data_1O0W
# 
_entry.id   1O0W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O0W         
RCSB  RCSB001663   
WWPDB D_1000001663 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          282968 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        1O0W 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-13 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Joint Center for Structural Genomics (JCSG)' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of Ribonuclease III  (TM1102) from Thermotoga maritima at 2.0 A resolution' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Joint Center for Structural Genomics (JCSG)' 
_citation_author.ordinal       1 
# 
_cell.length_a           36 
_cell.length_b           58.5 
_cell.length_c           70.2 
_cell.angle_alpha        67.2 
_cell.angle_beta         92 
_cell.angle_gamma        77.7 
_cell.entry_id           1O0W 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         1O0W 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Ribonuclease III' 29033.084 2   3.1.26.3 ? ? ? 
2 water   nat water              18.015    383 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNase III' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSDKIHHHHHHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEI
LYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKEL
FEQEFEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAA
RIAYEKLLKERS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSDKIHHHHHHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEI
LYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKEL
FEQEFEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAA
RIAYEKLLKERS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         282968 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  MET n 
1 14  ASN n 
1 15  GLU n 
1 16  SER n 
1 17  GLU n 
1 18  ARG n 
1 19  LYS n 
1 20  ILE n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  PHE n 
1 25  GLN n 
1 26  LYS n 
1 27  GLU n 
1 28  THR n 
1 29  GLY n 
1 30  ILE n 
1 31  ASN n 
1 32  PHE n 
1 33  LYS n 
1 34  ASN n 
1 35  GLU n 
1 36  GLU n 
1 37  LEU n 
1 38  LEU n 
1 39  PHE n 
1 40  ARG n 
1 41  ALA n 
1 42  LEU n 
1 43  CYS n 
1 44  HIS n 
1 45  SER n 
1 46  SER n 
1 47  TYR n 
1 48  ALA n 
1 49  ASN n 
1 50  GLU n 
1 51  GLN n 
1 52  ASN n 
1 53  GLN n 
1 54  ALA n 
1 55  GLY n 
1 56  ARG n 
1 57  LYS n 
1 58  ASP n 
1 59  VAL n 
1 60  GLU n 
1 61  SER n 
1 62  ASN n 
1 63  GLU n 
1 64  LYS n 
1 65  LEU n 
1 66  GLU n 
1 67  PHE n 
1 68  LEU n 
1 69  GLY n 
1 70  ASP n 
1 71  ALA n 
1 72  VAL n 
1 73  LEU n 
1 74  GLU n 
1 75  LEU n 
1 76  PHE n 
1 77  VAL n 
1 78  CYS n 
1 79  GLU n 
1 80  ILE n 
1 81  LEU n 
1 82  TYR n 
1 83  LYS n 
1 84  LYS n 
1 85  TYR n 
1 86  PRO n 
1 87  GLU n 
1 88  ALA n 
1 89  GLU n 
1 90  VAL n 
1 91  GLY n 
1 92  ASP n 
1 93  LEU n 
1 94  ALA n 
1 95  ARG n 
1 96  VAL n 
1 97  LYS n 
1 98  SER n 
1 99  ALA n 
1 100 ALA n 
1 101 ALA n 
1 102 SER n 
1 103 GLU n 
1 104 GLU n 
1 105 VAL n 
1 106 LEU n 
1 107 ALA n 
1 108 MET n 
1 109 VAL n 
1 110 SER n 
1 111 ARG n 
1 112 LYS n 
1 113 MET n 
1 114 ASN n 
1 115 LEU n 
1 116 GLY n 
1 117 LYS n 
1 118 PHE n 
1 119 LEU n 
1 120 PHE n 
1 121 LEU n 
1 122 GLY n 
1 123 LYS n 
1 124 GLY n 
1 125 GLU n 
1 126 GLU n 
1 127 LYS n 
1 128 THR n 
1 129 GLY n 
1 130 GLY n 
1 131 ARG n 
1 132 ASP n 
1 133 ARG n 
1 134 ASP n 
1 135 SER n 
1 136 ILE n 
1 137 LEU n 
1 138 ALA n 
1 139 ASP n 
1 140 ALA n 
1 141 PHE n 
1 142 GLU n 
1 143 ALA n 
1 144 LEU n 
1 145 LEU n 
1 146 ALA n 
1 147 ALA n 
1 148 ILE n 
1 149 TYR n 
1 150 LEU n 
1 151 ASP n 
1 152 GLN n 
1 153 GLY n 
1 154 TYR n 
1 155 GLU n 
1 156 LYS n 
1 157 ILE n 
1 158 LYS n 
1 159 GLU n 
1 160 LEU n 
1 161 PHE n 
1 162 GLU n 
1 163 GLN n 
1 164 GLU n 
1 165 PHE n 
1 166 GLU n 
1 167 PHE n 
1 168 TYR n 
1 169 ILE n 
1 170 GLU n 
1 171 LYS n 
1 172 ILE n 
1 173 MET n 
1 174 LYS n 
1 175 GLY n 
1 176 GLU n 
1 177 MET n 
1 178 LEU n 
1 179 PHE n 
1 180 ASP n 
1 181 TYR n 
1 182 LYS n 
1 183 THR n 
1 184 ALA n 
1 185 LEU n 
1 186 GLN n 
1 187 GLU n 
1 188 ILE n 
1 189 VAL n 
1 190 GLN n 
1 191 SER n 
1 192 GLU n 
1 193 HIS n 
1 194 LYS n 
1 195 VAL n 
1 196 PRO n 
1 197 PRO n 
1 198 GLU n 
1 199 TYR n 
1 200 ILE n 
1 201 LEU n 
1 202 VAL n 
1 203 ARG n 
1 204 THR n 
1 205 GLU n 
1 206 LYS n 
1 207 ASN n 
1 208 ASP n 
1 209 GLY n 
1 210 ASP n 
1 211 ARG n 
1 212 ILE n 
1 213 PHE n 
1 214 VAL n 
1 215 VAL n 
1 216 GLU n 
1 217 VAL n 
1 218 ARG n 
1 219 VAL n 
1 220 ASN n 
1 221 GLY n 
1 222 LYS n 
1 223 THR n 
1 224 ILE n 
1 225 ALA n 
1 226 THR n 
1 227 GLY n 
1 228 LYS n 
1 229 GLY n 
1 230 ARG n 
1 231 THR n 
1 232 LYS n 
1 233 LYS n 
1 234 GLU n 
1 235 ALA n 
1 236 GLU n 
1 237 LYS n 
1 238 GLU n 
1 239 ALA n 
1 240 ALA n 
1 241 ARG n 
1 242 ILE n 
1 243 ALA n 
1 244 TYR n 
1 245 GLU n 
1 246 LYS n 
1 247 LEU n 
1 248 LEU n 
1 249 LYS n 
1 250 GLU n 
1 251 ARG n 
1 252 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermotoga 
_entity_src_gen.pdbx_gene_src_gene                 TM1102 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    RNC_THEMA 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q9X0I6 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGD
LARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKI
MKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKLLKERS

;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O0W A 13 ? 252 ? Q9X0I6 1 ? 240 ? 1 240 
2 1 1O0W B 13 ? 252 ? Q9X0I6 1 ? 240 ? 1 240 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1O0W MET A 1  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -11 1  
1 1O0W GLY A 2  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -10 2  
1 1O0W SER A 3  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -9  3  
1 1O0W ASP A 4  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -8  4  
1 1O0W LYS A 5  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -7  5  
1 1O0W ILE A 6  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -6  6  
1 1O0W HIS A 7  ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -5  7  
1 1O0W HIS A 8  ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -4  8  
1 1O0W HIS A 9  ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -3  9  
1 1O0W HIS A 10 ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -2  10 
1 1O0W HIS A 11 ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -1  11 
1 1O0W HIS A 12 ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  0   12 
2 1O0W MET B 1  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -11 13 
2 1O0W GLY B 2  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -10 14 
2 1O0W SER B 3  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -9  15 
2 1O0W ASP B 4  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -8  16 
2 1O0W LYS B 5  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -7  17 
2 1O0W ILE B 6  ? UNP Q9X0I6 ? ? 'LEADER SEQUENCE' -6  18 
2 1O0W HIS B 7  ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -5  19 
2 1O0W HIS B 8  ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -4  20 
2 1O0W HIS B 9  ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -3  21 
2 1O0W HIS B 10 ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -2  22 
2 1O0W HIS B 11 ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  -1  23 
2 1O0W HIS B 12 ? UNP Q9X0I6 ? ? 'EXPRESSION TAG'  0   24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          1O0W 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.density_percent_sol   44.32 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.90 
_exptl_crystal_grow.pdbx_details    
'0.2 M Potassium Nitrate, 20% PEG 3350, pH 6.9, VAPOR DIFFUSION,SITTING DROP,NANODROP, temperature 293K, pH 6.90' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2002-03-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.979321 1.0 
2 0.978964 1.0 
3 0.918370 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.979321, 0.978964, 0.918370' 
# 
_reflns.entry_id                     1O0W 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             34.899 
_reflns.d_resolution_high            1.995 
_reflns.number_obs                   32670 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        11.60 
_reflns.B_iso_Wilson_estimate        29.50 
_reflns.pdbx_redundancy              3.900 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.99 
_reflns_shell.d_res_low              2.10 
_reflns_shell.percent_possible_all   88.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.27 
_reflns_shell.meanI_over_sigI_obs    3.8 
_reflns_shell.pdbx_redundancy        3.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1O0W 
_refine.ls_number_reflns_obs                     32670 
_refine.ls_number_reflns_all                     32670 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    94.6 
_refine.ls_R_factor_obs                          0.195 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.195 
_refine.ls_R_factor_R_free                       0.23 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  1631 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.30 
_refine.aniso_B[1][1]                            -2.52200 
_refine.aniso_B[2][2]                            1.77100 
_refine.aniso_B[3][3]                            0.75100 
_refine.aniso_B[1][2]                            0.53900 
_refine.aniso_B[1][3]                            5.39700 
_refine.aniso_B[2][3]                            1.86900 
_refine.solvent_model_details                    'BULK SOLVENT CORRECTION' 
_refine.solvent_model_param_ksol                 47.61 
_refine.solvent_model_param_bsol                 0.36 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ANISTROPIC 
_refine.pdbx_stereochemistry_target_values       'STANDARD CNS DICTIONARY/ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1O0W 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.13 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.18 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3851 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             383 
_refine_hist.number_atoms_total               4234 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.38  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.483 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.192 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.652 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.972 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   32 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             913 
_refine_ls_shell.R_factor_R_work                  0.2577 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2875 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            6.1 
_refine_ls_shell.number_reflns_R_free             59 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1O0W 
_struct.title                     'Crystal structure of Ribonuclease III (TM1102) from Thermotoga maritima at 2.0 A resolution' 
_struct.pdbx_descriptor           'Ribonuclease III (E.C.3.1.26.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;TM1102, Ribonuclease III, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
;
_struct_keywords.entry_id        1O0W 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 14  ? GLY A 29  ? ASN A 2   GLY A 17  1 ? 16 
HELX_P HELX_P2  2  ASN A 34  ? CYS A 43  ? ASN A 22  CYS A 31  1 ? 10 
HELX_P HELX_P3  3  HIS A 44  ? ALA A 54  ? HIS A 32  ALA A 42  1 ? 11 
HELX_P HELX_P4  4  ASN A 62  ? TYR A 85  ? ASN A 50  TYR A 73  1 ? 24 
HELX_P HELX_P5  5  GLU A 89  ? ALA A 101 ? GLU A 77  ALA A 89  1 ? 13 
HELX_P HELX_P6  6  SER A 102 ? MET A 113 ? SER A 90  MET A 101 1 ? 12 
HELX_P HELX_P7  7  ASN A 114 ? LEU A 119 ? ASN A 102 LEU A 107 1 ? 6  
HELX_P HELX_P8  8  GLY A 122 ? THR A 128 ? GLY A 110 THR A 116 1 ? 7  
HELX_P HELX_P9  9  GLY A 129 ? ASP A 132 ? GLY A 117 ASP A 120 5 ? 4  
HELX_P HELX_P10 10 ARG A 133 ? GLY A 153 ? ARG A 121 GLY A 141 1 ? 21 
HELX_P HELX_P11 11 GLY A 153 ? LYS A 174 ? GLY A 141 LYS A 162 1 ? 22 
HELX_P HELX_P12 12 ASP A 180 ? LYS A 194 ? ASP A 168 LYS A 182 1 ? 15 
HELX_P HELX_P13 13 THR A 231 ? LEU A 248 ? THR A 219 LEU A 236 1 ? 18 
HELX_P HELX_P14 14 ASN B 14  ? GLY B 29  ? ASN B 2   GLY B 17  1 ? 16 
HELX_P HELX_P15 15 ASN B 34  ? CYS B 43  ? ASN B 22  CYS B 31  1 ? 10 
HELX_P HELX_P16 16 HIS B 44  ? ALA B 54  ? HIS B 32  ALA B 42  1 ? 11 
HELX_P HELX_P17 17 ASN B 62  ? TYR B 85  ? ASN B 50  TYR B 73  1 ? 24 
HELX_P HELX_P18 18 GLU B 89  ? ALA B 101 ? GLU B 77  ALA B 89  1 ? 13 
HELX_P HELX_P19 19 SER B 102 ? MET B 113 ? SER B 90  MET B 101 1 ? 12 
HELX_P HELX_P20 20 ASN B 114 ? PHE B 118 ? ASN B 102 PHE B 106 5 ? 5  
HELX_P HELX_P21 21 GLY B 122 ? THR B 128 ? GLY B 110 THR B 116 1 ? 7  
HELX_P HELX_P22 22 GLY B 129 ? ASP B 132 ? GLY B 117 ASP B 120 5 ? 4  
HELX_P HELX_P23 23 ARG B 133 ? GLY B 153 ? ARG B 121 GLY B 141 1 ? 21 
HELX_P HELX_P24 24 GLY B 153 ? LYS B 174 ? GLY B 141 LYS B 162 1 ? 22 
HELX_P HELX_P25 25 ASP B 180 ? LYS B 194 ? ASP B 168 LYS B 182 1 ? 15 
HELX_P HELX_P26 26 THR B 231 ? LEU B 247 ? THR B 219 LEU B 235 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 198 ? GLU A 205 ? GLU A 186 GLU A 193 
A 2 ILE A 212 ? VAL A 219 ? ILE A 200 VAL A 207 
A 3 LYS A 222 ? GLY A 229 ? LYS A 210 GLY A 217 
B 1 GLU B 198 ? LYS B 206 ? GLU B 186 LYS B 194 
B 2 ARG B 211 ? VAL B 219 ? ARG B 199 VAL B 207 
B 3 LYS B 222 ? GLY B 229 ? LYS B 210 GLY B 217 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 205 ? N GLU A 193 O ILE A 212 ? O ILE A 200 
A 2 3 N VAL A 215 ? N VAL A 203 O GLY A 227 ? O GLY A 215 
B 1 2 N GLU B 205 ? N GLU B 193 O ILE B 212 ? O ILE B 200 
B 2 3 N VAL B 217 ? N VAL B 205 O ILE B 224 ? O ILE B 212 
# 
_atom_sites.entry_id                    1O0W 
_atom_sites.fract_transf_matrix[1][1]   0.027778 
_atom_sites.fract_transf_matrix[1][2]   -0.006057 
_atom_sites.fract_transf_matrix[1][3]   0.003739 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017496 
_atom_sites.fract_transf_matrix[2][3]   -0.007738 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015585 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 11  ? 18.121 -8.641  13.586 1.00 40.59 ? -1  HIS A N   1 
ATOM   2    C CA  . HIS A 1 11  ? 17.091 -8.354  12.543 1.00 38.70 ? -1  HIS A CA  1 
ATOM   3    C C   . HIS A 1 11  ? 17.707 -8.192  11.152 1.00 36.80 ? -1  HIS A C   1 
ATOM   4    O O   . HIS A 1 11  ? 18.682 -7.472  10.953 1.00 35.80 ? -1  HIS A O   1 
ATOM   5    C CB  . HIS A 1 11  ? 16.309 -7.083  12.894 1.00 42.12 ? -1  HIS A CB  1 
ATOM   6    C CG  . HIS A 1 11  ? 15.455 -6.578  11.772 1.00 43.93 ? -1  HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 11  ? 15.452 -5.258  11.372 1.00 45.31 ? -1  HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 11  ? 14.635 -7.233  10.913 1.00 45.13 ? -1  HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 11  ? 14.676 -5.125  10.308 1.00 45.53 ? -1  HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 11  ? 14.169 -6.309  10.010 1.00 45.98 ? -1  HIS A NE2 1 
ATOM   11   N N   . HIS A 1 12  ? 17.111 -8.873  10.192 1.00 34.26 ? 0   HIS A N   1 
ATOM   12   C CA  . HIS A 1 12  ? 17.546 -8.828  8.815  1.00 32.59 ? 0   HIS A CA  1 
ATOM   13   C C   . HIS A 1 12  ? 16.691 -7.804  8.067  1.00 30.79 ? 0   HIS A C   1 
ATOM   14   O O   . HIS A 1 12  ? 15.495 -8.009  7.876  1.00 31.35 ? 0   HIS A O   1 
ATOM   15   C CB  . HIS A 1 12  ? 17.381 -10.221 8.218  1.00 32.93 ? 0   HIS A CB  1 
ATOM   16   C CG  . HIS A 1 12  ? 17.503 -10.266 6.730  1.00 33.84 ? 0   HIS A CG  1 
ATOM   17   N ND1 . HIS A 1 12  ? 16.416 -10.140 5.896  1.00 34.32 ? 0   HIS A ND1 1 
ATOM   18   C CD2 . HIS A 1 12  ? 18.576 -10.459 5.926  1.00 34.91 ? 0   HIS A CD2 1 
ATOM   19   C CE1 . HIS A 1 12  ? 16.810 -10.262 4.642  1.00 35.38 ? 0   HIS A CE1 1 
ATOM   20   N NE2 . HIS A 1 12  ? 18.117 -10.456 4.631  1.00 35.61 ? 0   HIS A NE2 1 
ATOM   21   N N   . MET A 1 13  ? 17.294 -6.700  7.654  1.00 28.35 ? 1   MET A N   1 
ATOM   22   C CA  . MET A 1 13  ? 16.552 -5.668  6.917  1.00 27.60 ? 1   MET A CA  1 
ATOM   23   C C   . MET A 1 13  ? 16.050 -6.215  5.593  1.00 24.60 ? 1   MET A C   1 
ATOM   24   O O   . MET A 1 13  ? 16.827 -6.807  4.852  1.00 24.15 ? 1   MET A O   1 
ATOM   25   C CB  . MET A 1 13  ? 17.443 -4.451  6.604  1.00 31.43 ? 1   MET A CB  1 
ATOM   26   C CG  . MET A 1 13  ? 17.364 -3.307  7.606  1.00 36.75 ? 1   MET A CG  1 
ATOM   27   S SD  . MET A 1 13  ? 17.812 -3.944  9.201  1.00 45.13 ? 1   MET A SD  1 
ATOM   28   C CE  . MET A 1 13  ? 19.306 -2.851  9.645  1.00 41.96 ? 1   MET A CE  1 
ATOM   29   N N   . ASN A 1 14  ? 14.766 -6.041  5.285  1.00 20.78 ? 2   ASN A N   1 
ATOM   30   C CA  . ASN A 1 14  ? 14.333 -6.488  3.980  1.00 20.31 ? 2   ASN A CA  1 
ATOM   31   C C   . ASN A 1 14  ? 14.721 -5.380  2.989  1.00 20.69 ? 2   ASN A C   1 
ATOM   32   O O   . ASN A 1 14  ? 15.184 -4.314  3.386  1.00 17.44 ? 2   ASN A O   1 
ATOM   33   C CB  . ASN A 1 14  ? 12.822 -6.791  3.927  1.00 22.09 ? 2   ASN A CB  1 
ATOM   34   C CG  . ASN A 1 14  ? 11.948 -5.593  4.205  1.00 23.37 ? 2   ASN A CG  1 
ATOM   35   O OD1 . ASN A 1 14  ? 12.312 -4.448  3.935  1.00 23.45 ? 2   ASN A OD1 1 
ATOM   36   N ND2 . ASN A 1 14  ? 10.749 -5.861  4.732  1.00 25.44 ? 2   ASN A ND2 1 
ATOM   37   N N   . GLU A 1 15  ? 14.511 -5.639  1.707  1.00 22.74 ? 3   GLU A N   1 
ATOM   38   C CA  . GLU A 1 15  ? 14.847 -4.702  0.644  1.00 25.47 ? 3   GLU A CA  1 
ATOM   39   C C   . GLU A 1 15  ? 14.348 -3.255  0.818  1.00 24.64 ? 3   GLU A C   1 
ATOM   40   O O   . GLU A 1 15  ? 15.129 -2.315  0.681  1.00 23.72 ? 3   GLU A O   1 
ATOM   41   C CB  . GLU A 1 15  ? 14.348 -5.252  -0.699 1.00 29.03 ? 3   GLU A CB  1 
ATOM   42   C CG  . GLU A 1 15  ? 15.078 -4.631  -1.897 1.00 36.86 ? 3   GLU A CG  1 
ATOM   43   C CD  . GLU A 1 15  ? 14.784 -5.346  -3.221 1.00 39.98 ? 3   GLU A CD  1 
ATOM   44   O OE1 . GLU A 1 15  ? 14.650 -6.596  -3.212 1.00 41.90 ? 3   GLU A OE1 1 
ATOM   45   O OE2 . GLU A 1 15  ? 14.709 -4.654  -4.265 1.00 41.81 ? 3   GLU A OE2 1 
ATOM   46   N N   . SER A 1 16  ? 13.068 -3.060  1.127  1.00 23.61 ? 4   SER A N   1 
ATOM   47   C CA  . SER A 1 16  ? 12.559 -1.691  1.267  1.00 23.13 ? 4   SER A CA  1 
ATOM   48   C C   . SER A 1 16  ? 13.095 -0.987  2.522  1.00 21.58 ? 4   SER A C   1 
ATOM   49   O O   . SER A 1 16  ? 13.223 0.242   2.550  1.00 21.50 ? 4   SER A O   1 
ATOM   50   C CB  . SER A 1 16  ? 11.027 -1.683  1.274  1.00 24.79 ? 4   SER A CB  1 
ATOM   51   O OG  . SER A 1 16  ? 10.518 -2.221  2.480  1.00 27.53 ? 4   SER A OG  1 
ATOM   52   N N   . GLU A 1 17  ? 13.417 -1.761  3.552  1.00 17.68 ? 5   GLU A N   1 
ATOM   53   C CA  . GLU A 1 17  ? 13.939 -1.184  4.784  1.00 17.09 ? 5   GLU A CA  1 
ATOM   54   C C   . GLU A 1 17  ? 15.381 -0.747  4.540  1.00 16.68 ? 5   GLU A C   1 
ATOM   55   O O   . GLU A 1 17  ? 15.787 0.364   4.929  1.00 13.27 ? 5   GLU A O   1 
ATOM   56   C CB  . GLU A 1 17  ? 13.855 -2.215  5.928  1.00 17.05 ? 5   GLU A CB  1 
ATOM   57   C CG  . GLU A 1 17  ? 12.403 -2.546  6.346  1.00 16.41 ? 5   GLU A CG  1 
ATOM   58   C CD  . GLU A 1 17  ? 12.315 -3.780  7.287  1.00 17.82 ? 5   GLU A CD  1 
ATOM   59   O OE1 . GLU A 1 17  ? 13.298 -4.560  7.342  1.00 16.75 ? 5   GLU A OE1 1 
ATOM   60   O OE2 . GLU A 1 17  ? 11.262 -3.979  7.947  1.00 16.93 ? 5   GLU A OE2 1 
ATOM   61   N N   . ARG A 1 18  ? 16.144 -1.604  3.864  1.00 16.10 ? 6   ARG A N   1 
ATOM   62   C CA  . ARG A 1 18  ? 17.530 -1.281  3.562  1.00 17.42 ? 6   ARG A CA  1 
ATOM   63   C C   . ARG A 1 18  ? 17.591 -0.020  2.685  1.00 17.54 ? 6   ARG A C   1 
ATOM   64   O O   . ARG A 1 18  ? 18.424 0.872   2.917  1.00 14.05 ? 6   ARG A O   1 
ATOM   65   C CB  . ARG A 1 18  ? 18.219 -2.453  2.867  1.00 20.95 ? 6   ARG A CB  1 
ATOM   66   C CG  . ARG A 1 18  ? 19.656 -2.108  2.436  1.00 28.26 ? 6   ARG A CG  1 
ATOM   67   C CD  . ARG A 1 18  ? 20.644 -3.199  2.867  1.00 33.98 ? 6   ARG A CD  1 
ATOM   68   N NE  . ARG A 1 18  ? 20.898 -3.179  4.308  1.00 36.88 ? 6   ARG A NE  1 
ATOM   69   C CZ  . ARG A 1 18  ? 20.994 -4.268  5.067  1.00 38.49 ? 6   ARG A CZ  1 
ATOM   70   N NH1 . ARG A 1 18  ? 20.850 -5.470  4.510  1.00 39.54 ? 6   ARG A NH1 1 
ATOM   71   N NH2 . ARG A 1 18  ? 21.227 -4.157  6.379  1.00 37.50 ? 6   ARG A NH2 1 
ATOM   72   N N   . LYS A 1 19  ? 16.700 0.065   1.700  1.00 17.23 ? 7   LYS A N   1 
ATOM   73   C CA  . LYS A 1 19  ? 16.669 1.249   0.842  1.00 19.99 ? 7   LYS A CA  1 
ATOM   74   C C   . LYS A 1 19  ? 16.440 2.507   1.663  1.00 18.10 ? 7   LYS A C   1 
ATOM   75   O O   . LYS A 1 19  ? 17.128 3.514   1.462  1.00 18.09 ? 7   LYS A O   1 
ATOM   76   C CB  . LYS A 1 19  ? 15.552 1.175   -0.212 1.00 21.94 ? 7   LYS A CB  1 
ATOM   77   C CG  . LYS A 1 19  ? 15.826 0.212   -1.342 1.00 29.61 ? 7   LYS A CG  1 
ATOM   78   C CD  . LYS A 1 19  ? 14.830 0.400   -2.500 1.00 32.56 ? 7   LYS A CD  1 
ATOM   79   C CE  . LYS A 1 19  ? 15.094 -0.588  -3.641 1.00 36.56 ? 7   LYS A CE  1 
ATOM   80   N NZ  . LYS A 1 19  ? 14.689 0.008   -4.958 1.00 38.37 ? 7   LYS A NZ  1 
ATOM   81   N N   . ILE A 1 20  ? 15.447 2.474   2.554  1.00 15.47 ? 8   ILE A N   1 
ATOM   82   C CA  . ILE A 1 20  ? 15.167 3.657   3.364  1.00 14.37 ? 8   ILE A CA  1 
ATOM   83   C C   . ILE A 1 20  ? 16.393 4.038   4.214  1.00 12.53 ? 8   ILE A C   1 
ATOM   84   O O   . ILE A 1 20  ? 16.764 5.211   4.335  1.00 12.45 ? 8   ILE A O   1 
ATOM   85   C CB  . ILE A 1 20  ? 13.947 3.433   4.320  1.00 14.84 ? 8   ILE A CB  1 
ATOM   86   C CG1 . ILE A 1 20  ? 12.654 3.280   3.513  1.00 17.75 ? 8   ILE A CG1 1 
ATOM   87   C CG2 . ILE A 1 20  ? 13.814 4.606   5.287  1.00 14.32 ? 8   ILE A CG2 1 
ATOM   88   C CD1 . ILE A 1 20  ? 12.450 4.349   2.499  1.00 21.90 ? 8   ILE A CD1 1 
ATOM   89   N N   . VAL A 1 21  ? 16.997 3.030   4.821  1.00 12.32 ? 9   VAL A N   1 
ATOM   90   C CA  . VAL A 1 21  ? 18.152 3.234   5.679  1.00 14.08 ? 9   VAL A CA  1 
ATOM   91   C C   . VAL A 1 21  ? 19.305 3.831   4.857  1.00 13.72 ? 9   VAL A C   1 
ATOM   92   O O   . VAL A 1 21  ? 20.010 4.701   5.323  1.00 12.19 ? 9   VAL A O   1 
ATOM   93   C CB  . VAL A 1 21  ? 18.570 1.895   6.285  1.00 16.93 ? 9   VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 21  ? 19.961 1.989   6.857  1.00 16.93 ? 9   VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 21  ? 17.558 1.504   7.389  1.00 17.80 ? 9   VAL A CG2 1 
ATOM   96   N N   . GLU A 1 22  ? 19.444 3.379   3.615  1.00 14.90 ? 10  GLU A N   1 
ATOM   97   C CA  . GLU A 1 22  ? 20.487 3.893   2.754  1.00 17.16 ? 10  GLU A CA  1 
ATOM   98   C C   . GLU A 1 22  ? 20.164 5.332   2.374  1.00 15.52 ? 10  GLU A C   1 
ATOM   99   O O   . GLU A 1 22  ? 21.027 6.191   2.440  1.00 13.42 ? 10  GLU A O   1 
ATOM   100  C CB  . GLU A 1 22  ? 20.623 3.020   1.502  1.00 21.49 ? 10  GLU A CB  1 
ATOM   101  C CG  . GLU A 1 22  ? 21.169 1.637   1.820  1.00 31.02 ? 10  GLU A CG  1 
ATOM   102  C CD  . GLU A 1 22  ? 22.622 1.671   2.290  1.00 34.60 ? 10  GLU A CD  1 
ATOM   103  O OE1 . GLU A 1 22  ? 22.922 2.402   3.255  1.00 38.86 ? 10  GLU A OE1 1 
ATOM   104  O OE2 . GLU A 1 22  ? 23.464 0.963   1.692  1.00 40.71 ? 10  GLU A OE2 1 
ATOM   105  N N   . GLU A 1 23  ? 18.915 5.590   1.988  1.00 15.35 ? 11  GLU A N   1 
ATOM   106  C CA  . GLU A 1 23  ? 18.516 6.954   1.618  1.00 14.82 ? 11  GLU A CA  1 
ATOM   107  C C   . GLU A 1 23  ? 18.705 7.925   2.763  1.00 12.09 ? 11  GLU A C   1 
ATOM   108  O O   . GLU A 1 23  ? 19.196 9.046   2.565  1.00 13.78 ? 11  GLU A O   1 
ATOM   109  C CB  . GLU A 1 23  ? 17.053 6.993   1.143  1.00 18.19 ? 11  GLU A CB  1 
ATOM   110  C CG  . GLU A 1 23  ? 16.887 6.550   -0.332 1.00 24.51 ? 11  GLU A CG  1 
ATOM   111  C CD  . GLU A 1 23  ? 15.442 6.204   -0.712 1.00 29.13 ? 11  GLU A CD  1 
ATOM   112  O OE1 . GLU A 1 23  ? 14.508 6.654   0.004  1.00 32.45 ? 11  GLU A OE1 1 
ATOM   113  O OE2 . GLU A 1 23  ? 15.249 5.483   -1.727 1.00 29.47 ? 11  GLU A OE2 1 
ATOM   114  N N   . PHE A 1 24  ? 18.300 7.528   3.956  1.00 10.64 ? 12  PHE A N   1 
ATOM   115  C CA  . PHE A 1 24  ? 18.491 8.417   5.120  1.00 11.82 ? 12  PHE A CA  1 
ATOM   116  C C   . PHE A 1 24  ? 19.949 8.855   5.254  1.00 11.02 ? 12  PHE A C   1 
ATOM   117  O O   . PHE A 1 24  ? 20.244 10.040  5.442  1.00 12.78 ? 12  PHE A O   1 
ATOM   118  C CB  . PHE A 1 24  ? 18.084 7.720   6.430  1.00 9.88  ? 12  PHE A CB  1 
ATOM   119  C CG  . PHE A 1 24  ? 18.442 8.504   7.688  1.00 11.65 ? 12  PHE A CG  1 
ATOM   120  C CD1 . PHE A 1 24  ? 19.758 8.541   8.159  1.00 12.28 ? 12  PHE A CD1 1 
ATOM   121  C CD2 . PHE A 1 24  ? 17.461 9.178   8.404  1.00 11.09 ? 12  PHE A CD2 1 
ATOM   122  C CE1 . PHE A 1 24  ? 20.077 9.242   9.323  1.00 13.78 ? 12  PHE A CE1 1 
ATOM   123  C CE2 . PHE A 1 24  ? 17.765 9.881   9.572  1.00 16.28 ? 12  PHE A CE2 1 
ATOM   124  C CZ  . PHE A 1 24  ? 19.096 9.910   10.036 1.00 14.95 ? 12  PHE A CZ  1 
ATOM   125  N N   . GLN A 1 25  ? 20.865 7.897   5.195  1.00 11.23 ? 13  GLN A N   1 
ATOM   126  C CA  . GLN A 1 25  ? 22.289 8.247   5.346  1.00 12.73 ? 13  GLN A CA  1 
ATOM   127  C C   . GLN A 1 25  ? 22.770 9.169   4.227  1.00 13.49 ? 13  GLN A C   1 
ATOM   128  O O   . GLN A 1 25  ? 23.470 10.166  4.473  1.00 14.59 ? 13  GLN A O   1 
ATOM   129  C CB  . GLN A 1 25  ? 23.144 6.973   5.406  1.00 12.49 ? 13  GLN A CB  1 
ATOM   130  C CG  . GLN A 1 25  ? 22.827 6.111   6.631  1.00 12.53 ? 13  GLN A CG  1 
ATOM   131  C CD  . GLN A 1 25  ? 23.472 4.712   6.581  1.00 12.69 ? 13  GLN A CD  1 
ATOM   132  O OE1 . GLN A 1 25  ? 24.710 4.625   7.008  1.00 10.83 ? 13  GLN A OE1 1 
ATOM   133  N NE2 . GLN A 1 25  ? 22.855 3.745   6.161  1.00 13.38 ? 13  GLN A NE2 1 
ATOM   134  N N   . LYS A 1 26  ? 22.392 8.844   2.999  1.00 14.40 ? 14  LYS A N   1 
ATOM   135  C CA  . LYS A 1 26  ? 22.790 9.670   1.868  1.00 17.68 ? 14  LYS A CA  1 
ATOM   136  C C   . LYS A 1 26  ? 22.205 11.076  1.955  1.00 17.18 ? 14  LYS A C   1 
ATOM   137  O O   . LYS A 1 26  ? 22.909 12.058  1.771  1.00 16.74 ? 14  LYS A O   1 
ATOM   138  C CB  . LYS A 1 26  ? 22.343 9.027   0.543  1.00 18.73 ? 14  LYS A CB  1 
ATOM   139  C CG  . LYS A 1 26  ? 22.717 9.878   -0.681 1.00 23.46 ? 14  LYS A CG  1 
ATOM   140  C CD  . LYS A 1 26  ? 22.378 9.180   -2.007 1.00 27.26 ? 14  LYS A CD  1 
ATOM   141  C CE  . LYS A 1 26  ? 22.410 10.212  -3.160 1.00 30.90 ? 14  LYS A CE  1 
ATOM   142  N NZ  . LYS A 1 26  ? 23.678 11.067  -3.149 1.00 30.82 ? 14  LYS A NZ  1 
ATOM   143  N N   . GLU A 1 27  ? 20.913 11.175  2.256  1.00 16.70 ? 15  GLU A N   1 
ATOM   144  C CA  . GLU A 1 27  ? 20.233 12.477  2.326  1.00 19.04 ? 15  GLU A CA  1 
ATOM   145  C C   . GLU A 1 27  ? 20.597 13.397  3.466  1.00 19.47 ? 15  GLU A C   1 
ATOM   146  O O   . GLU A 1 27  ? 20.751 14.612  3.270  1.00 16.41 ? 15  GLU A O   1 
ATOM   147  C CB  . GLU A 1 27  ? 18.722 12.293  2.410  1.00 24.12 ? 15  GLU A CB  1 
ATOM   148  C CG  . GLU A 1 27  ? 17.989 12.715  1.199  1.00 29.77 ? 15  GLU A CG  1 
ATOM   149  C CD  . GLU A 1 27  ? 17.764 11.568  0.282  1.00 35.11 ? 15  GLU A CD  1 
ATOM   150  O OE1 . GLU A 1 27  ? 18.785 10.972  -0.144 1.00 36.21 ? 15  GLU A OE1 1 
ATOM   151  O OE2 . GLU A 1 27  ? 16.576 11.261  0.007  1.00 34.26 ? 15  GLU A OE2 1 
ATOM   152  N N   . THR A 1 28  ? 20.690 12.832  4.667  1.00 17.27 ? 16  THR A N   1 
ATOM   153  C CA  . THR A 1 28  ? 21.019 13.641  5.844  1.00 18.01 ? 16  THR A CA  1 
ATOM   154  C C   . THR A 1 28  ? 22.529 13.804  6.012  1.00 19.70 ? 16  THR A C   1 
ATOM   155  O O   . THR A 1 28  ? 22.964 14.673  6.760  1.00 19.74 ? 16  THR A O   1 
ATOM   156  C CB  . THR A 1 28  ? 20.583 12.974  7.150  1.00 17.35 ? 16  THR A CB  1 
ATOM   157  O OG1 . THR A 1 28  ? 21.306 11.734  7.271  1.00 15.98 ? 16  THR A OG1 1 
ATOM   158  C CG2 . THR A 1 28  ? 19.048 12.720  7.184  1.00 17.10 ? 16  THR A CG2 1 
ATOM   159  N N   . GLY A 1 29  ? 23.310 12.943  5.355  1.00 19.32 ? 17  GLY A N   1 
ATOM   160  C CA  . GLY A 1 29  ? 24.746 12.986  5.520  1.00 20.75 ? 17  GLY A CA  1 
ATOM   161  C C   . GLY A 1 29  ? 25.158 12.271  6.819  1.00 21.88 ? 17  GLY A C   1 
ATOM   162  O O   . GLY A 1 29  ? 26.338 12.196  7.140  1.00 23.28 ? 17  GLY A O   1 
ATOM   163  N N   . ILE A 1 30  ? 24.200 11.742  7.578  1.00 19.79 ? 18  ILE A N   1 
ATOM   164  C CA  . ILE A 1 30  ? 24.549 11.064  8.820  1.00 18.63 ? 18  ILE A CA  1 
ATOM   165  C C   . ILE A 1 30  ? 24.723 9.576   8.559  1.00 17.93 ? 18  ILE A C   1 
ATOM   166  O O   . ILE A 1 30  ? 23.752 8.823   8.557  1.00 16.29 ? 18  ILE A O   1 
ATOM   167  C CB  . ILE A 1 30  ? 23.466 11.291  9.912  1.00 19.09 ? 18  ILE A CB  1 
ATOM   168  C CG1 . ILE A 1 30  ? 23.225 12.793  10.097 1.00 18.69 ? 18  ILE A CG1 1 
ATOM   169  C CG2 . ILE A 1 30  ? 23.908 10.667  11.256 1.00 17.29 ? 18  ILE A CG2 1 
ATOM   170  C CD1 . ILE A 1 30  ? 22.040 13.132  11.097 1.00 18.38 ? 18  ILE A CD1 1 
ATOM   171  N N   . ASN A 1 31  ? 25.971 9.156   8.332  1.00 17.18 ? 19  ASN A N   1 
ATOM   172  C CA  . ASN A 1 31  ? 26.253 7.760   8.088  1.00 17.78 ? 19  ASN A CA  1 
ATOM   173  C C   . ASN A 1 31  ? 26.287 7.043   9.409  1.00 14.78 ? 19  ASN A C   1 
ATOM   174  O O   . ASN A 1 31  ? 26.535 7.648   10.436 1.00 14.31 ? 19  ASN A O   1 
ATOM   175  C CB  . ASN A 1 31  ? 27.604 7.552   7.378  1.00 21.66 ? 19  ASN A CB  1 
ATOM   176  C CG  . ASN A 1 31  ? 27.588 8.048   5.936  1.00 24.77 ? 19  ASN A CG  1 
ATOM   177  O OD1 . ASN A 1 31  ? 26.593 7.905   5.233  1.00 24.22 ? 19  ASN A OD1 1 
ATOM   178  N ND2 . ASN A 1 31  ? 28.695 8.621   5.496  1.00 26.51 ? 19  ASN A ND2 1 
ATOM   179  N N   . PHE A 1 32  ? 26.014 5.749   9.364  1.00 14.37 ? 20  PHE A N   1 
ATOM   180  C CA  . PHE A 1 32  ? 26.033 4.901   10.552 1.00 14.81 ? 20  PHE A CA  1 
ATOM   181  C C   . PHE A 1 32  ? 26.961 3.719   10.323 1.00 14.87 ? 20  PHE A C   1 
ATOM   182  O O   . PHE A 1 32  ? 27.096 3.249   9.183  1.00 15.77 ? 20  PHE A O   1 
ATOM   183  C CB  . PHE A 1 32  ? 24.632 4.339   10.829 1.00 14.84 ? 20  PHE A CB  1 
ATOM   184  C CG  . PHE A 1 32  ? 23.858 5.145   11.779 1.00 14.14 ? 20  PHE A CG  1 
ATOM   185  C CD1 . PHE A 1 32  ? 23.778 4.754   13.127 1.00 14.93 ? 20  PHE A CD1 1 
ATOM   186  C CD2 . PHE A 1 32  ? 23.212 6.302   11.356 1.00 10.57 ? 20  PHE A CD2 1 
ATOM   187  C CE1 . PHE A 1 32  ? 23.068 5.495   14.034 1.00 13.49 ? 20  PHE A CE1 1 
ATOM   188  C CE2 . PHE A 1 32  ? 22.485 7.074   12.260 1.00 12.96 ? 20  PHE A CE2 1 
ATOM   189  C CZ  . PHE A 1 32  ? 22.405 6.677   13.605 1.00 13.43 ? 20  PHE A CZ  1 
ATOM   190  N N   . LYS A 1 33  ? 27.612 3.263   11.390 1.00 14.31 ? 21  LYS A N   1 
ATOM   191  C CA  . LYS A 1 33  ? 28.461 2.093   11.301 1.00 15.09 ? 21  LYS A CA  1 
ATOM   192  C C   . LYS A 1 33  ? 27.501 0.920   11.465 1.00 14.83 ? 21  LYS A C   1 
ATOM   193  O O   . LYS A 1 33  ? 27.456 0.045   10.625 1.00 15.73 ? 21  LYS A O   1 
ATOM   194  C CB  . LYS A 1 33  ? 29.543 2.098   12.395 1.00 16.04 ? 21  LYS A CB  1 
ATOM   195  C CG  . LYS A 1 33  ? 30.394 3.391   12.373 1.00 17.41 ? 21  LYS A CG  1 
ATOM   196  C CD  . LYS A 1 33  ? 31.593 3.398   13.329 1.00 20.96 ? 21  LYS A CD  1 
ATOM   197  C CE  . LYS A 1 33  ? 31.203 3.270   14.774 1.00 22.43 ? 21  LYS A CE  1 
ATOM   198  N NZ  . LYS A 1 33  ? 32.269 3.746   15.696 1.00 22.20 ? 21  LYS A NZ  1 
ATOM   199  N N   . ASN A 1 34  ? 26.725 0.918   12.550 1.00 14.93 ? 22  ASN A N   1 
ATOM   200  C CA  . ASN A 1 34  ? 25.742 -0.146  12.793 1.00 16.25 ? 22  ASN A CA  1 
ATOM   201  C C   . ASN A 1 34  ? 24.384 0.364   12.258 1.00 16.79 ? 22  ASN A C   1 
ATOM   202  O O   . ASN A 1 34  ? 23.671 1.099   12.964 1.00 13.34 ? 22  ASN A O   1 
ATOM   203  C CB  . ASN A 1 34  ? 25.632 -0.423  14.303 1.00 16.13 ? 22  ASN A CB  1 
ATOM   204  C CG  . ASN A 1 34  ? 24.710 -1.577  14.599 1.00 19.32 ? 22  ASN A CG  1 
ATOM   205  O OD1 . ASN A 1 34  ? 23.960 -2.010  13.724 1.00 20.19 ? 22  ASN A OD1 1 
ATOM   206  N ND2 . ASN A 1 34  ? 24.747 -2.078  15.829 1.00 18.24 ? 22  ASN A ND2 1 
ATOM   207  N N   . GLU A 1 35  ? 24.050 0.016   11.011 1.00 14.94 ? 23  GLU A N   1 
ATOM   208  C CA  . GLU A 1 35  ? 22.791 0.460   10.415 1.00 18.74 ? 23  GLU A CA  1 
ATOM   209  C C   . GLU A 1 35  ? 21.546 -0.065  11.151 1.00 18.44 ? 23  GLU A C   1 
ATOM   210  O O   . GLU A 1 35  ? 20.445 0.485   10.995 1.00 16.72 ? 23  GLU A O   1 
ATOM   211  C CB  . GLU A 1 35  ? 22.739 0.066   8.923  1.00 22.08 ? 23  GLU A CB  1 
ATOM   212  C CG  . GLU A 1 35  ? 23.848 0.724   8.088  1.00 26.53 ? 23  GLU A CG  1 
ATOM   213  C CD  . GLU A 1 35  ? 23.742 0.436   6.585  1.00 29.70 ? 23  GLU A CD  1 
ATOM   214  O OE1 . GLU A 1 35  ? 23.380 -0.706  6.189  1.00 33.48 ? 23  GLU A OE1 1 
ATOM   215  O OE2 . GLU A 1 35  ? 24.030 1.355   5.801  1.00 29.83 ? 23  GLU A OE2 1 
ATOM   216  N N   . GLU A 1 36  ? 21.705 -1.110  11.958 1.00 16.78 ? 24  GLU A N   1 
ATOM   217  C CA  . GLU A 1 36  ? 20.554 -1.615  12.723 1.00 18.34 ? 24  GLU A CA  1 
ATOM   218  C C   . GLU A 1 36  ? 20.054 -0.594  13.771 1.00 16.25 ? 24  GLU A C   1 
ATOM   219  O O   . GLU A 1 36  ? 18.852 -0.537  14.037 1.00 14.00 ? 24  GLU A O   1 
ATOM   220  C CB  . GLU A 1 36  ? 20.884 -2.940  13.424 1.00 20.63 ? 24  GLU A CB  1 
ATOM   221  C CG  . GLU A 1 36  ? 19.876 -3.350  14.512 1.00 27.61 ? 24  GLU A CG  1 
ATOM   222  C CD  . GLU A 1 36  ? 18.414 -3.458  14.022 1.00 29.58 ? 24  GLU A CD  1 
ATOM   223  O OE1 . GLU A 1 36  ? 18.177 -3.677  12.812 1.00 32.07 ? 24  GLU A OE1 1 
ATOM   224  O OE2 . GLU A 1 36  ? 17.492 -3.343  14.867 1.00 32.10 ? 24  GLU A OE2 1 
ATOM   225  N N   . LEU A 1 37  ? 20.970 0.189   14.353 1.00 13.21 ? 25  LEU A N   1 
ATOM   226  C CA  . LEU A 1 37  ? 20.629 1.220   15.339 1.00 13.89 ? 25  LEU A CA  1 
ATOM   227  C C   . LEU A 1 37  ? 19.764 2.300   14.661 1.00 11.39 ? 25  LEU A C   1 
ATOM   228  O O   . LEU A 1 37  ? 18.797 2.797   15.254 1.00 9.07  ? 25  LEU A O   1 
ATOM   229  C CB  . LEU A 1 37  ? 21.898 1.896   15.900 1.00 13.33 ? 25  LEU A CB  1 
ATOM   230  C CG  . LEU A 1 37  ? 22.711 1.047   16.898 1.00 17.43 ? 25  LEU A CG  1 
ATOM   231  C CD1 . LEU A 1 37  ? 24.034 1.701   17.197 1.00 16.45 ? 25  LEU A CD1 1 
ATOM   232  C CD2 . LEU A 1 37  ? 21.918 0.857   18.164 1.00 19.63 ? 25  LEU A CD2 1 
ATOM   233  N N   . LEU A 1 38  ? 20.147 2.669   13.441 1.00 8.65  ? 26  LEU A N   1 
ATOM   234  C CA  . LEU A 1 38  ? 19.407 3.664   12.646 1.00 10.32 ? 26  LEU A CA  1 
ATOM   235  C C   . LEU A 1 38  ? 18.002 3.150   12.281 1.00 9.46  ? 26  LEU A C   1 
ATOM   236  O O   . LEU A 1 38  ? 17.005 3.849   12.427 1.00 9.57  ? 26  LEU A O   1 
ATOM   237  C CB  . LEU A 1 38  ? 20.200 4.010   11.363 1.00 10.88 ? 26  LEU A CB  1 
ATOM   238  C CG  . LEU A 1 38  ? 19.449 4.841   10.327 1.00 12.00 ? 26  LEU A CG  1 
ATOM   239  C CD1 . LEU A 1 38  ? 19.002 6.142   11.017 1.00 9.53  ? 26  LEU A CD1 1 
ATOM   240  C CD2 . LEU A 1 38  ? 20.354 5.152   9.088  1.00 9.76  ? 26  LEU A CD2 1 
ATOM   241  N N   . PHE A 1 39  ? 17.921 1.937   11.775 1.00 12.27 ? 27  PHE A N   1 
ATOM   242  C CA  . PHE A 1 39  ? 16.620 1.341   11.472 1.00 13.01 ? 27  PHE A CA  1 
ATOM   243  C C   . PHE A 1 39  ? 15.700 1.378   12.705 1.00 14.47 ? 27  PHE A C   1 
ATOM   244  O O   . PHE A 1 39  ? 14.533 1.801   12.650 1.00 14.66 ? 27  PHE A O   1 
ATOM   245  C CB  . PHE A 1 39  ? 16.820 -0.107  11.086 1.00 14.26 ? 27  PHE A CB  1 
ATOM   246  C CG  . PHE A 1 39  ? 15.562 -0.839  10.888 1.00 17.04 ? 27  PHE A CG  1 
ATOM   247  C CD1 . PHE A 1 39  ? 14.731 -0.529  9.814  1.00 13.38 ? 27  PHE A CD1 1 
ATOM   248  C CD2 . PHE A 1 39  ? 15.200 -1.853  11.757 1.00 17.57 ? 27  PHE A CD2 1 
ATOM   249  C CE1 . PHE A 1 39  ? 13.573 -1.214  9.596  1.00 18.87 ? 27  PHE A CE1 1 
ATOM   250  C CE2 . PHE A 1 39  ? 14.023 -2.561  11.546 1.00 23.88 ? 27  PHE A CE2 1 
ATOM   251  C CZ  . PHE A 1 39  ? 13.195 -2.239  10.443 1.00 18.52 ? 27  PHE A CZ  1 
ATOM   252  N N   . ARG A 1 40  ? 16.232 0.942   13.838 1.00 14.46 ? 28  ARG A N   1 
ATOM   253  C CA  . ARG A 1 40  ? 15.459 0.902   15.073 1.00 15.52 ? 28  ARG A CA  1 
ATOM   254  C C   . ARG A 1 40  ? 14.944 2.282   15.494 1.00 13.37 ? 28  ARG A C   1 
ATOM   255  O O   . ARG A 1 40  ? 13.794 2.408   15.898 1.00 13.23 ? 28  ARG A O   1 
ATOM   256  C CB  . ARG A 1 40  ? 16.303 0.289   16.178 1.00 18.38 ? 28  ARG A CB  1 
ATOM   257  C CG  . ARG A 1 40  ? 15.732 0.411   17.579 1.00 26.34 ? 28  ARG A CG  1 
ATOM   258  C CD  . ARG A 1 40  ? 15.283 -0.919  18.141 1.00 30.47 ? 28  ARG A CD  1 
ATOM   259  N NE  . ARG A 1 40  ? 16.099 -2.034  17.677 1.00 36.44 ? 28  ARG A NE  1 
ATOM   260  C CZ  . ARG A 1 40  ? 17.349 -2.290  18.045 1.00 37.87 ? 28  ARG A CZ  1 
ATOM   261  N NH1 . ARG A 1 40  ? 17.990 -1.505  18.906 1.00 41.45 ? 28  ARG A NH1 1 
ATOM   262  N NH2 . ARG A 1 40  ? 17.952 -3.367  17.561 1.00 39.98 ? 28  ARG A NH2 1 
ATOM   263  N N   . ALA A 1 41  ? 15.777 3.309   15.364 1.00 10.30 ? 29  ALA A N   1 
ATOM   264  C CA  . ALA A 1 41  ? 15.367 4.670   15.732 1.00 11.37 ? 29  ALA A CA  1 
ATOM   265  C C   . ALA A 1 41  ? 14.193 5.186   14.876 1.00 9.67  ? 29  ALA A C   1 
ATOM   266  O O   . ALA A 1 41  ? 13.358 5.986   15.352 1.00 8.40  ? 29  ALA A O   1 
ATOM   267  C CB  . ALA A 1 41  ? 16.552 5.635   15.608 1.00 9.24  ? 29  ALA A CB  1 
ATOM   268  N N   . LEU A 1 42  ? 14.160 4.749   13.626 1.00 8.29  ? 30  LEU A N   1 
ATOM   269  C CA  . LEU A 1 42  ? 13.134 5.145   12.685 1.00 10.57 ? 30  LEU A CA  1 
ATOM   270  C C   . LEU A 1 42  ? 11.873 4.290   12.776 1.00 11.11 ? 30  LEU A C   1 
ATOM   271  O O   . LEU A 1 42  ? 10.885 4.592   12.096 1.00 11.84 ? 30  LEU A O   1 
ATOM   272  C CB  . LEU A 1 42  ? 13.666 5.025   11.259 1.00 9.25  ? 30  LEU A CB  1 
ATOM   273  C CG  . LEU A 1 42  ? 14.852 5.925   10.864 1.00 11.13 ? 30  LEU A CG  1 
ATOM   274  C CD1 . LEU A 1 42  ? 15.429 5.392   9.534  1.00 7.66  ? 30  LEU A CD1 1 
ATOM   275  C CD2 . LEU A 1 42  ? 14.387 7.378   10.752 1.00 9.97  ? 30  LEU A CD2 1 
ATOM   276  N N   . CYS A 1 43  ? 11.923 3.212   13.569 1.00 10.79 ? 31  CYS A N   1 
ATOM   277  C CA  . CYS A 1 43  ? 10.793 2.284   13.677 1.00 13.11 ? 31  CYS A CA  1 
ATOM   278  C C   . CYS A 1 43  ? 9.783  2.638   14.755 1.00 12.58 ? 31  CYS A C   1 
ATOM   279  O O   . CYS A 1 43  ? 10.025 2.452   15.936 1.00 11.25 ? 31  CYS A O   1 
ATOM   280  C CB  . CYS A 1 43  ? 11.259 0.837   13.916 1.00 14.98 ? 31  CYS A CB  1 
ATOM   281  S SG  . CYS A 1 43  ? 11.759 -0.115  12.436 1.00 26.01 ? 31  CYS A SG  1 
ATOM   282  N N   . HIS A 1 44  ? 8.632  3.138   14.321 1.00 13.25 ? 32  HIS A N   1 
ATOM   283  C CA  . HIS A 1 44  ? 7.568  3.507   15.237 1.00 10.71 ? 32  HIS A CA  1 
ATOM   284  C C   . HIS A 1 44  ? 7.022  2.184   15.725 1.00 10.36 ? 32  HIS A C   1 
ATOM   285  O O   . HIS A 1 44  ? 7.055  1.180   14.991 1.00 7.47  ? 32  HIS A O   1 
ATOM   286  C CB  . HIS A 1 44  ? 6.435  4.229   14.515 1.00 10.99 ? 32  HIS A CB  1 
ATOM   287  C CG  . HIS A 1 44  ? 5.380  4.762   15.441 1.00 7.89  ? 32  HIS A CG  1 
ATOM   288  N ND1 . HIS A 1 44  ? 4.059  4.369   15.376 1.00 10.65 ? 32  HIS A ND1 1 
ATOM   289  C CD2 . HIS A 1 44  ? 5.462  5.648   16.464 1.00 9.33  ? 32  HIS A CD2 1 
ATOM   290  C CE1 . HIS A 1 44  ? 3.368  4.998   16.315 1.00 11.03 ? 32  HIS A CE1 1 
ATOM   291  N NE2 . HIS A 1 44  ? 4.200  5.780   16.993 1.00 8.56  ? 32  HIS A NE2 1 
ATOM   292  N N   . SER A 1 45  ? 6.489  2.188   16.937 1.00 11.83 ? 33  SER A N   1 
ATOM   293  C CA  . SER A 1 45  ? 5.906  0.956   17.515 1.00 13.79 ? 33  SER A CA  1 
ATOM   294  C C   . SER A 1 45  ? 4.791  0.355   16.625 1.00 13.98 ? 33  SER A C   1 
ATOM   295  O O   . SER A 1 45  ? 4.564  -0.873  16.601 1.00 11.35 ? 33  SER A O   1 
ATOM   296  C CB  . SER A 1 45  ? 5.310  1.279   18.886 1.00 17.50 ? 33  SER A CB  1 
ATOM   297  O OG  . SER A 1 45  ? 4.287  2.266   18.742 1.00 20.03 ? 33  SER A OG  1 
ATOM   298  N N   . SER A 1 46  ? 4.089  1.206   15.889 1.00 11.75 ? 34  SER A N   1 
ATOM   299  C CA  . SER A 1 46  ? 3.003  0.669   15.058 1.00 12.90 ? 34  SER A CA  1 
ATOM   300  C C   . SER A 1 46  ? 3.575  -0.263  13.993 1.00 11.12 ? 34  SER A C   1 
ATOM   301  O O   . SER A 1 46  ? 2.965  -1.261  13.638 1.00 10.90 ? 34  SER A O   1 
ATOM   302  C CB  . SER A 1 46  ? 2.175  1.812   14.408 1.00 11.62 ? 34  SER A CB  1 
ATOM   303  O OG  . SER A 1 46  ? 2.990  2.575   13.516 1.00 11.21 ? 34  SER A OG  1 
ATOM   304  N N   . TYR A 1 47  ? 4.774  0.039   13.507 1.00 11.08 ? 35  TYR A N   1 
ATOM   305  C CA  . TYR A 1 47  ? 5.414  -0.794  12.485 1.00 9.76  ? 35  TYR A CA  1 
ATOM   306  C C   . TYR A 1 47  ? 6.033  -2.056  13.119 1.00 11.10 ? 35  TYR A C   1 
ATOM   307  O O   . TYR A 1 47  ? 5.976  -3.145  12.552 1.00 9.54  ? 35  TYR A O   1 
ATOM   308  C CB  . TYR A 1 47  ? 6.500  0.018   11.753 1.00 11.00 ? 35  TYR A CB  1 
ATOM   309  C CG  . TYR A 1 47  ? 7.197  -0.731  10.637 1.00 11.97 ? 35  TYR A CG  1 
ATOM   310  C CD1 . TYR A 1 47  ? 6.609  -0.830  9.376  1.00 12.32 ? 35  TYR A CD1 1 
ATOM   311  C CD2 . TYR A 1 47  ? 8.483  -1.314  10.833 1.00 12.32 ? 35  TYR A CD2 1 
ATOM   312  C CE1 . TYR A 1 47  ? 7.258  -1.466  8.331  1.00 12.48 ? 35  TYR A CE1 1 
ATOM   313  C CE2 . TYR A 1 47  ? 9.145  -1.952  9.786  1.00 11.86 ? 35  TYR A CE2 1 
ATOM   314  C CZ  . TYR A 1 47  ? 8.536  -2.021  8.531  1.00 14.69 ? 35  TYR A CZ  1 
ATOM   315  O OH  . TYR A 1 47  ? 9.199  -2.577  7.439  1.00 13.41 ? 35  TYR A OH  1 
ATOM   316  N N   . ALA A 1 48  ? 6.643  -1.900  14.288 1.00 10.65 ? 36  ALA A N   1 
ATOM   317  C CA  . ALA A 1 48  ? 7.222  -3.050  14.967 1.00 10.94 ? 36  ALA A CA  1 
ATOM   318  C C   . ALA A 1 48  ? 6.094  -4.061  15.280 1.00 10.70 ? 36  ALA A C   1 
ATOM   319  O O   . ALA A 1 48  ? 6.253  -5.235  15.007 1.00 10.66 ? 36  ALA A O   1 
ATOM   320  C CB  . ALA A 1 48  ? 7.929  -2.598  16.266 1.00 10.45 ? 36  ALA A CB  1 
ATOM   321  N N   . ASN A 1 49  ? 4.950  -3.589  15.783 1.00 10.94 ? 37  ASN A N   1 
ATOM   322  C CA  . ASN A 1 49  ? 3.831  -4.477  16.104 1.00 13.48 ? 37  ASN A CA  1 
ATOM   323  C C   . ASN A 1 49  ? 3.296  -5.177  14.852 1.00 14.30 ? 37  ASN A C   1 
ATOM   324  O O   . ASN A 1 49  ? 3.010  -6.383  14.872 1.00 14.16 ? 37  ASN A O   1 
ATOM   325  C CB  . ASN A 1 49  ? 2.711  -3.693  16.804 1.00 16.19 ? 37  ASN A CB  1 
ATOM   326  C CG  . ASN A 1 49  ? 3.156  -3.141  18.149 1.00 17.37 ? 37  ASN A CG  1 
ATOM   327  O OD1 . ASN A 1 49  ? 4.122  -3.643  18.734 1.00 20.08 ? 37  ASN A OD1 1 
ATOM   328  N ND2 . ASN A 1 49  ? 2.465  -2.116  18.649 1.00 17.73 ? 37  ASN A ND2 1 
ATOM   329  N N   . GLU A 1 50  ? 3.176  -4.423  13.767 1.00 13.07 ? 38  GLU A N   1 
ATOM   330  C CA  . GLU A 1 50  ? 2.705  -4.969  12.487 1.00 13.25 ? 38  GLU A CA  1 
ATOM   331  C C   . GLU A 1 50  ? 3.650  -6.086  12.013 1.00 14.14 ? 38  GLU A C   1 
ATOM   332  O O   . GLU A 1 50  ? 3.215  -7.222  11.727 1.00 15.38 ? 38  GLU A O   1 
ATOM   333  C CB  . GLU A 1 50  ? 2.643  -3.845  11.439 1.00 15.53 ? 38  GLU A CB  1 
ATOM   334  C CG  . GLU A 1 50  ? 2.358  -4.258  9.983  1.00 16.91 ? 38  GLU A CG  1 
ATOM   335  C CD  . GLU A 1 50  ? 2.387  -3.054  9.035  1.00 18.69 ? 38  GLU A CD  1 
ATOM   336  O OE1 . GLU A 1 50  ? 1.308  -2.410  8.850  1.00 15.95 ? 38  GLU A OE1 1 
ATOM   337  O OE2 . GLU A 1 50  ? 3.498  -2.740  8.492  1.00 17.10 ? 38  GLU A OE2 1 
ATOM   338  N N   . GLN A 1 51  ? 4.947  -5.792  11.944 1.00 11.72 ? 39  GLN A N   1 
ATOM   339  C CA  . GLN A 1 51  ? 5.910  -6.789  11.503 1.00 11.98 ? 39  GLN A CA  1 
ATOM   340  C C   . GLN A 1 51  ? 6.012  -7.976  12.444 1.00 11.84 ? 39  GLN A C   1 
ATOM   341  O O   . GLN A 1 51  ? 6.207  -9.106  11.993 1.00 13.47 ? 39  GLN A O   1 
ATOM   342  C CB  . GLN A 1 51  ? 7.298  -6.137  11.328 1.00 13.43 ? 39  GLN A CB  1 
ATOM   343  C CG  . GLN A 1 51  ? 7.320  -5.070  10.197 1.00 11.68 ? 39  GLN A CG  1 
ATOM   344  C CD  . GLN A 1 51  ? 6.861  -5.633  8.880  1.00 15.81 ? 39  GLN A CD  1 
ATOM   345  O OE1 . GLN A 1 51  ? 7.438  -6.606  8.367  1.00 14.97 ? 39  GLN A OE1 1 
ATOM   346  N NE2 . GLN A 1 51  ? 5.802  -5.038  8.314  1.00 16.53 ? 39  GLN A NE2 1 
ATOM   347  N N   . ASN A 1 52  ? 5.910  -7.741  13.750 1.00 12.13 ? 40  ASN A N   1 
ATOM   348  C CA  . ASN A 1 52  ? 6.003  -8.849  14.698 1.00 13.71 ? 40  ASN A CA  1 
ATOM   349  C C   . ASN A 1 52  ? 4.795  -9.790  14.461 1.00 14.73 ? 40  ASN A C   1 
ATOM   350  O O   . ASN A 1 52  ? 4.926  -11.029 14.452 1.00 13.55 ? 40  ASN A O   1 
ATOM   351  C CB  . ASN A 1 52  ? 5.973  -8.330  16.146 1.00 15.20 ? 40  ASN A CB  1 
ATOM   352  C CG  . ASN A 1 52  ? 7.231  -7.537  16.543 1.00 17.80 ? 40  ASN A CG  1 
ATOM   353  O OD1 . ASN A 1 52  ? 7.090  -6.773  17.604 1.00 16.50 ? 40  ASN A OD1 1 
ATOM   354  N ND2 . ASN A 1 52  ? 8.312  -7.629  15.923 1.00 16.38 ? 40  ASN A ND2 1 
ATOM   355  N N   . GLN A 1 53  ? 3.628  -9.187  14.263 1.00 13.93 ? 41  GLN A N   1 
ATOM   356  C CA  . GLN A 1 53  ? 2.409  -9.952  14.009 1.00 17.04 ? 41  GLN A CA  1 
ATOM   357  C C   . GLN A 1 53  ? 2.529  -10.702 12.687 1.00 16.28 ? 41  GLN A C   1 
ATOM   358  O O   . GLN A 1 53  ? 1.864  -11.736 12.506 1.00 16.62 ? 41  GLN A O   1 
ATOM   359  C CB  . GLN A 1 53  ? 1.182  -9.026  14.040 1.00 18.91 ? 41  GLN A CB  1 
ATOM   360  C CG  . GLN A 1 53  ? 0.578  -8.911  15.442 1.00 26.22 ? 41  GLN A CG  1 
ATOM   361  C CD  . GLN A 1 53  ? 0.139  -7.501  15.805 1.00 31.14 ? 41  GLN A CD  1 
ATOM   362  O OE1 . GLN A 1 53  ? -0.477 -6.796  14.996 1.00 34.52 ? 41  GLN A OE1 1 
ATOM   363  N NE2 . GLN A 1 53  ? 0.440  -7.081  17.041 1.00 34.90 ? 41  GLN A NE2 1 
ATOM   364  N N   . ALA A 1 54  ? 3.385  -10.208 11.775 1.00 14.04 ? 42  ALA A N   1 
ATOM   365  C CA  . ALA A 1 54  ? 3.628  -10.906 10.510 1.00 12.90 ? 42  ALA A CA  1 
ATOM   366  C C   . ALA A 1 54  ? 4.778  -11.925 10.693 1.00 13.65 ? 42  ALA A C   1 
ATOM   367  O O   . ALA A 1 54  ? 5.277  -12.504 9.725  1.00 13.08 ? 42  ALA A O   1 
ATOM   368  C CB  . ALA A 1 54  ? 3.969  -9.923  9.379  1.00 14.52 ? 42  ALA A CB  1 
ATOM   369  N N   . GLY A 1 55  ? 5.211  -12.135 11.929 1.00 12.98 ? 43  GLY A N   1 
ATOM   370  C CA  . GLY A 1 55  ? 6.250  -13.132 12.153 1.00 13.96 ? 43  GLY A CA  1 
ATOM   371  C C   . GLY A 1 55  ? 7.692  -12.622 12.190 1.00 16.56 ? 43  GLY A C   1 
ATOM   372  O O   . GLY A 1 55  ? 8.628  -13.417 12.379 1.00 16.75 ? 43  GLY A O   1 
ATOM   373  N N   . ARG A 1 56  ? 7.896  -11.326 11.980 1.00 14.59 ? 44  ARG A N   1 
ATOM   374  C CA  . ARG A 1 56  ? 9.258  -10.781 12.029 1.00 16.36 ? 44  ARG A CA  1 
ATOM   375  C C   . ARG A 1 56  ? 9.432  -10.266 13.463 1.00 16.47 ? 44  ARG A C   1 
ATOM   376  O O   . ARG A 1 56  ? 9.313  -9.072  13.746 1.00 16.93 ? 44  ARG A O   1 
ATOM   377  C CB  . ARG A 1 56  ? 9.415  -9.666  10.981 1.00 16.31 ? 44  ARG A CB  1 
ATOM   378  C CG  . ARG A 1 56  ? 9.176  -10.198 9.540  1.00 17.68 ? 44  ARG A CG  1 
ATOM   379  C CD  . ARG A 1 56  ? 9.418  -9.150  8.470  1.00 17.55 ? 44  ARG A CD  1 
ATOM   380  N NE  . ARG A 1 56  ? 10.804 -8.694  8.435  1.00 16.89 ? 44  ARG A NE  1 
ATOM   381  C CZ  . ARG A 1 56  ? 11.170 -7.432  8.237  1.00 18.36 ? 44  ARG A CZ  1 
ATOM   382  N NH1 . ARG A 1 56  ? 10.242 -6.498  8.068  1.00 15.38 ? 44  ARG A NH1 1 
ATOM   383  N NH2 . ARG A 1 56  ? 12.469 -7.106  8.199  1.00 17.81 ? 44  ARG A NH2 1 
ATOM   384  N N   . LYS A 1 57  ? 9.723  -11.204 14.359 1.00 15.73 ? 45  LYS A N   1 
ATOM   385  C CA  . LYS A 1 57  ? 9.862  -10.943 15.785 1.00 16.27 ? 45  LYS A CA  1 
ATOM   386  C C   . LYS A 1 57  ? 11.056 -10.094 16.154 1.00 17.72 ? 45  LYS A C   1 
ATOM   387  O O   . LYS A 1 57  ? 11.096 -9.550  17.251 1.00 19.06 ? 45  LYS A O   1 
ATOM   388  C CB  . LYS A 1 57  ? 9.951  -12.278 16.558 1.00 18.13 ? 45  LYS A CB  1 
ATOM   389  C CG  . LYS A 1 57  ? 9.956  -12.131 18.073 0.00 17.51 ? 45  LYS A CG  1 
ATOM   390  C CD  . LYS A 1 57  ? 8.673  -11.483 18.572 0.00 17.71 ? 45  LYS A CD  1 
ATOM   391  C CE  . LYS A 1 57  ? 8.674  -11.349 20.086 0.00 17.63 ? 45  LYS A CE  1 
ATOM   392  N NZ  . LYS A 1 57  ? 8.779  -12.672 20.760 0.00 17.63 ? 45  LYS A NZ  1 
ATOM   393  N N   . ASP A 1 58  ? 12.031 -9.956  15.263 1.00 19.51 ? 46  ASP A N   1 
ATOM   394  C CA  . ASP A 1 58  ? 13.199 -9.169  15.645 1.00 22.74 ? 46  ASP A CA  1 
ATOM   395  C C   . ASP A 1 58  ? 13.080 -7.681  15.308 1.00 20.82 ? 46  ASP A C   1 
ATOM   396  O O   . ASP A 1 58  ? 13.976 -6.904  15.611 1.00 19.36 ? 46  ASP A O   1 
ATOM   397  C CB  . ASP A 1 58  ? 14.487 -9.764  15.034 1.00 26.65 ? 46  ASP A CB  1 
ATOM   398  C CG  . ASP A 1 58  ? 14.724 -11.223 15.460 1.00 33.01 ? 46  ASP A CG  1 
ATOM   399  O OD1 . ASP A 1 58  ? 14.686 -11.505 16.684 1.00 34.34 ? 46  ASP A OD1 1 
ATOM   400  O OD2 . ASP A 1 58  ? 14.949 -12.087 14.570 1.00 35.58 ? 46  ASP A OD2 1 
ATOM   401  N N   . VAL A 1 59  ? 11.981 -7.283  14.675 1.00 18.76 ? 47  VAL A N   1 
ATOM   402  C CA  . VAL A 1 59  ? 11.807 -5.876  14.370 1.00 16.63 ? 47  VAL A CA  1 
ATOM   403  C C   . VAL A 1 59  ? 11.358 -5.234  15.674 1.00 17.23 ? 47  VAL A C   1 
ATOM   404  O O   . VAL A 1 59  ? 10.350 -5.636  16.281 1.00 17.60 ? 47  VAL A O   1 
ATOM   405  C CB  . VAL A 1 59  ? 10.743 -5.674  13.249 1.00 16.06 ? 47  VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 59  ? 10.522 -4.176  12.993 1.00 16.14 ? 47  VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 59  ? 11.230 -6.365  11.955 1.00 16.82 ? 47  VAL A CG2 1 
ATOM   408  N N   . GLU A 1 60  ? 12.104 -4.238  16.117 1.00 16.25 ? 48  GLU A N   1 
ATOM   409  C CA  . GLU A 1 60  ? 11.791 -3.572  17.378 1.00 17.15 ? 48  GLU A CA  1 
ATOM   410  C C   . GLU A 1 60  ? 11.576 -2.073  17.207 1.00 15.27 ? 48  GLU A C   1 
ATOM   411  O O   . GLU A 1 60  ? 12.181 -1.459  16.340 1.00 15.71 ? 48  GLU A O   1 
ATOM   412  C CB  . GLU A 1 60  ? 12.924 -3.797  18.373 1.00 19.58 ? 48  GLU A CB  1 
ATOM   413  C CG  . GLU A 1 60  ? 12.962 -5.198  18.920 1.00 31.50 ? 48  GLU A CG  1 
ATOM   414  C CD  . GLU A 1 60  ? 14.250 -5.459  19.654 1.00 36.15 ? 48  GLU A CD  1 
ATOM   415  O OE1 . GLU A 1 60  ? 14.768 -4.498  20.281 1.00 39.95 ? 48  GLU A OE1 1 
ATOM   416  O OE2 . GLU A 1 60  ? 14.734 -6.616  19.611 1.00 40.05 ? 48  GLU A OE2 1 
ATOM   417  N N   . SER A 1 61  ? 10.731 -1.501  18.060 1.00 13.82 ? 49  SER A N   1 
ATOM   418  C CA  . SER A 1 61  ? 10.426 -0.066  18.022 1.00 13.52 ? 49  SER A CA  1 
ATOM   419  C C   . SER A 1 61  ? 11.550 0.768   18.602 1.00 10.99 ? 49  SER A C   1 
ATOM   420  O O   . SER A 1 61  ? 12.472 0.235   19.250 1.00 12.15 ? 49  SER A O   1 
ATOM   421  C CB  . SER A 1 61  ? 9.168  0.220   18.827 1.00 12.35 ? 49  SER A CB  1 
ATOM   422  O OG  . SER A 1 61  ? 9.481  0.320   20.201 1.00 13.34 ? 49  SER A OG  1 
ATOM   423  N N   . ASN A 1 62  ? 11.434 2.079   18.410 1.00 8.77  ? 50  ASN A N   1 
ATOM   424  C CA  . ASN A 1 62  ? 12.412 3.051   18.886 1.00 9.39  ? 50  ASN A CA  1 
ATOM   425  C C   . ASN A 1 62  ? 12.144 3.488   20.318 1.00 9.92  ? 50  ASN A C   1 
ATOM   426  O O   . ASN A 1 62  ? 12.778 4.410   20.786 1.00 8.52  ? 50  ASN A O   1 
