.0012  1001 HOH A O     
1960 O O     . HOH E .   ? 0.4188 0.4377 0.4333 -0.0133 -0.0004 0.0019  1002 HOH A O     
1961 O O     . HOH E .   ? 0.4373 0.4403 0.4319 -0.0039 0.0002  -0.0004 1003 HOH A O     
1962 O O     . HOH E .   ? 0.3479 0.3332 0.3290 -0.0064 -0.0076 -0.0052 1004 HOH A O     
1963 O O     . HOH E .   ? 0.4099 0.4335 0.4333 -0.0112 -0.0016 -0.0017 1005 HOH A O     
1964 O O     . HOH E .   ? 0.4311 0.4555 0.4400 0.0006  0.0046  0.0031  1006 HOH A O     
1965 O O     . HOH E .   ? 0.5388 0.5456 0.5411 -0.0021 -0.0007 -0.0002 1007 HOH A O     
1966 O O     . HOH E .   ? 0.3440 0.3741 0.3242 -0.0034 0.0027  0.0020  1008 HOH A O     
1967 O O     . HOH E .   ? 0.2353 0.3209 0.2348 0.0004  0.0063  0.0240  1009 HOH A O     
1968 O O     . HOH E .   ? 0.3446 0.3613 0.3168 -0.0127 -0.0046 0.0058  1010 HOH A O     
1969 O O     . HOH E .   ? 0.5404 0.5522 0.5470 -0.0011 -0.0040 0.0015  1011 HOH A O     
1970 O O     . HOH E .   ? 0.4361 0.4372 0.4412 -0.0049 -0.0037 -0.0097 1012 HOH A O     
1971 O O     . HOH E .   ? 0.5381 0.5355 0.5337 -0.0033 0.0049  -0.0038 1013 HOH A O     
1972 O O     . HOH E .   ? 0.4684 0.4689 0.4696 -0.0006 0.0036  -0.0003 1014 HOH A O     
1973 O O     . HOH E .   ? 0.4232 0.4083 0.3975 0.0075  0.0104  0.0108  1015 HOH A O     
1974 O O     . HOH E .   ? 0.5448 0.5401 0.5404 -0.0014 0.0006  0.0030  1016 HOH A O     
1975 O O     . HOH E .   ? 0.3833 0.3496 0.3557 -0.0021 -0.0006 -0.0026 1017 HOH A O     
1976 O O     . HOH E .   ? 0.4064 0.4052 0.3972 0.0003  0.0040  0.0027  1018 HOH A O     
1977 O O     . HOH E .   ? 0.5224 0.5218 0.5153 -0.0010 0.0017  0.0025  1019 HOH A O     
1978 O O     . HOH E .   ? 0.3763 0.3575 0.3559 -0.0041 -0.0002 -0.0009 1020 HOH A O     
1979 O O     . HOH E .   ? 0.2286 0.2574 0.2796 0.0175  0.0176  0.0044  1021 HOH A O     
1980 O O     . HOH E .   ? 0.5633 0.5672 0.5633 0.0029  0.0009  -0.0016 1022 HOH A O     
1981 O O     . HOH E .   ? 0.5547 0.5547 0.5557 0.0030  -0.0004 -0.0009 1023 HOH A O     
1982 O O     . HOH E .   ? 0.2576 0.3257 0.2619 -0.0224 -0.0103 -0.0003 1024 HOH A O     
1983 O O     . HOH E .   ? 0.5458 0.5518 0.5407 -0.0031 0.0010  0.0005  1025 HOH A O     
1984 O O     . HOH E .   ? 0.2320 0.3043 0.1953 0.0302  -0.0220 0.0050  1026 HOH A O     
1985 O O     . HOH E .   ? 0.1746 0.2745 0.1802 0.0039  -0.0021 0.0205  1027 HOH A O     
1986 O O     . HOH E .   ? 0.3057 0.3022 0.2547 0.0249  0.0158  0.0120  1028 HOH A O     
1987 O O     . HOH E .   ? 0.3066 0.3466 0.3107 0.0189  0.0176  -0.0090 1029 HOH A O     
1988 O O     . HOH E .   ? 0.4394 0.4473 0.4583 0.0051  0.0002  -0.0048 1030 HOH A O     
1989 O O     . HOH E .   ? 0.4390 0.4590 0.4551 0.0032  -0.0006 -0.0012 1031 HOH A O     
1990 O O     . HOH E .   ? 0.5246 0.5235 0.5249 0.0000  0.0015  -0.0011 1032 HOH A O     
1991 O O     . HOH E .   ? 0.3511 0.3779 0.3658 0.0025  0.0247  0.0092  1033 HOH A O     
1992 O O     . HOH E .   ? 0.3835 0.3925 0.3896 0.0122  0.0027  0.0037  1034 HOH A O     
1993 O O     . HOH E .   ? 0.5054 0.5052 0.5114 0.0029  -0.0028 -0.0003 1035 HOH A O     
1994 O O     . HOH E .   ? 0.4434 0.4415 0.4535 0.0031  0.0015  0.0022  1036 HOH A O     
1995 O O     . HOH E .   ? 0.5860 0.5803 0.5790 -0.0025 0.0030  0.0019  1037 HOH A O     
1996 O O     . HOH E .   ? 0.2996 0.2670 0.2851 0.0122  -0.0085 -0.0068 1038 HOH A O     
1997 O O     . HOH E .   ? 0.3618 0.3635 0.3611 0.0123  -0.0077 0.0004  1039 HOH A O     
1998 O O     . HOH E .   ? 0.1834 0.1807 0.2310 0.0050  0.0103  0.0154  1040 HOH A O     
1999 O O     . HOH E .   ? 0.1341 0.1273 0.1632 0.0030  0.0012  0.0019  1041 HOH A O     
2000 O O     . HOH E .   ? 0.1290 0.1235 0.1374 -0.0049 -0.0096 0.0029  1042 HOH A O     
2001 O O     . HOH E .   ? 0.1734 0.1652 0.1936 -0.0017 -0.0141 0.0038  1043 HOH A O     
2002 O O     . HOH E .   ? 0.4157 0.4011 0.4147 0.0049  0.0076  0.0012  1044 HOH A O     
2003 O O     . HOH E .   ? 0.5780 0.5764 0.5767 0.0008  0.0022  -0.0063 1045 HOH A O     
2004 O O     . HOH E .   ? 0.3688 0.3483 0.3535 -0.0089 -0.0025 -0.0116 1046 HOH A O     
2005 O O     . HOH E .   ? 0.3212 0.3120 0.3388 0.0019  0.0075  -0.0084 1047 HOH A O     
2006 O O     . HOH E .   ? 0.5468 0.5493 0.5490 0.0010  0.0013  0.0009  1048 HOH A O     
2007 O O     . HOH E .   ? 0.5827 0.5862 0.5773 0.0000  0.0000  0.0011  1049 HOH A O     
2008 O O     . HOH E .   ? 0.4791 0.4729 0.4801 0.0051  0.0032  -0.0006 1050 HOH A O     
2009 O O     . HOH E .   ? 0.5545 0.5552 0.5513 -0.0021 -0.0011 0.0017  1051 HOH A O     
2010 O O     . HOH E .   ? 0.4579 0.4561 0.4570 -0.0002 -0.0004 0.0047  1052 HOH A O     
2011 O O     . HOH E .   ? 0.5248 0.5231 0.5288 -0.0023 -0.0008 -0.0027 1053 HOH A O     
2012 O O     . HOH E .   ? 0.4615 0.4761 0.4666 0.0025  -0.0039 -0.0042 1054 HOH A O     
2013 O O     . HOH E .   ? 0.5150 0.5233 0.5239 -0.0037 0.0010  0.0029  1055 HOH A O     
2014 O O     . HOH E .   ? 0.4974 0.4969 0.5070 0.0000  0.0000  -0.0014 1056 HOH A O     
2015 O O     . HOH E .   ? 0.3867 0.4265 0.4439 0.0008  0.0047  -0.0039 1057 HOH A O     
2016 O O     . HOH E .   ? 0.5484 0.5467 0.5474 0.0040  -0.0013 0.0000  1058 HOH A O     
2017 O O     . HOH E .   ? 0.5738 0.5776 0.5743 0.0003  -0.0020 0.0001  1059 HOH A O     
2018 O O     . HOH E .   ? 0.5087 0.5101 0.5191 0.0021  -0.0005 -0.0012 1060 HOH A O     
2019 O O     . HOH E .   ? 0.3082 0.2630 0.2892 -0.0057 0.0045  0.0035  1061 HOH A O     
2020 O O     . HOH E .   ? 0.4112 0.3972 0.3996 0.0050  0.0064  0.0002  1062 HOH A O     
2021 O O     . HOH E .   ? 0.5336 0.5346 0.5255 -0.0015 0.0002  0.0012  1063 HOH A O     
2022 O O     . HOH E .   ? 0.4370 0.4614 0.4466 -0.0037 0.0020  -0.0015 1064 HOH A O     
2023 O O     . HOH E .   ? 0.4804 0.4851 0.4716 0.0019  -0.0006 0.0010  1065 HOH A O     
2024 O O     . HOH E .   ? 0.4439 0.4468 0.4470 0.0012  -0.0001 -0.0016 1066 HOH A O     
2025 O O     . HOH E .   ? 0.2133 0.2336 0.1923 0.0116  -0.0236 -0.0022 1067 HOH A O     
2026 O O     . HOH E .   ? 0.3736 0.3941 0.3661 0.0001  0.0018  -0.0075 1068 HOH A O     
2027 O O     . HOH E .   ? 0.4466 0.4276 0.4487 0.0044  -0.0020 -0.0059 1069 HOH A O     
2028 O O     . HOH E .   ? 0.4186 0.4248 0.4094 0.0042  0.0037  0.0025  1070 HOH A O     
2029 O O     . HOH E .   ? 0.2932 0.3430 0.3821 0.0017  0.0226  0.0165  1071 HOH A O     
2030 O O     . HOH E .   ? 0.4133 0.4098 0.4342 -0.0023 0.0048  0.0096  1072 HOH A O     
2031 O O     . HOH E .   ? 0.3421 0.3383 0.3494 -0.0035 0.0137  -0.0004 1073 HOH A O     
2032 O O     . HOH E .   ? 0.5166 0.5175 0.5222 0.0009  0.0022  -0.0036 1074 HOH A O     
2033 O O     . HOH E .   ? 0.5143 0.5158 0.5216 -0.0041 -0.0010 0.0012  1075 HOH A O     
2034 O O     . HOH E .   ? 0.3597 0.3680 0.3737 -0.0001 0.0214  0.0135  1076 HOH A O     
2035 O O     . HOH E .   ? 0.5056 0.5099 0.5077 -0.0018 -0.0014 -0.0010 1077 HOH A O     
2036 O O     . HOH E .   ? 0.3316 0.3351 0.3590 -0.0127 -0.0015 0.0098  1078 HOH A O     
2037 O O     . HOH E .   ? 0.3732 0.3719 0.3770 -0.0017 -0.0015 0.0096  1079 HOH A O     
2038 O O     . HOH E .   ? 0.4437 0.4346 0.4453 0.0007  -0.0013 0.0002  1080 HOH A O     
2039 O O     . HOH E .   ? 0.2765 0.2589 0.2529 0.0195  -0.0059 0.0325  1081 HOH A O     
2040 O O     . HOH E .   ? 0.2381 0.2552 0.2593 0.0152  -0.0049 -0.0060 1082 HOH A O     
2041 O O     . HOH E .   ? 0.3836 0.3773 0.3719 -0.0014 0.0037  -0.0017 1083 HOH A O     
2042 O O     . HOH E .   ? 0.3359 0.3079 0.3093 -0.0089 0.0003  0.0057  1084 HOH A O     
2043 O O     . HOH E .   ? 0.3865 0.4020 0.4100 -0.0025 0.0046  -0.0036 1085 HOH A O     
2044 O O     . HOH E .   ? 0.3594 0.3673 0.3738 -0.0061 0.0012  0.0024  1086 HOH A O     
2045 O O     . HOH E .   ? 0.4411 0.4556 0.4454 0.0096  0.0015  -0.0003 1087 HOH A O     
2046 O O     . HOH E .   ? 0.3690 0.3745 0.3877 -0.0013 0.0013  0.0026  1088 HOH A O     
2047 O O     . HOH E .   ? 0.4713 0.4610 0.4698 -0.0052 0.0035  -0.0006 1089 HOH A O     
2048 O O     . HOH E .   ? 0.4815 0.4900 0.4852 -0.0024 0.0000  -0.0028 1090 HOH A O     
2049 O O     . HOH E .   ? 0.5706 0.5677 0.5776 0.0003  -0.0011 0.0011  1091 HOH A O     
2050 O O     . HOH E .   ? 0.5851 0.5732 0.5834 -0.0022 -0.0028 -0.0005 1092 HOH A O     
2051 O O     . HOH E .   ? 0.5013 0.4968 0.5022 -0.0018 -0.0031 -0.0005 1093 HOH A O     
2052 O O     . HOH E .   ? 0.3606 0.3826 0.3817 -0.0033 -0.0128 -0.0124 1094 HOH A O     
2053 O O     . HOH E .   ? 0.4115 0.4362 0.4379 0.0005  0.0013  0.0027  1095 HOH A O     
2054 O O     . HOH E .   ? 0.1632 0.1902 0.1795 0.0103  0.0073  -0.0103 1096 HOH A O     
2055 O O     . HOH E .   ? 0.2208 0.2008 0.2118 0.0088  0.0125  0.0261  1097 HOH A O     
2056 O O     . HOH E .   ? 0.1713 0.2016 0.1760 0.0283  0.0067  0.0313  1098 HOH A O     
2057 O O     . HOH E .   ? 0.2098 0.2432 0.2487 0.0425  0.0021  0.0215  1099 HOH A O     
2058 O O     . HOH E .   ? 0.2869 0.2935 0.2810 0.0252  0.0064  0.0273  1100 HOH A O     
2059 O O     . HOH E .   ? 0.3019 0.3074 0.3002 0.0149  0.0085  0.0245  1101 HOH A O     
2060 O O     . HOH E .   ? 0.5022 0.4933 0.5119 0.0034  0.0086  -0.0051 1102 HOH A O     
2061 O O     . HOH E .   ? 0.4561 0.4549 0.4697 0.0042  0.0000  -0.0003 1103 HOH A O     
2062 O O     . HOH E .   ? 0.4771 0.4928 0.4843 0.0006  0.0032  0.0053  1104 HOH A O     
2063 O O     . HOH E .   ? 0.3073 0.2710 0.3126 0.0157  0.0084  0.0185  1105 HOH A O     
2064 O O     . HOH E .   ? 0.5510 0.5498 0.5377 0.0020  -0.0018 -0.0017 1106 HOH A O     
2065 O O     . HOH E .   ? 0.3812 0.4080 0.3721 0.0038  0.0008  -0.0141 1107 HOH A O     
2066 O O     . HOH E .   ? 0.3688 0.3605 0.3454 0.0091  0.0030  0.0226  1108 HOH A O     
2067 O O     . HOH E .   ? 0.4757 0.4705 0.4628 -0.0011 0.0029  -0.0093 1109 HOH A O     