ATOM   427  C CB  . ASN A 1 62  ? 12.431 4.312   17.986 1.00 8.44  ? 50  ASN A CB  1 
ATOM   428  C CG  . ASN A 1 62  ? 11.083 5.016   17.915 1.00 10.23 ? 50  ASN A CG  1 
ATOM   429  O OD1 . ASN A 1 62  ? 10.174 4.735   18.694 1.00 12.52 ? 50  ASN A OD1 1 
ATOM   430  N ND2 . ASN A 1 62  ? 10.947 5.941   16.975 1.00 13.34 ? 50  ASN A ND2 1 
ATOM   431  N N   . GLU A 1 63  ? 11.203 2.850   21.020 1.00 9.59  ? 51  GLU A N   1 
ATOM   432  C CA  . GLU A 1 63  ? 10.894 3.278   22.378 1.00 12.01 ? 51  GLU A CA  1 
ATOM   433  C C   . GLU A 1 63  ? 12.082 3.262   23.355 1.00 10.89 ? 51  GLU A C   1 
ATOM   434  O O   . GLU A 1 63  ? 12.255 4.198   24.121 1.00 13.17 ? 51  GLU A O   1 
ATOM   435  C CB  . GLU A 1 63  ? 9.723  2.458   22.935 1.00 15.02 ? 51  GLU A CB  1 
ATOM   436  C CG  . GLU A 1 63  ? 8.400  2.768   22.203 1.00 21.53 ? 51  GLU A CG  1 
ATOM   437  C CD  . GLU A 1 63  ? 7.323  1.723   22.477 1.00 26.88 ? 51  GLU A CD  1 
ATOM   438  O OE1 . GLU A 1 63  ? 7.484  0.553   22.042 1.00 30.10 ? 51  GLU A OE1 1 
ATOM   439  O OE2 . GLU A 1 63  ? 6.318  2.078   23.133 1.00 30.05 ? 51  GLU A OE2 1 
ATOM   440  N N   . LYS A 1 64  ? 12.894 2.217   23.340 1.00 11.57 ? 52  LYS A N   1 
ATOM   441  C CA  . LYS A 1 64  ? 14.047 2.174   24.257 1.00 11.86 ? 52  LYS A CA  1 
ATOM   442  C C   . LYS A 1 64  ? 15.107 3.252   23.873 1.00 10.31 ? 52  LYS A C   1 
ATOM   443  O O   . LYS A 1 64  ? 15.691 3.898   24.741 1.00 9.42  ? 52  LYS A O   1 
ATOM   444  C CB  . LYS A 1 64  ? 14.669 0.779   24.229 1.00 11.08 ? 52  LYS A CB  1 
ATOM   445  C CG  . LYS A 1 64  ? 13.665 -0.355  24.431 1.00 20.04 ? 52  LYS A CG  1 
ATOM   446  C CD  . LYS A 1 64  ? 13.550 -0.800  25.845 1.00 23.17 ? 52  LYS A CD  1 
ATOM   447  C CE  . LYS A 1 64  ? 13.998 -2.253  25.925 1.00 29.57 ? 52  LYS A CE  1 
ATOM   448  N NZ  . LYS A 1 64  ? 12.992 -3.252  25.410 1.00 27.83 ? 52  LYS A NZ  1 
ATOM   449  N N   . LEU A 1 65  ? 15.358 3.425   22.572 1.00 9.58  ? 53  LEU A N   1 
ATOM   450  C CA  . LEU A 1 65  ? 16.306 4.447   22.117 1.00 10.37 ? 53  LEU A CA  1 
ATOM   451  C C   . LEU A 1 65  ? 15.766 5.811   22.516 1.00 10.17 ? 53  LEU A C   1 
ATOM   452  O O   . LEU A 1 65  ? 16.522 6.660   22.951 1.00 12.58 ? 53  LEU A O   1 
ATOM   453  C CB  . LEU A 1 65  ? 16.518 4.386   20.588 1.00 9.74  ? 53  LEU A CB  1 
ATOM   454  C CG  . LEU A 1 65  ? 17.327 3.195   20.074 1.00 12.24 ? 53  LEU A CG  1 
ATOM   455  C CD1 . LEU A 1 65  ? 17.238 3.142   18.545 1.00 11.91 ? 53  LEU A CD1 1 
ATOM   456  C CD2 . LEU A 1 65  ? 18.820 3.328   20.550 1.00 9.18  ? 53  LEU A CD2 1 
ATOM   457  N N   . GLU A 1 66  ? 14.459 6.029   22.368 1.00 9.29  ? 54  GLU A N   1 
ATOM   458  C CA  . GLU A 1 66  ? 13.858 7.312   22.772 1.00 11.11 ? 54  GLU A CA  1 
ATOM   459  C C   . GLU A 1 66  ? 14.095 7.577   24.275 1.00 8.57  ? 54  GLU A C   1 
ATOM   460  O O   . GLU A 1 66  ? 14.364 8.701   24.678 1.00 9.55  ? 54  GLU A O   1 
ATOM   461  C CB  . GLU A 1 66  ? 12.336 7.312   22.512 1.00 15.65 ? 54  GLU A CB  1 
ATOM   462  C CG  . GLU A 1 66  ? 11.690 8.696   22.639 1.00 19.13 ? 54  GLU A CG  1 
ATOM   463  C CD  . GLU A 1 66  ? 10.258 8.633   23.151 1.00 27.47 ? 54  GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 66  ? 9.470  7.810   22.645 1.00 29.24 ? 54  GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 66  ? 9.914  9.405   24.082 1.00 33.84 ? 54  GLU A OE2 1 
ATOM   466  N N   . PHE A 1 67  ? 13.993 6.530   25.092 1.00 10.20 ? 55  PHE A N   1 
ATOM   467  C CA  . PHE A 1 67  ? 14.251 6.644   26.545 1.00 11.63 ? 55  PHE A CA  1 
ATOM   468  C C   . PHE A 1 67  ? 15.687 7.120   26.794 1.00 11.63 ? 55  PHE A C   1 
ATOM   469  O O   . PHE A 1 67  ? 15.926 8.016   27.604 1.00 11.84 ? 55  PHE A O   1 
ATOM   470  C CB  . PHE A 1 67  ? 14.038 5.277   27.219 1.00 15.36 ? 55  PHE A CB  1 
ATOM   471  C CG  . PHE A 1 67  ? 14.699 5.145   28.566 1.00 19.10 ? 55  PHE A CG  1 
ATOM   472  C CD1 . PHE A 1 67  ? 15.900 4.451   28.700 1.00 18.46 ? 55  PHE A CD1 1 
ATOM   473  C CD2 . PHE A 1 67  ? 14.105 5.694   29.705 1.00 19.89 ? 55  PHE A CD2 1 
ATOM   474  C CE1 . PHE A 1 67  ? 16.511 4.290   29.960 1.00 20.65 ? 55  PHE A CE1 1 
ATOM   475  C CE2 . PHE A 1 67  ? 14.703 5.544   30.967 1.00 18.39 ? 55  PHE A CE2 1 
ATOM   476  C CZ  . PHE A 1 67  ? 15.903 4.840   31.096 1.00 17.66 ? 55  PHE A CZ  1 
ATOM   477  N N   . LEU A 1 68  ? 16.653 6.532   26.089 1.00 11.40 ? 56  LEU A N   1 
ATOM   478  C CA  . LEU A 1 68  ? 18.060 6.942   26.267 1.00 10.96 ? 56  LEU A CA  1 
ATOM   479  C C   . LEU A 1 68  ? 18.268 8.302   25.589 1.00 10.67 ? 56  LEU A C   1 
ATOM   480  O O   . LEU A 1 68  ? 18.972 9.171   26.095 1.00 11.10 ? 56  LEU A O   1 
ATOM   481  C CB  . LEU A 1 68  ? 18.986 5.904   25.621 1.00 10.95 ? 56  LEU A CB  1 
ATOM   482  C CG  . LEU A 1 68  ? 20.487 6.232   25.556 1.00 11.06 ? 56  LEU A CG  1 
ATOM   483  C CD1 . LEU A 1 68  ? 21.003 6.538   27.001 1.00 13.01 ? 56  LEU A CD1 1 
ATOM   484  C CD2 . LEU A 1 68  ? 21.220 5.062   24.964 1.00 12.64 ? 56  LEU A CD2 1 
ATOM   485  N N   . GLY A 1 69  ? 17.627 8.471   24.435 1.00 11.22 ? 57  GLY A N   1 
ATOM   486  C CA  . GLY A 1 69  ? 17.775 9.705   23.686 1.00 11.05 ? 57  GLY A CA  1 
ATOM   487  C C   . GLY A 1 69  ? 17.380 10.961  24.429 1.00 13.04 ? 57  GLY A C   1 
ATOM   488  O O   . GLY A 1 69  ? 17.994 12.022  24.233 1.00 14.30 ? 57  GLY A O   1 
ATOM   489  N N   . ASP A 1 70  ? 16.326 10.876  25.236 1.00 13.37 ? 58  ASP A N   1 
ATOM   490  C CA  . ASP A 1 70  ? 15.888 12.029  26.012 1.00 15.15 ? 58  ASP A CA  1 
ATOM   491  C C   . ASP A 1 70  ? 16.979 12.449  27.018 1.00 13.07 ? 58  ASP A C   1 
ATOM   492  O O   . ASP A 1 70  ? 17.167 13.630  27.309 1.00 12.42 ? 58  ASP A O   1 
ATOM   493  C CB  . ASP A 1 70  ? 14.607 11.705  26.760 1.00 17.49 ? 58  ASP A CB  1 
ATOM   494  C CG  . ASP A 1 70  ? 13.964 12.948  27.345 1.00 26.25 ? 58  ASP A CG  1 
ATOM   495  O OD1 . ASP A 1 70  ? 13.456 13.795  26.562 1.00 27.59 ? 58  ASP A OD1 1 
ATOM   496  O OD2 . ASP A 1 70  ? 13.984 13.086  28.583 1.00 25.91 ? 58  ASP A OD2 1 
ATOM   497  N N   . ALA A 1 71  ? 17.694 11.467  27.550 1.00 11.82 ? 59  ALA A N   1 
ATOM   498  C CA  . ALA A 1 71  ? 18.770 11.769  28.490 1.00 11.09 ? 59  ALA A CA  1 
ATOM   499  C C   . ALA A 1 71  ? 19.968 12.366  27.687 1.00 10.95 ? 59  ALA A C   1 
ATOM   500  O O   . ALA A 1 71  ? 20.631 13.287  28.152 1.00 9.87  ? 59  ALA A O   1 
ATOM   501  C CB  . ALA A 1 71  ? 19.186 10.481  29.233 1.00 11.90 ? 59  ALA A CB  1 
ATOM   502  N N   . VAL A 1 72  ? 20.209 11.869  26.470 1.00 10.10 ? 60  VAL A N   1 
ATOM   503  C CA  . VAL A 1 72  ? 21.306 12.382  25.670 1.00 9.73  ? 60  VAL A CA  1 
ATOM   504  C C   . VAL A 1 72  ? 21.031 13.866  25.370 1.00 10.45 ? 60  VAL A C   1 
ATOM   505  O O   . VAL A 1 72  ? 21.889 14.724  25.542 1.00 11.15 ? 60  VAL A O   1 
ATOM   506  C CB  . VAL A 1 72  ? 21.456 11.578  24.348 1.00 9.89  ? 60  VAL A CB  1 
ATOM   507  C CG1 . VAL A 1 72  ? 22.471 12.284  23.424 1.00 10.68 ? 60  VAL A CG1 1 
ATOM   508  C CG2 . VAL A 1 72  ? 21.977 10.139  24.653 1.00 9.83  ? 60  VAL A CG2 1 
ATOM   509  N N   . LEU A 1 73  ? 19.794 14.146  24.961 1.00 10.51 ? 61  LEU A N   1 
ATOM   510  C CA  . LEU A 1 73  ? 19.354 15.486  24.632 1.00 12.40 ? 61  LEU A CA  1 
ATOM   511  C C   . LEU A 1 73  ? 19.466 16.442  25.833 1.00 12.45 ? 61  LEU A C   1 
ATOM   512  O O   . LEU A 1 73  ? 19.990 17.549  25.699 1.00 14.05 ? 61  LEU A O   1 
ATOM   513  C CB  . LEU A 1 73  ? 17.909 15.418  24.148 1.00 9.21  ? 61  LEU A CB  1 
ATOM   514  C CG  . LEU A 1 73  ? 17.278 16.761  23.779 1.00 12.22 ? 61  LEU A CG  1 
ATOM   515  C CD1 . LEU A 1 73  ? 18.056 17.397  22.599 1.00 11.22 ? 61  LEU A CD1 1 
ATOM   516  C CD2 . LEU A 1 73  ? 15.782 16.515  23.437 1.00 11.60 ? 61  LEU A CD2 1 
ATOM   517  N N   . GLU A 1 74  ? 18.976 16.013  26.998 1.00 14.68 ? 62  GLU A N   1 
ATOM   518  C CA  . GLU A 1 74  ? 19.039 16.830  28.223 1.00 16.36 ? 62  GLU A CA  1 
ATOM   519  C C   . GLU A 1 74  ? 20.494 17.213  28.550 1.00 15.90 ? 62  GLU A C   1 
ATOM   520  O O   . GLU A 1 74  ? 20.776 18.373  28.835 1.00 14.67 ? 62  GLU A O   1 
ATOM   521  C CB  . GLU A 1 74  ? 18.424 16.075  29.419 1.00 21.55 ? 62  GLU A CB  1 
ATOM   522  C CG  . GLU A 1 74  ? 18.551 16.813  30.787 1.00 28.98 ? 62  GLU A CG  1 
ATOM   523  C CD  . GLU A 1 74  ? 18.219 15.928  32.012 1.00 33.32 ? 62  GLU A CD  1 
ATOM   524  O OE1 . GLU A 1 74  ? 18.449 16.397  33.177 1.00 35.87 ? 62  GLU A OE1 1 
ATOM   525  O OE2 . GLU A 1 74  ? 17.730 14.771  31.818 1.00 34.78 ? 62  GLU A OE2 1 
ATOM   526  N N   . LEU A 1 75  ? 21.409 16.249  28.501 1.00 13.89 ? 63  LEU A N   1 
ATOM   527  C CA  . LEU A 1 75  ? 22.814 16.545  28.790 1.00 14.68 ? 63  LEU A CA  1 
ATOM   528  C C   . LEU A 1 75  ? 23.367 17.496  27.719 1.00 13.66 ? 63  LEU A C   1 
ATOM   529  O O   . LEU A 1 75  ? 24.011 18.468  28.028 1.00 14.80 ? 63  LEU A O   1 
ATOM   530  C CB  . LEU A 1 75  ? 23.683 15.272  28.817 1.00 14.41 ? 63  LEU A CB  1 
ATOM   531  C CG  . LEU A 1 75  ? 25.210 15.545  28.822 1.00 15.57 ? 63  LEU A CG  1 
ATOM   532  C CD1 . LEU A 1 75  ? 25.545 16.482  29.942 1.00 11.80 ? 63  LEU A CD1 1 
ATOM   533  C CD2 . LEU A 1 75  ? 26.019 14.229  28.955 1.00 14.00 ? 63  LEU A CD2 1 
ATOM   534  N N   . PHE A 1 76  ? 23.082 17.207  26.458 1.00 16.24 ? 64  PHE A N   1 
ATOM   535  C CA  . PHE A 1 76  ? 23.554 18.041  25.354 1.00 14.76 ? 64  PHE A CA  1 
ATOM   536  C C   . PHE A 1 76  ? 23.084 19.502  25.490 1.00 13.74 ? 64  PHE A C   1 
ATOM   537  O O   . PHE A 1 76  ? 23.872 20.445  25.262 1.00 13.37 ? 64  PHE A O   1 
ATOM   538  C CB  . PHE A 1 76  ? 23.049 17.428  24.040 1.00 17.39 ? 64  PHE A CB  1 
ATOM   539  C CG  . PHE A 1 76  ? 23.228 18.299  22.846 1.00 20.10 ? 64  PHE A CG  1 
ATOM   540  C CD1 . PHE A 1 76  ? 22.130 18.876  22.231 1.00 23.07 ? 64  PHE A CD1 1 
ATOM   541  C CD2 . PHE A 1 76  ? 24.482 18.481  22.281 1.00 22.45 ? 64  PHE A CD2 1 
ATOM   542  C CE1 . PHE A 1 76  ? 22.281 19.619  21.052 1.00 24.48 ? 64  PHE A CE1 1 
ATOM   543  C CE2 . PHE A 1 76  ? 24.639 19.222  21.102 1.00 24.02 ? 64  PHE A CE2 1 
ATOM   544  C CZ  . PHE A 1 76  ? 23.535 19.785  20.493 1.00 22.95 ? 64  PHE A CZ  1 
ATOM   545  N N   . VAL A 1 77  ? 21.816 19.701  25.846 1.00 11.48 ? 65  VAL A N   1 
ATOM   546  C CA  . VAL A 1 77  ? 21.288 21.071  26.005 1.00 13.95 ? 65  VAL A CA  1 
ATOM   547  C C   . VAL A 1 77  ? 21.834 21.735  27.294 1.00 15.35 ? 65  VAL A C   1 
ATOM   548  O O   . VAL A 1 77  ? 22.266 22.902  27.297 1.00 13.70 ? 65  VAL A O   1 
ATOM   549  C CB  . VAL A 1 77  ? 19.748 21.042  26.053 1.00 12.21 ? 65  VAL A CB  1 
ATOM   550  C CG1 . VAL A 1 77  ? 19.195 22.348  26.568 1.00 13.59 ? 65  VAL A CG1 1 
ATOM   551  C CG2 . VAL A 1 77  ? 19.203 20.719  24.659 1.00 13.55 ? 65  VAL A CG2 1 
ATOM   552  N N   . CYS A 1 78  ? 21.776 21.006  28.404 1.00 13.95 ? 66  CYS A N   1 
ATOM   553  C CA  . CYS A 1 78  ? 22.303 21.577  29.670 1.00 12.87 ? 66  CYS A CA  1 
ATOM   554  C C   . CYS A 1 78  ? 23.798 21.924  29.555 1.00 12.68 ? 66  CYS A C   1 
ATOM   555  O O   . CYS A 1 78  ? 24.246 22.910  30.124 1.00 12.55 ? 66  CYS A O   1 
ATOM   556  C CB  . CYS A 1 78  ? 22.114 20.605  30.837 1.00 12.11 ? 66  CYS A CB  1 
ATOM   557  S SG  . CYS A 1 78  ? 20.364 20.365  31.351 1.00 18.48 ? 66  CYS A SG  1 
ATOM   558  N N   . GLU A 1 79  ? 24.573 21.120  28.834 1.00 12.98 ? 67  GLU A N   1 
ATOM   559  C CA  . GLU A 1 79  ? 25.993 21.408  28.705 1.00 15.12 ? 67  GLU A CA  1 
ATOM   560  C C   . GLU A 1 79  ? 26.163 22.738  27.951 1.00 16.22 ? 67  GLU A C   1 
ATOM   561  O O   . GLU A 1 79  ? 26.981 23.565  28.332 1.00 15.46 ? 67  GLU A O   1 
ATOM   562  C CB  . GLU A 1 79  ? 26.728 20.284  27.968 1.00 17.57 ? 67  GLU A CB  1 
ATOM   563  C CG  . GLU A 1 79  ? 28.230 20.554  27.821 1.00 20.48 ? 67  GLU A CG  1 
ATOM   564  C CD  . GLU A 1 79  ? 29.073 19.316  27.530 1.00 23.42 ? 67  GLU A CD  1 
ATOM   565  O OE1 . GLU A 1 79  ? 28.527 18.181  27.485 1.00 23.02 ? 67  GLU A OE1 1 
ATOM   566  O OE2 . GLU A 1 79  ? 30.302 19.478  27.381 1.00 24.38 ? 67  GLU A OE2 1 
ATOM   567  N N   . ILE A 1 80  ? 25.386 22.938  26.890 1.00 13.04 ? 68  ILE A N   1 
ATOM   568  C CA  . ILE A 1 80  ? 25.463 24.204  26.134 1.00 15.52 ? 68  ILE A CA  1 
ATOM   569  C C   . ILE A 1 80  ? 25.079 25.400  27.043 1.00 14.28 ? 68  ILE A C   1 
ATOM   570  O O   . ILE A 1 80  ? 25.720 26.458  27.033 1.00 16.02 ? 68  ILE A O   1 
ATOM   571  C CB  . ILE A 1 80  ? 24.508 24.171  24.896 1.00 13.50 ? 68  ILE A CB  1 
ATOM   572  C CG1 . ILE A 1 80  ? 25.069 23.216  23.827 1.00 13.25 ? 68  ILE A CG1 1 
ATOM   573  C CG2 . ILE A 1 80  ? 24.340 25.610  24.317 1.00 17.34 ? 68  ILE A CG2 1 
ATOM   574  C CD1 . ILE A 1 80  ? 24.024 22.775  22.820 1.00 13.31 ? 68  ILE A CD1 1 
ATOM   575  N N   . LEU A 1 81  ? 24.028 25.225  27.828 1.00 14.50 ? 69  LEU A N   1 
ATOM   576  C CA  . LEU A 1 81  ? 23.594 26.279  28.718 1.00 14.31 ? 69  LEU A CA  1 
ATOM   577  C C   . LEU A 1 81  ? 24.658 26.591  29.765 1.00 15.64 ? 69  LEU A C   1 
ATOM   578  O O   . LEU A 1 81  ? 25.002 27.762  30.010 1.00 13.45 ? 69  LEU A O   1 
ATOM   579  C CB  . LEU A 1 81  ? 22.296 25.867  29.395 1.00 13.95 ? 69  LEU A CB  1 
ATOM   580  C CG  . LEU A 1 81  ? 21.062 26.013  28.483 1.00 17.69 ? 69  LEU A CG  1 
ATOM   581  C CD1 . LEU A 1 81  ? 19.902 25.195  29.049 1.00 14.20 ? 69  LEU A CD1 1 
ATOM   582  C CD2 . LEU A 1 81  ? 20.690 27.500  28.413 1.00 16.35 ? 69  LEU A CD2 1 
ATOM   583  N N   . TYR A 1 82  ? 25.201 25.542  30.363 1.00 13.98 ? 70  TYR A N   1 
ATOM   584  C CA  . TYR A 1 82  ? 26.194 25.735  31.408 1.00 15.85 ? 70  TYR A CA  1 
ATOM   585  C C   . TYR A 1 82  ? 27.407 26.495  30.881 1.00 17.23 ? 70  TYR A C   1 
ATOM   586  O O   . TYR A 1 82  ? 27.854 27.453  31.505 1.00 15.56 ? 70  TYR A O   1 
ATOM   587  C CB  . TYR A 1 82  ? 26.638 24.369  31.988 1.00 15.52 ? 70  TYR A CB  1 
ATOM   588  C CG  . TYR A 1 82  ? 27.707 24.490  33.067 1.00 15.75 ? 70  TYR A CG  1 
ATOM   589  C CD1 . TYR A 1 82  ? 27.361 24.512  34.420 1.00 15.23 ? 70  TYR A CD1 1 
ATOM   590  C CD2 . TYR A 1 82  ? 29.053 24.647  32.726 1.00 15.59 ? 70  TYR A CD2 1 
ATOM   591  C CE1 . TYR A 1 82  ? 28.323 24.691  35.414 1.00 15.45 ? 70  TYR A CE1 1 
ATOM   592  C CE2 . TYR A 1 82  ? 30.035 24.835  33.710 1.00 15.73 ? 70  TYR A CE2 1 
ATOM   593  C CZ  . TYR A 1 82  ? 29.648 24.854  35.053 1.00 14.87 ? 70  TYR A CZ  1 
ATOM   594  O OH  . TYR A 1 82  ? 30.570 25.068  36.020 1.00 15.20 ? 70  TYR A OH  1 
ATOM   595  N N   . LYS A 1 83  ? 27.904 26.083  29.711 1.00 18.61 ? 71  LYS A N   1 
ATOM   596  C CA  . LYS A 1 83  ? 29.096 26.681  29.110 1.00 20.52 ? 71  LYS A CA  1 
ATOM   597  C C   . LYS A 1 83  ? 28.936 28.036  28.459 1.00 22.67 ? 71  LYS A C   1 
ATOM   598  O O   . LYS A 1 83  ? 29.835 28.862  28.574 1.00 19.70 ? 71  LYS A O   1 
ATOM   599  C CB  . LYS A 1 83  ? 29.717 25.725  28.087 1.00 21.38 ? 71  LYS A CB  1 
ATOM   600  C CG  . LYS A 1 83  ? 30.360 24.494  28.732 1.00 22.85 ? 71  LYS A CG  1 
ATOM   601  C CD  . LYS A 1 83  ? 30.900 23.494  27.722 1.00 22.69 ? 71  LYS A CD  1 
ATOM   602  C CE  . LYS A 1 83  ? 31.669 22.408  28.477 1.00 22.56 ? 71  LYS A CE  1 
ATOM   603  N NZ  . LYS A 1 83  ? 32.210 21.377  27.584 1.00 23.92 ? 71  LYS A NZ  1 
ATOM   604  N N   . LYS A 1 84  ? 27.797 28.256  27.793 1.00 22.99 ? 72  LYS A N   1 
ATOM   605  C CA  . LYS A 1 84  ? 27.537 29.506  27.087 1.00 24.78 ? 72  LYS A CA  1 
ATOM   606  C C   . LYS A 1 84  ? 26.928 30.632  27.885 1.00 25.48 ? 72  LYS A C   1 
ATOM   607  O O   . LYS A 1 84  ? 27.106 31.782  27.520 1.00 24.61 ? 72  LYS A O   1 
ATOM   608  C CB  . LYS A 1 84  ? 26.637 29.258  25.868 1.00 28.13 ? 72  LYS A CB  1 
ATOM   609  C CG  . LYS A 1 84  ? 27.175 28.247  24.868 1.00 32.73 ? 72  LYS A CG  1 
ATOM   610  C CD  . LYS A 1 84  ? 28.426 28.739  24.163 1.00 39.28 ? 72  LYS A CD  1 
ATOM   611  C CE  . LYS A 1 84  ? 28.102 29.845  23.135 1.00 40.40 ? 72  LYS A CE  1 
ATOM   612  N NZ  . LYS A 1 84  ? 29.321 30.575  22.708 1.00 41.48 ? 72  LYS A NZ  1 
ATOM   613  N N   . TYR A 1 85  ? 26.220 30.323  28.969 1.00 25.07 ? 73  TYR A N   1 
ATOM   614  C CA  . TYR A 1 85  ? 25.578 31.360  29.760 1.00 26.89 ? 73  TYR A CA  1 
ATOM   615  C C   . TYR A 1 85  ? 25.981 31.340  31.230 1.00 26.88 ? 73  TYR A C   1 
ATOM   616  O O   . TYR A 1 85  ? 25.142 31.242  32.112 1.00 25.94 ? 73  TYR A O   1 
ATOM   617  C CB  . TYR A 1 85  ? 24.054 31.236  29.619 1.00 27.73 ? 73  TYR A CB  1 
ATOM   618  C CG  . TYR A 1 85  ? 23.616 31.297  28.169 1.00 31.28 ? 73  TYR A CG  1 
ATOM   619  C CD1 . TYR A 1 85  ? 23.550 32.521  27.486 1.00 29.93 ? 73  TYR A CD1 1 
ATOM   620  C CD2 . TYR A 1 85  ? 23.339 30.126  27.453 1.00 31.50 ? 73  TYR A CD2 1 
ATOM   621  C CE1 . TYR A 1 85  ? 23.217 32.574  26.131 1.00 30.60 ? 73  TYR A CE1 1 
ATOM   622  C CE2 . TYR A 1 85  ? 23.018 30.171  26.094 1.00 33.23 ? 73  TYR A CE2 1 
ATOM   623  C CZ  . TYR A 1 85  ? 22.953 31.401  25.432 1.00 32.90 ? 73  TYR A CZ  1 
ATOM   624  O OH  . TYR A 1 85  ? 22.622 31.446  24.077 1.00 33.07 ? 73  TYR A OH  1 
ATOM   625  N N   . PRO A 1 86  ? 27.284 31.471  31.507 1.00 29.03 ? 74  PRO A N   1 
ATOM   626  C CA  . PRO A 1 86  ? 27.752 31.460  32.894 1.00 30.88 ? 74  PRO A CA  1 
ATOM   627  C C   . PRO A 1 86  ? 27.121 32.509  33.813 1.00 34.49 ? 74  PRO A C   1 
ATOM   628  O O   . PRO A 1 86  ? 27.072 32.315  35.029 1.00 34.76 ? 74  PRO A O   1 
ATOM   629  C CB  . PRO A 1 86  ? 29.259 31.634  32.743 1.00 29.96 ? 74  PRO A CB  1 
ATOM   630  C CG  . PRO A 1 86  ? 29.380 32.458  31.487 1.00 28.32 ? 74  PRO A CG  1 
ATOM   631  C CD  . PRO A 1 86  ? 28.389 31.779  30.580 1.00 27.52 ? 74  PRO A CD  1 
ATOM   632  N N   . GLU A 1 87  ? 26.629 33.612  33.248 1.00 37.23 ? 75  GLU A N   1 
ATOM   633  C CA  . GLU A 1 87  ? 26.027 34.657  34.076 1.00 39.10 ? 75  GLU A CA  1 
ATOM   634  C C   . GLU A 1 87  ? 24.523 34.495  34.280 1.00 38.92 ? 75  GLU A C   1 
ATOM   635  O O   . GLU A 1 87  ? 23.908 35.250  35.030 1.00 38.49 ? 75  GLU A O   1 
ATOM   636  C CB  . GLU A 1 87  ? 26.331 36.044  33.491 1.00 41.98 ? 75  GLU A CB  1 
ATOM   637  C CG  . GLU A 1 87  ? 27.828 36.384  33.476 1.00 47.79 ? 75  GLU A CG  1 
ATOM   638  C CD  . GLU A 1 87  ? 28.114 37.855  33.184 1.00 50.82 ? 75  GLU A CD  1 
ATOM   639  O OE1 . GLU A 1 87  ? 28.652 38.545  34.085 1.00 52.15 ? 75  GLU A OE1 1 
ATOM   640  O OE2 . GLU A 1 87  ? 27.800 38.324  32.060 1.00 52.60 ? 75  GLU A OE2 1 
ATOM   641  N N   . ALA A 1 88  ? 23.933 33.496  33.636 1.00 38.26 ? 76  ALA A N   1 
ATOM   642  C CA  . ALA A 1 88  ? 22.500 33.270  33.750 1.00 38.18 ? 76  ALA A CA  1 
ATOM   643  C C   . ALA A 1 88  ? 22.071 32.754  35.118 1.00 38.36 ? 76  ALA A C   1 
ATOM   644  O O   . ALA A 1 88  ? 22.777 31.973  35.746 1.00 37.16 ? 76  ALA A O   1 
ATOM   645  C CB  . ALA A 1 88  ? 22.044 32.291  32.666 1.00 36.56 ? 76  ALA A CB  1 
ATOM   646  N N   . GLU A 1 89  ? 20.901 33.194  35.570 1.00 38.94 ? 77  GLU A N   1 
ATOM   647  C CA  . GLU A 1 89  ? 20.357 32.726  36.840 1.00 40.27 ? 77  GLU A CA  1 
ATOM   648  C C   . GLU A 1 89  ? 19.925 31.275  36.587 1.00 39.15 ? 77  GLU A C   1 
ATOM   649  O O   . GLU A 1 89  ? 19.470 30.947  35.488 1.00 38.11 ? 77  GLU A O   1 
ATOM   650  C CB  . GLU A 1 89  ? 19.145 33.571  37.245 1.00 44.63 ? 77  GLU A CB  1 
ATOM   651  C CG  . GLU A 1 89  ? 19.455 35.056  37.533 1.00 49.59 ? 77  GLU A CG  1 
ATOM   652  C CD  . GLU A 1 89  ? 18.211 35.946  37.453 1.00 52.67 ? 77  GLU A CD  1 
ATOM   653  O OE1 . GLU A 1 89  ? 17.688 36.152  36.329 1.00 54.49 ? 77  GLU A OE1 1 
ATOM   654  O OE2 . GLU A 1 89  ? 17.750 36.434  38.510 1.00 54.63 ? 77  GLU A OE2 1 
ATOM   655  N N   . VAL A 1 90  ? 20.054 30.412  37.589 1.00 37.68 ? 78  VAL A N   1 
ATOM   656  C CA  . VAL A 1 90  ? 19.697 29.009  37.416 1.00 36.64 ? 78  VAL A CA  1 
ATOM   657  C C   . VAL A 1 90  ? 18.234 28.833  36.992 1.00 35.41 ? 78  VAL A C   1 
ATOM   658  O O   . VAL A 1 90  ? 17.899 27.909  36.262 1.00 34.30 ? 78  VAL A O   1 
ATOM   659  C CB  . VAL A 1 90  ? 20.003 28.205  38.704 1.00 38.37 ? 78  VAL A CB  1 
ATOM   660  C CG1 . VAL A 1 90  ? 18.890 28.385  39.717 1.00 38.15 ? 78  VAL A CG1 1 
ATOM   661  C CG2 . VAL A 1 90  ? 20.220 26.737  38.364 1.00 37.39 ? 78  VAL A CG2 1 
ATOM   662  N N   . GLY A 1 91  ? 17.369 29.741  37.421 1.00 34.87 ? 79  GLY A N   1 
ATOM   663  C CA  . GLY A 1 91  ? 15.970 29.653  37.036 1.00 34.07 ? 79  GLY A CA  1 
ATOM   664  C C   . GLY A 1 91  ? 15.816 29.849  35.537 1.00 33.94 ? 79  GLY A C   1 
ATOM   665  O O   . GLY A 1 91  ? 14.855 29.368  34.924 1.00 32.90 ? 79  GLY A O   1 
ATOM   666  N N   . ASP A 1 92  ? 16.773 30.564  34.951 1.00 34.07 ? 80  ASP A N   1 
ATOM   667  C CA  . ASP A 1 92  ? 16.784 30.842  33.518 1.00 34.86 ? 80  ASP A CA  1 
ATOM   668  C C   . ASP A 1 92  ? 17.323 29.636  32.740 1.00 33.41 ? 80  ASP A C   1 
ATOM   669  O O   . ASP A 1 92  ? 16.820 29.303  31.664 1.00 32.21 ? 80  ASP A O   1 
ATOM   670  C CB  . ASP A 1 92  ? 17.642 32.077  33.229 1.00 37.88 ? 80  ASP A CB  1 
ATOM   671  C CG  . ASP A 1 92  ? 16.818 33.349  33.145 1.00 42.69 ? 80  ASP A CG  1 
ATOM   672  O OD1 . ASP A 1 92  ? 16.105 33.523  32.127 1.00 44.28 ? 80  ASP A OD1 1 
ATOM   673  O OD2 . ASP A 1 92  ? 16.871 34.167  34.098 1.00 44.28 ? 80  ASP A OD2 1 
ATOM   674  N N   . LEU A 1 93  ? 18.360 28.997  33.268 1.00 30.03 ? 81  LEU A N   1 
ATOM   675  C CA  . LEU A 1 93  ? 18.885 27.814  32.606 1.00 28.65 ? 81  LEU A CA  1 
ATOM   676  C C   . LEU A 1 93  ? 17.741 26.804  32.476 1.00 28.64 ? 81  LEU A C   1 
ATOM   677  O O   . LEU A 1 93  ? 17.479 26.288  31.383 1.00 27.70 ? 81  LEU A O   1 
ATOM   678  C CB  . LEU A 1 93  ? 20.035 27.213  33.411 1.00 27.44 ? 81  LEU A CB  1 
ATOM   679  C CG  . LEU A 1 93  ? 21.217 28.144  33.652 1.00 27.74 ? 81  LEU A CG  1 
ATOM   680  C CD1 . LEU A 1 93  ? 22.370 27.376  34.320 1.00 27.45 ? 81  LEU A CD1 1 
ATOM   681  C CD2 . LEU A 1 93  ? 21.678 28.721  32.331 1.00 29.63 ? 81  LEU A CD2 1 
ATOM   682  N N   . ALA A 1 94  ? 17.036 26.559  33.581 1.00 25.50 ? 82  ALA A N   1 
ATOM   683  C CA  . ALA A 1 94  ? 15.918 25.608  33.608 1.00 25.04 ? 82  ALA A CA  1 
ATOM   684  C C   . ALA A 1 94  ? 14.773 25.955  32.649 1.00 25.41 ? 82  ALA A C   1 
ATOM   685  O O   . ALA A 1 94  ? 14.166 25.067  32.020 1.00 23.03 ? 82  ALA A O   1 
ATOM   686  C CB  . ALA A 1 94  ? 15.370 25.496  35.031 1.00 25.70 ? 82  ALA A CB  1 
ATOM   687  N N   . ARG A 1 95  ? 14.453 27.244  32.569 1.00 24.64 ? 83  ARG A N   1 
ATOM   688  C CA  . ARG A 1 95  ? 13.405 27.704  31.676 1.00 23.78 ? 83  ARG A CA  1 
ATOM   689  C C   . ARG A 1 95  ? 13.814 27.368  30.246 1.00 20.82 ? 83  ARG A C   1 
ATOM   690  O O   . ARG A 1 95  ? 13.050 26.752  29.505 1.00 18.82 ? 83  ARG A O   1 
ATOM   691  C CB  . ARG A 1 95  ? 13.226 29.235  31.806 1.00 27.42 ? 83  ARG A CB  1 
ATOM   692  C CG  . ARG A 1 95  ? 12.279 29.846  30.763 1.00 28.93 ? 83  ARG A CG  1 
ATOM   693  C CD  . ARG A 1 95  ? 12.182 31.376  30.904 1.00 31.65 ? 83  ARG A CD  1 
ATOM   694  N NE  . ARG A 1 95  ? 13.449 32.079  30.675 1.00 31.59 ? 83  ARG A NE  1 
ATOM   695  C CZ  . ARG A 1 95  ? 13.974 32.306  29.474 1.00 34.81 ? 83  ARG A CZ  1 
ATOM   696  N NH1 . ARG A 1 95  ? 13.342 31.887  28.381 1.00 34.53 ? 83  ARG A NH1 1 
ATOM   697  N NH2 . ARG A 1 95  ? 15.134 32.945  29.360 1.00 34.99 ? 83  ARG A NH2 1 
ATOM   698  N N   . VAL A 1 96  ? 15.021 27.782  29.867 1.00 20.06 ? 84  VAL A N   1 
ATOM   699  C CA  . VAL A 1 96  ? 15.513 27.552  28.508 1.00 21.42 ? 84  VAL A CA  1 
ATOM   700  C C   . VAL A 1 96  ? 15.642 26.061  28.198 1.00 22.92 ? 84  VAL A C   1 
ATOM   701  O O   . VAL A 1 96  ? 15.268 25.600  27.103 1.00 23.37 ? 84  VAL A O   1 
ATOM   702  C CB  . VAL A 1 96  ? 16.884 28.227  28.259 1.00 21.11 ? 84  VAL A CB  1 
ATOM   703  C CG1 . VAL A 1 96  ? 17.278 28.068  26.777 1.00 19.28 ? 84  VAL A CG1 1 
ATOM   704  C CG2 . VAL A 1 96  ? 16.828 29.709  28.606 1.00 22.47 ? 84  VAL A CG2 1 
ATOM   705  N N   . LYS A 1 97  ? 16.166 25.301  29.151 1.00 21.52 ? 85  LYS A N   1 
ATOM   706  C CA  . LYS A 1 97  ? 16.328 23.857  28.955 1.00 22.64 ? 85  LYS A CA  1 
ATOM   707  C C   . LYS A 1 97  ? 15.009 23.229  28.518 1.00 22.25 ? 85  LYS A C   1 
ATOM   708  O O   . LYS A 1 97  ? 14.924 22.524  27.489 1.00 20.63 ? 85  LYS A O   1 
ATOM   709  C CB  . LYS A 1 97  ? 16.778 23.176  30.248 1.00 22.96 ? 85  LYS A CB  1 
ATOM   710  C CG  . LYS A 1 97  ? 17.032 21.674  30.062 1.00 27.27 ? 85  LYS A CG  1 
ATOM   711  C CD  . LYS A 1 97  ? 17.019 20.902  31.380 1.00 30.19 ? 85  LYS A CD  1 
ATOM   712  C CE  . LYS A 1 97  ? 15.598 20.487  31.777 1.00 32.95 ? 85  LYS A CE  1 
ATOM   713  N NZ  . LYS A 1 97  ? 15.531 19.680  33.039 1.00 35.08 ? 85  LYS A NZ  1 
ATOM   714  N N   . SER A 1 98  ? 13.971 23.484  29.306 1.00 21.68 ? 86  SER A N   1 
ATOM   715  C CA  . SER A 1 98  ? 12.662 22.943  28.989 1.00 24.26 ? 86  SER A CA  1 
ATOM   716  C C   . SER A 1 98  ? 12.146 23.368  27.634 1.00 22.61 ? 86  SER A C   1 
ATOM   717  O O   . SER A 1 98  ? 11.517 22.585  26.936 1.00 22.80 ? 86  SER A O   1 
ATOM   718  C CB  . SER A 1 98  ? 11.641 23.342  30.049 1.00 26.23 ? 86  SER A CB  1 
ATOM   719  O OG  . SER A 1 98  ? 12.008 22.773  31.287 1.00 32.08 ? 86  SER A OG  1 
ATOM   720  N N   . ALA A 1 99  ? 12.402 24.616  27.269 1.00 23.33 ? 87  ALA A N   1 
ATOM   721  C CA  . ALA A 1 99  ? 11.931 25.123  25.994 1.00 24.21 ? 87  ALA A CA  1 
ATOM   722  C C   . ALA A 1 99  ? 12.706 24.532  24.815 1.00 23.92 ? 87  ALA A C   1 
ATOM   723  O O   . ALA A 1 99  ? 12.133 24.261  23.750 1.00 23.29 ? 87  ALA A O   1 
ATOM   724  C CB  . ALA A 1 99  ? 12.039 26.652  25.983 1.00 24.61 ? 87  ALA A CB  1 
ATOM   725  N N   . ALA A 1 100 ? 14.007 24.329  25.012 1.00 21.65 ? 88  ALA A N   1 
ATOM   726  C CA  . ALA A 1 100 ? 14.864 23.813  23.960 1.00 21.53 ? 88  ALA A CA  1 
ATOM   727  C C   . ALA A 1 100 ? 14.665 22.346  23.650 1.00 21.93 ? 88  ALA A C   1 
ATOM   728  O O   . ALA A 1 100 ? 14.892 21.906  22.520 1.00 22.14 ? 88  ALA A O   1 
ATOM   729  C CB  . ALA A 1 100 ? 16.333 24.063  24.319 1.00 23.57 ? 88  ALA A CB  1 
ATOM   730  N N   . ALA A 1 101 ? 14.258 21.586  24.658 1.00 21.61 ? 89  ALA A N   1 
ATOM   731  C CA  . ALA A 1 101 ? 14.061 20.161  24.505 1.00 22.47 ? 89  ALA A CA  1 
ATOM   732  C C   . ALA A 1 101 ? 12.592 19.796  24.303 1.00 22.70 ? 89  ALA A C   1 
ATOM   733  O O   . ALA A 1 101 ? 12.242 18.615  24.330 1.00 21.82 ? 89  ALA A O   1 
ATOM   734  C CB  . ALA A 1 101 ? 14.613 19.434  25.752 1.00 23.01 ? 89  ALA A CB  1 
ATOM   735  N N   . SER A 1 102 ? 11.738 20.802  24.106 1.00 20.15 ? 90  SER A N   1 
ATOM   736  C CA  . SER A 1 102 ? 10.314 20.552  23.940 1.00 19.64 ? 90  SER A CA  1 
ATOM   737  C C   . SER A 1 102 ? 9.955  19.850  22.617 1.00 18.52 ? 90  SER A C   1 
ATOM   738  O O   . SER A 1 102 ? 10.704 19.900  21.652 1.00 17.60 ? 90  SER A O   1 
ATOM   739  C CB  . SER A 1 102 ? 9.530  21.867  24.022 1.00 19.94 ? 90  SER A CB  1 
ATOM   740  O OG  . SER A 1 102 ? 9.869  22.720  22.943 1.00 17.12 ? 90  SER A OG  1 
ATOM   741  N N   . GLU A 1 103 ? 8.799  19.198  22.611 1.00 17.19 ? 91  GLU A N   1 
ATOM   742  C CA  . GLU A 1 103 ? 8.260  18.505  21.430 1.00 20.50 ? 91  GLU A CA  1 
ATOM   743  C C   . GLU A 1 103 ? 8.241  19.477  20.254 1.00 19.19 ? 91  GLU A C   1 
ATOM   744  O O   . GLU A 1 103 ? 8.642  19.144  19.161 1.00 19.09 ? 91  GLU A O   1 
ATOM   745  C CB  . GLU A 1 103 ? 6.826  18.040  21.714 1.00 19.17 ? 91  GLU A CB  1 
ATOM   746  C CG  . GLU A 1 103 ? 6.220  17.182  20.622 1.00 22.06 ? 91  GLU A CG  1 
ATOM   747  C CD  . GLU A 1 103 ? 4.804  16.773  20.979 1.00 27.41 ? 91  GLU A CD  1 
ATOM   748  O OE1 . GLU A 1 103 ? 3.857  17.508  20.622 1.00 27.98 ? 91  GLU A OE1 1 
ATOM   749  O OE2 . GLU A 1 103 ? 4.649  15.728  21.656 1.00 28.80 ? 91  GLU A OE2 1 
ATOM   750  N N   . GLU A 1 104 ? 7.771  20.695  20.516 1.00 21.67 ? 92  GLU A N   1 
ATOM   751  C CA  . GLU A 1 104 ? 7.690  21.734  19.492 1.00 22.27 ? 92  GLU A CA  1 
ATOM   752  C C   . GLU A 1 104 ? 9.033  21.980  18.773 1.00 20.82 ? 92  GLU A C   1 
ATOM   753  O O   . GLU A 1 104 ? 9.099  21.979  17.543 1.00 16.71 ? 92  GLU A O   1 
ATOM   754  C CB  . GLU A 1 104 ? 7.196  23.047  20.129 1.00 27.42 ? 92  GLU A CB  1 
ATOM   755  C CG  . GLU A 1 104 ? 6.572  24.029  19.121 1.00 33.31 ? 92  GLU A CG  1 
ATOM   756  C CD  . GLU A 1 104 ? 6.031  25.308  19.784 1.00 37.04 ? 92  GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 104 ? 6.805  26.285  19.945 1.00 37.65 ? 92  GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 104 ? 4.831  25.325  20.155 1.00 39.02 ? 92  GLU A OE2 1 
ATOM   759  N N   . VAL A 1 105 ? 10.106 22.202  19.535 1.00 19.01 ? 93  VAL A N   1 
ATOM   760  C CA  . VAL A 1 105 ? 11.423 22.436  18.915 1.00 16.30 ? 93  VAL A CA  1 
ATOM   761  C C   . VAL A 1 105 ? 11.894 21.185  18.167 1.00 16.52 ? 93  VAL A C   1 
ATOM   762  O O   . VAL A 1 105 ? 12.313 21.249  16.992 1.00 15.76 ? 93  VAL A O   1 
ATOM   763  C CB  . VAL A 1 105 ? 12.491 22.821  19.991 1.00 18.11 ? 93  VAL A CB  1 
ATOM   764  C CG1 . VAL A 1 105 ? 13.909 22.761  19.399 1.00 18.03 ? 93  VAL A CG1 1 
ATOM   765  C CG2 . VAL A 1 105 ? 12.201 24.207  20.521 1.00 17.46 ? 93  VAL A CG2 1 
ATOM   766  N N   . LEU A 1 106 ? 11.793 20.033  18.830 1.00 15.83 ? 94  LEU A N   1 
ATOM   767  C CA  . LEU A 1 106 ? 12.248 18.787  18.219 1.00 15.39 ? 94  LEU A CA  1 
ATOM   768  C C   . LEU A 1 106 ? 11.511 18.416  16.921 1.00 14.92 ? 94  LEU A C   1 
ATOM   769  O O   . LEU A 1 106 ? 12.130 17.894  15.983 1.00 16.68 ? 94  LEU A O   1 
ATOM   770  C CB  . LEU A 1 106 ? 12.161 17.635  19.238 1.00 14.56 ? 94  LEU A CB  1 
ATOM   771  C CG  . LEU A 1 106 ? 12.992 17.799  20.533 1.00 16.82 ? 94  LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 106 ? 13.023 16.427  21.265 1.00 19.79 ? 94  LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 106 ? 14.426 18.252  20.220 1.00 14.26 ? 94  LEU A CD2 1 
ATOM   774  N N   . ALA A 1 107 ? 10.197 18.638  16.876 1.00 13.97 ? 95  ALA A N   1 
ATOM   775  C CA  . ALA A 1 107 ? 9.428  18.352  15.669 1.00 14.28 ? 95  ALA A CA  1 
ATOM   776  C C   . ALA A 1 107 ? 9.935  19.319  14.576 1.00 14.91 ? 95  ALA A C   1 
ATOM   777  O O   . ALA A 1 107 ? 10.079 18.935  13.416 1.00 15.04 ? 95  ALA A O   1 
ATOM   778  C CB  . ALA A 1 107 ? 7.914  18.579  15.939 1.00 12.01 ? 95  ALA A CB  1 
ATOM   779  N N   . MET A 1 108 ? 10.196 20.574  14.953 1.00 14.41 ? 96  MET A N   1 
ATOM   780  C CA  . MET A 1 108 ? 10.711 21.568  13.991 1.00 15.44 ? 96  MET A CA  1 
ATOM   781  C C   . MET A 1 108 ? 12.041 21.022  13.414 1.00 15.50 ? 96  MET A C   1 
ATOM   782  O O   . MET A 1 108 ? 12.254 20.946  12.187 1.00 14.94 ? 96  MET A O   1 
ATOM   783  C CB  . MET A 1 108 ? 10.956 22.928  14.696 1.00 14.80 ? 96  MET A CB  1 
ATOM   784  C CG  . MET A 1 108 ? 11.567 24.036  13.764 1.00 18.76 ? 96  MET A CG  1 
ATOM   785  S SD  . MET A 1 108 ? 11.998 25.611  14.607 1.00 12.98 ? 96  MET A SD  1 
ATOM   786  C CE  . MET A 1 108 ? 13.424 25.121  15.649 1.00 18.97 ? 96  MET A CE  1 
ATOM   787  N N   . VAL A 1 109 ? 12.921 20.599  14.310 1.00 15.49 ? 97  VAL A N   1 
ATOM   788  C CA  . VAL A 1 109 ? 14.210 20.063  13.882 1.00 15.91 ? 97  VAL A CA  1 
ATOM   789  C C   . VAL A 1 109 ? 14.007 18.847  12.991 1.00 15.29 ? 97  VAL A C   1 
ATOM   790  O O   . VAL A 1 109 ? 14.646 18.723  11.949 1.00 14.22 ? 97  VAL A O   1 
ATOM   791  C CB  . VAL A 1 109 ? 15.076 19.716  15.106 1.00 15.67 ? 97  VAL A CB  1 
ATOM   792  C CG1 . VAL A 1 109 ? 16.368 19.025  14.669 1.00 18.70 ? 97  VAL A CG1 1 
ATOM   793  C CG2 . VAL A 1 109 ? 15.440 21.011  15.826 1.00 17.59 ? 97  VAL A CG2 1 
ATOM   794  N N   . SER A 1 110 ? 13.078 17.972  13.377 1.00 14.51 ? 98  SER A N   1 
ATOM   795  C CA  . SER A 1 110 ? 12.803 16.775  12.601 1.00 14.20 ? 98  SER A CA  1 
ATOM   796  C C   . SER A 1 110 ? 12.317 17.103  11.197 1.00 16.65 ? 98  SER A C   1 
ATOM   797  O O   . SER A 1 110 ? 12.764 16.510  10.222 1.00 16.19 ? 98  SER A O   1 
ATOM   798  C CB  . SER A 1 110 ? 11.754 15.909  13.302 1.00 15.35 ? 98  SER A CB  1 
ATOM   799  O OG  . SER A 1 110 ? 12.207 15.528  14.565 1.00 18.47 ? 98  SER A OG  1 
ATOM   800  N N   . ARG A 1 111 ? 11.400 18.054  11.091 1.00 17.82 ? 99  ARG A N   1 
ATOM   801  C CA  . ARG A 1 111 ? 10.884 18.421  9.784  1.00 18.80 ? 99  ARG A CA  1 
ATOM   802  C C   . ARG A 1 111 ? 11.983 18.989  8.891  1.00 20.06 ? 99  ARG A C   1 
ATOM   803  O O   . ARG A 1 111 ? 12.072 18.669  7.699  1.00 19.63 ? 99  ARG A O   1 
ATOM   804  C CB  . ARG A 1 111 ? 9.725  19.406  9.936  1.00 16.89 ? 99  ARG A CB  1 
ATOM   805  C CG  . ARG A 1 111 ? 8.491  18.732  10.522 1.00 17.41 ? 99  ARG A CG  1 
ATOM   806  C CD  . ARG A 1 111 ? 7.262  19.637  10.647 1.00 14.62 ? 99  ARG A CD  1 
ATOM   807  N NE  . ARG A 1 111 ? 6.100  18.817  10.989 1.00 12.71 ? 99  ARG A NE  1 
ATOM   808  C CZ  . ARG A 1 111 ? 5.469  18.837  12.148 1.00 11.05 ? 99  ARG A CZ  1 
ATOM   809  N NH1 . ARG A 1 111 ? 5.867  19.653  13.115 1.00 12.30 ? 99  ARG A NH1 1 
ATOM   810  N NH2 . ARG A 1 111 ? 4.430  18.008  12.347 1.00 13.84 ? 99  ARG A NH2 1 
ATOM   811  N N   . LYS A 1 112 ? 12.838 19.811  9.469  1.00 20.92 ? 100 LYS A N   1 
ATOM   812  C CA  . LYS A 1 112 ? 13.924 20.404  8.699  1.00 22.63 ? 100 LYS A CA  1 
ATOM   813  C C   . LYS A 1 112 ? 14.834 19.349  8.084  1.00 23.14 ? 100 LYS A C   1 
ATOM   814  O O   . LYS A 1 112 ? 15.472 19.575  7.058  1.00 20.59 ? 100 LYS A O   1 
ATOM   815  C CB  . LYS A 1 112 ? 14.748 21.329  9.598  1.00 25.79 ? 100 LYS A CB  1 
ATOM   816  C CG  . LYS A 1 112 ? 14.085 22.652  9.888  1.00 30.45 ? 100 LYS A CG  1 
ATOM   817  C CD  . LYS A 1 112 ? 13.778 23.406  8.594  1.00 35.91 ? 100 LYS A CD  1 
ATOM   818  C CE  . LYS A 1 112 ? 13.390 24.875  8.870  1.00 38.35 ? 100 LYS A CE  1 
ATOM   819  N NZ  . LYS A 1 112 ? 13.192 25.605  7.582  1.00 39.14 ? 100 LYS A NZ  1 
ATOM   820  N N   . MET A 1 113 ? 14.875 18.192  8.732  1.00 21.91 ? 101 MET A N   1 
ATOM   821  C CA  . MET A 1 113 ? 15.686 17.062  8.331  1.00 22.35 ? 101 MET A CA  1 
ATOM   822  C C   . MET A 1 113 ? 14.881 16.106  7.411  1.00 22.35 ? 101 MET A C   1 
ATOM   823  O O   . MET A 1 113 ? 15.420 15.102  6.911  1.00 20.29 ? 101 MET A O   1 
ATOM   824  C CB  . MET A 1 113 ? 16.092 16.375  9.648  1.00 22.98 ? 101 MET A CB  1 
ATOM   825  C CG  . MET A 1 113 ? 17.113 15.298  9.625  1.00 25.52 ? 101 MET A CG  1 
ATOM   826  S SD  . MET A 1 113 ? 17.301 14.616  11.347 1.00 17.41 ? 101 MET A SD  1 
ATOM   827  C CE  . MET A 1 113 ? 17.667 15.734  12.048 1.00 3.96  ? 101 MET A CE  1 
ATOM   828  N N   . ASN A 1 114 ? 13.603 16.427  7.179  1.00 19.01 ? 102 ASN A N   1 
ATOM   829  C CA  . ASN A 1 114 ? 12.713 15.562  6.374  1.00 20.59 ? 102 ASN A CA  1 
ATOM   830  C C   . ASN A 1 114 ? 12.664 14.173  7.045  1.00 17.68 ? 102 ASN A C   1 
ATOM   831  O O   . ASN A 1 114 ? 12.568 13.147  6.373  1.00 15.84 ? 102 ASN A O   1 
ATOM   832  C CB  . ASN A 1 114 ? 13.215 15.427  4.923  1.00 23.04 ? 102 ASN A CB  1 
ATOM   833  C CG  . ASN A 1 114 ? 12.165 14.838  3.983  1.00 26.89 ? 102 ASN A CG  1 
ATOM   834  O OD1 . ASN A 1 114 ? 10.992 14.707  4.334  1.00 29.08 ? 102 ASN A OD1 1 
ATOM   835  N ND2 . ASN A 1 114 ? 12.585 14.490  2.765  1.00 29.44 ? 102 ASN A ND2 1 
ATOM   836  N N   . LEU A 1 115 ? 12.705 14.166  8.377  1.00 17.27 ? 103 LEU A N   1 
ATOM   837  C CA  . LEU A 1 115 ? 12.697 12.916  9.143  1.00 17.70 ? 103 LEU A CA  1 
ATOM   838  C C   . LEU A 1 115 ? 11.454 12.048  8.836  1.00 16.79 ? 103 LEU A C   1 
ATOM   839  O O   . LEU A 1 115 ? 11.538 10.818  8.775  1.00 15.18 ? 103 LEU A O   1 
ATOM   840  C CB  . LEU A 1 115 ? 12.755 13.223  10.648 1.00 18.30 ? 103 LEU A CB  1 
ATOM   841  C CG  . LEU A 1 115 ? 13.748 12.396  11.507 1.00 24.53 ? 103 LEU A CG  1 
ATOM   842  C CD1 . LEU A 1 115 ? 13.273 12.353  12.974 1.00 19.82 ? 103 LEU A CD1 1 
ATOM   843  C CD2 . LEU A 1 115 ? 13.900 11.005  10.994 1.00 22.21 ? 103 LEU A CD2 1 
ATOM   844  N N   . GLY A 1 116 ? 10.310 12.704  8.645  1.00 15.38 ? 104 GLY A N   1 
ATOM   845  C CA  . GLY A 1 116 ? 9.081  12.005  8.339  1.00 15.27 ? 104 GLY A CA  1 
ATOM   846  C C   . GLY A 1 116 ? 9.180  11.052  7.151  1.00 17.47 ? 104 GLY A C   1 
ATOM   847  O O   . GLY A 1 116 ? 8.505  10.030  7.122  1.00 20.26 ? 104 GLY A O   1 
ATOM   848  N N   . LYS A 1 117 ? 9.997  11.391  6.160  1.00 17.37 ? 105 LYS A N   1 
ATOM   849  C CA  . LYS A 1 117 ? 10.189 10.548  4.978  1.00 17.05 ? 105 LYS A CA  1 
ATOM   850  C C   . LYS A 1 117 ? 10.734 9.175   5.333  1.00 15.58 ? 105 LYS A C   1 
ATOM   851  O O   . LYS A 1 117 ? 10.382 8.178   4.698  1.00 16.27 ? 105 LYS A O   1 
ATOM   852  C CB  . LYS A 1 117 ? 11.196 11.216  4.018  1.00 19.48 ? 105 LYS A CB  1 
ATOM   853  C CG  . LYS A 1 117 ? 11.729 10.338  2.858  1.00 26.05 ? 105 LYS A CG  1 
ATOM   854  C CD  . LYS A 1 117 ? 12.823 11.095  2.054  1.00 32.03 ? 105 LYS A CD  1 
ATOM   855  C CE  . LYS A 1 117 ? 13.079 10.556  0.614  1.00 33.23 ? 105 LYS A CE  1 
ATOM   856  N NZ  . LYS A 1 117 ? 13.522 9.120   0.533  1.00 35.40 ? 105 LYS A NZ  1 
ATOM   857  N N   . PHE A 1 118 ? 11.620 9.141   6.330  1.00 13.68 ? 106 PHE A N   1 
ATOM   858  C CA  . PHE A 1 118 ? 12.308 7.907   6.720  1.00 13.95 ? 106 PHE A CA  1 
ATOM   859  C C   . PHE A 1 118 ? 11.724 7.062   7.853  1.00 12.58 ? 106 PHE A C   1 
ATOM   860  O O   . PHE A 1 118 ? 12.285 6.015   8.193  1.00 15.10 ? 106 PHE A O   1 
ATOM   861  C CB  . PHE A 1 118 ? 13.766 8.248   7.040  1.00 12.94 ? 106 PHE A CB  1 
ATOM   862  C CG  . PHE A 1 118 ? 14.418 9.135   6.001  1.00 16.12 ? 106 PHE A CG  1 
ATOM   863  C CD1 . PHE A 1 118 ? 14.858 8.606   4.773  1.00 15.64 ? 106 PHE A CD1 1 
ATOM   864  C CD2 . PHE A 1 118 ? 14.587 10.499  6.249  1.00 13.93 ? 106 PHE A CD2 1 
ATOM   865  C CE1 . PHE A 1 118 ? 15.462 9.428   3.810  1.00 15.62 ? 106 PHE A CE1 1 
ATOM   866  C CE2 . PHE A 1 118 ? 15.193 11.326  5.287  1.00 17.48 ? 106 PHE A CE2 1 
ATOM   867  C CZ  . PHE A 1 118 ? 15.633 10.789  4.067  1.00 14.57 ? 106 PHE A CZ  1 
ATOM   868  N N   . LEU A 1 119 ? 10.605 7.480   8.427  1.00 13.03 ? 107 LEU A N   1 
ATOM   869  C CA  . LEU A 1 119 ? 9.989  6.698   9.519  1.00 13.69 ? 107 LEU A CA  1 
ATOM   870  C C   . LEU A 1 119 ? 9.322  5.429   9.033  1.00 11.36 ? 107 LEU A C   1 
ATOM   871  O O   . LEU A 1 119 ? 8.814  5.378   7.919  1.00 10.90 ? 107 LEU A O   1 
ATOM   872  C CB  . LEU A 1 119 ? 8.929  7.505   10.242 1.00 13.11 ? 107 LEU A CB  1 
ATOM   873  C CG  . LEU A 1 119 ? 9.316  8.846   10.849 1.00 15.49 ? 107 LEU A CG  1 
ATOM   874  C CD1 . LEU A 1 119 ? 8.038  9.463   11.456 1.00 17.35 ? 107 LEU A CD1 1 
ATOM   875  C CD2 . LEU A 1 119 ? 10.402 8.660   11.921 1.00 17.35 ? 107 LEU A CD2 1 
ATOM   876  N N   . PHE A 1 120 ? 9.322  4.401   9.874  1.00 9.79  ? 108 PHE A N   1 
ATOM   877  C CA  . PHE A 1 120 ? 8.650  3.184   9.500  1.00 10.72 ? 108 PHE A CA  1 
ATOM   878  C C   . PHE A 1 120 ? 7.395  3.204   10.372 1.00 11.67 ? 108 PHE A C   1 
ATOM   879  O O   . PHE A 1 120 ? 7.465  3.276   11.599 1.00 10.29 ? 108 PHE A O   1 
ATOM   880  C CB  . PHE A 1 120 ? 9.502  1.955   9.794  1.00 11.51 ? 108 PHE A CB  1 
ATOM   881  C CG  . PHE A 1 120 ? 10.709 1.842   8.910  1.00 12.19 ? 108 PHE A CG  1 
ATOM   882  C CD1 . PHE A 1 120 ? 10.600 1.305   7.625  1.00 10.08 ? 108 PHE A CD1 1 
ATOM   883  C CD2 . PHE A 1 120 ? 11.945 2.275   9.356  1.00 12.68 ? 108 PHE A CD2 1 
ATOM   884  C CE1 . PHE A 1 120 ? 11.690 1.205   6.812  1.00 12.34 ? 108 PHE A CE1 1 
ATOM   885  C CE2 . PHE A 1 120 ? 13.069 2.176   8.531  1.00 14.12 ? 108 PHE A CE2 1 
ATOM   886  C CZ  . PHE A 1 120 ? 12.931 1.639   7.258  1.00 13.37 ? 108 PHE A CZ  1 
ATOM   887  N N   . LEU A 1 121 ? 6.252  3.147   9.711  1.00 11.12 ? 109 LEU A N   1 
ATOM   888  C CA  . LEU A 1 121 ? 4.956  3.205   10.380 1.00 12.06 ? 109 LEU A CA  1 
ATOM   889  C C   . LEU A 1 121 ? 4.092  2.060   9.930  1.00 12.62 ? 109 LEU A C   1 
ATOM   890  O O   . LEU A 1 121 ? 4.213  1.609   8.781  1.00 13.51 ? 109 LEU A O   1 
ATOM   891  C CB  . LEU A 1 121 ? 4.255  4.494   9.971  1.00 12.73 ? 109 LEU A CB  1 
ATOM   892  C CG  . LEU A 1 121 ? 5.029  5.786   10.252 1.00 14.60 ? 109 LEU A CG  1 
ATOM   893  C CD1 . LEU A 1 121 ? 4.233  6.983   9.682  1.00 18.24 ? 109 LEU A CD1 1 
ATOM   894  C CD2 . LEU A 1 121 ? 5.186  5.943   11.762 1.00 14.91 ? 109 LEU A CD2 1 
ATOM   895  N N   . GLY A 1 122 ? 3.209  1.609   10.821 1.00 13.52 ? 110 GLY A N   1 
ATOM   896  C CA  . GLY A 1 122 ? 2.269  0.558   10.473 1.00 11.81 ? 110 GLY A CA  1 
ATOM   897  C C   . GLY A 1 122 ? 1.301  1.164   9.455  1.00 14.02 ? 110 GLY A C   1 
ATOM   898  O O   . GLY A 1 122 ? 1.180  2.379   9.376  1.00 11.09 ? 110 GLY A O   1 
ATOM   899  N N   . LYS A 1 123 ? 0.631  0.328   8.664  1.00 14.68 ? 111 LYS A N   1 
ATOM   900  C CA  . LYS A 1 123 ? -0.289 0.848   7.656  1.00 18.00 ? 111 LYS A CA  1 
ATOM   901  C C   . LYS A 1 123 ? -1.397 1.760   8.224  1.00 15.90 ? 111 LYS A C   1 
ATOM   902  O O   . LYS A 1 123 ? -1.689 2.811   7.662  1.00 16.31 ? 111 LYS A O   1 
ATOM   903  C CB  . LYS A 1 123 ? -0.892 -0.332  6.893  1.00 21.38 ? 111 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 123 ? 0.157  -1.124  6.136  1.00 26.21 ? 111 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 123 ? 0.887  -0.273  5.116  1.00 31.72 ? 111 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 123 ? 2.135  -0.998  4.597  1.00 36.50 ? 111 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 123 ? 1.845  -2.418  4.173  1.00 39.55 ? 111 LYS A NZ  1 
ATOM   908  N N   . GLY A 1 124 ? -2.006 1.373   9.342  1.00 16.21 ? 112 GLY A N   1 
ATOM   909  C CA  . GLY A 1 124 ? -3.053 2.191   9.920  1.00 16.37 ? 112 GLY A CA  1 
ATOM   910  C C   . GLY A 1 124 ? -2.533 3.560   10.368 1.00 15.70 ? 112 GLY A C   1 
ATOM   911  O O   . GLY A 1 124 ? -3.187 4.598   10.182 1.00 12.76 ? 112 GLY A O   1 
ATOM   912  N N   . GLU A 1 125 ? -1.340 3.564   10.945 1.00 14.04 ? 113 GLU A N   1 
ATOM   913  C CA  . GLU A 1 125 ? -0.720 4.797   11.433 1.00 16.46 ? 113 GLU A CA  1 
ATOM   914  C C   . GLU A 1 125 ? -0.441 5.703   10.230 1.00 15.38 ? 113 GLU A C   1 
ATOM   915  O O   . GLU A 1 125 ? -0.642 6.922   10.278 1.00 15.96 ? 113 GLU A O   1 
ATOM   916  C CB  . GLU A 1 125 ? 0.576  4.457   12.197 1.00 17.98 ? 113 GLU A CB  1 
ATOM   917  C CG  . GLU A 1 125 ? 1.063  5.553   13.099 1.00 26.98 ? 113 GLU A CG  1 
ATOM   918  C CD  . GLU A 1 125 ? 0.069  5.843   14.220 1.00 31.77 ? 113 GLU A CD  1 
ATOM   919  O OE1 . GLU A 1 125 ? -0.125 7.026   14.565 1.00 33.08 ? 113 GLU A OE1 1 
ATOM   920  O OE2 . GLU A 1 125 ? -0.522 4.879   14.747 1.00 35.49 ? 113 GLU A OE2 1 
ATOM   921  N N   . GLU A 1 126 ? -0.007 5.089   9.141  1.00 15.67 ? 114 GLU A N   1 
ATOM   922  C CA  . GLU A 1 126 ? 0.285  5.806   7.906  1.00 17.73 ? 114 GLU A CA  1 
ATOM   923  C C   . GLU A 1 126 ? -1.010 6.469   7.370  1.00 17.53 ? 114 GLU A C   1 
ATOM   924  O O   . GLU A 1 126 ? -1.024 7.667   7.050  1.00 16.58 ? 114 GLU A O   1 
ATOM   925  C CB  . GLU A 1 126 ? 0.822  4.806   6.877  1.00 22.12 ? 114 GLU A CB  1 
ATOM   926  C CG  . GLU A 1 126 ? 1.132  5.394   5.525  1.00 29.24 ? 114 GLU A CG  1 
ATOM   927  C CD  . GLU A 1 126 ? 2.553  5.887   5.438  1.00 33.43 ? 114 GLU A CD  1 
ATOM   928  O OE1 . GLU A 1 126 ? 3.450  5.035   5.199  1.00 35.03 ? 114 GLU A OE1 1 
ATOM   929  O OE2 . GLU A 1 126 ? 2.763  7.114   5.619  1.00 35.49 ? 114 GLU A OE2 1 
ATOM   930  N N   . LYS A 1 127 ? -2.080 5.669   7.278  1.00 14.94 ? 115 LYS A N   1 
ATOM   931  C CA  . LYS A 1 127 ? -3.421 6.100   6.791  1.00 16.05 ? 115 LYS A CA  1 
ATOM   932  C C   . LYS A 1 127 ? -4.014 7.246   7.655  1.00 14.61 ? 115 LYS A C   1 
ATOM   933  O O   . LYS A 1 127 ? -4.770 8.075   7.169  1.00 12.76 ? 115 LYS A O   1 
ATOM   934  C CB  . LYS A 1 127 ? -4.374 4.874   6.822  1.00 15.59 ? 115 LYS A CB  1 
ATOM   935  C CG  . LYS A 1 127 ? -5.796 5.094   6.343  1.00 20.86 ? 115 LYS A CG  1 
ATOM   936  C CD  . LYS A 1 127 ? -6.698 3.851   6.552  1.00 21.66 ? 115 LYS A CD  1 
ATOM   937  C CE  . LYS A 1 127 ? -8.125 4.106   5.986  1.00 21.56 ? 115 LYS A CE  1 
ATOM   938  N NZ  . LYS A 1 127 ? -9.137 3.036   6.256  1.00 19.07 ? 115 LYS A NZ  1 
ATOM   939  N N   . THR A 1 128 ? -3.688 7.278   8.944  1.00 15.40 ? 116 THR A N   1 
ATOM   940  C CA  . THR A 1 128 ? -4.237 8.318   9.814  1.00 15.89 ? 116 THR A CA  1 
ATOM   941  C C   . THR A 1 128 ? -3.340 9.503   10.176 1.00 17.02 ? 116 THR A C   1 
ATOM   942  O O   . THR A 1 128 ? -3.511 10.134  11.228 1.00 17.79 ? 116 THR A O   1 
ATOM   943  C CB  . THR A 1 128 ? -4.819 7.689   11.106 1.00 16.28 ? 116 THR A CB  1 
ATOM   944  O OG1 . THR A 1 128 ? -3.817 6.907   11.764 1.00 18.39 ? 116 THR A OG1 1 
ATOM   945  C CG2 . THR A 1 128 ? -5.989 6.758   10.743 1.00 15.38 ? 116 THR A CG2 1 
ATOM   946  N N   . GLY A 1 129 ? -2.360 9.791   9.332  1.00 14.21 ? 117 GLY A N   1 
ATOM   947  C CA  . GLY A 1 129 ? -1.537 10.965  9.574  1.00 16.10 ? 117 GLY A CA  1 
ATOM   948  C C   . GLY A 1 129 ? -0.329 10.889  10.486 1.00 15.40 ? 117 GLY A C   1 
ATOM   949  O O   . GLY A 1 129 ? 0.324  11.916  10.755 1.00 14.22 ? 117 GLY A O   1 
ATOM   950  N N   . GLY A 1 130 ? 0.026  9.688   10.919 1.00 12.49 ? 118 GLY A N   1 
ATOM   951  C CA  . GLY A 1 130 ? 1.150  9.582   11.830 1.00 13.24 ? 118 GLY A CA  1 
ATOM   952  C C   . GLY A 1 130 ? 2.467  10.167  11.350 1.00 12.56 ? 118 GLY A C   1 
ATOM   953  O O   . GLY A 1 130 ? 3.268  10.625  12.164 1.00 14.90 ? 118 GLY A O   1 
ATOM   954  N N   . ARG A 1 131 ? 2.700  10.174  10.043 1.00 13.26 ? 119 ARG A N   1 
ATOM   955  C CA  . ARG A 1 131 ? 3.971  10.677  9.505  1.00 14.47 ? 119 ARG A CA  1 
ATOM   956  C C   . ARG A 1 131 ? 4.132  12.210  9.713  1.00 16.10 ? 119 ARG A C   1 
ATOM   957  O O   . ARG A 1 131 ? 5.251  12.761  9.636  1.00 13.74 ? 119 ARG A O   1 
ATOM   958  C CB  . ARG A 1 131 ? 4.069  10.252  8.009  1.00 16.40 ? 119 ARG A CB  1 
ATOM   959  C CG  . ARG A 1 131 ? 5.478  10.129  7.421  1.00 14.53 ? 119 ARG A CG  1 
ATOM   960  C CD  . ARG A 1 131 ? 5.459  9.538   6.043  1.00 14.87 ? 119 ARG A CD  1 
ATOM   961  N NE  . ARG A 1 131 ? 5.222  8.096   6.015  1.00 13.67 ? 119 ARG A NE  1 
ATOM   962  C CZ  . ARG A 1 131 ? 6.109  7.169   6.363  1.00 14.60 ? 119 ARG A CZ  1 
ATOM   963  N NH1 . ARG A 1 131 ? 7.341  7.510   6.776  1.00 10.94 ? 119 ARG A NH1 1 
ATOM   964  N NH2 . ARG A 1 131 ? 5.759  5.896   6.300  1.00 14.62 ? 119 ARG A NH2 1 
ATOM   965  N N   . ASP A 1 132 ? 3.024  12.874  10.044 1.00 13.70 ? 120 ASP A N   1 
ATOM   966  C CA  . ASP A 1 132 ? 3.006  14.327  10.276 1.00 15.80 ? 120 ASP A CA  1 
ATOM   967  C C   . ASP A 1 132 ? 2.803  14.641  11.765 1.00 15.89 ? 120 ASP A C   1 
ATOM   968  O O   . ASP A 1 132 ? 2.691  15.805  12.148 1.00 16.28 ? 120 ASP A O   1 
ATOM   969  C CB  . ASP A 1 132 ? 1.850  14.997  9.493  1.00 17.28 ? 120 ASP A CB  1 
ATOM   970  C CG  . ASP A 1 132 ? 1.973  14.838  7.976  1.00 20.27 ? 120 ASP A CG  1 
ATOM   971  O OD1 . ASP A 1 132 ? 3.094  14.988  7.444  1.00 22.43 ? 120 ASP A OD1 1 
ATOM   972  O OD2 . ASP A 1 132 ? 0.946  14.575  7.305  1.00 21.95 ? 120 ASP A OD2 1 
ATOM   973  N N   . ARG A 1 133 ? 2.746  13.608  12.606 1.00 15.42 ? 121 ARG A N   1 
ATOM   974  C CA  . ARG A 1 133 ? 2.486  13.811  14.025 1.00 16.56 ? 121 ARG A CA  1 
ATOM   975  C C   . ARG A 1 133 ? 3.687  14.314  14.816 1.00 15.75 ? 121 ARG A C   1 
ATOM   976  O O   . ARG A 1 133 ? 4.723  13.639  14.890 1.00 14.15 ? 121 ARG A O   1 
ATOM   977  C CB  . ARG A 1 133 ? 1.959  12.502  14.638 1.00 19.80 ? 121 ARG A CB  1 
ATOM   978  C CG  . ARG A 1 133 ? 1.247  12.681  15.961 1.00 26.73 ? 121 ARG A CG  1 
ATOM   979  C CD  . ARG A 1 133 ? 0.496  11.419  16.302 1.00 31.23 ? 121 ARG A CD  1 
ATOM   980  N NE  . ARG A 1 133 ? -0.202 10.929  15.109 1.00 37.24 ? 121 ARG A NE  1 
ATOM   981  C CZ  . ARG A 1 133 ? -0.916 9.809   15.049 1.00 38.44 ? 121 ARG A CZ  1 
ATOM   982  N NH1 . ARG A 1 133 ? -1.029 9.041   16.129 1.00 40.35 ? 121 ARG A NH1 1 
ATOM   983  N NH2 . ARG A 1 133 ? -1.531 9.466   13.913 1.00 40.40 ? 121 ARG A NH2 1 
ATOM   984  N N   . ASP A 1 134 ? 3.542  15.510  15.391 1.00 13.69 ? 122 ASP A N   1 
ATOM   985  C CA  . ASP A 1 134 ? 4.592  16.129  16.180 1.00 14.95 ? 122 ASP A CA  1 
ATOM   986  C C   . ASP A 1 134 ? 5.207  15.143  17.185 1.00 13.02 ? 122 ASP A C   1 
ATOM   987  O O   . ASP A 1 134 ? 6.420  15.032  17.274 1.00 11.81 ? 122 ASP A O   1 
ATOM   988  C CB  . ASP A 1 134 ? 4.058  17.347  16.955 1.00 17.45 ? 122 ASP A CB  1 
ATOM   989  C CG  . ASP A 1 134 ? 3.974  18.593  16.108 1.00 20.13 ? 122 ASP A CG  1 
ATOM   990  O OD1 . ASP A 1 134 ? 3.701  18.476  14.907 1.00 21.40 ? 122 ASP A OD1 1 
ATOM   991  O OD2 . ASP A 1 134 ? 4.185  19.706  16.642 1.00 23.96 ? 122 ASP A OD2 1 
ATOM   992  N N   . SER A 1 135 ? 4.375  14.435  17.935 1.00 13.67 ? 123 SER A N   1 
ATOM   993  C CA  . SER A 1 135 ? 4.897  13.500  18.940 1.00 14.79 ? 123 SER A CA  1 
ATOM   994  C C   . SER A 1 135 ? 5.747  12.390  18.327 1.00 13.43 ? 123 SER A C   1 
ATOM   995  O O   . SER A 1 135 ? 6.790  12.026  18.861 1.00 14.10 ? 123 SER A O   1 
ATOM   996  C CB  . SER A 1 135 ? 3.734  12.874  19.756 1.00 16.51 ? 123 SER A CB  1 
ATOM   997  O OG  . SER A 1 135 ? 2.892  12.093  18.921 1.00 17.48 ? 123 SER A OG  1 
ATOM   998  N N   . ILE A 1 136 ? 5.303  11.836  17.207 1.00 12.37 ? 124 ILE A N   1 
ATOM   999  C CA  . ILE A 1 136 ? 6.050  10.756  16.575 1.00 11.16 ? 124 ILE A CA  1 
ATOM   1000 C C   . ILE A 1 136 ? 7.385  11.297  16.036 1.00 12.65 ? 124 ILE A C   1 
ATOM   1001 O O   . ILE A 1 136 ? 8.434  10.649  16.148 1.00 9.84  ? 124 ILE A O   1 
ATOM   1002 C CB  . ILE A 1 136 ? 5.217  10.121  15.435 1.00 11.07 ? 124 ILE A CB  1 
ATOM   1003 C CG1 . ILE A 1 136 ? 4.026  9.364   16.043 1.00 10.56 ? 124 ILE A CG1 1 
ATOM   1004 C CG2 . ILE A 1 136 ? 6.117  9.264   14.504 1.00 10.60 ? 124 ILE A CG2 1 
ATOM   1005 C CD1 . ILE A 1 136 ? 3.215  8.527   15.061 1.00 13.30 ? 124 ILE A CD1 1 
ATOM   1006 N N   . LEU A 1 137 ? 7.356  12.500  15.469 1.00 10.98 ? 125 LEU A N   1 
ATOM   1007 C CA  . LEU A 1 137 ? 8.583  13.054  14.917 1.00 11.37 ? 125 LEU A CA  1 
ATOM   1008 C C   . LEU A 1 137 ? 9.576  13.363  16.029 1.00 13.55 ? 125 LEU A C   1 
ATOM   1009 O O   . LEU A 1 137 ? 10.750 13.027  15.919 1.00 13.59 ? 125 LEU A O   1 
ATOM   1010 C CB  . LEU A 1 137 ? 8.287  14.331  14.115 1.00 12.18 ? 125 LEU A CB  1 
ATOM   1011 C CG  . LEU A 1 137 ? 7.462  14.109  12.840 1.00 10.18 ? 125 LEU A CG  1 
ATOM   1012 C CD1 . LEU A 1 137 ? 6.815  15.441  12.382 1.00 11.99 ? 125 LEU A CD1 1 
ATOM   1013 C CD2 . LEU A 1 137 ? 8.337  13.515  11.781 1.00 12.27 ? 125 LEU A CD2 1 
ATOM   1014 N N   . ALA A 1 138 ? 9.099  14.020  17.085 1.00 12.76 ? 126 ALA A N   1 
ATOM   1015 C CA  . ALA A 1 138 ? 9.961  14.396  18.200 1.00 13.47 ? 126 ALA A CA  1 
ATOM   1016 C C   . ALA A 1 138 ? 10.562 13.142  18.808 1.00 14.11 ? 126 ALA A C   1 
ATOM   1017 O O   . ALA A 1 138 ? 11.767 13.085  19.090 1.00 13.37 ? 126 ALA A O   1 
ATOM   1018 C CB  . ALA A 1 138 ? 9.155  15.134  19.243 1.00 11.77 ? 126 ALA A CB  1 
ATOM   1019 N N   . ASP A 1 139 ? 9.697  12.150  19.048 1.00 13.17 ? 127 ASP A N   1 
ATOM   1020 C CA  . ASP A 1 139 ? 10.145 10.865  19.601 1.00 12.35 ? 127 ASP A CA  1 
ATOM   1021 C C   . ASP A 1 139 ? 11.223 10.231  18.719 1.00 11.45 ? 127 ASP A C   1 
ATOM   1022 O O   . ASP A 1 139 ? 12.253 9.748   19.227 1.00 13.71 ? 127 ASP A O   1 
ATOM   1023 C CB  . ASP A 1 139 ? 8.999  9.842   19.681 1.00 14.37 ? 127 ASP A CB  1 
ATOM   1024 C CG  . ASP A 1 139 ? 8.010  10.109  20.827 1.00 15.95 ? 127 ASP A CG  1 
ATOM   1025 O OD1 . ASP A 1 139 ? 8.229  11.027  21.632 1.00 20.77 ? 127 ASP A OD1 1 
ATOM   1026 O OD2 . ASP A 1 139 ? 6.999  9.375   20.901 1.00 20.33 ? 127 ASP A OD2 1 
ATOM   1027 N N   . ALA A 1 140 ? 10.980 10.172  17.410 1.00 9.84  ? 128 ALA A N   1 
ATOM   1028 C CA  . ALA A 1 140 ? 11.977 9.560   16.533 1.00 9.99  ? 128 ALA A CA  1 
ATOM   1029 C C   . ALA A 1 140 ? 13.283 10.359  16.582 1.00 11.00 ? 128 ALA A C   1 
ATOM   1030 O O   . ALA A 1 140 ? 14.376 9.784   16.480 1.00 10.65 ? 128 ALA A O   1 
ATOM   1031 C CB  . ALA A 1 140 ? 11.478 9.478   15.094 1.00 9.64  ? 128 ALA A CB  1 
ATOM   1032 N N   . PHE A 1 141 ? 13.182 11.673  16.773 1.00 9.85  ? 129 PHE A N   1 
ATOM   1033 C CA  . PHE A 1 141 ? 14.415 12.458  16.783 1.00 13.22 ? 129 PHE A CA  1 
ATOM   1034 C C   . PHE A 1 141 ? 15.259 12.090  18.001 1.00 12.14 ? 129 PHE A C   1 
ATOM   1035 O O   . PHE A 1 141 ? 16.468 11.948  17.896 1.00 11.55 ? 129 PHE A O   1 
ATOM   1036 C CB  . PHE A 1 141 ? 14.140 13.936  16.818 1.00 12.01 ? 129 PHE A CB  1 
ATOM   1037 C CG  . PHE A 1 141 ? 15.381 14.756  16.738 1.00 14.53 ? 129 PHE A CG  1 
ATOM   1038 C CD1 . PHE A 1 141 ? 16.036 14.923  15.516 1.00 13.15 ? 129 PHE A CD1 1 
ATOM   1039 C CD2 . PHE A 1 141 ? 15.933 15.318  17.889 1.00 12.55 ? 129 PHE A CD2 1 
ATOM   1040 C CE1 . PHE A 1 141 ? 17.239 15.649  15.442 1.00 14.16 ? 129 PHE A CE1 1 
ATOM   1041 C CE2 . PHE A 1 141 ? 17.142 16.052  17.825 1.00 13.85 ? 129 PHE A CE2 1 
ATOM   1042 C CZ  . PHE A 1 141 ? 17.781 16.211  16.614 1.00 14.71 ? 129 PHE A CZ  1 
ATOM   1043 N N   . GLU A 1 142 ? 14.602 11.963  19.146 1.00 12.87 ? 130 GLU A N   1 
ATOM   1044 C CA  . GLU A 1 142 ? 15.282 11.588  20.384 1.00 12.99 ? 130 GLU A CA  1 
ATOM   1045 C C   . GLU A 1 142 ? 15.918 10.200  20.229 1.00 11.46 ? 130 GLU A C   1 
ATOM   1046 O O   . GLU A 1 142 ? 17.041 9.975   20.685 1.00 11.74 ? 130 GLU A O   1 
ATOM   1047 C CB  . GLU A 1 142 ? 14.289 11.577  21.565 1.00 15.42 ? 130 GLU A CB  1 
ATOM   1048 C CG  . GLU A 1 142 ? 13.745 12.967  21.909 1.00 20.26 ? 130 GLU A CG  1 
ATOM   1049 C CD  . GLU A 1 142 ? 13.077 12.996  23.268 1.00 24.14 ? 130 GLU A CD  1 
ATOM   1050 O OE1 . GLU A 1 142 ? 12.192 12.167  23.522 1.00 28.48 ? 130 GLU A OE1 1 
ATOM   1051 O OE2 . GLU A 1 142 ? 13.441 13.854  24.090 1.00 28.24 ? 130 GLU A OE2 1 
ATOM   1052 N N   . ALA A 1 143 ? 15.179 9.279   19.615 1.00 10.45 ? 131 ALA A N   1 
ATOM   1053 C CA  . ALA A 1 143 ? 15.678 7.924   19.381 1.00 10.35 ? 131 ALA A CA  1 
ATOM   1054 C C   . ALA A 1 143 ? 16.930 8.005   18.473 1.00 12.22 ? 131 ALA A C   1 
ATOM   1055 O O   . ALA A 1 143 ? 17.925 7.298   18.679 1.00 10.78 ? 131 ALA A O   1 
ATOM   1056 C CB  . ALA A 1 143 ? 14.602 7.083   18.712 1.00 10.92 ? 131 ALA A CB  1 
ATOM   1057 N N   . LEU A 1 144 ? 16.889 8.901   17.490 1.00 13.65 ? 132 LEU A N   1 
ATOM   1058 C CA  . LEU A 1 144 ? 18.017 9.051   16.568 1.00 13.74 ? 132 LEU A CA  1 
ATOM   1059 C C   . LEU A 1 144 ? 19.253 9.517   17.347 1.00 13.95 ? 132 LEU A C   1 
ATOM   1060 O O   . LEU A 1 144 ? 20.355 9.010   17.133 1.00 13.72 ? 132 LEU A O   1 
ATOM   1061 C CB  . LEU A 1 144 ? 17.685 10.063  15.472 1.00 14.04 ? 132 LEU A CB  1 
ATOM   1062 C CG  . LEU A 1 144 ? 18.814 10.356  14.468 1.00 15.60 ? 132 LEU A CG  1 
ATOM   1063 C CD1 . LEU A 1 144 ? 19.328 9.077   13.768 1.00 15.68 ? 132 LEU A CD1 1 
ATOM   1064 C CD2 . LEU A 1 144 ? 18.258 11.344  13.441 1.00 18.07 ? 132 LEU A CD2 1 
ATOM   1065 N N   . LEU A 1 145 ? 19.066 10.466  18.259 1.00 13.38 ? 133 LEU A N   1 
ATOM   1066 C CA  . LEU A 1 145 ? 20.205 10.942  19.047 1.00 14.56 ? 133 LEU A CA  1 
ATOM   1067 C C   . LEU A 1 145 ? 20.810 9.776   19.827 1.00 14.57 ? 133 LEU A C   1 
ATOM   1068 O O   . LEU A 1 145 ? 22.033 9.671   19.930 1.00 13.68 ? 133 LEU A O   1 
ATOM   1069 C CB  . LEU A 1 145 ? 19.776 12.040  20.009 1.00 15.68 ? 133 LEU A CB  1 
ATOM   1070 C CG  . LEU A 1 145 ? 19.358 13.348  19.343 1.00 16.37 ? 133 LEU A CG  1 
ATOM   1071 C CD1 . LEU A 1 145 ? 18.796 14.245  20.417 1.00 19.43 ? 133 LEU A CD1 1 
ATOM   1072 C CD2 . LEU A 1 145 ? 20.522 14.004  18.645 1.00 15.37 ? 133 LEU A CD2 1 
ATOM   1073 N N   . ALA A 1 146 ? 19.965 8.922   20.413 1.00 12.06 ? 134 ALA A N   1 
ATOM   1074 C CA  . ALA A 1 146 ? 20.494 7.759   21.140 1.00 11.93 ? 134 ALA A CA  1 
ATOM   1075 C C   . ALA A 1 146 ? 21.251 6.820   20.190 1.00 11.01 ? 134 ALA A C   1 
ATOM   1076 O O   . ALA A 1 146 ? 22.284 6.274   20.567 1.00 12.89 ? 134 ALA A O   1 
ATOM   1077 C CB  . ALA A 1 146 ? 19.349 6.949   21.853 1.00 9.68  ? 134 ALA A CB  1 
ATOM   1078 N N   . ALA A 1 147 ? 20.729 6.607   18.979 1.00 8.73  ? 135 ALA A N   1 
ATOM   1079 C CA  . ALA A 1 147 ? 21.377 5.742   18.008 1.00 10.46 ? 135 ALA A CA  1 
ATOM   1080 C C   . ALA A 1 147 ? 22.752 6.304   17.618 1.00 11.91 ? 135 ALA A C   1 
ATOM   1081 O O   . ALA A 1 147 ? 23.752 5.559   17.566 1.00 11.56 ? 135 ALA A O   1 
ATOM   1082 C CB  . ALA A 1 147 ? 20.496 5.548   16.751 1.00 8.17  ? 135 ALA A CB  1 
ATOM   1083 N N   . ILE A 1 148 ? 22.805 7.608   17.341 1.00 11.45 ? 136 ILE A N   1 
ATOM   1084 C CA  . ILE A 1 148 ? 24.084 8.234   17.004 1.00 11.53 ? 136 ILE A CA  1 
ATOM   1085 C C   . ILE A 1 148 ? 25.043 8.141   18.233 1.00 12.02 ? 136 ILE A C   1 
ATOM   1086 O O   . ILE A 1 148 ? 26.251 7.817   18.102 1.00 10.15 ? 136 ILE A O   1 
ATOM   1087 C CB  . ILE A 1 148 ? 23.858 9.717   16.598 1.00 11.67 ? 136 ILE A CB  1 
ATOM   1088 C CG1 . ILE A 1 148 ? 23.145 9.768   15.233 1.00 10.01 ? 136 ILE A CG1 1 
ATOM   1089 C CG2 . ILE A 1 148 ? 25.192 10.488  16.531 1.00 11.21 ? 136 ILE A CG2 1 
ATOM   1090 C CD1 . ILE A 1 148 ? 22.577 11.177  14.927 1.00 14.14 ? 136 ILE A CD1 1 
ATOM   1091 N N   . TYR A 1 149 ? 24.494 8.415   19.410 1.00 9.45  ? 137 TYR A N   1 
ATOM   1092 C CA  . TYR A 1 149 ? 25.273 8.349   20.652 1.00 13.19 ? 137 TYR A CA  1 
ATOM   1093 C C   . TYR A 1 149 ? 25.886 6.956   20.806 1.00 13.47 ? 137 TYR A C   1 
ATOM   1094 O O   . TYR A 1 149 ? 27.095 6.825   21.038 1.00 14.62 ? 137 TYR A O   1 
ATOM   1095 C CB  . TYR A 1 149 ? 24.398 8.637   21.890 1.00 12.86 ? 137 TYR A CB  1 
ATOM   1096 C CG  . TYR A 1 149 ? 25.159 8.494   23.188 1.00 14.52 ? 137 TYR A CG  1 
ATOM   1097 C CD1 . TYR A 1 149 ? 26.166 9.409   23.535 1.00 15.03 ? 137 TYR A CD1 1 
ATOM   1098 C CD2 . TYR A 1 149 ? 24.843 7.478   24.098 1.00 15.99 ? 137 TYR A CD2 1 
ATOM   1099 C CE1 . TYR A 1 149 ? 26.828 9.334   24.775 1.00 16.89 ? 137 TYR A CE1 1 
ATOM   1100 C CE2 . TYR A 1 149 ? 25.503 7.387   25.337 1.00 16.09 ? 137 TYR A CE2 1 
ATOM   1101 C CZ  . TYR A 1 149 ? 26.481 8.320   25.674 1.00 17.73 ? 137 TYR A CZ  1 
ATOM   1102 O OH  . TYR A 1 149 ? 27.054 8.290   26.928 1.00 19.02 ? 137 TYR A OH  1 
ATOM   1103 N N   . LEU A 1 150 ? 25.056 5.925   20.670 1.00 11.95 ? 138 LEU A N   1 
ATOM   1104 C CA  . LEU A 1 150 ? 25.518 4.559   20.771 1.00 14.18 ? 138 LEU A CA  1 
ATOM   1105 C C   . LEU A 1 150 ? 26.467 4.157   19.642 1.00 16.53 ? 138 LEU A C   1 
ATOM   1106 O O   . LEU A 1 150 ? 27.441 3.466   19.881 1.00 13.52 ? 138 LEU A O   1 
ATOM   1107 C CB  . LEU A 1 150 ? 24.331 3.583   20.786 1.00 14.91 ? 138 LEU A CB  1 
ATOM   1108 C CG  . LEU A 1 150 ? 23.409 3.691   22.006 1.00 17.14 ? 138 LEU A CG  1 
ATOM   1109 C CD1 . LEU A 1 150 ? 22.204 2.774   21.779 1.00 15.28 ? 138 LEU A CD1 1 
ATOM   1110 C CD2 . LEU A 1 150 ? 24.168 3.305   23.308 1.00 18.13 ? 138 LEU A CD2 1 
ATOM   1111 N N   . ASP A 1 151 ? 26.184 4.587   18.416 1.00 13.38 ? 139 ASP A N   1 
ATOM   1112 C CA  . ASP A 1 151 ? 27.017 4.211   17.276 1.00 14.88 ? 139 ASP A CA  1 
ATOM   1113 C C   . ASP A 1 151 ? 28.360 4.945   17.194 1.00 15.35 ? 139 ASP A C   1 
ATOM   1114 O O   . ASP A 1 151 ? 29.394 4.323   16.972 1.00 14.43 ? 139 ASP A O   1 
ATOM   1115 C CB  . ASP A 1 151 ? 26.247 4.460   15.962 1.00 14.61 ? 139 ASP A CB  1 
ATOM   1116 C CG  . ASP A 1 151 ? 26.873 3.757   14.749 1.00 18.05 ? 139 ASP A CG  1 
ATOM   1117 O OD1 . ASP A 1 151 ? 27.050 2.512   14.777 1.00 14.82 ? 139 ASP A OD1 1 
ATOM   1118 O OD2 . ASP A 1 151 ? 27.172 4.450   13.744 1.00 13.47 ? 139 ASP A OD2 1 
ATOM   1119 N N   . GLN A 1 152 ? 28.320 6.258   17.387 1.00 16.01 ? 140 GLN A N   1 
ATOM   1120 C CA  . GLN A 1 152 ? 29.485 7.121   17.209 1.00 16.49 ? 140 GLN A CA  1 
ATOM   1121 C C   . GLN A 1 152 ? 29.890 8.014   18.361 1.00 17.61 ? 140 GLN A C   1 
ATOM   1122 O O   . GLN A 1 152 ? 30.885 8.706   18.258 1.00 19.76 ? 140 GLN A O   1 
ATOM   1123 C CB  . GLN A 1 152 ? 29.241 7.978   15.973 1.00 16.03 ? 140 GLN A CB  1 
ATOM   1124 C CG  . GLN A 1 152 ? 29.068 7.141   14.728 1.00 16.34 ? 140 GLN A CG  1 
ATOM   1125 C CD  . GLN A 1 152 ? 28.216 7.797   13.643 1.00 17.36 ? 140 GLN A CD  1 
ATOM   1126 O OE1 . GLN A 1 152 ? 28.653 8.961   13.153 1.00 13.92 ? 140 GLN A OE1 1 
ATOM   1127 N NE2 . GLN A 1 152 ? 27.173 7.253   13.245 1.00 16.33 ? 140 GLN A NE2 1 
ATOM   1128 N N   . GLY A 1 153 ? 29.107 8.045   19.437 1.00 17.11 ? 141 GLY A N   1 
ATOM   1129 C CA  . GLY A 1 153 ? 29.492 8.855   20.578 1.00 16.39 ? 141 GLY A CA  1 
ATOM   1130 C C   . GLY A 1 153 ? 28.952 10.261  20.709 1.00 15.72 ? 141 GLY A C   1 
ATOM   1131 O O   . GLY A 1 153 ? 28.434 10.839  19.752 1.00 14.28 ? 141 GLY A O   1 
ATOM   1132 N N   . TYR A 1 154 ? 29.111 10.809  21.916 1.00 14.24 ? 142 TYR A N   1 
ATOM   1133 C CA  . TYR A 1 154 ? 28.660 12.154  22.256 1.00 15.90 ? 142 TYR A CA  1 
ATOM   1134 C C   . TYR A 1 154 ? 29.320 13.249  21.409 1.00 17.68 ? 142 TYR A C   1 
ATOM   1135 O O   . TYR A 1 154 ? 28.680 14.257  21.100 1.00 17.15 ? 142 TYR A O   1 
ATOM   1136 C CB  . TYR A 1 154 ? 28.915 12.424  23.753 1.00 17.75 ? 142 TYR A CB  1 
ATOM   1137 C CG  . TYR A 1 154 ? 28.299 13.702  24.283 1.00 20.62 ? 142 TYR A CG  1 
ATOM   1138 C CD1 . TYR A 1 154 ? 26.905 13.819  24.452 1.00 18.41 ? 142 TYR A CD1 1 
ATOM   1139 C CD2 . TYR A 1 154 ? 29.099 14.788  24.617 1.00 20.14 ? 142 TYR A CD2 1 
ATOM   1140 C CE1 . TYR A 1 154 ? 26.345 15.005  24.942 1.00 20.66 ? 142 TYR A CE1 1 
ATOM   1141 C CE2 . TYR A 1 154 ? 28.550 15.973  25.117 1.00 21.46 ? 142 TYR A CE2 1 
ATOM   1142 C CZ  . TYR A 1 154 ? 27.166 16.067  25.274 1.00 19.91 ? 142 TYR A CZ  1 
ATOM   1143 O OH  . TYR A 1 154 ? 26.632 17.222  25.793 1.00 21.19 ? 142 TYR A OH  1 
ATOM   1144 N N   . GLU A 1 155 ? 30.586 13.074  21.033 1.00 15.64 ? 143 GLU A N   1 
ATOM   1145 C CA  . GLU A 1 155 ? 31.253 14.101  20.232 1.00 18.87 ? 143 GLU A CA  1 
ATOM   1146 C C   . GLU A 1 155 ? 30.594 14.242  18.877 1.00 16.23 ? 143 GLU A C   1 
ATOM   1147 O O   . GLU A 1 155 ? 30.550 15.332  18.318 1.00 13.72 ? 143 GLU A O   1 
ATOM   1148 C CB  . GLU A 1 155 ? 32.749 13.802  20.000 1.00 20.28 ? 143 GLU A CB  1 
ATOM   1149 C CG  . GLU A 1 155 ? 33.654 14.076  21.173 1.00 28.66 ? 143 GLU A CG  1 
ATOM   1150 C CD  . GLU A 1 155 ? 33.605 15.529  21.644 1.00 33.41 ? 143 GLU A CD  1 
ATOM   1151 O OE1 . GLU A 1 155 ? 33.764 16.445  20.790 1.00 36.31 ? 143 GLU A OE1 1 
ATOM   1152 O OE2 . GLU A 1 155 ? 33.418 15.744  22.872 1.00 34.12 ? 143 GLU A OE2 1 
ATOM   1153 N N   . LYS A 1 156 ? 30.092 13.138  18.344 1.00 15.27 ? 144 LYS A N   1 
ATOM   1154 C CA  . LYS A 1 156 ? 29.428 13.199  17.039 1.00 17.17 ? 144 LYS A CA  1 
ATOM   1155 C C   . LYS A 1 156 ? 28.130 14.001  17.156 1.00 17.49 ? 144 LYS A C   1 
ATOM   1156 O O   . LYS A 1 156 ? 27.754 14.767  16.251 1.00 16.50 ? 144 LYS A O   1 
ATOM   1157 C CB  . LYS A 1 156 ? 29.132 11.780  16.528 1.00 17.33 ? 144 LYS A CB  1 
ATOM   1158 C CG  . LYS A 1 156 ? 28.337 11.730  15.220 1.00 17.75 ? 144 LYS A CG  1 
ATOM   1159 C CD  . LYS A 1 156 ? 29.035 12.478  14.053 1.00 21.54 ? 144 LYS A CD  1 
ATOM   1160 C CE  . LYS A 1 156 ? 30.386 11.871  13.724 1.00 23.77 ? 144 LYS A CE  1 
ATOM   1161 N NZ  . LYS A 1 156 ? 30.813 12.238  12.333 1.00 28.21 ? 144 LYS A NZ  1 
ATOM   1162 N N   . ILE A 1 157 ? 27.411 13.785  18.260 1.00 18.62 ? 145 ILE A N   1 
ATOM   1163 C CA  . ILE A 1 157 ? 26.181 14.518  18.499 1.00 18.56 ? 145 ILE A CA  1 
ATOM   1164 C C   . ILE A 1 157 ? 26.506 16.037  18.484 1.00 20.09 ? 145 ILE A C   1 
ATOM   1165 O O   . ILE A 1 157 ? 25.805 16.851  17.848 1.00 17.81 ? 145 ILE A O   1 
ATOM   1166 C CB  . ILE A 1 157 ? 25.581 14.105  19.846 1.00 19.54 ? 145 ILE A CB  1 
ATOM   1167 C CG1 . ILE A 1 157 ? 25.096 12.649  19.732 1.00 20.26 ? 145 ILE A CG1 1 
ATOM   1168 C CG2 . ILE A 1 157 ? 24.430 15.047  20.227 1.00 20.68 ? 145 ILE A CG2 1 
ATOM   1169 C CD1 . ILE A 1 157 ? 24.531 12.107  20.979 1.00 24.70 ? 145 ILE A CD1 1 
ATOM   1170 N N   . LYS A 1 158 ? 27.572 16.435  19.165 1.00 18.48 ? 146 LYS A N   1 
ATOM   1171 C CA  . LYS A 1 158 ? 27.904 17.858  19.162 1.00 19.38 ? 146 LYS A CA  1 
ATOM   1172 C C   . LYS A 1 158 ? 28.278 18.280  17.747 1.00 19.05 ? 146 LYS A C   1 
ATOM   1173 O O   . LYS A 1 158 ? 27.819 19.293  17.248 1.00 19.26 ? 146 LYS A O   1 
ATOM   1174 C CB  . LYS A 1 158 ? 29.056 18.154  20.127 1.00 21.68 ? 146 LYS A CB  1 
ATOM   1175 C CG  . LYS A 1 158 ? 28.692 17.931  21.593 1.00 23.19 ? 146 LYS A CG  1 
ATOM   1176 C CD  . LYS A 1 158 ? 29.723 18.572  22.535 1.00 26.53 ? 146 LYS A CD  1 
ATOM   1177 C CE  . LYS A 1 158 ? 30.976 17.724  22.680 1.00 27.65 ? 146 LYS A CE  1 
ATOM   1178 N NZ  . LYS A 1 158 ? 31.958 18.350  23.651 1.00 28.13 ? 146 LYS A NZ  1 
ATOM   1179 N N   . GLU A 1 159 ? 29.105 17.486  17.089 1.00 19.88 ? 147 GLU A N   1 
ATOM   1180 C CA  . GLU A 1 159 ? 29.495 17.802  15.737 1.00 20.82 ? 147 GLU A CA  1 
ATOM   1181 C C   . GLU A 1 159 ? 28.272 18.099  14.842 1.00 20.97 ? 147 GLU A C   1 
ATOM   1182 O O   . GLU A 1 159 ? 28.214 19.094  14.129 1.00 15.99 ? 147 GLU A O   1 
ATOM   1183 C CB  . GLU A 1 159 ? 30.248 16.627  15.137 1.00 23.64 ? 147 GLU A CB  1 
ATOM   1184 C CG  . GLU A 1 159 ? 30.666 16.878  13.713 1.00 28.54 ? 147 GLU A CG  1 
ATOM   1185 C CD  . GLU A 1 159 ? 31.155 15.618  13.010 1.00 31.59 ? 147 GLU A CD  1 
ATOM   1186 O OE1 . GLU A 1 159 ? 31.673 14.711  13.698 1.00 35.40 ? 147 GLU A OE1 1 
ATOM   1187 O OE2 . GLU A 1 159 ? 31.039 15.550  11.768 1.00 33.40 ? 147 GLU A OE2 1 
ATOM   1188 N N   . LEU A 1 160 ? 27.289 17.213  14.878 1.00 19.06 ? 148 LEU A N   1 
ATOM   1189 C CA  . LEU A 1 160 ? 26.112 17.376  14.023 1.00 19.19 ? 148 LEU A CA  1 
ATOM   1190 C C   . LEU A 1 160 ? 25.073 18.415  14.438 1.00 19.13 ? 148 LEU A C   1 
ATOM   1191 O O   . LEU A 1 160 ? 24.380 18.980  13.586 1.00 21.53 ? 148 LEU A O   1 
ATOM   1192 C CB  . LEU A 1 160 ? 25.384 16.031  13.926 1.00 19.11 ? 148 LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 160 ? 26.171 14.822  13.413 1.00 19.45 ? 148 LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 160 ? 25.452 13.515  13.758 1.00 17.60 ? 148 LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 160 ? 26.371 14.975  11.889 1.00 20.12 ? 148 LEU A CD2 1 
ATOM   1196 N N   . PHE A 1 161 ? 24.980 18.681  15.732 1.00 15.33 ? 149 PHE A N   1 
ATOM   1197 C CA  . PHE A 1 161 ? 23.881 19.491  16.258 1.00 16.75 ? 149 PHE A CA  1 
ATOM   1198 C C   . PHE A 1 161 ? 24.163 20.654  17.178 1.00 16.62 ? 149 PHE A C   1 
ATOM   1199 O O   . PHE A 1 161 ? 23.261 21.430  17.459 1.00 19.49 ? 149 PHE A O   1 
ATOM   1200 C CB  . PHE A 1 161 ? 22.920 18.555  17.023 1.00 14.79 ? 149 PHE A CB  1 
ATOM   1201 C CG  . PHE A 1 161 ? 22.357 17.441  16.184 1.00 17.35 ? 149 PHE A CG  1 
ATOM   1202 C CD1 . PHE A 1 161 ? 21.490 17.715  15.125 1.00 17.53 ? 149 PHE A CD1 1 
ATOM   1203 C CD2 . PHE A 1 161 ? 22.673 16.121  16.457 1.00 15.99 ? 149 PHE A CD2 1 
ATOM   1204 C CE1 . PHE A 1 161 ? 20.942 16.678  14.357 1.00 16.85 ? 149 PHE A CE1 1 
ATOM   1205 C CE2 . PHE A 1 161 ? 22.130 15.088  15.692 1.00 17.17 ? 149 PHE A CE2 1 
ATOM   1206 C CZ  . PHE A 1 161 ? 21.266 15.367  14.650 1.00 16.49 ? 149 PHE A CZ  1 
ATOM   1207 N N   . GLU A 1 162 ? 25.378 20.772  17.682 1.00 18.24 ? 150 GLU A N   1 
ATOM   1208 C CA  . GLU A 1 162 ? 25.636 21.863  18.605 1.00 19.91 ? 150 GLU A CA  1 
ATOM   1209 C C   . GLU A 1 162 ? 25.382 23.254  18.034 1.00 20.21 ? 150 GLU A C   1 
ATOM   1210 O O   . GLU A 1 162 ? 24.785 24.086  18.698 1.00 20.00 ? 150 GLU A O   1 
ATOM   1211 C CB  . GLU A 1 162 ? 27.065 21.825  19.155 1.00 24.17 ? 150 GLU A CB  1 
ATOM   1212 C CG  . GLU A 1 162 ? 27.203 22.794  20.338 1.00 28.18 ? 150 GLU A CG  1 
ATOM   1213 C CD  . GLU A 1 162 ? 28.548 22.814  20.975 1.00 33.86 ? 150 GLU A CD  1 
ATOM   1214 O OE1 . GLU A 1 162 ? 28.689 23.562  21.962 1.00 39.29 ? 150 GLU A OE1 1 
ATOM   1215 O OE2 . GLU A 1 162 ? 29.474 22.105  20.511 1.00 38.19 ? 150 GLU A OE2 1 
ATOM   1216 N N   . GLN A 1 163 ? 25.829 23.501  16.810 1.00 21.60 ? 151 GLN A N   1 
ATOM   1217 C CA  . GLN A 1 163 ? 25.684 24.821  16.196 1.00 22.09 ? 151 GLN A CA  1 
ATOM   1218 C C   . GLN A 1 163 ? 24.218 25.145  16.037 1.00 21.77 ? 151 GLN A C   1 
ATOM   1219 O O   . GLN A 1 163 ? 23.778 26.230  16.344 1.00 22.94 ? 151 GLN A O   1 
ATOM   1220 C CB  . GLN A 1 163 ? 26.377 24.820  14.834 1.00 23.66 ? 151 GLN A CB  1 
ATOM   1221 C CG  . GLN A 1 163 ? 26.427 26.155  14.134 1.00 26.51 ? 151 GLN A CG  1 
ATOM   1222 C CD  . GLN A 1 163 ? 27.211 26.060  12.833 1.00 26.94 ? 151 GLN A CD  1 
ATOM   1223 O OE1 . GLN A 1 163 ? 28.419 26.317  12.789 1.00 28.08 ? 151 GLN A OE1 1 
ATOM   1224 N NE2 . GLN A 1 163 ? 26.530 25.665  11.776 1.00 25.89 ? 151 GLN A NE2 1 
ATOM   1225 N N   . GLU A 1 164 ? 23.460 24.178  15.566 1.00 20.86 ? 152 GLU A N   1 
ATOM   1226 C CA  . GLU A 1 164 ? 22.040 24.373  15.365 1.00 21.46 ? 152 GLU A CA  1 
ATOM   1227 C C   . GLU A 1 164 ? 21.327 24.644  16.674 1.00 20.50 ? 152 GLU A C   1 
ATOM   1228 O O   . GLU A 1 164 ? 20.483 25.540  16.747 1.00 18.70 ? 152 GLU A O   1 
ATOM   1229 C CB  . GLU A 1 164 ? 21.450 23.136  14.681 1.00 23.43 ? 152 GLU A CB  1 
ATOM   1230 C CG  . GLU A 1 164 ? 19.957 23.041  14.715 1.00 27.20 ? 152 GLU A CG  1 
ATOM   1231 C CD  . GLU A 1 164 ? 19.431 21.934  13.803 1.00 30.62 ? 152 GLU A CD  1 
ATOM   1232 O OE1 . GLU A 1 164 ? 20.113 20.883  13.665 1.00 28.88 ? 152 GLU A OE1 1 
ATOM   1233 O OE2 . GLU A 1 164 ? 18.326 22.116  13.235 1.00 31.32 ? 152 GLU A OE2 1 
ATOM   1234 N N   . PHE A 1 165 ? 21.657 23.880  17.717 1.00 19.11 ? 153 PHE A N   1 
ATOM   1235 C CA  . PHE A 1 165 ? 20.983 24.089  18.996 1.00 18.83 ? 153 PHE A CA  1 
ATOM   1236 C C   . PHE A 1 165 ? 21.456 25.306  19.766 1.00 16.56 ? 153 PHE A C   1 
ATOM   1237 O O   . PHE A 1 165 ? 20.695 25.885  20.495 1.00 15.75 ? 153 PHE A O   1 
ATOM   1238 C CB  . PHE A 1 165 ? 21.025 22.827  19.861 1.00 17.41 ? 153 PHE A CB  1 
ATOM   1239 C CG  . PHE A 1 165 ? 19.924 21.860  19.528 1.00 19.27 ? 153 PHE A CG  1 
ATOM   1240 C CD1 . PHE A 1 165 ? 19.973 21.110  18.355 1.00 15.62 ? 153 PHE A CD1 1 
ATOM   1241 C CD2 . PHE A 1 165 ? 18.799 21.741  20.371 1.00 20.94 ? 153 PHE A CD2 1 
ATOM   1242 C CE1 . PHE A 1 165 ? 18.929 20.250  18.008 1.00 19.74 ? 153 PHE A CE1 1 
ATOM   1243 C CE2 . PHE A 1 165 ? 17.734 20.877  20.037 1.00 21.51 ? 153 PHE A CE2 1 
ATOM   1244 C CZ  . PHE A 1 165 ? 17.795 20.129  18.857 1.00 19.69 ? 153 PHE A CZ  1 
ATOM   1245 N N   . GLU A 1 166 ? 22.712 25.679  19.595 1.00 17.11 ? 154 GLU A N   1 
ATOM   1246 C CA  . GLU A 1 166 ? 23.212 26.885  20.207 1.00 18.63 ? 154 GLU A CA  1 
ATOM   1247 C C   . GLU A 1 166 ? 22.340 28.048  19.689 1.00 17.84 ? 154 GLU A C   1 
ATOM   1248 O O   . GLU A 1 166 ? 21.992 28.956  20.446 1.00 16.71 ? 154 GLU A O   1 
ATOM   1249 C CB  . GLU A 1 166 ? 24.680 27.107  19.820 1.00 21.44 ? 154 GLU A CB  1 
ATOM   1250 C CG  . GLU A 1 166 ? 25.662 26.243  20.632 1.00 25.99 ? 154 GLU A CG  1 
ATOM   1251 C CD  . GLU A 1 166 ? 27.115 26.414  20.202 1.00 29.41 ? 154 GLU A CD  1 
ATOM   1252 O OE1 . GLU A 1 166 ? 27.380 26.598  18.991 1.00 32.56 ? 154 GLU A OE1 1 
ATOM   1253 O OE2 . GLU A 1 166 ? 28.007 26.331  21.069 1.00 32.29 ? 154 GLU A OE2 1 
ATOM   1254 N N   . PHE A 1 167 ? 21.962 27.992  18.408 1.00 17.33 ? 155 PHE A N   1 
ATOM   1255 C CA  . PHE A 1 167 ? 21.131 29.035  17.818 1.00 16.92 ? 155 PHE A CA  1 
ATOM   1256 C C   . PHE A 1 167 ? 19.746 29.066  18.458 1.00 16.58 ? 155 PHE A C   1 
ATOM   1257 O O   . PHE A 1 167 ? 19.261 30.142  18.819 1.00 16.10 ? 155 PHE A O   1 
ATOM   1258 C CB  . PHE A 1 167 ? 20.984 28.859  16.285 1.00 17.58 ? 155 PHE A CB  1 
ATOM   1259 C CG  . PHE A 1 167 ? 20.115 29.931  15.636 1.00 18.57 ? 155 PHE A CG  1 
ATOM   1260 C CD1 . PHE A 1 167 ? 18.785 29.678  15.335 1.00 19.63 ? 155 PHE A CD1 1 
ATOM   1261 C CD2 . PHE A 1 167 ? 20.615 31.217  15.416 1.00 20.46 ? 155 PHE A CD2 1 
ATOM   1262 C CE1 . PHE A 1 167 ? 17.944 30.684  14.825 1.00 19.68 ? 155 PHE A CE1 1 
ATOM   1263 C CE2 . PHE A 1 167 ? 19.795 32.234  14.908 1.00 20.77 ? 155 PHE A CE2 1 
ATOM   1264 C CZ  . PHE A 1 167 ? 18.449 31.962  14.613 1.00 19.55 ? 155 PHE A CZ  1 
ATOM   1265 N N   . TYR A 1 168 ? 19.109 27.900  18.597 1.00 16.96 ? 156 TYR A N   1 
ATOM   1266 C CA  . TYR A 1 168 ? 17.783 27.839  19.203 1.00 18.02 ? 156 TYR A CA  1 
ATOM   1267 C C   . TYR A 1 168 ? 17.854 28.304  20.667 1.00 18.20 ? 156 TYR A C   1 
ATOM   1268 O O   . TYR A 1 168 ? 17.030 29.068  21.139 1.00 17.76 ? 156 TYR A O   1 
ATOM   1269 C CB  . TYR A 1 168 ? 17.219 26.414  19.141 1.00 20.25 ? 156 TYR A CB  1 
ATOM   1270 C CG  . TYR A 1 168 ? 17.123 25.852  17.746 1.00 23.78 ? 156 TYR A CG  1 
ATOM   1271 C CD1 . TYR A 1 168 ? 16.892 26.679  16.657 1.00 24.71 ? 156 TYR A CD1 1 
ATOM   1272 C CD2 . TYR A 1 168 ? 17.283 24.476  17.514 1.00 25.89 ? 156 TYR A CD2 1 
ATOM   1273 C CE1 . TYR A 1 168 ? 16.829 26.159  15.354 1.00 25.72 ? 156 TYR A CE1 1 
ATOM   1274 C CE2 . TYR A 1 168 ? 17.216 23.951  16.236 1.00 26.42 ? 156 TYR A CE2 1 
ATOM   1275 C CZ  . TYR A 1 168 ? 16.996 24.798  15.153 1.00 26.53 ? 156 TYR A CZ  1 
ATOM   1276 O OH  . TYR A 1 168 ? 16.993 24.291  13.866 1.00 27.02 ? 156 TYR A OH  1 
ATOM   1277 N N   . ILE A 1 169 ? 18.853 27.828  21.392 1.00 18.32 ? 157 ILE A N   1 
ATOM   1278 C CA  . ILE A 1 169 ? 18.983 28.239  22.781 1.00 19.22 ? 157 ILE A CA  1 
ATOM   1279 C C   . ILE A 1 169 ? 19.202 29.762  22.909 1.00 20.00 ? 157 ILE A C   1 
ATOM   1280 O O   . ILE A 1 169 ? 18.666 30.389  23.839 1.00 20.84 ? 157 ILE A O   1 
ATOM   1281 C CB  . ILE A 1 169 ? 20.108 27.418  23.459 1.00 18.74 ? 157 ILE A CB  1 
ATOM   1282 C CG1 . ILE A 1 169 ? 19.580 25.982  23.692 1.00 19.81 ? 157 ILE A CG1 1 
ATOM   1283 C CG2 . ILE A 1 169 ? 20.553 28.091  24.763 1.00 18.88 ? 157 ILE A CG2 1 
ATOM   1284 C CD1 . ILE A 1 169 ? 20.659 24.951  24.036 1.00 21.71 ? 157 ILE A CD1 1 
ATOM   1285 N N   . GLU A 1 170 ? 19.954 30.364  21.985 1.00 20.70 ? 158 GLU A N   1 
ATOM   1286 C CA  . GLU A 1 170 ? 20.198 31.814  22.044 1.00 21.99 ? 158 GLU A CA  1 
ATOM   1287 C C   . GLU A 1 170 ? 18.858 32.532  21.860 1.00 22.07 ? 158 GLU A C   1 
ATOM   1288 O O   . GLU A 1 170 ? 18.536 33.456  22.602 1.00 22.07 ? 158 GLU A O   1 
ATOM   1289 C CB  . GLU A 1 170 ? 21.226 32.288  20.960 1.00 25.24 ? 158 GLU A CB  1 
ATOM   1290 C CG  . GLU A 1 170 ? 22.600 31.519  20.988 1.00 34.42 ? 158 GLU A CG  1 
ATOM   1291 C CD  . GLU A 1 170 ? 23.768 32.086  20.109 1.00 38.42 ? 158 GLU A CD  1 
ATOM   1292 O OE1 . GLU A 1 170 ? 24.295 33.177  20.453 1.00 41.46 ? 158 GLU A OE1 1 
ATOM   1293 O OE2 . GLU A 1 170 ? 24.177 31.433  19.096 1.00 39.57 ? 158 GLU A OE2 1 
ATOM   1294 N N   . LYS A 1 171 ? 18.071 32.106  20.869 1.00 20.75 ? 159 LYS A N   1 
ATOM   1295 C CA  . LYS A 1 171 ? 16.762 32.723  20.621 1.00 20.62 ? 159 LYS A CA  1 
ATOM   1296 C C   . LYS A 1 171 ? 15.892 32.655  21.880 1.00 21.63 ? 159 LYS A C   1 
ATOM   1297 O O   . LYS A 1 171 ? 15.312 33.654  22.330 1.00 21.56 ? 159 LYS A O   1 
ATOM   1298 C CB  . LYS A 1 171 ? 16.029 31.999  19.481 1.00 18.14 ? 159 LYS A CB  1 
ATOM   1299 C CG  . LYS A 1 171 ? 16.698 32.054  18.095 1.00 18.34 ? 159 LYS A CG  1 
ATOM   1300 C CD  . LYS A 1 171 ? 16.946 33.508  17.603 1.00 18.70 ? 159 LYS A CD  1 
ATOM   1301 C CE  . LYS A 1 171 ? 18.349 34.009  17.941 1.00 17.52 ? 159 LYS A CE  1 
ATOM   1302 N NZ  . LYS A 1 171 ? 18.611 35.416  17.476 1.00 19.92 ? 159 LYS A NZ  1 
ATOM   1303 N N   . ILE A 1 172 ? 15.783 31.456  22.444 1.00 21.56 ? 160 ILE A N   1 
ATOM   1304 C CA  . ILE A 1 172 ? 14.974 31.275  23.628 1.00 21.53 ? 160 ILE A CA  1 
ATOM   1305 C C   . ILE A 1 172 ? 15.517 32.080  24.824 1.00 22.77 ? 160 ILE A C   1 
ATOM   1306 O O   . ILE A 1 172 ? 14.753 32.743  25.534 1.00 21.02 ? 160 ILE A O   1 
ATOM   1307 C CB  . ILE A 1 172 ? 14.889 29.790  23.994 1.00 21.59 ? 160 ILE A CB  1 
ATOM   1308 C CG1 . ILE A 1 172 ? 14.172 29.027  22.864 1.00 22.44 ? 160 ILE A CG1 1 
ATOM   1309 C CG2 . ILE A 1 172 ? 14.162 29.615  25.321 1.00 21.13 ? 160 ILE A CG2 1 
ATOM   1310 C CD1 . ILE A 1 172 ? 14.385 27.484  22.906 1.00 20.97 ? 160 ILE A CD1 1 
ATOM   1311 N N   . MET A 1 173 ? 16.830 32.057  25.030 1.00 22.72 ? 161 MET A N   1 
ATOM   1312 C CA  . MET A 1 173 ? 17.377 32.772  26.178 1.00 24.83 ? 161 MET A CA  1 
ATOM   1313 C C   . MET A 1 173 ? 17.032 34.261  26.068 1.00 26.28 ? 161 MET A C   1 
ATOM   1314 O O   . MET A 1 173 ? 16.713 34.901  27.073 1.00 25.33 ? 161 MET A O   1 
ATOM   1315 C CB  . MET A 1 173 ? 18.901 32.550  26.272 1.00 21.55 ? 161 MET A CB  1 
ATOM   1316 C CG  . MET A 1 173 ? 19.598 33.294  27.421 1.00 23.47 ? 161 MET A CG  1 
ATOM   1317 S SD  . MET A 1 173 ? 19.055 32.785  29.083 1.00 15.14 ? 161 MET A SD  1 
ATOM   1318 C CE  . MET A 1 173 ? 19.971 31.192  29.230 1.00 20.14 ? 161 MET A CE  1 
ATOM   1319 N N   . LYS A 1 174 ? 17.072 34.793  24.840 1.00 27.15 ? 162 LYS A N   1 
ATOM   1320 C CA  . LYS A 1 174 ? 16.771 36.207  24.578 1.00 29.12 ? 162 LYS A CA  1 
ATOM   1321 C C   . LYS A 1 174 ? 15.284 36.523  24.530 1.00 29.85 ? 162 LYS A C   1 
ATOM   1322 O O   . LYS A 1 174 ? 14.899 37.664  24.227 1.00 28.46 ? 162 LYS A O   1 
ATOM   1323 C CB  . LYS A 1 174 ? 17.388 36.639  23.252 1.00 30.83 ? 162 LYS A CB  1 
ATOM   1324 C CG  . LYS A 1 174 ? 18.906 36.681  23.260 1.00 32.65 ? 162 LYS A CG  1 
ATOM   1325 C CD  . LYS A 1 174 ? 19.387 37.093  21.900 1.00 34.39 ? 162 LYS A CD  1 
ATOM   1326 C CE  . LYS A 1 174 ? 20.909 37.144  21.844 1.00 37.51 ? 162 LYS A CE  1 
ATOM   1327 N NZ  . LYS A 1 174 ? 21.387 37.504  20.476 1.00 37.00 ? 162 LYS A NZ  1 
ATOM   1328 N N   . GLY A 1 175 ? 14.463 35.513  24.821 1.00 28.97 ? 163 GLY A N   1 
ATOM   1329 C CA  . GLY A 1 175 ? 13.023 35.671  24.798 1.00 29.13 ? 163 GLY A CA  1 
ATOM   1330 C C   . GLY A 1 175 ? 12.458 35.960  23.413 1.00 30.00 ? 163 GLY A C   1 
ATOM   1331 O O   . GLY A 1 175 ? 11.394 36.576  23.287 1.00 30.58 ? 163 GLY A O   1 
ATOM   1332 N N   . GLU A 1 176 ? 13.165 35.539  22.373 1.00 29.45 ? 164 GLU A N   1 
ATOM   1333 C CA  . GLU A 1 176 ? 12.704 35.755  20.996 1.00 28.93 ? 164 GLU A CA  1 
ATOM   1334 C C   . GLU A 1 176 ? 11.917 34.517  20.606 1.00 28.79 ? 164 GLU A C   1 
ATOM   1335 O O   . GLU A 1 176 ? 12.379 33.404  20.789 1.00 28.27 ? 164 GLU A O   1 
ATOM   1336 C CB  . GLU A 1 176 ? 13.906 35.943  20.068 1.00 29.30 ? 164 GLU A CB  1 
ATOM   1337 C CG  . GLU A 1 176 ? 14.834 37.039  20.564 1.00 30.61 ? 164 GLU A CG  1 
ATOM   1338 C CD  . GLU A 1 176 ? 16.136 37.160  19.791 1.00 31.59 ? 164 GLU A CD  1 
ATOM   1339 O OE1 . GLU A 1 176 ? 16.639 36.144  19.283 1.00 34.06 ? 164 GLU A OE1 1 
ATOM   1340 O OE2 . GLU A 1 176 ? 16.683 38.277  19.717 1.00 31.17 ? 164 GLU A OE2 1 
ATOM   1341 N N   . MET A 1 177 ? 10.718 34.694  20.086 1.00 29.62 ? 165 MET A N   1 
ATOM   1342 C CA  . MET A 1 177 ? 9.931  33.535  19.719 1.00 29.59 ? 165 MET A CA  1 
ATOM   1343 C C   . MET A 1 177 ? 10.668 32.689  18.686 1.00 29.02 ? 165 MET A C   1 
ATOM   1344 O O   . MET A 1 177 ? 11.283 33.221  17.747 1.00 27.66 ? 165 MET A O   1 
ATOM   1345 C CB  . MET A 1 177 ? 8.566  33.980  19.200 1.00 33.33 ? 165 MET A CB  1 
ATOM   1346 C CG  . MET A 1 177 ? 7.763  34.746  20.231 1.00 36.16 ? 165 MET A CG  1 
ATOM   1347 S SD  . MET A 1 177 ? 6.200  35.258  19.525 1.00 40.83 ? 165 MET A SD  1 
ATOM   1348 C CE  . MET A 1 177 ? 5.297  33.678  19.580 1.00 36.17 ? 165 MET A CE  1 
ATOM   1349 N N   . LEU A 1 178 ? 10.613 31.371  18.875 1.00 26.20 ? 166 LEU A N   1 
ATOM   1350 C CA  . LEU A 1 178 ? 11.286 30.427  17.991 1.00 26.04 ? 166 LEU A CA  1 
ATOM   1351 C C   . LEU A 1 178 ? 10.344 29.573  17.150 1.00 25.97 ? 166 LEU A C   1 
ATOM   1352 O O   . LEU A 1 178 ? 9.491  28.853  17.684 1.00 27.28 ? 166 LEU A O   1 
ATOM   1353 C CB  . LEU A 1 178 ? 12.207 29.505  18.807 1.00 24.96 ? 166 LEU A CB  1 
ATOM   1354 C CG  . LEU A 1 178 ? 12.982 28.401  18.050 1.00 26.09 ? 166 LEU A CG  1 
ATOM   1355 C CD1 . LEU A 1 178 ? 13.987 29.038  17.073 1.00 25.52 ? 166 LEU A CD1 1 
ATOM   1356 C CD2 . LEU A 1 178 ? 13.710 27.480  19.059 1.00 23.88 ? 166 LEU A CD2 1 
ATOM   1357 N N   . PHE A 1 179 ? 10.514 29.646  15.834 1.00 24.30 ? 167 PHE A N   1 
ATOM   1358 C CA  . PHE A 1 179 ? 9.711  28.874  14.877 1.00 22.42 ? 167 PHE A CA  1 
ATOM   1359 C C   . PHE A 1 179 ? 10.437 28.851  13.517 1.00 21.62 ? 167 PHE A C   1 
ATOM   1360 O O   . PHE A 1 179 ? 11.537 29.384  13.410 1.00 19.87 ? 167 PHE A O   1 
ATOM   1361 C CB  . PHE A 1 179 ? 8.297  29.470  14.754 1.00 23.37 ? 167 PHE A CB  1 
ATOM   1362 C CG  . PHE A 1 179 ? 8.271  30.963  14.503 1.00 25.77 ? 167 PHE A CG  1 
ATOM   1363 C CD1 . PHE A 1 179 ? 8.342  31.862  15.565 1.00 26.14 ? 167 PHE A CD1 1 
ATOM   1364 C CD2 . PHE A 1 179 ? 8.212  31.466  13.197 1.00 25.06 ? 167 PHE A CD2 1 
ATOM   1365 C CE1 . PHE A 1 179 ? 8.364  33.249  15.343 1.00 26.22 ? 167 PHE A CE1 1 
ATOM   1366 C CE2 . PHE A 1 179 ? 8.231  32.838  12.958 1.00 25.13 ? 167 PHE A CE2 1 
ATOM   1367 C CZ  . PHE A 1 179 ? 8.311  33.733  14.037 1.00 27.29 ? 167 PHE A CZ  1 
ATOM   1368 N N   . ASP A 1 180 ? 9.853  28.215  12.499 1.00 19.84 ? 168 ASP A N   1 
ATOM   1369 C CA  . ASP A 1 180 ? 10.456 28.148  11.169 1.00 20.36 ? 168 ASP A CA  1 
ATOM   1370 C C   . ASP A 1 180 ? 10.345 29.563  10.565 1.00 19.56 ? 168 ASP A C   1 
ATOM   1371 O O   . ASP A 1 180 ? 9.381  29.866  9.878  1.00 18.55 ? 168 ASP A O   1 
ATOM   1372 C CB  . ASP A 1 180 ? 9.664  27.165  10.279 1.00 20.94 ? 168 ASP A CB  1 
ATOM   1373 C CG  . ASP A 1 180 ? 10.286 26.974  8.903  1.00 22.53 ? 168 ASP A CG  1 
ATOM   1374 O OD1 . ASP A 1 180 ? 11.179 27.775  8.493  1.00 25.89 ? 168 ASP A OD1 1 
ATOM   1375 O OD2 . ASP A 1 180 ? 9.870  26.018  8.212  1.00 23.71 ? 168 ASP A OD2 1 
ATOM   1376 N N   . TYR A 1 181 ? 11.322 30.404  10.847 1.00 17.17 ? 169 TYR A N   1 
ATOM   1377 C CA  . TYR A 1 181 ? 11.315 31.778  10.361 1.00 19.00 ? 169 TYR A CA  1 
ATOM   1378 C C   . TYR A 1 181 ? 11.106 31.934  8.852  1.00 17.39 ? 169 TYR A C   1 
ATOM   1379 O O   . TYR A 1 181 ? 10.260 32.702  8.412  1.00 19.42 ? 169 TYR A O   1 
ATOM   1380 C CB  . TYR A 1 181 ? 12.627 32.458  10.761 1.00 16.28 ? 169 TYR A CB  1 
ATOM   1381 C CG  . TYR A 1 181 ? 12.860 32.449  12.268 1.00 18.22 ? 169 TYR A CG  1 
ATOM   1382 C CD1 . TYR A 1 181 ? 11.902 32.973  13.137 1.00 18.92 ? 169 TYR A CD1 1 
ATOM   1383 C CD2 . TYR A 1 181 ? 14.036 31.930  12.811 1.00 16.25 ? 169 TYR A CD2 1 
ATOM   1384 C CE1 . TYR A 1 181 ? 12.114 32.987  14.533 1.00 18.81 ? 169 TYR A CE1 1 
ATOM   1385 C CE2 . TYR A 1 181 ? 14.263 31.937  14.186 1.00 18.25 ? 169 TYR A CE2 1 
ATOM   1386 C CZ  . TYR A 1 181 ? 13.303 32.471  15.041 1.00 17.79 ? 169 TYR A CZ  1 
ATOM   1387 O OH  . TYR A 1 181 ? 13.555 32.538  16.390 1.00 19.19 ? 169 TYR A OH  1 
ATOM   1388 N N   . LYS A 1 182 ? 11.894 31.225  8.059  1.00 18.58 ? 170 LYS A N   1 
ATOM   1389 C CA  . LYS A 1 182 ? 11.779 31.376  6.616  1.00 20.22 ? 170 LYS A CA  1 
ATOM   1390 C C   . LYS A 1 182 ? 10.400 31.061  6.072  1.00 20.11 ? 170 LYS A C   1 
ATOM   1391 O O   . LYS A 1 182 ? 9.886  31.767  5.210  1.00 15.35 ? 170 LYS A O   1 
ATOM   1392 C CB  . LYS A 1 182 ? 12.848 30.536  5.940  1.00 21.38 ? 170 LYS A CB  1 
ATOM   1393 C CG  . LYS A 1 182 ? 14.228 31.026  6.346  1.00 24.24 ? 170 LYS A CG  1 
ATOM   1394 C CD  . LYS A 1 182 ? 15.351 30.294  5.619  1.00 26.78 ? 170 LYS A CD  1 
ATOM   1395 C CE  . LYS A 1 182 ? 15.357 30.637  4.124  1.00 28.04 ? 170 LYS A CE  1 
ATOM   1396 N NZ  . LYS A 1 182 ? 16.482 29.943  3.442  1.00 25.36 ? 170 LYS A NZ  1 
ATOM   1397 N N   . THR A 1 183 ? 9.773  30.009  6.600  1.00 20.53 ? 171 THR A N   1 
ATOM   1398 C CA  . THR A 1 183 ? 8.448  29.656  6.125  1.00 18.84 ? 171 THR A CA  1 
ATOM   1399 C C   . THR A 1 183 ? 7.403  30.711  6.520  1.00 20.26 ? 171 THR A C   1 
ATOM   1400 O O   . THR A 1 183 ? 6.499  31.035  5.737  1.00 19.15 ? 171 THR A O   1 
ATOM   1401 C CB  . THR A 1 183 ? 8.063  28.262  6.656  1.00 18.47 ? 171 THR A CB  1 
ATOM   1402 O OG1 . THR A 1 183 ? 8.989  27.288  6.125  1.00 20.81 ? 171 THR A OG1 1 
ATOM   1403 C CG2 . THR A 1 183 ? 6.626  27.930  6.259  1.00 17.94 ? 171 THR A CG2 1 
ATOM   1404 N N   . ALA A 1 184 ? 7.511  31.238  7.739  1.00 18.60 ? 172 ALA A N   1 
ATOM   1405 C CA  . ALA A 1 184 ? 6.573  32.250  8.202  1.00 18.19 ? 172 ALA A CA  1 
ATOM   1406 C C   . ALA A 1 184 ? 6.699  33.536  7.370  1.00 20.06 ? 172 ALA A C   1 
ATOM   1407 O O   . ALA A 1 184 ? 5.691  34.156  6.999  1.00 19.48 ? 172 ALA A O   1 
ATOM   1408 C CB  . ALA A 1 184 ? 6.825  32.583  9.687  1.00 19.15 ? 172 ALA A CB  1 
ATOM   1409 N N   . LEU A 1 185 ? 7.937  33.950  7.117  1.00 19.23 ? 173 LEU A N   1 
ATOM   1410 C CA  . LEU A 1 185 ? 8.186  35.179  6.347  1.00 19.94 ? 173 LEU A CA  1 
ATOM   1411 C C   . LEU A 1 185 ? 7.640  35.060  4.921  1.00 21.18 ? 173 LEU A C   1 
ATOM   1412 O O   . LEU A 1 185 ? 7.042  35.999  4.372  1.00 22.27 ? 173 LEU A O   1 
ATOM   1413 C CB  . LEU A 1 185 ? 9.691  35.469  6.254  1.00 18.17 ? 173 LEU A CB  1 
ATOM   1414 C CG  . LEU A 1 185 ? 9.993  36.757  5.452  1.00 19.72 ? 173 LEU A CG  1 
ATOM   1415 C CD1 . LEU A 1 185 ? 9.277  37.960  6.082  1.00 14.99 ? 173 LEU A CD1 1 
ATOM   1416 C CD2 . LEU A 1 185 ? 11.513 36.984  5.388  1.00 18.73 ? 173 LEU A CD2 1 
ATOM   1417 N N   . GLN A 1 186 ? 7.872  33.909  4.312  1.00 22.41 ? 174 GLN A N   1 
ATOM   1418 C CA  . GLN A 1 186 ? 7.400  33.706  2.948  1.00 26.24 ? 174 GLN A CA  1 
ATOM   1419 C C   . GLN A 1 186 ? 5.880  33.847  2.863  1.00 26.75 ? 174 GLN A C   1 
ATOM   1420 O O   . GLN A 1 186 ? 5.343  34.464  1.946  1.00 25.62 ? 174 GLN A O   1 
ATOM   1421 C CB  . GLN A 1 186 ? 7.821  32.331  2.438  1.00 27.62 ? 174 GLN A CB  1 
ATOM   1422 C CG  . GLN A 1 186 ? 7.342  32.083  1.011  1.00 34.45 ? 174 GLN A CG  1 
ATOM   1423 C CD  . GLN A 1 186 ? 8.170  31.059  0.286  1.00 37.31 ? 174 GLN A CD  1 
ATOM   1424 O OE1 . GLN A 1 186 ? 7.947  29.851  0.424  1.00 42.47 ? 174 GLN A OE1 1 
ATOM   1425 N NE2 . GLN A 1 186 ? 9.151  31.528  -0.488 1.00 39.49 ? 174 GLN A NE2 1 
ATOM   1426 N N   . GLU A 1 187 ? 5.194  33.255  3.825  1.00 27.37 ? 175 GLU A N   1 
ATOM   1427 C CA  . GLU A 1 187 ? 3.741  33.300  3.874  1.00 28.91 ? 175 GLU A CA  1 
ATOM   1428 C C   . GLU A 1 187 ? 3.233  34.732  3.969  1.00 28.85 ? 175 GLU A C   1 
ATOM   1429 O O   . GLU A 1 187 ? 2.302  35.140  3.256  1.00 25.84 ? 175 GLU A O   1 
ATOM   1430 C CB  . GLU A 1 187 ? 3.269  32.499  5.092  1.00 32.21 ? 175 GLU A CB  1 
ATOM   1431 C CG  . GLU A 1 187 ? 1.788  32.559  5.391  1.00 36.91 ? 175 GLU A CG  1 
ATOM   1432 C CD  . GLU A 1 187 ? 1.431  31.680  6.582  1.00 40.25 ? 175 GLU A CD  1 
ATOM   1433 O OE1 . GLU A 1 187 ? 1.762  32.073  7.727  1.00 39.96 ? 175 GLU A OE1 1 
ATOM   1434 O OE2 . GLU A 1 187 ? 0.838  30.592  6.365  1.00 41.09 ? 175 GLU A OE2 1 
ATOM   1435 N N   . ILE A 1 188 ? 3.848  35.501  4.855  1.00 26.68 ? 176 ILE A N   1 
ATOM   1436 C CA  . ILE A 1 188 ? 3.422  36.870  5.038  1.00 28.16 ? 176 ILE A CA  1 
ATOM   1437 C C   . ILE A 1 188 ? 3.810  37.776  3.840  1.00 27.98 ? 176 ILE A C   1 
ATOM   1438 O O   . ILE A 1 188 ? 3.060  38.689  3.472  1.00 24.96 ? 176 ILE A O   1 
ATOM   1439 C CB  . ILE A 1 188 ? 3.976  37.405  6.406  1.00 30.90 ? 176 ILE A CB  1 
ATOM   1440 C CG1 . ILE A 1 188 ? 2.893  38.219  7.118  1.00 33.98 ? 176 ILE A CG1 1 
ATOM   1441 C CG2 . ILE A 1 188 ? 5.274  38.170  6.220  1.00 29.55 ? 176 ILE A CG2 1 
ATOM   1442 C CD1 . ILE A 1 188 ? 2.288  39.347  6.294  1.00 37.11 ? 176 ILE A CD1 1 
ATOM   1443 N N   . VAL A 1 189 ? 4.952  37.509  3.208  1.00 25.32 ? 177 VAL A N   1 
ATOM   1444 C CA  . VAL A 1 189 ? 5.363  38.335  2.080  1.00 26.29 ? 177 VAL A CA  1 
ATOM   1445 C C   . VAL A 1 189 ? 4.527  38.032  0.833  1.00 27.19 ? 177 VAL A C   1 
ATOM   1446 O O   . VAL A 1 189 ? 4.158  38.941  0.094  1.00 25.19 ? 177 VAL A O   1 
ATOM   1447 C CB  . VAL A 1 189 ? 6.852  38.161  1.765  1.00 25.16 ? 177 VAL A CB  1 
ATOM   1448 C CG1 . VAL A 1 189 ? 7.206  38.929  0.489  1.00 25.52 ? 177 VAL A CG1 1 
ATOM   1449 C CG2 . VAL A 1 189 ? 7.684  38.671  2.953  1.00 24.22 ? 177 VAL A CG2 1 
ATOM   1450 N N   . GLN A 1 190 ? 4.221  36.761  0.608  1.00 28.04 ? 178 GLN A N   1 
ATOM   1451 C CA  . GLN A 1 190 ? 3.400  36.385  -0.543 1.00 30.08 ? 178 GLN A CA  1 
ATOM   1452 C C   . GLN A 1 190 ? 1.994  36.964  -0.353 1.00 31.30 ? 178 GLN A C   1 
ATOM   1453 O O   . GLN A 1 190 ? 1.394  37.525  -1.274 1.00 30.27 ? 178 GLN A O   1 
ATOM   1454 C CB  . GLN A 1 190 ? 3.327  34.864  -0.674 1.00 30.39 ? 178 GLN A CB  1 
ATOM   1455 C CG  . GLN A 1 190 ? 2.582  34.368  -1.930 1.00 33.66 ? 178 GLN A CG  1 
ATOM   1456 C CD  . GLN A 1 190 ? 3.383  34.559  -3.211 1.00 34.28 ? 178 GLN A CD  1 
ATOM   1457 O OE1 . GLN A 1 190 ? 4.560  34.198  -3.281 1.00 36.43 ? 178 GLN A OE1 1 
ATOM   1458 N NE2 . GLN A 1 190 ? 2.746  35.111  -4.233 1.00 35.45 ? 178 GLN A NE2 1 
ATOM   1459 N N   . SER A 1 191 ? 1.465  36.851  0.860  1.00 33.39 ? 179 SER A N   1 
ATOM   1460 C CA  . SER A 1 191 ? 0.136  37.375  1.126  1.00 35.32 ? 179 SER A CA  1 
ATOM   1461 C C   . SER A 1 191 ? 0.023  38.865  0.858  1.00 35.15 ? 179 SER A C   1 
ATOM   1462 O O   . SER A 1 191 ? -0.961 39.315  0.280  1.00 35.32 ? 179 SER A O   1 
ATOM   1463 C CB  . SER A 1 191 ? -0.268 37.114  2.578  1.00 36.27 ? 179 SER A CB  1 
ATOM   1464 O OG  . SER A 1 191 ? -0.468 35.730  2.783  1.00 41.77 ? 179 SER A OG  1 
ATOM   1465 N N   . GLU A 1 192 ? 1.010  39.641  1.290  1.00 34.87 ? 180 GLU A N   1 
ATOM   1466 C CA  . GLU A 1 192 ? 0.920  41.078  1.095  1.00 36.45 ? 180 GLU A CA  1 
ATOM   1467 C C   . GLU A 1 192 ? 1.479  41.643  -0.194 1.00 34.69 ? 180 GLU A C   1 
ATOM   1468 O O   . GLU A 1 192 ? 1.051  42.705  -0.611 1.00 36.08 ? 180 GLU A O   1 
ATOM   1469 C CB  . GLU A 1 192 ? 1.542  41.820  2.282  1.00 39.21 ? 180 GLU A CB  1 
ATOM   1470 C CG  . GLU A 1 192 ? 3.005  41.552  2.535  1.00 43.22 ? 180 GLU A CG  1 
ATOM   1471 C CD  . GLU A 1 192 ? 3.576  42.424  3.665  1.00 47.31 ? 180 GLU A CD  1 
ATOM   1472 O OE1 . GLU A 1 192 ? 3.170  43.613  3.753  1.00 48.41 ? 180 GLU A OE1 1 
ATOM   1473 O OE2 . GLU A 1 192 ? 4.438  41.929  4.447  1.00 47.43 ? 180 GLU A OE2 1 
ATOM   1474 N N   . HIS A 1 193 ? 2.407  40.936  -0.830 1.00 32.55 ? 181 HIS A N   1 
ATOM   1475 C CA  . HIS A 1 193 ? 3.045  41.423  -2.055 1.00 31.57 ? 181 HIS A CA  1 
ATOM   1476 C C   . HIS A 1 193 ? 2.943  40.526  -3.284 1.00 31.01 ? 181 HIS A C   1 
ATOM   1477 O O   . HIS A 1 193 ? 3.386  40.899  -4.370 1.00 28.80 ? 181 HIS A O   1 
ATOM   1478 C CB  . HIS A 1 193 ? 4.532  41.658  -1.794 1.00 31.61 ? 181 HIS A CB  1 
ATOM   1479 C CG  . HIS A 1 193 ? 4.808  42.713  -0.781 1.00 30.95 ? 181 HIS A CG  1 
ATOM   1480 N ND1 . HIS A 1 193 ? 4.632  44.054  -1.039 1.00 31.96 ? 181 HIS A ND1 1 
ATOM   1481 C CD2 . HIS A 1 193 ? 5.262  42.627  0.490  1.00 31.47 ? 181 HIS A CD2 1 
ATOM   1482 C CE1 . HIS A 1 193 ? 4.971  44.752  0.029  1.00 32.11 ? 181 HIS A CE1 1 
ATOM   1483 N NE2 . HIS A 1 193 ? 5.357  43.910  0.972  1.00 32.16 ? 181 HIS A NE2 1 
ATOM   1484 N N   . LYS A 1 194 ? 2.414  39.327  -3.103 1.00 30.57 ? 182 LYS A N   1 
ATOM   1485 C CA  . LYS A 1 194 ? 2.282  38.391  -4.201 1.00 31.32 ? 182 LYS A CA  1 
ATOM   1486 C C   . LYS A 1 194 ? 3.613  37.972  -4.827 1.00 30.64 ? 182 LYS A C   1 
ATOM   1487 O O   . LYS A 1 194 ? 3.644  37.528  -5.966 1.00 30.08 ? 182 LYS A O   1 
ATOM   1488 C CB  . LYS A 1 194 ? 1.341  38.962  -5.271 1.00 33.96 ? 182 LYS A CB  1 
ATOM   1489 C CG  . LYS A 1 194 ? -0.131 39.025  -4.828 1.00 38.96 ? 182 LYS A CG  1 
ATOM   1490 C CD  . LYS A 1 194 ? -0.368 40.102  -3.766 1.00 41.78 ? 182 LYS A CD  1 
ATOM   1491 C CE  . LYS A 1 194 ? -1.750 39.985  -3.120 1.00 43.42 ? 182 LYS A CE  1 
ATOM   1492 N NZ  . LYS A 1 194 ? -2.009 41.114  -2.171 1.00 42.63 ? 182 LYS A NZ  1 
ATOM   1493 N N   . VAL A 1 195 ? 4.711  38.156  -4.098 1.00 29.62 ? 183 VAL A N   1 
ATOM   1494 C CA  . VAL A 1 195 ? 6.029  37.708  -4.550 1.00 28.49 ? 183 VAL A CA  1 
ATOM   1495 C C   . VAL A 1 195 ? 6.754  37.137  -3.324 1.00 28.01 ? 183 VAL A C   1 
ATOM   1496 O O   . VAL A 1 195 ? 6.424  37.440  -2.184 1.00 27.09 ? 183 VAL A O   1 
ATOM   1497 C CB  . VAL A 1 195 ? 6.928  38.844  -5.160 1.00 29.52 ? 183 VAL A CB  1 
ATOM   1498 C CG1 . VAL A 1 195 ? 6.344  39.338  -6.481 1.00 28.42 ? 183 VAL A CG1 1 
ATOM   1499 C CG2 . VAL A 1 195 ? 7.095  39.968  -4.160 1.00 29.36 ? 183 VAL A CG2 1 
ATOM   1500 N N   . PRO A 1 196 ? 7.747  36.293  -3.549 1.00 27.50 ? 184 PRO A N   1 
ATOM   1501 C CA  . PRO A 1 196 ? 8.462  35.721  -2.407 1.00 27.47 ? 184 PRO A CA  1 
ATOM   1502 C C   . PRO A 1 196 ? 9.653  36.572  -1.959 1.00 27.75 ? 184 PRO A C   1 
ATOM   1503 O O   . PRO A 1 196 ? 10.136 37.430  -2.709 1.00 24.98 ? 184 PRO A O   1 
ATOM   1504 C CB  . PRO A 1 196 ? 8.908  34.374  -2.940 1.00 26.72 ? 184 PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 196 ? 9.282  34.731  -4.387 1.00 29.48 ? 184 PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 196 ? 8.103  35.615  -4.811 1.00 28.60 ? 184 PRO A CD  1 
ATOM   1507 N N   . PRO A 1 197 ? 10.139 36.346  -0.718 1.00 27.31 ? 185 PRO A N   1 
ATOM   1508 C CA  . PRO A 1 197 ? 11.290 37.129  -0.251 1.00 26.56 ? 185 PRO A CA  1 
ATOM   1509 C C   . PRO A 1 197 ? 12.562 36.615  -0.917 1.00 26.51 ? 185 PRO A C   1 
ATOM   1510 O O   . PRO A 1 197 ? 12.649 35.452  -1.284 1.00 26.78 ? 185 PRO A O   1 
ATOM   1511 C CB  . PRO A 1 197 ? 11.282 36.905  1.269  1.00 26.94 ? 185 PRO A CB  1 
ATOM   1512 C CG  . PRO A 1 197 ? 10.647 35.582  1.440  1.00 27.12 ? 185 PRO A CG  1 
ATOM   1513 C CD  . PRO A 1 197 ? 9.549  35.552  0.376  1.00 26.36 ? 185 PRO A CD  1 
ATOM   1514 N N   . GLU A 1 198 ? 13.538 37.489  -1.102 1.00 26.29 ? 186 GLU A N   1 
ATOM   1515 C CA  . GLU A 1 198 ? 14.802 37.094  -1.703 1.00 27.08 ? 186 GLU A CA  1 
ATOM   1516 C C   . GLU A 1 198 ? 15.903 37.213  -0.645 1.00 25.66 ? 186 GLU A C   1 
ATOM   1517 O O   . GLU A 1 198 ? 15.960 38.195  0.096  1.00 24.49 ? 186 GLU A O   1 
ATOM   1518 C CB  . GLU A 1 198 ? 15.125 38.000  -2.901 1.00 31.02 ? 186 GLU A CB  1 
ATOM   1519 C CG  . GLU A 1 198 ? 14.769 39.455  -2.651 1.00 37.12 ? 186 GLU A CG  1 
ATOM   1520 C CD  . GLU A 1 198 ? 14.906 40.352  -3.890 1.00 39.72 ? 186 GLU A CD  1 
ATOM   1521 O OE1 . GLU A 1 198 ? 13.983 41.194  -4.089 1.00 38.07 ? 186 GLU A OE1 1 
ATOM   1522 O OE2 . GLU A 1 198 ? 15.929 40.225  -4.629 1.00 39.06 ? 186 GLU A OE2 1 
ATOM   1523 N N   . TYR A 1 199 ? 16.770 36.214  -0.581 1.00 23.76 ? 187 TYR A N   1 
ATOM   1524 C CA  . TYR A 1 199 ? 17.866 36.229  0.388  1.00 25.34 ? 187 TYR A CA  1 
ATOM   1525 C C   . TYR A 1 199 ? 19.167 36.474  -0.356 1.00 27.07 ? 187 TYR A C   1 
ATOM   1526 O O   . TYR A 1 199 ? 19.460 35.796  -1.348 1.00 28.25 ? 187 TYR A O   1 
ATOM   1527 C CB  . TYR A 1 199 ? 17.925 34.896  1.152  1.00 23.07 ? 187 TYR A CB  1 
ATOM   1528 C CG  . TYR A 1 199 ? 16.721 34.674  2.041  1.00 22.91 ? 187 TYR A CG  1 
ATOM   1529 C CD1 . TYR A 1 199 ? 16.747 35.026  3.392  1.00 22.85 ? 187 TYR A CD1 1 
ATOM   1530 C CD2 . TYR A 1 199 ? 15.523 34.176  1.514  1.00 24.10 ? 187 TYR A CD2 1 
ATOM   1531 C CE1 . TYR A 1 199 ? 15.602 34.896  4.199  1.00 22.10 ? 187 TYR A CE1 1 
ATOM   1532 C CE2 . TYR A 1 199 ? 14.373 34.035  2.311  1.00 23.35 ? 187 TYR A CE2 1 
ATOM   1533 C CZ  . TYR A 1 199 ? 14.429 34.398  3.649  1.00 23.15 ? 187 TYR A CZ  1 
ATOM   1534 O OH  . TYR A 1 199 ? 13.320 34.250  4.436  1.00 23.72 ? 187 TYR A OH  1 
ATOM   1535 N N   . ILE A 1 200 ? 19.923 37.466  0.100  1.00 26.97 ? 188 ILE A N   1 
ATOM   1536 C CA  . ILE A 1 200 ? 21.204 37.811  -0.516 1.00 28.21 ? 188 ILE A CA  1 
ATOM   1537 C C   . ILE A 1 200 ? 22.361 37.809  0.493  1.00 27.78 ? 188 ILE A C   1 
ATOM   1538 O O   . ILE A 1 200 ? 22.333 38.554  1.481  1.00 27.36 ? 188 ILE A O   1 
ATOM   1539 C CB  . ILE A 1 200 ? 21.193 39.230  -1.109 1.00 29.77 ? 188 ILE A CB  1 
ATOM   1540 C CG1 . ILE A 1 200 ? 19.856 39.516  -1.790 1.00 32.86 ? 188 ILE A CG1 1 
ATOM   1541 C CG2 . ILE A 1 200 ? 22.389 39.401  -2.035 1.00 29.46 ? 188 ILE A CG2 1 
ATOM   1542 C CD1 . ILE A 1 200 ? 19.443 38.503  -2.853 1.00 36.09 ? 188 ILE A CD1 1 
ATOM   1543 N N   . LEU A 1 201 ? 23.369 36.978  0.255  1.00 27.38 ? 189 LEU A N   1 
ATOM   1544 C CA  . LEU A 1 201 ? 24.534 36.965  1.121  1.00 28.30 ? 189 LEU A CA  1 
ATOM   1545 C C   . LEU A 1 201 ? 25.276 38.217  0.671  1.00 30.02 ? 189 LEU A C   1 
ATOM   1546 O O   . LEU A 1 201 ? 25.777 38.257  -0.444 1.00 30.71 ? 189 LEU A O   1 
ATOM   1547 C CB  . LEU A 1 201 ? 25.391 35.739  0.842  1.00 29.03 ? 189 LEU A CB  1 
ATOM   1548 C CG  . LEU A 1 201 ? 26.739 35.652  1.546  1.00 29.29 ? 189 LEU A CG  1 
ATOM   1549 C CD1 . LEU A 1 201 ? 26.546 35.665  3.042  1.00 28.78 ? 189 LEU A CD1 1 
ATOM   1550 C CD2 . LEU A 1 201 ? 27.415 34.352  1.147  1.00 28.61 ? 189 LEU A CD2 1 
ATOM   1551 N N   . VAL A 1 202 ? 25.334 39.241  1.510  1.00 28.75 ? 190 VAL A N   1 
ATOM   1552 C CA  . VAL A 1 202 ? 25.997 40.464  1.098  1.00 30.49 ? 190 VAL A CA  1 
ATOM   1553 C C   . VAL A 1 202 ? 27.462 40.553  1.504  1.00 31.86 ? 190 VAL A C   1 
ATOM   1554 O O   . VAL A 1 202 ? 28.219 41.325  0.921  1.00 32.04 ? 190 VAL A O   1 
ATOM   1555 C CB  . VAL A 1 202 ? 25.235 41.710  1.615  1.00 29.85 ? 190 VAL A CB  1 
ATOM   1556 C CG1 . VAL A 1 202 ? 23.822 41.728  1.018  1.00 29.38 ? 190 VAL A CG1 1 
ATOM   1557 C CG2 . VAL A 1 202 ? 25.173 41.703  3.128  1.00 28.19 ? 190 VAL A CG2 1 
ATOM   1558 N N   . ARG A 1 203 ? 27.865 39.769  2.494  1.00 31.33 ? 191 ARG A N   1 
ATOM   1559 C CA  . ARG A 1 203 ? 29.251 39.780  2.921  1.00 32.95 ? 191 ARG A CA  1 
ATOM   1560 C C   . ARG A 1 203 ? 29.484 38.735  3.989  1.00 33.85 ? 191 ARG A C   1 
ATOM   1561 O O   . ARG A 1 203 ? 28.552 38.071  4.433  1.00 32.59 ? 191 ARG A O   1 
ATOM   1562 C CB  . ARG A 1 203 ? 29.626 41.153  3.475  1.00 34.28 ? 191 ARG A CB  1 
ATOM   1563 C CG  . ARG A 1 203 ? 29.422 41.334  4.966  1.00 35.61 ? 191 ARG A CG  1 
ATOM   1564 C CD  . ARG A 1 203 ? 29.816 42.754  5.377  1.00 38.27 ? 191 ARG A CD  1 
ATOM   1565 N NE  . ARG A 1 203 ? 28.653 43.626  5.342  1.00 40.55 ? 191 ARG A NE  1 
ATOM   1566 C CZ  . ARG A 1 203 ? 27.927 43.943  6.408  1.00 39.22 ? 191 ARG A CZ  1 
ATOM   1567 N NH1 . ARG A 1 203 ? 28.250 43.476  7.602  1.00 40.56 ? 191 ARG A NH1 1 
ATOM   1568 N NH2 . ARG A 1 203 ? 26.855 44.695  6.269  1.00 40.72 ? 191 ARG A NH2 1 
ATOM   1569 N N   . THR A 1 204 ? 30.737 38.575  4.383  1.00 34.69 ? 192 THR A N   1 
ATOM   1570 C CA  . THR A 1 204 ? 31.058 37.645  5.447  1.00 36.89 ? 192 THR A CA  1 
ATOM   1571 C C   . THR A 1 204 ? 32.007 38.384  6.375  1.00 37.64 ? 192 THR A C   1 
ATOM   1572 O O   . THR A 1 204 ? 32.655 39.339  5.967  1.00 37.81 ? 192 THR A O   1 
ATOM   1573 C CB  . THR A 1 204 ? 31.702 36.330  4.920  1.00 36.76 ? 192 THR A CB  1 
ATOM   1574 O OG1 . THR A 1 204 ? 32.839 36.626  4.098  1.00 38.06 ? 192 THR A OG1 1 
ATOM   1575 C CG2 . THR A 1 204 ? 30.686 35.525  4.130  1.00 36.49 ? 192 THR A CG2 1 
ATOM   1576 N N   . GLU A 1 205 ? 32.051 37.966  7.630  1.00 39.86 ? 193 GLU A N   1 
ATOM   1577 C CA  . GLU A 1 205 ? 32.906 38.588  8.629  1.00 43.00 ? 193 GLU A CA  1 
ATOM   1578 C C   . GLU A 1 205 ? 33.540 37.460  9.432  1.00 45.49 ? 193 GLU A C   1 
ATOM   1579 O O   . GLU A 1 205 ? 33.152 36.307  9.290  1.00 44.92 ? 193 GLU A O   1 
ATOM   1580 C CB  . GLU A 1 205 ? 32.082 39.494  9.553  1.00 43.25 ? 193 GLU A CB  1 
ATOM   1581 C CG  . GLU A 1 205 ? 31.019 40.318  8.828  1.00 43.98 ? 193 GLU A CG  1 
ATOM   1582 C CD  . GLU A 1 205 ? 30.258 41.248  9.751  1.00 45.39 ? 193 GLU A CD  1 
ATOM   1583 O OE1 . GLU A 1 205 ? 29.957 40.848  10.895 1.00 45.09 ? 193 GLU A OE1 1 
ATOM   1584 O OE2 . GLU A 1 205 ? 29.945 42.381  9.325  1.00 46.84 ? 193 GLU A OE2 1 
ATOM   1585 N N   . LYS A 1 206 ? 34.516 37.794  10.266 1.00 48.99 ? 194 LYS A N   1 
ATOM   1586 C CA  . LYS A 1 206 ? 35.210 36.790  11.066 1.00 53.05 ? 194 LYS A CA  1 
ATOM   1587 C C   . LYS A 1 206 ? 35.332 37.297  12.492 1.00 55.96 ? 194 LYS A C   1 
ATOM   1588 O O   . LYS A 1 206 ? 36.427 37.355  13.046 1.00 57.20 ? 194 LYS A O   1 
ATOM   1589 C CB  . LYS A 1 206 ? 36.604 36.532  10.483 1.00 52.83 ? 194 LYS A CB  1 
ATOM   1590 C CG  . LYS A 1 206 ? 36.879 35.100  10.026 1.00 53.21 ? 194 LYS A CG  1 
ATOM   1591 C CD  . LYS A 1 206 ? 37.287 34.210  11.191 1.00 54.09 ? 194 LYS A CD  1 
ATOM   1592 C CE  . LYS A 1 206 ? 38.112 33.021  10.720 1.00 54.41 ? 194 LYS A CE  1 
ATOM   1593 N NZ  . LYS A 1 206 ? 38.702 32.260  11.860 1.00 54.75 ? 194 LYS A NZ  1 
ATOM   1594 N N   . ASN A 1 207 ? 34.201 37.671  13.083 1.00 58.97 ? 195 ASN A N   1 
ATOM   1595 C CA  . ASN A 1 207 ? 34.203 38.178  14.448 1.00 61.75 ? 195 ASN A CA  1 
ATOM   1596 C C   . ASN A 1 207 ? 33.960 37.079  15.477 1.00 62.91 ? 195 ASN A C   1 
ATOM   1597 O O   . ASN A 1 207 ? 33.274 36.089  15.199 1.00 63.12 ? 195 ASN A O   1 
ATOM   1598 C CB  . ASN A 1 207 ? 33.156 39.280  14.607 1.00 63.29 ? 195 ASN A CB  1 
ATOM   1599 C CG  . ASN A 1 207 ? 33.363 40.422  13.630 1.00 64.85 ? 195 ASN A CG  1 
ATOM   1600 O OD1 . ASN A 1 207 ? 34.488 40.894  13.433 1.00 65.28 ? 195 ASN A OD1 1 
ATOM   1601 N ND2 . ASN A 1 207 ? 32.272 40.881  13.018 1.00 65.46 ? 195 ASN A ND2 1 
ATOM   1602 N N   . ASP A 1 208 ? 34.543 37.266  16.662 1.00 63.82 ? 196 ASP A N   1 
ATOM   1603 C CA  . ASP A 1 208 ? 34.425 36.315  17.768 1.00 64.00 ? 196 ASP A CA  1 
ATOM   1604 C C   . ASP A 1 208 ? 35.259 35.046  17.518 1.00 62.95 ? 196 ASP A C   1 
ATOM   1605 O O   . ASP A 1 208 ? 35.396 34.203  18.412 1.00 63.27 ? 196 ASP A O   1 
ATOM   1606 C CB  . ASP A 1 208 ? 32.954 35.923  17.976 1.00 65.64 ? 196 ASP A CB  1 