2068 O O     . HOH E .   ? 0.3158 0.2903 0.2828 0.0156  -0.0106 0.0382  1110 HOH A O     
2069 O O     . HOH E .   ? 0.5984 0.6083 0.6065 -0.0009 -0.0001 -0.0029 1111 HOH A O     
2070 O O     . HOH E .   ? 0.4644 0.4398 0.4337 -0.0037 0.0040  0.0100  1112 HOH A O     
2071 O O     . HOH E .   ? 0.4145 0.4131 0.4284 -0.0039 0.0001  0.0021  1113 HOH A O     
2072 O O     . HOH E .   ? 0.3347 0.3427 0.3486 -0.0020 0.0054  0.0086  1114 HOH A O     
2073 O O     . HOH E .   ? 0.5009 0.4967 0.4931 0.0010  -0.0068 0.0047  1115 HOH A O     
2074 O O     . HOH E .   ? 0.3242 0.3306 0.3220 -0.0038 0.0052  -0.0155 1116 HOH A O     
2075 O O     . HOH E .   ? 0.3186 0.3184 0.2397 -0.0171 -0.0109 0.0118  1117 HOH A O     
2076 O O     . HOH E .   ? 0.2097 0.2872 0.2575 -0.0040 0.0040  0.0130  1118 HOH A O     
2077 O O     . HOH E .   ? 0.2902 0.2999 0.2439 0.0096  0.0066  0.0028  1119 HOH A O     
2078 O O     . HOH E .   ? 0.2947 0.2931 0.2680 -0.0069 0.0051  -0.0157 1120 HOH A O     
2079 O O     . HOH E .   ? 0.4109 0.4192 0.4247 0.0061  0.0013  0.0017  1121 HOH A O     
2080 O O     . HOH E .   ? 0.5189 0.5089 0.5144 0.0006  -0.0021 0.0023  1122 HOH A O     
2081 O O     . HOH E .   ? 0.5235 0.5273 0.5145 0.0013  0.0010  0.0009  1123 HOH A O     
2082 O O     . HOH E .   ? 0.3761 0.3671 0.3584 0.0058  -0.0045 0.0040  1124 HOH A O     
2083 O O     . HOH E .   ? 0.4572 0.4818 0.4619 0.0017  -0.0043 -0.0029 1125 HOH A O     
2084 O O     . HOH E .   ? 0.4880 0.5002 0.4813 0.0033  0.0007  -0.0040 1126 HOH A O     
2085 O O     . HOH E .   ? 0.4717 0.4625 0.4552 0.0098  -0.0058 -0.0034 1127 HOH A O     
2086 O O     . HOH E .   ? 0.4940 0.4880 0.4805 0.0010  0.0048  0.0030  1128 HOH A O     
2087 O O     . HOH E .   ? 0.4523 0.4428 0.4295 0.0105  -0.0010 0.0024  1129 HOH A O     
2088 O O     . HOH E .   ? 0.5173 0.5162 0.5197 0.0023  -0.0002 -0.0024 1130 HOH A O     
2089 O O     . HOH E .   ? 0.4301 0.4308 0.4169 -0.0054 0.0137  0.0033  1131 HOH A O     
2090 O O     . HOH E .   ? 0.3750 0.3739 0.3981 0.0058  0.0115  -0.0019 1132 HOH A O     
2091 O O     . HOH E .   ? 0.4803 0.4787 0.4767 -0.0015 0.0015  0.0039  1133 HOH A O     
2092 O O     . HOH E .   ? 0.5331 0.5405 0.5279 -0.0026 -0.0026 -0.0014 1134 HOH A O     
2093 O O     . HOH E .   ? 0.4760 0.4530 0.4566 0.0006  -0.0007 0.0043  1135 HOH A O     
2094 O O     . HOH E .   ? 0.3907 0.3748 0.3877 -0.0003 0.0025  0.0000  1136 HOH A O     
2095 O O     . HOH E .   ? 0.5667 0.5653 0.5631 -0.0009 -0.0022 0.0007  1137 HOH A O     
2096 O O     . HOH E .   ? 0.4813 0.4732 0.4750 0.0000  0.0002  -0.0036 1138 HOH A O     
2097 O O     . HOH E .   ? 0.5404 0.5251 0.5348 -0.0014 0.0001  0.0013  1139 HOH A O     
2098 O O     . HOH E .   ? 0.4545 0.4622 0.4603 0.0006  -0.0004 0.0024  1140 HOH A O     
2099 O O     . HOH E .   ? 0.4509 0.4518 0.4504 0.0003  0.0027  -0.0027 1141 HOH A O     
2100 O O     . HOH E .   ? 0.5989 0.6016 0.6074 -0.0007 0.0005  0.0008  1142 HOH A O     
2101 O O     . HOH E .   ? 0.5075 0.5023 0.5081 -0.0006 0.0048  -0.0043 1143 HOH A O     
2102 O O     . HOH E .   ? 0.5109 0.5028 0.5097 0.0034  -0.0002 0.0021  1144 HOH A O     
2103 O O     . HOH E .   ? 0.4699 0.4699 0.4731 0.0002  0.0078  -0.0007 1145 HOH A O     
2104 O O     . HOH E .   ? 0.4107 0.4105 0.3790 0.0069  0.0019  -0.0006 1146 HOH A O     
2105 O O     . HOH E .   ? 0.3574 0.3563 0.3502 0.0071  -0.0089 0.0090  1147 HOH A O     
2106 O O     . HOH E .   ? 0.4827 0.4816 0.4882 -0.0059 -0.0050 0.0001  1148 HOH A O     
2107 O O     . HOH E .   ? 0.4128 0.3931 0.3715 -0.0102 0.0046  -0.0055 1149 HOH A O     
2108 O O     . HOH E .   ? 0.3689 0.3341 0.3470 -0.0039 0.0035  -0.0037 1150 HOH A O     
2109 O O     . HOH E .   ? 0.4438 0.4178 0.4363 -0.0031 -0.0004 -0.0045 1151 HOH A O     
2110 O O     . HOH E .   ? 0.6021 0.5996 0.5995 0.0023  -0.0014 0.0011  1152 HOH A O     
2111 O O     . HOH E .   ? 0.4871 0.4806 0.4778 -0.0029 0.0009  -0.0005 1153 HOH A O     
2112 O O     . HOH E .   ? 0.5523 0.5466 0.5396 -0.0006 -0.0029 -0.0014 1154 HOH A O     
2113 O O     . HOH E .   ? 0.3659 0.3657 0.3325 -0.0147 -0.0238 -0.0124 1155 HOH A O     
2114 O O     . HOH E .   ? 0.5532 0.5576 0.5578 0.0000  -0.0015 0.0007  1156 HOH A O     
2115 O O     . HOH E .   ? 0.3648 0.3823 0.3583 0.0071  0.0102  -0.0058 1157 HOH A O     
2116 O O     . HOH E .   ? 0.2537 0.2831 0.2330 0.0015  0.0081  -0.0127 1158 HOH A O     
2117 O O     . HOH E .   ? 0.3477 0.3747 0.3574 0.0219  -0.0057 -0.0007 1159 HOH A O     
2118 O O     . HOH E .   ? 0.2435 0.2448 0.2199 0.0008  0.0047  -0.0153 1160 HOH A O     
2119 O O     . HOH E .   ? 0.3824 0.3820 0.3542 0.0036  0.0019  -0.0065 1161 HOH A O     
2120 O O     . HOH E .   ? 0.4880 0.4888 0.4984 0.0000  0.0047  -0.0008 1162 HOH A O     
2121 O O     . HOH E .   ? 0.6053 0.6052 0.6019 -0.0008 -0.0007 0.0014  1163 HOH A O     
2122 O O     . HOH E .   ? 0.3885 0.3933 0.3896 0.0008  0.0035  -0.0022 1164 HOH A O     
2123 O O     . HOH E .   ? 0.5048 0.5078 0.5044 0.0000  -0.0010 -0.0007 1165 HOH A O     
2124 O O     . HOH E .   ? 0.4378 0.4404 0.4716 0.0019  0.0058  -0.0004 1166 HOH A O     
2125 O O     . HOH E .   ? 0.5082 0.5014 0.5152 -0.0027 0.0056  0.0020  1167 HOH A O     
2126 O O     . HOH E .   ? 0.4601 0.4633 0.4807 0.0026  0.0106  -0.0004 1168 HOH A O     
2127 O O     . HOH E .   ? 0.4274 0.4269 0.4312 -0.0041 0.0094  -0.0044 1169 HOH A O     
2128 O O     . HOH E .   ? 0.5870 0.5824 0.5809 -0.0014 0.0006  0.0000  1170 HOH A O     
2129 O O     . HOH E .   ? 0.5334 0.5387 0.5444 -0.0025 -0.0006 -0.0008 1171 HOH A O     
2130 O O     . HOH E .   ? 0.4256 0.4452 0.4440 -0.0021 0.0002  0.0016  1172 HOH A O     
2131 O O     . HOH E .   ? 0.2110 0.2264 0.2758 0.0251  0.0179  -0.0194 1173 HOH A O     
2132 O O     . HOH E .   ? 0.4330 0.4325 0.4255 0.0046  -0.0007 0.0049  1174 HOH A O     
2133 O O     . HOH E .   ? 0.5428 0.5443 0.5328 -0.0011 -0.0001 -0.0021 1175 HOH A O     
2134 O O     . HOH E .   ? 0.3840 0.3684 0.3958 0.0070  0.0020  -0.0119 1176 HOH A O     
2135 O O     . HOH E .   ? 0.4755 0.4753 0.4867 0.0002  0.0014  -0.0014 1177 HOH A O     
2136 O O     . HOH E .   ? 0.1478 0.1265 0.1691 -0.0023 -0.0146 0.0111  1178 HOH A O     
2137 O O     . HOH E .   ? 0.2286 0.1768 0.2128 0.0045  -0.0051 0.0131  1179 HOH A O     
2138 O O     . HOH E .   ? 0.1944 0.1635 0.1945 -0.0031 -0.0122 0.0129  1180 HOH A O     
2139 O O     . HOH E .   ? 0.1838 0.2056 0.2221 0.0004  -0.0062 0.0216  1181 HOH A O     
2140 O O     . HOH E .   ? 0.1804 0.1738 0.1834 -0.0152 0.0106  -0.0051 1182 HOH A O     
2141 O O     . HOH E .   ? 0.2625 0.2717 0.2541 -0.0111 0.0017  -0.0189 1183 HOH A O     
2142 O O     . HOH E .   ? 0.2224 0.1973 0.2282 0.0097  -0.0098 -0.0117 1184 HOH A O     
2143 O O     . HOH E .   ? 0.2599 0.2157 0.2467 0.0131  0.0041  -0.0286 1185 HOH A O     
2144 O O     . HOH E .   ? 0.3590 0.3738 0.3828 0.0060  0.0053  0.0061  1186 HOH A O     
2145 O O     . HOH E .   ? 0.4396 0.4434 0.4357 -0.0075 -0.0071 -0.0087 1187 HOH A O     
2146 O O     . HOH E .   ? 0.5172 0.5153 0.5172 0.0016  -0.0033 -0.0037 1188 HOH A O     
2147 O O     . HOH E .   ? 0.4308 0.4137 0.4356 -0.0022 0.0044  -0.0009 1189 HOH A O     
2148 O O     . HOH E .   ? 0.2348 0.2639 0.2328 -0.0131 0.0350  -0.0173 1190 HOH A O     
2149 O O     . HOH E .   ? 0.2454 0.2454 0.2751 0.0107  -0.0058 0.0203  1191 HOH A O     
2150 O O     . HOH E .   ? 0.3009 0.3378 0.3141 0.0094  0.0031  0.0047  1192 HOH A O     
2151 O O     . HOH E .   ? 0.3877 0.3628 0.3690 0.0092  0.0076  -0.0002 1193 HOH A O     
2152 O O     . HOH E .   ? 0.3376 0.3180 0.3033 -0.0001 0.0158  -0.0117 1194 HOH A O     
2153 O O     . HOH E .   ? 0.5164 0.5230 0.5213 0.0031  0.0053  -0.0060 1195 HOH A O     
2154 O O     . HOH E .   ? 0.2717 0.2834 0.2934 -0.0061 0.0177  -0.0148 1196 HOH A O     
2155 O O     . HOH E .   ? 0.1830 0.2194 0.1924 0.0076  0.0156  0.0213  1197 HOH A O     
2156 O O     . HOH E .   ? 0.3401 0.3707 0.2725 -0.0018 0.0277  0.0149  1198 HOH A O     
2157 O O     . HOH E .   ? 0.2849 0.2930 0.2777 -0.0004 0.0134  0.0185  1199 HOH A O     
2158 O O     . HOH E .   ? 0.2775 0.3104 0.2923 -0.0014 0.0038  -0.0044 1200 HOH A O     
2159 O O     . HOH E .   ? 0.2579 0.2681 0.2893 0.0113  0.0108  0.0090  1201 HOH A O     
2160 O O     . HOH E .   ? 0.4814 0.4876 0.4914 0.0018  0.0008  -0.0025 1202 HOH A O     
2161 O O     . HOH E .   ? 0.3294 0.3433 0.3454 0.0160  0.0018  0.0035  1203 HOH A O     
2162 O O     . HOH E .   ? 0.2252 0.2471 0.2220 0.0251  -0.0059 0.0178  1204 HOH A O     
2163 O O     . HOH E .   ? 0.3441 0.3633 0.3644 0.0180  0.0008  0.0073  1205 HOH A O     
2164 O O     . HOH E .   ? 0.3235 0.3123 0.3064 0.0191  -0.0002 0.0285  1206 HOH A O     
2165 O O     . HOH E .   ? 0.4313 0.4349 0.4286 0.0066  0.0027  0.0117  1207 HOH A O     
2166 O O     . HOH E .   ? 0.2667 0.2284 0.2349 0.0402  0.0177  0.0327  1208 HOH A O     
2167 O O     . HOH E .   ? 0.2255 0.1954 0.2158 0.0314  0.0295  0.0308  1209 HOH A O     
2168 O O     . HOH E .   ? 0.2704 0.2534 0.2104 -0.0032 0.0030  0.0075  1210 HOH A O     
2169 O O     . HOH E .   ? 0.5434 0.5471 0.5495 0.0002  -0.0005 0.0021  1211 HOH A O     
2170 O O     . HOH E .   ? 0.3592 0.3135 0.3396 0.0015  0.0079  0.0121  1212 HOH A O     
2171 O O     . HOH E .   ? 0.3251 0.2896 0.3245 0.0070  0.0226  0.0121  1213 HOH A O     
2172 O O     . HOH E .   ? 0.5289 0.5259 0.5218 0.0018  0.0001  0.0019  1214 HOH A O     
2173 O O     . HOH E .   ? 0.5583 0.5581 0.5570 -0.0004 0.0009  0.0004  1215 HOH A O     
2174 O O     . HOH E .   ? 0.2153 0.2264 0.1983 0.0190  0.0239  0.0006  1216 HOH A O     
2175 O O     . HOH E .   ? 0.3841 0.3940 0.3762 -0.0066 -0.0018 0.0040  1217 HOH A O     
2176 O O     . HOH E .   ? 0.3334 0.3225 0.3845 -0.0033 0.0036  -0.0047 1218 HOH A O     
2177 O O     . HOH E .   ? 0.3453 0.3414 0.3603 0.0063  -0.0003 -0.0013 1219 HOH A O     
2178 O O     . HOH E .   ? 0.1437 0.1276 0.1438 0.0134  -0.0059 -0.0026 1220 HOH A O     
2179 O O     . HOH E .   ? 0.4717 0.4653 0.4682 0.0010  -0.0026 -0.0009 1221 HOH A O     
2180 O O     . HOH E .   ? 0.2553 0.2733 0.3082 0.0076  -0.0101 -0.0319 1222 HOH A O     
2181 O O     . HOH E .   ? 0.2959 0.2591 0.2762 0.0072  0.0064  -0.0217 1223 HOH A O     
2182 O O     . HOH E .   ? 0.4152 0.3976 0.4033 -0.0037 -0.0010 0.0049  1224 HOH A O     
2183 O O     . HOH E .   ? 0.3019 0.2929 0.3306 0.0102  -0.0204 0.0021  1225 HOH A O     
2184 O O     . HOH E .   ? 0.1394 0.1068 0.1340 0.0024  0.0093  -0.0029 1226 HOH A O     
2185 O O     . HOH E .   ? 0.3233 0.3022 0.3118 -0.0175 -0.0116 0.0051  1227 HOH A O     
2186 O O     . HOH E .   ? 0.2950 0.2082 0.2720 0.0003  -0.0071 0.0102  1228 HOH A O     
2187 O O     . HOH E .   ? 0.2336 0.2006 0.1941 0.0259  -0.0017 -0.0018 1229 HOH A O     
2188 O O     . HOH E .   ? 0.5361 0.5262 0.5244 -0.0019 -0.0011 0.0006  1230 HOH A O     
2189 O O     . HOH E .   ? 0.4276 0.4311 0.4136 0.0031  -0.0007 0.0007  1231 HOH A O     
2190 O O     . HOH E .   ? 0.3637 0.3916 0.3638 -0.0055 -0.0137 -0.0015 1232 HOH A O     
2191 O O     . HOH E .   ? 0.3799 0.4103 0.4121 -0.0105 -0.0162 0.0013  1233 HOH A O     
2192 O O     . HOH E .   ? 0.3740 0.3941 0.3958 0.0040  0.0040  -0.0058 1234 HOH A O     
2193 O O     . HOH E .   ? 0.4435 0.4472 0.4394 -0.0032 -0.0081 -0.0108 1235 HOH A O     
2194 O O     . HOH E .   ? 0.4339 0.4305 0.4437 -0.0011 0.0001  0.0087  1236 HOH A O     
2195 O O     . HOH E .   ? 0.4004 0.4148 0.4277 -0.0042 -0.0077 0.0070  1237 HOH A O     
2196 O O     . HOH E .   ? 0.4354 0.4461 0.4487 -0.0016 0.0006  -0.0077 1238 HOH A O     
2197 O O     . HOH E .   ? 0.4827 0.4745 0.4746 0.0020  -0.0004 0.0019  1239 HOH A O     
2198 O O     . HOH E .   ? 0.4895 0.4887 0.4866 0.0014  -0.0053 -0.0018 1240 HOH A O     
2199 O O     . HOH E .   ? 0.5053 0.4903 0.4975 0.0005  0.0002  0.0011  1241 HOH A O     
2200 O O     . HOH E .   ? 0.4743 0.4825 0.4874 0.0002  0.0023  -0.0008 1242 HOH A O     
2201 O O     . HOH E .   ? 0.4854 0.4900 0.4885 0.0024  0.0008  0.0006  1243 HOH A O     
2202 O O     . HOH E .   ? 0.4656 0.4559 0.4719 -0.0022 -0.0020 0.0025  1244 HOH A O     
2203 O O     . HOH E .   ? 0.4771 0.4784 0.4779 -0.0049 -0.0035 -0.0008 1245 HOH A O     
2204 O O     . HOH E .   ? 0.4678 0.4728 0.4629 0.0021  0.0035  0.0008  1246 HOH A O     
2205 O O     . HOH E .   ? 0.4589 0.4388 0.4528 0.0019  0.0049  0.0039  1247 HOH A O     
2206 O O     . HOH E .   ? 0.5266 0.5173 0.5162 0.0007  -0.0021 0.0014  1248 HOH A O     
2207 O O     . HOH E .   ? 0.4934 0.4977 0.4973 -0.0018 0.0007  -0.0022 1249 HOH A O     
2208 O O     . HOH E .   ? 0.4381 0.4433 0.4341 0.0036  -0.0066 0.0105  1250 HOH A O     
2209 O O     . HOH E .   ? 0.5298 0.5297 0.5270 -0.0034 -0.0009 0.0011  1251 HOH A O     
2210 O O     . HOH E .   ? 0.4592 0.4679 0.4709 -0.0013 -0.0064 -0.0019 1252 HOH A O     
2211 O O     . HOH E .   ? 0.4720 0.4741 0.4630 -0.0004 -0.0009 -0.0024 1253 HOH A O     
2212 O O     . HOH E .   ? 0.5508 0.5478 0.5520 0.0019  0.0004  -0.0032 1254 HOH A O     
2213 O O     . HOH E .   ? 0.5278 0.5389 0.5362 0.0047  -0.0005 -0.0001 1255 HOH A O     
2214 O O     . HOH E .   ? 0.3454 0.3503 0.3281 -0.0095 -0.0016 0.0096  1256 HOH A O     
2215 O O     . HOH E .   ? 0.3430 0.3422 0.3522 -0.0049 -0.0086 0.0044  1257 HOH A O     
2216 O O     . HOH E .   ? 0.3463 0.3614 0.3428 0.0168  -0.0050 0.0058  1258 HOH A O     
2217 O O     . HOH E .   ? 0.3416 0.3615 0.2947 -0.0039 -0.0126 -0.0006 1259 HOH A O     
2218 O O     . HOH E .   ? 0.3387 0.3432 0.3258 0.0052  -0.0001 -0.0057 1260 HOH A O     
2219 O O     . HOH E .   ? 0.3532 0.3575 0.3398 0.0034  -0.0034 0.0095  1261 HOH A O     
2220 O O     . HOH E .   ? 0.3451 0.3516 0.3142 0.0077  -0.0076 -0.0044 1262 HOH A O     
2221 O O     . HOH E .   ? 0.3532 0.3540 0.3530 -0.0025 0.0042  0.0075  1263 HOH A O     
2222 O O     . HOH E .   ? 0.3450 0.3274 0.3120 0.0067  0.0049  -0.0044 1264 HOH A O     
2223 O O     . HOH E .   ? 0.3754 0.3721 0.3847 -0.0042 0.0034  0.0047  1265 HOH A O     
2224 O O     . HOH E .   ? 0.3482 0.3490 0.3518 -0.0050 0.0069  -0.0020 1266 HOH A O     
2225 O O     . HOH E .   ? 0.3527 0.3480 0.3525 0.0080  -0.0014 -0.0045 1267 HOH A O     
2226 O O     . HOH E .   ? 0.3651 0.3576 0.3478 -0.0017 -0.0042 -0.0141 1268 HOH A O     
2227 O O     . HOH E .   ? 0.3599 0.3780 0.3564 0.0072  0.0109  0.0145  1269 HOH A O     
2228 O O     . HOH E .   ? 0.3570 0.3511 0.3342 0.0012  -0.0076 0.0000  1270 HOH A O     
2229 O O     . HOH E .   ? 0.3417 0.3477 0.3237 0.0096  -0.0078 0.0020  1271 HOH A O     
2230 O O     . HOH E .   ? 0.3387 0.3537 0.3412 0.0074  0.0022  -0.0002 1272 HOH A O     
2231 O O     . HOH E .   ? 0.3360 0.3247 0.3338 0.0014  -0.0063 -0.0028 1273 HOH A O     
2232 O O     . HOH E .   ? 0.3589 0.3734 0.3346 0.0015  0.0107  0.0029  1274 HOH A O     
2233 O O     . HOH E .   ? 0.3339 0.3638 0.3400 -0.0014 -0.0005 -0.0002 1275 HOH A O     
2234 O O     . HOH E .   ? 0.3610 0.3738 0.3160 -0.0077 -0.0145 -0.0058 1276 HOH A O     
2235 O O     . HOH E .   ? 0.3643 0.3495 0.3508 0.0086  -0.0063 -0.0008 1277 HOH A O     
2236 O O     . HOH E .   ? 0.2980 0.3027 0.3230 0.0003  -0.0058 0.0064  1278 HOH A O     
2237 O O     . HOH E .   ? 0.3608 0.3352 0.3276 -0.0087 0.0004  -0.0034 1279 HOH A O     
2238 O O     . HOH E .   ? 0.3487 0.3666 0.3606 -0.0032 -0.0039 0.0000  1280 HOH A O     
2239 O O     . HOH E .   ? 0.3051 0.3147 0.3263 0.0116  -0.0004 0.0018  1281 HOH A O     
2240 O O     . HOH F .   ? 0.5008 0.5108 0.4957 -0.0004 -0.0063 -0.0009 1000 HOH B O     
2241 O O     . HOH F .   ? 0.4727 0.4683 0.4608 -0.0002 -0.0008 -0.0013 1001 HOH B O     
2242 O O     . HOH F .   ? 0.4191 0.4376 0.4092 0.0009  -0.0017 -0.0011 1002 HOH B O     
2243 O O     . HOH F .   ? 0.4949 0.4855 0.4910 -0.0012 -0.0022 -0.0045 1003 HOH B O     
2244 O O     . HOH F .   ? 0.5800 0.5800 0.5763 0.0025  -0.0021 -0.0003 1004 HOH B O     
2245 O O     . HOH F .   ? 0.3654 0.3745 0.3123 -0.0021 -0.0135 0.0029  1005 HOH B O     
2246 O O     . HOH F .   ? 0.4466 0.4610 0.4366 0.0050  -0.0086 -0.0006 1006 HOH B O     
2247 O O     . HOH F .   ? 0.4707 0.4761 0.4693 0.0028  -0.0005 -0.0012 1007 HOH B O     
2248 O O     . HOH F .   ? 0.4286 0.4211 0.4130 -0.0003 0.0036  0.0068  1008 HOH B O     
2249 O O     . HOH F .   ? 0.3902 0.4087 0.4173 -0.0032 -0.0056 0.0017  1009 HOH B O     
2250 O O     . HOH F .   ? 0.3489 0.3335 0.3477 0.0005  -0.0096 -0.0071 1010 HOH B O     
2251 O O     . HOH F .   ? 0.3326 0.3543 0.3028 -0.0037 0.0124  -0.0123 1011 HOH B O     
2252 O O     . HOH F .   ? 0.4073 0.4059 0.4138 -0.0042 0.0057  0.0026  1012 HOH B O     
2253 O O     . HOH F .   ? 0.4082 0.4097 0.4048 0.0051  0.0036  -0.0022 1013 HOH B O     
2254 O O     . HOH F .   ? 0.3986 0.4041 0.3877 0.0006  -0.0044 -0.0015 1014 HOH B O     
2255 O O     . HOH F .   ? 0.3724 0.3788 0.3746 0.0076  -0.0040 -0.0059 1015 HOH B O     
2256 O O     . HOH F .   ? 0.3610 0.3599 0.3520 0.0073  -0.0058 -0.0111 1016 HOH B O     
2257 O O     . HOH F .   ? 0.4725 0.4801 0.4750 -0.0030 -0.0057 0.0002  1017 HOH B O     
2258 O O     . HOH F .   ? 0.5360 0.5365 0.5303 -0.0009 -0.0001 -0.0024 1018 HOH B O     
2259 O O     . HOH F .   ? 0.5804 0.5857 0.5835 -0.0002 -0.0005 0.0025  1019 HOH B O     
2260 O O     . HOH F .   ? 0.4242 0.4288 0.4182 0.0021  -0.0052 -0.0008 1020 HOH B O     
2261 O O     . HOH F .   ? 0.4652 0.4692 0.4589 -0.0013 0.0024  0.0016  1021 HOH B O     
2262 O O     . HOH F .   ? 0.3176 0.3706 0.2949 0.0046  0.0032  0.0037  1022 HOH B O     
2263 O O     . HOH F .   ? 0.2704 0.3375 0.2982 -0.0017 0.0184  0.0019  1023 HOH B O     
2264 O O     . HOH F .   ? 0.2210 0.3058 0.2243 -0.0107 -0.0053 -0.0024 1024 HOH B O     
2265 O O     . HOH F .   ? 0.6087 0.6013 0.6020 -0.0009 -0.0009 0.0009  1025 HOH B O     
2266 O O     . HOH F .   ? 0.5485 0.5388 0.5417 0.0013  0.0004  -0.0021 1026 HOH B O     
2267 O O     . HOH F .   ? 0.5280 0.5219 0.5306 0.0022  0.0003  -0.0007 1027 HOH B O     
2268 O O     . HOH F .   ? 0.4907 0.4938 0.4959 0.0034  -0.0004 0.0009  1028 HOH B O     
2269 O O     . HOH F .   ? 0.4504 0.4426 0.4488 -0.0044 -0.0026 -0.0035 1029 HOH B O     
2270 O O     . HOH F .   ? 0.4786 0.4698 0.4699 0.0049  0.0007  -0.0038 1030 HOH B O     
2271 O O     . HOH F .   ? 0.5809 0.5725 0.5741 0.0024  -0.0015 0.0009  1031 HOH B O     
2272 O O     . HOH F .   ? 0.1865 0.1637 0.1652 0.0166  0.0033  -0.0004 1032 HOH B O     
2273 O O     . HOH F .   ? 0.4361 0.4195 0.4070 0.0064  0.0012  -0.0034 1033 HOH B O     
2274 O O     . HOH F .   ? 0.4779 0.4702 0.4739 -0.0030 0.0003  -0.0047 1034 HOH B O     
2275 O O     . HOH F .   ? 0.3873 0.3717 0.3638 0.0121  0.0006  -0.0220 1035 HOH B O     
2276 O O     . HOH F .   ? 0.3216 0.3647 0.3634 -0.0105 0.0083  0.0045  1036 HOH B O     
2277 O O     . HOH F .   ? 0.4345 0.4319 0.4406 -0.0024 -0.0044 -0.0039 1037 HOH B O     
2278 O O     . HOH F .   ? 0.5338 0.5330 0.5307 -0.0003 -0.0010 -0.0019 1038 HOH B O     
2279 O O     . HOH F .   ? 0.5848 0.5770 0.5861 0.0059  0.0023  0.0002  1039 HOH B O     
2280 O O     . HOH F .   ? 0.6028 0.5998 0.5980 0.0005  -0.0014 0.0015  1040 HOH B O     
2281 O O     . HOH F .   ? 0.5683 0.5677 0.5735 -0.0002 -0.0030 0.0021  1041 HOH B O     
2282 O O     . HOH F .   ? 0.4311 0.4283 0.4246 -0.0024 0.0044  0.0005  1042 HOH B O     
2283 O O     . HOH F .   ? 0.5192 0.5074 0.5079 -0.0064 0.0012  -0.0014 1043 HOH B O     