ATOM   1607 C CG  . ASP A 1 208 ? 32.036 37.132  18.144 1.00 67.69 ? 196 ASP A CG  1 
ATOM   1608 O OD1 . ASP A 1 208 ? 31.986 37.994  17.236 1.00 68.10 ? 196 ASP A OD1 1 
ATOM   1609 O OD2 . ASP A 1 208 ? 31.353 37.217  19.188 1.00 69.60 ? 196 ASP A OD2 1 
ATOM   1610 N N   . GLY A 1 209 ? 35.811 34.920  16.309 1.00 60.74 ? 197 GLY A N   1 
ATOM   1611 C CA  . GLY A 1 209 ? 36.597 33.749  15.958 1.00 57.38 ? 197 GLY A CA  1 
ATOM   1612 C C   . GLY A 1 209 ? 35.914 32.925  14.877 1.00 56.09 ? 197 GLY A C   1 
ATOM   1613 O O   . GLY A 1 209 ? 36.580 32.288  14.056 1.00 56.07 ? 197 GLY A O   1 
ATOM   1614 N N   . ASP A 1 210 ? 34.580 32.943  14.876 1.00 53.78 ? 198 ASP A N   1 
ATOM   1615 C CA  . ASP A 1 210 ? 33.782 32.205  13.892 1.00 51.38 ? 198 ASP A CA  1 
ATOM   1616 C C   . ASP A 1 210 ? 33.626 33.008  12.608 1.00 48.13 ? 198 ASP A C   1 
ATOM   1617 O O   . ASP A 1 210 ? 33.680 34.236  12.617 1.00 47.73 ? 198 ASP A O   1 
ATOM   1618 C CB  . ASP A 1 210 ? 32.366 31.920  14.424 1.00 53.68 ? 198 ASP A CB  1 
ATOM   1619 C CG  . ASP A 1 210 ? 32.346 30.945  15.582 1.00 54.93 ? 198 ASP A CG  1 
ATOM   1620 O OD1 . ASP A 1 210 ? 32.732 29.770  15.386 1.00 55.99 ? 198 ASP A OD1 1 
ATOM   1621 O OD2 . ASP A 1 210 ? 31.935 31.362  16.686 1.00 56.54 ? 198 ASP A OD2 1 
ATOM   1622 N N   . ARG A 1 211 ? 33.430 32.314  11.498 1.00 44.81 ? 199 ARG A N   1 
ATOM   1623 C CA  . ARG A 1 211 ? 33.217 33.017  10.252 1.00 42.04 ? 199 ARG A CA  1 
ATOM   1624 C C   . ARG A 1 211 ? 31.739 33.422  10.315 1.00 39.32 ? 199 ARG A C   1 
ATOM   1625 O O   . ARG A 1 211 ? 30.898 32.638  10.748 1.00 36.79 ? 199 ARG A O   1 
ATOM   1626 C CB  . ARG A 1 211 ? 33.481 32.109  9.052  1.00 42.83 ? 199 ARG A CB  1 
ATOM   1627 C CG  . ARG A 1 211 ? 33.532 32.900  7.767  1.00 44.90 ? 199 ARG A CG  1 
ATOM   1628 C CD  . ARG A 1 211 ? 33.801 32.063  6.536  1.00 47.00 ? 199 ARG A CD  1 
ATOM   1629 N NE  . ARG A 1 211 ? 33.739 32.915  5.351  1.00 48.44 ? 199 ARG A NE  1 
ATOM   1630 C CZ  . ARG A 1 211 ? 33.647 32.462  4.110  1.00 49.61 ? 199 ARG A CZ  1 
ATOM   1631 N NH1 . ARG A 1 211 ? 33.615 31.155  3.882  1.00 51.40 ? 199 ARG A NH1 1 
ATOM   1632 N NH2 . ARG A 1 211 ? 33.552 33.314  3.098  1.00 50.30 ? 199 ARG A NH2 1 
ATOM   1633 N N   . ILE A 1 212 ? 31.429 34.648  9.905  1.00 36.01 ? 200 ILE A N   1 
ATOM   1634 C CA  . ILE A 1 212 ? 30.056 35.126  9.961  1.00 33.16 ? 200 ILE A CA  1 
ATOM   1635 C C   . ILE A 1 212 ? 29.515 35.577  8.616  1.00 31.75 ? 200 ILE A C   1 
ATOM   1636 O O   . ILE A 1 212 ? 30.141 36.378  7.918  1.00 31.13 ? 200 ILE A O   1 
ATOM   1637 C CB  . ILE A 1 212 ? 29.922 36.290  10.967 1.00 33.22 ? 200 ILE A CB  1 
ATOM   1638 C CG1 . ILE A 1 212 ? 30.367 35.815  12.347 1.00 33.39 ? 200 ILE A CG1 1 
ATOM   1639 C CG2 . ILE A 1 212 ? 28.462 36.799  11.022 1.00 32.66 ? 200 ILE A CG2 1 
ATOM   1640 C CD1 . ILE A 1 212 ? 30.296 36.880  13.374 1.00 37.11 ? 200 ILE A CD1 1 
ATOM   1641 N N   . PHE A 1 213 ? 28.341 35.055  8.277  1.00 29.22 ? 201 PHE A N   1 
ATOM   1642 C CA  . PHE A 1 213 ? 27.644 35.373  7.038  1.00 28.37 ? 201 PHE A CA  1 
ATOM   1643 C C   . PHE A 1 213 ? 26.590 36.454  7.314  1.00 27.14 ? 201 PHE A C   1 
ATOM   1644 O O   . PHE A 1 213 ? 25.872 36.394  8.318  1.00 26.73 ? 201 PHE A O   1 
ATOM   1645 C CB  . PHE A 1 213 ? 26.974 34.111  6.487  1.00 29.06 ? 201 PHE A CB  1 
ATOM   1646 C CG  . PHE A 1 213 ? 27.953 33.029  6.098  1.00 30.95 ? 201 PHE A CG  1 
ATOM   1647 C CD1 . PHE A 1 213 ? 28.318 32.851  4.767  1.00 30.72 ? 201 PHE A CD1 1 
ATOM   1648 C CD2 . PHE A 1 213 ? 28.551 32.222  7.073  1.00 31.65 ? 201 PHE A CD2 1 
ATOM   1649 C CE1 . PHE A 1 213 ? 29.270 31.891  4.400  1.00 33.01 ? 201 PHE A CE1 1 
ATOM   1650 C CE2 . PHE A 1 213 ? 29.507 31.258  6.719  1.00 32.60 ? 201 PHE A CE2 1 
ATOM   1651 C CZ  . PHE A 1 213 ? 29.868 31.093  5.379  1.00 32.83 ? 201 PHE A CZ  1 
ATOM   1652 N N   . VAL A 1 214 ? 26.523 37.450  6.436  1.00 25.63 ? 202 VAL A N   1 
ATOM   1653 C CA  . VAL A 1 214 ? 25.572 38.564  6.577  1.00 22.74 ? 202 VAL A CA  1 
ATOM   1654 C C   . VAL A 1 214 ? 24.608 38.503  5.405  1.00 21.40 ? 202 VAL A C   1 
ATOM   1655 O O   . VAL A 1 214 ? 25.016 38.652  4.241  1.00 21.48 ? 202 VAL A O   1 
ATOM   1656 C CB  . VAL A 1 214 ? 26.297 39.908  6.566  1.00 22.66 ? 202 VAL A CB  1 
ATOM   1657 C CG1 . VAL A 1 214 ? 25.306 41.028  6.837  1.00 21.10 ? 202 VAL A CG1 1 
ATOM   1658 C CG2 . VAL A 1 214 ? 27.420 39.899  7.619  1.00 22.16 ? 202 VAL A CG2 1 
ATOM   1659 N N   . VAL A 1 215 ? 23.336 38.257  5.710  1.00 17.97 ? 203 VAL A N   1 
ATOM   1660 C CA  . VAL A 1 215 ? 22.325 38.119  4.683  1.00 17.67 ? 203 VAL A CA  1 
ATOM   1661 C C   . VAL A 1 215 ? 21.218 39.167  4.844  1.00 19.00 ? 203 VAL A C   1 
ATOM   1662 O O   . VAL A 1 215 ? 20.754 39.447  5.974  1.00 17.70 ? 203 VAL A O   1 
ATOM   1663 C CB  . VAL A 1 215 ? 21.704 36.697  4.739  1.00 17.74 ? 203 VAL A CB  1 
ATOM   1664 C CG1 . VAL A 1 215 ? 20.534 36.578  3.779  1.00 20.34 ? 203 VAL A CG1 1 
ATOM   1665 C CG2 . VAL A 1 215 ? 22.768 35.652  4.402  1.00 18.26 ? 203 VAL A CG2 1 
ATOM   1666 N N   . GLU A 1 216 ? 20.805 39.751  3.716  1.00 18.05 ? 204 GLU A N   1 
ATOM   1667 C CA  . GLU A 1 216 ? 19.729 40.720  3.728  1.00 17.80 ? 204 GLU A CA  1 
ATOM   1668 C C   . GLU A 1 216 ? 18.566 40.011  3.087  1.00 18.59 ? 204 GLU A C   1 
ATOM   1669 O O   . GLU A 1 216 ? 18.734 39.260  2.121  1.00 19.05 ? 204 GLU A O   1 
ATOM   1670 C CB  . GLU A 1 216 ? 20.038 41.969  2.885  1.00 18.51 ? 204 GLU A CB  1 
ATOM   1671 C CG  . GLU A 1 216 ? 21.317 42.706  3.191  1.00 20.03 ? 204 GLU A CG  1 
ATOM   1672 C CD  . GLU A 1 216 ? 21.534 43.928  2.275  1.00 25.50 ? 204 GLU A CD  1 
ATOM   1673 O OE1 . GLU A 1 216 ? 20.968 43.969  1.153  1.00 24.84 ? 204 GLU A OE1 1 
ATOM   1674 O OE2 . GLU A 1 216 ? 22.294 44.844  2.674  1.00 28.47 ? 204 GLU A OE2 1 
ATOM   1675 N N   . VAL A 1 217 ? 17.382 40.223  3.622  1.00 16.60 ? 205 VAL A N   1 
ATOM   1676 C CA  . VAL A 1 217 ? 16.214 39.629  3.016  1.00 18.71 ? 205 VAL A CA  1 
ATOM   1677 C C   . VAL A 1 217 ? 15.537 40.841  2.355  1.00 18.83 ? 205 VAL A C   1 
ATOM   1678 O O   . VAL A 1 217 ? 15.454 41.923  2.947  1.00 17.10 ? 205 VAL A O   1 
ATOM   1679 C CB  . VAL A 1 217 ? 15.328 38.926  4.077  1.00 20.56 ? 205 VAL A CB  1 
ATOM   1680 C CG1 . VAL A 1 217 ? 14.786 39.915  5.043  1.00 23.02 ? 205 VAL A CG1 1 
ATOM   1681 C CG2 . VAL A 1 217 ? 14.225 38.132  3.394  1.00 24.88 ? 205 VAL A CG2 1 
ATOM   1682 N N   . ARG A 1 218 ? 15.132 40.677  1.102  1.00 19.24 ? 206 ARG A N   1 
ATOM   1683 C CA  . ARG A 1 218 ? 14.511 41.768  0.360  1.00 19.71 ? 206 ARG A CA  1 
ATOM   1684 C C   . ARG A 1 218 ? 13.191 41.356  -0.251 1.00 19.85 ? 206 ARG A C   1 
ATOM   1685 O O   . ARG A 1 218 ? 12.929 40.170  -0.463 1.00 18.99 ? 206 ARG A O   1 
ATOM   1686 C CB  . ARG A 1 218 ? 15.452 42.222  -0.765 1.00 20.52 ? 206 ARG A CB  1 
ATOM   1687 C CG  . ARG A 1 218 ? 16.893 42.479  -0.307 1.00 21.68 ? 206 ARG A CG  1 
ATOM   1688 C CD  . ARG A 1 218 ? 17.772 42.858  -1.499 1.00 23.89 ? 206 ARG A CD  1 
ATOM   1689 N NE  . ARG A 1 218 ? 19.169 43.145  -1.132 1.00 25.82 ? 206 ARG A NE  1 
ATOM   1690 C CZ  . ARG A 1 218 ? 20.194 43.099  -1.988 1.00 27.57 ? 206 ARG A CZ  1 
ATOM   1691 N NH1 . ARG A 1 218 ? 19.979 42.770  -3.259 1.00 27.51 ? 206 ARG A NH1 1 
ATOM   1692 N NH2 . ARG A 1 218 ? 21.430 43.394  -1.582 1.00 28.27 ? 206 ARG A NH2 1 
ATOM   1693 N N   . VAL A 1 219 ? 12.359 42.355  -0.530 1.00 19.37 ? 207 VAL A N   1 
ATOM   1694 C CA  . VAL A 1 219 ? 11.068 42.129  -1.165 1.00 22.32 ? 207 VAL A CA  1 
ATOM   1695 C C   . VAL A 1 219 ? 11.019 43.197  -2.258 1.00 23.04 ? 207 VAL A C   1 
ATOM   1696 O O   . VAL A 1 219 ? 11.184 44.387  -1.959 1.00 22.55 ? 207 VAL A O   1 
ATOM   1697 C CB  . VAL A 1 219 ? 9.870  42.370  -0.201 1.00 21.63 ? 207 VAL A CB  1 
ATOM   1698 C CG1 . VAL A 1 219 ? 8.575  41.958  -0.888 1.00 22.33 ? 207 VAL A CG1 1 
ATOM   1699 C CG2 . VAL A 1 219 ? 10.061 41.600  1.087  1.00 20.36 ? 207 VAL A CG2 1 
ATOM   1700 N N   . ASN A 1 220 ? 10.820 42.777  -3.509 1.00 22.96 ? 208 ASN A N   1 
ATOM   1701 C CA  . ASN A 1 220 ? 10.783 43.735  -4.615 1.00 25.09 ? 208 ASN A CA  1 
ATOM   1702 C C   . ASN A 1 220 ? 12.066 44.573  -4.674 1.00 25.11 ? 208 ASN A C   1 
ATOM   1703 O O   . ASN A 1 220 ? 12.016 45.765  -4.957 1.00 25.52 ? 208 ASN A O   1 
ATOM   1704 C CB  . ASN A 1 220 ? 9.594  44.691  -4.474 1.00 24.04 ? 208 ASN A CB  1 
ATOM   1705 C CG  . ASN A 1 220 ? 8.295  44.077  -4.911 1.00 23.68 ? 208 ASN A CG  1 
ATOM   1706 O OD1 . ASN A 1 220 ? 8.239  43.318  -5.887 1.00 24.09 ? 208 ASN A OD1 1 
ATOM   1707 N ND2 . ASN A 1 220 ? 7.226  44.427  -4.213 1.00 22.48 ? 208 ASN A ND2 1 
ATOM   1708 N N   . GLY A 1 221 ? 13.203 43.944  -4.403 1.00 25.92 ? 209 GLY A N   1 
ATOM   1709 C CA  . GLY A 1 221 ? 14.465 44.656  -4.438 1.00 25.17 ? 209 GLY A CA  1 
ATOM   1710 C C   . GLY A 1 221 ? 14.755 45.508  -3.215 1.00 25.22 ? 209 GLY A C   1 
ATOM   1711 O O   . GLY A 1 221 ? 15.876 45.958  -3.039 1.00 25.86 ? 209 GLY A O   1 
ATOM   1712 N N   . LYS A 1 222 ? 13.763 45.751  -2.369 1.00 25.58 ? 210 LYS A N   1 
ATOM   1713 C CA  . LYS A 1 222 ? 14.001 46.563  -1.169 1.00 26.76 ? 210 LYS A CA  1 
ATOM   1714 C C   . LYS A 1 222 ? 14.412 45.699  0.027  1.00 26.02 ? 210 LYS A C   1 
ATOM   1715 O O   . LYS A 1 222 ? 13.726 44.745  0.369  1.00 24.93 ? 210 LYS A O   1 
ATOM   1716 C CB  . LYS A 1 222 ? 12.742 47.351  -0.795 1.00 28.83 ? 210 LYS A CB  1 
ATOM   1717 C CG  . LYS A 1 222 ? 12.184 48.186  -1.945 1.00 32.17 ? 210 LYS A CG  1 
ATOM   1718 C CD  . LYS A 1 222 ? 11.300 49.322  -1.442 1.00 32.57 ? 210 LYS A CD  1 
ATOM   1719 C CE  . LYS A 1 222 ? 10.792 50.157  -2.615 1.00 35.74 ? 210 LYS A CE  1 
ATOM   1720 N NZ  . LYS A 1 222 ? 10.019 49.275  -3.556 1.00 37.99 ? 210 LYS A NZ  1 
ATOM   1721 N N   . THR A 1 223 ? 15.537 46.048  0.643  1.00 25.18 ? 211 THR A N   1 
ATOM   1722 C CA  . THR A 1 223 ? 16.045 45.349  1.809  1.00 24.49 ? 211 THR A CA  1 
ATOM   1723 C C   . THR A 1 223 ? 15.137 45.588  3.019  1.00 24.22 ? 211 THR A C   1 
ATOM   1724 O O   . THR A 1 223 ? 14.965 46.730  3.480  1.00 24.49 ? 211 THR A O   1 
ATOM   1725 C CB  . THR A 1 223 ? 17.441 45.847  2.193  1.00 24.79 ? 211 THR A CB  1 
ATOM   1726 O OG1 . THR A 1 223 ? 18.339 45.594  1.115  1.00 23.75 ? 211 THR A OG1 1 
ATOM   1727 C CG2 . THR A 1 223 ? 17.933 45.130  3.489  1.00 22.83 ? 211 THR A CG2 1 
ATOM   1728 N N   . ILE A 1 224 ? 14.576 44.502  3.532  1.00 19.94 ? 212 ILE A N   1 
ATOM   1729 C CA  . ILE A 1 224 ? 13.701 44.563  4.687  1.00 19.65 ? 212 ILE A CA  1 
ATOM   1730 C C   . ILE A 1 224 ? 14.490 44.438  5.988  1.00 19.45 ? 212 ILE A C   1 
ATOM   1731 O O   . ILE A 1 224 ? 14.226 45.148  6.957  1.00 19.73 ? 212 ILE A O   1 
ATOM   1732 C CB  . ILE A 1 224 ? 12.662 43.419  4.651  1.00 20.68 ? 212 ILE A CB  1 
ATOM   1733 C CG1 . ILE A 1 224 ? 11.854 43.507  3.354  1.00 19.93 ? 212 ILE A CG1 1 
ATOM   1734 C CG2 . ILE A 1 224 ? 11.754 43.521  5.842  1.00 20.93 ? 212 ILE A CG2 1 
ATOM   1735 C CD1 . ILE A 1 224 ? 11.299 44.902  3.138  1.00 19.01 ? 212 ILE A CD1 1 
ATOM   1736 N N   . ALA A 1 225 ? 15.459 43.529  6.003  1.00 18.31 ? 213 ALA A N   1 
ATOM   1737 C CA  . ALA A 1 225 ? 16.250 43.293  7.204  1.00 17.04 ? 213 ALA A CA  1 
ATOM   1738 C C   . ALA A 1 225 ? 17.535 42.569  6.879  1.00 17.39 ? 213 ALA A C   1 
ATOM   1739 O O   . ALA A 1 225 ? 17.655 41.916  5.841  1.00 16.39 ? 213 ALA A O   1 
ATOM   1740 C CB  . ALA A 1 225 ? 15.434 42.460  8.204  1.00 17.60 ? 213 ALA A CB  1 
ATOM   1741 N N   . THR A 1 226 ? 18.482 42.691  7.797  1.00 18.31 ? 214 THR A N   1 
ATOM   1742 C CA  . THR A 1 226 ? 19.767 42.053  7.681  1.00 18.60 ? 214 THR A CA  1 
ATOM   1743 C C   . THR A 1 226 ? 19.942 41.118  8.872  1.00 18.57 ? 214 THR A C   1 
ATOM   1744 O O   . THR A 1 226 ? 19.670 41.497  10.017 1.00 18.84 ? 214 THR A O   1 
ATOM   1745 C CB  . THR A 1 226 ? 20.892 43.088  7.686  1.00 19.26 ? 214 THR A CB  1 
ATOM   1746 O OG1 . THR A 1 226 ? 20.693 44.016  6.600  1.00 21.81 ? 214 THR A OG1 1 
ATOM   1747 C CG2 . THR A 1 226 ? 22.225 42.403  7.511  1.00 21.50 ? 214 THR A CG2 1 
ATOM   1748 N N   . GLY A 1 227 ? 20.390 39.900  8.596  1.00 17.26 ? 215 GLY A N   1 
ATOM   1749 C CA  . GLY A 1 227 ? 20.622 38.938  9.651  1.00 15.73 ? 215 GLY A CA  1 
ATOM   1750 C C   . GLY A 1 227 ? 22.042 38.383  9.555  1.00 19.13 ? 215 GLY A C   1 
ATOM   1751 O O   . GLY A 1 227 ? 22.629 38.322  8.455  1.00 18.46 ? 215 GLY A O   1 
ATOM   1752 N N   . LYS A 1 228 ? 22.602 37.975  10.694 1.00 18.67 ? 216 LYS A N   1 
ATOM   1753 C CA  . LYS A 1 228 ? 23.954 37.421  10.736 1.00 22.06 ? 216 LYS A CA  1 
ATOM   1754 C C   . LYS A 1 228 ? 23.928 36.023  11.383 1.00 23.77 ? 216 LYS A C   1 
ATOM   1755 O O   . LYS A 1 228 ? 23.086 35.761  12.244 1.00 23.03 ? 216 LYS A O   1 
ATOM   1756 C CB  . LYS A 1 228 ? 24.861 38.349  11.549 1.00 22.15 ? 216 LYS A CB  1 
ATOM   1757 C CG  . LYS A 1 228 ? 24.940 39.764  10.966 1.00 26.78 ? 216 LYS A CG  1 
ATOM   1758 C CD  . LYS A 1 228 ? 26.046 40.561  11.646 1.00 31.22 ? 216 LYS A CD  1 
ATOM   1759 C CE  . LYS A 1 228 ? 26.081 42.011  11.191 1.00 32.72 ? 216 LYS A CE  1 
ATOM   1760 N NZ  . LYS A 1 228 ? 27.243 42.704  11.824 1.00 36.15 ? 216 LYS A NZ  1 
ATOM   1761 N N   . GLY A 1 229 ? 24.837 35.145  10.956 1.00 23.07 ? 217 GLY A N   1 
ATOM   1762 C CA  . GLY A 1 229 ? 24.908 33.799  11.506 1.00 23.95 ? 217 GLY A CA  1 
ATOM   1763 C C   . GLY A 1 229 ? 26.247 33.128  11.207 1.00 24.23 ? 217 GLY A C   1 
ATOM   1764 O O   . GLY A 1 229 ? 27.043 33.670  10.449 1.00 24.01 ? 217 GLY A O   1 
ATOM   1765 N N   . ARG A 1 230 ? 26.497 31.955  11.792 1.00 24.45 ? 218 ARG A N   1 
ATOM   1766 C CA  . ARG A 1 230 ? 27.754 31.231  11.568 1.00 26.18 ? 218 ARG A CA  1 
ATOM   1767 C C   . ARG A 1 230 ? 27.778 30.428  10.263 1.00 26.86 ? 218 ARG A C   1 
ATOM   1768 O O   . ARG A 1 230 ? 28.816 29.854  9.900  1.00 26.24 ? 218 ARG A O   1 
ATOM   1769 C CB  . ARG A 1 230 ? 28.052 30.316  12.761 1.00 26.77 ? 218 ARG A CB  1 
ATOM   1770 C CG  . ARG A 1 230 ? 28.471 31.086  14.000 1.00 29.04 ? 218 ARG A CG  1 
ATOM   1771 C CD  . ARG A 1 230 ? 28.199 30.289  15.256 1.00 32.00 ? 218 ARG A CD  1 
ATOM   1772 N NE  . ARG A 1 230 ? 26.796 29.877  15.366 1.00 31.95 ? 218 ARG A NE  1 
ATOM   1773 C CZ  . ARG A 1 230 ? 26.347 29.052  16.319 1.00 33.38 ? 218 ARG A CZ  1 
ATOM   1774 N NH1 . ARG A 1 230 ? 27.210 28.577  17.230 1.00 27.86 ? 218 ARG A NH1 1 
ATOM   1775 N NH2 . ARG A 1 230 ? 25.055 28.684  16.354 1.00 26.34 ? 218 ARG A NH2 1 
ATOM   1776 N N   . THR A 1 231 ? 26.632 30.366  9.581  1.00 25.43 ? 219 THR A N   1 
ATOM   1777 C CA  . THR A 1 231 ? 26.530 29.692  8.292  1.00 26.14 ? 219 THR A CA  1 
ATOM   1778 C C   . THR A 1 231 ? 25.557 30.535  7.461  1.00 27.01 ? 219 THR A C   1 
ATOM   1779 O O   . THR A 1 231 ? 24.872 31.402  8.000  1.00 26.93 ? 219 THR A O   1 
ATOM   1780 C CB  . THR A 1 231 ? 25.960 28.239  8.402  1.00 27.35 ? 219 THR A CB  1 
ATOM   1781 O OG1 . THR A 1 231 ? 24.628 28.285  8.920  1.00 26.77 ? 219 THR A OG1 1 
ATOM   1782 C CG2 . THR A 1 231 ? 26.840 27.354  9.338  1.00 27.08 ? 219 THR A CG2 1 
ATOM   1783 N N   . LYS A 1 232 ? 25.514 30.285  6.157  1.00 27.34 ? 220 LYS A N   1 
ATOM   1784 C CA  . LYS A 1 232 ? 24.636 30.998  5.244  1.00 28.16 ? 220 LYS A CA  1 
ATOM   1785 C C   . LYS A 1 232 ? 23.194 30.714  5.662  1.00 27.13 ? 220 LYS A C   1 
ATOM   1786 O O   . LYS A 1 232 ? 22.363 31.617  5.749  1.00 23.60 ? 220 LYS A O   1 
ATOM   1787 C CB  . LYS A 1 232 ? 24.869 30.497  3.815  1.00 32.02 ? 220 LYS A CB  1 
ATOM   1788 C CG  . LYS A 1 232 ? 24.356 31.423  2.720  1.00 35.05 ? 220 LYS A CG  1 
ATOM   1789 C CD  . LYS A 1 232 ? 24.394 30.703  1.384  1.00 37.89 ? 220 LYS A CD  1 
ATOM   1790 C CE  . LYS A 1 232 ? 23.823 31.563  0.268  1.00 40.94 ? 220 LYS A CE  1 
ATOM   1791 N NZ  . LYS A 1 232 ? 23.824 30.840  -1.048 1.00 41.60 ? 220 LYS A NZ  1 
ATOM   1792 N N   . LYS A 1 233 ? 22.916 29.441  5.930  1.00 25.58 ? 221 LYS A N   1 
ATOM   1793 C CA  . LYS A 1 233 ? 21.591 29.026  6.365  1.00 26.27 ? 221 LYS A CA  1 
ATOM   1794 C C   . LYS A 1 233 ? 21.155 29.766  7.627  1.00 23.72 ? 221 LYS A C   1 
ATOM   1795 O O   . LYS A 1 233 ? 20.066 30.325  7.671  1.00 24.82 ? 221 LYS A O   1 
ATOM   1796 C CB  . LYS A 1 233 ? 21.561 27.510  6.624  1.00 27.37 ? 221 LYS A CB  1 
ATOM   1797 C CG  . LYS A 1 233 ? 21.041 26.687  5.435  1.00 32.12 ? 221 LYS A CG  1 
ATOM   1798 C CD  . LYS A 1 233 ? 20.850 25.218  5.830  1.00 31.94 ? 221 LYS A CD  1 
ATOM   1799 C CE  . LYS A 1 233 ? 20.025 24.440  4.799  1.00 35.93 ? 221 LYS A CE  1 
ATOM   1800 N NZ  . LYS A 1 233 ? 19.962 22.963  5.108  1.00 34.43 ? 221 LYS A NZ  1 
ATOM   1801 N N   . GLU A 1 234 ? 22.008 29.770  8.649  1.00 20.92 ? 222 GLU A N   1 
ATOM   1802 C CA  . GLU A 1 234 ? 21.681 30.440  9.900  1.00 18.67 ? 222 GLU A CA  1 
ATOM   1803 C C   . GLU A 1 234 ? 21.416 31.939  9.695  1.00 17.77 ? 222 GLU A C   1 
ATOM   1804 O O   . GLU A 1 234 ? 20.483 32.480  10.267 1.00 16.90 ? 222 GLU A O   1 
ATOM   1805 C CB  . GLU A 1 234 ? 22.817 30.258  10.893 1.00 18.98 ? 222 GLU A CB  1 
ATOM   1806 C CG  . GLU A 1 234 ? 22.481 30.602  12.327 1.00 21.43 ? 222 GLU A CG  1 
ATOM   1807 C CD  . GLU A 1 234 ? 23.629 30.201  13.262 1.00 25.89 ? 222 GLU A CD  1 
ATOM   1808 O OE1 . GLU A 1 234 ? 24.594 30.994  13.412 1.00 24.24 ? 222 GLU A OE1 1 
ATOM   1809 O OE2 . GLU A 1 234 ? 23.577 29.074  13.816 1.00 24.32 ? 222 GLU A OE2 1 
ATOM   1810 N N   . ALA A 1 235 ? 22.258 32.600  8.905  1.00 16.66 ? 223 ALA A N   1 
ATOM   1811 C CA  . ALA A 1 235 ? 22.098 34.022  8.652  1.00 16.05 ? 223 ALA A CA  1 
ATOM   1812 C C   . ALA A 1 235 ? 20.736 34.258  7.970  1.00 15.02 ? 223 ALA A C   1 
ATOM   1813 O O   . ALA A 1 235 ? 19.996 35.166  8.352  1.00 15.41 ? 223 ALA A O   1 
ATOM   1814 C CB  . ALA A 1 235 ? 23.271 34.535  7.790  1.00 14.75 ? 223 ALA A CB  1 
ATOM   1815 N N   . GLU A 1 236 ? 20.388 33.422  7.003  1.00 16.08 ? 224 GLU A N   1 
ATOM   1816 C CA  . GLU A 1 236 ? 19.095 33.533  6.334  1.00 19.95 ? 224 GLU A CA  1 
ATOM   1817 C C   . GLU A 1 236 ? 17.949 33.415  7.348  1.00 19.93 ? 224 GLU A C   1 
ATOM   1818 O O   . GLU A 1 236 ? 16.995 34.194  7.322  1.00 19.01 ? 224 GLU A O   1 
ATOM   1819 C CB  . GLU A 1 236 ? 18.966 32.446  5.246  1.00 21.90 ? 224 GLU A CB  1 
ATOM   1820 C CG  . GLU A 1 236 ? 19.933 32.666  4.073  1.00 25.00 ? 224 GLU A CG  1 
ATOM   1821 C CD  . GLU A 1 236 ? 19.861 31.558  3.019  1.00 27.12 ? 224 GLU A CD  1 
ATOM   1822 O OE1 . GLU A 1 236 ? 18.918 30.754  3.056  1.00 29.19 ? 224 GLU A OE1 1 
ATOM   1823 O OE2 . GLU A 1 236 ? 20.742 31.496  2.143  1.00 29.23 ? 224 GLU A OE2 1 
ATOM   1824 N N   . LYS A 1 237 ? 18.068 32.459  8.263  1.00 20.20 ? 225 LYS A N   1 
ATOM   1825 C CA  . LYS A 1 237 ? 17.048 32.250  9.299  1.00 20.88 ? 225 LYS A CA  1 
ATOM   1826 C C   . LYS A 1 237 ? 16.929 33.507  10.172 1.00 17.32 ? 225 LYS A C   1 
ATOM   1827 O O   . LYS A 1 237 ? 15.829 33.940  10.509 1.00 13.89 ? 225 LYS A O   1 
ATOM   1828 C CB  . LYS A 1 237 ? 17.436 31.086  10.252 1.00 22.70 ? 225 LYS A CB  1 
ATOM   1829 C CG  . LYS A 1 237 ? 17.280 29.648  9.773  1.00 28.83 ? 225 LYS A CG  1 
ATOM   1830 C CD  . LYS A 1 237 ? 17.561 28.717  10.976 1.00 30.12 ? 225 LYS A CD  1 
ATOM   1831 C CE  . LYS A 1 237 ? 17.560 27.234  10.608 1.00 34.78 ? 225 LYS A CE  1 
ATOM   1832 N NZ  . LYS A 1 237 ? 17.842 26.385  11.823 1.00 36.63 ? 225 LYS A NZ  1 
ATOM   1833 N N   . GLU A 1 238 ? 18.077 34.045  10.582 1.00 17.24 ? 226 GLU A N   1 
ATOM   1834 C CA  . GLU A 1 238 ? 18.110 35.235  11.444 1.00 18.06 ? 226 GLU A CA  1 
ATOM   1835 C C   . GLU A 1 238 ? 17.462 36.400  10.709 1.00 18.30 ? 226 GLU A C   1 
ATOM   1836 O O   . GLU A 1 238 ? 16.661 37.147  11.277 1.00 19.12 ? 226 GLU A O   1 
ATOM   1837 C CB  . GLU A 1 238 ? 19.551 35.637  11.753 1.00 20.67 ? 226 GLU A CB  1 
ATOM   1838 C CG  . GLU A 1 238 ? 20.034 35.451  13.142 1.00 23.65 ? 226 GLU A CG  1 
ATOM   1839 C CD  . GLU A 1 238 ? 19.192 36.155  14.192 1.00 24.50 ? 226 GLU A CD  1 
ATOM   1840 O OE1 . GLU A 1 238 ? 18.198 35.562  14.643 1.00 21.70 ? 226 GLU A OE1 1 
ATOM   1841 O OE2 . GLU A 1 238 ? 19.532 37.291  14.574 1.00 25.15 ? 226 GLU A OE2 1 
ATOM   1842 N N   . ALA A 1 239 ? 17.868 36.581  9.450  1.00 18.38 ? 227 ALA A N   1 
ATOM   1843 C CA  . ALA A 1 239 ? 17.315 37.647  8.600  1.00 17.02 ? 227 ALA A CA  1 
ATOM   1844 C C   . ALA A 1 239 ? 15.781 37.530  8.502  1.00 17.27 ? 227 ALA A C   1 
ATOM   1845 O O   . ALA A 1 239 ? 15.061 38.525  8.581  1.00 14.69 ? 227 ALA A O   1 
ATOM   1846 C CB  . ALA A 1 239 ? 17.912 37.552  7.210  1.00 17.48 ? 227 ALA A CB  1 
ATOM   1847 N N   . ALA A 1 240 ? 15.283 36.301  8.336  1.00 16.66 ? 228 ALA A N   1 
ATOM   1848 C CA  . ALA A 1 240 ? 13.832 36.092  8.233  1.00 17.02 ? 228 ALA A CA  1 
ATOM   1849 C C   . ALA A 1 240 ? 13.171 36.438  9.563  1.00 15.50 ? 228 ALA A C   1 
ATOM   1850 O O   . ALA A 1 240 ? 12.088 37.029  9.594  1.00 14.10 ? 228 ALA A O   1 
ATOM   1851 C CB  . ALA A 1 240 ? 13.520 34.616  7.830  1.00 17.62 ? 228 ALA A CB  1 
ATOM   1852 N N   . ARG A 1 241 ? 13.820 36.069  10.671 1.00 15.62 ? 229 ARG A N   1 
ATOM   1853 C CA  . ARG A 1 241 ? 13.251 36.382  11.991 1.00 14.63 ? 229 ARG A CA  1 
ATOM   1854 C C   . ARG A 1 241 ? 13.058 37.892  12.170 1.00 13.85 ? 229 ARG A C   1 
ATOM   1855 O O   . ARG A 1 241 ? 12.000 38.351  12.553 1.00 12.36 ? 229 ARG A O   1 
ATOM   1856 C CB  . ARG A 1 241 ? 14.162 35.880  13.114 1.00 18.00 ? 229 ARG A CB  1 
ATOM   1857 C CG  . ARG A 1 241 ? 13.581 36.123  14.508 1.00 18.21 ? 229 ARG A CG  1 
ATOM   1858 C CD  . ARG A 1 241 ? 14.574 35.695  15.592 1.00 20.59 ? 229 ARG A CD  1 
ATOM   1859 N NE  . ARG A 1 241 ? 15.763 36.560  15.682 1.00 19.15 ? 229 ARG A NE  1 
ATOM   1860 C CZ  . ARG A 1 241 ? 15.774 37.805  16.173 1.00 20.25 ? 229 ARG A CZ  1 
ATOM   1861 N NH1 . ARG A 1 241 ? 14.660 38.367  16.621 1.00 18.28 ? 229 ARG A NH1 1 
ATOM   1862 N NH2 . ARG A 1 241 ? 16.914 38.487  16.244 1.00 18.77 ? 229 ARG A NH2 1 
ATOM   1863 N N   . ILE A 1 242 ? 14.114 38.645  11.871 1.00 14.47 ? 230 ILE A N   1 
ATOM   1864 C CA  . ILE A 1 242 ? 14.121 40.092  11.999 1.00 13.91 ? 230 ILE A CA  1 
ATOM   1865 C C   . ILE A 1 242 ? 13.091 40.744  11.060 1.00 14.80 ? 230 ILE A C   1 
ATOM   1866 O O   . ILE A 1 242 ? 12.313 41.606  11.480 1.00 14.19 ? 230 ILE A O   1 
ATOM   1867 C CB  . ILE A 1 242 ? 15.551 40.610  11.748 1.00 15.80 ? 230 ILE A CB  1 
ATOM   1868 C CG1 . ILE A 1 242 ? 16.475 39.984  12.819 1.00 17.29 ? 230 ILE A CG1 1 
ATOM   1869 C CG2 . ILE A 1 242 ? 15.581 42.139  11.822 1.00 15.66 ? 230 ILE A CG2 1 
ATOM   1870 C CD1 . ILE A 1 242 ? 17.962 40.275  12.680 1.00 19.12 ? 230 ILE A CD1 1 
ATOM   1871 N N   . ALA A 1 243 ? 13.066 40.310  9.812  1.00 15.54 ? 231 ALA A N   1 
ATOM   1872 C CA  . ALA A 1 243 ? 12.103 40.829  8.866  1.00 17.31 ? 231 ALA A CA  1 
ATOM   1873 C C   . ALA A 1 243 ? 10.680 40.490  9.305  1.00 20.76 ? 231 ALA A C   1 
ATOM   1874 O O   . ALA A 1 243 ? 9.782  41.334  9.239  1.00 19.20 ? 231 ALA A O   1 
ATOM   1875 C CB  . ALA A 1 243 ? 12.383 40.253  7.491  1.00 18.26 ? 231 ALA A CB  1 
ATOM   1876 N N   . TYR A 1 244 ? 10.460 39.263  9.779  1.00 21.05 ? 232 TYR A N   1 
ATOM   1877 C CA  . TYR A 1 244 ? 9.116  38.896  10.205 1.00 23.64 ? 232 TYR A CA  1 
ATOM   1878 C C   . TYR A 1 244 ? 8.634  39.806  11.334 1.00 24.09 ? 232 TYR A C   1 
ATOM   1879 O O   . TYR A 1 244 ? 7.553  40.396  11.239 1.00 23.77 ? 232 TYR A O   1 
ATOM   1880 C CB  . TYR A 1 244 ? 9.084  37.425  10.655 1.00 24.48 ? 232 TYR A CB  1 
ATOM   1881 C CG  . TYR A 1 244 ? 7.702  36.914  10.968 1.00 24.37 ? 232 TYR A CG  1 
ATOM   1882 C CD1 . TYR A 1 244 ? 7.226  36.891  12.278 1.00 25.29 ? 232 TYR A CD1 1 
ATOM   1883 C CD2 . TYR A 1 244 ? 6.883  36.405  9.960  1.00 24.91 ? 232 TYR A CD2 1 
ATOM   1884 C CE1 . TYR A 1 244 ? 5.973  36.356  12.576 1.00 26.20 ? 232 TYR A CE1 1 
ATOM   1885 C CE2 . TYR A 1 244 ? 5.619  35.883  10.255 1.00 25.87 ? 232 TYR A CE2 1 
ATOM   1886 C CZ  . TYR A 1 244 ? 5.181  35.856  11.558 1.00 26.08 ? 232 TYR A CZ  1 
ATOM   1887 O OH  . TYR A 1 244 ? 3.954  35.301  11.862 1.00 30.36 ? 232 TYR A OH  1 
ATOM   1888 N N   . GLU A 1 245 ? 9.450  39.930  12.383 1.00 24.01 ? 233 GLU A N   1 
ATOM   1889 C CA  . GLU A 1 245 ? 9.123  40.762  13.540 1.00 26.65 ? 233 GLU A CA  1 
ATOM   1890 C C   . GLU A 1 245 ? 8.899  42.220  13.148 1.00 28.89 ? 233 GLU A C   1 
ATOM   1891 O O   . GLU A 1 245 ? 8.036  42.893  13.714 1.00 27.78 ? 233 GLU A O   1 
ATOM   1892 C CB  . GLU A 1 245 ? 10.241 40.687  14.603 1.00 27.87 ? 233 GLU A CB  1 
ATOM   1893 C CG  . GLU A 1 245 ? 10.368 39.307  15.317 1.00 34.06 ? 233 GLU A CG  1 
ATOM   1894 C CD  . GLU A 1 245 ? 11.505 39.247  16.359 1.00 37.75 ? 233 GLU A CD  1 
ATOM   1895 O OE1 . GLU A 1 245 ? 11.986 40.332  16.784 1.00 38.63 ? 233 GLU A OE1 1 
ATOM   1896 O OE2 . GLU A 1 245 ? 11.912 38.115  16.761 1.00 38.50 ? 233 GLU A OE2 1 
ATOM   1897 N N   . LYS A 1 246 ? 9.695  42.703  12.194 1.00 29.77 ? 234 LYS A N   1 
ATOM   1898 C CA  . LYS A 1 246 ? 9.590  44.076  11.712 1.00 31.63 ? 234 LYS A CA  1 
ATOM   1899 C C   . LYS A 1 246 ? 8.316  44.282  10.922 1.00 34.08 ? 234 LYS A C   1 
ATOM   1900 O O   . LYS A 1 246 ? 7.578  45.230  11.176 1.00 34.54 ? 234 LYS A O   1 
ATOM   1901 C CB  . LYS A 1 246 ? 10.777 44.435  10.809 1.00 29.72 ? 234 LYS A CB  1 
ATOM   1902 C CG  . LYS A 1 246 ? 10.618 45.766  10.047 1.00 30.13 ? 234 LYS A CG  1 
ATOM   1903 C CD  . LYS A 1 246 ? 11.923 46.154  9.372  1.00 29.13 ? 234 LYS A CD  1 
ATOM   1904 C CE  . LYS A 1 246 ? 11.731 47.203  8.287  1.00 30.65 ? 234 LYS A CE  1 
ATOM   1905 N NZ  . LYS A 1 246 ? 13.040 47.575  7.627  1.00 31.11 ? 234 LYS A NZ  1 
ATOM   1906 N N   . LEU A 1 247 ? 8.073  43.409  9.947  1.00 36.97 ? 235 LEU A N   1 
ATOM   1907 C CA  . LEU A 1 247 ? 6.879  43.532  9.115  1.00 40.18 ? 235 LEU A CA  1 
ATOM   1908 C C   . LEU A 1 247 ? 5.607  43.471  9.945  1.00 42.34 ? 235 LEU A C   1 
ATOM   1909 O O   . LEU A 1 247 ? 4.603  44.073  9.585  1.00 44.12 ? 235 LEU A O   1 
ATOM   1910 C CB  . LEU A 1 247 ? 6.871  42.460  8.020  1.00 37.86 ? 235 LEU A CB  1 
ATOM   1911 C CG  . LEU A 1 247 ? 7.996  42.626  7.001  1.00 36.81 ? 235 LEU A CG  1 
ATOM   1912 C CD1 . LEU A 1 247 ? 7.946  41.481  6.013  1.00 36.08 ? 235 LEU A CD1 1 
ATOM   1913 C CD2 . LEU A 1 247 ? 7.863  43.973  6.274  1.00 36.27 ? 235 LEU A CD2 1 
ATOM   1914 N N   . LEU A 1 248 ? 5.649  42.766  11.068 1.00 45.52 ? 236 LEU A N   1 
ATOM   1915 C CA  . LEU A 1 248 ? 4.481  42.687  11.931 1.00 47.94 ? 236 LEU A CA  1 
ATOM   1916 C C   . LEU A 1 248 ? 4.481  43.819  12.971 1.00 50.03 ? 236 LEU A C   1 
ATOM   1917 O O   . LEU A 1 248 ? 5.061  44.896  12.695 1.00 49.29 ? 236 LEU A O   1 
ATOM   1918 C CB  . LEU A 1 248 ? 4.430  41.329  12.644 1.00 47.86 ? 236 LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 248 ? 4.425  40.060  11.782 1.00 48.29 ? 236 LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 248 ? 4.019  38.887  12.658 1.00 48.47 ? 236 LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 248 ? 3.465  40.198  10.602 1.00 47.85 ? 236 LEU A CD2 1 
ATOM   1922 N N   . HIS B 1 11  ? 38.537 33.493  41.635 1.00 39.98 ? -1  HIS B N   1 
ATOM   1923 C CA  . HIS B 1 11  ? 38.475 33.029  43.063 1.00 39.77 ? -1  HIS B CA  1 
ATOM   1924 C C   . HIS B 1 11  ? 39.749 32.399  43.632 1.00 39.13 ? -1  HIS B C   1 
ATOM   1925 O O   . HIS B 1 11  ? 40.149 31.311  43.239 1.00 38.79 ? -1  HIS B O   1 
ATOM   1926 C CB  . HIS B 1 11  ? 37.372 32.003  43.267 1.00 40.51 ? -1  HIS B CB  1 
ATOM   1927 C CG  . HIS B 1 11  ? 37.371 31.423  44.646 1.00 40.27 ? -1  HIS B CG  1 
ATOM   1928 N ND1 . HIS B 1 11  ? 37.136 30.089  44.898 1.00 42.08 ? -1  HIS B ND1 1 
ATOM   1929 C CD2 . HIS B 1 11  ? 37.618 31.997  45.849 1.00 40.09 ? -1  HIS B CD2 1 
ATOM   1930 C CE1 . HIS B 1 11  ? 37.244 29.866  46.198 1.00 41.93 ? -1  HIS B CE1 1 
ATOM   1931 N NE2 . HIS B 1 11  ? 37.535 31.007  46.795 1.00 40.77 ? -1  HIS B NE2 1 
ATOM   1932 N N   . HIS B 1 12  ? 40.353 33.069  44.599 1.00 38.76 ? 0   HIS B N   1 
ATOM   1933 C CA  . HIS B 1 12  ? 41.561 32.570  45.244 1.00 38.65 ? 0   HIS B CA  1 
ATOM   1934 C C   . HIS B 1 12  ? 41.109 31.753  46.458 1.00 36.89 ? 0   HIS B C   1 
ATOM   1935 O O   . HIS B 1 12  ? 40.332 32.238  47.276 1.00 35.32 ? 0   HIS B O   1 
ATOM   1936 C CB  . HIS B 1 12  ? 42.431 33.762  45.671 1.00 40.26 ? 0   HIS B CB  1 
ATOM   1937 C CG  . HIS B 1 12  ? 43.511 33.425  46.654 1.00 42.08 ? 0   HIS B CG  1 
ATOM   1938 N ND1 . HIS B 1 12  ? 43.256 33.167  47.985 1.00 42.33 ? 0   HIS B ND1 1 
ATOM   1939 C CD2 . HIS B 1 12  ? 44.858 33.371  46.512 1.00 43.14 ? 0   HIS B CD2 1 
ATOM   1940 C CE1 . HIS B 1 12  ? 44.398 32.976  48.623 1.00 43.84 ? 0   HIS B CE1 1 
ATOM   1941 N NE2 . HIS B 1 12  ? 45.387 33.095  47.753 1.00 44.47 ? 0   HIS B NE2 1 
ATOM   1942 N N   . MET B 1 13  ? 41.561 30.507  46.560 1.00 34.52 ? 1   MET B N   1 
ATOM   1943 C CA  . MET B 1 13  ? 41.182 29.693  47.710 1.00 33.59 ? 1   MET B CA  1 
ATOM   1944 C C   . MET B 1 13  ? 41.999 30.075  48.927 1.00 30.41 ? 1   MET B C   1 
ATOM   1945 O O   . MET B 1 13  ? 43.216 30.109  48.866 1.00 29.93 ? 1   MET B O   1 
ATOM   1946 C CB  . MET B 1 13  ? 41.391 28.226  47.410 1.00 36.58 ? 1   MET B CB  1 
ATOM   1947 C CG  . MET B 1 13  ? 40.291 27.633  46.614 1.00 40.61 ? 1   MET B CG  1 
ATOM   1948 S SD  . MET B 1 13  ? 40.818 25.994  46.329 1.00 51.33 ? 1   MET B SD  1 
ATOM   1949 C CE  . MET B 1 13  ? 41.161 26.071  44.527 1.00 50.50 ? 1   MET B CE  1 
ATOM   1950 N N   . ASN B 1 14  ? 41.336 30.394  50.027 1.00 28.84 ? 2   ASN B N   1 
ATOM   1951 C CA  . ASN B 1 14  ? 42.066 30.748  51.229 1.00 27.72 ? 2   ASN B CA  1 
ATOM   1952 C C   . ASN B 1 14  ? 42.551 29.458  51.901 1.00 27.22 ? 2   ASN B C   1 
ATOM   1953 O O   . ASN B 1 14  ? 42.239 28.358  51.440 1.00 24.00 ? 2   ASN B O   1 
ATOM   1954 C CB  . ASN B 1 14  ? 41.194 31.562  52.171 1.00 26.03 ? 2   ASN B CB  1 
ATOM   1955 C CG  . ASN B 1 14  ? 39.971 30.815  52.624 1.00 28.91 ? 2   ASN B CG  1 
ATOM   1956 O OD1 . ASN B 1 14  ? 39.974 29.587  52.724 1.00 26.41 ? 2   ASN B OD1 1 
ATOM   1957 N ND2 . ASN B 1 14  ? 38.910 31.564  52.937 1.00 28.52 ? 2   ASN B ND2 1 
ATOM   1958 N N   . GLU B 1 15  ? 43.299 29.594  52.994 1.00 26.35 ? 3   GLU B N   1 
ATOM   1959 C CA  . GLU B 1 15  ? 43.874 28.435  53.663 1.00 27.01 ? 3   GLU B CA  1 
ATOM   1960 C C   . GLU B 1 15  ? 42.925 27.318  54.045 1.00 25.04 ? 3   GLU B C   1 
ATOM   1961 O O   . GLU B 1 15  ? 43.235 26.156  53.834 1.00 25.82 ? 3   GLU B O   1 
ATOM   1962 C CB  . GLU B 1 15  ? 44.674 28.861  54.912 1.00 29.13 ? 3   GLU B CB  1 
ATOM   1963 C CG  . GLU B 1 15  ? 45.933 29.655  54.573 1.00 36.50 ? 3   GLU B CG  1 
ATOM   1964 C CD  . GLU B 1 15  ? 46.794 29.947  55.805 1.00 40.34 ? 3   GLU B CD  1 
ATOM   1965 O OE1 . GLU B 1 15  ? 46.219 30.312  56.865 1.00 42.55 ? 3   GLU B OE1 1 
ATOM   1966 O OE2 . GLU B 1 15  ? 48.037 29.826  55.711 1.00 41.62 ? 3   GLU B OE2 1 
ATOM   1967 N N   . SER B 1 16  ? 41.784 27.656  54.626 1.00 24.66 ? 4   SER B N   1 
ATOM   1968 C CA  . SER B 1 16  ? 40.854 26.622  55.014 1.00 26.43 ? 4   SER B CA  1 
ATOM   1969 C C   . SER B 1 16  ? 40.180 25.958  53.800 1.00 25.72 ? 4   SER B C   1 
ATOM   1970 O O   . SER B 1 16  ? 39.861 24.771  53.832 1.00 26.74 ? 4   SER B O   1 
ATOM   1971 C CB  . SER B 1 16  ? 39.813 27.204  55.980 1.00 27.21 ? 4   SER B CB  1 
ATOM   1972 O OG  . SER B 1 16  ? 39.048 28.219  55.349 1.00 32.34 ? 4   SER B OG  1 
ATOM   1973 N N   . GLU B 1 17  ? 39.973 26.709  52.729 1.00 25.49 ? 5   GLU B N   1 
ATOM   1974 C CA  . GLU B 1 17  ? 39.337 26.129  51.539 1.00 24.19 ? 5   GLU B CA  1 
ATOM   1975 C C   . GLU B 1 17  ? 40.348 25.222  50.850 1.00 24.93 ? 5   GLU B C   1 
ATOM   1976 O O   . GLU B 1 17  ? 40.017 24.145  50.360 1.00 23.82 ? 5   GLU B O   1 
ATOM   1977 C CB  . GLU B 1 17  ? 38.861 27.243  50.600 1.00 23.05 ? 5   GLU B CB  1 
ATOM   1978 C CG  . GLU B 1 17  ? 37.766 28.098  51.232 1.00 20.20 ? 5   GLU B CG  1 
ATOM   1979 C CD  . GLU B 1 17  ? 37.485 29.403  50.478 1.00 23.18 ? 5   GLU B CD  1 
ATOM   1980 O OE1 . GLU B 1 17  ? 38.352 29.842  49.686 1.00 23.25 ? 5   GLU B OE1 1 
ATOM   1981 O OE2 . GLU B 1 17  ? 36.404 30.011  50.711 1.00 22.52 ? 5   GLU B OE2 1 
ATOM   1982 N N   . ARG B 1 18  ? 41.598 25.663  50.853 1.00 26.17 ? 6   ARG B N   1 
ATOM   1983 C CA  . ARG B 1 18  ? 42.684 24.922  50.252 1.00 26.09 ? 6   ARG B CA  1 
ATOM   1984 C C   . ARG B 1 18  ? 42.859 23.568  50.951 1.00 25.04 ? 6   ARG B C   1 
ATOM   1985 O O   . ARG B 1 18  ? 43.024 22.535  50.298 1.00 23.46 ? 6   ARG B O   1 
ATOM   1986 C CB  . ARG B 1 18  ? 43.967 25.730  50.383 1.00 29.00 ? 6   ARG B CB  1 
ATOM   1987 C CG  . ARG B 1 18  ? 45.056 25.283  49.460 1.00 35.18 ? 6   ARG B CG  1 
ATOM   1988 C CD  . ARG B 1 18  ? 44.919 26.013  48.141 1.00 41.13 ? 6   ARG B CD  1 
ATOM   1989 N NE  . ARG B 1 18  ? 45.686 25.357  47.097 1.00 45.40 ? 6   ARG B NE  1 
ATOM   1990 C CZ  . ARG B 1 18  ? 45.521 25.575  45.798 1.00 47.66 ? 6   ARG B CZ  1 
ATOM   1991 N NH1 . ARG B 1 18  ? 44.608 26.444  45.381 1.00 46.89 ? 6   ARG B NH1 1 
ATOM   1992 N NH2 . ARG B 1 18  ? 46.265 24.905  44.916 1.00 49.62 ? 6   ARG B NH2 1 
ATOM   1993 N N   . LYS B 1 19  ? 42.829 23.566  52.280 1.00 24.49 ? 7   LYS B N   1 
ATOM   1994 C CA  . LYS B 1 19  ? 42.993 22.311  53.010 1.00 24.98 ? 7   LYS B CA  1 
ATOM   1995 C C   . LYS B 1 19  ? 41.877 21.315  52.749 1.00 22.45 ? 7   LYS B C   1 
ATOM   1996 O O   . LYS B 1 19  ? 42.129 20.119  52.674 1.00 20.35 ? 7   LYS B O   1 
ATOM   1997 C CB  . LYS B 1 19  ? 43.092 22.551  54.520 1.00 27.99 ? 7   LYS B CB  1 
ATOM   1998 C CG  . LYS B 1 19  ? 44.456 23.071  54.985 1.00 34.03 ? 7   LYS B CG  1 
ATOM   1999 C CD  . LYS B 1 19  ? 44.512 23.227  56.526 1.00 37.32 ? 7   LYS B CD  1 
ATOM   2000 C CE  . LYS B 1 19  ? 45.891 23.692  57.001 1.00 39.77 ? 7   LYS B CE  1 
ATOM   2001 N NZ  . LYS B 1 19  ? 45.897 23.992  58.464 1.00 41.54 ? 7   LYS B NZ  1 
ATOM   2002 N N   . ILE B 1 20  ? 40.641 21.804  52.646 1.00 22.35 ? 8   ILE B N   1 
ATOM   2003 C CA  . ILE B 1 20  ? 39.492 20.926  52.391 1.00 21.58 ? 8   ILE B CA  1 
ATOM   2004 C C   . ILE B 1 20  ? 39.649 20.276  51.000 1.00 20.58 ? 8   ILE B C   1 
ATOM   2005 O O   . ILE B 1 20  ? 39.481 19.064  50.834 1.00 19.49 ? 8   ILE B O   1 
ATOM   2006 C CB  . ILE B 1 20  ? 38.168 21.731  52.418 1.00 22.67 ? 8   ILE B CB  1 
ATOM   2007 C CG1 . ILE B 1 20  ? 37.921 22.281  53.829 1.00 26.97 ? 8   ILE B CG1 1 
ATOM   2008 C CG2 . ILE B 1 20  ? 37.006 20.847  51.969 1.00 21.66 ? 8   ILE B CG2 1 
ATOM   2009 C CD1 . ILE B 1 20  ? 37.641 21.206  54.855 1.00 28.90 ? 8   ILE B CD1 1 
ATOM   2010 N N   . VAL B 1 21  ? 39.996 21.103  50.020 1.00 18.44 ? 9   VAL B N   1 
ATOM   2011 C CA  . VAL B 1 21  ? 40.163 20.653  48.645 1.00 20.08 ? 9   VAL B CA  1 
ATOM   2012 C C   . VAL B 1 21  ? 41.281 19.623  48.537 1.00 21.50 ? 9   VAL B C   1 
ATOM   2013 O O   . VAL B 1 21  ? 41.109 18.590  47.876 1.00 19.22 ? 9   VAL B O   1 
ATOM   2014 C CB  . VAL B 1 21  ? 40.396 21.885  47.711 1.00 20.87 ? 9   VAL B CB  1 
ATOM   2015 C CG1 . VAL B 1 21  ? 40.854 21.471  46.314 1.00 21.35 ? 9   VAL B CG1 1 
ATOM   2016 C CG2 . VAL B 1 21  ? 39.084 22.654  47.597 1.00 20.30 ? 9   VAL B CG2 1 
ATOM   2017 N N   . GLU B 1 22  ? 42.402 19.874  49.219 1.00 23.57 ? 10  GLU B N   1 
ATOM   2018 C CA  . GLU B 1 22  ? 43.515 18.937  49.187 1.00 24.18 ? 10  GLU B CA  1 
ATOM   2019 C C   . GLU B 1 22  ? 43.071 17.624  49.824 1.00 22.80 ? 10  GLU B C   1 
ATOM   2020 O O   . GLU B 1 22  ? 43.323 16.542  49.280 1.00 22.29 ? 10  GLU B O   1 
ATOM   2021 C CB  . GLU B 1 22  ? 44.719 19.490  49.958 1.00 28.11 ? 10  GLU B CB  1 
ATOM   2022 C CG  . GLU B 1 22  ? 45.294 20.805  49.429 1.00 34.71 ? 10  GLU B CG  1 
ATOM   2023 C CD  . GLU B 1 22  ? 46.580 21.227  50.168 1.00 38.40 ? 10  GLU B CD  1 
ATOM   2024 O OE1 . GLU B 1 22  ? 46.554 21.375  51.415 1.00 39.79 ? 10  GLU B OE1 1 
ATOM   2025 O OE2 . GLU B 1 22  ? 47.626 21.406  49.503 1.00 41.18 ? 10  GLU B OE2 1 
ATOM   2026 N N   . GLU B 1 23  ? 42.415 17.716  50.977 1.00 21.79 ? 11  GLU B N   1 
ATOM   2027 C CA  . GLU B 1 23  ? 41.945 16.514  51.674 1.00 21.78 ? 11  GLU B CA  1 
ATOM   2028 C C   . GLU B 1 23  ? 40.964 15.720  50.823 1.00 19.64 ? 11  GLU B C   1 
ATOM   2029 O O   . GLU B 1 23  ? 41.042 14.501  50.756 1.00 18.10 ? 11  GLU B O   1 
ATOM   2030 C CB  . GLU B 1 23  ? 41.255 16.884  52.987 1.00 24.38 ? 11  GLU B CB  1 
ATOM   2031 C CG  . GLU B 1 23  ? 42.143 17.692  53.930 1.00 31.38 ? 11  GLU B CG  1 
ATOM   2032 C CD  . GLU B 1 23  ? 41.486 18.047  55.250 1.00 34.60 ? 11  GLU B CD  1 
ATOM   2033 O OE1 . GLU B 1 23  ? 40.300 18.465  55.258 1.00 37.64 ? 11  GLU B OE1 1 
ATOM   2034 O OE2 . GLU B 1 23  ? 42.176 17.923  56.288 1.00 38.00 ? 11  GLU B OE2 1 
ATOM   2035 N N   . PHE B 1 24  ? 40.021 16.407  50.184 1.00 18.27 ? 12  PHE B N   1 
ATOM   2036 C CA  . PHE B 1 24  ? 39.044 15.679  49.371 1.00 18.38 ? 12  PHE B CA  1 
ATOM   2037 C C   . PHE B 1 24  ? 39.745 14.804  48.334 1.00 17.47 ? 12  PHE B C   1 
ATOM   2038 O O   . PHE B 1 24  ? 39.438 13.603  48.193 1.00 16.80 ? 12  PHE B O   1 
ATOM   2039 C CB  . PHE B 1 24  ? 38.075 16.646  48.673 1.00 18.07 ? 12  PHE B CB  1 
ATOM   2040 C CG  . PHE B 1 24  ? 37.197 15.980  47.646 1.00 17.26 ? 12  PHE B CG  1 
ATOM   2041 C CD1 . PHE B 1 24  ? 37.717 15.608  46.400 1.00 17.46 ? 12  PHE B CD1 1 
ATOM   2042 C CD2 . PHE B 1 24  ? 35.874 15.699  47.935 1.00 16.79 ? 12  PHE B CD2 1 
ATOM   2043 C CE1 . PHE B 1 24  ? 36.925 14.959  45.454 1.00 16.39 ? 12  PHE B CE1 1 
ATOM   2044 C CE2 . PHE B 1 24  ? 35.052 15.044  46.999 1.00 20.69 ? 12  PHE B CE2 1 
ATOM   2045 C CZ  . PHE B 1 24  ? 35.579 14.673  45.755 1.00 18.58 ? 12  PHE B CZ  1 
ATOM   2046 N N   . GLN B 1 25  ? 40.714 15.397  47.643 1.00 16.78 ? 13  GLN B N   1 
ATOM   2047 C CA  . GLN B 1 25  ? 41.448 14.683  46.599 1.00 18.99 ? 13  GLN B CA  1 
ATOM   2048 C C   . GLN B 1 25  ? 42.258 13.494  47.165 1.00 20.72 ? 13  GLN B C   1 
ATOM   2049 O O   . GLN B 1 25  ? 42.253 12.396  46.602 1.00 18.98 ? 13  GLN B O   1 
ATOM   2050 C CB  . GLN B 1 25  ? 42.337 15.676  45.837 1.00 20.45 ? 13  GLN B CB  1 
ATOM   2051 C CG  . GLN B 1 25  ? 41.498 16.655  44.957 1.00 19.74 ? 13  GLN B CG  1 
ATOM   2052 C CD  . GLN B 1 25  ? 42.321 17.787  44.355 1.00 18.05 ? 13  GLN B CD  1 
ATOM   2053 O OE1 . GLN B 1 25  ? 42.789 17.596  43.141 1.00 14.62 ? 13  GLN B OE1 1 
ATOM   2054 N NE2 . GLN B 1 25  ? 42.535 18.817  44.996 1.00 21.39 ? 13  GLN B NE2 1 
ATOM   2055 N N   . LYS B 1 26  ? 42.927 13.715  48.287 1.00 20.91 ? 14  LYS B N   1 
ATOM   2056 C CA  . LYS B 1 26  ? 43.708 12.656  48.898 1.00 23.49 ? 14  LYS B CA  1 
ATOM   2057 C C   . LYS B 1 26  ? 42.791 11.549  49.399 1.00 23.61 ? 14  LYS B C   1 
ATOM   2058 O O   . LYS B 1 26  ? 43.021 10.391  49.097 1.00 22.53 ? 14  LYS B O   1 
ATOM   2059 C CB  . LYS B 1 26  ? 44.565 13.244  50.032 1.00 25.08 ? 14  LYS B CB  1 
ATOM   2060 C CG  . LYS B 1 26  ? 45.517 14.311  49.475 1.00 30.09 ? 14  LYS B CG  1 
ATOM   2061 C CD  . LYS B 1 26  ? 46.560 14.870  50.456 1.00 34.11 ? 14  LYS B CD  1 
ATOM   2062 C CE  . LYS B 1 26  ? 47.320 16.033  49.777 1.00 33.40 ? 14  LYS B CE  1 
ATOM   2063 N NZ  . LYS B 1 26  ? 48.201 16.814  50.688 1.00 37.80 ? 14  LYS B NZ  1 
ATOM   2064 N N   . GLU B 1 27  ? 41.717 11.906  50.108 1.00 24.51 ? 15  GLU B N   1 
ATOM   2065 C CA  . GLU B 1 27  ? 40.801 10.902  50.653 1.00 26.98 ? 15  GLU B CA  1 
ATOM   2066 C C   . GLU B 1 27  ? 40.092 10.047  49.596 1.00 26.77 ? 15  GLU B C   1 
ATOM   2067 O O   . GLU B 1 27  ? 40.058 8.813   49.690 1.00 23.96 ? 15  GLU B O   1 
ATOM   2068 C CB  . GLU B 1 27  ? 39.719 11.558  51.536 1.00 30.76 ? 15  GLU B CB  1 
ATOM   2069 C CG  . GLU B 1 27  ? 39.889 11.457  53.065 1.00 36.48 ? 15  GLU B CG  1 
ATOM   2070 C CD  . GLU B 1 27  ? 40.673 12.619  53.677 1.00 39.16 ? 15  GLU B CD  1 
ATOM   2071 O OE1 . GLU B 1 27  ? 41.696 13.038  53.086 1.00 40.16 ? 15  GLU B OE1 1 
ATOM   2072 O OE2 . GLU B 1 27  ? 40.278 13.103  54.766 1.00 41.22 ? 15  GLU B OE2 1 
ATOM   2073 N N   . THR B 1 28  ? 39.509 10.705  48.601 1.00 24.74 ? 16  THR B N   1 
ATOM   2074 C CA  . THR B 1 28  ? 38.758 9.996   47.566 1.00 23.64 ? 16  THR B CA  1 
ATOM   2075 C C   . THR B 1 28  ? 39.606 9.501   46.410 1.00 23.98 ? 16  THR B C   1 
ATOM   2076 O O   . THR B 1 28  ? 39.165 8.649   45.645 1.00 24.61 ? 16  THR B O   1 
ATOM   2077 C CB  . THR B 1 28  ? 37.703 10.904  46.938 1.00 23.61 ? 16  THR B CB  1 
ATOM   2078 O OG1 . THR B 1 28  ? 38.379 11.943  46.231 1.00 20.94 ? 16  THR B OG1 1 
ATOM   2079 C CG2 . THR B 1 28  ? 36.793 11.523  47.998 1.00 20.38 ? 16  THR B CG2 1 
ATOM   2080 N N   . GLY B 1 29  ? 40.793 10.073  46.247 1.00 24.85 ? 17  GLY B N   1 
ATOM   2081 C CA  . GLY B 1 29  ? 41.657 9.674   45.152 1.00 25.66 ? 17  GLY B CA  1 
ATOM   2082 C C   . GLY B 1 29  ? 41.277 10.339  43.827 1.00 26.10 ? 17  GLY B C   1 
ATOM   2083 O O   . GLY B 1 29  ? 41.912 10.090  42.800 1.00 25.66 ? 17  GLY B O   1 
ATOM   2084 N N   . ILE B 1 30  ? 40.230 11.159  43.846 1.00 24.08 ? 18  ILE B N   1 
ATOM   2085 C CA  . ILE B 1 30  ? 39.777 11.871  42.654 1.00 23.13 ? 18  ILE B CA  1 
ATOM   2086 C C   . ILE B 1 30  ? 40.564 13.182  42.593 1.00 24.27 ? 18  ILE B C   1 
ATOM   2087 O O   . ILE B 1 30  ? 40.212 14.161  43.261 1.00 24.46 ? 18  ILE B O   1 
ATOM   2088 C CB  . ILE B 1 30  ? 38.257 12.201  42.751 1.00 23.31 ? 18  ILE B CB  1 
ATOM   2089 C CG1 . ILE B 1 30  ? 37.463 10.922  43.049 1.00 22.35 ? 18  ILE B CG1 1 
ATOM   2090 C CG2 . ILE B 1 30  ? 37.758 12.827  41.458 1.00 19.68 ? 18  ILE B CG2 1 
ATOM   2091 C CD1 . ILE B 1 30  ? 36.008 11.193  43.418 1.00 22.03 ? 18  ILE B CD1 1 
ATOM   2092 N N   . ASN B 1 31  ? 41.633 13.200  41.805 1.00 24.13 ? 19  ASN B N   1 
ATOM   2093 C CA  . ASN B 1 31  ? 42.455 14.392  41.676 1.00 25.47 ? 19  ASN B CA  1 
ATOM   2094 C C   . ASN B 1 31  ? 41.989 15.256  40.528 1.00 23.86 ? 19  ASN B C   1 
ATOM   2095 O O   . ASN B 1 31  ? 41.755 14.772  39.424 1.00 22.96 ? 19  ASN B O   1 
ATOM   2096 C CB  . ASN B 1 31  ? 43.928 14.013  41.488 1.00 27.69 ? 19  ASN B CB  1 
ATOM   2097 C CG  . ASN B 1 31  ? 44.556 13.554  42.775 1.00 29.65 ? 19  ASN B CG  1 
ATOM   2098 O OD1 . ASN B 1 31  ? 44.743 12.246  42.922 1.00 31.71 ? 19  ASN B OD1 1 
ATOM   2099 N ND2 . ASN B 1 31  ? 44.846 14.369  43.647 1.00 30.74 ? 19  ASN B ND2 1 
ATOM   2100 N N   . PHE B 1 32  ? 41.853 16.544  40.806 1.00 22.44 ? 20  PHE B N   1 
ATOM   2101 C CA  . PHE B 1 32  ? 41.381 17.486  39.797 1.00 23.61 ? 20  PHE B CA  1 
ATOM   2102 C C   . PHE B 1 32  ? 42.494 18.253  39.119 1.00 24.47 ? 20  PHE B C   1 
ATOM   2103 O O   . PHE B 1 32  ? 43.464 18.622  39.758 1.00 23.23 ? 20  PHE B O   1 
ATOM   2104 C CB  . PHE B 1 32  ? 40.420 18.508  40.434 1.00 21.70 ? 20  PHE B CB  1 
ATOM   2105 C CG  . PHE B 1 32  ? 38.981 18.065  40.460 1.00 20.53 ? 20  PHE B CG  1 
ATOM   2106 C CD1 . PHE B 1 32  ? 38.049 18.648  39.591 1.00 19.36 ? 20  PHE B CD1 1 
ATOM   2107 C CD2 . PHE B 1 32  ? 38.563 17.058  41.327 1.00 16.28 ? 20  PHE B CD2 1 
ATOM   2108 C CE1 . PHE B 1 32  ? 36.707 18.230  39.589 1.00 19.03 ? 20  PHE B CE1 1 
ATOM   2109 C CE2 . PHE B 1 32  ? 37.232 16.629  41.332 1.00 17.69 ? 20  PHE B CE2 1 
ATOM   2110 C CZ  . PHE B 1 32  ? 36.298 17.218  40.461 1.00 16.02 ? 20  PHE B CZ  1 
ATOM   2111 N N   . LYS B 1 33  ? 42.329 18.512  37.824 1.00 25.33 ? 21  LYS B N   1 
ATOM   2112 C CA  . LYS B 1 33  ? 43.292 19.314  37.090 1.00 26.41 ? 21  LYS B CA  1 
ATOM   2113 C C   . LYS B 1 33  ? 42.929 20.751  37.454 1.00 25.65 ? 21  LYS B C   1 
ATOM   2114 O O   . LYS B 1 33  ? 43.802 21.570  37.744 1.00 25.31 ? 21  LYS B O   1 
ATOM   2115 C CB  . LYS B 1 33  ? 43.123 19.125  35.587 1.00 29.19 ? 21  LYS B CB  1 
ATOM   2116 C CG  . LYS B 1 33  ? 43.160 17.682  35.107 1.00 33.54 ? 21  LYS B CG  1 
ATOM   2117 C CD  . LYS B 1 33  ? 42.831 17.623  33.604 1.00 36.03 ? 21  LYS B CD  1 
ATOM   2118 C CE  . LYS B 1 33  ? 42.499 16.220  33.137 1.00 38.63 ? 21  LYS B CE  1 
ATOM   2119 N NZ  . LYS B 1 33  ? 42.027 16.254  31.710 1.00 41.52 ? 21  LYS B NZ  1 
ATOM   2120 N N   . ASN B 1 34  ? 41.629 21.051  37.433 1.00 22.57 ? 22  ASN B N   1 
ATOM   2121 C CA  . ASN B 1 34  ? 41.132 22.392  37.778 1.00 22.46 ? 22  ASN B CA  1 
ATOM   2122 C C   . ASN B 1 34  ? 40.412 22.345  39.140 1.00 22.38 ? 22  ASN B C   1 
ATOM   2123 O O   . ASN B 1 34  ? 39.216 22.048  39.209 1.00 21.17 ? 22  ASN B O   1 
ATOM   2124 C CB  . ASN B 1 34  ? 40.164 22.878  36.674 1.00 21.89 ? 22  ASN B CB  1 
ATOM   2125 C CG  . ASN B 1 34  ? 39.505 24.199  37.006 1.00 21.20 ? 22  ASN B CG  1 
ATOM   2126 O OD1 . ASN B 1 34  ? 39.672 24.744  38.086 1.00 22.05 ? 22  ASN B OD1 1 
ATOM   2127 N ND2 . ASN B 1 34  ? 38.722 24.711  36.066 1.00 23.72 ? 22  ASN B ND2 1 
ATOM   2128 N N   . GLU B 1 35  ? 41.135 22.649  40.221 1.00 22.59 ? 23  GLU B N   1 
ATOM   2129 C CA  . GLU B 1 35  ? 40.562 22.593  41.573 1.00 22.09 ? 23  GLU B CA  1 
ATOM   2130 C C   . GLU B 1 35  ? 39.407 23.514  41.872 1.00 20.55 ? 23  GLU B C   1 
ATOM   2131 O O   . GLU B 1 35  ? 38.682 23.286  42.843 1.00 18.72 ? 23  GLU B O   1 
ATOM   2132 C CB  . GLU B 1 35  ? 41.647 22.810  42.627 1.00 23.36 ? 23  GLU B CB  1 
ATOM   2133 C CG  . GLU B 1 35  ? 42.761 21.819  42.490 1.00 25.72 ? 23  GLU B CG  1 
ATOM   2134 C CD  . GLU B 1 35  ? 43.787 21.947  43.584 1.00 28.33 ? 23  GLU B CD  1 
ATOM   2135 O OE1 . GLU B 1 35  ? 44.159 23.111  43.895 1.00 28.80 ? 23  GLU B OE1 1 
ATOM   2136 O OE2 . GLU B 1 35  ? 44.212 20.887  44.114 1.00 24.28 ? 23  GLU B OE2 1 
ATOM   2137 N N   . GLU B 1 36  ? 39.247 24.558  41.069 1.00 19.09 ? 24  GLU B N   1 
ATOM   2138 C CA  . GLU B 1 36  ? 38.140 25.491  41.248 1.00 20.60 ? 24  GLU B CA  1 
ATOM   2139 C C   . GLU B 1 36  ? 36.798 24.789  41.017 1.00 18.05 ? 24  GLU B C   1 
ATOM   2140 O O   . GLU B 1 36  ? 35.806 25.141  41.640 1.00 16.29 ? 24  GLU B O   1 
ATOM   2141 C CB  . GLU B 1 36  ? 38.282 26.676  40.282 1.00 24.27 ? 24  GLU B CB  1 
ATOM   2142 C CG  . GLU B 1 36  ? 37.045 27.567  40.166 1.00 29.22 ? 24  GLU B CG  1 
ATOM   2143 C CD  . GLU B 1 36  ? 36.550 28.093  41.506 1.00 32.40 ? 24  GLU B CD  1 
ATOM   2144 O OE1 . GLU B 1 36  ? 37.365 28.283  42.427 1.00 34.18 ? 24  GLU B OE1 1 
ATOM   2145 O OE2 . GLU B 1 36  ? 35.334 28.323  41.638 1.00 34.47 ? 24  GLU B OE2 1 
ATOM   2146 N N   . LEU B 1 37  ? 36.789 23.804  40.115 1.00 18.62 ? 25  LEU B N   1 
ATOM   2147 C CA  . LEU B 1 37  ? 35.596 23.028  39.808 1.00 17.50 ? 25  LEU B CA  1 
ATOM   2148 C C   . LEU B 1 37  ? 35.218 22.223  41.035 1.00 17.05 ? 25  LEU B C   1 
ATOM   2149 O O   . LEU B 1 37  ? 34.031 22.134  41.368 1.00 16.06 ? 25  LEU B O   1 
ATOM   2150 C CB  . LEU B 1 37  ? 35.820 22.061  38.639 1.00 17.27 ? 25  LEU B CB  1 
ATOM   2151 C CG  . LEU B 1 37  ? 35.842 22.695  37.244 1.00 21.10 ? 25  LEU B CG  1 
ATOM   2152 C CD1 . LEU B 1 37  ? 36.208 21.657  36.213 1.00 20.06 ? 25  LEU B CD1 1 
ATOM   2153 C CD2 . LEU B 1 37  ? 34.446 23.308  36.933 1.00 20.19 ? 25  LEU B CD2 1 
ATOM   2154 N N   . LEU B 1 38  ? 36.221 21.621  41.690 1.00 15.11 ? 26  LEU B N   1 
ATOM   2155 C CA  . LEU B 1 38  ? 35.979 20.834  42.904 1.00 14.37 ? 26  LEU B CA  1 
ATOM   2156 C C   . LEU B 1 38  ? 35.447 21.736  44.031 1.00 14.12 ? 26  LEU B C   1 
ATOM   2157 O O   . LEU B 1 38  ? 34.492 21.394  44.724 1.00 11.57 ? 26  LEU B O   1 
ATOM   2158 C CB  . LEU B 1 38  ? 37.275 20.145  43.362 1.00 14.44 ? 26  LEU B CB  1 
ATOM   2159 C CG  . LEU B 1 38  ? 37.193 19.450  44.728 1.00 16.44 ? 26  LEU B CG  1 
ATOM   2160 C CD1 . LEU B 1 38  ? 35.953 18.562  44.789 1.00 14.71 ? 26  LEU B CD1 1 
ATOM   2161 C CD2 . LEU B 1 38  ? 38.482 18.605  44.957 1.00 13.69 ? 26  LEU B CD2 1 
ATOM   2162 N N   . PHE B 1 39  ? 36.061 22.902  44.190 1.00 14.46 ? 27  PHE B N   1 
ATOM   2163 C CA  . PHE B 1 39  ? 35.643 23.847  45.213 1.00 14.32 ? 27  PHE B CA  1 
ATOM   2164 C C   . PHE B 1 39  ? 34.195 24.289  45.034 1.00 15.49 ? 27  PHE B C   1 
ATOM   2165 O O   . PHE B 1 39  ? 33.387 24.280  45.967 1.00 15.18 ? 27  PHE B O   1 
ATOM   2166 C CB  . PHE B 1 39  ? 36.490 25.098  45.166 1.00 15.14 ? 27  PHE B CB  1 
ATOM   2167 C CG  . PHE B 1 39  ? 36.009 26.150  46.115 1.00 18.82 ? 27  PHE B CG  1 
ATOM   2168 C CD1 . PHE B 1 39  ? 36.259 26.029  47.482 1.00 18.76 ? 27  PHE B CD1 1 
ATOM   2169 C CD2 . PHE B 1 39  ? 35.245 27.209  45.664 1.00 18.92 ? 27  PHE B CD2 1 
ATOM   2170 C CE1 . PHE B 1 39  ? 35.756 26.952  48.398 1.00 21.77 ? 27  PHE B CE1 1 
ATOM   2171 C CE2 . PHE B 1 39  ? 34.737 28.137  46.561 1.00 24.74 ? 27  PHE B CE2 1 
ATOM   2172 C CZ  . PHE B 1 39  ? 34.997 28.010  47.946 1.00 24.01 ? 27  PHE B CZ  1 
ATOM   2173 N N   . ARG B 1 40  ? 33.878 24.710  43.822 1.00 14.06 ? 28  ARG B N   1 
ATOM   2174 C CA  . ARG B 1 40  ? 32.547 25.163  43.524 1.00 13.85 ? 28  ARG B CA  1 
ATOM   2175 C C   . ARG B 1 40  ? 31.524 24.061  43.820 1.00 13.39 ? 28  ARG B C   1 
ATOM   2176 O O   . ARG B 1 40  ? 30.471 24.362  44.395 1.00 13.27 ? 28  ARG B O   1 
ATOM   2177 C CB  . ARG B 1 40  ? 32.476 25.581  42.058 1.00 17.25 ? 28  ARG B CB  1 
ATOM   2178 C CG  . ARG B 1 40  ? 31.293 26.494  41.703 1.00 23.51 ? 28  ARG B CG  1 
ATOM   2179 C CD  . ARG B 1 40  ? 31.780 27.846  41.191 1.00 28.07 ? 28  ARG B CD  1 
ATOM   2180 N NE  . ARG B 1 40  ? 32.779 27.668  40.149 1.00 33.19 ? 28  ARG B NE  1 
ATOM   2181 C CZ  . ARG B 1 40  ? 33.396 28.654  39.503 1.00 34.66 ? 28  ARG B CZ  1 
ATOM   2182 N NH1 . ARG B 1 40  ? 33.131 29.916  39.774 1.00 36.11 ? 28  ARG B NH1 1 
ATOM   2183 N NH2 . ARG B 1 40  ? 34.296 28.367  38.574 1.00 39.33 ? 28  ARG B NH2 1 
ATOM   2184 N N   . ALA B 1 41  ? 31.833 22.794  43.472 1.00 10.85 ? 29  ALA B N   1 
ATOM   2185 C CA  . ALA B 1 41  ? 30.875 21.697  43.697 1.00 10.21 ? 29  ALA B CA  1 
ATOM   2186 C C   . ALA B 1 41  ? 30.536 21.524  45.164 1.00 11.40 ? 29  ALA B C   1 
ATOM   2187 O O   . ALA B 1 41  ? 29.391 21.157  45.516 1.00 12.31 ? 29  ALA B O   1 
ATOM   2188 C CB  . ALA B 1 41  ? 31.401 20.356  43.147 1.00 8.70  ? 29  ALA B CB  1 
ATOM   2189 N N   . LEU B 1 42  ? 31.545 21.737  45.997 1.00 10.75 ? 30  LEU B N   1 
ATOM   2190 C CA  . LEU B 1 42  ? 31.428 21.620  47.437 1.00 14.76 ? 30  LEU B CA  1 
ATOM   2191 C C   . LEU B 1 42  ? 30.814 22.855  48.114 1.00 13.85 ? 30  LEU B C   1 
ATOM   2192 O O   . LEU B 1 42  ? 30.504 22.792  49.320 1.00 13.36 ? 30  LEU B O   1 
ATOM   2193 C CB  . LEU B 1 42  ? 32.833 21.320  48.046 1.00 13.73 ? 30  LEU B CB  1 
ATOM   2194 C CG  . LEU B 1 42  ? 33.448 19.986  47.603 1.00 18.05 ? 30  LEU B CG  1 
ATOM   2195 C CD1 . LEU B 1 42  ? 34.952 19.923  47.975 1.00 17.08 ? 30  LEU B CD1 1 
ATOM   2196 C CD2 . LEU B 1 42  ? 32.652 18.855  48.229 1.00 17.42 ? 30  LEU B CD2 1 
ATOM   2197 N N   . CYS B 1 43  ? 30.623 23.962  47.381 1.00 14.47 ? 31  CYS B N   1 
ATOM   2198 C CA  . CYS B 1 43  ? 30.054 25.175  47.999 1.00 16.82 ? 31  CYS B CA  1 
ATOM   2199 C C   . CYS B 1 43  ? 28.544 25.337  48.016 1.00 16.88 ? 31  CYS B C   1 
ATOM   2200 O O   . CYS B 1 43  ? 27.914 25.618  46.980 1.00 14.81 ? 31  CYS B O   1 
ATOM   2201 C CB  . CYS B 1 43  ? 30.614 26.490  47.396 1.00 20.60 ? 31  CYS B CB  1 
ATOM   2202 S SG  . CYS B 1 43  ? 32.280 26.878  47.905 1.00 34.82 ? 31  CYS B SG  1 
ATOM   2203 N N   . HIS B 1 44  ? 27.972 25.217  49.212 1.00 17.03 ? 32  HIS B N   1 
ATOM   2204 C CA  . HIS B 1 44  ? 26.537 25.405  49.370 1.00 15.84 ? 32  HIS B CA  1 
ATOM   2205 C C   . HIS B 1 44  ? 26.308 26.928  49.257 1.00 16.44 ? 32  HIS B C   1 
ATOM   2206 O O   . HIS B 1 44  ? 27.202 27.732  49.614 1.00 13.99 ? 32  HIS B O   1 
ATOM   2207 C CB  . HIS B 1 44  ? 26.082 24.940  50.746 1.00 15.74 ? 32  HIS B CB  1 
ATOM   2208 C CG  . HIS B 1 44  ? 24.597 24.945  50.926 1.00 13.93 ? 32  HIS B CG  1 
ATOM   2209 N ND1 . HIS B 1 44  ? 23.951 25.840  51.752 1.00 14.94 ? 32  HIS B ND1 1 
ATOM   2210 C CD2 . HIS B 1 44  ? 23.627 24.189  50.352 1.00 12.49 ? 32  HIS B CD2 1 
ATOM   2211 C CE1 . HIS B 1 44  ? 22.644 25.637  51.680 1.00 13.86 ? 32  HIS B CE1 1 
ATOM   2212 N NE2 . HIS B 1 44  ? 22.422 24.638  50.840 1.00 14.16 ? 32  HIS B NE2 1 
ATOM   2213 N N   . SER B 1 45  ? 25.124 27.299  48.772 1.00 14.74 ? 33  SER B N   1 
ATOM   2214 C CA  . SER B 1 45  ? 24.740 28.699  48.597 1.00 15.67 ? 33  SER B CA  1 
ATOM   2215 C C   . SER B 1 45  ? 24.922 29.518  49.891 1.00 16.59 ? 33  SER B C   1 
ATOM   2216 O O   . SER B 1 45  ? 25.277 30.697  49.854 1.00 15.23 ? 33  SER B O   1 
ATOM   2217 C CB  . SER B 1 45  ? 23.266 28.757  48.146 1.00 17.78 ? 33  SER B CB  1 
ATOM   2218 O OG  . SER B 1 45  ? 22.469 28.068  49.092 1.00 16.48 ? 33  SER B OG  1 
ATOM   2219 N N   . SER B 1 46  ? 24.652 28.903  51.038 1.00 16.46 ? 34  SER B N   1 
ATOM   2220 C CA  . SER B 1 46  ? 24.813 29.612  52.311 1.00 16.14 ? 34  SER B CA  1 
ATOM   2221 C C   . SER B 1 46  ? 26.278 30.050  52.502 1.00 16.21 ? 34  SER B C   1 
ATOM   2222 O O   . SER B 1 46  ? 26.547 31.119  53.033 1.00 17.38 ? 34  SER B O   1 
ATOM   2223 C CB  . SER B 1 46  ? 24.387 28.713  53.479 1.00 17.26 ? 34  SER B CB  1 
ATOM   2224 O OG  . SER B 1 46  ? 25.274 27.607  53.614 1.00 17.83 ? 34  SER B OG  1 
ATOM   2225 N N   . TYR B 1 47  ? 27.230 29.230  52.067 1.00 16.08 ? 35  TYR B N   1 
ATOM   2226 C CA  . TYR B 1 47  ? 28.639 29.604  52.198 1.00 14.72 ? 35  TYR B CA  1 
ATOM   2227 C C   . TYR B 1 47  ? 28.998 30.708  51.202 1.00 14.84 ? 35  TYR B C   1 
ATOM   2228 O O   . TYR B 1 47  ? 29.606 31.700  51.561 1.00 12.85 ? 35  TYR B O   1 
ATOM   2229 C CB  . TYR B 1 47  ? 29.556 28.402  51.952 1.00 15.16 ? 35  TYR B CB  1 
ATOM   2230 C CG  . TYR B 1 47  ? 31.013 28.734  52.196 1.00 16.39 ? 35  TYR B CG  1 
ATOM   2231 C CD1 . TYR B 1 47  ? 31.518 28.803  53.495 1.00 16.95 ? 35  TYR B CD1 1 
ATOM   2232 C CD2 . TYR B 1 47  ? 31.899 28.936  51.125 1.00 17.64 ? 35  TYR B CD2 1 
ATOM   2233 C CE1 . TYR B 1 47  ? 32.869 29.044  53.736 1.00 16.68 ? 35  TYR B CE1 1 
ATOM   2234 C CE2 . TYR B 1 47  ? 33.251 29.183  51.352 1.00 18.65 ? 35  TYR B CE2 1 
ATOM   2235 C CZ  . TYR B 1 47  ? 33.728 29.222  52.680 1.00 18.70 ? 35  TYR B CZ  1 
ATOM   2236 O OH  . TYR B 1 47  ? 35.071 29.362  52.924 1.00 17.21 ? 35  TYR B OH  1 
ATOM   2237 N N   . ALA B 1 48  ? 28.627 30.516  49.938 1.00 15.63 ? 36  ALA B N   1 
ATOM   2238 C CA  . ALA B 1 48  ? 28.887 31.520  48.912 1.00 16.37 ? 36  ALA B CA  1 
ATOM   2239 C C   . ALA B 1 48  ? 28.300 32.894  49.312 1.00 16.89 ? 36  ALA B C   1 
ATOM   2240 O O   . ALA B 1 48  ? 28.983 33.924  49.179 1.00 17.53 ? 36  ALA B O   1 
ATOM   2241 C CB  . ALA B 1 48  ? 28.296 31.057  47.567 1.00 15.28 ? 36  ALA B CB  1 
ATOM   2242 N N   . ASN B 1 49  ? 27.053 32.917  49.796 1.00 17.15 ? 37  ASN B N   1 
ATOM   2243 C CA  . ASN B 1 49  ? 26.397 34.175  50.193 1.00 18.51 ? 37  ASN B CA  1 
ATOM   2244 C C   . ASN B 1 49  ? 27.108 34.843  51.392 1.00 19.00 ? 37  ASN B C   1 
ATOM   2245 O O   . ASN B 1 49  ? 27.293 36.068  51.431 1.00 17.42 ? 37  ASN B O   1 
ATOM   2246 C CB  . ASN B 1 49  ? 24.918 33.931  50.544 1.00 19.51 ? 37  ASN B CB  1 
ATOM   2247 C CG  . ASN B 1 49  ? 24.092 33.489  49.339 1.00 22.68 ? 37  ASN B CG  1 
ATOM   2248 O OD1 . ASN B 1 49  ? 24.483 33.711  48.193 1.00 24.70 ? 37  ASN B OD1 1 
ATOM   2249 N ND2 . ASN B 1 49  ? 22.939 32.873  49.596 1.00 22.78 ? 37  ASN B ND2 1 
ATOM   2250 N N   . GLU B 1 50  ? 27.490 34.020  52.358 1.00 17.89 ? 38  GLU B N   1 
ATOM   2251 C CA  . GLU B 1 50  ? 28.213 34.483  53.522 1.00 18.65 ? 38  GLU B CA  1 
ATOM   2252 C C   . GLU B 1 50  ? 29.530 35.118  53.048 1.00 19.13 ? 38  GLU B C   1 
ATOM   2253 O O   . GLU B 1 50  ? 29.847 36.244  53.426 1.00 20.98 ? 38  GLU B O   1 
ATOM   2254 C CB  . GLU B 1 50  ? 28.494 33.290  54.441 1.00 21.83 ? 38  GLU B CB  1 
ATOM   2255 C CG  . GLU B 1 50  ? 29.483 33.555  55.584 1.00 25.00 ? 38  GLU B CG  1 
ATOM   2256 C CD  . GLU B 1 50  ? 29.636 32.340  56.491 1.00 26.70 ? 38  GLU B CD  1 
ATOM   2257 O OE1 . GLU B 1 50  ? 28.736 32.116  57.334 1.00 26.25 ? 38  GLU B OE1 1 
ATOM   2258 O OE2 . GLU B 1 50  ? 30.648 31.605  56.341 1.00 29.32 ? 38  GLU B OE2 1 
ATOM   2259 N N   . GLN B 1 51  ? 30.283 34.416  52.204 1.00 18.47 ? 39  GLN B N   1 
ATOM   2260 C CA  . GLN B 1 51  ? 31.557 34.942  51.718 1.00 18.62 ? 39  GLN B CA  1 
ATOM   2261 C C   . GLN B 1 51  ? 31.393 36.187  50.842 1.00 17.58 ? 39  GLN B C   1 
ATOM   2262 O O   . GLN B 1 51  ? 32.176 37.122  50.965 1.00 17.17 ? 39  GLN B O   1 
ATOM   2263 C CB  . GLN B 1 51  ? 32.355 33.856  50.969 1.00 17.42 ? 39  GLN B CB  1 
ATOM   2264 C CG  . GLN B 1 51  ? 32.778 32.677  51.866 1.00 17.37 ? 39  GLN B CG  1 
ATOM   2265 C CD  . GLN B 1 51  ? 33.464 33.158  53.152 1.00 21.37 ? 39  GLN B CD  1 
ATOM   2266 O OE1 . GLN B 1 51  ? 34.494 33.819  53.099 1.00 23.36 ? 39  GLN B OE1 1 
ATOM   2267 N NE2 . GLN B 1 51  ? 32.886 32.830  54.300 1.00 20.24 ? 39  GLN B NE2 1 
ATOM   2268 N N   . ASN B 1 52  ? 30.375 36.207  49.976 1.00 17.95 ? 40  ASN B N   1 
ATOM   2269 C CA  . ASN B 1 52  ? 30.131 37.373  49.106 1.00 18.71 ? 40  ASN B CA  1 
ATOM   2270 C C   . ASN B 1 52  ? 29.876 38.625  49.971 1.00 18.21 ? 40  ASN B C   1 
ATOM   2271 O O   . ASN B 1 52  ? 30.417 39.706  49.733 1.00 17.34 ? 40  ASN B O   1 
ATOM   2272 C CB  . ASN B 1 52  ? 28.908 37.144  48.191 1.00 18.42 ? 40  ASN B CB  1 
ATOM   2273 C CG  . ASN B 1 52  ? 29.102 35.992  47.218 1.00 19.41 ? 40  ASN B CG  1 
ATOM   2274 O OD1 . ASN B 1 52  ? 28.007 35.369  46.839 1.00 18.03 ? 40  ASN B OD1 1 
ATOM   2275 N ND2 . ASN B 1 52  ? 30.230 35.675  46.797 1.00 22.83 ? 40  ASN B ND2 1 
ATOM   2276 N N   . GLN B 1 53  ? 29.028 38.458  50.968 1.00 19.62 ? 41  GLN B N   1 
ATOM   2277 C CA  . GLN B 1 53  ? 28.685 39.533  51.885 1.00 19.37 ? 41  GLN B CA  1 
ATOM   2278 C C   . GLN B 1 53  ? 29.918 40.041  52.638 1.00 19.46 ? 41  GLN B C   1 
ATOM   2279 O O   . GLN B 1 53  ? 29.938 41.185  53.142 1.00 15.97 ? 41  GLN B O   1 
ATOM   2280 C CB  . GLN B 1 53  ? 27.609 39.036  52.835 1.00 23.06 ? 41  GLN B CB  1 
ATOM   2281 C CG  . GLN B 1 53  ? 26.226 39.016  52.172 1.00 27.81 ? 41  GLN B CG  1 
ATOM   2282 C CD  . GLN B 1 53  ? 25.274 38.032  52.812 1.00 33.27 ? 41  GLN B CD  1 
ATOM   2283 O OE1 . GLN B 1 53  ? 25.445 37.640  53.978 1.00 36.79 ? 41  GLN B OE1 1 
ATOM   2284 N NE2 . GLN B 1 53  ? 24.252 37.622  52.056 1.00 34.50 ? 41  GLN B NE2 1 
ATOM   2285 N N   . ALA B 1 54  ? 30.956 39.205  52.699 1.00 17.95 ? 42  ALA B N   1 
ATOM   2286 C CA  . ALA B 1 54  ? 32.188 39.593  53.373 1.00 16.78 ? 42  ALA B CA  1 
ATOM   2287 C C   . ALA B 1 54  ? 33.224 40.064  52.352 1.00 16.92 ? 42  ALA B C   1 
ATOM   2288 O O   . ALA B 1 54  ? 34.402 40.159  52.663 1.00 18.30 ? 42  ALA B O   1 
ATOM   2289 C CB  . ALA B 1 54  ? 32.739 38.438  54.192 1.00 16.87 ? 42  ALA B CB  1 
ATOM   2290 N N   . GLY B 1 55  ? 32.789 40.328  51.125 1.00 17.97 ? 43  GLY B N   1 
ATOM   2291 C CA  . GLY B 1 55  ? 33.707 40.838  50.109 1.00 20.51 ? 43  GLY B CA  1 
ATOM   2292 C C   . GLY B 1 55  ? 34.392 39.871  49.151 1.00 21.77 ? 43  GLY B C   1 
ATOM   2293 O O   . GLY B 1 55  ? 35.106 40.299  48.244 1.00 19.82 ? 43  GLY B O   1 
ATOM   2294 N N   . ARG B 1 56  ? 34.207 38.570  49.347 1.00 20.02 ? 44  ARG B N   1 
ATOM   2295 C CA  . ARG B 1 56  ? 34.827 37.617  48.449 1.00 21.08 ? 44  ARG B CA  1 
ATOM   2296 C C   . ARG B 1 56  ? 33.726 37.306  47.424 1.00 21.69 ? 44  ARG B C   1 
ATOM   2297 O O   . ARG B 1 56  ? 32.949 36.349  47.559 1.00 20.43 ? 44  ARG B O   1 
ATOM   2298 C CB  . ARG B 1 56  ? 35.270 36.388  49.249 1.00 19.95 ? 44  ARG B CB  1 
ATOM   2299 C CG  . ARG B 1 56  ? 36.196 36.760  50.409 1.00 17.73 ? 44  ARG B CG  1 
ATOM   2300 C CD  . ARG B 1 56  ? 36.757 35.538  51.096 1.00 19.47 ? 44  ARG B CD  1 
ATOM   2301 N NE  . ARG B 1 56  ? 37.543 34.663  50.208 1.00 18.46 ? 44  ARG B NE  1 
ATOM   2302 C CZ  . ARG B 1 56  ? 37.454 33.333  50.214 1.00 20.53 ? 44  ARG B CZ  1 
ATOM   2303 N NH1 . ARG B 1 56  ? 36.606 32.732  51.052 1.00 18.37 ? 44  ARG B NH1 1 
ATOM   2304 N NH2 . ARG B 1 56  ? 38.223 32.593  49.404 1.00 22.11 ? 44  ARG B NH2 1 
ATOM   2305 N N   . LYS B 1 57  ? 33.660 38.157  46.407 1.00 21.99 ? 45  LYS B N   1 
ATOM   2306 C CA  . LYS B 1 57  ? 32.633 38.054  45.389 1.00 23.62 ? 45  LYS B CA  1 
ATOM   2307 C C   . LYS B 1 57  ? 32.773 36.912  44.415 1.00 23.03 ? 45  LYS B C   1 
ATOM   2308 O O   . LYS B 1 57  ? 31.785 36.546  43.779 1.00 24.07 ? 45  LYS B O   1 
ATOM   2309 C CB  . LYS B 1 57  ? 32.509 39.377  44.605 1.00 27.09 ? 45  LYS B CB  1 
ATOM   2310 C CG  . LYS B 1 57  ? 32.115 40.607  45.463 1.00 34.06 ? 45  LYS B CG  1 
ATOM   2311 C CD  . LYS B 1 57  ? 31.130 40.289  46.609 1.00 35.52 ? 45  LYS B CD  1 
ATOM   2312 C CE  . LYS B 1 57  ? 29.829 39.625  46.110 1.00 40.91 ? 45  LYS B CE  1 
ATOM   2313 N NZ  . LYS B 1 57  ? 28.912 40.520  45.331 1.00 43.68 ? 45  LYS B NZ  1 
ATOM   2314 N N   . ASP B 1 58  ? 33.967 36.338  44.294 1.00 22.55 ? 46  ASP B N   1 
ATOM   2315 C CA  . ASP B 1 58  ? 34.155 35.243  43.361 1.00 24.10 ? 46  ASP B CA  1 
ATOM   2316 C C   . ASP B 1 58  ? 33.877 33.851  43.950 1.00 23.01 ? 46  ASP B C   1 
ATOM   2317 O O   . ASP B 1 58  ? 34.087 32.834  43.284 1.00 22.40 ? 46  ASP B O   1 
ATOM   2318 C CB  . ASP B 1 58  ? 35.559 35.322  42.746 1.00 28.80 ? 46  ASP B CB  1 
ATOM   2319 C CG  . ASP B 1 58  ? 35.772 36.625  41.968 1.00 32.90 ? 46  ASP B CG  1 
ATOM   2320 O OD1 . ASP B 1 58  ? 34.893 36.971  41.140 1.00 34.80 ? 46  ASP B OD1 1 
ATOM   2321 O OD2 . ASP B 1 58  ? 36.799 37.305  42.187 1.00 36.99 ? 46  ASP B OD2 1 
ATOM   2322 N N   . VAL B 1 59  ? 33.415 33.801  45.196 1.00 19.15 ? 47  VAL B N   1 
ATOM   2323 C CA  . VAL B 1 59  ? 33.062 32.511  45.784 1.00 18.35 ? 47  VAL B CA  1 
ATOM   2324 C C   . VAL B 1 59  ? 31.675 32.225  45.228 1.00 17.21 ? 47  VAL B C   1 
ATOM   2325 O O   . VAL B 1 59  ? 30.755 32.992  45.470 1.00 18.53 ? 47  VAL B O   1 
ATOM   2326 C CB  . VAL B 1 59  ? 32.977 32.603  47.307 1.00 16.77 ? 47  VAL B CB  1 
ATOM   2327 C CG1 . VAL B 1 59  ? 32.447 31.254  47.893 1.00 13.18 ? 47  VAL B CG1 1 
ATOM   2328 C CG2 . VAL B 1 59  ? 34.372 32.959  47.863 1.00 16.40 ? 47  VAL B CG2 1 
ATOM   2329 N N   . GLU B 1 60  ? 31.532 31.152  44.457 1.00 18.00 ? 48  GLU B N   1 
ATOM   2330 C CA  . GLU B 1 60  ? 30.235 30.812  43.858 1.00 19.95 ? 48  GLU B CA  1 
ATOM   2331 C C   . GLU B 1 60  ? 29.649 29.489  44.381 1.00 17.75 ? 48  GLU B C   1 
ATOM   2332 O O   . GLU B 1 60  ? 30.366 28.568  44.693 1.00 19.46 ? 48  GLU B O   1 
ATOM   2333 C CB  . GLU B 1 60  ? 30.375 30.738  42.323 1.00 23.85 ? 48  GLU B CB  1 
ATOM   2334 C CG  . GLU B 1 60  ? 29.048 30.765  41.584 1.00 31.30 ? 48  GLU B CG  1 
ATOM   2335 C CD  . GLU B 1 60  ? 29.167 30.327  40.122 1.00 35.43 ? 48  GLU B CD  1 
ATOM   2336 O OE1 . GLU B 1 60  ? 30.000 30.901  39.369 1.00 36.66 ? 48  GLU B OE1 1 
ATOM   2337 O OE2 . GLU B 1 60  ? 28.417 29.404  39.744 1.00 35.41 ? 48  GLU B OE2 1 
ATOM   2338 N N   . SER B 1 61  ? 28.333 29.380  44.447 1.00 16.83 ? 49  SER B N   1 
ATOM   2339 C CA  . SER B 1 61  ? 27.736 28.144  44.939 1.00 15.87 ? 49  SER B CA  1 
ATOM   2340 C C   . SER B 1 61  ? 27.785 27.027  43.900 1.00 12.83 ? 49  SER B C   1 
ATOM   2341 O O   . SER B 1 61  ? 28.130 27.252  42.744 1.00 13.10 ? 49  SER B O   1 
ATOM   2342 C CB  . SER B 1 61  ? 26.279 28.380  45.314 1.00 15.88 ? 49  SER B CB  1 
ATOM   2343 O OG  . SER B 1 61  ? 25.481 28.348  44.152 1.00 17.93 ? 49  SER B OG  1 
ATOM   2344 N N   . ASN B 1 62  ? 27.380 25.831  44.312 1.00 12.82 ? 50  ASN B N   1 
ATOM   2345 C CA  . ASN B 1 62  ? 27.361 24.676  43.418 1.00 14.10 ? 50  ASN B CA  1 
ATOM   2346 C C   . ASN B 1 62  ? 26.046 24.564  42.622 1.00 14.33 ? 50  ASN B C   1 
ATOM   2347 O O   . ASN B 1 62  ? 25.801 23.540  42.002 1.00 14.23 ? 50  ASN B O   1 
ATOM   2348 C CB  . ASN B 1 62  ? 27.517 23.376  44.222 1.00 12.33 ? 50  ASN B CB  1 
ATOM   2349 C CG  . ASN B 1 62  ? 26.400 23.172  45.255 1.00 15.77 ? 50  ASN B CG  1 
ATOM   2350 O OD1 . ASN B 1 62  ? 25.351 23.821  45.226 1.00 13.17 ? 50  ASN B OD1 1 
ATOM   2351 N ND2 . ASN B 1 62  ? 26.630 22.240  46.181 1.00 16.78 ? 50  ASN B ND2 1 
ATOM   2352 N N   . GLU B 1 63  ? 25.183 25.571  42.679 1.00 14.50 ? 51  GLU B N   1 
ATOM   2353 C CA  . GLU B 1 63  ? 23.895 25.479  41.976 1.00 15.24 ? 51  GLU B CA  1 
ATOM   2354 C C   . GLU B 1 63  ? 23.981 25.273  40.457 1.00 14.84 ? 51  GLU B C   1 
ATOM   2355 O O   . GLU B 1 63  ? 23.205 24.502  39.927 1.00 14.97 ? 51  GLU B O   1 
ATOM   2356 C CB  . GLU B 1 63  ? 23.023 26.702  42.285 1.00 18.09 ? 51  GLU B CB  1 
ATOM   2357 C CG  . GLU B 1 63  ? 22.649 26.816  43.767 1.00 25.57 ? 51  GLU B CG  1 
ATOM   2358 C CD  . GLU B 1 63  ? 22.024 28.154  44.096 1.00 29.65 ? 51  GLU B CD  1 
ATOM   2359 O OE1 . GLU B 1 63  ? 22.773 29.152  44.243 1.00 31.41 ? 51  GLU B OE1 1 
ATOM   2360 O OE2 . GLU B 1 63  ? 20.775 28.200  44.182 1.00 34.43 ? 51  GLU B OE2 1 
ATOM   2361 N N   . LYS B 1 64  ? 24.882 25.955  39.746 1.00 14.64 ? 52  LYS B N   1 
ATOM   2362 C CA  . LYS B 1 64  ? 24.981 25.728  38.275 1.00 14.69 ? 52  LYS B CA  1 
ATOM   2363 C C   . LYS B 1 64  ? 25.570 24.354  37.941 1.00 15.04 ? 52  LYS B C   1 
ATOM   2364 O O   . LYS B 1 64  ? 25.152 23.689  36.988 1.00 15.69 ? 52  LYS B O   1 
ATOM   2365 C CB  . LYS B 1 64  ? 25.830 26.826  37.606 1.00 13.71 ? 52  LYS B CB  1 
ATOM   2366 C CG  . LYS B 1 64  ? 25.064 28.155  37.502 1.00 18.42 ? 52  LYS B CG  1 
ATOM   2367 C CD  . LYS B 1 64  ? 25.962 29.326  37.331 1.00 23.16 ? 52  LYS B CD  1 
ATOM   2368 C CE  . LYS B 1 64  ? 25.134 30.591  37.120 1.00 27.17 ? 52  LYS B CE  1 
ATOM   2369 N NZ  . LYS B 1 64  ? 25.980 31.802  37.221 1.00 28.70 ? 52  LYS B NZ  1 
ATOM   2370 N N   . LEU B 1 65  ? 26.558 23.928  38.724 1.00 13.05 ? 53  LEU B N   1 
ATOM   2371 C CA  . LEU B 1 65  ? 27.172 22.626  38.505 1.00 12.71 ? 53  LEU B CA  1 
ATOM   2372 C C   . LEU B 1 65  ? 26.126 21.574  38.801 1.00 12.44 ? 53  LEU B C   1 
ATOM   2373 O O   . LEU B 1 65  ? 26.059 20.539  38.144 1.00 13.47 ? 53  LEU B O   1 
ATOM   2374 C CB  . LEU B 1 65  ? 28.387 22.435  39.434 1.00 12.13 ? 53  LEU B CB  1 
ATOM   2375 C CG  . LEU B 1 65  ? 29.703 23.068  39.006 1.00 12.63 ? 53  LEU B CG  1 
ATOM   2376 C CD1 . LEU B 1 65  ? 30.742 22.965  40.146 1.00 10.63 ? 53  LEU B CD1 1 
ATOM   2377 C CD2 . LEU B 1 65  ? 30.205 22.335  37.742 1.00 12.55 ? 53  LEU B CD2 1 
ATOM   2378 N N   . GLU B 1 66  ? 25.300 21.828  39.801 1.00 11.04 ? 54  GLU B N   1 
ATOM   2379 C CA  . GLU B 1 66  ? 24.274 20.851  40.096 1.00 14.50 ? 54  GLU B CA  1 
ATOM   2380 C C   . GLU B 1 66  ? 23.262 20.722  38.942 1.00 13.36 ? 54  GLU B C   1 
ATOM   2381 O O   . GLU B 1 66  ? 22.750 19.622  38.680 1.00 12.20 ? 54  GLU B O   1 
ATOM   2382 C CB  . GLU B 1 66  ? 23.543 21.210  41.386 1.00 16.44 ? 54  GLU B CB  1 
ATOM   2383 C CG  . GLU B 1 66  ? 22.678 20.081  41.819 1.00 22.38 ? 54  GLU B CG  1 
ATOM   2384 C CD  . GLU B 1 66  ? 21.288 20.509  42.116 1.00 28.02 ? 54  GLU B CD  1 
ATOM   2385 O OE1 . GLU B 1 66  ? 21.120 21.413  42.983 1.00 29.63 ? 54  GLU B OE1 1 
ATOM   2386 O OE2 . GLU B 1 66  ? 20.367 19.941  41.475 1.00 33.08 ? 54  GLU B OE2 1 
ATOM   2387 N N   . PHE B 1 67  ? 22.964 21.848  38.286 1.00 13.10 ? 55  PHE B N   1 
ATOM   2388 C CA  . PHE B 1 67  ? 22.051 21.869  37.132 1.00 13.09 ? 55  PHE B CA  1 
ATOM   2389 C C   . PHE B 1 67  ? 22.655 20.997  36.031 1.00 13.40 ? 55  PHE B C   1 
ATOM   2390 O O   . PHE B 1 67  ? 21.964 20.188  35.402 1.00 13.40 ? 55  PHE B O   1 
ATOM   2391 C CB  . PHE B 1 67  ? 21.868 23.315  36.632 1.00 15.39 ? 55  PHE B CB  1 
ATOM   2392 C CG  . PHE B 1 67  ? 21.432 23.417  35.183 1.00 18.20 ? 55  PHE B CG  1 
ATOM   2393 C CD1 . PHE B 1 67  ? 22.380 23.568  34.165 1.00 22.69 ? 55  PHE B CD1 1 
ATOM   2394 C CD2 . PHE B 1 67  ? 20.090 23.411  34.844 1.00 18.83 ? 55  PHE B CD2 1 
ATOM   2395 C CE1 . PHE B 1 67  ? 21.986 23.719  32.808 1.00 20.85 ? 55  PHE B CE1 1 
ATOM   2396 C CE2 . PHE B 1 67  ? 19.682 23.563  33.501 1.00 20.60 ? 55  PHE B CE2 1 
ATOM   2397 C CZ  . PHE B 1 67  ? 20.639 23.718  32.486 1.00 20.95 ? 55  PHE B CZ  1 
ATOM   2398 N N   . LEU B 1 68  ? 23.955 21.135  35.792 1.00 11.01 ? 56  LEU B N   1 
ATOM   2399 C CA  . LEU B 1 68  ? 24.560 20.301  34.763 1.00 11.20 ? 56  LEU B CA  1 
ATOM   2400 C C   . LEU B 1 68  ? 24.662 18.850  35.282 1.00 10.97 ? 56  LEU B C   1 
ATOM   2401 O O   . LEU B 1 68  ? 24.400 17.883  34.557 1.00 11.11 ? 56  LEU B O   1 
ATOM   2402 C CB  . LEU B 1 68  ? 25.955 20.826  34.425 1.00 10.63 ? 56  LEU B CB  1 
ATOM   2403 C CG  . LEU B 1 68  ? 26.786 19.928  33.484 1.00 9.98  ? 56  LEU B CG  1 
ATOM   2404 C CD1 . LEU B 1 68  ? 26.001 19.727  32.159 1.00 11.81 ? 56  LEU B CD1 1 
ATOM   2405 C CD2 . LEU B 1 68  ? 28.128 20.584  33.209 1.00 10.19 ? 56  LEU B CD2 1 
ATOM   2406 N N   . GLY B 1 69  ? 25.059 18.727  36.544 1.00 11.60 ? 57  GLY B N   1 
ATOM   2407 C CA  . GLY B 1 69  ? 25.251 17.419  37.144 1.00 13.82 ? 57  GLY B CA  1 
ATOM   2408 C C   . GLY B 1 69  ? 24.033 16.543  37.089 1.00 16.09 ? 57  GLY B C   1 
ATOM   2409 O O   . GLY B 1 69  ? 24.144 15.316  36.934 1.00 15.31 ? 57  GLY B O   1 
ATOM   2410 N N   . ASP B 1 70  ? 22.859 17.155  37.227 1.00 16.00 ? 58  ASP B N   1 
ATOM   2411 C CA  . ASP B 1 70  ? 21.644 16.371  37.178 1.00 18.46 ? 58  ASP B CA  1 
ATOM   2412 C C   . ASP B 1 70  ? 21.503 15.687  35.793 1.00 18.68 ? 58  ASP B C   1 
ATOM   2413 O O   . ASP B 1 70  ? 21.124 14.536  35.704 1.00 18.75 ? 58  ASP B O   1 
ATOM   2414 C CB  . ASP B 1 70  ? 20.444 17.258  37.500 1.00 22.16 ? 58  ASP B CB  1 
ATOM   2415 C CG  . ASP B 1 70  ? 19.156 16.479  37.533 1.00 29.34 ? 58  ASP B CG  1 
ATOM   2416 O OD1 . ASP B 1 70  ? 18.987 15.626  38.450 1.00 30.89 ? 58  ASP B OD1 1 
ATOM   2417 O OD2 . ASP B 1 70  ? 18.331 16.709  36.625 1.00 30.53 ? 58  ASP B OD2 1 
ATOM   2418 N N   . ALA B 1 71  ? 21.854 16.385  34.726 1.00 16.24 ? 59  ALA B N   1 
ATOM   2419 C CA  . ALA B 1 71  ? 21.767 15.814  33.376 1.00 15.17 ? 59  ALA B CA  1 
ATOM   2420 C C   . ALA B 1 71  ? 22.835 14.754  33.173 1.00 15.24 ? 59  ALA B C   1 
ATOM   2421 O O   . ALA B 1 71  ? 22.604 13.764  32.481 1.00 12.23 ? 59  ALA B O   1 
ATOM   2422 C CB  . ALA B 1 71  ? 21.941 16.898  32.338 1.00 16.31 ? 59  ALA B CB  1 
ATOM   2423 N N   . VAL B 1 72  ? 24.014 14.968  33.779 1.00 14.29 ? 60  VAL B N   1 
ATOM   2424 C CA  . VAL B 1 72  ? 25.066 13.990  33.651 1.00 12.93 ? 60  VAL B CA  1 
ATOM   2425 C C   . VAL B 1 72  ? 24.572 12.683  34.310 1.00 13.28 ? 60  VAL B C   1 
ATOM   2426 O O   . VAL B 1 72  ? 24.680 11.599  33.718 1.00 12.74 ? 60  VAL B O   1 
ATOM   2427 C CB  . VAL B 1 72  ? 26.363 14.457  34.320 1.00 12.52 ? 60  VAL B CB  1 
ATOM   2428 C CG1 . VAL B 1 72  ? 27.353 13.288  34.348 1.00 14.68 ? 60  VAL B CG1 1 
ATOM   2429 C CG2 . VAL B 1 72  ? 27.012 15.640  33.511 1.00 9.54  ? 60  VAL B CG2 1 
ATOM   2430 N N   . LEU B 1 73  ? 24.018 12.811  35.521 1.00 13.31 ? 61  LEU B N   1 
ATOM   2431 C CA  . LEU B 1 73  ? 23.493 11.672  36.271 1.00 15.20 ? 61  LEU B CA  1 
ATOM   2432 C C   . LEU B 1 73  ? 22.391 10.938  35.483 1.00 15.23 ? 61  LEU B C   1 
ATOM   2433 O O   . LEU B 1 73  ? 22.388 9.705   35.413 1.00 15.71 ? 61  LEU B O   1 
ATOM   2434 C CB  . LEU B 1 73  ? 22.921 12.135  37.620 1.00 13.72 ? 61  LEU B CB  1 
ATOM   2435 C CG  . LEU B 1 73  ? 22.269 11.017  38.449 1.00 17.35 ? 61  LEU B CG  1 
ATOM   2436 C CD1 . LEU B 1 73  ? 23.367 10.023  38.881 1.00 17.76 ? 61  LEU B CD1 1 
ATOM   2437 C CD2 . LEU B 1 73  ? 21.556 11.580  39.678 1.00 15.72 ? 61  LEU B CD2 1 
ATOM   2438 N N   . GLU B 1 74  ? 21.463 11.697  34.890 1.00 15.95 ? 62  GLU B N   1 
ATOM   2439 C CA  . GLU B 1 74  ? 20.375 11.074  34.127 1.00 18.20 ? 62  GLU B CA  1 
ATOM   2440 C C   . GLU B 1 74  ? 20.880 10.248  32.957 1.00 15.10 ? 62  GLU B C   1 
ATOM   2441 O O   . GLU B 1 74  ? 20.354 9.163   32.688 1.00 13.96 ? 62  GLU B O   1 
ATOM   2442 C CB  . GLU B 1 74  ? 19.402 12.125  33.587 1.00 23.23 ? 62  GLU B CB  1 
ATOM   2443 C CG  . GLU B 1 74  ? 18.834 13.077  34.624 1.00 32.22 ? 62  GLU B CG  1 
ATOM   2444 C CD  . GLU B 1 74  ? 18.079 12.385  35.754 1.00 37.22 ? 62  GLU B CD  1 
ATOM   2445 O OE1 . GLU B 1 74  ? 17.181 11.554  35.466 1.00 39.79 ? 62  GLU B OE1 1 
ATOM   2446 O OE2 . GLU B 1 74  ? 18.384 12.693  36.938 1.00 41.47 ? 62  GLU B OE2 1 
ATOM   2447 N N   . LEU B 1 75  ? 21.890 10.757  32.250 1.00 14.47 ? 63  LEU B N   1 
ATOM   2448 C CA  . LEU B 1 75  ? 22.432 10.025  31.111 1.00 13.30 ? 63  LEU B CA  1 
ATOM   2449 C C   . LEU B 1 75  ? 23.196 8.805   31.616 1.00 14.04 ? 63  LEU B C   1 
ATOM   2450 O O   . LEU B 1 75  ? 23.099 7.726   31.050 1.00 13.79 ? 63  LEU B O   1 
ATOM   2451 C CB  . LEU B 1 75  ? 23.375 10.903  30.262 1.00 14.00 ? 63  LEU B CB  1 
ATOM   2452 C CG  . LEU B 1 75  ? 24.070 10.133  29.118 1.00 15.42 ? 63  LEU B CG  1 
ATOM   2453 C CD1 . LEU B 1 75  ? 23.029 9.367   28.242 1.00 14.89 ? 63  LEU B CD1 1 
ATOM   2454 C CD2 . LEU B 1 75  ? 24.907 11.099  28.281 1.00 17.42 ? 63  LEU B CD2 1 
ATOM   2455 N N   . PHE B 1 76  ? 23.916 8.981   32.714 1.00 15.04 ? 64  PHE B N   1 
ATOM   2456 C CA  . PHE B 1 76  ? 24.704 7.885   33.273 1.00 14.51 ? 64  PHE B CA  1 
ATOM   2457 C C   . PHE B 1 76  ? 23.787 6.721   33.656 1.00 14.25 ? 64  PHE B C   1 
ATOM   2458 O O   . PHE B 1 76  ? 24.061 5.559   33.308 1.00 14.97 ? 64  PHE B O   1 
ATOM   2459 C CB  . PHE B 1 76  ? 25.501 8.426   34.476 1.00 16.67 ? 64  PHE B CB  1 
ATOM   2460 C CG  . PHE B 1 76  ? 26.201 7.377   35.291 1.00 21.76 ? 64  PHE B CG  1 
ATOM   2461 C CD1 . PHE B 1 76  ? 25.754 7.073   36.579 1.00 24.22 ? 64  PHE B CD1 1 
ATOM   2462 C CD2 . PHE B 1 76  ? 27.362 6.759   34.824 1.00 24.67 ? 64  PHE B CD2 1 
ATOM   2463 C CE1 . PHE B 1 76  ? 26.472 6.165   37.397 1.00 26.44 ? 64  PHE B CE1 1 
ATOM   2464 C CE2 . PHE B 1 76  ? 28.082 5.856   35.635 1.00 23.15 ? 64  PHE B CE2 1 
ATOM   2465 C CZ  . PHE B 1 76  ? 27.635 5.565   36.915 1.00 23.06 ? 64  PHE B CZ  1 
ATOM   2466 N N   . VAL B 1 77  ? 22.706 7.021   34.373 1.00 13.67 ? 65  VAL B N   1 
ATOM   2467 C CA  . VAL B 1 77  ? 21.770 5.986   34.801 1.00 14.73 ? 65  VAL B CA  1 
ATOM   2468 C C   . VAL B 1 77  ? 21.004 5.404   33.597 1.00 16.36 ? 65  VAL B C   1 
ATOM   2469 O O   . VAL B 1 77  ? 20.815 4.187   33.477 1.00 15.96 ? 65  VAL B O   1 
ATOM   2470 C CB  . VAL B 1 77  ? 20.766 6.556   35.844 1.00 15.05 ? 65  VAL B CB  1 
ATOM   2471 C CG1 . VAL B 1 77  ? 19.693 5.527   36.149 1.00 16.61 ? 65  VAL B CG1 1 
ATOM   2472 C CG2 . VAL B 1 77  ? 21.509 6.980   37.143 1.00 14.97 ? 65  VAL B CG2 1 
ATOM   2473 N N   . CYS B 1 78  ? 20.534 6.271   32.711 1.00 14.85 ? 66  CYS B N   1 
ATOM   2474 C CA  . CYS B 1 78  ? 19.801 5.768   31.543 1.00 15.36 ? 66  CYS B CA  1 
ATOM   2475 C C   . CYS B 1 78  ? 20.655 4.879   30.648 1.00 15.05 ? 66  CYS B C   1 
ATOM   2476 O O   . CYS B 1 78  ? 20.174 3.880   30.107 1.00 16.12 ? 66  CYS B O   1 
ATOM   2477 C CB  . CYS B 1 78  ? 19.222 6.938   30.730 1.00 15.35 ? 66  CYS B CB  1 
ATOM   2478 S SG  . CYS B 1 78  ? 17.846 7.708   31.529 1.00 18.02 ? 66  CYS B SG  1 
ATOM   2479 N N   . GLU B 1 79  ? 21.924 5.222   30.488 1.00 14.96 ? 67  GLU B N   1 
ATOM   2480 C CA  . GLU B 1 79  ? 22.802 4.415   29.652 1.00 16.29 ? 67  GLU B CA  1 
ATOM   2481 C C   . GLU B 1 79  ? 22.975 3.029   30.287 1.00 15.08 ? 67  GLU B C   1 
ATOM   2482 O O   . GLU B 1 79  ? 22.990 2.028   29.598 1.00 14.36 ? 67  GLU B O   1 
ATOM   2483 C CB  . GLU B 1 79  ? 24.164 5.084   29.503 1.00 17.46 ? 67  GLU B CB  1 
ATOM   2484 C CG  . GLU B 1 79  ? 25.137 4.284   28.660 1.00 18.69 ? 67  GLU B CG  1 
ATOM   2485 C CD  . GLU B 1 79  ? 26.305 5.113   28.201 1.00 23.12 ? 67  GLU B CD  1 
ATOM   2486 O OE1 . GLU B 1 79  ? 26.360 6.316   28.564 1.00 23.50 ? 67  GLU B OE1 1 
ATOM   2487 O OE2 . GLU B 1 79  ? 27.151 4.570   27.449 1.00 25.60 ? 67  GLU B OE2 1 
ATOM   2488 N N   . ILE B 1 80  ? 23.117 2.983   31.602 1.00 14.71 ? 68  ILE B N   1 
ATOM   2489 C CA  . ILE B 1 80  ? 23.252 1.684   32.247 1.00 16.56 ? 68  ILE B CA  1 
ATOM   2490 C C   . ILE B 1 80  ? 21.966 0.879   32.041 1.00 15.61 ? 68  ILE B C   1 
ATOM   2491 O O   . ILE B 1 80  ? 22.015 -0.320  31.740 1.00 17.28 ? 68  ILE B O   1 
ATOM   2492 C CB  . ILE B 1 80  ? 23.501 1.818   33.758 1.00 14.15 ? 68  ILE B CB  1 
ATOM   2493 C CG1 . ILE B 1 80  ? 24.906 2.372   34.012 1.00 15.42 ? 68  ILE B CG1 1 
ATOM   2494 C CG2 . ILE B 1 80  ? 23.309 0.412   34.445 1.00 17.61 ? 68  ILE B CG2 1 
ATOM   2495 C CD1 . ILE B 1 80  ? 25.141 2.824   35.453 1.00 15.89 ? 68  ILE B CD1 1 
ATOM   2496 N N   . LEU B 1 81  ? 20.822 1.532   32.230 1.00 14.55 ? 69  LEU B N   1 
ATOM   2497 C CA  . LEU B 1 81  ? 19.528 0.856   32.092 1.00 15.14 ? 69  LEU B CA  1 
ATOM   2498 C C   . LEU B 1 81  ? 19.292 0.310   30.674 1.00 16.72 ? 69  LEU B C   1 
ATOM   2499 O O   . LEU B 1 81  ? 18.761 -0.807  30.478 1.00 15.70 ? 69  LEU B O   1 
ATOM   2500 C CB  . LEU B 1 81  ? 18.401 1.820   32.480 1.00 14.57 ? 69  LEU B CB  1 
ATOM   2501 C CG  . LEU B 1 81  ? 18.282 2.110   33.985 1.00 16.54 ? 69  LEU B CG  1 
ATOM   2502 C CD1 . LEU B 1 81  ? 17.275 3.231   34.254 1.00 15.15 ? 69  LEU B CD1 1 
ATOM   2503 C CD2 . LEU B 1 81  ? 17.834 0.821   34.681 1.00 18.49 ? 69  LEU B CD2 1 
ATOM   2504 N N   . TYR B 1 82  ? 19.700 1.103   29.690 1.00 14.79 ? 70  TYR B N   1 
ATOM   2505 C CA  . TYR B 1 82  ? 19.531 0.740   28.293 1.00 14.44 ? 70  TYR B CA  1 
ATOM   2506 C C   . TYR B 1 82  ? 20.449 -0.443  27.952 1.00 15.67 ? 70  TYR B C   1 
ATOM   2507 O O   . TYR B 1 82  ? 20.017 -1.399  27.339 1.00 14.91 ? 70  TYR B O   1 
ATOM   2508 C CB  . TYR B 1 82  ? 19.889 1.959   27.410 1.00 13.23 ? 70  TYR B CB  1 
ATOM   2509 C CG  . TYR B 1 82  ? 19.761 1.689   25.937 1.00 14.11 ? 70  TYR B CG  1 
ATOM   2510 C CD1 . TYR B 1 82  ? 18.579 1.962   25.253 1.00 12.33 ? 70  TYR B CD1 1 
ATOM   2511 C CD2 . TYR B 1 82  ? 20.801 1.067   25.240 1.00 14.71 ? 70  TYR B CD2 1 
ATOM   2512 C CE1 . TYR B 1 82  ? 18.435 1.600   23.893 1.00 13.15 ? 70  TYR B CE1 1 
ATOM   2513 C CE2 . TYR B 1 82  ? 20.674 0.704   23.901 1.00 14.03 ? 70  TYR B CE2 1 
ATOM   2514 C CZ  . TYR B 1 82  ? 19.486 0.970   23.232 1.00 13.60 ? 70  TYR B CZ  1 
ATOM   2515 O OH  . TYR B 1 82  ? 19.377 0.552   21.915 1.00 15.26 ? 70  TYR B OH  1 
ATOM   2516 N N   . LYS B 1 83  ? 21.721 -0.376  28.366 1.00 17.11 ? 71  LYS B N   1 
ATOM   2517 C CA  . LYS B 1 83  ? 22.670 -1.435  28.060 1.00 19.92 ? 71  LYS B CA  1 
ATOM   2518 C C   . LYS B 1 83  ? 22.521 -2.735  28.835 1.00 20.22 ? 71  LYS B C   1 
ATOM   2519 O O   . LYS B 1 83  ? 22.749 -3.800  28.274 1.00 19.44 ? 71  LYS B O   1 
ATOM   2520 C CB  . LYS B 1 83  ? 24.104 -0.912  28.219 1.00 21.26 ? 71  LYS B CB  1 
ATOM   2521 C CG  . LYS B 1 83  ? 24.445 0.129   27.186 1.00 20.81 ? 71  LYS B CG  1 
ATOM   2522 C CD  . LYS B 1 83  ? 25.910 0.548   27.250 1.00 23.33 ? 71  LYS B CD  1 
ATOM   2523 C CE  . LYS B 1 83  ? 26.161 1.606   26.181 1.00 23.47 ? 71  LYS B CE  1 
ATOM   2524 N NZ  . LYS B 1 83  ? 27.616 2.029   26.087 1.00 27.45 ? 71  LYS B NZ  1 
ATOM   2525 N N   . LYS B 1 84  ? 22.091 -2.645  30.092 1.00 20.57 ? 72  LYS B N   1 
ATOM   2526 C CA  . LYS B 1 84  ? 21.986 -3.810  30.951 1.00 22.92 ? 72  LYS B CA  1 
ATOM   2527 C C   . LYS B 1 84  ? 20.645 -4.512  31.017 1.00 24.92 ? 72  LYS B C   1 
ATOM   2528 O O   . LYS B 1 84  ? 20.590 -5.681  31.403 1.00 24.22 ? 72  LYS B O   1 
ATOM   2529 C CB  . LYS B 1 84  ? 22.436 -3.441  32.363 1.00 23.45 ? 72  LYS B CB  1 
ATOM   2530 C CG  . LYS B 1 84  ? 23.840 -2.861  32.407 1.00 29.20 ? 72  LYS B CG  1 
ATOM   2531 C CD  . LYS B 1 84  ? 24.820 -3.733  33.227 1.00 35.59 ? 72  LYS B CD  1 
ATOM   2532 C CE  . LYS B 1 84  ? 24.873 -5.176  32.708 1.00 37.45 ? 72  LYS B CE  1 
ATOM   2533 N NZ  . LYS B 1 84  ? 25.519 -6.120  33.668 1.00 36.22 ? 72  LYS B NZ  1 
ATOM   2534 N N   . TYR B 1 85  ? 19.569 -3.822  30.651 1.00 23.77 ? 73  TYR B N   1 
ATOM   2535 C CA  . TYR B 1 85  ? 18.255 -4.435  30.684 1.00 25.07 ? 73  TYR B CA  1 
ATOM   2536 C C   . TYR B 1 85  ? 17.523 -4.281  29.347 1.00 26.90 ? 73  TYR B C   1 
ATOM   2537 O O   . TYR B 1 85  ? 16.469 -3.647  29.259 1.00 27.12 ? 73  TYR B O   1 
ATOM   2538 C CB  . TYR B 1 85  ? 17.443 -3.829  31.823 1.00 26.85 ? 73  TYR B CB  1 
ATOM   2539 C CG  . TYR B 1 85  ? 18.133 -3.967  33.164 1.00 30.23 ? 73  TYR B CG  1 
ATOM   2540 C CD1 . TYR B 1 85  ? 18.024 -5.147  33.922 1.00 30.55 ? 73  TYR B CD1 1 
ATOM   2541 C CD2 . TYR B 1 85  ? 18.932 -2.945  33.648 1.00 29.93 ? 73  TYR B CD2 1 
ATOM   2542 C CE1 . TYR B 1 85  ? 18.704 -5.289  35.136 1.00 32.55 ? 73  TYR B CE1 1 
ATOM   2543 C CE2 . TYR B 1 85  ? 19.613 -3.072  34.850 1.00 32.73 ? 73  TYR B CE2 1 
ATOM   2544 C CZ  . TYR B 1 85  ? 19.502 -4.241  35.595 1.00 32.64 ? 73  TYR B CZ  1 
ATOM   2545 O OH  . TYR B 1 85  ? 20.207 -4.336  36.778 1.00 32.30 ? 73  TYR B OH  1 
ATOM   2546 N N   . PRO B 1 86  ? 18.076 -4.865  28.283 1.00 28.72 ? 74  PRO B N   1 
ATOM   2547 C CA  . PRO B 1 86  ? 17.461 -4.783  26.959 1.00 31.91 ? 74  PRO B CA  1 
ATOM   2548 C C   . PRO B 1 86  ? 16.040 -5.348  26.879 1.00 34.22 ? 74  PRO B C   1 
ATOM   2549 O O   . PRO B 1 86  ? 15.246 -4.931  26.032 1.00 35.60 ? 74  PRO B O   1 
ATOM   2550 C CB  . PRO B 1 86  ? 18.439 -5.556  26.087 1.00 31.18 ? 74  PRO B CB  1 
ATOM   2551 C CG  . PRO B 1 86  ? 19.041 -6.541  27.053 1.00 31.11 ? 74  PRO B CG  1 
ATOM   2552 C CD  . PRO B 1 86  ? 19.312 -5.659  28.227 1.00 30.30 ? 74  PRO B CD  1 
ATOM   2553 N N   . GLU B 1 87  ? 15.710 -6.276  27.770 1.00 36.47 ? 75  GLU B N   1 
ATOM   2554 C CA  . GLU B 1 87  ? 14.393 -6.887  27.740 1.00 39.74 ? 75  GLU B CA  1 
ATOM   2555 C C   . GLU B 1 87  ? 13.353 -6.173  28.589 1.00 38.70 ? 75  GLU B C   1 
ATOM   2556 O O   . GLU B 1 87  ? 12.161 -6.429  28.446 1.00 39.99 ? 75  GLU B O   1 
ATOM   2557 C CB  . GLU B 1 87  ? 14.499 -8.359  28.159 1.00 43.14 ? 75  GLU B CB  1 
ATOM   2558 C CG  . GLU B 1 87  ? 15.672 -9.097  27.505 1.00 48.28 ? 75  GLU B CG  1 
ATOM   2559 C CD  . GLU B 1 87  ? 15.720 -8.924  25.984 1.00 50.39 ? 75  GLU B CD  1 
ATOM   2560 O OE1 . GLU B 1 87  ? 16.708 -9.387  25.373 1.00 52.49 ? 75  GLU B OE1 1 
ATOM   2561 O OE2 . GLU B 1 87  ? 14.780 -8.332  25.395 1.00 52.12 ? 75  GLU B OE2 1 
ATOM   2562 N N   . ALA B 1 88  ? 13.800 -5.273  29.461 1.00 37.42 ? 76  ALA B N   1 
ATOM   2563 C CA  . ALA B 1 88  ? 12.890 -4.537  30.338 1.00 35.59 ? 76  ALA B CA  1 
ATOM   2564 C C   . ALA B 1 88  ? 11.921 -3.658  29.558 1.00 35.82 ? 76  ALA B C   1 
ATOM   2565 O O   . ALA B 1 88  ? 12.298 -3.061  28.545 1.00 35.92 ? 76  ALA B O   1 
ATOM   2566 C CB  . ALA B 1 88  ? 13.690 -3.677  31.315 1.00 33.39 ? 76  ALA B CB  1 
ATOM   2567 N N   . GLU B 1 89  ? 10.675 -3.584  30.024 1.00 35.16 ? 77  GLU B N   1 
ATOM   2568 C CA  . GLU B 1 89  ? 9.678  -2.738  29.383 1.00 36.55 ? 77  GLU B CA  1 
ATOM   2569 C C   . GLU B 1 89  ? 10.124 -1.306  29.666 1.00 35.88 ? 77  GLU B C   1 
ATOM   2570 O O   . GLU B 1 89  ? 10.711 -1.048  30.722 1.00 34.71 ? 77  GLU B O   1 
ATOM   2571 C CB  . GLU B 1 89  ? 8.294  -2.965  30.000 1.00 39.43 ? 77  GLU B CB  1 
ATOM   2572 C CG  . GLU B 1 89  ? 7.607  -4.277  29.628 1.00 44.43 ? 77  GLU B CG  1 
ATOM   2573 C CD  . GLU B 1 89  ? 6.232  -4.417  30.297 1.00 48.65 ? 77  GLU B CD  1 
ATOM   2574 O OE1 . GLU B 1 89  ? 5.448  -5.317  29.904 1.00 50.99 ? 77  GLU B OE1 1 
ATOM   2575 O OE2 . GLU B 1 89  ? 5.936  -3.623  31.226 1.00 50.43 ? 77  GLU B OE2 1 
ATOM   2576 N N   . VAL B 1 90  ? 9.843  -0.374  28.752 1.00 35.25 ? 78  VAL B N   1 
ATOM   2577 C CA  . VAL B 1 90  ? 10.265 1.015   28.949 1.00 35.95 ? 78  VAL B CA  1 
ATOM   2578 C C   . VAL B 1 90  ? 9.716  1.597   30.240 1.00 35.19 ? 78  VAL B C   1 
ATOM   2579 O O   . VAL B 1 90  ? 10.340 2.474   30.852 1.00 35.30 ? 78  VAL B O   1 
ATOM   2580 C CB  . VAL B 1 90  ? 9.848  1.939   27.769 1.00 38.21 ? 78  VAL B CB  1 
ATOM   2581 C CG1 . VAL B 1 90  ? 10.393 3.347   28.002 1.00 38.15 ? 78  VAL B CG1 1 
ATOM   2582 C CG2 . VAL B 1 90  ? 10.407 1.398   26.458 1.00 40.01 ? 78  VAL B CG2 1 
ATOM   2583 N N   . GLY B 1 91  ? 8.555  1.101   30.656 1.00 34.16 ? 79  GLY B N   1 
ATOM   2584 C CA  . GLY B 1 91  ? 7.944  1.573   31.884 1.00 32.61 ? 79  GLY B CA  1 
ATOM   2585 C C   . GLY B 1 91  ? 8.799  1.208   33.088 1.00 32.42 ? 79  GLY B C   1 
ATOM   2586 O O   . GLY B 1 91  ? 8.874  1.966   34.060 1.00 32.37 ? 79  GLY B O   1 
ATOM   2587 N N   . ASP B 1 92  ? 9.443  0.047   33.028 1.00 31.44 ? 80  ASP B N   1 
ATOM   2588 C CA  . ASP B 1 92  ? 10.295 -0.392  34.124 1.00 31.47 ? 80  ASP B CA  1 
ATOM   2589 C C   . ASP B 1 92  ? 11.543 0.493   34.108 1.00 29.40 ? 80  ASP B C   1 
ATOM   2590 O O   . ASP B 1 92  ? 12.024 0.902   35.165 1.00 28.16 ? 80  ASP B O   1 
ATOM   2591 C CB  . ASP B 1 92  ? 10.705 -1.873  33.977 1.00 33.09 ? 80  ASP B CB  1 
ATOM   2592 C CG  . ASP B 1 92  ? 9.524  -2.838  34.118 1.00 37.64 ? 80  ASP B CG  1 
ATOM   2593 O OD1 . ASP B 1 92  ? 8.635  -2.577  34.963 1.00 38.77 ? 80  ASP B OD1 1 
ATOM   2594 O OD2 . ASP B 1 92  ? 9.497  -3.872  33.395 1.00 39.95 ? 80  ASP B OD2 1 
ATOM   2595 N N   . LEU B 1 93  ? 12.063 0.777   32.912 1.00 26.25 ? 81  LEU B N   1 
ATOM   2596 C CA  . LEU B 1 93  ? 13.241 1.640   32.793 1.00 25.57 ? 81  LEU B CA  1 
ATOM   2597 C C   . LEU B 1 93  ? 12.989 3.030   33.418 1.00 24.69 ? 81  LEU B C   1 
ATOM   2598 O O   . LEU B 1 93  ? 13.829 3.522   34.186 1.00 23.45 ? 81  LEU B O   1 
ATOM   2599 C CB  . LEU B 1 93  ? 13.681 1.789   31.327 1.00 25.58 ? 81  LEU B CB  1 
ATOM   2600 C CG  . LEU B 1 93  ? 14.004 0.532   30.507 1.00 26.91 ? 81  LEU B CG  1 
ATOM   2601 C CD1 . LEU B 1 93  ? 14.537 0.961   29.163 1.00 27.56 ? 81  LEU B CD1 1 
ATOM   2602 C CD2 . LEU B 1 93  ? 15.042 -0.342  31.211 1.00 28.23 ? 81  LEU B CD2 1 
ATOM   2603 N N   . ALA B 1 94  ? 11.841 3.649   33.125 1.00 23.92 ? 82  ALA B N   1 
ATOM   2604 C CA  . ALA B 1 94  ? 11.494 4.965   33.686 1.00 23.41 ? 82  ALA B CA  1 
ATOM   2605 C C   . ALA B 1 94  ? 11.322 4.946   35.220 1.00 25.14 ? 82  ALA B C   1 
ATOM   2606 O O   . ALA B 1 94  ? 11.659 5.921   35.939 1.00 23.85 ? 82  ALA B O   1 
ATOM   2607 C CB  . ALA B 1 94  ? 10.207 5.487   33.030 1.00 26.70 ? 82  ALA B CB  1 
ATOM   2608 N N   . ARG B 1 95  ? 10.767 3.843   35.718 1.00 25.09 ? 83  ARG B N   1 
ATOM   2609 C CA  . ARG B 1 95  ? 10.559 3.662   37.154 1.00 25.30 ? 83  ARG B CA  1 
ATOM   2610 C C   . ARG B 1 95  ? 11.913 3.525   37.838 1.00 23.13 ? 83  ARG B C   1 
ATOM   2611 O O   . ARG B 1 95  ? 12.169 4.159   38.848 1.00 22.69 ? 83  ARG B O   1 
ATOM   2612 C CB  . ARG B 1 95  ? 9.737  2.391   37.436 1.00 25.74 ? 83  ARG B CB  1 
ATOM   2613 C CG  . ARG B 1 95  ? 9.816  1.949   38.907 1.00 30.43 ? 83  ARG B CG  1 
ATOM   2614 C CD  . ARG B 1 95  ? 9.017  0.666   39.216 1.00 30.71 ? 83  ARG B CD  1 
ATOM   2615 N NE  . ARG B 1 95  ? 9.530  -0.520  38.528 1.00 32.18 ? 83  ARG B NE  1 
ATOM   2616 C CZ  . ARG B 1 95  ? 10.616 -1.197  38.900 1.00 34.23 ? 83  ARG B CZ  1 
ATOM   2617 N NH1 . ARG B 1 95  ? 11.318 -0.812  39.967 1.00 35.31 ? 83  ARG B NH1 1 
ATOM   2618 N NH2 . ARG B 1 95  ? 11.006 -2.253  38.201 1.00 34.00 ? 83  ARG B NH2 1 
ATOM   2619 N N   . VAL B 1 96  ? 12.775 2.691   37.276 1.00 22.80 ? 84  VAL B N   1 
ATOM   2620 C CA  . VAL B 1 96  ? 14.083 2.483   37.875 1.00 22.84 ? 84  VAL B CA  1 
ATOM   2621 C C   . VAL B 1 96  ? 14.926 3.741   37.800 1.00 23.22 ? 84  VAL B C   1 
ATOM   2622 O O   . VAL B 1 96  ? 15.666 4.051   38.734 1.00 22.77 ? 84  VAL B O   1 
ATOM   2623 C CB  . VAL B 1 96  ? 14.833 1.321   37.231 1.00 19.75 ? 84  VAL B CB  1 
ATOM   2624 C CG1 . VAL B 1 96  ? 16.226 1.183   37.867 1.00 22.40 ? 84  VAL B CG1 1 
ATOM   2625 C CG2 . VAL B 1 96  ? 14.055 0.027   37.464 1.00 22.60 ? 84  VAL B CG2 1 
ATOM   2626 N N   . LYS B 1 97  ? 14.798 4.477   36.700 1.00 23.81 ? 85  LYS B N   1 
ATOM   2627 C CA  . LYS B 1 97  ? 15.552 5.715   36.531 1.00 23.38 ? 85  LYS B CA  1 
ATOM   2628 C C   . LYS B 1 97  ? 15.245 6.685   37.668 1.00 23.57 ? 85  LYS B C   1 
ATOM   2629 O O   . LYS B 1 97  ? 16.166 7.204   38.337 1.00 21.71 ? 85  LYS B O   1 
ATOM   2630 C CB  . LYS B 1 97  ? 15.214 6.396   35.200 1.00 24.94 ? 85  LYS B CB  1 
ATOM   2631 C CG  . LYS B 1 97  ? 16.026 7.669   34.993 1.00 27.15 ? 85  LYS B CG  1 
ATOM   2632 C CD  . LYS B 1 97  ? 15.448 8.568   33.910 1.00 32.24 ? 85  LYS B CD  1 
ATOM   2633 C CE  . LYS B 1 97  ? 14.176 9.276   34.383 1.00 35.95 ? 85  LYS B CE  1 
ATOM   2634 N NZ  . LYS B 1 97  ? 13.625 10.213  33.339 1.00 37.00 ? 85  LYS B NZ  1 
ATOM   2635 N N   . SER B 1 98  ? 13.950 6.926   37.897 1.00 22.46 ? 86  SER B N   1 
ATOM   2636 C CA  . SER B 1 98  ? 13.543 7.859   38.942 1.00 23.74 ? 86  SER B CA  1 
ATOM   2637 C C   . SER B 1 98  ? 14.059 7.467   40.301 1.00 23.05 ? 86  SER B C   1 
ATOM   2638 O O   . SER B 1 98  ? 14.515 8.318   41.057 1.00 24.27 ? 86  SER B O   1 
ATOM   2639 C CB  . SER B 1 98  ? 12.026 7.991   38.999 1.00 25.08 ? 86  SER B CB  1 
ATOM   2640 O OG  . SER B 1 98  ? 11.573 8.436   37.747 1.00 28.22 ? 86  SER B OG  1 
ATOM   2641 N N   . ALA B 1 99  ? 13.997 6.179   40.611 1.00 23.12 ? 87  ALA B N   1 
ATOM   2642 C CA  . ALA B 1 99  ? 14.473 5.717   41.903 1.00 22.80 ? 87  ALA B CA  1 
ATOM   2643 C C   . ALA B 1 99  ? 15.993 5.862   42.009 1.00 23.88 ? 87  ALA B C   1 
ATOM   2644 O O   . ALA B 1 99  ? 16.512 6.371   43.028 1.00 22.63 ? 87  ALA B O   1 
ATOM   2645 C CB  . ALA B 1 99  ? 14.068 4.262   42.112 1.00 23.97 ? 87  ALA B CB  1 
ATOM   2646 N N   . ALA B 1 100 ? 16.701 5.440   40.956 1.00 21.94 ? 88  ALA B N   1 
ATOM   2647 C CA  . ALA B 1 100 ? 18.162 5.487   40.951 1.00 24.17 ? 88  ALA B CA  1 
ATOM   2648 C C   . ALA B 1 100 ? 18.745 6.895   41.084 1.00 24.55 ? 88  ALA B C   1 
ATOM   2649 O O   . ALA B 1 100 ? 19.799 7.081   41.695 1.00 26.42 ? 88  ALA B O   1 
ATOM   2650 C CB  . ALA B 1 100 ? 18.715 4.797   39.688 1.00 24.19 ? 88  ALA B CB  1 
ATOM   2651 N N   . ALA B 1 101 ? 18.059 7.886   40.530 1.00 24.24 ? 89  ALA B N   1 
ATOM   2652 C CA  . ALA B 1 101 ? 18.528 9.258   40.599 1.00 24.83 ? 89  ALA B CA  1 
ATOM   2653 C C   . ALA B 1 101 ? 17.884 10.007  41.767 1.00 24.40 ? 89  ALA B C   1 
ATOM   2654 O O   . ALA B 1 101 ? 18.056 11.214  41.884 1.00 25.51 ? 89  ALA B O   1 
ATOM   2655 C CB  . ALA B 1 101 ? 18.204 9.985   39.293 1.00 23.70 ? 89  ALA B CB  1 
ATOM   2656 N N   . SER B 1 102 ? 17.139 9.308   42.622 1.00 23.49 ? 90  SER B N   1 
ATOM   2657 C CA  . SER B 1 102 ? 16.453 9.970   43.737 1.00 22.70 ? 90  SER B CA  1 
ATOM   2658 C C   . SER B 1 102 ? 17.359 10.556  44.830 1.00 22.43 ? 90  SER B C   1 
ATOM   2659 O O   . SER B 1 102 ? 18.495 10.130  45.021 1.00 21.01 ? 90  SER B O   1 
ATOM   2660 C CB  . SER B 1 102 ? 15.442 9.012   44.393 1.00 21.93 ? 90  SER B CB  1 
ATOM   2661 O OG  . SER B 1 102 ? 16.106 7.986   45.114 1.00 23.09 ? 90  SER B OG  1 
ATOM   2662 N N   . GLU B 1 103 ? 16.831 11.544  45.544 1.00 21.44 ? 91  GLU B N   1 
ATOM   2663 C CA  . GLU B 1 103 ? 17.565 12.175  46.633 1.00 24.17 ? 91  GLU B CA  1 
ATOM   2664 C C   . GLU B 1 103 ? 18.026 11.124  47.640 1.00 23.65 ? 91  GLU B C   1 
ATOM   2665 O O   . GLU B 1 103 ? 19.170 11.160  48.088 1.00 23.48 ? 91  GLU B O   1 
ATOM   2666 C CB  . GLU B 1 103 ? 16.678 13.206  47.323 1.00 24.12 ? 91  GLU B CB  1 
ATOM   2667 C CG  . GLU B 1 103 ? 17.376 13.999  48.391 1.00 26.58 ? 91  GLU B CG  1 
ATOM   2668 C CD  . GLU B 1 103 ? 16.409 14.855  49.159 1.00 25.69 ? 91  GLU B CD  1 
ATOM   2669 O OE1 . GLU B 1 103 ? 15.757 14.323  50.076 1.00 29.75 ? 91  GLU B OE1 1 
ATOM   2670 O OE2 . GLU B 1 103 ? 16.290 16.049  48.822 1.00 26.61 ? 91  GLU B OE2 1 
ATOM   2671 N N   . GLU B 1 104 ? 17.137 10.182  47.987 1.00 23.63 ? 92  GLU B N   1 
ATOM   2672 C CA  . GLU B 1 104 ? 17.482 9.121   48.924 1.00 24.68 ? 92  GLU B CA  1 
ATOM   2673 C C   . GLU B 1 104 ? 18.754 8.363   48.521 1.00 22.52 ? 92  GLU B C   1 
ATOM   2674 O O   . GLU B 1 104 ? 19.664 8.227   49.324 1.00 21.49 ? 92  GLU B O   1 
ATOM   2675 C CB  . GLU B 1 104 ? 16.345 8.095   49.067 1.00 28.91 ? 92  GLU B CB  1 
ATOM   2676 C CG  . GLU B 1 104 ? 15.251 8.464   50.041 1.00 35.21 ? 92  GLU B CG  1 
ATOM   2677 C CD  . GLU B 1 104 ? 14.631 7.222   50.692 1.00 39.02 ? 92  GLU B CD  1 
ATOM   2678 O OE1 . GLU B 1 104 ? 14.156 6.330   49.952 1.00 40.40 ? 92  GLU B OE1 1 
ATOM   2679 O OE2 . GLU B 1 104 ? 14.625 7.138   51.948 1.00 42.51 ? 92  GLU B OE2 1 
ATOM   2680 N N   . VAL B 1 105 ? 18.786 7.841   47.292 1.00 19.98 ? 93  VAL B N   1 
ATOM   2681 C CA  . VAL B 1 105 ? 19.949 7.106   46.790 1.00 17.82 ? 93  VAL B CA  1 
ATOM   2682 C C   . VAL B 1 105 ? 21.192 8.001   46.735 1.00 17.26 ? 93  VAL B C   1 
ATOM   2683 O O   . VAL B 1 105 ? 22.251 7.631   47.251 1.00 17.45 ? 93  VAL B O   1 
ATOM   2684 C CB  . VAL B 1 105 ? 19.673 6.520   45.376 1.00 17.79 ? 93  VAL B CB  1 
ATOM   2685 C CG1 . VAL B 1 105 ? 20.958 6.026   44.747 1.00 20.16 ? 93  VAL B CG1 1 
ATOM   2686 C CG2 . VAL B 1 105 ? 18.688 5.378   45.482 1.00 18.23 ? 93  VAL B CG2 1 
ATOM   2687 N N   . LEU B 1 106 ? 21.057 9.192   46.151 1.00 16.15 ? 94  LEU B N   1 
ATOM   2688 C CA  . LEU B 1 106 ? 22.181 10.122  46.078 1.00 17.05 ? 94  LEU B CA  1 
ATOM   2689 C C   . LEU B 1 106 ? 22.753 10.504  47.448 1.00 15.83 ? 94  LEU B C   1 
ATOM   2690 O O   . LEU B 1 106 ? 23.954 10.688  47.593 1.00 18.16 ? 94  LEU B O   1 
ATOM   2691 C CB  . LEU B 1 106 ? 21.771 11.409  45.335 1.00 16.30 ? 94  LEU B CB  1 
ATOM   2692 C CG  . LEU B 1 106 ? 21.276 11.137  43.913 1.00 16.58 ? 94  LEU B CG  1 
ATOM   2693 C CD1 . LEU B 1 106 ? 21.081 12.459  43.158 1.00 18.00 ? 94  LEU B CD1 1 
ATOM   2694 C CD2 . LEU B 1 106 ? 22.250 10.244  43.219 1.00 16.20 ? 94  LEU B CD2 1 
ATOM   2695 N N   . ALA B 1 107 ? 21.905 10.641  48.457 1.00 16.38 ? 95  ALA B N   1 
ATOM   2696 C CA  . ALA B 1 107 ? 22.436 11.001  49.760 1.00 18.33 ? 95  ALA B CA  1 
ATOM   2697 C C   . ALA B 1 107 ? 23.214 9.819   50.321 1.00 19.11 ? 95  ALA B C   1 
ATOM   2698 O O   . ALA B 1 107 ? 24.245 10.013  50.975 1.00 20.79 ? 95  ALA B O   1 
ATOM   2699 C CB  . ALA B 1 107 ? 21.317 11.404  50.720 1.00 15.87 ? 95  ALA B CB  1 
ATOM   2700 N N   . MET B 1 108 ? 22.714 8.611   50.065 1.00 20.30 ? 96  MET B N   1 
ATOM   2701 C CA  . MET B 1 108 ? 23.358 7.363   50.528 1.00 20.75 ? 96  MET B CA  1 
ATOM   2702 C C   . MET B 1 108 ? 24.773 7.297   49.923 1.00 21.49 ? 96  MET B C   1 
ATOM   2703 O O   . MET B 1 108 ? 25.763 7.037   50.612 1.00 22.69 ? 96  MET B O   1 
ATOM   2704 C CB  . MET B 1 108 ? 22.516 6.139   50.084 1.00 17.68 ? 96  MET B CB  1 
ATOM   2705 C CG  . MET B 1 108 ? 23.060 4.777   50.571 1.00 22.41 ? 96  MET B CG  1 
ATOM   2706 S SD  . MET B 1 108 ? 22.135 3.326   49.923 1.00 17.01 ? 96  MET B SD  1 
ATOM   2707 C CE  . MET B 1 108 ? 22.207 3.606   48.153 1.00 24.08 ? 96  MET B CE  1 
ATOM   2708 N N   . VAL B 1 109 ? 24.855 7.558   48.625 1.00 22.74 ? 97  VAL B N   1 
ATOM   2709 C CA  . VAL B 1 109 ? 26.121 7.560   47.899 1.00 22.23 ? 97  VAL B CA  1 
ATOM   2710 C C   . VAL B 1 109 ? 27.065 8.642   48.460 1.00 21.71 ? 97  VAL B C   1 
ATOM   2711 O O   . VAL B 1 109 ? 28.258 8.410   48.677 1.00 21.06 ? 97  VAL B O   1 
ATOM   2712 C CB  . VAL B 1 109 ? 25.853 7.817   46.389 1.00 22.66 ? 97  VAL B CB  1 
ATOM   2713 C CG1 . VAL B 1 109 ? 27.157 7.894   45.615 1.00 24.71 ? 97  VAL B CG1 1 
ATOM   2714 C CG2 . VAL B 1 109 ? 24.975 6.698   45.828 1.00 24.82 ? 97  VAL B CG2 1 
ATOM   2715 N N   . SER B 1 110 ? 26.529 9.828   48.688 1.00 22.35 ? 98  SER B N   1 
ATOM   2716 C CA  . SER B 1 110 ? 27.325 10.914  49.231 1.00 21.48 ? 98  SER B CA  1 
ATOM   2717 C C   . SER B 1 110 ? 27.904 10.510  50.566 1.00 22.62 ? 98  SER B C   1 
ATOM   2718 O O   . SER B 1 110 ? 29.080 10.739  50.845 1.00 21.65 ? 98  SER B O   1 
ATOM   2719 C CB  . SER B 1 110 ? 26.468 12.154  49.413 1.00 21.73 ? 98  SER B CB  1 
ATOM   2720 O OG  . SER B 1 110 ? 26.069 12.637  48.157 1.00 25.74 ? 98  SER B OG  1 
ATOM   2721 N N   . ARG B 1 111 ? 27.071 9.911   51.405 1.00 23.96 ? 99  ARG B N   1 
ATOM   2722 C CA  . ARG B 1 111 ? 27.538 9.486   52.716 1.00 25.31 ? 99  ARG B CA  1 
ATOM   2723 C C   . ARG B 1 111 ? 28.626 8.417   52.610 1.00 27.20 ? 99  ARG B C   1 
ATOM   2724 O O   . ARG B 1 111 ? 29.556 8.398   53.418 1.00 28.33 ? 99  ARG B O   1 
ATOM   2725 C CB  . ARG B 1 111 ? 26.358 8.990   53.572 1.00 24.77 ? 99  ARG B CB  1 
ATOM   2726 C CG  . ARG B 1 111 ? 25.484 10.134  54.067 1.00 23.76 ? 99  ARG B CG  1 
ATOM   2727 C CD  . ARG B 1 111 ? 24.398 9.695   55.025 1.00 22.85 ? 99  ARG B CD  1 
ATOM   2728 N NE  . ARG B 1 111 ? 23.680 10.857  55.513 1.00 23.02 ? 99  ARG B NE  1 
ATOM   2729 C CZ  . ARG B 1 111 ? 22.489 11.261  55.088 1.00 22.85 ? 99  ARG B CZ  1 
ATOM   2730 N NH1 . ARG B 1 111 ? 21.835 10.583  54.146 1.00 23.26 ? 99  ARG B NH1 1 
ATOM   2731 N NH2 . ARG B 1 111 ? 21.960 12.361  55.604 1.00 21.15 ? 99  ARG B NH2 1 
ATOM   2732 N N   . LYS B 1 112 ? 28.529 7.540   51.615 1.00 28.38 ? 100 LYS B N   1 
ATOM   2733 C CA  . LYS B 1 112 ? 29.543 6.511   51.451 1.00 30.57 ? 100 LYS B CA  1 
ATOM   2734 C C   . LYS B 1 112 ? 30.900 7.159   51.163 1.00 31.23 ? 100 LYS B C   1 
ATOM   2735 O O   . LYS B 1 112 ? 31.929 6.663   51.600 1.00 29.09 ? 100 LYS B O   1 
ATOM   2736 C CB  . LYS B 1 112 ? 29.163 5.545   50.328 1.00 33.56 ? 100 LYS B CB  1 
ATOM   2737 C CG  . LYS B 1 112 ? 27.987 4.634   50.670 1.00 37.74 ? 100 LYS B CG  1 
ATOM   2738 C CD  . LYS B 1 112 ? 27.649 3.668   49.512 1.00 42.06 ? 100 LYS B CD  1 
ATOM   2739 C CE  . LYS B 1 112 ? 26.378 2.857   49.811 1.00 43.99 ? 100 LYS B CE  1 
ATOM   2740 N NZ  . LYS B 1 112 ? 26.030 1.842   48.766 1.00 45.39 ? 100 LYS B NZ  1 
ATOM   2741 N N   . MET B 1 113 ? 30.882 8.283   50.444 1.00 29.96 ? 101 MET B N   1 
ATOM   2742 C CA  . MET B 1 113 ? 32.096 9.044   50.107 1.00 29.16 ? 101 MET B CA  1 
ATOM   2743 C C   . MET B 1 113 ? 32.434 10.048  51.213 1.00 27.90 ? 101 MET B C   1 
ATOM   2744 O O   . MET B 1 113 ? 33.316 10.885  51.012 1.00 28.51 ? 101 MET B O   1 
ATOM   2745 C CB  . MET B 1 113 ? 31.884 9.925   48.861 1.00 28.15 ? 101 MET B CB  1 
ATOM   2746 C CG  . MET B 1 113 ? 31.728 9.284   47.522 1.00 27.19 ? 101 MET B CG  1 
ATOM   2747 S SD  . MET B 1 113 ? 31.457 10.694  46.391 1.00 17.49 ? 101 MET B SD  1 
ATOM   2748 C CE  . MET B 1 113 ? 32.981 11.471  46.401 1.00 22.48 ? 101 MET B CE  1 
ATOM   2749 N N   . ASN B 1 114 ? 31.717 10.012  52.334 1.00 25.84 ? 102 ASN B N   1 
ATOM   2750 C CA  . ASN B 1 114 ? 31.952 10.976  53.413 1.00 25.41 ? 102 ASN B CA  1 
ATOM   2751 C C   . ASN B 1 114 ? 31.976 12.403  52.832 1.00 23.05 ? 102 ASN B C   1 
ATOM   2752 O O   . ASN B 1 114 ? 32.794 13.216  53.229 1.00 20.97 ? 102 ASN B O   1 
ATOM   2753 C CB  . ASN B 1 114 ? 33.308 10.725  54.116 1.00 29.36 ? 102 ASN B CB  1 
ATOM   2754 C CG  . ASN B 1 114 ? 33.396 9.346   54.768 1.00 34.03 ? 102 ASN B CG  1 
ATOM   2755 O OD1 . ASN B 1 114 ? 32.528 8.960   55.565 1.00 35.80 ? 102 ASN B OD1 1 
ATOM   2756 N ND2 . ASN B 1 114 ? 34.456 8.602   54.441 1.00 35.81 ? 102 ASN B ND2 1 
ATOM   2757 N N   . LEU B 1 115 ? 31.067 12.703  51.911 1.00 22.18 ? 103 LEU B N   1 
ATOM   2758 C CA  . LEU B 1 115 ? 31.018 14.016  51.287 1.00 20.75 ? 103 LEU B CA  1 
ATOM   2759 C C   . LEU B 1 115 ? 30.712 15.122  52.295 1.00 20.57 ? 103 LEU B C   1 
ATOM   2760 O O   . LEU B 1 115 ? 31.202 16.244  52.162 1.00 17.73 ? 103 LEU B O   1 
ATOM   2761 C CB  . LEU B 1 115 ? 29.955 14.037  50.177 1.00 22.01 ? 103 LEU B CB  1 
ATOM   2762 C CG  . LEU B 1 115 ? 30.403 14.371  48.745 1.00 24.49 ? 103 LEU B CG  1 
ATOM   2763 C CD1 . LEU B 1 115 ? 29.179 14.797  47.921 1.00 23.45 ? 103 LEU B CD1 1 
ATOM   2764 C CD2 . LEU B 1 115 ? 31.397 15.457  48.723 1.00 22.21 ? 103 LEU B CD2 1 
ATOM   2765 N N   . GLY B 1 116 ? 29.877 14.802  53.281 1.00 18.10 ? 104 GLY B N   1 
ATOM   2766 C CA  . GLY B 1 116 ? 29.512 15.766  54.297 1.00 17.80 ? 104 GLY B CA  1 
ATOM   2767 C C   . GLY B 1 116 ? 30.691 16.496  54.941 1.00 20.16 ? 104 GLY B C   1 
ATOM   2768 O O   . GLY B 1 116 ? 30.586 17.667  55.332 1.00 18.49 ? 104 GLY B O   1 
ATOM   2769 N N   . LYS B 1 117 ? 31.833 15.836  55.027 1.00 20.20 ? 105 LYS B N   1 
ATOM   2770 C CA  . LYS B 1 117 ? 32.965 16.475  55.656 1.00 22.03 ? 105 LYS B CA  1 
ATOM   2771 C C   . LYS B 1 117 ? 33.656 17.512  54.767 1.00 20.63 ? 105 LYS B C   1 
ATOM   2772 O O   . LYS B 1 117 ? 34.375 18.347  55.280 1.00 18.36 ? 105 LYS B O   1 
ATOM   2773 C CB  . LYS B 1 117 ? 33.974 15.429  56.084 1.00 25.16 ? 105 LYS B CB  1 
ATOM   2774 C CG  . LYS B 1 117 ? 34.949 15.046  55.012 1.00 26.93 ? 105 LYS B CG  1 
ATOM   2775 C CD  . LYS B 1 117 ? 36.159 14.304  55.606 1.00 33.32 ? 105 LYS B CD  1 
ATOM   2776 C CE  . LYS B 1 117 ? 35.887 12.811  55.811 1.00 32.45 ? 105 LYS B CE  1 
ATOM   2777 N NZ  . LYS B 1 117 ? 37.146 12.114  56.190 1.00 35.23 ? 105 LYS B NZ  1 
ATOM   2778 N N   . PHE B 1 118 ? 33.437 17.441  53.445 1.00 18.90 ? 106 PHE B N   1 
ATOM   2779 C CA  . PHE B 1 118 ? 34.063 18.365  52.508 1.00 18.58 ? 106 PHE B CA  1 
ATOM   2780 C C   . PHE B 1 118 ? 33.222 19.547  52.068 1.00 18.60 ? 106 PHE B C   1 
ATOM   2781 O O   . PHE B 1 118 ? 33.731 20.420  51.370 1.00 18.87 ? 106 PHE B O   1 
ATOM   2782 C CB  . PHE B 1 118 ? 34.537 17.605  51.270 1.00 19.72 ? 106 PHE B CB  1 
ATOM   2783 C CG  . PHE B 1 118 ? 35.463 16.490  51.591 1.00 21.39 ? 106 PHE B CG  1 
ATOM   2784 C CD1 . PHE B 1 118 ? 36.733 16.761  52.084 1.00 20.11 ? 106 PHE B CD1 1 
ATOM   2785 C CD2 . PHE B 1 118 ? 35.041 15.164  51.483 1.00 21.00 ? 106 PHE B CD2 1 
ATOM   2786 C CE1 . PHE B 1 118 ? 37.570 15.738  52.476 1.00 21.36 ? 106 PHE B CE1 1 
ATOM   2787 C CE2 . PHE B 1 118 ? 35.887 14.123  51.877 1.00 24.20 ? 106 PHE B CE2 1 
ATOM   2788 C CZ  . PHE B 1 118 ? 37.153 14.418  52.376 1.00 21.82 ? 106 PHE B CZ  1 