2284 O O     . HOH F .   ? 0.2105 0.2404 0.2126 0.0021  0.0094  0.0184  1044 HOH B O     
2285 O O     . HOH F .   ? 0.2851 0.2754 0.2787 0.0035  -0.0041 0.0006  1045 HOH B O     
2286 O O     . HOH F .   ? 0.2198 0.1910 0.2155 -0.0097 0.0016  0.0059  1046 HOH B O     
2287 O O     . HOH F .   ? 0.4793 0.4812 0.4682 0.0032  -0.0008 0.0014  1047 HOH B O     
2288 O O     . HOH F .   ? 0.4505 0.4587 0.4566 0.0026  -0.0050 -0.0055 1048 HOH B O     
2289 O O     . HOH F .   ? 0.4719 0.4661 0.4831 0.0033  -0.0006 0.0008  1049 HOH B O     
2290 O O     . HOH F .   ? 0.3342 0.3472 0.3360 0.0040  -0.0118 0.0027  1050 HOH B O     
2291 O O     . HOH F .   ? 0.4072 0.4205 0.4098 -0.0030 0.0040  0.0039  1051 HOH B O     
2292 O O     . HOH F .   ? 0.2896 0.3317 0.2759 0.0058  -0.0060 -0.0130 1052 HOH B O     
2293 O O     . HOH F .   ? 0.4981 0.5115 0.5024 -0.0022 -0.0005 -0.0015 1053 HOH B O     
2294 O O     . HOH F .   ? 0.4754 0.4689 0.4519 0.0037  -0.0045 -0.0064 1054 HOH B O     
2295 O O     . HOH F .   ? 0.5964 0.5908 0.5949 0.0001  0.0002  0.0011  1055 HOH B O     
2296 O O     . HOH F .   ? 0.4536 0.4543 0.4395 0.0066  -0.0034 -0.0005 1056 HOH B O     
2297 O O     . HOH F .   ? 0.5352 0.5356 0.5343 0.0006  -0.0012 0.0008  1057 HOH B O     
2298 O O     . HOH F .   ? 0.5903 0.5934 0.5996 0.0010  0.0010  0.0004  1058 HOH B O     
2299 O O     . HOH F .   ? 0.5040 0.5066 0.4901 0.0015  0.0008  0.0015  1059 HOH B O     
2300 O O     . HOH F .   ? 0.2909 0.3435 0.3123 -0.0133 0.0147  0.0046  1060 HOH B O     
2301 O O     . HOH F .   ? 0.4117 0.4117 0.4041 0.0036  -0.0018 0.0033  1061 HOH B O     
2302 O O     . HOH F .   ? 0.3071 0.3036 0.3051 0.0093  0.0071  -0.0008 1062 HOH B O     
2303 O O     . HOH F .   ? 0.5664 0.5712 0.5696 0.0019  0.0020  0.0008  1063 HOH B O     
2304 O O     . HOH F .   ? 0.5309 0.5162 0.5281 0.0045  -0.0019 -0.0022 1064 HOH B O     
2305 O O     . HOH F .   ? 0.5163 0.5156 0.5330 -0.0006 -0.0012 -0.0055 1065 HOH B O     
2306 O O     . HOH F .   ? 0.5196 0.5274 0.5275 -0.0009 0.0046  -0.0004 1066 HOH B O     
2307 O O     . HOH F .   ? 0.4471 0.4573 0.4448 -0.0020 -0.0010 -0.0011 1067 HOH B O     
2308 O O     . HOH F .   ? 0.4132 0.4122 0.4090 -0.0042 0.0002  0.0032  1068 HOH B O     
2309 O O     . HOH F .   ? 0.5107 0.4943 0.4989 0.0006  0.0006  0.0034  1069 HOH B O     
2310 O O     . HOH F .   ? 0.4857 0.4822 0.4819 -0.0016 0.0017  -0.0048 1070 HOH B O     
2311 O O     . HOH F .   ? 0.4704 0.4829 0.4879 -0.0036 -0.0037 0.0035  1071 HOH B O     
2312 O O     . HOH F .   ? 0.4202 0.4028 0.4252 -0.0022 -0.0062 -0.0037 1072 HOH B O     
2313 O O     . HOH F .   ? 0.5434 0.5396 0.5368 0.0025  -0.0026 -0.0022 1073 HOH B O     
2314 O O     . HOH F .   ? 0.5416 0.5390 0.5467 0.0031  0.0014  0.0007  1074 HOH B O     
2315 O O     . HOH F .   ? 0.2956 0.3048 0.2584 0.0113  -0.0213 0.0336  1075 HOH B O     
2316 O O     . HOH F .   ? 0.2630 0.2891 0.2207 0.0077  -0.0119 0.0091  1076 HOH B O     
2317 O O     . HOH F .   ? 0.3728 0.3699 0.3611 -0.0028 -0.0084 0.0042  1077 HOH B O     
2318 O O     . HOH F .   ? 0.3583 0.3628 0.3399 0.0087  -0.0138 0.0011  1078 HOH B O     
2319 O O     . HOH F .   ? 0.5073 0.5088 0.5134 -0.0019 -0.0068 -0.0034 1079 HOH B O     
2320 O O     . HOH F .   ? 0.3262 0.3246 0.3615 -0.0002 -0.0024 0.0037  1080 HOH B O     
2321 O O     . HOH F .   ? 0.5425 0.5492 0.5482 -0.0013 0.0023  -0.0036 1081 HOH B O     
2322 O O     . HOH F .   ? 0.4351 0.4150 0.4437 -0.0021 -0.0093 -0.0053 1082 HOH B O     
2323 O O     . HOH F .   ? 0.2814 0.2699 0.3133 0.0129  -0.0055 -0.0225 1083 HOH B O     
2324 O O     . HOH F .   ? 0.2057 0.2188 0.2464 0.0214  -0.0089 -0.0062 1084 HOH B O     
2325 O O     . HOH F .   ? 0.2569 0.2406 0.2674 0.0016  -0.0058 -0.0089 1085 HOH B O     
2326 O O     . HOH F .   ? 0.2427 0.3098 0.3159 0.0115  -0.0088 -0.0166 1086 HOH B O     
2327 O O     . HOH F .   ? 0.4635 0.4721 0.4665 0.0013  -0.0025 -0.0039 1087 HOH B O     
2328 O O     . HOH F .   ? 0.2236 0.2411 0.2198 -0.0290 -0.0043 -0.0096 1088 HOH B O     
2329 O O     . HOH F .   ? 0.2173 0.2607 0.2164 -0.0155 -0.0011 -0.0145 1089 HOH B O     
2330 O O     . HOH F .   ? 0.1298 0.1588 0.1487 0.0040  -0.0009 -0.0001 1090 HOH B O     
2331 O O     . HOH F .   ? 0.3122 0.3279 0.2952 -0.0236 0.0507  -0.0188 1091 HOH B O     
2332 O O     . HOH F .   ? 0.5080 0.4856 0.5142 -0.0039 -0.0038 0.0018  1092 HOH B O     
2333 O O     . HOH F .   ? 0.6064 0.6014 0.6076 -0.0006 0.0033  -0.0001 1093 HOH B O     
2334 O O     . HOH F .   ? 0.4444 0.4316 0.4412 0.0025  -0.0014 0.0000  1094 HOH B O     
2335 O O     . HOH F .   ? 0.5094 0.4996 0.5016 -0.0030 0.0015  -0.0013 1095 HOH B O     
2336 O O     . HOH F .   ? 0.3068 0.3149 0.3215 0.0016  0.0082  0.0127  1096 HOH B O     
2337 O O     . HOH F .   ? 0.2942 0.2306 0.2611 0.0360  -0.0129 -0.0005 1097 HOH B O     
2338 O O     . HOH F .   ? 0.3303 0.2944 0.2742 0.0037  0.0062  -0.0094 1098 HOH B O     
2339 O O     . HOH F .   ? 0.3040 0.2760 0.3226 -0.0065 -0.0064 -0.0041 1099 HOH B O     
2340 O O     . HOH F .   ? 0.1875 0.2318 0.2834 0.0076  0.0082  -0.0007 1100 HOH B O     
2341 O O     . HOH F .   ? 0.2452 0.2986 0.2802 0.0025  0.0204  -0.0150 1101 HOH B O     
2342 O O     . HOH F .   ? 0.2814 0.3188 0.3548 0.0043  -0.0015 -0.0007 1102 HOH B O     
2343 O O     . HOH F .   ? 0.3092 0.3178 0.3352 0.0000  0.0077  -0.0087 1103 HOH B O     
2344 O O     . HOH F .   ? 0.2916 0.2758 0.3060 -0.0160 0.0230  0.0218  1104 HOH B O     
2345 O O     . HOH F .   ? 0.3954 0.3818 0.3884 -0.0131 0.0007  -0.0033 1105 HOH B O     
2346 O O     . HOH F .   ? 0.4277 0.4350 0.4354 0.0009  -0.0053 -0.0053 1106 HOH B O     
2347 O O     . HOH F .   ? 0.3144 0.2890 0.3021 -0.0017 0.0064  0.0039  1107 HOH B O     
2348 O O     . HOH F .   ? 0.3561 0.3396 0.3562 -0.0120 0.0004  -0.0012 1108 HOH B O     
2349 O O     . HOH F .   ? 0.2374 0.2822 0.2809 0.0136  0.0006  -0.0072 1109 HOH B O     
2350 O O     . HOH F .   ? 0.2891 0.2611 0.3409 -0.0071 -0.0115 0.0068  1110 HOH B O     
2351 O O     . HOH F .   ? 0.1716 0.2108 0.1965 0.0076  -0.0104 -0.0306 1111 HOH B O     
2352 O O     . HOH F .   ? 0.2936 0.2832 0.2800 -0.0057 -0.0037 -0.0001 1112 HOH B O     
2353 O O     . HOH F .   ? 0.3681 0.3707 0.3659 -0.0101 0.0024  -0.0004 1113 HOH B O     
2354 O O     . HOH F .   ? 0.3017 0.3257 0.3216 -0.0405 0.0058  -0.0035 1114 HOH B O     
2355 O O     . HOH F .   ? 0.2146 0.2717 0.2604 -0.0219 0.0370  -0.0103 1115 HOH B O     
2356 O O     . HOH F .   ? 0.4019 0.3873 0.3882 0.0008  0.0050  -0.0079 1116 HOH B O     
2357 O O     . HOH F .   ? 0.3525 0.3243 0.3016 0.0175  -0.0014 0.0003  1117 HOH B O     
2358 O O     . HOH F .   ? 0.2949 0.3338 0.3521 0.0125  0.0028  0.0051  1118 HOH B O     
2359 O O     . HOH F .   ? 0.2368 0.2425 0.2210 0.0225  0.0089  -0.0022 1119 HOH B O     
2360 O O     . HOH F .   ? 0.3898 0.3661 0.3895 -0.0032 -0.0032 -0.0064 1120 HOH B O     
2361 O O     . HOH F .   ? 0.3582 0.3496 0.3583 -0.0081 -0.0016 -0.0063 1121 HOH B O     
2362 O O     . HOH F .   ? 0.5006 0.5111 0.5018 0.0004  -0.0028 0.0007  1122 HOH B O     
2363 O O     . HOH F .   ? 0.4361 0.4465 0.4474 -0.0073 -0.0001 0.0003  1123 HOH B O     
2364 O O     . HOH F .   ? 0.5162 0.5037 0.5146 -0.0044 -0.0009 -0.0002 1124 HOH B O     
2365 O O     . HOH F .   ? 0.4547 0.4177 0.4430 0.0024  -0.0007 0.0020  1125 HOH B O     
2366 O O     . HOH F .   ? 0.2079 0.1579 0.2113 -0.0074 -0.0092 0.0037  1126 HOH B O     
2367 O O     . HOH F .   ? 0.2060 0.1740 0.2246 0.0057  0.0139  0.0249  1127 HOH B O     
2368 O O     . HOH F .   ? 0.1790 0.1626 0.2165 0.0108  0.0164  0.0149  1128 HOH B O     
2369 O O     . HOH F .   ? 0.1788 0.1546 0.2145 -0.0031 0.0069  0.0176  1129 HOH B O     
2370 O O     . HOH F .   ? 0.1262 0.1084 0.1651 -0.0056 0.0097  0.0061  1130 HOH B O     
2371 O O     . HOH F .   ? 0.1492 0.1296 0.1734 0.0030  0.0183  0.0040  1131 HOH B O     
2372 O O     . HOH F .   ? 0.2913 0.2866 0.2774 0.0212  -0.0147 -0.0083 1132 HOH B O     
2373 O O     . HOH F .   ? 0.3257 0.3186 0.3764 -0.0068 -0.0078 -0.0032 1133 HOH B O     
2374 O O     . HOH F .   ? 0.4350 0.4332 0.4469 -0.0082 0.0033  -0.0008 1134 HOH B O     
2375 O O     . HOH F .   ? 0.4914 0.4882 0.4912 -0.0060 -0.0038 -0.0009 1135 HOH B O     
2376 O O     . HOH F .   ? 0.1969 0.2092 0.2458 0.0143  -0.0037 -0.0135 1136 HOH B O     
2377 O O     . HOH F .   ? 0.2573 0.2420 0.2443 0.0330  0.0187  -0.0031 1137 HOH B O     
2378 O O     . HOH F .   ? 0.3475 0.3281 0.3304 -0.0179 0.0036  -0.0003 1138 HOH B O     
2379 O O     . HOH F .   ? 0.4770 0.4948 0.4764 -0.0012 0.0037  0.0049  1139 HOH B O     
2380 O O     . HOH F .   ? 0.3790 0.3935 0.3762 0.0019  0.0001  0.0027  1140 HOH B O     
2381 O O     . HOH F .   ? 0.3528 0.2663 0.2627 0.0271  -0.0287 0.0091  1141 HOH B O     
2382 O O     . HOH F .   ? 0.2146 0.1934 0.1694 0.0054  0.0128  0.0028  1142 HOH B O     
2383 O O     . HOH F .   ? 0.2475 0.2466 0.2345 0.0090  0.0137  -0.0042 1143 HOH B O     
2384 O O     . HOH F .   ? 0.3889 0.3950 0.4008 0.0055  0.0142  -0.0199 1144 HOH B O     
2385 O O     . HOH F .   ? 0.3368 0.3225 0.2976 0.0092  -0.0133 0.0174  1145 HOH B O     
2386 O O     . HOH F .   ? 0.3076 0.2811 0.2834 0.0038  0.0049  0.0088  1146 HOH B O     
2387 O O     . HOH F .   ? 0.3319 0.3726 0.3585 -0.0054 -0.0003 -0.0128 1147 HOH B O     
2388 O O     . HOH F .   ? 0.2772 0.2813 0.2919 -0.0174 -0.0094 0.0029  1148 HOH B O     
2389 O O     . HOH F .   ? 0.4715 0.4560 0.4535 -0.0091 -0.0008 -0.0012 1149 HOH B O     
2390 O O     . HOH F .   ? 0.2060 0.1853 0.1895 -0.0122 0.0131  -0.0080 1150 HOH B O     
2391 O O     . HOH F .   ? 0.1825 0.2040 0.2231 -0.0121 0.0047  0.0156  1151 HOH B O     
2392 O O     . HOH F .   ? 0.1205 0.1168 0.1470 -0.0025 0.0035  0.0057  1152 HOH B O     
2393 O O     . HOH F .   ? 0.1368 0.1508 0.1756 0.0026  -0.0045 0.0048  1153 HOH B O     
2394 O O     . HOH F .   ? 0.3570 0.3834 0.3954 -0.0024 0.0029  0.0076  1154 HOH B O     
2395 O O     . HOH F .   ? 0.3904 0.3897 0.3944 0.0121  -0.0032 0.0058  1155 HOH B O     
2396 O O     . HOH F .   ? 0.3772 0.3602 0.3679 -0.0037 -0.0086 0.0199  1156 HOH B O     
2397 O O     . HOH F .   ? 0.5495 0.5376 0.5452 -0.0042 0.0014  0.0040  1157 HOH B O     
2398 O O     . HOH F .   ? 0.4881 0.4884 0.4805 0.0018  -0.0015 0.0030  1158 HOH B O     
2399 O O     . HOH F .   ? 0.5939 0.5875 0.5957 0.0004  -0.0017 0.0008  1159 HOH B O     
2400 O O     . HOH F .   ? 0.4272 0.3914 0.3900 0.0049  0.0049  -0.0078 1160 HOH B O     
2401 O O     . HOH F .   ? 0.4791 0.4691 0.4813 -0.0022 0.0008  -0.0043 1161 HOH B O     
2402 O O     . HOH F .   ? 0.4755 0.4732 0.4662 0.0025  0.0017  0.0007  1162 HOH B O     
2403 O O     . HOH F .   ? 0.3103 0.2658 0.3258 -0.0297 0.0147  0.0000  1163 HOH B O     
2404 O O     . HOH F .   ? 0.5841 0.5856 0.5839 0.0008  -0.0007 -0.0006 1164 HOH B O     
2405 O O     . HOH F .   ? 0.4668 0.4549 0.4651 -0.0032 0.0013  0.0012  1165 HOH B O     
2406 O O     . HOH F .   ? 0.3420 0.3892 0.3419 -0.0090 0.0043  0.0129  1166 HOH B O     
2407 O O     . HOH F .   ? 0.1981 0.2198 0.2144 0.0109  0.0048  0.0166  1167 HOH B O     
2408 O O     . HOH F .   ? 0.3369 0.3336 0.3173 -0.0038 0.0073  -0.0065 1168 HOH B O     
2409 O O     . HOH F .   ? 0.3381 0.3600 0.3435 -0.0015 0.0009  0.0132  1169 HOH B O     
2410 O O     . HOH F .   ? 0.3729 0.3845 0.3717 0.0002  -0.0094 -0.0039 1170 HOH B O     
2411 O O     . HOH F .   ? 0.3449 0.3431 0.3307 0.0048  -0.0173 0.0145  1171 HOH B O     
2412 O O     . HOH F .   ? 0.3731 0.3666 0.3551 0.0018  -0.0026 -0.0092 1172 HOH B O     
2413 O O     . HOH F .   ? 0.3018 0.2727 0.2294 -0.0228 -0.0221 0.0041  1173 HOH B O     
2414 O O     . HOH F .   ? 0.2530 0.2449 0.2509 -0.0123 0.0040  -0.0016 1174 HOH B O     
2415 O O     . HOH F .   ? 0.4986 0.4803 0.4923 -0.0036 0.0000  -0.0029 1175 HOH B O     
2416 O O     . HOH F .   ? 0.1536 0.1416 0.1565 0.0035  -0.0168 -0.0021 1176 HOH B O     
2417 O O     . HOH F .   ? 0.1721 0.1463 0.1697 0.0054  -0.0211 -0.0116 1177 HOH B O     
2418 O O     . HOH F .   ? 0.3097 0.2584 0.2793 0.0066  -0.0029 0.0064  1178 HOH B O     
2419 O O     . HOH F .   ? 0.2417 0.2319 0.2210 -0.0170 0.0179  -0.0118 1179 HOH B O     
2420 O O     . HOH F .   ? 0.2194 0.1851 0.1586 -0.0263 0.0036  -0.0116 1180 HOH B O     
2421 O O     . HOH F .   ? 0.3505 0.3508 0.3283 -0.0002 0.0056  -0.0008 1181 HOH B O     
2422 O O     . HOH F .   ? 0.4364 0.4328 0.4450 0.0022  0.0038  -0.0081 1182 HOH B O     
2423 O O     . HOH F .   ? 0.4950 0.5014 0.5004 0.0017  0.0029  0.0039  1183 HOH B O     
2424 O O     . HOH F .   ? 0.5503 0.5496 0.5459 -0.0008 -0.0009 0.0011  1184 HOH B O     
2425 O O     . HOH F .   ? 0.4204 0.4297 0.4393 -0.0056 -0.0017 0.0039  1185 HOH B O     
2426 O O     . HOH F .   ? 0.3756 0.3981 0.4122 0.0101  -0.0079 -0.0051 1186 HOH B O     
2427 O O     . HOH F .   ? 0.4768 0.4680 0.4759 -0.0043 -0.0014 -0.0001 1187 HOH B O     
2428 O O     . HOH F .   ? 0.2000 0.1919 0.2218 -0.0134 0.0013  -0.0047 1188 HOH B O     
2429 O O     . HOH F .   ? 0.1869 0.2191 0.2188 0.0267  0.0085  0.0016  1189 HOH B O     
2430 O O     . HOH F .   ? 0.2165 0.2362 0.2235 -0.0075 0.0132  -0.0128 1190 HOH B O     
2431 O O     . HOH F .   ? 0.3257 0.3471 0.3027 -0.0069 0.0004  -0.0042 1191 HOH B O     
2432 O O     . HOH F .   ? 0.3269 0.3247 0.3158 0.0068  -0.0035 -0.0162 1192 HOH B O     
2433 O O     . HOH F .   ? 0.1945 0.1802 0.2268 -0.0100 0.0104  0.0047  1193 HOH B O     
2434 O O     . HOH F .   ? 0.4039 0.4165 0.4070 0.0009  0.0001  0.0048  1194 HOH B O     
2435 O O     . HOH F .   ? 0.4879 0.4814 0.4892 -0.0048 -0.0033 0.0014  1195 HOH B O     
2436 O O     . HOH F .   ? 0.3686 0.3704 0.3662 0.0000  -0.0032 -0.0004 1196 HOH B O     
2437 O O     . HOH F .   ? 0.5023 0.5093 0.5149 0.0009  -0.0064 -0.0019 1197 HOH B O     
2438 O O     . HOH F .   ? 0.2693 0.2827 0.3149 -0.0014 -0.0168 -0.0135 1198 HOH B O     
2439 O O     . HOH F .   ? 0.2866 0.2995 0.2997 0.0015  -0.0114 0.0042  1199 HOH B O     
2440 O O     . HOH F .   ? 0.3537 0.3622 0.3625 -0.0001 -0.0069 -0.0012 1200 HOH B O     
2441 O O     . HOH F .   ? 0.3879 0.3840 0.3877 -0.0063 -0.0035 0.0005  1201 HOH B O     
2442 O O     . HOH F .   ? 0.3056 0.3239 0.3032 -0.0127 0.0000  -0.0080 1202 HOH B O     
2443 O O     . HOH F .   ? 0.3137 0.3062 0.2898 -0.0178 -0.0015 -0.0133 1203 HOH B O     
2444 O O     . HOH F .   ? 0.2094 0.2087 0.2424 -0.0054 -0.0029 0.0085  1204 HOH B O     
2445 O O     . HOH F .   ? 0.3570 0.3382 0.3914 0.0024  -0.0030 0.0192  1205 HOH B O     
2446 O O     . HOH F .   ? 0.2118 0.2240 0.2244 0.0160  -0.0020 0.0076  1206 HOH B O     
2447 O O     . HOH F .   ? 0.1779 0.2163 0.2041 0.0016  -0.0001 0.0081  1207 HOH B O     
2448 O O     . HOH F .   ? 0.1969 0.2206 0.2386 0.0190  -0.0046 0.0073  1208 HOH B O     
2449 O O     . HOH F .   ? 0.3161 0.3287 0.3413 0.0146  -0.0189 0.0138  1209 HOH B O     
2450 O O     . HOH F .   ? 0.4502 0.4605 0.4622 0.0034  0.0089  0.0042  1210 HOH B O     
2451 O O     . HOH F .   ? 0.3450 0.3585 0.3853 0.0045  -0.0001 -0.0015 1211 HOH B O     
2452 O O     . HOH F .   ? 0.4819 0.5049 0.4788 0.0077  -0.0021 -0.0009 1212 HOH B O     
2453 O O     . HOH F .   ? 0.4402 0.4493 0.4475 0.0000  -0.0011 0.0000  1213 HOH B O     
2454 O O     . HOH F .   ? 0.6071 0.6064 0.6034 -0.0002 -0.0003 0.0003  1214 HOH B O     
2455 O O     . HOH F .   ? 0.4468 0.4410 0.4386 0.0033  -0.0009 0.0012  1215 HOH B O     
2456 O O     . HOH F .   ? 0.5648 0.5689 0.5652 0.0002  0.0008  -0.0010 1216 HOH B O     
2457 O O     . HOH F .   ? 0.3150 0.3207 0.3084 -0.0022 -0.0098 0.0234  1217 HOH B O     
2458 O O     . HOH F .   ? 0.3849 0.3868 0.3920 0.0012  -0.0002 -0.0007 1218 HOH B O     
2459 O O     . HOH F .   ? 0.5745 0.5765 0.5729 0.0003  0.0015  -0.0008 1219 HOH B O     
2460 O O     . HOH F .   ? 0.4367 0.4318 0.4483 0.0044  0.0005  0.0038  1220 HOH B O     
2461 O O     . HOH F .   ? 0.4425 0.4287 0.4443 0.0034  -0.0082 -0.0028 1221 HOH B O     
2462 O O     . HOH F .   ? 0.2859 0.2318 0.3045 0.0202  -0.0161 0.0042  1222 HOH B O     
2463 O O     . HOH F .   ? 0.5071 0.5026 0.5043 0.0024  -0.0032 -0.0019 1223 HOH B O     
2464 O O     . HOH F .   ? 0.4767 0.4769 0.4933 0.0050  -0.0030 -0.0029 1224 HOH B O     
2465 O O     . HOH F .   ? 0.1372 0.1854 0.2117 0.0030  -0.0073 -0.0201 1225 HOH B O     
2466 O O     . HOH F .   ? 0.2174 0.1834 0.2800 -0.0066 0.0139  -0.0196 1226 HOH B O     
2467 O O     . HOH F .   ? 0.4495 0.4625 0.4482 0.0047  0.0014  0.0044  1227 HOH B O     
2468 O O     . HOH F .   ? 0.4273 0.4212 0.4223 -0.0057 0.0064  0.0031  1228 HOH B O     
2469 O O     . HOH F .   ? 0.3814 0.3854 0.3774 -0.0069 0.0098  0.0021  1229 HOH B O     
2470 O O     . HOH F .   ? 0.3374 0.3114 0.3225 0.0081  0.0051  -0.0049 1230 HOH B O     
2471 O O     . HOH F .   ? 0.2304 0.2294 0.2816 -0.0147 -0.0036 -0.0071 1231 HOH B O     
2472 O O     . HOH F .   ? 0.4118 0.4162 0.4255 -0.0049 0.0017  0.0088  1232 HOH B O     
2473 O O     . HOH F .   ? 0.1814 0.1673 0.2187 -0.0155 0.0161  0.0113  1233 HOH B O     
2474 O O     . HOH F .   ? 0.3904 0.4287 0.3822 -0.0063 0.0032  0.0093  1234 HOH B O     
2475 O O     . HOH F .   ? 0.3329 0.2823 0.3477 -0.0011 -0.0211 0.0027  1235 HOH B O     
2476 O O     . HOH F .   ? 0.4412 0.4244 0.4389 -0.0007 -0.0001 0.0002  1236 HOH B O     
2477 O O     . HOH F .   ? 0.5814 0.5823 0.5839 0.0005  -0.0016 -0.0015 1237 HOH B O     
2478 O O     . HOH F .   ? 0.2946 0.3099 0.3099 0.0022  0.0129  0.0053  1238 HOH B O     
2479 O O     . HOH F .   ? 0.2814 0.2727 0.2810 0.0232  0.0374  0.0093  1239 HOH B O     
2480 O O     . HOH F .   ? 0.2351 0.1973 0.2180 -0.0002 0.0120  0.0068  1240 HOH B O     
2481 O O     . HOH F .   ? 0.5012 0.5128 0.5083 -0.0029 -0.0007 0.0032  1241 HOH B O     
2482 O O     . HOH F .   ? 0.4250 0.4269 0.4474 -0.0014 -0.0002 0.0000  1242 HOH B O     
2483 O O     . HOH F .   ? 0.4630 0.4598 0.4517 -0.0051 0.0011  0.0014  1243 HOH B O     
2484 O O     . HOH F .   ? 0.4470 0.4607 0.4450 -0.0020 -0.0003 -0.0010 1244 HOH B O     
2485 O O     . HOH F .   ? 0.3974 0.3768 0.3590 -0.0045 0.0078  0.0061  1245 HOH B O     
2486 O O     . HOH F .   ? 0.4527 0.4456 0.4377 -0.0038 -0.0021 0.0026  1246 HOH B O     
2487 O O     . HOH F .   ? 0.4650 0.4522 0.4538 0.0050  -0.0027 0.0019  1247 HOH B O     
2488 O O     . HOH F .   ? 0.4569 0.4562 0.4497 0.0019  0.0008  0.0030  1248 HOH B O     
2489 O O     . HOH F .   ? 0.4395 0.4311 0.4381 0.0006  0.0087  -0.0016 1249 HOH B O     
2490 O O     . HOH F .   ? 0.4117 0.4025 0.3977 -0.0159 -0.0063 0.0025  1250 HOH B O     
2491 O O     . HOH F .   ? 0.4761 0.4764 0.4781 -0.0014 -0.0032 0.0014  1251 HOH B O     
2492 O O     . HOH F .   ? 0.4677 0.4672 0.4628 -0.0016 -0.0011 0.0055  1252 HOH B O     
2493 O O     . HOH F .   ? 0.4758 0.4669 0.4797 -0.0018 0.0017  0.0000  1253 HOH B O     
2494 O O     . HOH F .   ? 0.5096 0.5115 0.5072 0.0009  -0.0033 0.0038  1254 HOH B O     
2495 O O     . HOH F .   ? 0.4482 0.4350 0.4266 -0.0022 0.0035  0.0043  1255 HOH B O     
2496 O O     . HOH F .   ? 0.4893 0.5035 0.4921 -0.0013 -0.0025 0.0000  1256 HOH B O     
2497 O O     . HOH F .   ? 0.4892 0.4743 0.4817 -0.0048 0.0017  0.0009  1257 HOH B O     
2498 O O     . HOH F .   ? 0.5038 0.5098 0.4968 -0.0007 0.0001  0.0000  1258 HOH B O     
2499 O O     . HOH F .   ? 0.5011 0.4924 0.5052 0.0033  0.0011  -0.0015 1259 HOH B O     
2500 O O     . HOH F .   ? 0.4688 0.4668 0.4798 -0.0011 -0.0011 0.0057  1260 HOH B O     