ATOM   2789 N N   . LEU B 1 119 ? 31.956 19.601  52.486 1.00 17.54 ? 107 LEU B N   1 
ATOM   2790 C CA  . LEU B 1 119 ? 31.075 20.722  52.090 1.00 16.66 ? 107 LEU B CA  1 
ATOM   2791 C C   . LEU B 1 119 ? 31.425 22.041  52.752 1.00 14.89 ? 107 LEU B C   1 
ATOM   2792 O O   . LEU B 1 119 ? 31.879 22.069  53.893 1.00 14.18 ? 107 LEU B O   1 
ATOM   2793 C CB  . LEU B 1 119 ? 29.628 20.412  52.453 1.00 14.27 ? 107 LEU B CB  1 
ATOM   2794 C CG  . LEU B 1 119 ? 29.011 19.146  51.860 1.00 16.35 ? 107 LEU B CG  1 
ATOM   2795 C CD1 . LEU B 1 119 ? 27.653 18.952  52.453 1.00 16.06 ? 107 LEU B CD1 1 
ATOM   2796 C CD2 . LEU B 1 119 ? 28.945 19.266  50.334 1.00 17.04 ? 107 LEU B CD2 1 
ATOM   2797 N N   . PHE B 1 120 ? 31.202 23.128  52.029 1.00 13.29 ? 108 PHE B N   1 
ATOM   2798 C CA  . PHE B 1 120 ? 31.417 24.462  52.560 1.00 14.77 ? 108 PHE B CA  1 
ATOM   2799 C C   . PHE B 1 120 ? 30.020 24.986  52.878 1.00 13.91 ? 108 PHE B C   1 
ATOM   2800 O O   . PHE B 1 120 ? 29.195 25.089  51.996 1.00 14.63 ? 108 PHE B O   1 
ATOM   2801 C CB  . PHE B 1 120 ? 32.087 25.344  51.509 1.00 13.79 ? 108 PHE B CB  1 
ATOM   2802 C CG  . PHE B 1 120 ? 33.514 24.980  51.254 1.00 15.52 ? 108 PHE B CG  1 
ATOM   2803 C CD1 . PHE B 1 120 ? 34.514 25.350  52.174 1.00 12.97 ? 108 PHE B CD1 1 
ATOM   2804 C CD2 . PHE B 1 120 ? 33.864 24.229  50.131 1.00 14.21 ? 108 PHE B CD2 1 
ATOM   2805 C CE1 . PHE B 1 120 ? 35.832 24.972  51.975 1.00 15.20 ? 108 PHE B CE1 1 
ATOM   2806 C CE2 . PHE B 1 120 ? 35.198 23.835  49.914 1.00 15.57 ? 108 PHE B CE2 1 
ATOM   2807 C CZ  . PHE B 1 120 ? 36.187 24.212  50.849 1.00 15.66 ? 108 PHE B CZ  1 
ATOM   2808 N N   . LEU B 1 121 ? 29.765 25.312  54.139 1.00 13.20 ? 109 LEU B N   1 
ATOM   2809 C CA  . LEU B 1 121 ? 28.456 25.781  54.565 1.00 14.75 ? 109 LEU B CA  1 
ATOM   2810 C C   . LEU B 1 121 ? 28.530 27.085  55.334 1.00 15.77 ? 109 LEU B C   1 
ATOM   2811 O O   . LEU B 1 121 ? 29.539 27.351  55.991 1.00 16.89 ? 109 LEU B O   1 
ATOM   2812 C CB  . LEU B 1 121 ? 27.821 24.747  55.502 1.00 15.99 ? 109 LEU B CB  1 
ATOM   2813 C CG  . LEU B 1 121 ? 27.564 23.338  54.972 1.00 18.47 ? 109 LEU B CG  1 
ATOM   2814 C CD1 . LEU B 1 121 ? 26.941 22.467  56.103 1.00 19.94 ? 109 LEU B CD1 1 
ATOM   2815 C CD2 . LEU B 1 121 ? 26.624 23.429  53.798 1.00 18.12 ? 109 LEU B CD2 1 
ATOM   2816 N N   . GLY B 1 122 ? 27.461 27.886  55.268 1.00 16.91 ? 110 GLY B N   1 
ATOM   2817 C CA  . GLY B 1 122 ? 27.421 29.118  56.043 1.00 15.78 ? 110 GLY B CA  1 
ATOM   2818 C C   . GLY B 1 122 ? 27.265 28.726  57.513 1.00 18.77 ? 110 GLY B C   1 
ATOM   2819 O O   . GLY B 1 122 ? 26.735 27.639  57.827 1.00 18.25 ? 110 GLY B O   1 
ATOM   2820 N N   . LYS B 1 123 ? 27.723 29.588  58.429 1.00 20.32 ? 111 LYS B N   1 
ATOM   2821 C CA  . LYS B 1 123 ? 27.627 29.276  59.857 1.00 21.88 ? 111 LYS B CA  1 
ATOM   2822 C C   . LYS B 1 123 ? 26.200 28.941  60.317 1.00 22.20 ? 111 LYS B C   1 
ATOM   2823 O O   . LYS B 1 123 ? 25.974 27.963  61.047 1.00 22.45 ? 111 LYS B O   1 
ATOM   2824 C CB  . LYS B 1 123 ? 28.205 30.432  60.688 1.00 23.93 ? 111 LYS B CB  1 
ATOM   2825 C CG  . LYS B 1 123 ? 29.743 30.557  60.556 1.00 28.80 ? 111 LYS B CG  1 
ATOM   2826 C CD  . LYS B 1 123 ? 30.439 29.216  60.910 1.00 34.09 ? 111 LYS B CD  1 
ATOM   2827 C CE  . LYS B 1 123 ? 31.963 29.262  60.726 1.00 35.99 ? 111 LYS B CE  1 
ATOM   2828 N NZ  . LYS B 1 123 ? 32.599 27.908  60.918 1.00 39.91 ? 111 LYS B NZ  1 
ATOM   2829 N N   . GLY B 1 124 ? 25.234 29.728  59.873 1.00 22.02 ? 112 GLY B N   1 
ATOM   2830 C CA  . GLY B 1 124 ? 23.861 29.471  60.269 1.00 23.83 ? 112 GLY B CA  1 
ATOM   2831 C C   . GLY B 1 124 ? 23.371 28.133  59.757 1.00 23.96 ? 112 GLY B C   1 
ATOM   2832 O O   . GLY B 1 124 ? 22.730 27.358  60.490 1.00 24.41 ? 112 GLY B O   1 
ATOM   2833 N N   . GLU B 1 125 ? 23.667 27.857  58.493 1.00 22.59 ? 113 GLU B N   1 
ATOM   2834 C CA  . GLU B 1 125 ? 23.258 26.611  57.866 1.00 24.62 ? 113 GLU B CA  1 
ATOM   2835 C C   . GLU B 1 125 ? 23.903 25.417  58.564 1.00 25.57 ? 113 GLU B C   1 
ATOM   2836 O O   . GLU B 1 125 ? 23.264 24.378  58.799 1.00 26.51 ? 113 GLU B O   1 
ATOM   2837 C CB  . GLU B 1 125 ? 23.644 26.639  56.380 1.00 26.03 ? 113 GLU B CB  1 
ATOM   2838 C CG  . GLU B 1 125 ? 23.309 25.391  55.646 1.00 28.83 ? 113 GLU B CG  1 
ATOM   2839 C CD  . GLU B 1 125 ? 21.823 25.147  55.624 1.00 33.56 ? 113 GLU B CD  1 
ATOM   2840 O OE1 . GLU B 1 125 ? 21.395 24.086  56.118 1.00 34.42 ? 113 GLU B OE1 1 
ATOM   2841 O OE2 . GLU B 1 125 ? 21.082 26.018  55.118 1.00 34.95 ? 113 GLU B OE2 1 
ATOM   2842 N N   . GLU B 1 126 ? 25.173 25.560  58.900 1.00 26.73 ? 114 GLU B N   1 
ATOM   2843 C CA  . GLU B 1 126 ? 25.879 24.498  59.577 1.00 29.87 ? 114 GLU B CA  1 
ATOM   2844 C C   . GLU B 1 126 ? 25.233 24.272  60.948 1.00 31.38 ? 114 GLU B C   1 
ATOM   2845 O O   . GLU B 1 126 ? 25.016 23.130  61.371 1.00 32.07 ? 114 GLU B O   1 
ATOM   2846 C CB  . GLU B 1 126 ? 27.342 24.878  59.752 1.00 31.93 ? 114 GLU B CB  1 
ATOM   2847 C CG  . GLU B 1 126 ? 28.222 23.709  60.141 1.00 38.21 ? 114 GLU B CG  1 
ATOM   2848 C CD  . GLU B 1 126 ? 29.699 24.050  60.089 1.00 40.77 ? 114 GLU B CD  1 
ATOM   2849 O OE1 . GLU B 1 126 ? 30.106 25.043  60.745 1.00 41.70 ? 114 GLU B OE1 1 
ATOM   2850 O OE2 . GLU B 1 126 ? 30.452 23.318  59.398 1.00 41.54 ? 114 GLU B OE2 1 
ATOM   2851 N N   . LYS B 1 127 ? 24.885 25.357  61.628 1.00 30.83 ? 115 LYS B N   1 
ATOM   2852 C CA  . LYS B 1 127 ? 24.294 25.224  62.961 1.00 31.51 ? 115 LYS B CA  1 
ATOM   2853 C C   . LYS B 1 127 ? 22.932 24.543  62.938 1.00 31.66 ? 115 LYS B C   1 
ATOM   2854 O O   . LYS B 1 127 ? 22.521 23.916  63.917 1.00 29.79 ? 115 LYS B O   1 
ATOM   2855 C CB  . LYS B 1 127 ? 24.172 26.592  63.636 1.00 31.99 ? 115 LYS B CB  1 
ATOM   2856 C CG  . LYS B 1 127 ? 23.962 26.495  65.128 1.00 34.56 ? 115 LYS B CG  1 
ATOM   2857 C CD  . LYS B 1 127 ? 23.825 27.859  65.769 1.00 36.80 ? 115 LYS B CD  1 
ATOM   2858 C CE  . LYS B 1 127 ? 23.522 27.728  67.271 1.00 37.58 ? 115 LYS B CE  1 
ATOM   2859 N NZ  . LYS B 1 127 ? 23.193 29.061  67.839 1.00 36.75 ? 115 LYS B NZ  1 
ATOM   2860 N N   . THR B 1 128 ? 22.224 24.655  61.819 1.00 30.76 ? 116 THR B N   1 
ATOM   2861 C CA  . THR B 1 128 ? 20.913 24.036  61.747 1.00 29.94 ? 116 THR B CA  1 
ATOM   2862 C C   . THR B 1 128 ? 20.951 22.626  61.174 1.00 28.28 ? 116 THR B C   1 
ATOM   2863 O O   . THR B 1 128 ? 19.948 22.142  60.677 1.00 27.31 ? 116 THR B O   1 
ATOM   2864 C CB  . THR B 1 128 ? 19.938 24.887  60.927 1.00 31.15 ? 116 THR B CB  1 
ATOM   2865 O OG1 . THR B 1 128 ? 20.399 24.996  59.576 1.00 34.37 ? 116 THR B OG1 1 
ATOM   2866 C CG2 . THR B 1 128 ? 19.824 26.278  61.545 1.00 33.84 ? 116 THR B CG2 1 
ATOM   2867 N N   . GLY B 1 129 ? 22.119 21.986  61.228 1.00 26.36 ? 117 GLY B N   1 
ATOM   2868 C CA  . GLY B 1 129 ? 22.234 20.621  60.740 1.00 26.55 ? 117 GLY B CA  1 
ATOM   2869 C C   . GLY B 1 129 ? 22.382 20.420  59.238 1.00 24.34 ? 117 GLY B C   1 
ATOM   2870 O O   . GLY B 1 129 ? 22.154 19.325  58.731 1.00 21.64 ? 117 GLY B O   1 
ATOM   2871 N N   . GLY B 1 130 ? 22.795 21.460  58.526 1.00 22.86 ? 118 GLY B N   1 
ATOM   2872 C CA  . GLY B 1 130 ? 22.947 21.347  57.088 1.00 21.12 ? 118 GLY B CA  1 
ATOM   2873 C C   . GLY B 1 130 ? 23.914 20.302  56.559 1.00 19.14 ? 118 GLY B C   1 
ATOM   2874 O O   . GLY B 1 130 ? 23.697 19.757  55.476 1.00 18.84 ? 118 GLY B O   1 
ATOM   2875 N N   . ARG B 1 131 ? 24.975 20.008  57.304 1.00 19.17 ? 119 ARG B N   1 
ATOM   2876 C CA  . ARG B 1 131 ? 25.960 19.038  56.847 1.00 19.32 ? 119 ARG B CA  1 
ATOM   2877 C C   . ARG B 1 131 ? 25.403 17.618  56.766 1.00 19.96 ? 119 ARG B C   1 
ATOM   2878 O O   . ARG B 1 131 ? 25.975 16.761  56.093 1.00 18.68 ? 119 ARG B O   1 
ATOM   2879 C CB  . ARG B 1 131 ? 27.190 19.070  57.770 1.00 22.31 ? 119 ARG B CB  1 
ATOM   2880 C CG  . ARG B 1 131 ? 28.480 18.581  57.124 1.00 20.31 ? 119 ARG B CG  1 
ATOM   2881 C CD  . ARG B 1 131 ? 29.662 18.919  58.006 1.00 20.36 ? 119 ARG B CD  1 
ATOM   2882 N NE  . ARG B 1 131 ? 29.918 20.355  58.021 1.00 19.12 ? 119 ARG B NE  1 
ATOM   2883 C CZ  . ARG B 1 131 ? 30.619 20.987  57.086 1.00 19.71 ? 119 ARG B CZ  1 
ATOM   2884 N NH1 . ARG B 1 131 ? 31.138 20.303  56.067 1.00 16.05 ? 119 ARG B NH1 1 
ATOM   2885 N NH2 . ARG B 1 131 ? 30.801 22.295  57.170 1.00 19.20 ? 119 ARG B NH2 1 
ATOM   2886 N N   . ASP B 1 132 ? 24.277 17.377  57.439 1.00 18.52 ? 120 ASP B N   1 
ATOM   2887 C CA  . ASP B 1 132 ? 23.658 16.049  57.440 1.00 21.86 ? 120 ASP B CA  1 
ATOM   2888 C C   . ASP B 1 132 ? 22.360 16.041  56.641 1.00 22.43 ? 120 ASP B C   1 
ATOM   2889 O O   . ASP B 1 132 ? 21.673 15.026  56.592 1.00 21.71 ? 120 ASP B O   1 
ATOM   2890 C CB  . ASP B 1 132 ? 23.367 15.599  58.888 1.00 23.26 ? 120 ASP B CB  1 
ATOM   2891 C CG  . ASP B 1 132 ? 24.600 15.672  59.766 1.00 25.84 ? 120 ASP B CG  1 
ATOM   2892 O OD1 . ASP B 1 132 ? 25.645 15.113  59.355 1.00 27.78 ? 120 ASP B OD1 1 
ATOM   2893 O OD2 . ASP B 1 132 ? 24.534 16.306  60.848 1.00 27.81 ? 120 ASP B OD2 1 
ATOM   2894 N N   . ARG B 1 133 ? 22.028 17.174  56.013 1.00 21.57 ? 121 ARG B N   1 
ATOM   2895 C CA  . ARG B 1 133 ? 20.781 17.276  55.258 1.00 21.68 ? 121 ARG B CA  1 
ATOM   2896 C C   . ARG B 1 133 ? 20.819 16.536  53.924 1.00 20.73 ? 121 ARG B C   1 
ATOM   2897 O O   . ARG B 1 133 ? 21.637 16.851  53.041 1.00 17.82 ? 121 ARG B O   1 
ATOM   2898 C CB  . ARG B 1 133 ? 20.432 18.760  55.027 1.00 25.47 ? 121 ARG B CB  1 
ATOM   2899 C CG  . ARG B 1 133 ? 19.071 18.958  54.344 1.00 31.21 ? 121 ARG B CG  1 
ATOM   2900 C CD  . ARG B 1 133 ? 18.517 20.367  54.493 1.00 35.49 ? 121 ARG B CD  1 
ATOM   2901 N NE  . ARG B 1 133 ? 18.195 20.658  55.888 1.00 39.50 ? 121 ARG B NE  1 
ATOM   2902 C CZ  . ARG B 1 133 ? 18.817 21.581  56.612 1.00 41.11 ? 121 ARG B CZ  1 
ATOM   2903 N NH1 . ARG B 1 133 ? 19.782 22.300  56.058 1.00 40.82 ? 121 ARG B NH1 1 
ATOM   2904 N NH2 . ARG B 1 133 ? 18.502 21.761  57.893 1.00 41.33 ? 121 ARG B NH2 1 
ATOM   2905 N N   . ASP B 1 134 ? 19.928 15.560  53.776 1.00 19.40 ? 122 ASP B N   1 
ATOM   2906 C CA  . ASP B 1 134 ? 19.852 14.763  52.553 1.00 19.96 ? 122 ASP B CA  1 
ATOM   2907 C C   . ASP B 1 134 ? 19.877 15.610  51.287 1.00 17.83 ? 122 ASP B C   1 
ATOM   2908 O O   . ASP B 1 134 ? 20.607 15.296  50.351 1.00 15.68 ? 122 ASP B O   1 
ATOM   2909 C CB  . ASP B 1 134 ? 18.582 13.898  52.527 1.00 21.14 ? 122 ASP B CB  1 
ATOM   2910 C CG  . ASP B 1 134 ? 18.718 12.629  53.347 1.00 24.29 ? 122 ASP B CG  1 
ATOM   2911 O OD1 . ASP B 1 134 ? 19.656 12.525  54.165 1.00 25.15 ? 122 ASP B OD1 1 
ATOM   2912 O OD2 . ASP B 1 134 ? 17.885 11.720  53.175 1.00 27.78 ? 122 ASP B OD2 1 
ATOM   2913 N N   . SER B 1 135 ? 19.087 16.680  51.248 1.00 18.95 ? 123 SER B N   1 
ATOM   2914 C CA  . SER B 1 135 ? 19.027 17.500  50.024 1.00 18.81 ? 123 SER B CA  1 
ATOM   2915 C C   . SER B 1 135 ? 20.365 18.180  49.710 1.00 17.38 ? 123 SER B C   1 
ATOM   2916 O O   . SER B 1 135 ? 20.791 18.229  48.567 1.00 18.43 ? 123 SER B O   1 
ATOM   2917 C CB  . SER B 1 135 ? 17.903 18.548  50.130 1.00 18.65 ? 123 SER B CB  1 
ATOM   2918 O OG  . SER B 1 135 ? 18.151 19.505  51.156 1.00 19.68 ? 123 SER B OG  1 
ATOM   2919 N N   . ILE B 1 136 ? 21.008 18.738  50.721 1.00 16.25 ? 124 ILE B N   1 
ATOM   2920 C CA  . ILE B 1 136 ? 22.306 19.395  50.519 1.00 15.17 ? 124 ILE B CA  1 
ATOM   2921 C C   . ILE B 1 136 ? 23.327 18.353  50.050 1.00 15.30 ? 124 ILE B C   1 
ATOM   2922 O O   . ILE B 1 136 ? 24.097 18.577  49.121 1.00 13.28 ? 124 ILE B O   1 
ATOM   2923 C CB  . ILE B 1 136 ? 22.786 20.101  51.832 1.00 13.89 ? 124 ILE B CB  1 
ATOM   2924 C CG1 . ILE B 1 136 ? 21.839 21.262  52.161 1.00 13.65 ? 124 ILE B CG1 1 
ATOM   2925 C CG2 . ILE B 1 136 ? 24.238 20.609  51.673 1.00 14.24 ? 124 ILE B CG2 1 
ATOM   2926 C CD1 . ILE B 1 136 ? 22.052 21.905  53.530 1.00 12.24 ? 124 ILE B CD1 1 
ATOM   2927 N N   . LEU B 1 137 ? 23.314 17.180  50.668 1.00 15.54 ? 125 LEU B N   1 
ATOM   2928 C CA  . LEU B 1 137 ? 24.254 16.139  50.266 1.00 14.79 ? 125 LEU B CA  1 
ATOM   2929 C C   . LEU B 1 137 ? 24.015 15.665  48.813 1.00 15.14 ? 125 LEU B C   1 
ATOM   2930 O O   . LEU B 1 137 ? 24.954 15.478  48.032 1.00 14.54 ? 125 LEU B O   1 
ATOM   2931 C CB  . LEU B 1 137 ? 24.117 14.932  51.222 1.00 16.22 ? 125 LEU B CB  1 
ATOM   2932 C CG  . LEU B 1 137 ? 24.634 15.193  52.650 1.00 15.01 ? 125 LEU B CG  1 
ATOM   2933 C CD1 . LEU B 1 137 ? 24.141 14.118  53.597 1.00 16.07 ? 125 LEU B CD1 1 
ATOM   2934 C CD2 . LEU B 1 137 ? 26.179 15.237  52.629 1.00 15.67 ? 125 LEU B CD2 1 
ATOM   2935 N N   . ALA B 1 138 ? 22.757 15.444  48.463 1.00 15.57 ? 126 ALA B N   1 
ATOM   2936 C CA  . ALA B 1 138 ? 22.432 14.938  47.129 1.00 16.60 ? 126 ALA B CA  1 
ATOM   2937 C C   . ALA B 1 138 ? 22.815 15.973  46.096 1.00 16.57 ? 126 ALA B C   1 
ATOM   2938 O O   . ALA B 1 138 ? 23.363 15.624  45.058 1.00 17.91 ? 126 ALA B O   1 
ATOM   2939 C CB  . ALA B 1 138 ? 20.935 14.601  47.028 1.00 15.70 ? 126 ALA B CB  1 
ATOM   2940 N N   . ASP B 1 139 ? 22.504 17.242  46.382 1.00 15.97 ? 127 ASP B N   1 
ATOM   2941 C CA  . ASP B 1 139 ? 22.841 18.341  45.475 1.00 16.33 ? 127 ASP B CA  1 
ATOM   2942 C C   . ASP B 1 139 ? 24.353 18.449  45.226 1.00 15.52 ? 127 ASP B C   1 
ATOM   2943 O O   . ASP B 1 139 ? 24.800 18.618  44.095 1.00 14.80 ? 127 ASP B O   1 
ATOM   2944 C CB  . ASP B 1 139 ? 22.369 19.693  46.042 1.00 18.25 ? 127 ASP B CB  1 
ATOM   2945 C CG  . ASP B 1 139 ? 20.847 19.911  45.913 1.00 20.37 ? 127 ASP B CG  1 
ATOM   2946 O OD1 . ASP B 1 139 ? 20.155 19.154  45.202 1.00 22.19 ? 127 ASP B OD1 1 
ATOM   2947 O OD2 . ASP B 1 139 ? 20.354 20.869  46.539 1.00 23.74 ? 127 ASP B OD2 1 
ATOM   2948 N N   . ALA B 1 140 ? 25.145 18.389  46.289 1.00 13.83 ? 128 ALA B N   1 
ATOM   2949 C CA  . ALA B 1 140 ? 26.583 18.508  46.104 1.00 12.30 ? 128 ALA B CA  1 
ATOM   2950 C C   . ALA B 1 140 ? 27.137 17.332  45.292 1.00 11.93 ? 128 ALA B C   1 
ATOM   2951 O O   . ALA B 1 140 ? 28.074 17.505  44.507 1.00 12.61 ? 128 ALA B O   1 
ATOM   2952 C CB  . ALA B 1 140 ? 27.287 18.608  47.476 1.00 13.50 ? 128 ALA B CB  1 
ATOM   2953 N N   . PHE B 1 141 ? 26.541 16.153  45.454 1.00 10.75 ? 129 PHE B N   1 
ATOM   2954 C CA  . PHE B 1 141 ? 27.014 14.974  44.733 1.00 11.97 ? 129 PHE B CA  1 
ATOM   2955 C C   . PHE B 1 141 ? 26.724 15.163  43.253 1.00 11.73 ? 129 PHE B C   1 
ATOM   2956 O O   . PHE B 1 141 ? 27.537 14.819  42.432 1.00 10.99 ? 129 PHE B O   1 
ATOM   2957 C CB  . PHE B 1 141 ? 26.314 13.699  45.203 1.00 12.33 ? 129 PHE B CB  1 
ATOM   2958 C CG  . PHE B 1 141 ? 26.737 12.480  44.436 1.00 15.95 ? 129 PHE B CG  1 
ATOM   2959 C CD1 . PHE B 1 141 ? 27.942 11.831  44.744 1.00 16.53 ? 129 PHE B CD1 1 
ATOM   2960 C CD2 . PHE B 1 141 ? 25.971 12.006  43.373 1.00 14.39 ? 129 PHE B CD2 1 
ATOM   2961 C CE1 . PHE B 1 141 ? 28.364 10.727  44.000 1.00 17.90 ? 129 PHE B CE1 1 
ATOM   2962 C CE2 . PHE B 1 141 ? 26.380 10.907  42.626 1.00 14.96 ? 129 PHE B CE2 1 
ATOM   2963 C CZ  . PHE B 1 141 ? 27.584 10.259  42.938 1.00 16.01 ? 129 PHE B CZ  1 
ATOM   2964 N N   . GLU B 1 142 ? 25.531 15.661  42.918 1.00 11.23 ? 130 GLU B N   1 
ATOM   2965 C CA  . GLU B 1 142 ? 25.220 15.907  41.521 1.00 14.28 ? 130 GLU B CA  1 
ATOM   2966 C C   . GLU B 1 142 ? 26.196 16.995  41.012 1.00 12.28 ? 130 GLU B C   1 
ATOM   2967 O O   . GLU B 1 142 ? 26.687 16.929  39.885 1.00 14.18 ? 130 GLU B O   1 
ATOM   2968 C CB  . GLU B 1 142 ? 23.767 16.405  41.374 1.00 18.40 ? 130 GLU B CB  1 
ATOM   2969 C CG  . GLU B 1 142 ? 22.728 15.373  41.749 1.00 21.56 ? 130 GLU B CG  1 
ATOM   2970 C CD  . GLU B 1 142 ? 21.346 15.810  41.308 1.00 28.46 ? 130 GLU B CD  1 
ATOM   2971 O OE1 . GLU B 1 142 ? 21.268 16.585  40.338 1.00 32.45 ? 130 GLU B OE1 1 
ATOM   2972 O OE2 . GLU B 1 142 ? 20.342 15.380  41.913 1.00 30.79 ? 130 GLU B OE2 1 
ATOM   2973 N N   . ALA B 1 143 ? 26.462 17.998  41.839 1.00 13.08 ? 131 ALA B N   1 
ATOM   2974 C CA  . ALA B 1 143 ? 27.401 19.058  41.447 1.00 15.10 ? 131 ALA B CA  1 
ATOM   2975 C C   . ALA B 1 143 ? 28.791 18.436  41.227 1.00 14.89 ? 131 ALA B C   1 
ATOM   2976 O O   . ALA B 1 143 ? 29.504 18.763  40.263 1.00 18.32 ? 131 ALA B O   1 
ATOM   2977 C CB  . ALA B 1 143 ? 27.456 20.132  42.532 1.00 15.67 ? 131 ALA B CB  1 
ATOM   2978 N N   . LEU B 1 144 ? 29.172 17.503  42.094 1.00 16.32 ? 132 LEU B N   1 
ATOM   2979 C CA  . LEU B 1 144 ? 30.478 16.862  41.960 1.00 16.37 ? 132 LEU B CA  1 
ATOM   2980 C C   . LEU B 1 144 ? 30.531 16.097  40.627 1.00 16.47 ? 132 LEU B C   1 
ATOM   2981 O O   . LEU B 1 144 ? 31.553 16.138  39.926 1.00 13.10 ? 132 LEU B O   1 
ATOM   2982 C CB  . LEU B 1 144 ? 30.721 15.890  43.116 1.00 15.80 ? 132 LEU B CB  1 
ATOM   2983 C CG  . LEU B 1 144 ? 32.025 15.100  43.031 1.00 17.01 ? 132 LEU B CG  1 
ATOM   2984 C CD1 . LEU B 1 144 ? 33.274 16.007  43.051 1.00 16.43 ? 132 LEU B CD1 1 
ATOM   2985 C CD2 . LEU B 1 144 ? 32.034 14.137  44.196 1.00 17.54 ? 132 LEU B CD2 1 
ATOM   2986 N N   . LEU B 1 145 ? 29.446 15.397  40.282 1.00 14.60 ? 133 LEU B N   1 
ATOM   2987 C CA  . LEU B 1 145 ? 29.456 14.671  39.011 1.00 14.95 ? 133 LEU B CA  1 
ATOM   2988 C C   . LEU B 1 145 ? 29.733 15.642  37.867 1.00 15.54 ? 133 LEU B C   1 
ATOM   2989 O O   . LEU B 1 145 ? 30.510 15.315  36.963 1.00 15.48 ? 133 LEU B O   1 
ATOM   2990 C CB  . LEU B 1 145 ? 28.147 13.943  38.752 1.00 13.42 ? 133 LEU B CB  1 
ATOM   2991 C CG  . LEU B 1 145 ? 27.804 12.784  39.682 1.00 18.06 ? 133 LEU B CG  1 
ATOM   2992 C CD1 . LEU B 1 145 ? 26.380 12.283  39.350 1.00 17.32 ? 133 LEU B CD1 1 
ATOM   2993 C CD2 . LEU B 1 145 ? 28.848 11.661  39.516 1.00 18.65 ? 133 LEU B CD2 1 
ATOM   2994 N N   . ALA B 1 146 ? 29.094 16.819  37.894 1.00 14.75 ? 134 ALA B N   1 
ATOM   2995 C CA  . ALA B 1 146 ? 29.327 17.838  36.848 1.00 15.41 ? 134 ALA B CA  1 
ATOM   2996 C C   . ALA B 1 146 ? 30.795 18.272  36.824 1.00 12.43 ? 134 ALA B C   1 
ATOM   2997 O O   . ALA B 1 146 ? 31.406 18.373  35.767 1.00 12.72 ? 134 ALA B O   1 
ATOM   2998 C CB  . ALA B 1 146 ? 28.446 19.060  37.072 1.00 15.51 ? 134 ALA B CB  1 
ATOM   2999 N N   . ALA B 1 147 ? 31.358 18.531  37.993 1.00 12.51 ? 135 ALA B N   1 
ATOM   3000 C CA  . ALA B 1 147 ? 32.759 18.943  38.101 1.00 14.01 ? 135 ALA B CA  1 
ATOM   3001 C C   . ALA B 1 147 ? 33.699 17.909  37.496 1.00 14.16 ? 135 ALA B C   1 
ATOM   3002 O O   . ALA B 1 147 ? 34.622 18.250  36.726 1.00 12.64 ? 135 ALA B O   1 
ATOM   3003 C CB  . ALA B 1 147 ? 33.150 19.202  39.608 1.00 13.41 ? 135 ALA B CB  1 
ATOM   3004 N N   . ILE B 1 148 ? 33.473 16.643  37.832 1.00 13.60 ? 136 ILE B N   1 
ATOM   3005 C CA  . ILE B 1 148 ? 34.330 15.577  37.310 1.00 14.14 ? 136 ILE B CA  1 
ATOM   3006 C C   . ILE B 1 148 ? 34.147 15.435  35.780 1.00 14.65 ? 136 ILE B C   1 
ATOM   3007 O O   . ILE B 1 148 ? 35.105 15.222  35.026 1.00 12.79 ? 136 ILE B O   1 
ATOM   3008 C CB  . ILE B 1 148 ? 34.013 14.219  38.012 1.00 14.91 ? 136 ILE B CB  1 
ATOM   3009 C CG1 . ILE B 1 148 ? 34.370 14.301  39.518 1.00 13.63 ? 136 ILE B CG1 1 
ATOM   3010 C CG2 . ILE B 1 148 ? 34.783 13.093  37.345 1.00 11.46 ? 136 ILE B CG2 1 
ATOM   3011 C CD1 . ILE B 1 148 ? 33.879 13.098  40.285 1.00 13.34 ? 136 ILE B CD1 1 
ATOM   3012 N N   . TYR B 1 149 ? 32.902 15.580  35.347 1.00 14.58 ? 137 TYR B N   1 
ATOM   3013 C CA  . TYR B 1 149 ? 32.552 15.479  33.937 1.00 14.89 ? 137 TYR B CA  1 
ATOM   3014 C C   . TYR B 1 149 ? 33.301 16.558  33.156 1.00 15.64 ? 137 TYR B C   1 
ATOM   3015 O O   . TYR B 1 149 ? 33.874 16.286  32.105 1.00 14.73 ? 137 TYR B O   1 
ATOM   3016 C CB  . TYR B 1 149 ? 31.032 15.675  33.767 1.00 17.07 ? 137 TYR B CB  1 
ATOM   3017 C CG  . TYR B 1 149 ? 30.589 15.767  32.328 1.00 16.70 ? 137 TYR B CG  1 
ATOM   3018 C CD1 . TYR B 1 149 ? 30.577 14.643  31.524 1.00 17.79 ? 137 TYR B CD1 1 
ATOM   3019 C CD2 . TYR B 1 149 ? 30.197 16.989  31.772 1.00 18.75 ? 137 TYR B CD2 1 
ATOM   3020 C CE1 . TYR B 1 149 ? 30.180 14.710  30.187 1.00 19.21 ? 137 TYR B CE1 1 
ATOM   3021 C CE2 . TYR B 1 149 ? 29.802 17.076  30.428 1.00 19.61 ? 137 TYR B CE2 1 
ATOM   3022 C CZ  . TYR B 1 149 ? 29.798 15.929  29.647 1.00 20.82 ? 137 TYR B CZ  1 
ATOM   3023 O OH  . TYR B 1 149 ? 29.400 15.976  28.326 1.00 22.89 ? 137 TYR B OH  1 
ATOM   3024 N N   . LEU B 1 150 ? 33.280 17.782  33.675 1.00 16.97 ? 138 LEU B N   1 
ATOM   3025 C CA  . LEU B 1 150 ? 33.970 18.895  33.027 1.00 19.44 ? 138 LEU B CA  1 
ATOM   3026 C C   . LEU B 1 150 ? 35.490 18.798  33.129 1.00 20.34 ? 138 LEU B C   1 
ATOM   3027 O O   . LEU B 1 150 ? 36.188 19.067  32.164 1.00 20.56 ? 138 LEU B O   1 
ATOM   3028 C CB  . LEU B 1 150 ? 33.510 20.216  33.631 1.00 19.28 ? 138 LEU B CB  1 
ATOM   3029 C CG  . LEU B 1 150 ? 32.062 20.576  33.274 1.00 20.54 ? 138 LEU B CG  1 
ATOM   3030 C CD1 . LEU B 1 150 ? 31.635 21.794  34.121 1.00 21.44 ? 138 LEU B CD1 1 
ATOM   3031 C CD2 . LEU B 1 150 ? 31.948 20.854  31.770 1.00 21.21 ? 138 LEU B CD2 1 
ATOM   3032 N N   . ASP B 1 151 ? 36.001 18.382  34.286 1.00 21.12 ? 139 ASP B N   1 
ATOM   3033 C CA  . ASP B 1 151 ? 37.456 18.275  34.494 1.00 21.07 ? 139 ASP B CA  1 
ATOM   3034 C C   . ASP B 1 151 ? 38.117 17.057  33.861 1.00 22.94 ? 139 ASP B C   1 
ATOM   3035 O O   . ASP B 1 151 ? 39.207 17.170  33.313 1.00 22.75 ? 139 ASP B O   1 
ATOM   3036 C CB  . ASP B 1 151 ? 37.791 18.245  36.001 1.00 19.40 ? 139 ASP B CB  1 
ATOM   3037 C CG  . ASP B 1 151 ? 39.317 18.398  36.289 1.00 19.57 ? 139 ASP B CG  1 
ATOM   3038 O OD1 . ASP B 1 151 ? 39.871 19.477  36.061 1.00 17.28 ? 139 ASP B OD1 1 
ATOM   3039 O OD2 . ASP B 1 151 ? 39.968 17.447  36.758 1.00 18.54 ? 139 ASP B OD2 1 
ATOM   3040 N N   . GLN B 1 152 ? 37.468 15.900  33.945 1.00 22.46 ? 140 GLN B N   1 
ATOM   3041 C CA  . GLN B 1 152 ? 38.078 14.668  33.446 1.00 23.85 ? 140 GLN B CA  1 
ATOM   3042 C C   . GLN B 1 152 ? 37.279 13.875  32.439 1.00 23.75 ? 140 GLN B C   1 
ATOM   3043 O O   . GLN B 1 152 ? 37.811 12.974  31.823 1.00 24.12 ? 140 GLN B O   1 
ATOM   3044 C CB  . GLN B 1 152 ? 38.412 13.746  34.610 1.00 24.79 ? 140 GLN B CB  1 
ATOM   3045 C CG  . GLN B 1 152 ? 39.364 14.332  35.619 1.00 29.88 ? 140 GLN B CG  1 
ATOM   3046 C CD  . GLN B 1 152 ? 39.919 13.279  36.567 1.00 33.22 ? 140 GLN B CD  1 
ATOM   3047 O OE1 . GLN B 1 152 ? 39.659 13.313  37.771 1.00 36.68 ? 140 GLN B OE1 1 
ATOM   3048 N NE2 . GLN B 1 152 ? 40.685 12.326  36.022 1.00 35.41 ? 140 GLN B NE2 1 
ATOM   3049 N N   . GLY B 1 153 ? 35.992 14.176  32.299 1.00 23.64 ? 141 GLY B N   1 
ATOM   3050 C CA  . GLY B 1 153 ? 35.196 13.466  31.319 1.00 21.27 ? 141 GLY B CA  1 
ATOM   3051 C C   . GLY B 1 153 ? 34.274 12.378  31.816 1.00 21.03 ? 141 GLY B C   1 
ATOM   3052 O O   . GLY B 1 153 ? 34.381 11.880  32.938 1.00 19.00 ? 141 GLY B O   1 
ATOM   3053 N N   . TYR B 1 154 ? 33.369 12.000  30.920 1.00 19.12 ? 142 TYR B N   1 
ATOM   3054 C CA  . TYR B 1 154 ? 32.365 10.989  31.157 1.00 19.02 ? 142 TYR B CA  1 
ATOM   3055 C C   . TYR B 1 154 ? 32.936 9.603   31.489 1.00 19.41 ? 142 TYR B C   1 
ATOM   3056 O O   . TYR B 1 154 ? 32.392 8.913   32.347 1.00 19.45 ? 142 TYR B O   1 
ATOM   3057 C CB  . TYR B 1 154 ? 31.438 10.906  29.928 1.00 19.80 ? 142 TYR B CB  1 
ATOM   3058 C CG  . TYR B 1 154 ? 30.206 10.048  30.140 1.00 19.91 ? 142 TYR B CG  1 
ATOM   3059 C CD1 . TYR B 1 154 ? 29.175 10.470  30.984 1.00 19.51 ? 142 TYR B CD1 1 
ATOM   3060 C CD2 . TYR B 1 154 ? 30.069 8.843   29.475 1.00 18.26 ? 142 TYR B CD2 1 
ATOM   3061 C CE1 . TYR B 1 154 ? 28.027 9.706   31.152 1.00 19.65 ? 142 TYR B CE1 1 
ATOM   3062 C CE2 . TYR B 1 154 ? 28.923 8.054   29.629 1.00 20.87 ? 142 TYR B CE2 1 
ATOM   3063 C CZ  . TYR B 1 154 ? 27.908 8.502   30.474 1.00 19.86 ? 142 TYR B CZ  1 
ATOM   3064 O OH  . TYR B 1 154 ? 26.786 7.745   30.618 1.00 18.83 ? 142 TYR B OH  1 
ATOM   3065 N N   . GLU B 1 155 ? 34.010 9.196   30.815 1.00 19.87 ? 143 GLU B N   1 
ATOM   3066 C CA  . GLU B 1 155 ? 34.622 7.889   31.074 1.00 22.11 ? 143 GLU B CA  1 
ATOM   3067 C C   . GLU B 1 155 ? 35.125 7.822   32.514 1.00 20.05 ? 143 GLU B C   1 
ATOM   3068 O O   . GLU B 1 155 ? 35.112 6.768   33.129 1.00 20.69 ? 143 GLU B O   1 
ATOM   3069 C CB  . GLU B 1 155 ? 35.798 7.621   30.125 1.00 24.73 ? 143 GLU B CB  1 
ATOM   3070 C CG  . GLU B 1 155 ? 35.422 7.351   28.651 1.00 29.92 ? 143 GLU B CG  1 
ATOM   3071 C CD  . GLU B 1 155 ? 34.525 6.131   28.475 1.00 35.17 ? 143 GLU B CD  1 
ATOM   3072 O OE1 . GLU B 1 155 ? 34.803 5.086   29.122 1.00 36.69 ? 143 GLU B OE1 1 
ATOM   3073 O OE2 . GLU B 1 155 ? 33.555 6.214   27.683 1.00 34.19 ? 143 GLU B OE2 1 
ATOM   3074 N N   . LYS B 1 156 ? 35.560 8.949   33.056 1.00 17.67 ? 144 LYS B N   1 
ATOM   3075 C CA  . LYS B 1 156 ? 36.034 8.937   34.430 1.00 18.65 ? 144 LYS B CA  1 
ATOM   3076 C C   . LYS B 1 156 ? 34.838 8.720   35.365 1.00 19.41 ? 144 LYS B C   1 
ATOM   3077 O O   . LYS B 1 156 ? 34.942 8.035   36.386 1.00 18.77 ? 144 LYS B O   1 
ATOM   3078 C CB  . LYS B 1 156 ? 36.759 10.250  34.750 1.00 17.79 ? 144 LYS B CB  1 
ATOM   3079 C CG  . LYS B 1 156 ? 37.291 10.363  36.188 1.00 20.60 ? 144 LYS B CG  1 
ATOM   3080 C CD  . LYS B 1 156 ? 38.232 9.215   36.570 1.00 22.31 ? 144 LYS B CD  1 
ATOM   3081 C CE  . LYS B 1 156 ? 38.944 9.491   37.893 1.00 23.90 ? 144 LYS B CE  1 
ATOM   3082 N NZ  . LYS B 1 156 ? 39.795 8.334   38.297 1.00 27.81 ? 144 LYS B NZ  1 
ATOM   3083 N N   . ILE B 1 157 ? 33.687 9.290   35.008 1.00 19.19 ? 145 ILE B N   1 
ATOM   3084 C CA  . ILE B 1 157 ? 32.507 9.120   35.847 1.00 18.75 ? 145 ILE B CA  1 
ATOM   3085 C C   . ILE B 1 157 ? 32.154 7.622   35.932 1.00 18.36 ? 145 ILE B C   1 
ATOM   3086 O O   . ILE B 1 157 ? 31.834 7.107   37.011 1.00 18.12 ? 145 ILE B O   1 
ATOM   3087 C CB  . ILE B 1 157 ? 31.291 9.863   35.270 1.00 18.93 ? 145 ILE B CB  1 
ATOM   3088 C CG1 . ILE B 1 157 ? 31.504 11.380  35.373 1.00 19.00 ? 145 ILE B CG1 1 
ATOM   3089 C CG2 . ILE B 1 157 ? 29.990 9.395   36.005 1.00 19.64 ? 145 ILE B CG2 1 
ATOM   3090 C CD1 . ILE B 1 157 ? 31.284 11.922  36.727 1.00 19.48 ? 145 ILE B CD1 1 
ATOM   3091 N N   . LYS B 1 158 ? 32.193 6.933   34.798 1.00 17.63 ? 146 LYS B N   1 
ATOM   3092 C CA  . LYS B 1 158 ? 31.866 5.489   34.772 1.00 18.14 ? 146 LYS B CA  1 
ATOM   3093 C C   . LYS B 1 158 ? 32.906 4.700   35.587 1.00 18.52 ? 146 LYS B C   1 
ATOM   3094 O O   . LYS B 1 158 ? 32.574 3.821   36.383 1.00 17.72 ? 146 LYS B O   1 
ATOM   3095 C CB  . LYS B 1 158 ? 31.872 4.960   33.330 1.00 19.94 ? 146 LYS B CB  1 
ATOM   3096 C CG  . LYS B 1 158 ? 30.874 5.657   32.403 1.00 24.66 ? 146 LYS B CG  1 
ATOM   3097 C CD  . LYS B 1 158 ? 30.425 4.774   31.239 1.00 26.67 ? 146 LYS B CD  1 
ATOM   3098 C CE  . LYS B 1 158 ? 31.382 4.820   30.069 1.00 28.54 ? 146 LYS B CE  1 
ATOM   3099 N NZ  . LYS B 1 158 ? 30.808 4.063   28.918 1.00 28.96 ? 146 LYS B NZ  1 
ATOM   3100 N N   . GLU B 1 159 ? 34.170 5.010   35.343 1.00 17.00 ? 147 GLU B N   1 
ATOM   3101 C CA  . GLU B 1 159 ? 35.250 4.355   36.050 1.00 21.89 ? 147 GLU B CA  1 
ATOM   3102 C C   . GLU B 1 159 ? 35.004 4.486   37.565 1.00 20.96 ? 147 GLU B C   1 
ATOM   3103 O O   . GLU B 1 159 ? 35.136 3.523   38.304 1.00 21.68 ? 147 GLU B O   1 
ATOM   3104 C CB  . GLU B 1 159 ? 36.557 5.030   35.638 1.00 24.31 ? 147 GLU B CB  1 
ATOM   3105 C CG  . GLU B 1 159 ? 37.778 4.590   36.367 1.00 31.48 ? 147 GLU B CG  1 
ATOM   3106 C CD  . GLU B 1 159 ? 38.938 5.510   36.063 1.00 34.58 ? 147 GLU B CD  1 
ATOM   3107 O OE1 . GLU B 1 159 ? 39.126 5.832   34.850 1.00 38.11 ? 147 GLU B OE1 1 
ATOM   3108 O OE2 . GLU B 1 159 ? 39.646 5.907   37.024 1.00 34.72 ? 147 GLU B OE2 1 
ATOM   3109 N N   . LEU B 1 160 ? 34.588 5.663   38.019 1.00 20.16 ? 148 LEU B N   1 
ATOM   3110 C CA  . LEU B 1 160 ? 34.349 5.880   39.456 1.00 19.78 ? 148 LEU B CA  1 
ATOM   3111 C C   . LEU B 1 160 ? 33.044 5.324   40.037 1.00 19.64 ? 148 LEU B C   1 
ATOM   3112 O O   . LEU B 1 160 ? 33.022 4.802   41.151 1.00 17.34 ? 148 LEU B O   1 
ATOM   3113 C CB  . LEU B 1 160 ? 34.363 7.382   39.770 1.00 17.08 ? 148 LEU B CB  1 
ATOM   3114 C CG  . LEU B 1 160 ? 35.669 8.126   39.590 1.00 20.42 ? 148 LEU B CG  1 
ATOM   3115 C CD1 . LEU B 1 160 ? 35.416 9.635   39.664 1.00 20.31 ? 148 LEU B CD1 1 
ATOM   3116 C CD2 . LEU B 1 160 ? 36.648 7.688   40.723 1.00 20.77 ? 148 LEU B CD2 1 
ATOM   3117 N N   . PHE B 1 161 ? 31.961 5.428   39.271 1.00 17.35 ? 149 PHE B N   1 
ATOM   3118 C CA  . PHE B 1 161 ? 30.636 5.077   39.792 1.00 18.44 ? 149 PHE B CA  1 
ATOM   3119 C C   . PHE B 1 161 ? 29.802 4.020   39.108 1.00 17.11 ? 149 PHE B C   1 
ATOM   3120 O O   . PHE B 1 161 ? 28.769 3.628   39.650 1.00 19.04 ? 149 PHE B O   1 
ATOM   3121 C CB  . PHE B 1 161 ? 29.775 6.354   39.845 1.00 18.59 ? 149 PHE B CB  1 
ATOM   3122 C CG  . PHE B 1 161 ? 30.394 7.479   40.619 1.00 19.40 ? 149 PHE B CG  1 
ATOM   3123 C CD1 . PHE B 1 161 ? 30.580 7.375   42.006 1.00 21.50 ? 149 PHE B CD1 1 
ATOM   3124 C CD2 . PHE B 1 161 ? 30.802 8.638   39.976 1.00 18.89 ? 149 PHE B CD2 1 
ATOM   3125 C CE1 . PHE B 1 161 ? 31.164 8.415   42.731 1.00 21.68 ? 149 PHE B CE1 1 
ATOM   3126 C CE2 . PHE B 1 161 ? 31.393 9.694   40.690 1.00 21.25 ? 149 PHE B CE2 1 
ATOM   3127 C CZ  . PHE B 1 161 ? 31.576 9.587   42.061 1.00 21.43 ? 149 PHE B CZ  1 
ATOM   3128 N N   . GLU B 1 162 ? 30.213 3.549   37.933 1.00 17.70 ? 150 GLU B N   1 
ATOM   3129 C CA  . GLU B 1 162 ? 29.390 2.574   37.244 1.00 18.39 ? 150 GLU B CA  1 
ATOM   3130 C C   . GLU B 1 162 ? 29.077 1.319   38.047 1.00 21.23 ? 150 GLU B C   1 
ATOM   3131 O O   . GLU B 1 162 ? 27.908 0.913   38.182 1.00 18.27 ? 150 GLU B O   1 
ATOM   3132 C CB  . GLU B 1 162 ? 30.008 2.168   35.902 1.00 21.40 ? 150 GLU B CB  1 
ATOM   3133 C CG  . GLU B 1 162 ? 29.069 1.296   35.088 1.00 25.90 ? 150 GLU B CG  1 
ATOM   3134 C CD  . GLU B 1 162 ? 29.520 1.110   33.659 1.00 32.06 ? 150 GLU B CD  1 
ATOM   3135 O OE1 . GLU B 1 162 ? 30.752 1.099   33.411 1.00 33.78 ? 150 GLU B OE1 1 
ATOM   3136 O OE2 . GLU B 1 162 ? 28.637 0.962   32.785 1.00 34.10 ? 150 GLU B OE2 1 
ATOM   3137 N N   . GLN B 1 163 ? 30.117 0.694   38.583 1.00 20.75 ? 151 GLN B N   1 
ATOM   3138 C CA  . GLN B 1 163 ? 29.902 -0.536  39.317 1.00 23.03 ? 151 GLN B CA  1 
ATOM   3139 C C   . GLN B 1 163 ? 28.894 -0.330  40.438 1.00 22.62 ? 151 GLN B C   1 
ATOM   3140 O O   . GLN B 1 163 ? 27.932 -1.072  40.542 1.00 24.31 ? 151 GLN B O   1 
ATOM   3141 C CB  . GLN B 1 163 ? 31.229 -1.038  39.868 1.00 25.10 ? 151 GLN B CB  1 
ATOM   3142 C CG  . GLN B 1 163 ? 31.229 -2.492  40.299 1.00 27.21 ? 151 GLN B CG  1 
ATOM   3143 C CD  . GLN B 1 163 ? 32.599 -2.883  40.839 1.00 30.45 ? 151 GLN B CD  1 
ATOM   3144 O OE1 . GLN B 1 163 ? 32.994 -2.250  41.941 1.00 27.35 ? 151 GLN B OE1 1 
ATOM   3145 N NE2 . GLN B 1 163 ? 33.305 -3.726  40.258 1.00 32.03 ? 151 GLN B NE2 1 
ATOM   3146 N N   . GLU B 1 164 ? 29.114 0.694   41.251 1.00 21.42 ? 152 GLU B N   1 
ATOM   3147 C CA  . GLU B 1 164 ? 28.240 1.034   42.361 1.00 22.70 ? 152 GLU B CA  1 
ATOM   3148 C C   . GLU B 1 164 ? 26.783 1.255   41.930 1.00 23.24 ? 152 GLU B C   1 
ATOM   3149 O O   . GLU B 1 164 ? 25.850 0.694   42.531 1.00 22.89 ? 152 GLU B O   1 
ATOM   3150 C CB  . GLU B 1 164 ? 28.786 2.288   43.049 1.00 25.07 ? 152 GLU B CB  1 
ATOM   3151 C CG  . GLU B 1 164 ? 27.907 2.931   44.079 1.00 28.74 ? 152 GLU B CG  1 
ATOM   3152 C CD  . GLU B 1 164 ? 28.664 3.994   44.894 1.00 30.83 ? 152 GLU B CD  1 
ATOM   3153 O OE1 . GLU B 1 164 ? 29.494 4.735   44.315 1.00 30.90 ? 152 GLU B OE1 1 
ATOM   3154 O OE2 . GLU B 1 164 ? 28.413 4.097   46.116 1.00 34.23 ? 152 GLU B OE2 1 
ATOM   3155 N N   . PHE B 1 165 ? 26.576 2.085   40.912 1.00 21.54 ? 153 PHE B N   1 
ATOM   3156 C CA  . PHE B 1 165 ? 25.205 2.329   40.425 1.00 20.76 ? 153 PHE B CA  1 
ATOM   3157 C C   . PHE B 1 165 ? 24.567 1.118   39.730 1.00 19.35 ? 153 PHE B C   1 
ATOM   3158 O O   . PHE B 1 165 ? 23.352 0.957   39.773 1.00 17.98 ? 153 PHE B O   1 
ATOM   3159 C CB  . PHE B 1 165 ? 25.160 3.559   39.514 1.00 19.34 ? 153 PHE B CB  1 
ATOM   3160 C CG  . PHE B 1 165 ? 25.020 4.851   40.272 1.00 22.54 ? 153 PHE B CG  1 
ATOM   3161 C CD1 . PHE B 1 165 ? 26.136 5.462   40.849 1.00 22.65 ? 153 PHE B CD1 1 
ATOM   3162 C CD2 . PHE B 1 165 ? 23.760 5.440   40.452 1.00 22.41 ? 153 PHE B CD2 1 
ATOM   3163 C CE1 . PHE B 1 165 ? 26.006 6.647   41.598 1.00 23.97 ? 153 PHE B CE1 1 
ATOM   3164 C CE2 . PHE B 1 165 ? 23.618 6.624   41.202 1.00 22.69 ? 153 PHE B CE2 1 
ATOM   3165 C CZ  . PHE B 1 165 ? 24.754 7.228   41.774 1.00 23.55 ? 153 PHE B CZ  1 
ATOM   3166 N N   . GLU B 1 166 ? 25.367 0.273   39.085 1.00 20.16 ? 154 GLU B N   1 
ATOM   3167 C CA  . GLU B 1 166 ? 24.810 -0.927  38.474 1.00 22.23 ? 154 GLU B CA  1 
ATOM   3168 C C   . GLU B 1 166 ? 24.205 -1.795  39.595 1.00 21.51 ? 154 GLU B C   1 
ATOM   3169 O O   . GLU B 1 166 ? 23.187 -2.491  39.401 1.00 19.12 ? 154 GLU B O   1 
ATOM   3170 C CB  . GLU B 1 166 ? 25.884 -1.744  37.735 1.00 24.22 ? 154 GLU B CB  1 
ATOM   3171 C CG  . GLU B 1 166 ? 26.255 -1.234  36.349 1.00 27.36 ? 154 GLU B CG  1 
ATOM   3172 C CD  . GLU B 1 166 ? 27.484 -1.945  35.789 1.00 31.32 ? 154 GLU B CD  1 
ATOM   3173 O OE1 . GLU B 1 166 ? 28.260 -2.506  36.602 1.00 32.80 ? 154 GLU B OE1 1 
ATOM   3174 O OE2 . GLU B 1 166 ? 27.685 -1.935  34.552 1.00 32.92 ? 154 GLU B OE2 1 
ATOM   3175 N N   . PHE B 1 167 ? 24.856 -1.758  40.757 1.00 22.06 ? 155 PHE B N   1 
ATOM   3176 C CA  . PHE B 1 167 ? 24.410 -2.520  41.917 1.00 21.30 ? 155 PHE B CA  1 
ATOM   3177 C C   . PHE B 1 167 ? 23.075 -1.973  42.409 1.00 21.54 ? 155 PHE B C   1 
ATOM   3178 O O   . PHE B 1 167 ? 22.134 -2.735  42.590 1.00 22.58 ? 155 PHE B O   1 
ATOM   3179 C CB  . PHE B 1 167 ? 25.450 -2.448  43.044 1.00 23.22 ? 155 PHE B CB  1 
ATOM   3180 C CG  . PHE B 1 167 ? 25.063 -3.228  44.267 1.00 27.41 ? 155 PHE B CG  1 
ATOM   3181 C CD1 . PHE B 1 167 ? 24.603 -2.573  45.411 1.00 29.20 ? 155 PHE B CD1 1 
ATOM   3182 C CD2 . PHE B 1 167 ? 25.108 -4.625  44.255 1.00 28.72 ? 155 PHE B CD2 1 
ATOM   3183 C CE1 . PHE B 1 167 ? 24.192 -3.298  46.525 1.00 32.15 ? 155 PHE B CE1 1 
ATOM   3184 C CE2 . PHE B 1 167 ? 24.699 -5.363  45.364 1.00 30.64 ? 155 PHE B CE2 1 
ATOM   3185 C CZ  . PHE B 1 167 ? 24.241 -4.702  46.500 1.00 30.86 ? 155 PHE B CZ  1 
ATOM   3186 N N   . TYR B 1 168 ? 22.988 -0.660  42.634 1.00 20.21 ? 156 TYR B N   1 
ATOM   3187 C CA  . TYR B 1 168 ? 21.737 -0.064  43.081 1.00 21.78 ? 156 TYR B CA  1 
ATOM   3188 C C   . TYR B 1 168 ? 20.626 -0.333  42.074 1.00 21.11 ? 156 TYR B C   1 
ATOM   3189 O O   . TYR B 1 168 ? 19.517 -0.734  42.436 1.00 20.49 ? 156 TYR B O   1 
ATOM   3190 C CB  . TYR B 1 168 ? 21.861 1.458   43.250 1.00 22.26 ? 156 TYR B CB  1 
ATOM   3191 C CG  . TYR B 1 168 ? 22.967 1.876   44.187 1.00 27.42 ? 156 TYR B CG  1 
ATOM   3192 C CD1 . TYR B 1 168 ? 23.296 1.103   45.306 1.00 29.02 ? 156 TYR B CD1 1 
ATOM   3193 C CD2 . TYR B 1 168 ? 23.696 3.031   43.949 1.00 28.18 ? 156 TYR B CD2 1 
ATOM   3194 C CE1 . TYR B 1 168 ? 24.331 1.470   46.152 1.00 29.59 ? 156 TYR B CE1 1 
ATOM   3195 C CE2 . TYR B 1 168 ? 24.724 3.404   44.783 1.00 31.08 ? 156 TYR B CE2 1 
ATOM   3196 C CZ  . TYR B 1 168 ? 25.044 2.620   45.878 1.00 29.70 ? 156 TYR B CZ  1 
ATOM   3197 O OH  . TYR B 1 168 ? 26.119 2.965   46.648 1.00 32.34 ? 156 TYR B OH  1 
ATOM   3198 N N   . ILE B 1 169 ? 20.942 -0.098  40.805 1.00 19.69 ? 157 ILE B N   1 
ATOM   3199 C CA  . ILE B 1 169 ? 19.973 -0.280  39.734 1.00 19.97 ? 157 ILE B CA  1 
ATOM   3200 C C   . ILE B 1 169 ? 19.433 -1.713  39.717 1.00 21.46 ? 157 ILE B C   1 
ATOM   3201 O O   . ILE B 1 169 ? 18.235 -1.932  39.535 1.00 22.33 ? 157 ILE B O   1 
ATOM   3202 C CB  . ILE B 1 169 ? 20.611 0.143   38.404 1.00 17.72 ? 157 ILE B CB  1 
ATOM   3203 C CG1 . ILE B 1 169 ? 20.568 1.681   38.315 1.00 19.21 ? 157 ILE B CG1 1 
ATOM   3204 C CG2 . ILE B 1 169 ? 19.911 -0.505  37.235 1.00 19.29 ? 157 ILE B CG2 1 
ATOM   3205 C CD1 . ILE B 1 169 ? 21.593 2.288   37.378 1.00 20.37 ? 157 ILE B CD1 1 
ATOM   3206 N N   . GLU B 1 170 ? 20.308 -2.687  39.927 1.00 20.92 ? 158 GLU B N   1 
ATOM   3207 C CA  . GLU B 1 170 ? 19.885 -4.083  39.964 1.00 21.32 ? 158 GLU B CA  1 
ATOM   3208 C C   . GLU B 1 170 ? 18.881 -4.305  41.102 1.00 20.77 ? 158 GLU B C   1 
ATOM   3209 O O   . GLU B 1 170 ? 17.867 -4.936  40.879 1.00 20.05 ? 158 GLU B O   1 
ATOM   3210 C CB  . GLU B 1 170 ? 21.099 -5.010  40.134 1.00 25.21 ? 158 GLU B CB  1 
ATOM   3211 C CG  . GLU B 1 170 ? 20.778 -6.508  40.197 1.00 31.71 ? 158 GLU B CG  1 
ATOM   3212 C CD  . GLU B 1 170 ? 20.570 -7.146  38.820 1.00 38.05 ? 158 GLU B CD  1 
ATOM   3213 O OE1 . GLU B 1 170 ? 20.694 -6.425  37.795 1.00 38.57 ? 158 GLU B OE1 1 
ATOM   3214 O OE2 . GLU B 1 170 ? 20.291 -8.376  38.763 1.00 39.50 ? 158 GLU B OE2 1 
ATOM   3215 N N   . LYS B 1 171 ? 19.160 -3.778  42.304 1.00 20.18 ? 159 LYS B N   1 
ATOM   3216 C CA  . LYS B 1 171 ? 18.254 -3.919  43.460 1.00 20.66 ? 159 LYS B CA  1 
ATOM   3217 C C   . LYS B 1 171 ? 16.860 -3.323  43.166 1.00 21.43 ? 159 LYS B C   1 
ATOM   3218 O O   . LYS B 1 171 ? 15.818 -3.936  43.426 1.00 20.40 ? 159 LYS B O   1 
ATOM   3219 C CB  . LYS B 1 171 ? 18.823 -3.192  44.694 1.00 19.97 ? 159 LYS B CB  1 
ATOM   3220 C CG  . LYS B 1 171 ? 20.178 -3.655  45.211 1.00 24.01 ? 159 LYS B CG  1 
ATOM   3221 C CD  . LYS B 1 171 ? 20.143 -5.070  45.801 1.00 24.96 ? 159 LYS B CD  1 
ATOM   3222 C CE  . LYS B 1 171 ? 20.350 -6.130  44.747 1.00 28.41 ? 159 LYS B CE  1 
ATOM   3223 N NZ  . LYS B 1 171 ? 21.574 -5.888  43.955 1.00 31.88 ? 159 LYS B NZ  1 
ATOM   3224 N N   . ILE B 1 172 ? 16.862 -2.086  42.678 1.00 20.82 ? 160 ILE B N   1 
ATOM   3225 C CA  . ILE B 1 172 ? 15.632 -1.401  42.334 1.00 20.25 ? 160 ILE B CA  1 
ATOM   3226 C C   . ILE B 1 172 ? 14.945 -2.182  41.220 1.00 21.55 ? 160 ILE B C   1 
ATOM   3227 O O   . ILE B 1 172 ? 13.769 -2.494  41.346 1.00 22.82 ? 160 ILE B O   1 
ATOM   3228 C CB  . ILE B 1 172 ? 15.929 0.064   41.893 1.00 20.70 ? 160 ILE B CB  1 
ATOM   3229 C CG1 . ILE B 1 172 ? 16.529 0.841   43.073 1.00 18.65 ? 160 ILE B CG1 1 
ATOM   3230 C CG2 . ILE B 1 172 ? 14.661 0.740   41.441 1.00 17.84 ? 160 ILE B CG2 1 
ATOM   3231 C CD1 . ILE B 1 172 ? 17.112 2.223   42.704 1.00 21.67 ? 160 ILE B CD1 1 
ATOM   3232 N N   . MET B 1 173 ? 15.679 -2.554  40.165 1.00 21.79 ? 161 MET B N   1 
ATOM   3233 C CA  . MET B 1 173 ? 15.050 -3.292  39.064 1.00 23.81 ? 161 MET B CA  1 
ATOM   3234 C C   . MET B 1 173 ? 14.402 -4.584  39.557 1.00 27.46 ? 161 MET B C   1 
ATOM   3235 O O   . MET B 1 173 ? 13.339 -4.969  39.062 1.00 24.90 ? 161 MET B O   1 
ATOM   3236 C CB  . MET B 1 173 ? 16.053 -3.606  37.951 1.00 20.81 ? 161 MET B CB  1 
ATOM   3237 C CG  . MET B 1 173 ? 15.460 -4.355  36.734 1.00 22.64 ? 161 MET B CG  1 
ATOM   3238 S SD  . MET B 1 173 ? 14.095 -3.503  35.838 1.00 13.95 ? 161 MET B SD  1 
ATOM   3239 C CE  . MET B 1 173 ? 15.084 -2.321  34.913 1.00 18.16 ? 161 MET B CE  1 
ATOM   3240 N N   . LYS B 1 174 ? 15.028 -5.242  40.542 1.00 28.26 ? 162 LYS B N   1 
ATOM   3241 C CA  . LYS B 1 174 ? 14.476 -6.485  41.077 1.00 32.51 ? 162 LYS B CA  1 
ATOM   3242 C C   . LYS B 1 174 ? 13.396 -6.207  42.125 1.00 33.30 ? 162 LYS B C   1 
ATOM   3243 O O   . LYS B 1 174 ? 12.801 -7.144  42.674 1.00 33.68 ? 162 LYS B O   1 
ATOM   3244 C CB  . LYS B 1 174 ? 15.572 -7.343  41.727 1.00 34.60 ? 162 LYS B CB  1 
ATOM   3245 C CG  . LYS B 1 174 ? 16.642 -7.896  40.808 1.00 36.55 ? 162 LYS B CG  1 
ATOM   3246 C CD  . LYS B 1 174 ? 17.705 -8.559  41.684 1.00 41.47 ? 162 LYS B CD  1 
ATOM   3247 C CE  . LYS B 1 174 ? 18.725 -9.361  40.883 1.00 43.65 ? 162 LYS B CE  1 
ATOM   3248 N NZ  . LYS B 1 174 ? 18.094 -10.473 40.108 1.00 45.48 ? 162 LYS B NZ  1 
ATOM   3249 N N   . GLY B 1 175 ? 13.140 -4.929  42.401 1.00 33.65 ? 163 GLY B N   1 
ATOM   3250 C CA  . GLY B 1 175 ? 12.138 -4.570  43.394 1.00 33.49 ? 163 GLY B CA  1 
ATOM   3251 C C   . GLY B 1 175 ? 12.588 -4.812  44.833 1.00 34.33 ? 163 GLY B C   1 
ATOM   3252 O O   . GLY B 1 175 ? 11.772 -4.885  45.751 1.00 35.29 ? 163 GLY B O   1 
ATOM   3253 N N   . GLU B 1 176 ? 13.889 -4.938  45.043 1.00 34.28 ? 164 GLU B N   1 
ATOM   3254 C CA  . GLU B 1 176 ? 14.418 -5.176  46.390 1.00 33.62 ? 164 GLU B CA  1 
ATOM   3255 C C   . GLU B 1 176 ? 14.697 -3.821  47.004 1.00 33.79 ? 164 GLU B C   1 
ATOM   3256 O O   . GLU B 1 176 ? 15.345 -2.983  46.377 1.00 32.06 ? 164 GLU B O   1 
ATOM   3257 C CB  . GLU B 1 176 ? 15.710 -5.987  46.305 1.00 34.48 ? 164 GLU B CB  1 
ATOM   3258 C CG  . GLU B 1 176 ? 15.714 -6.958  45.138 1.00 36.99 ? 164 GLU B CG  1 
ATOM   3259 C CD  . GLU B 1 176 ? 16.910 -7.888  45.123 1.00 38.32 ? 164 GLU B CD  1 
ATOM   3260 O OE1 . GLU B 1 176 ? 18.060 -7.397  45.108 1.00 37.73 ? 164 GLU B OE1 1 
ATOM   3261 O OE2 . GLU B 1 176 ? 16.693 -9.123  45.106 1.00 39.65 ? 164 GLU B OE2 1 
ATOM   3262 N N   . MET B 1 177 ? 14.216 -3.590  48.221 1.00 34.14 ? 165 MET B N   1 
ATOM   3263 C CA  . MET B 1 177 ? 14.443 -2.295  48.848 1.00 35.94 ? 165 MET B CA  1 
ATOM   3264 C C   . MET B 1 177 ? 15.932 -1.987  48.944 1.00 34.25 ? 165 MET B C   1 
ATOM   3265 O O   . MET B 1 177 ? 16.781 -2.877  49.116 1.00 35.01 ? 165 MET B O   1 
ATOM   3266 C CB  . MET B 1 177 ? 13.778 -2.225  50.226 1.00 39.74 ? 165 MET B CB  1 
ATOM   3267 C CG  . MET B 1 177 ? 12.262 -2.098  50.155 1.00 42.18 ? 165 MET B CG  1 
ATOM   3268 S SD  . MET B 1 177 ? 11.549 -2.083  51.792 1.00 49.92 ? 165 MET B SD  1 
ATOM   3269 C CE  . MET B 1 177 ? 12.301 -0.497  52.476 1.00 45.47 ? 165 MET B CE  1 
ATOM   3270 N N   . LEU B 1 178 ? 16.243 -0.714  48.788 1.00 32.50 ? 166 LEU B N   1 
ATOM   3271 C CA  . LEU B 1 178 ? 17.620 -0.257  48.833 1.00 31.31 ? 166 LEU B CA  1 
ATOM   3272 C C   . LEU B 1 178 ? 17.832 0.696   49.990 1.00 30.44 ? 166 LEU B C   1 
ATOM   3273 O O   . LEU B 1 178 ? 17.092 1.652   50.163 1.00 30.79 ? 166 LEU B O   1 
ATOM   3274 C CB  . LEU B 1 178 ? 17.969 0.432   47.508 1.00 31.92 ? 166 LEU B CB  1 
ATOM   3275 C CG  . LEU B 1 178 ? 19.387 0.951   47.286 1.00 31.73 ? 166 LEU B CG  1 
ATOM   3276 C CD1 . LEU B 1 178 ? 20.384 -0.204  47.494 1.00 31.62 ? 166 LEU B CD1 1 
ATOM   3277 C CD2 . LEU B 1 178 ? 19.493 1.559   45.876 1.00 31.63 ? 166 LEU B CD2 1 
ATOM   3278 N N   . PHE B 1 179 ? 18.842 0.407   50.798 1.00 30.22 ? 167 PHE B N   1 
ATOM   3279 C CA  . PHE B 1 179 ? 19.192 1.240   51.933 1.00 29.03 ? 167 PHE B CA  1 
ATOM   3280 C C   . PHE B 1 179 ? 20.548 0.768   52.466 1.00 28.94 ? 167 PHE B C   1 
ATOM   3281 O O   . PHE B 1 179 ? 21.158 -0.129  51.886 1.00 26.13 ? 167 PHE B O   1 
ATOM   3282 C CB  . PHE B 1 179 ? 18.112 1.183   53.025 1.00 29.48 ? 167 PHE B CB  1 
ATOM   3283 C CG  . PHE B 1 179 ? 17.725 -0.213  53.454 1.00 30.95 ? 167 PHE B CG  1 
ATOM   3284 C CD1 . PHE B 1 179 ? 16.798 -0.953  52.724 1.00 31.55 ? 167 PHE B CD1 1 
ATOM   3285 C CD2 . PHE B 1 179 ? 18.270 -0.777  54.605 1.00 31.18 ? 167 PHE B CD2 1 
ATOM   3286 C CE1 . PHE B 1 179 ? 16.412 -2.240  53.133 1.00 32.41 ? 167 PHE B CE1 1 
ATOM   3287 C CE2 . PHE B 1 179 ? 17.892 -2.058  55.024 1.00 31.45 ? 167 PHE B CE2 1 
ATOM   3288 C CZ  . PHE B 1 179 ? 16.961 -2.787  54.285 1.00 32.57 ? 167 PHE B CZ  1 
ATOM   3289 N N   . ASP B 1 180 ? 21.038 1.392   53.533 1.00 28.31 ? 168 ASP B N   1 
ATOM   3290 C CA  . ASP B 1 180 ? 22.321 0.993   54.110 1.00 28.90 ? 168 ASP B CA  1 
ATOM   3291 C C   . ASP B 1 180 ? 22.031 -0.298  54.856 1.00 28.19 ? 168 ASP B C   1 
ATOM   3292 O O   . ASP B 1 180 ? 21.668 -0.279  56.037 1.00 28.44 ? 168 ASP B O   1 
ATOM   3293 C CB  . ASP B 1 180 ? 22.831 2.040   55.102 1.00 32.20 ? 168 ASP B CB  1 
ATOM   3294 C CG  . ASP B 1 180 ? 24.231 1.705   55.648 1.00 34.44 ? 168 ASP B CG  1 
ATOM   3295 O OD1 . ASP B 1 180 ? 24.644 0.509   55.598 1.00 35.80 ? 168 ASP B OD1 1 
ATOM   3296 O OD2 . ASP B 1 180 ? 24.908 2.638   56.139 1.00 34.82 ? 168 ASP B OD2 1 
ATOM   3297 N N   . TYR B 1 181 ? 22.178 -1.416  54.155 1.00 27.38 ? 169 TYR B N   1 
ATOM   3298 C CA  . TYR B 1 181 ? 21.887 -2.720  54.746 1.00 25.50 ? 169 TYR B CA  1 
ATOM   3299 C C   . TYR B 1 181 ? 22.698 -3.018  56.004 1.00 24.25 ? 169 TYR B C   1 
ATOM   3300 O O   . TYR B 1 181 ? 22.146 -3.428  57.028 1.00 24.27 ? 169 TYR B O   1 
ATOM   3301 C CB  . TYR B 1 181 ? 22.169 -3.823  53.735 1.00 24.88 ? 169 TYR B CB  1 
ATOM   3302 C CG  . TYR B 1 181 ? 21.491 -3.631  52.400 1.00 26.21 ? 169 TYR B CG  1 
ATOM   3303 C CD1 . TYR B 1 181 ? 20.095 -3.589  52.310 1.00 26.14 ? 169 TYR B CD1 1 
ATOM   3304 C CD2 . TYR B 1 181 ? 22.239 -3.517  51.219 1.00 24.50 ? 169 TYR B CD2 1 
ATOM   3305 C CE1 . TYR B 1 181 ? 19.461 -3.447  51.076 1.00 27.14 ? 169 TYR B CE1 1 
ATOM   3306 C CE2 . TYR B 1 181 ? 21.603 -3.376  49.971 1.00 25.57 ? 169 TYR B CE2 1 
ATOM   3307 C CZ  . TYR B 1 181 ? 20.216 -3.346  49.917 1.00 25.39 ? 169 TYR B CZ  1 
ATOM   3308 O OH  . TYR B 1 181 ? 19.557 -3.250  48.709 1.00 28.47 ? 169 TYR B OH  1 
ATOM   3309 N N   . LYS B 1 182 ? 24.008 -2.851  55.889 1.00 24.90 ? 170 LYS B N   1 
ATOM   3310 C CA  . LYS B 1 182 ? 24.926 -3.151  56.984 1.00 28.14 ? 170 LYS B CA  1 
ATOM   3311 C C   . LYS B 1 182 ? 24.581 -2.433  58.274 1.00 28.01 ? 170 LYS B C   1 
ATOM   3312 O O   . LYS B 1 182 ? 24.482 -3.036  59.345 1.00 27.90 ? 170 LYS B O   1 
ATOM   3313 C CB  . LYS B 1 182 ? 26.353 -2.826  56.560 1.00 28.69 ? 170 LYS B CB  1 
ATOM   3314 C CG  . LYS B 1 182 ? 26.838 -3.695  55.429 1.00 33.56 ? 170 LYS B CG  1 
ATOM   3315 C CD  . LYS B 1 182 ? 28.244 -3.310  55.025 1.00 37.71 ? 170 LYS B CD  1 
ATOM   3316 C CE  . LYS B 1 182 ? 28.649 -3.999  53.718 1.00 40.58 ? 170 LYS B CE  1 
ATOM   3317 N NZ  . LYS B 1 182 ? 29.904 -3.422  53.133 1.00 42.00 ? 170 LYS B NZ  1 
ATOM   3318 N N   . THR B 1 183 ? 24.375 -1.131  58.169 1.00 27.87 ? 171 THR B N   1 
ATOM   3319 C CA  . THR B 1 183 ? 24.028 -0.348  59.340 1.00 25.44 ? 171 THR B CA  1 
ATOM   3320 C C   . THR B 1 183 ? 22.688 -0.799  59.908 1.00 24.05 ? 171 THR B C   1 
ATOM   3321 O O   . THR B 1 183 ? 22.496 -0.823  61.116 1.00 22.26 ? 171 THR B O   1 
ATOM   3322 C CB  . THR B 1 183 ? 23.980 1.151   58.969 1.00 25.19 ? 171 THR B CB  1 
ATOM   3323 O OG1 . THR B 1 183 ? 25.297 1.569   58.596 1.00 26.02 ? 171 THR B OG1 1 
ATOM   3324 C CG2 . THR B 1 183 ? 23.502 1.982   60.130 1.00 21.69 ? 171 THR B CG2 1 
ATOM   3325 N N   . ALA B 1 184 ? 21.760 -1.172  59.034 1.00 24.45 ? 172 ALA B N   1 
ATOM   3326 C CA  . ALA B 1 184 ? 20.434 -1.604  59.493 1.00 21.80 ? 172 ALA B CA  1 
ATOM   3327 C C   . ALA B 1 184 ? 20.504 -2.981  60.177 1.00 21.96 ? 172 ALA B C   1 
ATOM   3328 O O   . ALA B 1 184 ? 19.799 -3.260  61.150 1.00 22.04 ? 172 ALA B O   1 
ATOM   3329 C CB  . ALA B 1 184 ? 19.470 -1.663  58.298 1.00 24.59 ? 172 ALA B CB  1 
ATOM   3330 N N   . LEU B 1 185 ? 21.320 -3.863  59.636 1.00 21.80 ? 173 LEU B N   1 
ATOM   3331 C CA  . LEU B 1 185 ? 21.445 -5.201  60.235 1.00 23.11 ? 173 LEU B CA  1 
ATOM   3332 C C   . LEU B 1 185 ? 22.172 -5.081  61.593 1.00 23.41 ? 173 LEU B C   1 
ATOM   3333 O O   . LEU B 1 185 ? 21.779 -5.704  62.589 1.00 25.34 ? 173 LEU B O   1 
ATOM   3334 C CB  . LEU B 1 185 ? 22.233 -6.119  59.297 1.00 21.21 ? 173 LEU B CB  1 
ATOM   3335 C CG  . LEU B 1 185 ? 22.442 -7.575  59.745 1.00 22.27 ? 173 LEU B CG  1 
ATOM   3336 C CD1 . LEU B 1 185 ? 21.088 -8.276  59.886 1.00 20.60 ? 173 LEU B CD1 1 
ATOM   3337 C CD2 . LEU B 1 185 ? 23.331 -8.312  58.748 1.00 20.18 ? 173 LEU B CD2 1 
ATOM   3338 N N   . GLN B 1 186 ? 23.227 -4.271  61.613 1.00 25.21 ? 174 GLN B N   1 
ATOM   3339 C CA  . GLN B 1 186 ? 24.022 -4.061  62.829 1.00 27.98 ? 174 GLN B CA  1 
ATOM   3340 C C   . GLN B 1 186 ? 23.138 -3.711  63.998 1.00 28.54 ? 174 GLN B C   1 
ATOM   3341 O O   . GLN B 1 186 ? 23.288 -4.261  65.093 1.00 26.13 ? 174 GLN B O   1 
ATOM   3342 C CB  . GLN B 1 186 ? 25.025 -2.931  62.624 1.00 30.95 ? 174 GLN B CB  1 
ATOM   3343 C CG  . GLN B 1 186 ? 25.463 -2.242  63.920 1.00 36.45 ? 174 GLN B CG  1 
ATOM   3344 C CD  . GLN B 1 186 ? 26.463 -3.070  64.703 1.00 39.49 ? 174 GLN B CD  1 
ATOM   3345 O OE1 . GLN B 1 186 ? 27.341 -3.711  64.110 1.00 41.48 ? 174 GLN B OE1 1 
ATOM   3346 N NE2 . GLN B 1 186 ? 26.363 -3.040  66.040 1.00 39.28 ? 174 GLN B NE2 1 
ATOM   3347 N N   . GLU B 1 187 ? 22.218 -2.780  63.754 1.00 29.01 ? 175 GLU B N   1 
ATOM   3348 C CA  . GLU B 1 187 ? 21.293 -2.310  64.772 1.00 30.69 ? 175 GLU B CA  1 
ATOM   3349 C C   . GLU B 1 187 ? 20.367 -3.406  65.276 1.00 29.73 ? 175 GLU B C   1 
ATOM   3350 O O   . GLU B 1 187 ? 20.138 -3.532  66.473 1.00 29.42 ? 175 GLU B O   1 
ATOM   3351 C CB  . GLU B 1 187 ? 20.456 -1.136  64.226 1.00 34.13 ? 175 GLU B CB  1 
ATOM   3352 C CG  . GLU B 1 187 ? 21.206 0.214   64.172 1.00 39.04 ? 175 GLU B CG  1 
ATOM   3353 C CD  . GLU B 1 187 ? 20.367 1.356   63.541 1.00 42.74 ? 175 GLU B CD  1 
ATOM   3354 O OE1 . GLU B 1 187 ? 19.114 1.335   63.682 1.00 44.38 ? 175 GLU B OE1 1 
ATOM   3355 O OE2 . GLU B 1 187 ? 20.962 2.276   62.917 1.00 43.36 ? 175 GLU B OE2 1 
ATOM   3356 N N   . ILE B 1 188 ? 19.832 -4.213  64.370 1.00 29.45 ? 176 ILE B N   1 
ATOM   3357 C CA  . ILE B 1 188 ? 18.915 -5.268  64.794 1.00 27.39 ? 176 ILE B CA  1 
ATOM   3358 C C   . ILE B 1 188 ? 19.635 -6.451  65.476 1.00 25.16 ? 176 ILE B C   1 
ATOM   3359 O O   . ILE B 1 188 ? 19.149 -7.005  66.459 1.00 22.06 ? 176 ILE B O   1 
ATOM   3360 C CB  . ILE B 1 188 ? 18.066 -5.740  63.594 1.00 29.76 ? 176 ILE B CB  1 
ATOM   3361 C CG1 . ILE B 1 188 ? 16.786 -6.392  64.096 1.00 32.23 ? 176 ILE B CG1 1 
ATOM   3362 C CG2 . ILE B 1 188 ? 18.847 -6.718  62.716 1.00 31.65 ? 176 ILE B CG2 1 
ATOM   3363 C CD1 . ILE B 1 188 ? 16.982 -7.754  64.690 1.00 34.72 ? 176 ILE B CD1 1 
ATOM   3364 N N   . VAL B 1 189 ? 20.803 -6.819  64.971 1.00 24.74 ? 177 VAL B N   1 
ATOM   3365 C CA  . VAL B 1 189 ? 21.555 -7.922  65.573 1.00 23.88 ? 177 VAL B CA  1 
ATOM   3366 C C   . VAL B 1 189 ? 22.101 -7.493  66.932 1.00 23.96 ? 177 VAL B C   1 
ATOM   3367 O O   . VAL B 1 189 ? 21.975 -8.221  67.905 1.00 24.69 ? 177 VAL B O   1 
ATOM   3368 C CB  . VAL B 1 189 ? 22.718 -8.363  64.682 1.00 21.48 ? 177 VAL B CB  1 
ATOM   3369 C CG1 . VAL B 1 189 ? 23.666 -9.290  65.472 1.00 20.96 ? 177 VAL B CG1 1 
ATOM   3370 C CG2 . VAL B 1 189 ? 22.166 -9.081  63.446 1.00 22.43 ? 177 VAL B CG2 1 
ATOM   3371 N N   . GLN B 1 190 ? 22.681 -6.302  67.007 1.00 24.76 ? 178 GLN B N   1 
ATOM   3372 C CA  . GLN B 1 190 ? 23.215 -5.840  68.284 1.00 25.56 ? 178 GLN B CA  1 
ATOM   3373 C C   . GLN B 1 190 ? 22.087 -5.874  69.313 1.00 26.39 ? 178 GLN B C   1 
ATOM   3374 O O   . GLN B 1 190 ? 22.272 -6.361  70.423 1.00 25.80 ? 178 GLN B O   1 
ATOM   3375 C CB  . GLN B 1 190 ? 23.802 -4.434  68.152 1.00 25.13 ? 178 GLN B CB  1 
ATOM   3376 C CG  . GLN B 1 190 ? 24.517 -3.909  69.408 1.00 28.41 ? 178 GLN B CG  1 
ATOM   3377 C CD  . GLN B 1 190 ? 25.901 -4.525  69.623 1.00 29.73 ? 178 GLN B CD  1 
ATOM   3378 O OE1 . GLN B 1 190 ? 26.723 -4.591  68.702 1.00 30.68 ? 178 GLN B OE1 1 
ATOM   3379 N NE2 . GLN B 1 190 ? 26.176 -4.945  70.855 1.00 31.10 ? 178 GLN B NE2 1 