2501 O O     . HOH F .   ? 0.4915 0.4998 0.4988 -0.0057 0.0011  0.0005  1261 HOH B O     
2502 O O     . HOH F .   ? 0.5293 0.5227 0.5279 -0.0012 -0.0027 0.0003  1262 HOH B O     
2503 O O     . HOH F .   ? 0.4600 0.4512 0.4574 -0.0022 -0.0025 -0.0017 1263 HOH B O     
2504 O O     . HOH F .   ? 0.5082 0.5066 0.4980 -0.0019 0.0047  0.0010  1264 HOH B O     
2505 O O     . HOH F .   ? 0.3482 0.3189 0.3567 0.0016  -0.0016 -0.0051 1265 HOH B O     
2506 O O     . HOH F .   ? 0.3575 0.3615 0.3483 0.0024  -0.0086 0.0010  1266 HOH B O     
2507 O O     . HOH F .   ? 0.3662 0.3374 0.3359 0.0082  0.0027  -0.0051 1267 HOH B O     
2508 O O     . HOH F .   ? 0.3536 0.3694 0.3589 -0.0160 -0.0084 0.0128  1268 HOH B O     
2509 O O     . HOH F .   ? 0.3508 0.3025 0.3231 0.0083  -0.0038 0.0114  1269 HOH B O     
2510 O O     . HOH F .   ? 0.3318 0.3388 0.3274 0.0102  -0.0119 0.0116  1270 HOH B O     
2511 O O     . HOH F .   ? 0.3457 0.3325 0.3691 -0.0098 0.0086  -0.0014 1271 HOH B O     
2512 O O     . HOH F .   ? 0.3732 0.3681 0.3435 0.0010  0.0063  0.0027  1272 HOH B O     
2513 O O     . HOH F .   ? 0.3409 0.3381 0.3300 0.0029  -0.0053 0.0031  1273 HOH B O     
2514 O O     . HOH F .   ? 0.3509 0.3647 0.3748 -0.0001 -0.0026 -0.0017 1274 HOH B O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  MET 30  30  30  MET MET A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  CYS 40  40  40  CYS CYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  CYS 72  72  72  CYS CYS A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 CYS 110 110 110 CYS CYS A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
B 1 1   LYS 1   1   1   LYS LYS B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   ALA 5   5   5   ALA ALA B . n 
B 1 6   ALA 6   6   6   ALA ALA B . n 
B 1 7   LYS 7   7   7   LYS LYS B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  ARG 10  10  10  ARG ARG B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  HIS 12  12  12  HIS HIS B . n 
B 1 13  MET 13  13  13  MET MET B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  SER 18  18  18  SER SER B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  ALA 20  20  20  ALA ALA B . n 
B 1 21  SER 21  21  21  SER SER B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  ASN 24  24  24  ASN ASN B . n 
B 1 25  TYR 25  25  25  TYR TYR B . n 
B 1 26  CYS 26  26  26  CYS CYS B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  GLN 28  28  28  GLN GLN B . n 
B 1 29  MET 29  29  29  MET MET B . n 
B 1 30  MET 30  30  30  MET MET B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  ARG 33  33  33  ARG ARG B . n 
B 1 34  ASN 34  34  34  ASN ASN B . n 
B 1 35  LEU 35  35  35  LEU LEU B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  ARG 39  39  39  ARG ARG B . n 
B 1 40  CYS 40  40  40  CYS CYS B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  PHE 46  46  46  PHE PHE B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  CYS 58  58  58  CYS CYS B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  GLN 60  60  60  GLN GLN B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  ASN 62  62  62  ASN ASN B . n 
B 1 63  VAL 63  63  63  VAL VAL B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  CYS 65  65  65  CYS CYS B . n 
B 1 66  LYS 66  66  66  LYS LYS B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ASN 71  71  71  ASN ASN B . n 
B 1 72  CYS 72  72  72  CYS CYS B . n 
B 1 73  TYR 73  73  73  TYR TYR B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  THR 78  78  78  THR THR B . n 
B 1 79  MET 79  79  79  MET MET B . n 
B 1 80  SER 80  80  80  SER SER B . n 
B 1 81  ILE 81  81  81  ILE ILE B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  CYS 84  84  84  CYS CYS B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  THR 87  87  87  THR THR B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  TYR 92  92  92  TYR TYR B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  ASN 94  94  94  ASN ASN B . n 
B 1 95  CYS 95  95  95  CYS CYS B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 THR 100 100 100 THR THR B . n 
B 1 101 GLN 101 101 101 GLN GLN B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 ASN 103 103 103 ASN ASN B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 HIS 105 105 105 HIS HIS B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 CYS 110 110 110 CYS CYS B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 GLY 112 112 112 GLY GLY B . n 
B 1 113 ASN 113 113 113 ASN ASN B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 PRO 117 117 117 PRO PRO B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 HIS 119 119 119 HIS HIS B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 SER 123 123 123 SER SER B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 A2P 1   998  998 A2P A2P A . 
D 2 A2P 1   999  999 A2P A2P B . 
E 3 HOH 1   999  13  HOH WAT A . 
E 3 HOH 2   1000 22  HOH WAT A . 
E 3 HOH 3   1001 23  HOH WAT A . 
E 3 HOH 4   1002 24  HOH WAT A . 
E 3 HOH 5   1003 26  HOH WAT A . 
E 3 HOH 6   1004 27  HOH WAT A . 
E 3 HOH 7   1005 28  HOH WAT A . 
E 3 HOH 8   1006 29  HOH WAT A . 
E 3 HOH 9   1007 31  HOH WAT A . 
E 3 HOH 10  1008 35  HOH WAT A . 
E 3 HOH 11  1009 36  HOH WAT A . 
E 3 HOH 12  1010 37  HOH WAT A . 
E 3 HOH 13  1011 38  HOH WAT A . 
E 3 HOH 14  1012 39  HOH WAT A . 
E 3 HOH 15  1013 40  HOH WAT A . 
E 3 HOH 16  1014 41  HOH WAT A . 
E 3 HOH 17  1015 42  HOH WAT A . 
E 3 HOH 18  1016 43  HOH WAT A . 
E 3 HOH 19  1017 44  HOH WAT A . 
E 3 HOH 20  1018 45  HOH WAT A . 
E 3 HOH 21  1019 46  HOH WAT A . 
E 3 HOH 22  1020 54  HOH WAT A . 
E 3 HOH 23  1021 55  HOH WAT A . 
E 3 HOH 24  1022 58  HOH WAT A . 
E 3 HOH 25  1023 59  HOH WAT A . 
E 3 HOH 26  1024 60  HOH WAT A . 
E 3 HOH 27  1025 61  HOH WAT A . 
E 3 HOH 28  1026 86  HOH WAT A . 
E 3 HOH 29  1027 87  HOH WAT A . 
E 3 HOH 30  1028 93  HOH WAT A . 
E 3 HOH 31  1029 94  HOH WAT A . 
E 3 HOH 32  1030 95  HOH WAT A . 
E 3 HOH 33  1031 102 HOH WAT A . 
E 3 HOH 34  1032 113 HOH WAT A . 
E 3 HOH 35  1033 127 HOH WAT A . 
E 3 HOH 36  1034 128 HOH WAT A . 
E 3 HOH 37  1035 129 HOH WAT A . 
E 3 HOH 38  1036 130 HOH WAT A . 
E 3 HOH 39  1037 132 HOH WAT A . 
E 3 HOH 40  1038 133 HOH WAT A . 
E 3 HOH 41  1039 134 HOH WAT A . 
E 3 HOH 42  1040 135 HOH WAT A . 
E 3 HOH 43  1041 136 HOH WAT A . 
E 3 HOH 44  1042 137 HOH WAT A . 
E 3 HOH 45  1043 138 HOH WAT A . 
E 3 HOH 46  1044 140 HOH WAT A . 
E 3 HOH 47  1045 141 HOH WAT A . 
E 3 HOH 48  1046 142 HOH WAT A . 
E 3 HOH 49  1047 143 HOH WAT A . 
E 3 HOH 50  1048 144 HOH WAT A . 
E 3 HOH 51  1049 145 HOH WAT A . 
E 3 HOH 52  1050 146 HOH WAT A . 
E 3 HOH 53  1051 147 HOH WAT A . 
E 3 HOH 54  1052 148 HOH WAT A . 
E 3 HOH 55  1053 149 HOH WAT A . 
E 3 HOH 56  1054 150 HOH WAT A . 
E 3 HOH 57  1055 151 HOH WAT A . 
E 3 HOH 58  1056 152 HOH WAT A . 
E 3 HOH 59  1057 153 HOH WAT A . 
E 3 HOH 60  1058 154 HOH WAT A . 
E 3 HOH 61  1059 155 HOH WAT A . 
E 3 HOH 62  1060 156 HOH WAT A . 
E 3 HOH 63  1061 157 HOH WAT A . 
E 3 HOH 64  1062 158 HOH WAT A . 
E 3 HOH 65  1063 159 HOH WAT A . 
E 3 HOH 66  1064 160 HOH WAT A . 
E 3 HOH 67  1065 161 HOH WAT A . 
E 3 HOH 68  1066 162 HOH WAT A . 
E 3 HOH 69  1067 163 HOH WAT A . 
E 3 HOH 70  1068 164 HOH WAT A . 
E 3 HOH 71  1069 165 HOH WAT A . 
E 3 HOH 72  1070 166 HOH WAT A . 
E 3 HOH 73  1071 167 HOH WAT A . 
E 3 HOH 74  1072 168 HOH WAT A . 
E 3 HOH 75  1073 169 HOH WAT A . 
E 3 HOH 76  1074 170 HOH WAT A . 
E 3 HOH 77  1075 171 HOH WAT A . 
E 3 HOH 78  1076 172 HOH WAT A . 
E 3 HOH 79  1077 173 HOH WAT A . 
E 3 HOH 80  1078 175 HOH WAT A . 
E 3 HOH 81  1079 176 HOH WAT A . 
E 3 HOH 82  1080 177 HOH WAT A . 
E 3 HOH 83  1081 178 HOH WAT A . 
E 3 HOH 84  1082 179 HOH WAT A . 
E 3 HOH 85  1083 180 HOH WAT A . 
E 3 HOH 86  1084 181 HOH WAT A . 
E 3 HOH 87  1085 182 HOH WAT A . 
E 3 HOH 88  1086 183 HOH WAT A . 
E 3 HOH 89  1087 184 HOH WAT A . 
E 3 HOH 90  1088 185 HOH WAT A . 
E 3 HOH 91  1089 186 HOH WAT A . 
E 3 HOH 92  1090 187 HOH WAT A . 
E 3 HOH 93  1091 188 HOH WAT A . 
E 3 HOH 94  1092 189 HOH WAT A . 
E 3 HOH 95  1093 190 HOH WAT A . 
E 3 HOH 96  1094 191 HOH WAT A . 
E 3 HOH 97  1095 192 HOH WAT A . 
E 3 HOH 98  1096 193 HOH WAT A . 
E 3 HOH 99  1097 194 HOH WAT A . 
E 3 HOH 100 1098 195 HOH WAT A . 
E 3 HOH 101 1099 196 HOH WAT A . 
E 3 HOH 102 1100 197 HOH WAT A . 
E 3 HOH 103 1101 198 HOH WAT A . 
E 3 HOH 104 1102 199 HOH WAT A . 
E 3 HOH 105 1103 200 HOH WAT A . 
E 3 HOH 106 1104 201 HOH WAT A . 
E 3 HOH 107 1105 202 HOH WAT A . 
E 3 HOH 108 1106 203 HOH WAT A . 
E 3 HOH 109 1107 204 HOH WAT A . 
E 3 HOH 110 1108 205 HOH WAT A . 
E 3 HOH 111 1109 206 HOH WAT A . 
E 3 HOH 112 1110 207 HOH WAT A . 
E 3 HOH 113 1111 208 HOH WAT A . 
E 3 HOH 114 1112 209 HOH WAT A . 
E 3 HOH 115 1113 210 HOH WAT A . 
E 3 HOH 116 1114 211 HOH WAT A . 
E 3 HOH 117 1115 212 HOH WAT A . 
E 3 HOH 118 1116 213 HOH WAT A . 
E 3 HOH 119 1117 214 HOH WAT A . 
E 3 HOH 120 1118 215 HOH WAT A . 
E 3 HOH 121 1119 216 HOH WAT A . 
E 3 HOH 122 1120 217 HOH WAT A . 
E 3 HOH 123 1121 218 HOH WAT A . 
E 3 HOH 124 1122 219 HOH WAT A . 
E 3 HOH 125 1123 220 HOH WAT A . 
E 3 HOH 126 1124 221 HOH WAT A . 
E 3 HOH 127 1125 222 HOH WAT A . 
E 3 HOH 128 1126 223 HOH WAT A . 
E 3 HOH 129 1127 224 HOH WAT A . 
E 3 HOH 130 1128 225 HOH WAT A . 
E 3 HOH 131 1129 226 HOH WAT A . 
E 3 HOH 132 1130 227 HOH WAT A . 
E 3 HOH 133 1131 228 HOH WAT A . 
E 3 HOH 134 1132 229 HOH WAT A . 
E 3 HOH 135 1133 230 HOH WAT A . 
E 3 HOH 136 1134 231 HOH WAT A . 
E 3 HOH 137 1135 232 HOH WAT A . 
E 3 HOH 138 1136 233 HOH WAT A . 
E 3 HOH 139 1137 234 HOH WAT A . 
E 3 HOH 140 1138 235 HOH WAT A . 
E 3 HOH 141 1139 236 HOH WAT A . 
E 3 HOH 142 1140 237 HOH WAT A . 
E 3 HOH 143 1141 238 HOH WAT A . 
E 3 HOH 144 1142 239 HOH WAT A . 