ATOM   3380 N N   . SER B 1 191 ? 20.900 -5.390  68.946 1.00 28.04 ? 179 SER B N   1 
ATOM   3381 C CA  . SER B 1 191 ? 19.772 -5.397  69.886 1.00 28.29 ? 179 SER B CA  1 
ATOM   3382 C C   . SER B 1 191 ? 19.325 -6.768  70.379 1.00 27.53 ? 179 SER B C   1 
ATOM   3383 O O   . SER B 1 191 ? 19.058 -6.942  71.562 1.00 29.06 ? 179 SER B O   1 
ATOM   3384 C CB  . SER B 1 191 ? 18.553 -4.687  69.281 1.00 30.79 ? 179 SER B CB  1 
ATOM   3385 O OG  . SER B 1 191 ? 18.757 -3.282  69.274 1.00 36.83 ? 179 SER B OG  1 
ATOM   3386 N N   . GLU B 1 192 ? 19.215 -7.732  69.474 1.00 27.61 ? 180 GLU B N   1 
ATOM   3387 C CA  . GLU B 1 192 ? 18.774 -9.076  69.842 1.00 28.42 ? 180 GLU B CA  1 
ATOM   3388 C C   . GLU B 1 192 ? 19.861 -9.960  70.469 1.00 26.91 ? 180 GLU B C   1 
ATOM   3389 O O   . GLU B 1 192 ? 19.568 -10.824 71.278 1.00 27.21 ? 180 GLU B O   1 
ATOM   3390 C CB  . GLU B 1 192 ? 18.228 -9.802  68.601 1.00 31.49 ? 180 GLU B CB  1 
ATOM   3391 C CG  . GLU B 1 192 ? 16.993 -9.132  67.914 1.00 36.18 ? 180 GLU B CG  1 
ATOM   3392 C CD  . GLU B 1 192 ? 16.444 -9.949  66.728 1.00 39.36 ? 180 GLU B CD  1 
ATOM   3393 O OE1 . GLU B 1 192 ? 15.415 -9.536  66.130 1.00 42.35 ? 180 GLU B OE1 1 
ATOM   3394 O OE2 . GLU B 1 192 ? 17.040 -11.002 66.385 1.00 42.19 ? 180 GLU B OE2 1 
ATOM   3395 N N   . HIS B 1 193 ? 21.116 -9.746  70.097 1.00 25.89 ? 181 HIS B N   1 
ATOM   3396 C CA  . HIS B 1 193 ? 22.178 -10.631 70.588 1.00 25.91 ? 181 HIS B CA  1 
ATOM   3397 C C   . HIS B 1 193 ? 23.269 -10.018 71.435 1.00 25.95 ? 181 HIS B C   1 
ATOM   3398 O O   . HIS B 1 193 ? 24.065 -10.737 72.032 1.00 26.73 ? 181 HIS B O   1 
ATOM   3399 C CB  . HIS B 1 193 ? 22.809 -11.332 69.394 1.00 24.46 ? 181 HIS B CB  1 
ATOM   3400 C CG  . HIS B 1 193 ? 21.850 -12.194 68.637 1.00 25.31 ? 181 HIS B CG  1 
ATOM   3401 N ND1 . HIS B 1 193 ? 21.471 -13.446 69.073 1.00 24.53 ? 181 HIS B ND1 1 
ATOM   3402 C CD2 . HIS B 1 193 ? 21.153 -11.968 67.493 1.00 25.19 ? 181 HIS B CD2 1 
ATOM   3403 C CE1 . HIS B 1 193 ? 20.583 -13.955 68.235 1.00 25.39 ? 181 HIS B CE1 1 
ATOM   3404 N NE2 . HIS B 1 193 ? 20.371 -13.077 67.267 1.00 25.83 ? 181 HIS B NE2 1 
ATOM   3405 N N   . LYS B 1 194 ? 23.309 -8.697  71.486 1.00 25.51 ? 182 LYS B N   1 
ATOM   3406 C CA  . LYS B 1 194 ? 24.327 -7.979  72.255 1.00 25.92 ? 182 LYS B CA  1 
ATOM   3407 C C   . LYS B 1 194 ? 25.719 -8.075  71.681 1.00 23.77 ? 182 LYS B C   1 
ATOM   3408 O O   . LYS B 1 194 ? 26.681 -7.749  72.365 1.00 24.03 ? 182 LYS B O   1 
ATOM   3409 C CB  . LYS B 1 194 ? 24.353 -8.433  73.718 1.00 27.94 ? 182 LYS B CB  1 
ATOM   3410 C CG  . LYS B 1 194 ? 23.287 -7.757  74.556 1.00 31.13 ? 182 LYS B CG  1 
ATOM   3411 C CD  . LYS B 1 194 ? 21.916 -8.076  74.035 1.00 34.93 ? 182 LYS B CD  1 
ATOM   3412 C CE  . LYS B 1 194 ? 20.840 -7.412  74.880 1.00 38.30 ? 182 LYS B CE  1 
ATOM   3413 N NZ  . LYS B 1 194 ? 20.833 -5.912  74.731 1.00 41.80 ? 182 LYS B NZ  1 
ATOM   3414 N N   . VAL B 1 195 ? 25.820 -8.562  70.448 1.00 21.73 ? 183 VAL B N   1 
ATOM   3415 C CA  . VAL B 1 195 ? 27.091 -8.619  69.715 1.00 22.23 ? 183 VAL B CA  1 
ATOM   3416 C C   . VAL B 1 195 ? 26.782 -8.173  68.277 1.00 20.66 ? 183 VAL B C   1 
ATOM   3417 O O   . VAL B 1 195 ? 25.641 -8.225  67.829 1.00 21.06 ? 183 VAL B O   1 
ATOM   3418 C CB  . VAL B 1 195 ? 27.741 -10.033 69.639 1.00 22.59 ? 183 VAL B CB  1 
ATOM   3419 C CG1 . VAL B 1 195 ? 28.193 -10.500 71.033 1.00 24.18 ? 183 VAL B CG1 1 
ATOM   3420 C CG2 . VAL B 1 195 ? 26.779 -11.014 69.005 1.00 23.04 ? 183 VAL B CG2 1 
ATOM   3421 N N   . PRO B 1 196 ? 27.794 -7.699  67.556 1.00 20.32 ? 184 PRO B N   1 
ATOM   3422 C CA  . PRO B 1 196 ? 27.576 -7.251  66.175 1.00 22.03 ? 184 PRO B CA  1 
ATOM   3423 C C   . PRO B 1 196 ? 27.729 -8.382  65.163 1.00 22.56 ? 184 PRO B C   1 
ATOM   3424 O O   . PRO B 1 196 ? 28.347 -9.414  65.457 1.00 22.10 ? 184 PRO B O   1 
ATOM   3425 C CB  . PRO B 1 196 ? 28.658 -6.198  65.993 1.00 20.66 ? 184 PRO B CB  1 
ATOM   3426 C CG  . PRO B 1 196 ? 29.837 -6.849  66.749 1.00 20.40 ? 184 PRO B CG  1 
ATOM   3427 C CD  . PRO B 1 196 ? 29.161 -7.377  68.023 1.00 19.16 ? 184 PRO B CD  1 
ATOM   3428 N N   . PRO B 1 197 ? 27.150 -8.216  63.957 1.00 23.21 ? 185 PRO B N   1 
ATOM   3429 C CA  . PRO B 1 197 ? 27.313 -9.293  62.972 1.00 23.08 ? 185 PRO B CA  1 
ATOM   3430 C C   . PRO B 1 197 ? 28.748 -9.255  62.431 1.00 22.23 ? 185 PRO B C   1 
ATOM   3431 O O   . PRO B 1 197 ? 29.409 -8.209  62.476 1.00 22.41 ? 185 PRO B O   1 
ATOM   3432 C CB  . PRO B 1 197 ? 26.278 -8.953  61.899 1.00 24.47 ? 185 PRO B CB  1 
ATOM   3433 C CG  . PRO B 1 197 ? 26.172 -7.445  61.983 1.00 26.04 ? 185 PRO B CG  1 
ATOM   3434 C CD  . PRO B 1 197 ? 26.210 -7.182  63.482 1.00 24.34 ? 185 PRO B CD  1 
ATOM   3435 N N   . GLU B 1 198 ? 29.240 -10.383 61.940 1.00 20.38 ? 186 GLU B N   1 
ATOM   3436 C CA  . GLU B 1 198 ? 30.584 -10.419 61.377 1.00 21.83 ? 186 GLU B CA  1 
ATOM   3437 C C   . GLU B 1 198 ? 30.500 -10.858 59.909 1.00 20.57 ? 186 GLU B C   1 
ATOM   3438 O O   . GLU B 1 198 ? 29.688 -11.711 59.559 1.00 17.27 ? 186 GLU B O   1 
ATOM   3439 C CB  . GLU B 1 198 ? 31.477 -11.391 62.153 1.00 25.98 ? 186 GLU B CB  1 
ATOM   3440 C CG  . GLU B 1 198 ? 31.455 -11.180 63.681 1.00 33.31 ? 186 GLU B CG  1 
ATOM   3441 C CD  . GLU B 1 198 ? 32.022 -9.827  64.137 1.00 37.19 ? 186 GLU B CD  1 
ATOM   3442 O OE1 . GLU B 1 198 ? 32.571 -9.061  63.304 1.00 40.27 ? 186 GLU B OE1 1 
ATOM   3443 O OE2 . GLU B 1 198 ? 31.931 -9.535  65.357 1.00 40.32 ? 186 GLU B OE2 1 
ATOM   3444 N N   . TYR B 1 199 ? 31.352 -10.273 59.070 1.00 19.01 ? 187 TYR B N   1 
ATOM   3445 C CA  . TYR B 1 199 ? 31.363 -10.570 57.643 1.00 22.58 ? 187 TYR B CA  1 
ATOM   3446 C C   . TYR B 1 199 ? 32.643 -11.325 57.343 1.00 24.38 ? 187 TYR B C   1 
ATOM   3447 O O   . TYR B 1 199 ? 33.751 -10.826 57.596 1.00 25.62 ? 187 TYR B O   1 
ATOM   3448 C CB  . TYR B 1 199 ? 31.306 -9.264  56.827 1.00 21.13 ? 187 TYR B CB  1 
ATOM   3449 C CG  . TYR B 1 199 ? 30.031 -8.487  57.051 1.00 22.02 ? 187 TYR B CG  1 
ATOM   3450 C CD1 . TYR B 1 199 ? 28.898 -8.743  56.283 1.00 23.11 ? 187 TYR B CD1 1 
ATOM   3451 C CD2 . TYR B 1 199 ? 29.926 -7.563  58.083 1.00 22.33 ? 187 TYR B CD2 1 
ATOM   3452 C CE1 . TYR B 1 199 ? 27.703 -8.113  56.542 1.00 21.98 ? 187 TYR B CE1 1 
ATOM   3453 C CE2 . TYR B 1 199 ? 28.724 -6.924  58.352 1.00 23.01 ? 187 TYR B CE2 1 
ATOM   3454 C CZ  . TYR B 1 199 ? 27.615 -7.215  57.574 1.00 22.49 ? 187 TYR B CZ  1 
ATOM   3455 O OH  . TYR B 1 199 ? 26.395 -6.659  57.863 1.00 22.55 ? 187 TYR B OH  1 
ATOM   3456 N N   . ILE B 1 200 ? 32.482 -12.522 56.799 1.00 24.36 ? 188 ILE B N   1 
ATOM   3457 C CA  . ILE B 1 200 ? 33.608 -13.379 56.489 1.00 27.20 ? 188 ILE B CA  1 
ATOM   3458 C C   . ILE B 1 200 ? 33.662 -13.716 55.002 1.00 28.22 ? 188 ILE B C   1 
ATOM   3459 O O   . ILE B 1 200 ? 32.739 -14.340 54.472 1.00 27.82 ? 188 ILE B O   1 
ATOM   3460 C CB  . ILE B 1 200 ? 33.484 -14.701 57.281 1.00 27.95 ? 188 ILE B CB  1 
ATOM   3461 C CG1 . ILE B 1 200 ? 33.233 -14.393 58.765 1.00 29.75 ? 188 ILE B CG1 1 
ATOM   3462 C CG2 . ILE B 1 200 ? 34.723 -15.572 57.053 1.00 30.07 ? 188 ILE B CG2 1 
ATOM   3463 C CD1 . ILE B 1 200 ? 34.298 -13.529 59.416 1.00 32.89 ? 188 ILE B CD1 1 
ATOM   3464 N N   . LEU B 1 201 ? 34.731 -13.309 54.324 1.00 29.40 ? 189 LEU B N   1 
ATOM   3465 C CA  . LEU B 1 201 ? 34.861 -13.650 52.913 1.00 31.53 ? 189 LEU B CA  1 
ATOM   3466 C C   . LEU B 1 201 ? 35.257 -15.118 52.922 1.00 33.69 ? 189 LEU B C   1 
ATOM   3467 O O   . LEU B 1 201 ? 36.386 -15.466 53.284 1.00 35.38 ? 189 LEU B O   1 
ATOM   3468 C CB  . LEU B 1 201 ? 35.960 -12.830 52.231 1.00 31.38 ? 189 LEU B CB  1 
ATOM   3469 C CG  . LEU B 1 201 ? 36.264 -13.298 50.797 1.00 31.04 ? 189 LEU B CG  1 
ATOM   3470 C CD1 . LEU B 1 201 ? 35.025 -13.078 49.930 1.00 31.43 ? 189 LEU B CD1 1 
ATOM   3471 C CD2 . LEU B 1 201 ? 37.455 -12.537 50.217 1.00 29.54 ? 189 LEU B CD2 1 
ATOM   3472 N N   . VAL B 1 202 ? 34.340 -15.991 52.540 1.00 34.02 ? 190 VAL B N   1 
ATOM   3473 C CA  . VAL B 1 202 ? 34.653 -17.406 52.550 1.00 35.64 ? 190 VAL B CA  1 
ATOM   3474 C C   . VAL B 1 202 ? 35.189 -17.932 51.225 1.00 38.11 ? 190 VAL B C   1 
ATOM   3475 O O   . VAL B 1 202 ? 35.713 -19.047 51.158 1.00 37.73 ? 190 VAL B O   1 
ATOM   3476 C CB  . VAL B 1 202 ? 33.410 -18.225 52.912 1.00 34.03 ? 190 VAL B CB  1 
ATOM   3477 C CG1 . VAL B 1 202 ? 32.877 -17.769 54.268 1.00 33.24 ? 190 VAL B CG1 1 
ATOM   3478 C CG2 . VAL B 1 202 ? 32.364 -18.073 51.826 1.00 31.10 ? 190 VAL B CG2 1 
ATOM   3479 N N   . ARG B 1 203 ? 35.084 -17.132 50.171 1.00 39.54 ? 191 ARG B N   1 
ATOM   3480 C CA  . ARG B 1 203 ? 35.515 -17.623 48.880 1.00 41.37 ? 191 ARG B CA  1 
ATOM   3481 C C   . ARG B 1 203 ? 35.511 -16.567 47.776 1.00 43.50 ? 191 ARG B C   1 
ATOM   3482 O O   . ARG B 1 203 ? 34.734 -15.610 47.811 1.00 41.50 ? 191 ARG B O   1 
ATOM   3483 C CB  . ARG B 1 203 ? 34.584 -18.774 48.515 1.00 41.48 ? 191 ARG B CB  1 
ATOM   3484 C CG  . ARG B 1 203 ? 34.848 -19.441 47.228 1.00 41.91 ? 191 ARG B CG  1 
ATOM   3485 C CD  . ARG B 1 203 ? 33.980 -20.682 47.095 1.00 42.19 ? 191 ARG B CD  1 
ATOM   3486 N NE  . ARG B 1 203 ? 32.600 -20.379 46.731 1.00 43.17 ? 191 ARG B NE  1 
ATOM   3487 C CZ  . ARG B 1 203 ? 31.576 -20.345 47.576 1.00 43.48 ? 191 ARG B CZ  1 
ATOM   3488 N NH1 . ARG B 1 203 ? 31.757 -20.597 48.869 1.00 43.90 ? 191 ARG B NH1 1 
ATOM   3489 N NH2 . ARG B 1 203 ? 30.362 -20.069 47.117 1.00 43.14 ? 191 ARG B NH2 1 
ATOM   3490 N N   . THR B 1 204 ? 36.412 -16.730 46.814 1.00 45.97 ? 192 THR B N   1 
ATOM   3491 C CA  . THR B 1 204 ? 36.464 -15.828 45.669 1.00 50.28 ? 192 THR B CA  1 
ATOM   3492 C C   . THR B 1 204 ? 36.532 -16.781 44.491 1.00 53.12 ? 192 THR B C   1 
ATOM   3493 O O   . THR B 1 204 ? 37.030 -17.898 44.633 1.00 53.77 ? 192 THR B O   1 
ATOM   3494 C CB  . THR B 1 204 ? 37.708 -14.897 45.689 1.00 49.80 ? 192 THR B CB  1 
ATOM   3495 O OG1 . THR B 1 204 ? 38.903 -15.683 45.672 1.00 52.49 ? 192 THR B OG1 1 
ATOM   3496 C CG2 . THR B 1 204 ? 37.703 -14.029 46.926 1.00 48.99 ? 192 THR B CG2 1 
ATOM   3497 N N   . GLU B 1 205 ? 36.009 -16.365 43.344 1.00 56.49 ? 193 GLU B N   1 
ATOM   3498 C CA  . GLU B 1 205 ? 36.013 -17.215 42.161 1.00 60.32 ? 193 GLU B CA  1 
ATOM   3499 C C   . GLU B 1 205 ? 35.762 -16.395 40.899 1.00 62.38 ? 193 GLU B C   1 
ATOM   3500 O O   . GLU B 1 205 ? 35.141 -15.331 40.955 1.00 62.81 ? 193 GLU B O   1 
ATOM   3501 C CB  . GLU B 1 205 ? 34.940 -18.295 42.313 1.00 61.68 ? 193 GLU B CB  1 
ATOM   3502 C CG  . GLU B 1 205 ? 33.591 -17.757 42.776 1.00 64.29 ? 193 GLU B CG  1 
ATOM   3503 C CD  . GLU B 1 205 ? 32.633 -18.859 43.206 1.00 66.46 ? 193 GLU B CD  1 
ATOM   3504 O OE1 . GLU B 1 205 ? 32.463 -19.838 42.446 1.00 68.16 ? 193 GLU B OE1 1 
ATOM   3505 O OE2 . GLU B 1 205 ? 32.039 -18.752 44.302 1.00 67.59 ? 193 GLU B OE2 1 
ATOM   3506 N N   . LYS B 1 206 ? 36.255 -16.874 39.758 1.00 64.41 ? 194 LYS B N   1 
ATOM   3507 C CA  . LYS B 1 206 ? 36.049 -16.156 38.499 1.00 66.37 ? 194 LYS B CA  1 
ATOM   3508 C C   . LYS B 1 206 ? 34.967 -16.834 37.668 1.00 67.82 ? 194 LYS B C   1 
ATOM   3509 O O   . LYS B 1 206 ? 35.223 -17.825 36.979 1.00 68.01 ? 194 LYS B O   1 
ATOM   3510 C CB  . LYS B 1 206 ? 37.353 -16.075 37.697 1.00 65.74 ? 194 LYS B CB  1 
ATOM   3511 C CG  . LYS B 1 206 ? 38.001 -17.417 37.387 1.00 65.81 ? 194 LYS B CG  1 
ATOM   3512 C CD  . LYS B 1 206 ? 38.915 -17.300 36.179 1.00 65.43 ? 194 LYS B CD  1 
ATOM   3513 C CE  . LYS B 1 206 ? 38.118 -16.853 34.963 1.00 65.32 ? 194 LYS B CE  1 
ATOM   3514 N NZ  . LYS B 1 206 ? 38.977 -16.521 33.798 1.00 64.90 ? 194 LYS B NZ  1 
ATOM   3515 N N   . ASN B 1 207 ? 33.756 -16.290 37.721 1.00 69.68 ? 195 ASN B N   1 
ATOM   3516 C CA  . ASN B 1 207 ? 32.658 -16.887 36.980 1.00 71.19 ? 195 ASN B CA  1 
ATOM   3517 C C   . ASN B 1 207 ? 32.166 -16.165 35.738 1.00 72.13 ? 195 ASN B C   1 
ATOM   3518 O O   . ASN B 1 207 ? 31.268 -15.321 35.803 1.00 72.84 ? 195 ASN B O   1 
ATOM   3519 C CB  . ASN B 1 207 ? 31.484 -17.145 37.910 1.00 71.80 ? 195 ASN B CB  1 
ATOM   3520 C CG  . ASN B 1 207 ? 31.661 -18.412 38.707 1.00 72.65 ? 195 ASN B CG  1 
ATOM   3521 O OD1 . ASN B 1 207 ? 31.737 -19.506 38.140 1.00 72.76 ? 195 ASN B OD1 1 
ATOM   3522 N ND2 . ASN B 1 207 ? 31.742 -18.277 40.027 1.00 73.09 ? 195 ASN B ND2 1 
ATOM   3523 N N   . ASP B 1 208 ? 32.755 -16.551 34.605 1.00 72.76 ? 196 ASP B N   1 
ATOM   3524 C CA  . ASP B 1 208 ? 32.442 -16.024 33.269 1.00 72.75 ? 196 ASP B CA  1 
ATOM   3525 C C   . ASP B 1 208 ? 32.053 -14.555 33.243 1.00 72.36 ? 196 ASP B C   1 
ATOM   3526 O O   . ASP B 1 208 ? 30.962 -14.191 32.787 1.00 72.96 ? 196 ASP B O   1 
ATOM   3527 C CB  . ASP B 1 208 ? 31.328 -16.835 32.600 1.00 73.68 ? 196 ASP B CB  1 
ATOM   3528 C CG  . ASP B 1 208 ? 31.719 -18.287 32.366 1.00 75.11 ? 196 ASP B CG  1 
ATOM   3529 O OD1 . ASP B 1 208 ? 32.905 -18.544 32.006 1.00 75.47 ? 196 ASP B OD1 1 
ATOM   3530 O OD2 . ASP B 1 208 ? 30.834 -19.163 32.528 1.00 75.67 ? 196 ASP B OD2 1 
ATOM   3531 N N   . GLY B 1 209 ? 32.957 -13.704 33.712 1.00 71.49 ? 197 GLY B N   1 
ATOM   3532 C CA  . GLY B 1 209 ? 32.700 -12.272 33.728 1.00 69.81 ? 197 GLY B CA  1 
ATOM   3533 C C   . GLY B 1 209 ? 33.912 -11.615 34.342 1.00 68.51 ? 197 GLY B C   1 
ATOM   3534 O O   . GLY B 1 209 ? 34.606 -10.838 33.688 1.00 68.84 ? 197 GLY B O   1 
ATOM   3535 N N   . ASP B 1 210 ? 34.151 -11.946 35.610 1.00 66.61 ? 198 ASP B N   1 
ATOM   3536 C CA  . ASP B 1 210 ? 35.287 -11.454 36.395 1.00 64.01 ? 198 ASP B CA  1 
ATOM   3537 C C   . ASP B 1 210 ? 35.339 -12.311 37.648 1.00 61.93 ? 198 ASP B C   1 
ATOM   3538 O O   . ASP B 1 210 ? 34.937 -13.473 37.639 1.00 61.82 ? 198 ASP B O   1 
ATOM   3539 C CB  . ASP B 1 210 ? 35.106 -9.996  36.838 1.00 64.76 ? 198 ASP B CB  1 
ATOM   3540 C CG  . ASP B 1 210 ? 35.087 -9.022  35.680 1.00 65.68 ? 198 ASP B CG  1 
ATOM   3541 O OD1 . ASP B 1 210 ? 36.010 -9.089  34.833 1.00 65.96 ? 198 ASP B OD1 1 
ATOM   3542 O OD2 . ASP B 1 210 ? 34.153 -8.187  35.623 1.00 65.50 ? 198 ASP B OD2 1 
ATOM   3543 N N   . ARG B 1 211 ? 35.807 -11.720 38.737 1.00 59.13 ? 199 ARG B N   1 
ATOM   3544 C CA  . ARG B 1 211 ? 35.889 -12.432 40.001 1.00 56.37 ? 199 ARG B CA  1 
ATOM   3545 C C   . ARG B 1 211 ? 34.657 -12.082 40.830 1.00 53.52 ? 199 ARG B C   1 
ATOM   3546 O O   . ARG B 1 211 ? 34.126 -10.967 40.750 1.00 52.33 ? 199 ARG B O   1 
ATOM   3547 C CB  . ARG B 1 211 ? 37.157 -12.015 40.756 1.00 57.80 ? 199 ARG B CB  1 
ATOM   3548 C CG  . ARG B 1 211 ? 37.684 -13.033 41.759 1.00 59.03 ? 199 ARG B CG  1 
ATOM   3549 C CD  . ARG B 1 211 ? 39.110 -12.662 42.135 1.00 59.85 ? 199 ARG B CD  1 
ATOM   3550 N NE  . ARG B 1 211 ? 39.760 -13.632 43.012 1.00 61.11 ? 199 ARG B NE  1 
ATOM   3551 C CZ  . ARG B 1 211 ? 41.048 -13.568 43.337 1.00 61.83 ? 199 ARG B CZ  1 
ATOM   3552 N NH1 . ARG B 1 211 ? 41.791 -12.584 42.844 1.00 61.79 ? 199 ARG B NH1 1 
ATOM   3553 N NH2 . ARG B 1 211 ? 41.593 -14.465 44.155 1.00 62.02 ? 199 ARG B NH2 1 
ATOM   3554 N N   . ILE B 1 212 ? 34.181 -13.059 41.590 1.00 49.43 ? 200 ILE B N   1 
ATOM   3555 C CA  . ILE B 1 212 ? 33.046 -12.830 42.460 1.00 46.55 ? 200 ILE B CA  1 
ATOM   3556 C C   . ILE B 1 212 ? 33.352 -13.366 43.847 1.00 42.38 ? 200 ILE B C   1 
ATOM   3557 O O   . ILE B 1 212 ? 33.779 -14.507 44.026 1.00 42.23 ? 200 ILE B O   1 
ATOM   3558 C CB  . ILE B 1 212 ? 31.746 -13.439 41.901 1.00 47.29 ? 200 ILE B CB  1 
ATOM   3559 C CG1 . ILE B 1 212 ? 31.987 -14.872 41.437 1.00 47.94 ? 200 ILE B CG1 1 
ATOM   3560 C CG2 . ILE B 1 212 ? 31.222 -12.552 40.766 1.00 46.80 ? 200 ILE B CG2 1 
ATOM   3561 C CD1 . ILE B 1 212 ? 30.785 -15.490 40.754 1.00 49.38 ? 200 ILE B CD1 1 
ATOM   3562 N N   . PHE B 1 213 ? 33.166 -12.484 44.816 1.00 38.30 ? 201 PHE B N   1 
ATOM   3563 C CA  . PHE B 1 213 ? 33.400 -12.755 46.218 1.00 34.56 ? 201 PHE B CA  1 
ATOM   3564 C C   . PHE B 1 213 ? 32.151 -13.322 46.886 1.00 31.98 ? 201 PHE B C   1 
ATOM   3565 O O   . PHE B 1 213 ? 31.032 -12.903 46.592 1.00 29.82 ? 201 PHE B O   1 
ATOM   3566 C CB  . PHE B 1 213 ? 33.806 -11.454 46.908 1.00 35.10 ? 201 PHE B CB  1 
ATOM   3567 C CG  . PHE B 1 213 ? 35.010 -10.800 46.292 1.00 37.16 ? 201 PHE B CG  1 
ATOM   3568 C CD1 . PHE B 1 213 ? 34.976 -10.349 44.972 1.00 37.41 ? 201 PHE B CD1 1 
ATOM   3569 C CD2 . PHE B 1 213 ? 36.181 -10.645 47.022 1.00 37.31 ? 201 PHE B CD2 1 
ATOM   3570 C CE1 . PHE B 1 213 ? 36.089 -9.752  44.388 1.00 38.33 ? 201 PHE B CE1 1 
ATOM   3571 C CE2 . PHE B 1 213 ? 37.304 -10.048 46.453 1.00 38.29 ? 201 PHE B CE2 1 
ATOM   3572 C CZ  . PHE B 1 213 ? 37.259 -9.600  45.133 1.00 38.42 ? 201 PHE B CZ  1 
ATOM   3573 N N   . VAL B 1 214 ? 32.349 -14.288 47.777 1.00 29.56 ? 202 VAL B N   1 
ATOM   3574 C CA  . VAL B 1 214 ? 31.238 -14.892 48.513 1.00 25.96 ? 202 VAL B CA  1 
ATOM   3575 C C   . VAL B 1 214 ? 31.492 -14.554 49.977 1.00 24.13 ? 202 VAL B C   1 
ATOM   3576 O O   . VAL B 1 214 ? 32.513 -14.953 50.547 1.00 23.89 ? 202 VAL B O   1 
ATOM   3577 C CB  . VAL B 1 214 ? 31.218 -16.404 48.329 1.00 26.76 ? 202 VAL B CB  1 
ATOM   3578 C CG1 . VAL B 1 214 ? 29.965 -16.998 48.981 1.00 25.48 ? 202 VAL B CG1 1 
ATOM   3579 C CG2 . VAL B 1 214 ? 31.282 -16.738 46.847 1.00 29.41 ? 202 VAL B CG2 1 
ATOM   3580 N N   . VAL B 1 215 ? 30.588 -13.781 50.562 1.00 21.47 ? 203 VAL B N   1 
ATOM   3581 C CA  . VAL B 1 215 ? 30.684 -13.361 51.955 1.00 20.44 ? 203 VAL B CA  1 
ATOM   3582 C C   . VAL B 1 215 ? 29.572 -13.963 52.812 1.00 21.13 ? 203 VAL B C   1 
ATOM   3583 O O   . VAL B 1 215 ? 28.410 -14.027 52.395 1.00 20.47 ? 203 VAL B O   1 
ATOM   3584 C CB  . VAL B 1 215 ? 30.601 -11.808 52.082 1.00 20.32 ? 203 VAL B CB  1 
ATOM   3585 C CG1 . VAL B 1 215 ? 30.360 -11.398 53.547 1.00 20.71 ? 203 VAL B CG1 1 
ATOM   3586 C CG2 . VAL B 1 215 ? 31.916 -11.168 51.553 1.00 18.27 ? 203 VAL B CG2 1 
ATOM   3587 N N   . GLU B 1 216 ? 29.924 -14.424 54.006 1.00 18.88 ? 204 GLU B N   1 
ATOM   3588 C CA  . GLU B 1 216 ? 28.899 -14.937 54.904 1.00 18.88 ? 204 GLU B CA  1 
ATOM   3589 C C   . GLU B 1 216 ? 28.807 -13.950 56.050 1.00 18.75 ? 204 GLU B C   1 
ATOM   3590 O O   . GLU B 1 216 ? 29.829 -13.489 56.565 1.00 18.95 ? 204 GLU B O   1 
ATOM   3591 C CB  . GLU B 1 216 ? 29.268 -16.304 55.484 1.00 17.85 ? 204 GLU B CB  1 
ATOM   3592 C CG  . GLU B 1 216 ? 29.321 -17.438 54.509 1.00 19.59 ? 204 GLU B CG  1 
ATOM   3593 C CD  . GLU B 1 216 ? 29.619 -18.801 55.202 1.00 23.17 ? 204 GLU B CD  1 
ATOM   3594 O OE1 . GLU B 1 216 ? 30.024 -18.828 56.388 1.00 24.26 ? 204 GLU B OE1 1 
ATOM   3595 O OE2 . GLU B 1 216 ? 29.454 -19.836 54.546 1.00 23.71 ? 204 GLU B OE2 1 
ATOM   3596 N N   . VAL B 1 217 ? 27.593 -13.607 56.461 1.00 18.86 ? 205 VAL B N   1 
ATOM   3597 C CA  . VAL B 1 217 ? 27.460 -12.716 57.591 1.00 18.27 ? 205 VAL B CA  1 
ATOM   3598 C C   . VAL B 1 217 ? 27.058 -13.663 58.717 1.00 18.28 ? 205 VAL B C   1 
ATOM   3599 O O   . VAL B 1 217 ? 26.175 -14.507 58.533 1.00 18.30 ? 205 VAL B O   1 
ATOM   3600 C CB  . VAL B 1 217 ? 26.407 -11.604 57.329 1.00 19.16 ? 205 VAL B CB  1 
ATOM   3601 C CG1 . VAL B 1 217 ? 25.019 -12.207 57.117 1.00 20.57 ? 205 VAL B CG1 1 
ATOM   3602 C CG2 . VAL B 1 217 ? 26.410 -10.605 58.487 1.00 20.53 ? 205 VAL B CG2 1 
ATOM   3603 N N   . ARG B 1 218 ? 27.730 -13.550 59.860 1.00 16.87 ? 206 ARG B N   1 
ATOM   3604 C CA  . ARG B 1 218 ? 27.471 -14.442 60.999 1.00 18.74 ? 206 ARG B CA  1 
ATOM   3605 C C   . ARG B 1 218 ? 27.266 -13.692 62.302 1.00 18.02 ? 206 ARG B C   1 
ATOM   3606 O O   . ARG B 1 218 ? 27.683 -12.546 62.453 1.00 18.72 ? 206 ARG B O   1 
ATOM   3607 C CB  . ARG B 1 218 ? 28.662 -15.400 61.222 1.00 19.23 ? 206 ARG B CB  1 
ATOM   3608 C CG  . ARG B 1 218 ? 29.177 -16.111 59.976 1.00 20.19 ? 206 ARG B CG  1 
ATOM   3609 C CD  . ARG B 1 218 ? 30.499 -16.879 60.239 1.00 19.97 ? 206 ARG B CD  1 
ATOM   3610 N NE  . ARG B 1 218 ? 30.870 -17.696 59.081 1.00 23.51 ? 206 ARG B NE  1 
ATOM   3611 C CZ  . ARG B 1 218 ? 32.092 -18.169 58.841 1.00 26.68 ? 206 ARG B CZ  1 
ATOM   3612 N NH1 . ARG B 1 218 ? 33.084 -17.911 59.680 1.00 27.18 ? 206 ARG B NH1 1 
ATOM   3613 N NH2 . ARG B 1 218 ? 32.323 -18.900 57.752 1.00 27.83 ? 206 ARG B NH2 1 
ATOM   3614 N N   . VAL B 1 219 ? 26.601 -14.354 63.231 1.00 17.26 ? 207 VAL B N   1 
ATOM   3615 C CA  . VAL B 1 219 ? 26.403 -13.814 64.572 1.00 19.04 ? 207 VAL B CA  1 
ATOM   3616 C C   . VAL B 1 219 ? 26.882 -14.969 65.470 1.00 19.16 ? 207 VAL B C   1 
ATOM   3617 O O   . VAL B 1 219 ? 26.452 -16.132 65.286 1.00 17.87 ? 207 VAL B O   1 
ATOM   3618 C CB  . VAL B 1 219 ? 24.937 -13.505 64.902 1.00 19.54 ? 207 VAL B CB  1 
ATOM   3619 C CG1 . VAL B 1 219 ? 24.855 -12.919 66.322 1.00 21.63 ? 207 VAL B CG1 1 
ATOM   3620 C CG2 . VAL B 1 219 ? 24.395 -12.473 63.909 1.00 23.39 ? 207 VAL B CG2 1 
ATOM   3621 N N   . ASN B 1 220 ? 27.776 -14.657 66.409 1.00 18.61 ? 208 ASN B N   1 
ATOM   3622 C CA  . ASN B 1 220 ? 28.333 -15.683 67.305 1.00 19.57 ? 208 ASN B CA  1 
ATOM   3623 C C   . ASN B 1 220 ? 28.862 -16.890 66.523 1.00 20.88 ? 208 ASN B C   1 
ATOM   3624 O O   . ASN B 1 220 ? 28.742 -18.033 66.989 1.00 21.65 ? 208 ASN B O   1 
ATOM   3625 C CB  . ASN B 1 220 ? 27.273 -16.207 68.288 1.00 17.88 ? 208 ASN B CB  1 
ATOM   3626 C CG  . ASN B 1 220 ? 26.893 -15.196 69.336 1.00 18.76 ? 208 ASN B CG  1 
ATOM   3627 O OD1 . ASN B 1 220 ? 27.757 -14.539 69.926 1.00 18.24 ? 208 ASN B OD1 1 
ATOM   3628 N ND2 . ASN B 1 220 ? 25.583 -15.080 69.600 1.00 16.07 ? 208 ASN B ND2 1 
ATOM   3629 N N   . GLY B 1 221 ? 29.467 -16.655 65.360 1.00 20.27 ? 209 GLY B N   1 
ATOM   3630 C CA  . GLY B 1 221 ? 29.990 -17.760 64.592 1.00 19.89 ? 209 GLY B CA  1 
ATOM   3631 C C   . GLY B 1 221 ? 28.987 -18.539 63.756 1.00 20.07 ? 209 GLY B C   1 
ATOM   3632 O O   . GLY B 1 221 ? 29.379 -19.437 63.016 1.00 21.66 ? 209 GLY B O   1 
ATOM   3633 N N   . LYS B 1 222 ? 27.704 -18.217 63.860 1.00 19.60 ? 210 LYS B N   1 
ATOM   3634 C CA  . LYS B 1 222 ? 26.673 -18.912 63.084 1.00 22.33 ? 210 LYS B CA  1 
ATOM   3635 C C   . LYS B 1 222 ? 26.355 -18.081 61.841 1.00 21.38 ? 210 LYS B C   1 
ATOM   3636 O O   . LYS B 1 222 ? 26.122 -16.893 61.954 1.00 20.51 ? 210 LYS B O   1 
ATOM   3637 C CB  . LYS B 1 222 ? 25.384 -19.049 63.909 1.00 24.76 ? 210 LYS B CB  1 
ATOM   3638 C CG  . LYS B 1 222 ? 25.556 -19.655 65.308 1.00 30.47 ? 210 LYS B CG  1 
ATOM   3639 C CD  . LYS B 1 222 ? 25.727 -21.175 65.278 1.00 32.75 ? 210 LYS B CD  1 
ATOM   3640 C CE  . LYS B 1 222 ? 25.899 -21.766 66.698 1.00 35.20 ? 210 LYS B CE  1 
ATOM   3641 N NZ  . LYS B 1 222 ? 26.073 -23.251 66.684 1.00 31.24 ? 210 LYS B NZ  1 
ATOM   3642 N N   . THR B 1 223 ? 26.333 -18.711 60.674 1.00 21.17 ? 211 THR B N   1 
ATOM   3643 C CA  . THR B 1 223 ? 26.034 -18.019 59.429 1.00 21.56 ? 211 THR B CA  1 
ATOM   3644 C C   . THR B 1 223 ? 24.549 -17.680 59.332 1.00 20.63 ? 211 THR B C   1 
ATOM   3645 O O   . THR B 1 223 ? 23.694 -18.548 59.493 1.00 18.17 ? 211 THR B O   1 
ATOM   3646 C CB  . THR B 1 223 ? 26.450 -18.888 58.204 1.00 22.59 ? 211 THR B CB  1 
ATOM   3647 O OG1 . THR B 1 223 ? 27.872 -19.050 58.213 1.00 22.10 ? 211 THR B OG1 1 
ATOM   3648 C CG2 . THR B 1 223 ? 26.032 -18.227 56.884 1.00 20.44 ? 211 THR B CG2 1 
ATOM   3649 N N   . ILE B 1 224 ? 24.259 -16.409 59.095 1.00 19.41 ? 212 ILE B N   1 
ATOM   3650 C CA  . ILE B 1 224 ? 22.885 -15.928 58.945 1.00 21.12 ? 212 ILE B CA  1 
ATOM   3651 C C   . ILE B 1 224 ? 22.502 -15.917 57.467 1.00 20.85 ? 212 ILE B C   1 
ATOM   3652 O O   . ILE B 1 224 ? 21.365 -16.251 57.110 1.00 21.56 ? 212 ILE B O   1 
ATOM   3653 C CB  . ILE B 1 224 ? 22.731 -14.483 59.463 1.00 24.21 ? 212 ILE B CB  1 
ATOM   3654 C CG1 . ILE B 1 224 ? 22.886 -14.451 60.972 1.00 25.37 ? 212 ILE B CG1 1 
ATOM   3655 C CG2 . ILE B 1 224 ? 21.349 -13.935 59.117 1.00 28.35 ? 212 ILE B CG2 1 
ATOM   3656 C CD1 . ILE B 1 224 ? 22.621 -13.079 61.522 1.00 27.69 ? 212 ILE B CD1 1 
ATOM   3657 N N   . ALA B 1 225 ? 23.438 -15.507 56.611 1.00 17.89 ? 213 ALA B N   1 
ATOM   3658 C CA  . ALA B 1 225 ? 23.177 -15.472 55.178 1.00 16.89 ? 213 ALA B CA  1 
ATOM   3659 C C   . ALA B 1 225 ? 24.495 -15.367 54.451 1.00 16.95 ? 213 ALA B C   1 
ATOM   3660 O O   . ALA B 1 225 ? 25.544 -15.054 55.042 1.00 17.23 ? 213 ALA B O   1 
ATOM   3661 C CB  . ALA B 1 225 ? 22.249 -14.276 54.802 1.00 14.08 ? 213 ALA B CB  1 
ATOM   3662 N N   . THR B 1 226 ? 24.432 -15.657 53.166 1.00 17.17 ? 214 THR B N   1 
ATOM   3663 C CA  . THR B 1 226 ? 25.584 -15.616 52.302 1.00 19.41 ? 214 THR B CA  1 
ATOM   3664 C C   . THR B 1 226 ? 25.263 -14.598 51.206 1.00 20.93 ? 214 THR B C   1 
ATOM   3665 O O   . THR B 1 226 ? 24.112 -14.510 50.763 1.00 21.60 ? 214 THR B O   1 
ATOM   3666 C CB  . THR B 1 226 ? 25.797 -16.976 51.671 1.00 18.83 ? 214 THR B CB  1 
ATOM   3667 O OG1 . THR B 1 226 ? 25.936 -17.957 52.709 1.00 18.64 ? 214 THR B OG1 1 
ATOM   3668 C CG2 . THR B 1 226 ? 27.020 -16.964 50.809 1.00 20.30 ? 214 THR B CG2 1 
ATOM   3669 N N   . GLY B 1 227 ? 26.263 -13.825 50.795 1.00 21.80 ? 215 GLY B N   1 
ATOM   3670 C CA  . GLY B 1 227 ? 26.055 -12.846 49.743 1.00 22.89 ? 215 GLY B CA  1 
ATOM   3671 C C   . GLY B 1 227 ? 27.184 -12.893 48.727 1.00 25.35 ? 215 GLY B C   1 
ATOM   3672 O O   . GLY B 1 227 ? 28.340 -13.203 49.070 1.00 23.65 ? 215 GLY B O   1 
ATOM   3673 N N   . LYS B 1 228 ? 26.853 -12.582 47.474 1.00 26.63 ? 216 LYS B N   1 
ATOM   3674 C CA  . LYS B 1 228 ? 27.820 -12.577 46.383 1.00 27.73 ? 216 LYS B CA  1 
ATOM   3675 C C   . LYS B 1 228 ? 27.893 -11.218 45.694 1.00 28.99 ? 216 LYS B C   1 
ATOM   3676 O O   . LYS B 1 228 ? 26.899 -10.496 45.602 1.00 27.39 ? 216 LYS B O   1 
ATOM   3677 C CB  . LYS B 1 228 ? 27.477 -13.682 45.373 1.00 29.28 ? 216 LYS B CB  1 
ATOM   3678 C CG  . LYS B 1 228 ? 27.631 -15.092 45.996 1.00 31.54 ? 216 LYS B CG  1 
ATOM   3679 C CD  . LYS B 1 228 ? 27.076 -16.240 45.132 1.00 33.64 ? 216 LYS B CD  1 
ATOM   3680 C CE  . LYS B 1 228 ? 27.192 -17.581 45.890 1.00 35.77 ? 216 LYS B CE  1 
ATOM   3681 N NZ  . LYS B 1 228 ? 26.711 -18.787 45.129 1.00 36.66 ? 216 LYS B NZ  1 
ATOM   3682 N N   . GLY B 1 229 ? 29.086 -10.867 45.221 1.00 29.32 ? 217 GLY B N   1 
ATOM   3683 C CA  . GLY B 1 229 ? 29.270 -9.587  44.570 1.00 29.55 ? 217 GLY B CA  1 
ATOM   3684 C C   . GLY B 1 229 ? 30.545 -9.534  43.740 1.00 31.44 ? 217 GLY B C   1 
ATOM   3685 O O   . GLY B 1 229 ? 31.406 -10.426 43.807 1.00 30.93 ? 217 GLY B O   1 
ATOM   3686 N N   . ARG B 1 230 ? 30.671 -8.470  42.958 1.00 31.42 ? 218 ARG B N   1 
ATOM   3687 C CA  . ARG B 1 230 ? 31.830 -8.293  42.113 1.00 32.92 ? 218 ARG B CA  1 
ATOM   3688 C C   . ARG B 1 230 ? 33.020 -7.784  42.901 1.00 33.20 ? 218 ARG B C   1 
ATOM   3689 O O   . ARG B 1 230 ? 34.135 -7.773  42.399 1.00 33.93 ? 218 ARG B O   1 
ATOM   3690 C CB  . ARG B 1 230 ? 31.479 -7.369  40.958 1.00 31.70 ? 218 ARG B CB  1 
ATOM   3691 C CG  . ARG B 1 230 ? 30.383 -7.984  40.098 1.00 33.68 ? 218 ARG B CG  1 
ATOM   3692 C CD  . ARG B 1 230 ? 29.702 -6.933  39.260 1.00 31.93 ? 218 ARG B CD  1 
ATOM   3693 N NE  . ARG B 1 230 ? 29.071 -5.930  40.111 1.00 32.63 ? 218 ARG B NE  1 
ATOM   3694 C CZ  . ARG B 1 230 ? 28.504 -4.822  39.637 1.00 33.29 ? 218 ARG B CZ  1 
ATOM   3695 N NH1 . ARG B 1 230 ? 28.503 -4.595  38.321 1.00 30.32 ? 218 ARG B NH1 1 
ATOM   3696 N NH2 . ARG B 1 230 ? 27.943 -3.953  40.466 1.00 29.94 ? 218 ARG B NH2 1 
ATOM   3697 N N   . THR B 1 231 ? 32.772 -7.359  44.136 1.00 33.47 ? 219 THR B N   1 
ATOM   3698 C CA  . THR B 1 231 ? 33.838 -6.918  45.031 1.00 34.25 ? 219 THR B CA  1 
ATOM   3699 C C   . THR B 1 231 ? 33.467 -7.425  46.431 1.00 34.82 ? 219 THR B C   1 
ATOM   3700 O O   . THR B 1 231 ? 32.324 -7.850  46.665 1.00 33.96 ? 219 THR B O   1 
ATOM   3701 C CB  . THR B 1 231 ? 33.955 -5.408  45.117 1.00 34.81 ? 219 THR B CB  1 
ATOM   3702 O OG1 . THR B 1 231 ? 32.864 -4.905  45.895 1.00 35.20 ? 219 THR B OG1 1 
ATOM   3703 C CG2 . THR B 1 231 ? 33.978 -4.778  43.702 1.00 35.28 ? 219 THR B CG2 1 
ATOM   3704 N N   . LYS B 1 232 ? 34.417 -7.381  47.358 1.00 34.20 ? 220 LYS B N   1 
ATOM   3705 C CA  . LYS B 1 232 ? 34.140 -7.853  48.704 1.00 33.67 ? 220 LYS B CA  1 
ATOM   3706 C C   . LYS B 1 232 ? 33.062 -7.017  49.366 1.00 31.67 ? 220 LYS B C   1 
ATOM   3707 O O   . LYS B 1 232 ? 32.132 -7.559  49.954 1.00 28.67 ? 220 LYS B O   1 
ATOM   3708 C CB  . LYS B 1 232 ? 35.398 -7.841  49.583 1.00 36.09 ? 220 LYS B CB  1 
ATOM   3709 C CG  . LYS B 1 232 ? 35.055 -8.163  51.034 1.00 38.70 ? 220 LYS B CG  1 
ATOM   3710 C CD  . LYS B 1 232 ? 36.206 -7.892  51.983 1.00 43.29 ? 220 LYS B CD  1 
ATOM   3711 C CE  . LYS B 1 232 ? 37.353 -8.822  51.680 1.00 45.20 ? 220 LYS B CE  1 
ATOM   3712 N NZ  . LYS B 1 232 ? 36.840 -10.216 51.620 1.00 47.48 ? 220 LYS B NZ  1 
ATOM   3713 N N   . LYS B 1 233 ? 33.195 -5.700  49.285 1.00 30.82 ? 221 LYS B N   1 
ATOM   3714 C CA  . LYS B 1 233 ? 32.202 -4.812  49.876 1.00 31.74 ? 221 LYS B CA  1 
ATOM   3715 C C   . LYS B 1 233 ? 30.801 -5.064  49.313 1.00 30.68 ? 221 LYS B C   1 
ATOM   3716 O O   . LYS B 1 233 ? 29.805 -4.967  50.028 1.00 30.09 ? 221 LYS B O   1 
ATOM   3717 C CB  . LYS B 1 233 ? 32.577 -3.341  49.636 1.00 34.41 ? 221 LYS B CB  1 
ATOM   3718 C CG  . LYS B 1 233 ? 33.645 -2.793  50.599 1.00 38.85 ? 221 LYS B CG  1 
ATOM   3719 C CD  . LYS B 1 233 ? 34.143 -1.380  50.213 1.00 39.47 ? 221 LYS B CD  1 
ATOM   3720 C CE  . LYS B 1 233 ? 33.032 -0.312  50.273 1.00 41.67 ? 221 LYS B CE  1 
ATOM   3721 N NZ  . LYS B 1 233 ? 32.021 -0.427  49.161 1.00 42.05 ? 221 LYS B NZ  1 
ATOM   3722 N N   . GLU B 1 234 ? 30.730 -5.365  48.020 1.00 28.65 ? 222 GLU B N   1 
ATOM   3723 C CA  . GLU B 1 234 ? 29.442 -5.609  47.394 1.00 26.47 ? 222 GLU B CA  1 
ATOM   3724 C C   . GLU B 1 234 ? 28.829 -6.882  47.975 1.00 24.02 ? 222 GLU B C   1 
ATOM   3725 O O   . GLU B 1 234 ? 27.659 -6.898  48.327 1.00 24.05 ? 222 GLU B O   1 
ATOM   3726 C CB  . GLU B 1 234 ? 29.600 -5.732  45.878 1.00 26.13 ? 222 GLU B CB  1 
ATOM   3727 C CG  . GLU B 1 234 ? 28.296 -5.566  45.141 1.00 28.21 ? 222 GLU B CG  1 
ATOM   3728 C CD  . GLU B 1 234 ? 28.507 -5.502  43.656 1.00 30.19 ? 222 GLU B CD  1 
ATOM   3729 O OE1 . GLU B 1 234 ? 28.629 -6.580  43.026 1.00 30.66 ? 222 GLU B OE1 1 
ATOM   3730 O OE2 . GLU B 1 234 ? 28.579 -4.368  43.130 1.00 32.95 ? 222 GLU B OE2 1 
ATOM   3731 N N   . ALA B 1 235 ? 29.616 -7.945  48.068 1.00 22.42 ? 223 ALA B N   1 
ATOM   3732 C CA  . ALA B 1 235 ? 29.126 -9.190  48.652 1.00 22.57 ? 223 ALA B CA  1 
ATOM   3733 C C   . ALA B 1 235 ? 28.646 -8.925  50.097 1.00 21.90 ? 223 ALA B C   1 
ATOM   3734 O O   . ALA B 1 235 ? 27.603 -9.381  50.508 1.00 20.85 ? 223 ALA B O   1 
ATOM   3735 C CB  . ALA B 1 235 ? 30.245 -10.232 48.633 1.00 22.90 ? 223 ALA B CB  1 
ATOM   3736 N N   . GLU B 1 236 ? 29.407 -8.157  50.869 1.00 24.43 ? 224 GLU B N   1 
ATOM   3737 C CA  . GLU B 1 236 ? 29.003 -7.863  52.239 1.00 25.14 ? 224 GLU B CA  1 
ATOM   3738 C C   . GLU B 1 236 ? 27.649 -7.148  52.290 1.00 26.38 ? 224 GLU B C   1 
ATOM   3739 O O   . GLU B 1 236 ? 26.801 -7.451  53.141 1.00 23.60 ? 224 GLU B O   1 
ATOM   3740 C CB  . GLU B 1 236 ? 30.080 -7.022  52.942 1.00 27.77 ? 224 GLU B CB  1 
ATOM   3741 C CG  . GLU B 1 236 ? 31.383 -7.794  53.206 1.00 29.98 ? 224 GLU B CG  1 
ATOM   3742 C CD  . GLU B 1 236 ? 32.511 -6.894  53.719 1.00 35.05 ? 224 GLU B CD  1 
ATOM   3743 O OE1 . GLU B 1 236 ? 32.279 -5.664  53.856 1.00 33.67 ? 224 GLU B OE1 1 
ATOM   3744 O OE2 . GLU B 1 236 ? 33.622 -7.422  53.983 1.00 33.89 ? 224 GLU B OE2 1 
ATOM   3745 N N   . LYS B 1 237 ? 27.428 -6.206  51.374 1.00 25.98 ? 225 LYS B N   1 
ATOM   3746 C CA  . LYS B 1 237 ? 26.154 -5.497  51.364 1.00 25.97 ? 225 LYS B CA  1 
ATOM   3747 C C   . LYS B 1 237 ? 25.047 -6.471  51.033 1.00 22.54 ? 225 LYS B C   1 
ATOM   3748 O O   . LYS B 1 237 ? 23.953 -6.403  51.604 1.00 21.37 ? 225 LYS B O   1 
ATOM   3749 C CB  . LYS B 1 237 ? 26.123 -4.375  50.312 1.00 27.52 ? 225 LYS B CB  1 
ATOM   3750 C CG  . LYS B 1 237 ? 27.065 -3.226  50.546 1.00 31.03 ? 225 LYS B CG  1 
ATOM   3751 C CD  . LYS B 1 237 ? 26.796 -2.139  49.518 1.00 34.53 ? 225 LYS B CD  1 
ATOM   3752 C CE  . LYS B 1 237 ? 27.845 -1.048  49.567 1.00 36.99 ? 225 LYS B CE  1 
ATOM   3753 N NZ  . LYS B 1 237 ? 27.579 -0.056  48.470 1.00 40.29 ? 225 LYS B NZ  1 
ATOM   3754 N N   . GLU B 1 238 ? 25.325 -7.359  50.086 1.00 22.81 ? 226 GLU B N   1 
ATOM   3755 C CA  . GLU B 1 238 ? 24.338 -8.352  49.651 1.00 23.24 ? 226 GLU B CA  1 
ATOM   3756 C C   . GLU B 1 238 ? 24.003 -9.294  50.801 1.00 21.52 ? 226 GLU B C   1 
ATOM   3757 O O   . GLU B 1 238 ? 22.850 -9.602  51.049 1.00 20.97 ? 226 GLU B O   1 
ATOM   3758 C CB  . GLU B 1 238 ? 24.891 -9.154  48.476 1.00 26.25 ? 226 GLU B CB  1 
ATOM   3759 C CG  . GLU B 1 238 ? 24.410 -8.691  47.129 1.00 29.88 ? 226 GLU B CG  1 
ATOM   3760 C CD  . GLU B 1 238 ? 22.898 -8.847  46.989 1.00 31.02 ? 226 GLU B CD  1 
ATOM   3761 O OE1 . GLU B 1 238 ? 22.153 -7.893  47.334 1.00 31.40 ? 226 GLU B OE1 1 
ATOM   3762 O OE2 . GLU B 1 238 ? 22.460 -9.937  46.558 1.00 31.13 ? 226 GLU B OE2 1 
ATOM   3763 N N   . ALA B 1 239 ? 25.036 -9.775  51.490 1.00 21.11 ? 227 ALA B N   1 
ATOM   3764 C CA  . ALA B 1 239 ? 24.825 -10.659 52.630 1.00 19.32 ? 227 ALA B CA  1 
ATOM   3765 C C   . ALA B 1 239 ? 23.978 -9.969  53.705 1.00 18.12 ? 227 ALA B C   1 
ATOM   3766 O O   . ALA B 1 239 ? 23.085 -10.575 54.303 1.00 16.04 ? 227 ALA B O   1 
ATOM   3767 C CB  . ALA B 1 239 ? 26.171 -11.077 53.217 1.00 20.84 ? 227 ALA B CB  1 
ATOM   3768 N N   . ALA B 1 240 ? 24.237 -8.682  53.931 1.00 18.01 ? 228 ALA B N   1 
ATOM   3769 C CA  . ALA B 1 240 ? 23.492 -7.944  54.943 1.00 17.34 ? 228 ALA B CA  1 
ATOM   3770 C C   . ALA B 1 240 ? 22.032 -7.770  54.503 1.00 17.28 ? 228 ALA B C   1 
ATOM   3771 O O   . ALA B 1 240 ? 21.096 -7.895  55.302 1.00 16.18 ? 228 ALA B O   1 
ATOM   3772 C CB  . ALA B 1 240 ? 24.150 -6.573  55.189 1.00 20.92 ? 228 ALA B CB  1 
ATOM   3773 N N   . ARG B 1 241 ? 21.834 -7.481  53.225 1.00 19.04 ? 229 ARG B N   1 
ATOM   3774 C CA  . ARG B 1 241 ? 20.458 -7.301  52.704 1.00 18.60 ? 229 ARG B CA  1 
ATOM   3775 C C   . ARG B 1 241 ? 19.651 -8.579  52.940 1.00 18.22 ? 229 ARG B C   1 
ATOM   3776 O O   . ARG B 1 241 ? 18.524 -8.545  53.452 1.00 17.99 ? 229 ARG B O   1 
ATOM   3777 C CB  . ARG B 1 241 ? 20.476 -7.015  51.200 1.00 18.87 ? 229 ARG B CB  1 
ATOM   3778 C CG  . ARG B 1 241 ? 19.071 -6.931  50.533 1.00 21.78 ? 229 ARG B CG  1 
ATOM   3779 C CD  . ARG B 1 241 ? 19.234 -6.728  49.052 1.00 24.33 ? 229 ARG B CD  1 
ATOM   3780 N NE  . ARG B 1 241 ? 19.712 -7.926  48.339 1.00 25.69 ? 229 ARG B NE  1 
ATOM   3781 C CZ  . ARG B 1 241 ? 18.953 -8.975  48.023 1.00 25.83 ? 229 ARG B CZ  1 
ATOM   3782 N NH1 . ARG B 1 241 ? 17.671 -9.001  48.358 1.00 25.97 ? 229 ARG B NH1 1 
ATOM   3783 N NH2 . ARG B 1 241 ? 19.469 -9.986  47.332 1.00 26.03 ? 229 ARG B NH2 1 
ATOM   3784 N N   . ILE B 1 242 ? 20.251 -9.703  52.558 1.00 18.86 ? 230 ILE B N   1 
ATOM   3785 C CA  . ILE B 1 242 ? 19.613 -11.014 52.675 1.00 18.58 ? 230 ILE B CA  1 
ATOM   3786 C C   . ILE B 1 242 ? 19.313 -11.353 54.138 1.00 18.52 ? 230 ILE B C   1 
ATOM   3787 O O   . ILE B 1 242 ? 18.179 -11.732 54.482 1.00 16.81 ? 230 ILE B O   1 
ATOM   3788 C CB  . ILE B 1 242 ? 20.497 -12.093 51.961 1.00 20.24 ? 230 ILE B CB  1 
ATOM   3789 C CG1 . ILE B 1 242 ? 20.526 -11.782 50.451 1.00 21.79 ? 230 ILE B CG1 1 
ATOM   3790 C CG2 . ILE B 1 242 ? 19.938 -13.502 52.191 1.00 19.55 ? 230 ILE B CG2 1 
ATOM   3791 C CD1 . ILE B 1 242 ? 21.516 -12.587 49.621 1.00 20.50 ? 230 ILE B CD1 1 
ATOM   3792 N N   . ALA B 1 243 ? 20.306 -11.172 55.000 1.00 17.85 ? 231 ALA B N   1 
ATOM   3793 C CA  . ALA B 1 243 ? 20.148 -11.436 56.426 1.00 17.67 ? 231 ALA B CA  1 
ATOM   3794 C C   . ALA B 1 243 ? 19.044 -10.583 57.023 1.00 20.12 ? 231 ALA B C   1 
ATOM   3795 O O   . ALA B 1 243 ? 18.217 -11.070 57.785 1.00 18.55 ? 231 ALA B O   1 
ATOM   3796 C CB  . ALA B 1 243 ? 21.437 -11.161 57.149 1.00 15.18 ? 231 ALA B CB  1 
ATOM   3797 N N   . TYR B 1 244 ? 19.043 -9.294  56.689 1.00 22.24 ? 232 TYR B N   1 
ATOM   3798 C CA  . TYR B 1 244 ? 18.024 -8.392  57.205 1.00 24.21 ? 232 TYR B CA  1 
ATOM   3799 C C   . TYR B 1 244 ? 16.611 -8.831  56.793 1.00 24.89 ? 232 TYR B C   1 
ATOM   3800 O O   . TYR B 1 244 ? 15.728 -8.939  57.626 1.00 25.01 ? 232 TYR B O   1 
ATOM   3801 C CB  . TYR B 1 244 ? 18.294 -6.956  56.716 1.00 25.91 ? 232 TYR B CB  1 
ATOM   3802 C CG  . TYR B 1 244 ? 17.456 -5.940  57.438 1.00 30.04 ? 232 TYR B CG  1 
ATOM   3803 C CD1 . TYR B 1 244 ? 16.175 -5.639  56.999 1.00 31.41 ? 232 TYR B CD1 1 
ATOM   3804 C CD2 . TYR B 1 244 ? 17.920 -5.321  58.608 1.00 32.24 ? 232 TYR B CD2 1 
ATOM   3805 C CE1 . TYR B 1 244 ? 15.373 -4.762  57.686 1.00 35.53 ? 232 TYR B CE1 1 
ATOM   3806 C CE2 . TYR B 1 244 ? 17.111 -4.433  59.318 1.00 34.43 ? 232 TYR B CE2 1 
ATOM   3807 C CZ  . TYR B 1 244 ? 15.842 -4.166  58.843 1.00 34.82 ? 232 TYR B CZ  1 
ATOM   3808 O OH  . TYR B 1 244 ? 15.016 -3.318  59.512 1.00 39.94 ? 232 TYR B OH  1 
ATOM   3809 N N   . GLU B 1 245 ? 16.400 -9.107  55.512 1.00 26.01 ? 233 GLU B N   1 
ATOM   3810 C CA  . GLU B 1 245 ? 15.074 -9.517  55.052 1.00 28.56 ? 233 GLU B CA  1 
ATOM   3811 C C   . GLU B 1 245 ? 14.658 -10.805 55.744 1.00 29.82 ? 233 GLU B C   1 
ATOM   3812 O O   . GLU B 1 245 ? 13.477 -10.998 56.092 1.00 27.98 ? 233 GLU B O   1 
ATOM   3813 C CB  . GLU B 1 245 ? 15.075 -9.761  53.547 1.00 30.63 ? 233 GLU B CB  1 
ATOM   3814 C CG  . GLU B 1 245 ? 15.437 -8.555  52.707 1.00 37.50 ? 233 GLU B CG  1 
ATOM   3815 C CD  . GLU B 1 245 ? 15.287 -8.844  51.226 1.00 40.27 ? 233 GLU B CD  1 
ATOM   3816 O OE1 . GLU B 1 245 ? 14.765 -9.941  50.902 1.00 43.13 ? 233 GLU B OE1 1 
ATOM   3817 O OE2 . GLU B 1 245 ? 15.681 -7.985  50.392 1.00 42.88 ? 233 GLU B OE2 1 
ATOM   3818 N N   . LYS B 1 246 ? 15.633 -11.701 55.894 1.00 29.59 ? 234 LYS B N   1 
ATOM   3819 C CA  . LYS B 1 246 ? 15.408 -12.969 56.552 1.00 30.98 ? 234 LYS B CA  1 
ATOM   3820 C C   . LYS B 1 246 ? 14.948 -12.699 57.981 1.00 32.36 ? 234 LYS B C   1 
ATOM   3821 O O   . LYS B 1 246 ? 13.892 -13.178 58.391 1.00 32.32 ? 234 LYS B O   1 
ATOM   3822 C CB  . LYS B 1 246 ? 16.706 -13.796 56.542 1.00 30.13 ? 234 LYS B CB  1 
ATOM   3823 C CG  . LYS B 1 246 ? 16.657 -15.087 57.374 1.00 31.51 ? 234 LYS B CG  1 
ATOM   3824 C CD  . LYS B 1 246 ? 17.893 -15.971 57.108 1.00 30.76 ? 234 LYS B CD  1 
ATOM   3825 C CE  . LYS B 1 246 ? 18.023 -17.056 58.152 1.00 31.24 ? 234 LYS B CE  1 
ATOM   3826 N NZ  . LYS B 1 246 ? 19.256 -17.871 57.960 1.00 30.00 ? 234 LYS B NZ  1 
ATOM   3827 N N   . LEU B 1 247 ? 15.728 -11.919 58.728 1.00 35.14 ? 235 LEU B N   1 
ATOM   3828 C CA  . LEU B 1 247 ? 15.401 -11.595 60.115 1.00 39.59 ? 235 LEU B CA  1 
ATOM   3829 C C   . LEU B 1 247 ? 14.158 -10.718 60.288 1.00 43.64 ? 235 LEU B C   1 
ATOM   3830 O O   . LEU B 1 247 ? 14.181 -9.725  61.001 1.00 45.49 ? 235 LEU B O   1 
ATOM   3831 C CB  . LEU B 1 247 ? 16.591 -10.925 60.811 1.00 39.50 ? 235 LEU B CB  1 
ATOM   3832 C CG  . LEU B 1 247 ? 17.905 -11.716 60.898 1.00 40.66 ? 235 LEU B CG  1 
ATOM   3833 C CD1 . LEU B 1 247 ? 18.869 -10.948 61.804 1.00 40.28 ? 235 LEU B CD1 1 
ATOM   3834 C CD2 . LEU B 1 247 ? 17.669 -13.141 61.432 1.00 41.61 ? 235 LEU B CD2 1 
ATOM   3835 N N   . LEU B 1 248 ? 13.080 -11.097 59.619 1.00 47.45 ? 236 LEU B N   1 
ATOM   3836 C CA  . LEU B 1 248 ? 11.790 -10.412 59.684 1.00 50.50 ? 236 LEU B CA  1 
ATOM   3837 C C   . LEU B 1 248 ? 10.905 -11.609 59.419 1.00 52.64 ? 236 LEU B C   1 
ATOM   3838 O O   . LEU B 1 248 ? 9.966  -11.562 58.634 1.00 53.18 ? 236 LEU B O   1 
ATOM   3839 C CB  . LEU B 1 248 ? 11.661 -9.368  58.568 1.00 51.06 ? 236 LEU B CB  1 
ATOM   3840 C CG  . LEU B 1 248 ? 12.622 -8.181  58.677 1.00 50.34 ? 236 LEU B CG  1 
ATOM   3841 C CD1 . LEU B 1 248 ? 12.382 -7.189  57.553 1.00 51.33 ? 236 LEU B CD1 1 
ATOM   3842 C CD2 . LEU B 1 248 ? 12.419 -7.506  60.007 1.00 51.13 ? 236 LEU B CD2 1 
ATOM   3843 N N   . LYS B 1 249 ? 11.288 -12.697 60.089 1.00 54.91 ? 237 LYS B N   1 
ATOM   3844 C CA  . LYS B 1 249 ? 10.666 -14.015 60.030 1.00 57.01 ? 237 LYS B CA  1 
ATOM   3845 C C   . LYS B 1 249 ? 9.385  -14.112 60.852 1.00 58.83 ? 237 LYS B C   1 
ATOM   3846 O O   . LYS B 1 249 ? 9.390  -14.827 61.894 1.00 59.67 ? 237 LYS B O   1 
ATOM   3847 C CB  . LYS B 1 249 ? 11.683 -15.043 60.531 1.00 57.30 ? 237 LYS B CB  1 
ATOM   3848 C CG  . LYS B 1 249 ? 12.335 -14.636 61.856 1.00 57.19 ? 237 LYS B CG  1 
ATOM   3849 C CD  . LYS B 1 249 ? 13.599 -15.434 62.135 1.00 58.05 ? 237 LYS B CD  1 
ATOM   3850 C CE  . LYS B 1 249 ? 14.161 -15.114 63.511 1.00 57.28 ? 237 LYS B CE  1 
ATOM   3851 N NZ  . LYS B 1 249 ? 14.415 -13.670 63.681 1.00 57.72 ? 237 LYS B NZ  1 
HETATM 3852 O O   . HOH C 2 .   ? 14.683 1.276   20.675 1.00 12.24 ? 241 HOH A O   1 
HETATM 3853 O O   . HOH C 2 .   ? 8.452  7.771   16.778 1.00 13.34 ? 242 HOH A O   1 
HETATM 3854 O O   . HOH C 2 .   ? 7.462  4.072   18.886 1.00 13.31 ? 243 HOH A O   1 
HETATM 3855 O O   . HOH C 2 .   ? 3.709  -0.838  7.188  1.00 19.98 ? 244 HOH A O   1 
HETATM 3856 O O   . HOH C 2 .   ? 1.067  9.575   7.589  1.00 17.52 ? 245 HOH A O   1 
HETATM 3857 O O   . HOH C 2 .   ? 30.470 9.259   23.863 1.00 26.06 ? 246 HOH A O   1 
HETATM 3858 O O   . HOH C 2 .   ? 1.445  15.110  18.254 1.00 22.77 ? 247 HOH A O   1 
HETATM 3859 O O   . HOH C 2 .   ? 6.561  3.006   6.762  1.00 16.58 ? 248 HOH A O   1 
HETATM 3860 O O   . HOH C 2 .   ? 32.786 26.040  35.355 1.00 18.73 ? 249 HOH A O   1 
HETATM 3861 O O   . HOH C 2 .   ? 11.817 -0.610  22.026 1.00 15.98 ? 250 HOH A O   1 
HETATM 3862 O O   . HOH C 2 .   ? 18.753 45.864  7.135  1.00 18.29 ? 251 HOH A O   1 
HETATM 3863 O O   . HOH C 2 .   ? 6.820  7.506   19.102 1.00 22.27 ? 252 HOH A O   1 
HETATM 3864 O O   . HOH C 2 .   ? 0.507  -1.865  14.233 1.00 20.96 ? 253 HOH A O   1 
HETATM 3865 O O   . HOH C 2 .   ? 27.236 28.148  33.825 1.00 22.22 ? 254 HOH A O   1 
HETATM 3866 O O   . HOH C 2 .   ? 28.792 5.493   22.771 1.00 27.08 ? 255 HOH A O   1 
HETATM 3867 O O   . HOH C 2 .   ? 13.810 28.712  9.160  1.00 25.95 ? 256 HOH A O   1 
HETATM 3868 O O   . HOH C 2 .   ? 29.654 26.820  38.018 1.00 18.32 ? 257 HOH A O   1 
HETATM 3869 O O   . HOH C 2 .   ? 4.333  9.742   19.941 1.00 20.26 ? 258 HOH A O   1 
HETATM 3870 O O   . HOH C 2 .   ? 28.357 0.842   16.352 1.00 15.54 ? 259 HOH A O   1 
HETATM 3871 O O   . HOH C 2 .   ? -1.374 2.012   14.680 1.00 31.04 ? 260 HOH A O   1 
HETATM 3872 O O   . HOH C 2 .   ? 7.208  22.075  13.210 1.00 17.14 ? 261 HOH A O   1 
HETATM 3873 O O   . HOH C 2 .   ? 24.516 22.010  14.148 1.00 22.21 ? 262 HOH A O   1 
HETATM 3874 O O   . HOH C 2 .   ? 27.498 10.127  11.106 1.00 20.82 ? 263 HOH A O   1 
HETATM 3875 O O   . HOH C 2 .   ? 6.405  -2.116  19.455 1.00 21.62 ? 264 HOH A O   1 
HETATM 3876 O O   . HOH C 2 .   ? 8.919  -5.974  19.334 1.00 20.84 ? 265 HOH A O   1 
HETATM 3877 O O   . HOH C 2 .   ? 21.555 38.680  13.559 1.00 18.94 ? 266 HOH A O   1 
HETATM 3878 O O   . HOH C 2 .   ? 4.635  -6.655  18.990 1.00 26.02 ? 267 HOH A O   1 
HETATM 3879 O O   . HOH C 2 .   ? 17.032 19.642  11.455 1.00 28.72 ? 268 HOH A O   1 
HETATM 3880 O O   . HOH C 2 .   ? 22.388 45.466  5.434  1.00 29.28 ? 269 HOH A O   1 
HETATM 3881 O O   . HOH C 2 .   ? 23.225 26.016  9.162  1.00 31.88 ? 270 HOH A O   1 
HETATM 3882 O O   . HOH C 2 .   ? 20.955 31.278  39.889 1.00 28.89 ? 271 HOH A O   1 
HETATM 3883 O O   . HOH C 2 .   ? 9.063  -3.182  19.815 1.00 18.17 ? 272 HOH A O   1 
HETATM 3884 O O   . HOH C 2 .   ? 26.506 20.204  24.381 1.00 24.34 ? 273 HOH A O   1 
HETATM 3885 O O   . HOH C 2 .   ? 10.939 11.295  25.904 1.00 33.17 ? 274 HOH A O   1 
HETATM 3886 O O   . HOH C 2 .   ? 7.149  22.782  15.864 1.00 19.26 ? 275 HOH A O   1 
HETATM 3887 O O   . HOH C 2 .   ? 14.414 9.121   29.455 1.00 28.83 ? 276 HOH A O   1 
HETATM 3888 O O   . HOH C 2 .   ? 23.700 0.736   -1.753 1.00 37.01 ? 277 HOH A O   1 
HETATM 3889 O O   . HOH C 2 .   ? 12.378 -10.872 12.664 1.00 35.35 ? 278 HOH A O   1 
HETATM 3890 O O   . HOH C 2 .   ? 3.468  7.026   19.318 1.00 32.52 ? 279 HOH A O   1 
HETATM 3891 O O   . HOH C 2 .   ? 0.378  -13.669 13.577 1.00 26.59 ? 280 HOH A O   1 
HETATM 3892 O O   . HOH C 2 .   ? 27.280 28.354  5.002  1.00 27.85 ? 281 HOH A O   1 
HETATM 3893 O O   . HOH C 2 .   ? 10.957 23.059  10.670 1.00 26.43 ? 282 HOH A O   1 
HETATM 3894 O O   . HOH C 2 .   ? -0.307 6.637   17.693 1.00 38.79 ? 283 HOH A O   1 
HETATM 3895 O O   . HOH C 2 .   ? 10.869 39.933  -3.968 1.00 28.56 ? 284 HOH A O   1 
HETATM 3896 O O   . HOH C 2 .   ? 16.662 -0.366  21.186 1.00 19.44 ? 285 HOH A O   1 
HETATM 3897 O O   . HOH C 2 .   ? 10.036 5.406   5.107  1.00 29.15 ? 286 HOH A O   1 
HETATM 3898 O O   . HOH C 2 .   ? 7.867  46.230  -2.408 1.00 46.87 ? 287 HOH A O   1 
HETATM 3899 O O   . HOH C 2 .   ? 23.850 25.144  11.911 1.00 24.59 ? 288 HOH A O   1 
HETATM 3900 O O   . HOH C 2 .   ? 22.161 27.107  12.983 1.00 26.78 ? 289 HOH A O   1 
HETATM 3901 O O   . HOH C 2 .   ? 8.065  26.215  13.196 1.00 20.30 ? 290 HOH A O   1 
HETATM 3902 O O   . HOH C 2 .   ? 17.345 30.928  39.711 1.00 42.10 ? 291 HOH A O   1 
HETATM 3903 O O   . HOH C 2 .   ? 28.444 21.690  24.228 1.00 31.20 ? 292 HOH A O   1 
HETATM 3904 O O   . HOH C 2 .   ? 22.725 -3.974  16.820 1.00 39.69 ? 293 HOH A O   1 
HETATM 3905 O O   . HOH C 2 .   ? 0.731  11.759  6.238  1.00 22.91 ? 294 HOH A O   1 
HETATM 3906 O O   . HOH C 2 .   ? 1.629  1.951   18.299 1.00 28.99 ? 295 HOH A O   1 
HETATM 3907 O O   . HOH C 2 .   ? 3.726  33.312  8.270  1.00 43.86 ? 296 HOH A O   1 
HETATM 3908 O O   . HOH C 2 .   ? 14.342 -2.603  21.418 1.00 40.19 ? 297 HOH A O   1 
HETATM 3909 O O   . HOH C 2 .   ? 10.510 5.873   25.136 1.00 29.76 ? 298 HOH A O   1 
HETATM 3910 O O   . HOH C 2 .   ? 0.930  -7.783  10.339 1.00 26.23 ? 299 HOH A O   1 
HETATM 3911 O O   . HOH C 2 .   ? 13.441 -2.079  14.223 1.00 34.70 ? 300 HOH A O   1 
HETATM 3912 O O   . HOH C 2 .   ? -3.442 39.565  1.834  1.00 30.81 ? 301 HOH A O   1 
HETATM 3913 O O   . HOH C 2 .   ? 3.610  -5.741  6.338  1.00 46.50 ? 302 HOH A O   1 
HETATM 3914 O O   . HOH C 2 .   ? 7.549  24.783  9.122  1.00 36.85 ? 303 HOH A O   1 
HETATM 3915 O O   . HOH C 2 .   ? 31.284 29.988  10.945 1.00 24.30 ? 304 HOH A O   1 
HETATM 3916 O O   . HOH C 2 .   ? 29.159 10.205  26.776 1.00 29.35 ? 305 HOH A O   1 
HETATM 3917 O O   . HOH C 2 .   ? 10.396 16.824  24.888 1.00 33.02 ? 306 HOH A O   1 
HETATM 3918 O O   . HOH C 2 .   ? 6.309  21.538  23.112 1.00 30.92 ? 307 HOH A O   1 
HETATM 3919 O O   . HOH C 2 .   ? 1.617  16.259  20.766 1.00 40.71 ? 308 HOH A O   1 
HETATM 3920 O O   . HOH C 2 .   ? 11.636 1.301   0.558  1.00 26.85 ? 309 HOH A O   1 
HETATM 3921 O O   . HOH C 2 .   ? 28.332 24.946  23.870 1.00 39.39 ? 310 HOH A O   1 
HETATM 3922 O O   . HOH C 2 .   ? 1.055  16.918  15.542 1.00 30.79 ? 311 HOH A O   1 
HETATM 3923 O O   . HOH C 2 .   ? 18.091 28.323  6.882  1.00 46.09 ? 312 HOH A O   1 
HETATM 3924 O O   . HOH C 2 .   ? 6.612  -8.604  6.796  1.00 25.56 ? 313 HOH A O   1 
HETATM 3925 O O   . HOH C 2 .   ? 27.883 0.763   7.475  1.00 32.53 ? 314 HOH A O   1 
HETATM 3926 O O   . HOH C 2 .   ? 32.924 14.030  15.621 1.00 31.79 ? 315 HOH A O   1 
HETATM 3927 O O   . HOH C 2 .   ? 9.462  -8.709  4.805  1.00 23.95 ? 316 HOH A O   1 
HETATM 3928 O O   . HOH C 2 .   ? 30.471 28.185  31.998 1.00 29.90 ? 317 HOH A O   1 
HETATM 3929 O O   . HOH C 2 .   ? 24.666 27.218  5.016  1.00 26.55 ? 318 HOH A O   1 
HETATM 3930 O O   . HOH C 2 .   ? 26.002 7.196   2.772  1.00 36.97 ? 319 HOH A O   1 
HETATM 3931 O O   . HOH C 2 .   ? 7.389  19.223  25.029 1.00 29.41 ? 320 HOH A O   1 
HETATM 3932 O O   . HOH C 2 .   ? 26.772 -0.991  17.841 1.00 24.65 ? 321 HOH A O   1 
HETATM 3933 O O   . HOH C 2 .   ? 2.536  -7.649  18.331 1.00 46.29 ? 322 HOH A O   1 
HETATM 3934 O O   . HOH C 2 .   ? 20.571 27.134  10.635 1.00 36.50 ? 323 HOH A O   1 
HETATM 3935 O O   . HOH C 2 .   ? 13.318 -8.212  0.918  1.00 32.28 ? 324 HOH A O   1 
HETATM 3936 O O   . HOH C 2 .   ? 5.426  -1.038  22.034 1.00 28.78 ? 325 HOH A O   1 
HETATM 3937 O O   . HOH C 2 .   ? 10.348 26.844  29.396 1.00 40.28 ? 326 HOH A O   1 
HETATM 3938 O O   . HOH C 2 .   ? 10.498 20.108  27.922 1.00 32.34 ? 327 HOH A O   1 
HETATM 3939 O O   . HOH C 2 .   ? 20.018 1.775   -2.091 1.00 34.39 ? 328 HOH A O   1 
HETATM 3940 O O   . HOH C 2 .   ? 31.853 10.821  19.301 1.00 34.74 ? 329 HOH A O   1 
HETATM 3941 O O   . HOH C 2 .   ? 17.230 -9.541  1.877  1.00 46.55 ? 330 HOH A O   1 
HETATM 3942 O O   . HOH C 2 .   ? 16.652 34.036  -2.520 1.00 29.66 ? 331 HOH A O   1 
HETATM 3943 O O   . HOH C 2 .   ? 31.971 4.976   18.924 1.00 44.34 ? 332 HOH A O   1 
HETATM 3944 O O   . HOH C 2 .   ? 9.146  24.960  27.936 1.00 41.11 ? 333 HOH A O   1 
HETATM 3945 O O   . HOH C 2 .   ? 27.920 21.536  15.288 1.00 27.99 ? 334 HOH A O   1 
HETATM 3946 O O   . HOH C 2 .   ? -4.522 41.686  -0.313 1.00 44.35 ? 335 HOH A O   1 
HETATM 3947 O O   . HOH C 2 .   ? 12.017 12.072  -1.654 1.00 31.42 ? 336 HOH A O   1 
HETATM 3948 O O   . HOH C 2 .   ? 6.795  4.021   25.419 1.00 45.52 ? 337 HOH A O   1 
HETATM 3949 O O   . HOH C 2 .   ? 33.886 12.882  13.234 1.00 40.76 ? 338 HOH A O   1 
HETATM 3950 O O   . HOH C 2 .   ? 10.160 37.396  19.495 1.00 33.83 ? 339 HOH A O   1 
HETATM 3951 O O   . HOH C 2 .   ? 23.529 29.399  22.504 1.00 27.31 ? 340 HOH A O   1 
HETATM 3952 O O   . HOH C 2 .   ? 13.908 22.344  33.815 1.00 43.17 ? 341 HOH A O   1 
HETATM 3953 O O   . HOH C 2 .   ? 31.864 17.584  26.245 1.00 44.93 ? 342 HOH A O   1 
HETATM 3954 O O   . HOH C 2 .   ? 27.958 44.979  10.656 1.00 51.80 ? 343 HOH A O   1 
HETATM 3955 O O   . HOH C 2 .   ? 28.402 30.957  19.887 1.00 46.16 ? 344 HOH A O   1 
HETATM 3956 O O   . HOH C 2 .   ? 6.568  29.001  10.547 1.00 37.72 ? 345 HOH A O   1 
HETATM 3957 O O   . HOH C 2 .   ? -0.742 0.917   12.468 1.00 16.46 ? 346 HOH A O   1 
HETATM 3958 O O   . HOH C 2 .   ? 31.253 28.445  34.604 1.00 22.58 ? 347 HOH A O   1 
HETATM 3959 O O   . HOH C 2 .   ? 10.810 7.203   27.390 1.00 35.41 ? 348 HOH A O   1 
HETATM 3960 O O   . HOH C 2 .   ? 17.249 -2.111  23.374 1.00 24.93 ? 349 HOH A O   1 
HETATM 3961 O O   . HOH C 2 .   ? 8.588  23.700  11.550 1.00 26.70 ? 350 HOH A O   1 
HETATM 3962 O O   . HOH C 2 .   ? 29.016 28.559  35.839 1.00 29.03 ? 351 HOH A O   1 
HETATM 3963 O O   . HOH C 2 .   ? 19.519 -3.050  22.947 1.00 31.65 ? 352 HOH A O   1 
HETATM 3964 O O   . HOH C 2 .   ? 33.258 18.577  28.450 1.00 34.30 ? 353 HOH A O   1 
HETATM 3965 O O   . HOH C 2 .   ? 20.824 41.072  12.569 1.00 32.77 ? 354 HOH A O   1 
HETATM 3966 O O   . HOH C 2 .   ? -3.334 6.792   15.801 1.00 48.54 ? 355 HOH A O   1 
HETATM 3967 O O   . HOH C 2 .   ? 22.262 34.238  14.467 1.00 37.45 ? 356 HOH A O   1 
HETATM 3968 O O   . HOH C 2 .   ? 11.277 32.968  3.467  1.00 21.48 ? 357 HOH A O   1 
HETATM 3969 O O   . HOH C 2 .   ? 29.844 1.607   18.165 1.00 35.30 ? 358 HOH A O   1 
HETATM 3970 O O   . HOH C 2 .   ? -2.370 7.790   19.364 1.00 36.88 ? 359 HOH A O   1 