E 3 HOH 145 1143 240 HOH WAT A . 
E 3 HOH 146 1144 241 HOH WAT A . 
E 3 HOH 147 1145 242 HOH WAT A . 
E 3 HOH 148 1146 243 HOH WAT A . 
E 3 HOH 149 1147 244 HOH WAT A . 
E 3 HOH 150 1148 245 HOH WAT A . 
E 3 HOH 151 1149 246 HOH WAT A . 
E 3 HOH 152 1150 247 HOH WAT A . 
E 3 HOH 153 1151 248 HOH WAT A . 
E 3 HOH 154 1152 249 HOH WAT A . 
E 3 HOH 155 1153 250 HOH WAT A . 
E 3 HOH 156 1154 251 HOH WAT A . 
E 3 HOH 157 1155 252 HOH WAT A . 
E 3 HOH 158 1156 253 HOH WAT A . 
E 3 HOH 159 1157 254 HOH WAT A . 
E 3 HOH 160 1158 255 HOH WAT A . 
E 3 HOH 161 1159 256 HOH WAT A . 
E 3 HOH 162 1160 257 HOH WAT A . 
E 3 HOH 163 1161 258 HOH WAT A . 
E 3 HOH 164 1162 259 HOH WAT A . 
E 3 HOH 165 1163 260 HOH WAT A . 
E 3 HOH 166 1164 261 HOH WAT A . 
E 3 HOH 167 1165 262 HOH WAT A . 
E 3 HOH 168 1166 263 HOH WAT A . 
E 3 HOH 169 1167 264 HOH WAT A . 
E 3 HOH 170 1168 265 HOH WAT A . 
E 3 HOH 171 1169 266 HOH WAT A . 
E 3 HOH 172 1170 267 HOH WAT A . 
E 3 HOH 173 1171 269 HOH WAT A . 
E 3 HOH 174 1172 270 HOH WAT A . 
E 3 HOH 175 1173 271 HOH WAT A . 
E 3 HOH 176 1174 273 HOH WAT A . 
E 3 HOH 177 1175 274 HOH WAT A . 
E 3 HOH 178 1176 275 HOH WAT A . 
E 3 HOH 179 1177 276 HOH WAT A . 
E 3 HOH 180 1178 277 HOH WAT A . 
E 3 HOH 181 1179 278 HOH WAT A . 
E 3 HOH 182 1180 279 HOH WAT A . 
E 3 HOH 183 1181 280 HOH WAT A . 
E 3 HOH 184 1182 281 HOH WAT A . 
E 3 HOH 185 1183 282 HOH WAT A . 
E 3 HOH 186 1184 284 HOH WAT A . 
E 3 HOH 187 1185 286 HOH WAT A . 
E 3 HOH 188 1186 288 HOH WAT A . 
E 3 HOH 189 1187 289 HOH WAT A . 
E 3 HOH 190 1188 290 HOH WAT A . 
E 3 HOH 191 1189 291 HOH WAT A . 
E 3 HOH 192 1190 292 HOH WAT A . 
E 3 HOH 193 1191 305 HOH WAT A . 
E 3 HOH 194 1192 313 HOH WAT A . 
E 3 HOH 195 1193 314 HOH WAT A . 
E 3 HOH 196 1194 315 HOH WAT A . 
E 3 HOH 197 1195 316 HOH WAT A . 
E 3 HOH 198 1196 317 HOH WAT A . 
E 3 HOH 199 1197 319 HOH WAT A . 
E 3 HOH 200 1198 320 HOH WAT A . 
E 3 HOH 201 1199 321 HOH WAT A . 
E 3 HOH 202 1200 322 HOH WAT A . 
E 3 HOH 203 1201 323 HOH WAT A . 
E 3 HOH 204 1202 325 HOH WAT A . 
E 3 HOH 205 1203 326 HOH WAT A . 
E 3 HOH 206 1204 327 HOH WAT A . 
E 3 HOH 207 1205 328 HOH WAT A . 
E 3 HOH 208 1206 329 HOH WAT A . 
E 3 HOH 209 1207 330 HOH WAT A . 
E 3 HOH 210 1208 331 HOH WAT A . 
E 3 HOH 211 1209 332 HOH WAT A . 
E 3 HOH 212 1210 333 HOH WAT A . 
E 3 HOH 213 1211 334 HOH WAT A . 
E 3 HOH 214 1212 335 HOH WAT A . 
E 3 HOH 215 1213 336 HOH WAT A . 
E 3 HOH 216 1214 338 HOH WAT A . 
E 3 HOH 217 1215 339 HOH WAT A . 
E 3 HOH 218 1216 340 HOH WAT A . 
E 3 HOH 219 1217 374 HOH WAT A . 
E 3 HOH 220 1218 386 HOH WAT A . 
E 3 HOH 221 1219 387 HOH WAT A . 
E 3 HOH 222 1220 388 HOH WAT A . 
E 3 HOH 223 1221 389 HOH WAT A . 
E 3 HOH 224 1222 390 HOH WAT A . 
E 3 HOH 225 1223 401 HOH WAT A . 
E 3 HOH 226 1224 449 HOH WAT A . 
E 3 HOH 227 1225 459 HOH WAT A . 
E 3 HOH 228 1226 463 HOH WAT A . 
E 3 HOH 229 1227 464 HOH WAT A . 
E 3 HOH 230 1228 465 HOH WAT A . 
E 3 HOH 231 1229 467 HOH WAT A . 
E 3 HOH 232 1230 470 HOH WAT A . 
E 3 HOH 233 1231 473 HOH WAT A . 
E 3 HOH 234 1232 476 HOH WAT A . 
E 3 HOH 235 1233 477 HOH WAT A . 
E 3 HOH 236 1234 478 HOH WAT A . 
E 3 HOH 237 1235 479 HOH WAT A . 
E 3 HOH 238 1236 481 HOH WAT A . 
E 3 HOH 239 1237 488 HOH WAT A . 
E 3 HOH 240 1238 490 HOH WAT A . 
E 3 HOH 241 1239 491 HOH WAT A . 
E 3 HOH 242 1240 496 HOH WAT A . 
E 3 HOH 243 1241 497 HOH WAT A . 
E 3 HOH 244 1242 500 HOH WAT A . 
E 3 HOH 245 1243 501 HOH WAT A . 
E 3 HOH 246 1244 502 HOH WAT A . 
E 3 HOH 247 1245 503 HOH WAT A . 
E 3 HOH 248 1246 504 HOH WAT A . 
E 3 HOH 249 1247 505 HOH WAT A . 
E 3 HOH 250 1248 506 HOH WAT A . 
E 3 HOH 251 1249 508 HOH WAT A . 
E 3 HOH 252 1250 509 HOH WAT A . 
E 3 HOH 253 1251 513 HOH WAT A . 
E 3 HOH 254 1252 514 HOH WAT A . 
E 3 HOH 255 1253 515 HOH WAT A . 
E 3 HOH 256 1254 521 HOH WAT A . 
E 3 HOH 257 1255 522 HOH WAT A . 
E 3 HOH 258 1256 523 HOH WAT A . 
E 3 HOH 259 1257 524 HOH WAT A . 
E 3 HOH 260 1258 525 HOH WAT A . 
E 3 HOH 261 1259 526 HOH WAT A . 
E 3 HOH 262 1260 527 HOH WAT A . 
E 3 HOH 263 1261 528 HOH WAT A . 
E 3 HOH 264 1262 529 HOH WAT A . 
E 3 HOH 265 1263 530 HOH WAT A . 
E 3 HOH 266 1264 531 HOH WAT A . 
E 3 HOH 267 1265 532 HOH WAT A . 
E 3 HOH 268 1266 533 HOH WAT A . 
E 3 HOH 269 1267 534 HOH WAT A . 
E 3 HOH 270 1268 539 HOH WAT A . 
E 3 HOH 271 1269 540 HOH WAT A . 
E 3 HOH 272 1270 541 HOH WAT A . 
E 3 HOH 273 1271 542 HOH WAT A . 
E 3 HOH 274 1272 543 HOH WAT A . 
E 3 HOH 275 1273 544 HOH WAT A . 
E 3 HOH 276 1274 545 HOH WAT A . 
E 3 HOH 277 1275 546 HOH WAT A . 
E 3 HOH 278 1276 547 HOH WAT A . 
E 3 HOH 279 1277 548 HOH WAT A . 
E 3 HOH 280 1278 549 HOH WAT A . 
E 3 HOH 281 1279 550 HOH WAT A . 
E 3 HOH 282 1280 556 HOH WAT A . 
E 3 HOH 283 1281 558 HOH WAT A . 
F 3 HOH 1   1000 1   HOH WAT B . 
F 3 HOH 2   1001 2   HOH WAT B . 
F 3 HOH 3   1002 3   HOH WAT B . 
F 3 HOH 4   1003 4   HOH WAT B . 
F 3 HOH 5   1004 5   HOH WAT B . 
F 3 HOH 6   1005 6   HOH WAT B . 
F 3 HOH 7   1006 7   HOH WAT B . 
F 3 HOH 8   1007 8   HOH WAT B . 
F 3 HOH 9   1008 9   HOH WAT B . 
F 3 HOH 10  1009 10  HOH WAT B . 
F 3 HOH 11  1010 11  HOH WAT B . 
F 3 HOH 12  1011 12  HOH WAT B . 
F 3 HOH 13  1012 14  HOH WAT B . 
F 3 HOH 14  1013 15  HOH WAT B . 
F 3 HOH 15  1014 16  HOH WAT B . 
F 3 HOH 16  1015 17  HOH WAT B . 
F 3 HOH 17  1016 18  HOH WAT B . 
F 3 HOH 18  1017 19  HOH WAT B . 
F 3 HOH 19  1018 20  HOH WAT B . 
F 3 HOH 20  1019 21  HOH WAT B . 
F 3 HOH 21  1020 25  HOH WAT B . 
F 3 HOH 22  1021 30  HOH WAT B . 
F 3 HOH 23  1022 32  HOH WAT B . 
F 3 HOH 24  1023 33  HOH WAT B . 
F 3 HOH 25  1024 34  HOH WAT B . 
F 3 HOH 26  1025 47  HOH WAT B . 
F 3 HOH 27  1026 48  HOH WAT B . 
F 3 HOH 28  1027 49  HOH WAT B . 
F 3 HOH 29  1028 50  HOH WAT B . 
F 3 HOH 30  1029 51  HOH WAT B . 
F 3 HOH 31  1030 52  HOH WAT B . 
F 3 HOH 32  1031 53  HOH WAT B . 
F 3 HOH 33  1032 56  HOH WAT B . 
F 3 HOH 34  1033 57  HOH WAT B . 
F 3 HOH 35  1034 62  HOH WAT B . 
F 3 HOH 36  1035 63  HOH WAT B . 
F 3 HOH 37  1036 64  HOH WAT B . 
F 3 HOH 38  1037 65  HOH WAT B . 
F 3 HOH 39  1038 66  HOH WAT B . 
F 3 HOH 40  1039 67  HOH WAT B . 
F 3 HOH 41  1040 68  HOH WAT B . 
F 3 HOH 42  1041 69  HOH WAT B . 
F 3 HOH 43  1042 70  HOH WAT B . 
F 3 HOH 44  1043 71  HOH WAT B . 
F 3 HOH 45  1044 72  HOH WAT B . 
F 3 HOH 46  1045 73  HOH WAT B . 
F 3 HOH 47  1046 74  HOH WAT B . 
F 3 HOH 48  1047 75  HOH WAT B . 
F 3 HOH 49  1048 76  HOH WAT B . 
F 3 HOH 50  1049 77  HOH WAT B . 
F 3 HOH 51  1050 78  HOH WAT B . 
F 3 HOH 52  1051 79  HOH WAT B . 
F 3 HOH 53  1052 80  HOH WAT B . 
F 3 HOH 54  1053 81  HOH WAT B . 
F 3 HOH 55  1054 82  HOH WAT B . 
F 3 HOH 56  1055 83  HOH WAT B . 
F 3 HOH 57  1056 84  HOH WAT B . 
F 3 HOH 58  1057 85  HOH WAT B . 
F 3 HOH 59  1058 88  HOH WAT B . 
F 3 HOH 60  1059 89  HOH WAT B . 
F 3 HOH 61  1060 90  HOH WAT B . 
F 3 HOH 62  1061 91  HOH WAT B . 
F 3 HOH 63  1062 92  HOH WAT B . 
F 3 HOH 64  1063 96  HOH WAT B . 
F 3 HOH 65  1064 97  HOH WAT B . 
F 3 HOH 66  1065 98  HOH WAT B . 
F 3 HOH 67  1066 99  HOH WAT B . 
F 3 HOH 68  1067 100 HOH WAT B . 
F 3 HOH 69  1068 101 HOH WAT B . 
F 3 HOH 70  1069 103 HOH WAT B . 
F 3 HOH 71  1070 104 HOH WAT B . 
F 3 HOH 72  1071 105 HOH WAT B . 
F 3 HOH 73  1072 106 HOH WAT B . 
F 3 HOH 74  1073 107 HOH WAT B . 
F 3 HOH 75  1074 108 HOH WAT B . 
F 3 HOH 76  1075 109 HOH WAT B . 
F 3 HOH 77  1076 110 HOH WAT B . 
F 3 HOH 78  1077 111 HOH WAT B . 
F 3 HOH 79  1078 112 HOH WAT B . 
F 3 HOH 80  1079 114 HOH WAT B . 
F 3 HOH 81  1080 115 HOH WAT B . 
F 3 HOH 82  1081 116 HOH WAT B . 
F 3 HOH 83  1082 117 HOH WAT B . 
F 3 HOH 84  1083 118 HOH WAT B . 
F 3 HOH 85  1084 119 HOH WAT B . 
F 3 HOH 86  1085 120 HOH WAT B . 
F 3 HOH 87  1086 121 HOH WAT B . 
F 3 HOH 88  1087 122 HOH WAT B . 
F 3 HOH 89  1088 123 HOH WAT B . 
F 3 HOH 90  1089 124 HOH WAT B . 
F 3 HOH 91  1090 125 HOH WAT B . 
F 3 HOH 92  1091 126 HOH WAT B . 
F 3 HOH 93  1092 131 HOH WAT B . 
F 3 HOH 94  1093 139 HOH WAT B . 
F 3 HOH 95  1094 174 HOH WAT B . 
F 3 HOH 96  1095 268 HOH WAT B . 
F 3 HOH 97  1096 272 HOH WAT B . 
F 3 HOH 98  1097 283 HOH WAT B . 
F 3 HOH 99  1098 285 HOH WAT B . 
F 3 HOH 100 1099 287 HOH WAT B . 
F 3 HOH 101 1100 293 HOH WAT B . 
F 3 HOH 102 1101 294 HOH WAT B . 
F 3 HOH 103 1102 295 HOH WAT B . 
F 3 HOH 104 1103 296 HOH WAT B . 
F 3 HOH 105 1104 297 HOH WAT B . 
F 3 HOH 106 1105 298 HOH WAT B . 
F 3 HOH 107 1106 299 HOH WAT B . 
F 3 HOH 108 1107 300 HOH WAT B . 
F 3 HOH 109 1108 301 HOH WAT B . 
F 3 HOH 110 1109 302 HOH WAT B . 
F 3 HOH 111 1110 303 HOH WAT B . 
F 3 HOH 112 1111 304 HOH WAT B . 
F 3 HOH 113 1112 306 HOH WAT B . 
F 3 HOH 114 1113 307 HOH WAT B . 
F 3 HOH 115 1114 308 HOH WAT B . 
F 3 HOH 116 1115 309 HOH WAT B . 
F 3 HOH 117 1116 310 HOH WAT B . 
F 3 HOH 118 1117 311 HOH WAT B . 
F 3 HOH 119 1118 312 HOH WAT B . 
F 3 HOH 120 1119 318 HOH WAT B . 
F 3 HOH 121 1120 324 HOH WAT B . 
F 3 HOH 122 1121 337 HOH WAT B . 
F 3 HOH 123 1122 341 HOH WAT B . 
F 3 HOH 124 1123 342 HOH WAT B . 
F 3 HOH 125 1124 343 HOH WAT B . 
F 3 HOH 126 1125 344 HOH WAT B . 
F 3 HOH 127 1126 345 HOH WAT B . 
F 3 HOH 128 1127 346 HOH WAT B . 
F 3 HOH 129 1128 347 HOH WAT B . 
F 3 HOH 130 1129 348 HOH WAT B . 
F 3 HOH 131 1130 349 HOH WAT B . 
F 3 HOH 132 1131 350 HOH WAT B . 
F 3 HOH 133 1132 351 HOH WAT B . 
F 3 HOH 134 1133 352 HOH WAT B . 
F 3 HOH 135 1134 353 HOH WAT B . 
F 3 HOH 136 1135 354 HOH WAT B . 
F 3 HOH 137 1136 355 HOH WAT B . 
F 3 HOH 138 1137 356 HOH WAT B . 
F 3 HOH 139 1138 357 HOH WAT B . 
F 3 HOH 140 1139 358 HOH WAT B . 
F 3 HOH 141 1140 359 HOH WAT B . 
F 3 HOH 142 1141 360 HOH WAT B . 
F 3 HOH 143 1142 361 HOH WAT B . 
F 3 HOH 144 1143 362 HOH WAT B . 
F 3 HOH 145 1144 363 HOH WAT B . 
F 3 HOH 146 1145 364 HOH WAT B . 
F 3 HOH 147 1146 365 HOH WAT B . 
F 3 HOH 148 1147 366 HOH WAT B . 
F 3 HOH 149 1148 367 HOH WAT B . 
F 3 HOH 150 1149 368 HOH WAT B . 
F 3 HOH 151 1150 369 HOH WAT B . 
F 3 HOH 152 1151 370 HOH WAT B . 
F 3 HOH 153 1152 371 HOH WAT B . 
F 3 HOH 154 1153 372 HOH WAT B . 
F 3 HOH 155 1154 373 HOH WAT B . 
F 3 HOH 156 1155 375 HOH WAT B . 
F 3 HOH 157 1156 376 HOH WAT B . 
F 3 HOH 158 1157 377 HOH WAT B . 
F 3 HOH 159 1158 378 HOH WAT B . 
F 3 HOH 160 1159 379 HOH WAT B . 
F 3 HOH 161 1160 380 HOH WAT B . 
F 3 HOH 162 1161 381 HOH WAT B . 
F 3 HOH 163 1162 382 HOH WAT B . 
F 3 HOH 164 1163 383 HOH WAT B . 
F 3 HOH 165 1164 384 HOH WAT B . 
F 3 HOH 166 1165 385 HOH WAT B . 
F 3 HOH 167 1166 391 HOH WAT B . 
F 3 HOH 168 1167 392 HOH WAT B . 
F 3 HOH 169 1168 393 HOH WAT B . 
F 3 HOH 170 1169 394 HOH WAT B . 
F 3 HOH 171 1170 395 HOH WAT B . 
F 3 HOH 172 1171 396 HOH WAT B . 
F 3 HOH 173 1172 397 HOH WAT B . 
F 3 HOH 174 1173 398 HOH WAT B . 
F 3 HOH 175 1174 399 HOH WAT B . 
F 3 HOH 176 1175 400 HOH WAT B . 
F 3 HOH 177 1176 402 HOH WAT B . 
F 3 HOH 178 1177 403 HOH WAT B . 
F 3 HOH 179 1178 404 HOH WAT B . 
F 3 HOH 180 1179 405 HOH WAT B . 
F 3 HOH 181 1180 406 HOH WAT B . 
F 3 HOH 182 1181 407 HOH WAT B . 
F 3 HOH 183 1182 408 HOH WAT B . 
F 3 HOH 184 1183 409 HOH WAT B . 
F 3 HOH 185 1184 410 HOH WAT B . 
F 3 HOH 186 1185 411 HOH WAT B . 
F 3 HOH 187 1186 412 HOH WAT B . 
F 3 HOH 188 1187 413 HOH WAT B . 
F 3 HOH 189 1188 414 HOH WAT B . 
F 3 HOH 190 1189 415 HOH WAT B . 
F 3 HOH 191 1190 416 HOH WAT B . 
F 3 HOH 192 1191 417 HOH WAT B . 
F 3 HOH 193 1192 418 HOH WAT B . 
F 3 HOH 194 1193 419 HOH WAT B . 
F 3 HOH 195 1194 420 HOH WAT B . 
F 3 HOH 196 1195 421 HOH WAT B . 
F 3 HOH 197 1196 422 HOH WAT B . 
F 3 HOH 198 1197 423 HOH WAT B . 
F 3 HOH 199 1198 424 HOH WAT B . 
F 3 HOH 200 1199 425 HOH WAT B . 
F 3 HOH 201 1200 426 HOH WAT B . 
F 3 HOH 202 1201 427 HOH WAT B . 
F 3 HOH 203 1202 428 HOH WAT B . 
F 3 HOH 204 1203 429 HOH WAT B . 
F 3 HOH 205 1204 430 HOH WAT B . 
F 3 HOH 206 1205 431 HOH WAT B . 
F 3 HOH 207 1206 432 HOH WAT B . 
F 3 HOH 208 1207 433 HOH WAT B . 
F 3 HOH 209 1208 434 HOH WAT B . 
F 3 HOH 210 1209 435 HOH WAT B . 
F 3 HOH 211 1210 436 HOH WAT B . 
F 3 HOH 212 1211 437 HOH WAT B . 
F 3 HOH 213 1212 438 HOH WAT B . 
F 3 HOH 214 1213 439 HOH WAT B . 
F 3 HOH 215 1214 440 HOH WAT B . 
F 3 HOH 216 1215 441 HOH WAT B . 
F 3 HOH 217 1216 442 HOH WAT B . 
F 3 HOH 218 1217 443 HOH WAT B . 
F 3 HOH 219 1218 444 HOH WAT B . 
F 3 HOH 220 1219 445 HOH WAT B . 
F 3 HOH 221 1220 446 HOH WAT B . 
F 3 HOH 222 1221 447 HOH WAT B . 
F 3 HOH 223 1222 448 HOH WAT B . 
F 3 HOH 224 1223 450 HOH WAT B . 
F 3 HOH 225 1224 451 HOH WAT B . 
F 3 HOH 226 1225 452 HOH WAT B . 
F 3 HOH 227 1226 453 HOH WAT B . 
F 3 HOH 228 1227 454 HOH WAT B . 
F 3 HOH 229 1228 455 HOH WAT B . 
F 3 HOH 230 1229 456 HOH WAT B . 
F 3 HOH 231 1230 457 HOH WAT B . 
F 3 HOH 232 1231 458 HOH WAT B . 
F 3 HOH 233 1232 460 HOH WAT B . 
F 3 HOH 234 1233 461 HOH WAT B . 
F 3 HOH 235 1234 462 HOH WAT B . 
F 3 HOH 236 1235 466 HOH WAT B . 
F 3 HOH 237 1236 468 HOH WAT B . 
F 3 HOH 238 1237 469 HOH WAT B . 
F 3 HOH 239 1238 471 HOH WAT B . 
F 3 HOH 240 1239 472 HOH WAT B . 
F 3 HOH 241 1240 474 HOH WAT B . 
F 3 HOH 242 1241 475 HOH WAT B . 
F 3 HOH 243 1242 480 HOH WAT B . 
F 3 HOH 244 1243 482 HOH WAT B . 
F 3 HOH 245 1244 483 HOH WAT B . 
F 3 HOH 246 1245 484 HOH WAT B . 
F 3 HOH 247 1246 485 HOH WAT B . 
F 3 HOH 248 1247 486 HOH WAT B . 
F 3 HOH 249 1248 487 HOH WAT B . 
F 3 HOH 250 1249 489 HOH WAT B . 
F 3 HOH 251 1250 492 HOH WAT B . 
F 3 HOH 252 1251 493 HOH WAT B . 
F 3 HOH 253 1252 494 HOH WAT B . 
F 3 HOH 254 1253 495 HOH WAT B . 
F 3 HOH 255 1254 498 HOH WAT B . 
F 3 HOH 256 1255 499 HOH WAT B . 
F 3 HOH 257 1256 507 HOH WAT B . 
F 3 HOH 258 1257 510 HOH WAT B . 
F 3 HOH 259 1258 511 HOH WAT B . 
F 3 HOH 260 1259 512 HOH WAT B . 
F 3 HOH 261 1260 516 HOH WAT B . 
F 3 HOH 262 1261 517 HOH WAT B . 
F 3 HOH 263 1262 518 HOH WAT B . 
F 3 HOH 264 1263 519 HOH WAT B . 
F 3 HOH 265 1264 520 HOH WAT B . 
F 3 HOH 266 1265 535 HOH WAT B . 
F 3 HOH 267 1266 536 HOH WAT B . 
F 3 HOH 268 1267 537 HOH WAT B . 
F 3 HOH 269 1268 538 HOH WAT B . 
F 3 HOH 270 1269 551 HOH WAT B . 
F 3 HOH 271 1270 552 HOH WAT B . 
F 3 HOH 272 1271 553 HOH WAT B . 
F 3 HOH 273 1272 554 HOH WAT B . 
F 3 HOH 274 1273 555 HOH WAT B . 
F 3 HOH 275 1274 557 HOH WAT B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 1136 ? E HOH . 
2 1 B HOH 1196 ? F HOH . 
3 1 B HOH 1213 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-09 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.0 ? 1 
MAR345    'data collection' .   ? 2 
SCALEPACK 'data scaling'    .   ? 3 
CNS       phasing           .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 1063 ? ? O A HOH 1244 ? ? 1.49 
2  1 O   A HOH 1153 ? ? O A HOH 1275 ? ? 1.71 
3  1 OD2 A ASP 83   ? ? O A HOH 1244 ? ? 1.80 
4  1 OE2 B GLU 111  ? ? O B HOH 1145 ? ? 1.86 
5  1 O   B HOH 1037 ? ? O B HOH 1038 ? ? 1.90 
6  1 O   B HOH 1034 ? ? O B HOH 1035 ? ? 1.92 
7  1 O   A HOH 1186 ? ? O A HOH 1187 ? ? 1.96 
8  1 O   A HOH 1186 ? ? O A HOH 1195 ? ? 1.97 
9  1 O   A HOH 1183 ? ? O A HOH 1221 ? ? 2.01 
10 1 O   B HOH 1060 ? ? O B HOH 1061 ? ? 2.02 
11 1 O3P B A2P 999  ? ? O B HOH 1254 ? ? 2.04 
12 1 O   A HOH 1038 ? ? O A HOH 1039 ? ? 2.06 
13 1 O   A HOH 1109 ? ? O A HOH 1251 ? ? 2.06 
14 1 C   B HIS 48   ? ? O B HOH 1245 ? ? 2.10 
15 1 O   A HOH 1056 ? ? O A HOH 1264 ? ? 2.10 
16 1 O   A HOH 1063 ? ? O A HOH 1064 ? ? 2.11 
17 1 O   A HOH 1055 ? ? O A HOH 1264 ? ? 2.13 
18 1 O   A HOH 1239 ? ? O A HOH 1242 ? ? 2.13 
19 1 O   A HOH 1221 ? ? O A HOH 1222 ? ? 2.13 
20 1 O   B SER 16   ? ? O B HOH 1120 ? ? 2.13 
21 1 OE1 A GLN 69   ? ? O A HOH 1218 ? ? 2.15 
22 1 O   B HOH 1211 ? ? O B HOH 1212 ? ? 2.15 
23 1 OG  B SER 32   ? ? O B HOH 1058 ? ? 2.15 
24 1 O   A ALA 20   ? ? O A HOH 1233 ? ? 2.16 
25 1 OG  B SER 21   ? ? O B HOH 1067 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O B HOH 1071 ? ? 1_555 O B HOH 1072 ? ? 2_556 1.80 
2 1 O B HOH 1081 ? ? 1_555 O B HOH 1082 ? ? 1_565 1.87 
3 1 O A HOH 1169 ? ? 1_555 O A HOH 1281 ? ? 2_655 1.88 
4 1 O B HOH 1063 ? ? 1_555 O B HOH 1064 ? ? 1_565 2.02 
5 1 O A HOH 1278 ? ? 1_555 O B HOH 1010 ? ? 3_555 2.06 
6 1 O B HOH 1197 ? ? 1_555 O B HOH 1197 ? ? 2_556 2.15 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG A ARG 39 ? ? CD A ARG 39 ? ? NE  A ARG 39 ? ? 126.50 111.80 14.70  2.10 N 
2 1 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 125.69 120.30 5.39   0.50 N 
3 1 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH2 A ARG 39 ? ? 111.88 120.30 -8.42  0.50 N 
4 1 N  B SER 22 ? ? CA B SER 22 ? ? CB  B SER 22 ? ? 123.88 110.50 13.38  1.50 N 
5 1 N  B SER 22 ? ? CA B SER 22 ? ? C   B SER 22 ? ? 93.14  111.00 -17.86 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 19 ? ? 89.13   91.50   
2  1 ALA A 20 ? ? -153.15 22.71   
3  1 HIS A 48 ? ? -112.94 57.97   
4  1 GLN A 60 ? ? -98.48  -142.23 
5  1 ASN A 71 ? ? -96.66  37.35   
6  1 SER B 15 ? ? -84.81  48.51   
7  1 SER B 16 ? ? -131.62 -45.73  
8  1 ALA B 19 ? ? -144.76 -134.99 
9  1 ALA B 20 ? ? -82.24  -98.41  
10 1 SER B 21 ? ? 165.03  -84.21  
11 1 LYS B 37 ? ? -66.86  -73.28  
12 1 GLN B 60 ? ? -109.72 -131.63 
13 1 ASN B 71 ? ? -91.70  33.61   
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             HIS 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              48 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   10.26 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     39 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.069 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-2'-5'-DIPHOSPHATE" A2P 
3 water                         HOH 
#