HETATM 3971 O O   . HOH C 2 .   ? 8.257  3.738   4.710  1.00 33.32 ? 360 HOH A O   1 
HETATM 3972 O O   . HOH C 2 .   ? 11.750 8.910   -1.665 1.00 43.63 ? 361 HOH A O   1 
HETATM 3973 O O   . HOH C 2 .   ? 25.355 -2.244  9.627  1.00 31.75 ? 362 HOH A O   1 
HETATM 3974 O O   . HOH C 2 .   ? 29.917 29.704  17.527 1.00 40.01 ? 363 HOH A O   1 
HETATM 3975 O O   . HOH C 2 .   ? 23.901 -4.801  13.025 1.00 35.68 ? 364 HOH A O   1 
HETATM 3976 O O   . HOH C 2 .   ? 9.150  6.590   20.768 1.00 23.30 ? 365 HOH A O   1 
HETATM 3977 O O   . HOH C 2 .   ? 31.316 10.957  26.614 1.00 35.80 ? 366 HOH A O   1 
HETATM 3978 O O   . HOH C 2 .   ? 13.240 -9.810  10.714 1.00 41.96 ? 367 HOH A O   1 
HETATM 3979 O O   . HOH C 2 .   ? 9.647  13.054  22.578 1.00 34.19 ? 368 HOH A O   1 
HETATM 3980 O O   . HOH C 2 .   ? 2.963  -0.703  21.379 1.00 34.71 ? 369 HOH A O   1 
HETATM 3981 O O   . HOH C 2 .   ? 17.541 42.498  -5.181 1.00 38.13 ? 370 HOH A O   1 
HETATM 3982 O O   . HOH C 2 .   ? 19.549 18.965  11.901 1.00 28.91 ? 371 HOH A O   1 
HETATM 3983 O O   . HOH C 2 .   ? 9.535  -1.252  23.404 1.00 39.23 ? 372 HOH A O   1 
HETATM 3984 O O   . HOH C 2 .   ? 35.454 14.897  12.096 1.00 36.01 ? 373 HOH A O   1 
HETATM 3985 O O   . HOH C 2 .   ? 4.048  1.342   22.598 1.00 37.32 ? 374 HOH A O   1 
HETATM 3986 O O   . HOH C 2 .   ? 11.350 31.831  22.899 1.00 32.55 ? 375 HOH A O   1 
HETATM 3987 O O   . HOH C 2 .   ? 32.797 13.955  10.657 1.00 41.99 ? 376 HOH A O   1 
HETATM 3988 O O   . HOH C 2 .   ? 8.438  -3.741  5.231  1.00 35.97 ? 377 HOH A O   1 
HETATM 3989 O O   . HOH C 2 .   ? 7.831  25.353  15.677 1.00 33.35 ? 378 HOH A O   1 
HETATM 3990 O O   . HOH C 2 .   ? 1.488  -6.846  7.308  1.00 36.07 ? 379 HOH A O   1 
HETATM 3991 O O   . HOH C 2 .   ? 19.487 34.910  33.867 1.00 39.91 ? 380 HOH A O   1 
HETATM 3992 O O   . HOH C 2 .   ? 30.119 -0.895  14.798 1.00 36.40 ? 381 HOH A O   1 
HETATM 3993 O O   . HOH C 2 .   ? 29.402 9.767   2.278  1.00 46.68 ? 382 HOH A O   1 
HETATM 3994 O O   . HOH C 2 .   ? 27.702 14.281  8.744  1.00 38.09 ? 383 HOH A O   1 
HETATM 3995 O O   . HOH C 2 .   ? 29.403 25.666  17.305 1.00 38.44 ? 384 HOH A O   1 
HETATM 3996 O O   . HOH C 2 .   ? 29.002 10.842  7.767  1.00 36.60 ? 385 HOH A O   1 
HETATM 3997 O O   . HOH C 2 .   ? 10.205 19.702  5.684  1.00 36.39 ? 386 HOH A O   1 
HETATM 3998 O O   . HOH C 2 .   ? 22.878 22.672  10.975 1.00 32.13 ? 387 HOH A O   1 
HETATM 3999 O O   . HOH C 2 .   ? 16.467 29.903  0.777  1.00 36.63 ? 388 HOH A O   1 
HETATM 4000 O O   . HOH C 2 .   ? 11.137 -5.313  0.459  1.00 33.34 ? 389 HOH A O   1 
HETATM 4001 O O   . HOH C 2 .   ? 9.394  -1.204  4.910  1.00 39.01 ? 390 HOH A O   1 
HETATM 4002 O O   . HOH C 2 .   ? 32.430 10.876  22.430 1.00 39.16 ? 391 HOH A O   1 
HETATM 4003 O O   . HOH C 2 .   ? 13.932 -9.961  3.004  1.00 43.40 ? 392 HOH A O   1 
HETATM 4004 O O   . HOH C 2 .   ? 24.973 45.060  2.189  1.00 35.21 ? 393 HOH A O   1 
HETATM 4005 O O   . HOH C 2 .   ? -1.065 -4.372  17.401 1.00 54.46 ? 394 HOH A O   1 
HETATM 4006 O O   . HOH C 2 .   ? 0.462  33.769  1.473  1.00 40.41 ? 395 HOH A O   1 
HETATM 4007 O O   . HOH C 2 .   ? 23.695 5.385   2.031  1.00 32.96 ? 396 HOH A O   1 
HETATM 4008 O O   . HOH C 2 .   ? 33.848 25.260  33.227 1.00 40.94 ? 397 HOH A O   1 
HETATM 4009 O O   . HOH C 2 .   ? 9.678  27.023  19.765 1.00 37.97 ? 398 HOH A O   1 
HETATM 4010 O O   . HOH C 2 .   ? 8.391  7.988   3.077  1.00 28.81 ? 399 HOH A O   1 
HETATM 4011 O O   . HOH C 2 .   ? 10.557 14.529  26.259 1.00 46.04 ? 400 HOH A O   1 
HETATM 4012 O O   . HOH C 2 .   ? 11.541 -13.846 13.409 1.00 33.81 ? 401 HOH A O   1 
HETATM 4013 O O   . HOH C 2 .   ? 33.152 11.446  16.899 1.00 39.62 ? 402 HOH A O   1 
HETATM 4014 O O   . HOH C 2 .   ? 32.772 13.385  24.770 1.00 41.07 ? 403 HOH A O   1 
HETATM 4015 O O   . HOH C 2 .   ? 25.632 2.249   -0.735 1.00 41.80 ? 404 HOH A O   1 
HETATM 4016 O O   . HOH C 2 .   ? 9.336  15.391  8.584  1.00 14.85 ? 405 HOH A O   1 
HETATM 4017 O O   . HOH C 2 .   ? 6.007  43.087  -7.654 1.00 21.14 ? 406 HOH A O   1 
HETATM 4018 O O   . HOH C 2 .   ? 9.452  14.664  5.963  1.00 29.79 ? 407 HOH A O   1 
HETATM 4019 O O   . HOH C 2 .   ? 22.407 -1.166  0.585  1.00 45.37 ? 408 HOH A O   1 
HETATM 4020 O O   . HOH C 2 .   ? 1.650  -2.359  0.592  1.00 64.80 ? 409 HOH A O   1 
HETATM 4021 O O   . HOH C 2 .   ? 40.238 31.156  13.590 1.00 46.44 ? 410 HOH A O   1 
HETATM 4022 O O   . HOH C 2 .   ? 27.078 23.827  9.951  1.00 42.13 ? 411 HOH A O   1 
HETATM 4023 O O   . HOH C 2 .   ? 9.940  29.377  28.244 1.00 38.90 ? 412 HOH A O   1 
HETATM 4024 O O   . HOH C 2 .   ? 35.096 18.492  20.683 1.00 40.39 ? 413 HOH A O   1 
HETATM 4025 O O   . HOH C 2 .   ? 18.901 -6.442  15.326 1.00 45.28 ? 414 HOH A O   1 
HETATM 4026 O O   . HOH C 2 .   ? 16.297 48.823  0.064  1.00 39.41 ? 415 HOH A O   1 
HETATM 4027 O O   . HOH C 2 .   ? 25.881 30.155  21.423 1.00 40.48 ? 416 HOH A O   1 
HETATM 4028 O O   . HOH C 2 .   ? 13.829 40.052  22.744 1.00 36.37 ? 417 HOH A O   1 
HETATM 4029 O O   . HOH C 2 .   ? 5.543  -0.398  5.391  1.00 45.26 ? 418 HOH A O   1 
HETATM 4030 O O   . HOH C 2 .   ? -1.281 3.065   4.518  1.00 28.36 ? 419 HOH A O   1 
HETATM 4031 O O   . HOH C 2 .   ? 17.957 -6.539  2.060  1.00 43.74 ? 420 HOH A O   1 
HETATM 4032 O O   . HOH C 2 .   ? 9.879  25.311  17.449 1.00 34.14 ? 421 HOH A O   1 
HETATM 4033 O O   . HOH C 2 .   ? 2.970  -10.174 17.653 1.00 43.44 ? 422 HOH A O   1 
HETATM 4034 O O   . HOH C 2 .   ? 11.613 9.655   27.854 1.00 37.36 ? 423 HOH A O   1 
HETATM 4035 O O   . HOH C 2 .   ? 18.638 3.763   -0.919 1.00 31.85 ? 424 HOH A O   1 
HETATM 4036 O O   . HOH C 2 .   ? 14.988 -4.175  15.012 1.00 39.25 ? 425 HOH A O   1 
HETATM 4037 O O   . HOH C 2 .   ? 31.916 -0.844  12.566 1.00 36.82 ? 426 HOH A O   1 
HETATM 4038 O O   . HOH C 2 .   ? 9.005  2.021   1.801  1.00 38.40 ? 427 HOH A O   1 
HETATM 4039 O O   . HOH C 2 .   ? 0.296  -1.274  17.031 1.00 37.43 ? 428 HOH A O   1 
HETATM 4040 O O   . HOH C 2 .   ? 36.347 42.675  12.447 1.00 46.39 ? 429 HOH A O   1 
HETATM 4041 O O   . HOH C 2 .   ? 19.809 26.498  14.048 1.00 35.82 ? 430 HOH A O   1 
HETATM 4042 O O   . HOH C 2 .   ? 30.921 25.464  23.695 1.00 37.84 ? 431 HOH A O   1 
HETATM 4043 O O   . HOH C 2 .   ? 0.633  45.336  -2.408 1.00 44.17 ? 432 HOH A O   1 
HETATM 4044 O O   . HOH C 2 .   ? 26.358 4.243   -2.175 1.00 43.99 ? 433 HOH A O   1 
HETATM 4045 O O   . HOH C 2 .   ? 6.556  32.713  -2.310 1.00 48.27 ? 434 HOH A O   1 
HETATM 4046 O O   . HOH C 2 .   ? 24.970 29.635  34.297 1.00 49.93 ? 435 HOH A O   1 
HETATM 4047 O O   . HOH C 2 .   ? 20.176 -7.102  7.697  1.00 38.00 ? 436 HOH A O   1 
HETATM 4048 O O   . HOH C 2 .   ? 22.654 33.439  -1.928 1.00 44.82 ? 437 HOH A O   1 
HETATM 4049 O O   . HOH C 2 .   ? 3.357  29.133  5.947  1.00 49.38 ? 438 HOH A O   1 
HETATM 4050 O O   . HOH C 2 .   ? 25.917 34.516  30.662 1.00 45.56 ? 439 HOH A O   1 
HETATM 4051 O O   . HOH C 2 .   ? 6.677  14.079  22.408 1.00 46.79 ? 440 HOH A O   1 
HETATM 4052 O O   . HOH C 2 .   ? 5.792  5.245   20.485 1.00 42.58 ? 441 HOH A O   1 
HETATM 4053 O O   . HOH C 2 .   ? 19.741 -0.180  -0.681 1.00 32.27 ? 442 HOH A O   1 
HETATM 4054 O O   . HOH C 2 .   ? 10.386 24.596  32.715 1.00 40.17 ? 443 HOH A O   1 
HETATM 4055 O O   . HOH C 2 .   ? 38.531 36.810  15.048 1.00 45.57 ? 444 HOH A O   1 
HETATM 4056 O O   . HOH C 2 .   ? 25.688 -0.565  20.050 1.00 53.42 ? 445 HOH A O   1 
HETATM 4057 O O   . HOH C 2 .   ? 16.202 41.236  16.732 1.00 44.62 ? 446 HOH A O   1 
HETATM 4058 O O   . HOH C 2 .   ? 10.675 20.444  31.010 1.00 49.04 ? 447 HOH A O   1 
HETATM 4059 O O   . HOH D 2 .   ? 26.069 -11.741 73.465 1.00 16.64 ? 241 HOH B O   1 
HETATM 4060 O O   . HOH D 2 .   ? 28.109 25.862  40.247 1.00 12.52 ? 242 HOH B O   1 
HETATM 4061 O O   . HOH D 2 .   ? 31.943 24.973  55.967 1.00 17.23 ? 243 HOH B O   1 
HETATM 4062 O O   . HOH D 2 .   ? 44.983 18.547  41.975 1.00 15.69 ? 244 HOH B O   1 
HETATM 4063 O O   . HOH D 2 .   ? 21.057 -1.293  20.966 1.00 15.85 ? 245 HOH B O   1 
HETATM 4064 O O   . HOH D 2 .   ? 24.686 12.797  57.081 1.00 17.52 ? 246 HOH B O   1 
HETATM 4065 O O   . HOH D 2 .   ? 23.833 -18.709 53.875 1.00 14.61 ? 247 HOH B O   1 
HETATM 4066 O O   . HOH D 2 .   ? 24.316 30.177  56.672 1.00 19.51 ? 248 HOH B O   1 
HETATM 4067 O O   . HOH D 2 .   ? 24.570 21.343  48.211 1.00 16.42 ? 249 HOH B O   1 
HETATM 4068 O O   . HOH D 2 .   ? 19.188 20.004  35.006 1.00 19.39 ? 250 HOH B O   1 
HETATM 4069 O O   . HOH D 2 .   ? 23.963 25.416  47.039 1.00 16.73 ? 251 HOH B O   1 
HETATM 4070 O O   . HOH D 2 .   ? 31.242 29.376  57.108 1.00 27.66 ? 252 HOH B O   1 
HETATM 4071 O O   . HOH D 2 .   ? 25.615 36.086  47.196 1.00 22.98 ? 253 HOH B O   1 
HETATM 4072 O O   . HOH D 2 .   ? 33.438 13.247  28.258 1.00 26.69 ? 254 HOH B O   1 
HETATM 4073 O O   . HOH D 2 .   ? 39.952 23.919  56.301 1.00 34.26 ? 255 HOH B O   1 
HETATM 4074 O O   . HOH D 2 .   ? 26.773 31.792  44.025 1.00 19.29 ? 256 HOH B O   1 
HETATM 4075 O O   . HOH D 2 .   ? 20.504 13.711  30.815 1.00 19.42 ? 257 HOH B O   1 
HETATM 4076 O O   . HOH D 2 .   ? 26.103 28.654  40.892 1.00 15.14 ? 258 HOH B O   1 
HETATM 4077 O O   . HOH D 2 .   ? 32.501 -2.013  46.356 1.00 31.24 ? 259 HOH B O   1 
HETATM 4078 O O   . HOH D 2 .   ? 21.703 7.882   53.677 1.00 21.51 ? 260 HOH B O   1 
HETATM 4079 O O   . HOH D 2 .   ? 36.328 27.527  54.553 1.00 24.60 ? 261 HOH B O   1 
HETATM 4080 O O   . HOH D 2 .   ? 28.014 3.405   23.978 1.00 36.14 ? 262 HOH B O   1 
HETATM 4081 O O   . HOH D 2 .   ? 23.697 -17.059 68.226 1.00 29.53 ? 263 HOH B O   1 
HETATM 4082 O O   . HOH D 2 .   ? 14.231 9.983   47.654 1.00 43.14 ? 264 HOH B O   1 
HETATM 4083 O O   . HOH D 2 .   ? 29.161 -12.156 66.031 1.00 25.13 ? 265 HOH B O   1 
HETATM 4084 O O   . HOH D 2 .   ? 29.272 13.220  27.322 1.00 29.58 ? 266 HOH B O   1 
HETATM 4085 O O   . HOH D 2 .   ? 18.422 18.547  40.649 1.00 35.46 ? 267 HOH B O   1 
HETATM 4086 O O   . HOH D 2 .   ? 31.600 2.181   41.229 1.00 23.93 ? 268 HOH B O   1 
HETATM 4087 O O   . HOH D 2 .   ? 17.537 15.200  55.767 1.00 21.01 ? 269 HOH B O   1 
HETATM 4088 O O   . HOH D 2 .   ? 36.473 36.307  45.882 1.00 32.73 ? 270 HOH B O   1 
HETATM 4089 O O   . HOH D 2 .   ? 28.919 -2.196  44.440 1.00 32.34 ? 271 HOH B O   1 
HETATM 4090 O O   . HOH D 2 .   ? 22.170 22.673  47.703 1.00 28.72 ? 272 HOH B O   1 
HETATM 4091 O O   . HOH D 2 .   ? 19.274 21.324  49.404 1.00 28.88 ? 273 HOH B O   1 
HETATM 4092 O O   . HOH D 2 .   ? 16.772 17.073  53.024 1.00 26.00 ? 274 HOH B O   1 
HETATM 4093 O O   . HOH D 2 .   ? 24.097 -12.283 46.370 1.00 18.84 ? 275 HOH B O   1 
HETATM 4094 O O   . HOH D 2 .   ? 36.048 35.689  54.317 1.00 27.36 ? 276 HOH B O   1 
HETATM 4095 O O   . HOH D 2 .   ? 27.607 -19.951 52.357 1.00 27.46 ? 277 HOH B O   1 
HETATM 4096 O O   . HOH D 2 .   ? 46.130 14.071  46.045 1.00 27.35 ? 278 HOH B O   1 
HETATM 4097 O O   . HOH D 2 .   ? 29.592 5.692   26.745 1.00 31.06 ? 279 HOH B O   1 
HETATM 4098 O O   . HOH D 2 .   ? 36.925 -6.296  46.790 1.00 30.13 ? 280 HOH B O   1 
HETATM 4099 O O   . HOH D 2 .   ? 6.400  0.208   29.104 1.00 29.77 ? 281 HOH B O   1 
HETATM 4100 O O   . HOH D 2 .   ? 17.453 -1.295  26.290 1.00 24.60 ? 282 HOH B O   1 
HETATM 4101 O O   . HOH D 2 .   ? 25.013 31.573  46.256 1.00 25.92 ? 283 HOH B O   1 
HETATM 4102 O O   . HOH D 2 .   ? 19.699 -13.614 72.423 1.00 34.23 ? 284 HOH B O   1 
HETATM 4103 O O   . HOH D 2 .   ? 20.892 23.830  40.868 1.00 27.29 ? 285 HOH B O   1 
HETATM 4104 O O   . HOH D 2 .   ? 21.478 29.392  51.125 1.00 28.28 ? 286 HOH B O   1 
HETATM 4105 O O   . HOH D 2 .   ? 28.852 43.549  52.689 1.00 29.62 ? 287 HOH B O   1 
HETATM 4106 O O   . HOH D 2 .   ? 33.385 -8.591  60.425 1.00 30.80 ? 288 HOH B O   1 
HETATM 4107 O O   . HOH D 2 .   ? 39.969 20.846  33.617 1.00 24.84 ? 289 HOH B O   1 
HETATM 4108 O O   . HOH D 2 .   ? 16.207 11.759  51.031 1.00 28.57 ? 290 HOH B O   1 
HETATM 4109 O O   . HOH D 2 .   ? 31.651 -1.103  44.025 1.00 37.65 ? 291 HOH B O   1 
HETATM 4110 O O   . HOH D 2 .   ? 33.156 1.696   38.395 1.00 30.80 ? 292 HOH B O   1 
HETATM 4111 O O   . HOH D 2 .   ? 38.355 23.236  33.790 1.00 47.71 ? 293 HOH B O   1 
HETATM 4112 O O   . HOH D 2 .   ? 41.525 30.437  55.532 1.00 41.41 ? 294 HOH B O   1 
HETATM 4113 O O   . HOH D 2 .   ? 18.229 23.330  53.299 1.00 30.28 ? 295 HOH B O   1 
HETATM 4114 O O   . HOH D 2 .   ? 19.862 23.902  50.454 1.00 24.73 ? 296 HOH B O   1 
HETATM 4115 O O   . HOH D 2 .   ? 25.267 5.464   53.082 1.00 41.22 ? 297 HOH B O   1 
HETATM 4116 O O   . HOH D 2 .   ? 31.182 -2.683  36.287 1.00 36.57 ? 298 HOH B O   1 
HETATM 4117 O O   . HOH D 2 .   ? 30.631 -5.719  62.008 1.00 30.21 ? 299 HOH B O   1 
HETATM 4118 O O   . HOH D 2 .   ? 36.917 -12.386 56.223 1.00 26.19 ? 300 HOH B O   1 
HETATM 4119 O O   . HOH D 2 .   ? 22.750 -3.354  36.991 1.00 21.53 ? 301 HOH B O   1 
HETATM 4120 O O   . HOH D 2 .   ? 26.877 5.087   32.026 1.00 24.39 ? 302 HOH B O   1 
HETATM 4121 O O   . HOH D 2 .   ? 25.947 21.030  60.147 1.00 29.11 ? 303 HOH B O   1 
HETATM 4122 O O   . HOH D 2 .   ? 17.304 14.160  42.329 1.00 47.58 ? 304 HOH B O   1 
HETATM 4123 O O   . HOH D 2 .   ? 16.968 14.173  39.148 1.00 42.04 ? 305 HOH B O   1 
HETATM 4124 O O   . HOH D 2 .   ? 34.420 16.913  29.504 1.00 33.44 ? 306 HOH B O   1 
HETATM 4125 O O   . HOH D 2 .   ? 8.303  -1.120  26.724 1.00 36.50 ? 307 HOH B O   1 
HETATM 4126 O O   . HOH D 2 .   ? 41.680 11.160  39.611 1.00 36.75 ? 308 HOH B O   1 
HETATM 4127 O O   . HOH D 2 .   ? 39.358 34.502  53.342 1.00 30.04 ? 309 HOH B O   1 
HETATM 4128 O O   . HOH D 2 .   ? 30.641 -4.207  55.806 1.00 36.47 ? 310 HOH B O   1 
HETATM 4129 O O   . HOH D 2 .   ? 22.347 32.359  52.604 1.00 44.97 ? 311 HOH B O   1 
HETATM 4130 O O   . HOH D 2 .   ? 32.456 -14.519 63.183 1.00 40.76 ? 312 HOH B O   1 
HETATM 4131 O O   . HOH D 2 .   ? 14.244 11.049  40.711 1.00 34.31 ? 313 HOH B O   1 
HETATM 4132 O O   . HOH D 2 .   ? 24.360 34.057  38.433 1.00 39.90 ? 314 HOH B O   1 
HETATM 4133 O O   . HOH D 2 .   ? 43.615 7.622   42.697 1.00 43.85 ? 315 HOH B O   1 
HETATM 4134 O O   . HOH D 2 .   ? 30.621 12.848  56.312 1.00 33.66 ? 316 HOH B O   1 
HETATM 4135 O O   . HOH D 2 .   ? 10.731 5.078   40.735 1.00 31.66 ? 317 HOH B O   1 
HETATM 4136 O O   . HOH D 2 .   ? 25.520 18.607  61.457 1.00 34.17 ? 318 HOH B O   1 
HETATM 4137 O O   . HOH D 2 .   ? 17.713 0.687   65.483 1.00 49.39 ? 319 HOH B O   1 
HETATM 4138 O O   . HOH D 2 .   ? 28.839 -6.487  71.664 1.00 26.24 ? 320 HOH B O   1 
HETATM 4139 O O   . HOH D 2 .   ? 16.815 -6.032  52.630 1.00 39.04 ? 321 HOH B O   1 
HETATM 4140 O O   . HOH D 2 .   ? 35.853 -4.114  40.605 1.00 36.40 ? 322 HOH B O   1 
HETATM 4141 O O   . HOH D 2 .   ? 25.228 -5.691  40.472 1.00 39.28 ? 323 HOH B O   1 
HETATM 4142 O O   . HOH D 2 .   ? 27.249 -21.374 60.755 1.00 44.12 ? 324 HOH B O   1 
HETATM 4143 O O   . HOH D 2 .   ? 29.099 -3.609  68.698 1.00 44.98 ? 325 HOH B O   1 
HETATM 4144 O O   . HOH D 2 .   ? 25.938 -5.114  60.111 1.00 28.25 ? 326 HOH B O   1 
HETATM 4145 O O   . HOH D 2 .   ? 15.597 10.607  31.736 1.00 44.17 ? 327 HOH B O   1 
HETATM 4146 O O   . HOH D 2 .   ? 35.836 -4.502  48.242 1.00 32.35 ? 328 HOH B O   1 
HETATM 4147 O O   . HOH D 2 .   ? 11.294 8.437   35.085 1.00 44.71 ? 329 HOH B O   1 
HETATM 4148 O O   . HOH D 2 .   ? 28.022 34.148  44.484 1.00 26.61 ? 330 HOH B O   1 
HETATM 4149 O O   . HOH D 2 .   ? 31.461 13.506  26.773 1.00 55.35 ? 331 HOH B O   1 
HETATM 4150 O O   . HOH D 2 .   ? 35.533 -19.561 60.719 1.00 49.31 ? 332 HOH B O   1 
HETATM 4151 O O   . HOH D 2 .   ? 21.658 30.173  55.360 1.00 38.13 ? 333 HOH B O   1 
HETATM 4152 O O   . HOH D 2 .   ? 18.765 25.672  54.047 1.00 41.68 ? 334 HOH B O   1 
HETATM 4153 O O   . HOH D 2 .   ? 35.198 10.944  28.254 1.00 31.75 ? 335 HOH B O   1 
HETATM 4154 O O   . HOH D 2 .   ? 19.832 -18.848 60.246 1.00 47.23 ? 336 HOH B O   1 
HETATM 4155 O O   . HOH D 2 .   ? 25.589 -1.346  53.490 1.00 36.26 ? 337 HOH B O   1 
HETATM 4156 O O   . HOH D 2 .   ? 27.285 2.407   30.939 1.00 31.88 ? 338 HOH B O   1 
HETATM 4157 O O   . HOH D 2 .   ? 20.551 1.922   57.062 1.00 39.38 ? 339 HOH B O   1 
HETATM 4158 O O   . HOH D 2 .   ? 44.146 6.999   40.192 1.00 39.11 ? 340 HOH B O   1 
HETATM 4159 O O   . HOH D 2 .   ? 32.103 2.012   44.334 1.00 42.46 ? 341 HOH B O   1 
HETATM 4160 O O   . HOH D 2 .   ? 25.118 37.916  48.981 1.00 32.29 ? 342 HOH B O   1 
HETATM 4161 O O   . HOH D 2 .   ? 35.903 23.300  32.895 1.00 34.34 ? 343 HOH B O   1 
HETATM 4162 O O   . HOH D 2 .   ? 16.804 -7.405  30.134 1.00 39.52 ? 344 HOH B O   1 
HETATM 4163 O O   . HOH D 2 .   ? 39.089 -15.899 49.329 1.00 47.31 ? 345 HOH B O   1 
HETATM 4164 O O   . HOH D 2 .   ? 29.677 -20.477 60.113 1.00 37.93 ? 346 HOH B O   1 
HETATM 4165 O O   . HOH D 2 .   ? 22.624 -17.253 65.765 1.00 45.79 ? 347 HOH B O   1 
HETATM 4166 O O   . HOH D 2 .   ? 23.522 -1.103  21.335 1.00 33.67 ? 348 HOH B O   1 
HETATM 4167 O O   . HOH D 2 .   ? 45.182 11.569  45.381 1.00 58.95 ? 349 HOH B O   1 
HETATM 4168 O O   . HOH D 2 .   ? 21.273 -1.703  68.382 1.00 37.03 ? 350 HOH B O   1 
HETATM 4169 O O   . HOH D 2 .   ? 15.687 19.702  52.062 1.00 46.92 ? 351 HOH B O   1 
HETATM 4170 O O   . HOH D 2 .   ? 20.710 4.003   53.640 1.00 30.12 ? 352 HOH B O   1 
HETATM 4171 O O   . HOH D 2 .   ? 25.431 -8.513  44.414 1.00 35.71 ? 353 HOH B O   1 
HETATM 4172 O O   . HOH D 2 .   ? 40.430 8.587   40.762 1.00 40.77 ? 354 HOH B O   1 
HETATM 4173 O O   . HOH D 2 .   ? 34.263 35.322  56.812 1.00 43.88 ? 355 HOH B O   1 
HETATM 4174 O O   . HOH D 2 .   ? 28.801 2.022   28.902 1.00 37.86 ? 356 HOH B O   1 
HETATM 4175 O O   . HOH D 2 .   ? 35.568 7.871   47.154 1.00 52.07 ? 357 HOH B O   1 
HETATM 4176 O O   . HOH D 2 .   ? 19.502 7.927   52.135 1.00 30.73 ? 358 HOH B O   1 
HETATM 4177 O O   . HOH D 2 .   ? 45.930 16.542  43.715 1.00 34.28 ? 359 HOH B O   1 
HETATM 4178 O O   . HOH D 2 .   ? 19.482 14.150  58.667 1.00 33.15 ? 360 HOH B O   1 
HETATM 4179 O O   . HOH D 2 .   ? 18.438 19.902  38.359 1.00 37.63 ? 361 HOH B O   1 
HETATM 4180 O O   . HOH D 2 .   ? 9.900  3.087   42.256 1.00 42.70 ? 362 HOH B O   1 
HETATM 4181 O O   . HOH D 2 .   ? 29.449 31.395  36.768 1.00 51.61 ? 363 HOH B O   1 
HETATM 4182 O O   . HOH D 2 .   ? 31.624 -6.895  71.446 1.00 47.49 ? 364 HOH B O   1 
HETATM 4183 O O   . HOH D 2 .   ? 21.092 -2.682  24.999 1.00 27.72 ? 365 HOH B O   1 
HETATM 4184 O O   . HOH D 2 .   ? 14.438 6.130   46.033 1.00 41.99 ? 366 HOH B O   1 
HETATM 4185 O O   . HOH D 2 .   ? 34.397 21.182  55.467 1.00 32.22 ? 367 HOH B O   1 
HETATM 4186 O O   . HOH D 2 .   ? 34.034 29.987  43.393 1.00 29.21 ? 368 HOH B O   1 
HETATM 4187 O O   . HOH D 2 .   ? 14.377 1.033   47.906 1.00 37.21 ? 369 HOH B O   1 
HETATM 4188 O O   . HOH D 2 .   ? 14.234 12.379  44.630 1.00 36.94 ? 370 HOH B O   1 
HETATM 4189 O O   . HOH D 2 .   ? 34.223 23.649  55.928 1.00 36.74 ? 371 HOH B O   1 
HETATM 4190 O O   . HOH D 2 .   ? 7.777  -4.846  36.740 1.00 47.26 ? 372 HOH B O   1 
HETATM 4191 O O   . HOH D 2 .   ? 28.071 27.253  62.780 1.00 32.60 ? 373 HOH B O   1 
HETATM 4192 O O   . HOH D 2 .   ? 26.590 42.988  53.063 1.00 44.82 ? 374 HOH B O   1 
HETATM 4193 O O   . HOH D 2 .   ? 27.667 -13.809 72.527 1.00 13.95 ? 375 HOH B O   1 
HETATM 4194 O O   . HOH D 2 .   ? 28.491 12.651  54.492 1.00 18.74 ? 376 HOH B O   1 
HETATM 4195 O O   . HOH D 2 .   ? 30.106 -14.147 64.312 1.00 22.09 ? 377 HOH B O   1 
HETATM 4196 O O   . HOH D 2 .   ? 28.490 20.827  60.643 1.00 47.09 ? 378 HOH B O   1 
HETATM 4197 O O   . HOH D 2 .   ? 32.714 28.792  45.009 1.00 39.52 ? 379 HOH B O   1 
HETATM 4198 O O   . HOH D 2 .   ? 46.216 17.649  46.615 1.00 34.64 ? 380 HOH B O   1 
HETATM 4199 O O   . HOH D 2 .   ? 10.612 -12.868 56.743 1.00 37.66 ? 381 HOH B O   1 
HETATM 4200 O O   . HOH D 2 .   ? 6.324  -12.173 61.003 1.00 44.18 ? 382 HOH B O   1 
HETATM 4201 O O   . HOH D 2 .   ? 32.476 25.662  58.591 1.00 39.55 ? 383 HOH B O   1 
HETATM 4202 O O   . HOH D 2 .   ? 18.853 5.151   52.209 1.00 36.15 ? 384 HOH B O   1 
HETATM 4203 O O   . HOH D 2 .   ? 20.620 31.190  43.519 1.00 36.12 ? 385 HOH B O   1 
HETATM 4204 O O   . HOH D 2 .   ? 19.083 3.743   55.523 1.00 37.80 ? 386 HOH B O   1 
HETATM 4205 O O   . HOH D 2 .   ? 24.667 -0.947  67.900 1.00 39.49 ? 387 HOH B O   1 
HETATM 4206 O O   . HOH D 2 .   ? 21.470 25.274  47.467 1.00 42.44 ? 388 HOH B O   1 
HETATM 4207 O O   . HOH D 2 .   ? 16.577 21.572  48.015 1.00 43.11 ? 389 HOH B O   1 
HETATM 4208 O O   . HOH D 2 .   ? 7.271  4.288   34.925 1.00 41.33 ? 390 HOH B O   1 
HETATM 4209 O O   . HOH D 2 .   ? 41.597 25.043  57.908 1.00 46.74 ? 391 HOH B O   1 
HETATM 4210 O O   . HOH D 2 .   ? 18.909 23.098  38.972 1.00 30.79 ? 392 HOH B O   1 
HETATM 4211 O O   . HOH D 2 .   ? 18.739 12.703  56.774 1.00 47.26 ? 393 HOH B O   1 
HETATM 4212 O O   . HOH D 2 .   ? 29.508 37.474  55.748 1.00 30.56 ? 394 HOH B O   1 
HETATM 4213 O O   . HOH D 2 .   ? 38.463 15.448  38.152 1.00 34.22 ? 395 HOH B O   1 
HETATM 4214 O O   . HOH D 2 .   ? 19.900 18.091  59.264 1.00 43.02 ? 396 HOH B O   1 
HETATM 4215 O O   . HOH D 2 .   ? 29.443 37.614  43.705 1.00 46.01 ? 397 HOH B O   1 
HETATM 4216 O O   . HOH D 2 .   ? 43.436 24.181  40.312 1.00 36.37 ? 398 HOH B O   1 
HETATM 4217 O O   . HOH D 2 .   ? 22.737 22.949  44.643 1.00 31.06 ? 399 HOH B O   1 
HETATM 4218 O O   . HOH D 2 .   ? 12.370 6.526   44.492 1.00 41.12 ? 400 HOH B O   1 
HETATM 4219 O O   . HOH D 2 .   ? 35.243 4.119   31.659 1.00 43.29 ? 401 HOH B O   1 
HETATM 4220 O O   . HOH D 2 .   ? 6.455  -15.125 61.434 1.00 46.48 ? 402 HOH B O   1 
HETATM 4221 O O   . HOH D 2 .   ? 16.463 -11.918 38.343 1.00 49.38 ? 403 HOH B O   1 
HETATM 4222 O O   . HOH D 2 .   ? 26.210 -0.386  31.618 1.00 47.45 ? 404 HOH B O   1 
HETATM 4223 O O   . HOH D 2 .   ? 33.193 32.645  57.373 1.00 49.19 ? 405 HOH B O   1 
HETATM 4224 O O   . HOH D 2 .   ? 20.013 16.637  44.151 1.00 41.81 ? 406 HOH B O   1 
HETATM 4225 O O   . HOH D 2 .   ? 35.286 -6.776  33.079 1.00 38.70 ? 407 HOH B O   1 
HETATM 4226 O O   . HOH D 2 .   ? 13.910 2.693   45.681 1.00 46.26 ? 408 HOH B O   1 
HETATM 4227 O O   . HOH D 2 .   ? 36.858 10.526  30.932 1.00 35.16 ? 409 HOH B O   1 
HETATM 4228 O O   . HOH D 2 .   ? 36.854 31.590  40.066 1.00 43.52 ? 410 HOH B O   1 
HETATM 4229 O O   . HOH D 2 .   ? 36.356 42.393  47.734 1.00 39.47 ? 411 HOH B O   1 
HETATM 4230 O O   . HOH D 2 .   ? 23.407 -2.118  23.810 1.00 46.49 ? 412 HOH B O   1 
HETATM 4231 O O   . HOH D 2 .   ? 19.022 -16.647 61.578 1.00 41.10 ? 413 HOH B O   1 
HETATM 4232 O O   . HOH D 2 .   ? 29.877 6.347   46.993 1.00 46.07 ? 414 HOH B O   1 
HETATM 4233 O O   . HOH D 2 .   ? 40.583 11.384  33.408 1.00 38.97 ? 415 HOH B O   1 
HETATM 4234 O O   . HOH D 2 .   ? 39.935 21.596  57.250 1.00 38.24 ? 416 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -11 ?   ?   ?   A . n 
A 1 2   GLY 2   -10 ?   ?   ?   A . n 
A 1 3   SER 3   -9  ?   ?   ?   A . n 
A 1 4   ASP 4   -8  ?   ?   ?   A . n 
A 1 5   LYS 5   -7  ?   ?   ?   A . n 
A 1 6   ILE 6   -6  ?   ?   ?   A . n 
A 1 7   HIS 7   -5  ?   ?   ?   A . n 
A 1 8   HIS 8   -4  ?   ?   ?   A . n 
A 1 9   HIS 9   -3  ?   ?   ?   A . n 
A 1 10  HIS 10  -2  ?   ?   ?   A . n 
A 1 11  HIS 11  -1  -2  HIS HIS A . n 
A 1 12  HIS 12  0   -1  HIS HIS A . n 
A 1 13  MET 13  1   1   MET MET A . n 
A 1 14  ASN 14  2   2   ASN ASN A . n 
A 1 15  GLU 15  3   3   GLU GLU A . n 
A 1 16  SER 16  4   4   SER SER A . n 
A 1 17  GLU 17  5   5   GLU GLU A . n 
A 1 18  ARG 18  6   6   ARG ARG A . n 
A 1 19  LYS 19  7   7   LYS LYS A . n 
A 1 20  ILE 20  8   8   ILE ILE A . n 
A 1 21  VAL 21  9   9   VAL VAL A . n 
A 1 22  GLU 22  10  10  GLU GLU A . n 
A 1 23  GLU 23  11  11  GLU GLU A . n 
A 1 24  PHE 24  12  12  PHE PHE A . n 
A 1 25  GLN 25  13  13  GLN GLN A . n 
A 1 26  LYS 26  14  14  LYS LYS A . n 
A 1 27  GLU 27  15  15  GLU GLU A . n 
A 1 28  THR 28  16  16  THR THR A . n 
A 1 29  GLY 29  17  17  GLY GLY A . n 
A 1 30  ILE 30  18  18  ILE ILE A . n 
A 1 31  ASN 31  19  19  ASN ASN A . n 
A 1 32  PHE 32  20  20  PHE PHE A . n 
A 1 33  LYS 33  21  21  LYS LYS A . n 
A 1 34  ASN 34  22  22  ASN ASN A . n 
A 1 35  GLU 35  23  23  GLU GLU A . n 
A 1 36  GLU 36  24  24  GLU GLU A . n 
A 1 37  LEU 37  25  25  LEU LEU A . n 
A 1 38  LEU 38  26  26  LEU LEU A . n 
A 1 39  PHE 39  27  27  PHE PHE A . n 
A 1 40  ARG 40  28  28  ARG ARG A . n 
A 1 41  ALA 41  29  29  ALA ALA A . n 
A 1 42  LEU 42  30  30  LEU LEU A . n 
A 1 43  CYS 43  31  31  CYS CYS A . n 
A 1 44  HIS 44  32  32  HIS HIS A . n 
A 1 45  SER 45  33  33  SER SER A . n 
A 1 46  SER 46  34  34  SER SER A . n 
A 1 47  TYR 47  35  35  TYR TYR A . n 
A 1 48  ALA 48  36  36  ALA ALA A . n 
A 1 49  ASN 49  37  37  ASN ASN A . n 
A 1 50  GLU 50  38  38  GLU GLU A . n 
A 1 51  GLN 51  39  39  GLN GLN A . n 
A 1 52  ASN 52  40  40  ASN ASN A . n 
A 1 53  GLN 53  41  41  GLN GLN A . n 
A 1 54  ALA 54  42  42  ALA ALA A . n 
A 1 55  GLY 55  43  43  GLY GLY A . n 
A 1 56  ARG 56  44  44  ARG ARG A . n 
A 1 57  LYS 57  45  45  LYS LYS A . n 
A 1 58  ASP 58  46  46  ASP ASP A . n 
A 1 59  VAL 59  47  47  VAL VAL A . n 
A 1 60  GLU 60  48  48  GLU GLU A . n 
A 1 61  SER 61  49  49  SER SER A . n 
A 1 62  ASN 62  50  50  ASN ASN A . n 
A 1 63  GLU 63  51  51  GLU GLU A . n 
A 1 64  LYS 64  52  52  LYS LYS A . n 
A 1 65  LEU 65  53  53  LEU LEU A . n 
A 1 66  GLU 66  54  54  GLU GLU A . n 
A 1 67  PHE 67  55  55  PHE PHE A . n 
A 1 68  LEU 68  56  56  LEU LEU A . n 
A 1 69  GLY 69  57  57  GLY GLY A . n 
A 1 70  ASP 70  58  58  ASP ASP A . n 
A 1 71  ALA 71  59  59  ALA ALA A . n 
A 1 72  VAL 72  60  60  VAL VAL A . n 
A 1 73  LEU 73  61  61  LEU LEU A . n 
A 1 74  GLU 74  62  62  GLU GLU A . n 
A 1 75  LEU 75  63  63  LEU LEU A . n 
A 1 76  PHE 76  64  64  PHE PHE A . n 
A 1 77  VAL 77  65  65  VAL VAL A . n 
A 1 78  CYS 78  66  66  CYS CYS A . n 
A 1 79  GLU 79  67  67  GLU GLU A . n 
A 1 80  ILE 80  68  68  ILE ILE A . n 
A 1 81  LEU 81  69  69  LEU LEU A . n 
A 1 82  TYR 82  70  70  TYR TYR A . n 
A 1 83  LYS 83  71  71  LYS LYS A . n 
A 1 84  LYS 84  72  72  LYS LYS A . n 
A 1 85  TYR 85  73  73  TYR TYR A . n 
A 1 86  PRO 86  74  74  PRO PRO A . n 
A 1 87  GLU 87  75  75  GLU GLU A . n 
A 1 88  ALA 88  76  76  ALA ALA A . n 
A 1 89  GLU 89  77  77  GLU GLU A . n 
A 1 90  VAL 90  78  78  VAL VAL A . n 
A 1 91  GLY 91  79  79  GLY GLY A . n 
A 1 92  ASP 92  80  80  ASP ASP A . n 
A 1 93  LEU 93  81  81  LEU LEU A . n 
A 1 94  ALA 94  82  82  ALA ALA A . n 
A 1 95  ARG 95  83  83  ARG ARG A . n 
A 1 96  VAL 96  84  84  VAL VAL A . n 
A 1 97  LYS 97  85  85  LYS LYS A . n 
A 1 98  SER 98  86  86  SER SER A . n 
A 1 99  ALA 99  87  87  ALA ALA A . n 
A 1 100 ALA 100 88  88  ALA ALA A . n 
A 1 101 ALA 101 89  89  ALA ALA A . n 
A 1 102 SER 102 90  90  SER SER A . n 
A 1 103 GLU 103 91  91  GLU GLU A . n 
A 1 104 GLU 104 92  92  GLU GLU A . n 
A 1 105 VAL 105 93  93  VAL VAL A . n 
A 1 106 LEU 106 94  94  LEU LEU A . n 
A 1 107 ALA 107 95  95  ALA ALA A . n 
A 1 108 MET 108 96  96  MET MET A . n 
A 1 109 VAL 109 97  97  VAL VAL A . n 
A 1 110 SER 110 98  98  SER SER A . n 
A 1 111 ARG 111 99  99  ARG ARG A . n 
A 1 112 LYS 112 100 100 LYS LYS A . n 
A 1 113 MET 113 101 101 MET MET A . n 
A 1 114 ASN 114 102 102 ASN ASN A . n 
A 1 115 LEU 115 103 103 LEU LEU A . n 
A 1 116 GLY 116 104 104 GLY GLY A . n 
A 1 117 LYS 117 105 105 LYS LYS A . n 
A 1 118 PHE 118 106 106 PHE PHE A . n 
A 1 119 LEU 119 107 107 LEU LEU A . n 
A 1 120 PHE 120 108 108 PHE PHE A . n 
A 1 121 LEU 121 109 109 LEU LEU A . n 
A 1 122 GLY 122 110 110 GLY GLY A . n 
A 1 123 LYS 123 111 111 LYS LYS A . n 
A 1 124 GLY 124 112 112 GLY GLY A . n 
A 1 125 GLU 125 113 113 GLU GLU A . n 
A 1 126 GLU 126 114 114 GLU GLU A . n 
A 1 127 LYS 127 115 115 LYS LYS A . n 
A 1 128 THR 128 116 116 THR THR A . n 
A 1 129 GLY 129 117 117 GLY GLY A . n 
A 1 130 GLY 130 118 118 GLY GLY A . n 
A 1 131 ARG 131 119 119 ARG ARG A . n 
A 1 132 ASP 132 120 120 ASP ASP A . n 
A 1 133 ARG 133 121 121 ARG ARG A . n 
A 1 134 ASP 134 122 122 ASP ASP A . n 
A 1 135 SER 135 123 123 SER SER A . n 
A 1 136 ILE 136 124 124 ILE ILE A . n 
A 1 137 LEU 137 125 125 LEU LEU A . n 
A 1 138 ALA 138 126 126 ALA ALA A . n 
A 1 139 ASP 139 127 127 ASP ASP A . n 
A 1 140 ALA 140 128 128 ALA ALA A . n 
A 1 141 PHE 141 129 129 PHE PHE A . n 
A 1 142 GLU 142 130 130 GLU GLU A . n 
A 1 143 ALA 143 131 131 ALA ALA A . n 
A 1 144 LEU 144 132 132 LEU LEU A . n 
A 1 145 LEU 145 133 133 LEU LEU A . n 
A 1 146 ALA 146 134 134 ALA ALA A . n 
A 1 147 ALA 147 135 135 ALA ALA A . n 
A 1 148 ILE 148 136 136 ILE ILE A . n 
A 1 149 TYR 149 137 137 TYR TYR A . n 
A 1 150 LEU 150 138 138 LEU LEU A . n 
A 1 151 ASP 151 139 139 ASP ASP A . n 
A 1 152 GLN 152 140 140 GLN GLN A . n 
A 1 153 GLY 153 141 141 GLY GLY A . n 
A 1 154 TYR 154 142 142 TYR TYR A . n 
A 1 155 GLU 155 143 143 GLU GLU A . n 
A 1 156 LYS 156 144 144 LYS LYS A . n 
A 1 157 ILE 157 145 145 ILE ILE A . n 
A 1 158 LYS 158 146 146 LYS LYS A . n 
A 1 159 GLU 159 147 147 GLU GLU A . n 
A 1 160 LEU 160 148 148 LEU LEU A . n 
A 1 161 PHE 161 149 149 PHE PHE A . n 
A 1 162 GLU 162 150 150 GLU GLU A . n 
A 1 163 GLN 163 151 151 GLN GLN A . n 
A 1 164 GLU 164 152 152 GLU GLU A . n 
A 1 165 PHE 165 153 153 PHE PHE A . n 
A 1 166 GLU 166 154 154 GLU GLU A . n 
A 1 167 PHE 167 155 155 PHE PHE A . n 
A 1 168 TYR 168 156 156 TYR TYR A . n 
A 1 169 ILE 169 157 157 ILE ILE A . n 
A 1 170 GLU 170 158 158 GLU GLU A . n 
A 1 171 LYS 171 159 159 LYS LYS A . n 
A 1 172 ILE 172 160 160 ILE ILE A . n 
A 1 173 MET 173 161 161 MET MET A . n 
A 1 174 LYS 174 162 162 LYS LYS A . n 
A 1 175 GLY 175 163 163 GLY GLY A . n 
A 1 176 GLU 176 164 164 GLU GLU A . n 
A 1 177 MET 177 165 165 MET MET A . n 
A 1 178 LEU 178 166 166 LEU LEU A . n 
A 1 179 PHE 179 167 167 PHE PHE A . n 
A 1 180 ASP 180 168 168 ASP ASP A . n 
A 1 181 TYR 181 169 169 TYR TYR A . n 
A 1 182 LYS 182 170 170 LYS LYS A . n 
A 1 183 THR 183 171 171 THR THR A . n 
A 1 184 ALA 184 172 172 ALA ALA A . n 
A 1 185 LEU 185 173 173 LEU LEU A . n 
A 1 186 GLN 186 174 174 GLN GLN A . n 
A 1 187 GLU 187 175 175 GLU GLU A . n 
A 1 188 ILE 188 176 176 ILE ILE A . n 
A 1 189 VAL 189 177 177 VAL VAL A . n 
A 1 190 GLN 190 178 178 GLN GLN A . n 
A 1 191 SER 191 179 179 SER SER A . n 
A 1 192 GLU 192 180 180 GLU GLU A . n 
A 1 193 HIS 193 181 181 HIS HIS A . n 
A 1 194 LYS 194 182 182 LYS LYS A . n 
A 1 195 VAL 195 183 183 VAL VAL A . n 
A 1 196 PRO 196 184 184 PRO PRO A . n 
A 1 197 PRO 197 185 185 PRO PRO A . n 
A 1 198 GLU 198 186 186 GLU GLU A . n 
A 1 199 TYR 199 187 187 TYR TYR A . n 
A 1 200 ILE 200 188 188 ILE ILE A . n 
A 1 201 LEU 201 189 189 LEU LEU A . n 
A 1 202 VAL 202 190 190 VAL VAL A . n 
A 1 203 ARG 203 191 191 ARG ARG A . n 
A 1 204 THR 204 192 192 THR THR A . n 
A 1 205 GLU 205 193 193 GLU GLU A . n 
A 1 206 LYS 206 194 194 LYS LYS A . n 
A 1 207 ASN 207 195 195 ASN ASN A . n 
A 1 208 ASP 208 196 196 ASP ASP A . n 
A 1 209 GLY 209 197 197 GLY GLY A . n 
A 1 210 ASP 210 198 198 ASP ASP A . n 
A 1 211 ARG 211 199 199 ARG ARG A . n 
A 1 212 ILE 212 200 200 ILE ILE A . n 
A 1 213 PHE 213 201 201 PHE PHE A . n 
A 1 214 VAL 214 202 202 VAL VAL A . n 
A 1 215 VAL 215 203 203 VAL VAL A . n 
A 1 216 GLU 216 204 204 GLU GLU A . n 
A 1 217 VAL 217 205 205 VAL VAL A . n 
A 1 218 ARG 218 206 206 ARG ARG A . n 
A 1 219 VAL 219 207 207 VAL VAL A . n 
A 1 220 ASN 220 208 208 ASN ASN A . n 
A 1 221 GLY 221 209 209 GLY GLY A . n 
A 1 222 LYS 222 210 210 LYS LYS A . n 
A 1 223 THR 223 211 211 THR THR A . n 
A 1 224 ILE 224 212 212 ILE ILE A . n 
A 1 225 ALA 225 213 213 ALA ALA A . n 
A 1 226 THR 226 214 214 THR THR A . n 
A 1 227 GLY 227 215 215 GLY GLY A . n 
A 1 228 LYS 228 216 216 LYS LYS A . n 
A 1 229 GLY 229 217 217 GLY GLY A . n 
A 1 230 ARG 230 218 218 ARG ARG A . n 
A 1 231 THR 231 219 219 THR THR A . n 
A 1 232 LYS 232 220 220 LYS LYS A . n 
A 1 233 LYS 233 221 221 LYS LYS A . n 
A 1 234 GLU 234 222 222 GLU GLU A . n 
A 1 235 ALA 235 223 223 ALA ALA A . n 
A 1 236 GLU 236 224 224 GLU GLU A . n 
A 1 237 LYS 237 225 225 LYS LYS A . n 
A 1 238 GLU 238 226 226 GLU GLU A . n 
A 1 239 ALA 239 227 227 ALA ALA A . n 
A 1 240 ALA 240 228 228 ALA ALA A . n 
A 1 241 ARG 241 229 229 ARG ARG A . n 
A 1 242 ILE 242 230 230 ILE ILE A . n 
A 1 243 ALA 243 231 231 ALA ALA A . n 
A 1 244 TYR 244 232 232 TYR TYR A . n 
A 1 245 GLU 245 233 233 GLU GLU A . n 
A 1 246 LYS 246 234 234 LYS LYS A . n 
A 1 247 LEU 247 235 235 LEU LEU A . n 
A 1 248 LEU 248 236 236 LEU LEU A . n 
A 1 249 LYS 249 237 ?   ?   ?   A . n 
A 1 250 GLU 250 238 ?   ?   ?   A . n 
A 1 251 ARG 251 239 ?   ?   ?   A . n 
A 1 252 SER 252 240 ?   ?   ?   A . n 
B 1 1   MET 1   -11 ?   ?   ?   B . n 
B 1 2   GLY 2   -10 ?   ?   ?   B . n 
B 1 3   SER 3   -9  ?   ?   ?   B . n 
B 1 4   ASP 4   -8  ?   ?   ?   B . n 
B 1 5   LYS 5   -7  ?   ?   ?   B . n 
B 1 6   ILE 6   -6  ?   ?   ?   B . n 
B 1 7   HIS 7   -5  ?   ?   ?   B . n 
B 1 8   HIS 8   -4  ?   ?   ?   B . n 
B 1 9   HIS 9   -3  ?   ?   ?   B . n 
B 1 10  HIS 10  -2  ?   ?   ?   B . n 
B 1 11  HIS 11  -1  -2  HIS HIS B . n 
B 1 12  HIS 12  0   0   HIS HIS B . n 
B 1 13  MET 13  1   1   MET MET B . n 
B 1 14  ASN 14  2   2   ASN ASN B . n 
B 1 15  GLU 15  3   3   GLU GLU B . n 
B 1 16  SER 16  4   4   SER SER B . n 
B 1 17  GLU 17  5   5   GLU GLU B . n 
B 1 18  ARG 18  6   6   ARG ARG B . n 
B 1 19  LYS 19  7   7   LYS LYS B . n 
B 1 20  ILE 20  8   8   ILE ILE B . n 
B 1 21  VAL 21  9   9   VAL VAL B . n 
B 1 22  GLU 22  10  10  GLU GLU B . n 
B 1 23  GLU 23  11  11  GLU GLU B . n 
B 1 24  PHE 24  12  12  PHE PHE B . n 
B 1 25  GLN 25  13  13  GLN GLN B . n 
B 1 26  LYS 26  14  14  LYS LYS B . n 
B 1 27  GLU 27  15  15  GLU GLU B . n 
B 1 28  THR 28  16  16  THR THR B . n 
B 1 29  GLY 29  17  17  GLY GLY B . n 
B 1 30  ILE 30  18  18  ILE ILE B . n 
B 1 31  ASN 31  19  19  ASN ASN B . n 
B 1 32  PHE 32  20  20  PHE PHE B . n 
B 1 33  LYS 33  21  21  LYS LYS B . n 
B 1 34  ASN 34  22  22  ASN ASN B . n 
B 1 35  GLU 35  23  23  GLU GLU B . n 
B 1 36  GLU 36  24  24  GLU GLU B . n 
B 1 37  LEU 37  25  25  LEU LEU B . n 
B 1 38  LEU 38  26  26  LEU LEU B . n 
B 1 39  PHE 39  27  27  PHE PHE B . n 
B 1 40  ARG 40  28  28  ARG ARG B . n 
B 1 41  ALA 41  29  29  ALA ALA B . n 
B 1 42  LEU 42  30  30  LEU LEU B . n 
B 1 43  CYS 43  31  31  CYS CYS B . n 
B 1 44  HIS 44  32  32  HIS HIS B . n 
B 1 45  SER 45  33  33  SER SER B . n 
B 1 46  SER 46  34  34  SER SER B . n 
B 1 47  TYR 47  35  35  TYR TYR B . n 
B 1 48  ALA 48  36  36  ALA ALA B . n 
B 1 49  ASN 49  37  37  ASN ASN B . n 
B 1 50  GLU 50  38  38  GLU GLU B . n 
B 1 51  GLN 51  39  39  GLN GLN B . n 
B 1 52  ASN 52  40  40  ASN ASN B . n 
B 1 53  GLN 53  41  41  GLN GLN B . n 
B 1 54  ALA 54  42  42  ALA ALA B . n 
B 1 55  GLY 55  43  43  GLY GLY B . n 
B 1 56  ARG 56  44  44  ARG ARG B . n 
B 1 57  LYS 57  45  45  LYS LYS B . n 
B 1 58  ASP 58  46  46  ASP ASP B . n 
B 1 59  VAL 59  47  47  VAL VAL B . n 
B 1 60  GLU 60  48  48  GLU GLU B . n 
B 1 61  SER 61  49  49  SER SER B . n 
B 1 62  ASN 62  50  50  ASN ASN B . n 
B 1 63  GLU 63  51  51  GLU GLU B . n 
B 1 64  LYS 64  52  52  LYS LYS B . n 
B 1 65  LEU 65  53  53  LEU LEU B . n 
B 1 66  GLU 66  54  54  GLU GLU B . n 
B 1 67  PHE 67  55  55  PHE PHE B . n 
B 1 68  LEU 68  56  56  LEU LEU B . n 
B 1 69  GLY 69  57  57  GLY GLY B . n 
B 1 70  ASP 70  58  58  ASP ASP B . n 
B 1 71  ALA 71  59  59  ALA ALA B . n 
B 1 72  VAL 72  60  60  VAL VAL B . n 
B 1 73  LEU 73  61  61  LEU LEU B . n 
B 1 74  GLU 74  62  62  GLU GLU B . n 
B 1 75  LEU 75  63  63  LEU LEU B . n 
B 1 76  PHE 76  64  64  PHE PHE B . n 
B 1 77  VAL 77  65  65  VAL VAL B . n 
B 1 78  CYS 78  66  66  CYS CYS B . n 
B 1 79  GLU 79  67  67  GLU GLU B . n 
B 1 80  ILE 80  68  68  ILE ILE B . n 
B 1 81  LEU 81  69  69  LEU LEU B . n 
B 1 82  TYR 82  70  70  TYR TYR B . n 
B 1 83  LYS 83  71  71  LYS LYS B . n 
B 1 84  LYS 84  72  72  LYS LYS B . n 
B 1 85  TYR 85  73  73  TYR TYR B . n 
B 1 86  PRO 86  74  74  PRO PRO B . n 
B 1 87  GLU 87  75  75  GLU GLU B . n 
B 1 88  ALA 88  76  76  ALA ALA B . n 
B 1 89  GLU 89  77  77  GLU GLU B . n 
B 1 90  VAL 90  78  78  VAL VAL B . n 
B 1 91  GLY 91  79  79  GLY GLY B . n 
B 1 92  ASP 92  80  80  ASP ASP B . n 
B 1 93  LEU 93  81  81  LEU LEU B . n 
B 1 94  ALA 94  82  82  ALA ALA B . n 
B 1 95  ARG 95  83  83  ARG ARG B . n 
B 1 96  VAL 96  84  84  VAL VAL B . n 
B 1 97  LYS 97  85  85  LYS LYS B . n 
B 1 98  SER 98  86  86  SER SER B . n 
B 1 99  ALA 99  87  87  ALA ALA B . n 
B 1 100 ALA 100 88  88  ALA ALA B . n 
B 1 101 ALA 101 89  89  ALA ALA B . n 
B 1 102 SER 102 90  90  SER SER B . n 
B 1 103 GLU 103 91  91  GLU GLU B . n 
B 1 104 GLU 104 92  92  GLU GLU B . n 
B 1 105 VAL 105 93  93  VAL VAL B . n 
B 1 106 LEU 106 94  94  LEU LEU B . n 
B 1 107 ALA 107 95  95  ALA ALA B . n 
B 1 108 MET 108 96  96  MET MET B . n 
B 1 109 VAL 109 97  97  VAL VAL B . n 
B 1 110 SER 110 98  98  SER SER B . n 
B 1 111 ARG 111 99  99  ARG ARG B . n 
B 1 112 LYS 112 100 100 LYS LYS B . n 
B 1 113 MET 113 101 101 MET MET B . n 
B 1 114 ASN 114 102 102 ASN ASN B . n 
B 1 115 LEU 115 103 103 LEU LEU B . n 
B 1 116 GLY 116 104 104 GLY GLY B . n 
B 1 117 LYS 117 105 105 LYS LYS B . n 
B 1 118 PHE 118 106 106 PHE PHE B . n 
B 1 119 LEU 119 107 107 LEU LEU B . n 
B 1 120 PHE 120 108 108 PHE PHE B . n 
B 1 121 LEU 121 109 109 LEU LEU B . n 
B 1 122 GLY 122 110 110 GLY GLY B . n 
B 1 123 LYS 123 111 111 LYS LYS B . n 
B 1 124 GLY 124 112 112 GLY GLY B . n 
B 1 125 GLU 125 113 113 GLU GLU B . n 
B 1 126 GLU 126 114 114 GLU GLU B . n 
B 1 127 LYS 127 115 115 LYS LYS B . n 
B 1 128 THR 128 116 116 THR THR B . n 
B 1 129 GLY 129 117 117 GLY GLY B . n 
B 1 130 GLY 130 118 118 GLY GLY B . n 
B 1 131 ARG 131 119 119 ARG ARG B . n 
B 1 132 ASP 132 120 120 ASP ASP B . n 
B 1 133 ARG 133 121 121 ARG ARG B . n 
B 1 134 ASP 134 122 122 ASP ASP B . n 
B 1 135 SER 135 123 123 SER SER B . n 
B 1 136 ILE 136 124 124 ILE ILE B . n 
B 1 137 LEU 137 125 125 LEU LEU B . n 
B 1 138 ALA 138 126 126 ALA ALA B . n 
B 1 139 ASP 139 127 127 ASP ASP B . n 
B 1 140 ALA 140 128 128 ALA ALA B . n 
B 1 141 PHE 141 129 129 PHE PHE B . n 
B 1 142 GLU 142 130 130 GLU GLU B . n 
B 1 143 ALA 143 131 131 ALA ALA B . n 
B 1 144 LEU 144 132 132 LEU LEU B . n 
B 1 145 LEU 145 133 133 LEU LEU B . n 
B 1 146 ALA 146 134 134 ALA ALA B . n 
B 1 147 ALA 147 135 135 ALA ALA B . n 
B 1 148 ILE 148 136 136 ILE ILE B . n 
B 1 149 TYR 149 137 137 TYR TYR B . n 
B 1 150 LEU 150 138 138 LEU LEU B . n 
B 1 151 ASP 151 139 139 ASP ASP B . n 
B 1 152 GLN 152 140 140 GLN GLN B . n 
B 1 153 GLY 153 141 141 GLY GLY B . n 
B 1 154 TYR 154 142 142 TYR TYR B . n 
B 1 155 GLU 155 143 143 GLU GLU B . n 
B 1 156 LYS 156 144 144 LYS LYS B . n 
B 1 157 ILE 157 145 145 ILE ILE B . n 
B 1 158 LYS 158 146 146 LYS LYS B . n 
B 1 159 GLU 159 147 147 GLU GLU B . n 
B 1 160 LEU 160 148 148 LEU LEU B . n 
B 1 161 PHE 161 149 149 PHE PHE B . n 
B 1 162 GLU 162 150 150 GLU GLU B . n 
B 1 163 GLN 163 151 151 GLN GLN B . n 
B 1 164 GLU 164 152 152 GLU GLU B . n 
B 1 165 PHE 165 153 153 PHE PHE B . n 
B 1 166 GLU 166 154 154 GLU GLU B . n 
B 1 167 PHE 167 155 155 PHE PHE B . n 
B 1 168 TYR 168 156 156 TYR TYR B . n 
B 1 169 ILE 169 157 157 ILE ILE B . n 
B 1 170 GLU 170 158 158 GLU GLU B . n 
B 1 171 LYS 171 159 159 LYS LYS B . n 
B 1 172 ILE 172 160 160 ILE ILE B . n 
B 1 173 MET 173 161 161 MET MET B . n 
B 1 174 LYS 174 162 162 LYS LYS B . n 
B 1 175 GLY 175 163 163 GLY GLY B . n 
B 1 176 GLU 176 164 164 GLU GLU B . n 
B 1 177 MET 177 165 165 MET MET B . n 
B 1 178 LEU 178 166 166 LEU LEU B . n 
B 1 179 PHE 179 167 167 PHE PHE B . n 
B 1 180 ASP 180 168 168 ASP ASP B . n 
B 1 181 TYR 181 169 169 TYR TYR B . n 
B 1 182 LYS 182 170 170 LYS LYS B . n 
B 1 183 THR 183 171 171 THR THR B . n 
B 1 184 ALA 184 172 172 ALA ALA B . n 
B 1 185 LEU 185 173 173 LEU LEU B . n 
B 1 186 GLN 186 174 174 GLN GLN B . n 
B 1 187 GLU 187 175 175 GLU GLU B . n 
B 1 188 ILE 188 176 176 ILE ILE B . n 
B 1 189 VAL 189 177 177 VAL VAL B . n 
B 1 190 GLN 190 178 178 GLN GLN B . n 
B 1 191 SER 191 179 179 SER SER B . n 
B 1 192 GLU 192 180 180 GLU GLU B . n 
B 1 193 HIS 193 181 181 HIS HIS B . n 
B 1 194 LYS 194 182 182 LYS LYS B . n 
B 1 195 VAL 195 183 183 VAL VAL B . n 
B 1 196 PRO 196 184 184 PRO PRO B . n 
B 1 197 PRO 197 185 185 PRO PRO B . n 
B 1 198 GLU 198 186 186 GLU GLU B . n 
B 1 199 TYR 199 187 187 TYR TYR B . n 
B 1 200 ILE 200 188 188 ILE ILE B . n 
B 1 201 LEU 201 189 189 LEU LEU B . n 
B 1 202 VAL 202 190 190 VAL VAL B . n 
B 1 203 ARG 203 191 191 ARG ARG B . n 
B 1 204 THR 204 192 192 THR THR B . n 
B 1 205 GLU 205 193 193 GLU GLU B . n 
B 1 206 LYS 206 194 194 LYS LYS B . n 
B 1 207 ASN 207 195 195 ASN ASN B . n 
B 1 208 ASP 208 196 196 ASP ASP B . n 
B 1 209 GLY 209 197 197 GLY GLY B . n 
B 1 210 ASP 210 198 198 ASP ASP B . n 
B 1 211 ARG 211 199 199 ARG ARG B . n 
B 1 212 ILE 212 200 200 ILE ILE B . n 
B 1 213 PHE 213 201 201 PHE PHE B . n 
B 1 214 VAL 214 202 202 VAL VAL B . n 
B 1 215 VAL 215 203 203 VAL VAL B . n 
B 1 216 GLU 216 204 204 GLU GLU B . n 
B 1 217 VAL 217 205 205 VAL VAL B . n 
B 1 218 ARG 218 206 206 ARG ARG B . n 
B 1 219 VAL 219 207 207 VAL VAL B . n 
B 1 220 ASN 220 208 208 ASN ASN B . n 
B 1 221 GLY 221 209 209 GLY GLY B . n 
B 1 222 LYS 222 210 210 LYS LYS B . n 
B 1 223 THR 223 211 211 THR THR B . n 
B 1 224 ILE 224 212 212 ILE ILE B . n 
B 1 225 ALA 225 213 213 ALA ALA B . n 
B 1 226 THR 226 214 214 THR THR B . n 
B 1 227 GLY 227 215 215 GLY GLY B . n 
B 1 228 LYS 228 216 216 LYS LYS B . n 
B 1 229 GLY 229 217 217 GLY GLY B . n 
B 1 230 ARG 230 218 218 ARG ARG B . n 
B 1 231 THR 231 219 219 THR THR B . n 
B 1 232 LYS 232 220 220 LYS LYS B . n 
B 1 233 LYS 233 221 221 LYS LYS B . n 
B 1 234 GLU 234 222 222 GLU GLU B . n 
B 1 235 ALA 235 223 223 ALA ALA B . n 
B 1 236 GLU 236 224 224 GLU GLU B . n 
B 1 237 LYS 237 225 225 LYS LYS B . n 
B 1 238 GLU 238 226 226 GLU GLU B . n 
B 1 239 ALA 239 227 227 ALA ALA B . n 
B 1 240 ALA 240 228 228 ALA ALA B . n 
B 1 241 ARG 241 229 229 ARG ARG B . n 
B 1 242 ILE 242 230 230 ILE ILE B . n 
B 1 243 ALA 243 231 231 ALA ALA B . n 
B 1 244 TYR 244 232 232 TYR TYR B . n 
B 1 245 GLU 245 233 233 GLU GLU B . n 
B 1 246 LYS 246 234 234 LYS LYS B . n 
B 1 247 LEU 247 235 235 LEU LEU B . n 
B 1 248 LEU 248 236 236 LEU LEU B . n 
B 1 249 LYS 249 237 237 LYS LYS B . n 
B 1 250 GLU 250 238 ?   ?   ?   B . n 
B 1 251 ARG 251 239 ?   ?   ?   B . n 
B 1 252 SER 252 240 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Joint Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     JCSG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   241 2   HOH HOH A . 
C 2 HOH 2   242 4   HOH HOH A . 
C 2 HOH 3   243 7   HOH HOH A . 
C 2 HOH 4   244 9   HOH HOH A . 
C 2 HOH 5   245 10  HOH HOH A . 
C 2 HOH 6   246 12  HOH HOH A . 
C 2 HOH 7   247 13  HOH HOH A . 
C 2 HOH 8   248 14  HOH HOH A . 
C 2 HOH 9   249 15  HOH HOH A . 
C 2 HOH 10  250 16  HOH HOH A . 
C 2 HOH 11  251 17  HOH HOH A . 
C 2 HOH 12  252 19  HOH HOH A . 
C 2 HOH 13  253 20  HOH HOH A . 
C 2 HOH 14  254 21  HOH HOH A . 
C 2 HOH 15  255 27  HOH HOH A . 
C 2 HOH 16  256 30  HOH HOH A . 
C 2 HOH 17  257 31  HOH HOH A . 
C 2 HOH 18  258 33  HOH HOH A . 
C 2 HOH 19  259 35  HOH HOH A . 
C 2 HOH 20  260 36  HOH HOH A . 
C 2 HOH 21  261 39  HOH HOH A . 
C 2 HOH 22  262 40  HOH HOH A . 
C 2 HOH 23  263 43  HOH HOH A . 
C 2 HOH 24  264 44  HOH HOH A . 
C 2 HOH 25  265 45  HOH HOH A . 
C 2 HOH 26  266 46  HOH HOH A . 
C 2 HOH 27  267 48  HOH HOH A . 
C 2 HOH 28  268 50  HOH HOH A . 
C 2 HOH 29  269 51  HOH HOH A . 
C 2 HOH 30  270 53  HOH HOH A . 
C 2 HOH 31  271 54  HOH HOH A . 
C 2 HOH 32  272 57  HOH HOH A . 
C 2 HOH 33  273 58  HOH HOH A . 
C 2 HOH 34  274 68  HOH HOH A . 
C 2 HOH 35  275 73  HOH HOH A . 
C 2 HOH 36  276 74  HOH HOH A . 
C 2 HOH 37  277 76  HOH HOH A . 
C 2 HOH 38  278 77  HOH HOH A . 
C 2 HOH 39  279 79  HOH HOH A . 
C 2 HOH 40  280 80  HOH HOH A . 
C 2 HOH 41  281 84  HOH HOH A . 
C 2 HOH 42  282 85  HOH HOH A . 
C 2 HOH 43  283 86  HOH HOH A . 
C 2 HOH 44  284 87  HOH HOH A . 
C 2 HOH 45  285 88  HOH HOH A . 
C 2 HOH 46  286 89  HOH HOH A . 
C 2 HOH 47  287 90  HOH HOH A . 
C 2 HOH 48  288 91  HOH HOH A . 
C 2 HOH 49  289 92  HOH HOH A . 
C 2 HOH 50  290 93  HOH HOH A . 
C 2 HOH 51  291 96  HOH HOH A . 
C 2 HOH 52  292 97  HOH HOH A . 
C 2 HOH 53  293 98  HOH HOH A . 
C 2 HOH 54  294 100 HOH HOH A . 
C 2 HOH 55  295 101 HOH HOH A . 
C 2 HOH 56  296 105 HOH HOH A . 
C 2 HOH 57  297 106 HOH HOH A . 
C 2 HOH 58  298 107 HOH HOH A . 
C 2 HOH 59  299 108 HOH HOH A . 
C 2 HOH 60  300 109 HOH HOH A . 
C 2 HOH 61  301 112 HOH HOH A . 
C 2 HOH 62  302 113 HOH HOH A . 
C 2 HOH 63  303 114 HOH HOH A . 
C 2 HOH 64  304 115 HOH HOH A . 
C 2 HOH 65  305 116 HOH HOH A . 
C 2 HOH 66  306 117 HOH HOH A . 
C 2 HOH 67  307 118 HOH HOH A . 
C 2 HOH 68  308 119 HOH HOH A . 
C 2 HOH 69  309 120 HOH HOH A . 
C 2 HOH 70  310 122 HOH HOH A . 
C 2 HOH 71  311 125 HOH HOH A . 
C 2 HOH 72  312 127 HOH HOH A . 
C 2 HOH 73  313 129 HOH HOH A . 
C 2 HOH 74  314 130 HOH HOH A . 
C 2 HOH 75  315 132 HOH HOH A . 
C 2 HOH 76  316 135 HOH HOH A . 
C 2 HOH 77  317 136 HOH HOH A . 
C 2 HOH 78  318 137 HOH HOH A . 
C 2 HOH 79  319 139 HOH HOH A . 
C 2 HOH 80  320 143 HOH HOH A . 
C 2 HOH 81  321 144 HOH HOH A . 
C 2 HOH 82  322 146 HOH HOH A . 
C 2 HOH 83  323 149 HOH HOH A . 
C 2 HOH 84  324 150 HOH HOH A . 
C 2 HOH 85  325 151 HOH HOH A . 
C 2 HOH 86  326 153 HOH HOH A . 
C 2 HOH 87  327 154 HOH HOH A . 
C 2 HOH 88  328 159 HOH HOH A . 
C 2 HOH 89  329 160 HOH HOH A . 
C 2 HOH 90  330 168 HOH HOH A . 
C 2 HOH 91  331 169 HOH HOH A . 
C 2 HOH 92  332 170 HOH HOH A . 
C 2 HOH 93  333 172 HOH HOH A . 
C 2 HOH 94  334 173 HOH HOH A . 
C 2 HOH 95  335 174 HOH HOH A . 
C 2 HOH 96  336 175 HOH HOH A . 
C 2 HOH 97  337 176 HOH HOH A . 
C 2 HOH 98  338 178 HOH HOH A . 
C 2 HOH 99  339 179 HOH HOH A . 
C 2 HOH 100 340 181 HOH HOH A . 
C 2 HOH 101 341 183 HOH HOH A . 
C 2 HOH 102 342 189 HOH HOH A . 
C 2 HOH 103 343 191 HOH HOH A . 
C 2 HOH 104 344 195 HOH HOH A . 
C 2 HOH 105 345 196 HOH HOH A . 
C 2 HOH 106 346 197 HOH HOH A . 
C 2 HOH 107 347 198 HOH HOH A . 
C 2 HOH 108 348 200 HOH HOH A . 
C 2 HOH 109 349 202 HOH HOH A . 
C 2 HOH 110 350 203 HOH HOH A . 
C 2 HOH 111 351 204 HOH HOH A . 
C 2 HOH 112 352 206 HOH HOH A . 
C 2 HOH 113 353 208 HOH HOH A . 
C 2 HOH 114 354 211 HOH HOH A . 
C 2 HOH 115 355 212 HOH HOH A . 
C 2 HOH 116 356 214 HOH HOH A . 
C 2 HOH 117 357 215 HOH HOH A . 
C 2 HOH 118 358 216 HOH HOH A . 
C 2 HOH 119 359 217 HOH HOH A . 
C 2 HOH 120 360 218 HOH HOH A . 
C 2 HOH 121 361 219 HOH HOH A . 
C 2 HOH 122 362 220 HOH HOH A . 
C 2 HOH 123 363 221 HOH HOH A . 
C 2 HOH 124 364 222 HOH HOH A . 
C 2 HOH 125 365 223 HOH HOH A . 
C 2 HOH 126 366 226 HOH HOH A . 
C 2 HOH 127 367 227 HOH HOH A . 
C 2 HOH 128 368 228 HOH HOH A . 
C 2 HOH 129 369 229 HOH HOH A . 
C 2 HOH 130 370 230 HOH HOH A . 
C 2 HOH 131 371 235 HOH HOH A . 
C 2 HOH 132 372 237 HOH HOH A . 
C 2 HOH 133 373 238 HOH HOH A . 
C 2 HOH 134 374 244 HOH HOH A . 
C 2 HOH 135 375 247 HOH HOH A . 
C 2 HOH 136 376 248 HOH HOH A . 
C 2 HOH 137 377 250 HOH HOH A . 
C 2 HOH 138 378 251 HOH HOH A . 
C 2 HOH 139 379 252 HOH HOH A . 
C 2 HOH 140 380 253 HOH HOH A . 
C 2 HOH 141 381 256 HOH HOH A . 
C 2 HOH 142 382 258 HOH HOH A . 
C 2 HOH 143 383 259 HOH HOH A . 
C 2 HOH 144 384 261 HOH HOH A . 
C 2 HOH 145 385 264 HOH HOH A . 
C 2 HOH 146 386 266 HOH HOH A . 
C 2 HOH 147 387 270 HOH HOH A . 
C 2 HOH 148 388 273 HOH HOH A . 
C 2 HOH 149 389 275 HOH HOH A . 
C 2 HOH 150 390 276 HOH HOH A . 
C 2 HOH 151 391 279 HOH HOH A . 
C 2 HOH 152 392 282 HOH HOH A . 
C 2 HOH 153 393 285 HOH HOH A . 
C 2 HOH 154 394 287 HOH HOH A . 
C 2 HOH 155 395 289 HOH HOH A . 
C 2 HOH 156 396 292 HOH HOH A . 
C 2 HOH 157 397 293 HOH HOH A . 
C 2 HOH 158 398 294 HOH HOH A . 
C 2 HOH 159 399 295 HOH HOH A . 
C 2 HOH 160 400 299 HOH HOH A . 
C 2 HOH 161 401 300 HOH HOH A . 
C 2 HOH 162 402 302 HOH HOH A . 
C 2 HOH 163 403 304 HOH HOH A . 
C 2 HOH 164 404 306 HOH HOH A . 
C 2 HOH 165 405 310 HOH HOH A . 
C 2 HOH 166 406 311 HOH HOH A . 
C 2 HOH 167 407 315 HOH HOH A . 
C 2 HOH 168 408 316 HOH HOH A . 
C 2 HOH 169 409 317 HOH HOH A . 
C 2 HOH 170 410 320 HOH HOH A . 
C 2 HOH 171 411 323 HOH HOH A . 
C 2 HOH 172 412 325 HOH HOH A . 
C 2 HOH 173 413 327 HOH HOH A . 
C 2 HOH 174 414 328 HOH HOH A . 
C 2 HOH 175 415 330 HOH HOH A . 
C 2 HOH 176 416 331 HOH HOH A . 
C 2 HOH 177 417 333 HOH HOH A . 
C 2 HOH 178 418 335 HOH HOH A . 
C 2 HOH 179 419 336 HOH HOH A . 
C 2 HOH 180 420 339 HOH HOH A . 
C 2 HOH 181 421 342 HOH HOH A . 
C 2 HOH 182 422 343 HOH HOH A . 
C 2 HOH 183 423 344 HOH HOH A . 
C 2 HOH 184 424 345 HOH HOH A . 
C 2 HOH 185 425 348 HOH HOH A . 
C 2 HOH 186 426 353 HOH HOH A . 
C 2 HOH 187 427 356 HOH HOH A . 
C 2 HOH 188 428 360 HOH HOH A . 
C 2 HOH 189 429 361 HOH HOH A . 
C 2 HOH 190 430 364 HOH HOH A . 
C 2 HOH 191 431 365 HOH HOH A . 
C 2 HOH 192 432 368 HOH HOH A . 
C 2 HOH 193 433 369 HOH HOH A . 
C 2 HOH 194 434 370 HOH HOH A . 
C 2 HOH 195 435 371 HOH HOH A . 
C 2 HOH 196 436 372 HOH HOH A . 
C 2 HOH 197 437 375 HOH HOH A . 
C 2 HOH 198 438 376 HOH HOH A . 
C 2 HOH 199 439 377 HOH HOH A . 
C 2 HOH 200 440 380 HOH HOH A . 
C 2 HOH 201 441 381 HOH HOH A . 
C 2 HOH 202 442 382 HOH HOH A . 
C 2 HOH 203 443 385 HOH HOH A . 
C 2 HOH 204 444 386 HOH HOH A . 
C 2 HOH 205 445 388 HOH HOH A . 
C 2 HOH 206 446 390 HOH HOH A . 
C 2 HOH 207 447 393 HOH HOH A . 
D 2 HOH 1   241 1   HOH HOH B . 
D 2 HOH 2   242 3   HOH HOH B . 
D 2 HOH 3   243 5   HOH HOH B . 
D 2 HOH 4   244 6   HOH HOH B . 
D 2 HOH 5   245 8   HOH HOH B . 
D 2 HOH 6   246 11  HOH HOH B . 
D 2 HOH 7   247 18  HOH HOH B . 
D 2 HOH 8   248 22  HOH HOH B . 
D 2 HOH 9   249 23  HOH HOH B . 
D 2 HOH 10  250 24  HOH HOH B . 
D 2 HOH 11  251 25  HOH HOH B . 
D 2 HOH 12  252 26  HOH HOH B . 
D 2 HOH 13  253 28  HOH HOH B . 
D 2 HOH 14  254 29  HOH HOH B . 
D 2 HOH 15  255 32  HOH HOH B . 
D 2 HOH 16  256 34  HOH HOH B . 
D 2 HOH 17  257 37  HOH HOH B . 
D 2 HOH 18  258 38  HOH HOH B . 
D 2 HOH 19  259 41  HOH HOH B . 
D 2 HOH 20  260 47  HOH HOH B . 
D 2 HOH 21  261 49  HOH HOH B . 
D 2 HOH 22  262 52  HOH HOH B . 
D 2 HOH 23  263 55  HOH HOH B . 
D 2 HOH 24  264 56  HOH HOH B . 
D 2 HOH 25  265 59  HOH HOH B . 
D 2 HOH 26  266 60  HOH HOH B . 
D 2 HOH 27  267 61  HOH HOH B . 
D 2 HOH 28  268 62  HOH HOH B . 
D 2 HOH 29  269 63  HOH HOH B . 
D 2 HOH 30  270 64  HOH HOH B . 
D 2 HOH 31  271 65  HOH HOH B . 
D 2 HOH 32  272 66  HOH HOH B . 
D 2 HOH 33  273 67  HOH HOH B . 
D 2 HOH 34  274 69  HOH HOH B . 
D 2 HOH 35  275 70  HOH HOH B . 
D 2 HOH 36  276 71  HOH HOH B . 
D 2 HOH 37  277 72  HOH HOH B . 
D 2 HOH 38  278 75  HOH HOH B . 
D 2 HOH 39  279 78  HOH HOH B . 
D 2 HOH 40  280 81  HOH HOH B . 
D 2 HOH 41  281 82  HOH HOH B . 
D 2 HOH 42  282 83  HOH HOH B . 
D 2 HOH 43  283 94  HOH HOH B . 
D 2 HOH 44  284 95  HOH HOH B . 
D 2 HOH 45  285 99  HOH HOH B . 
D 2 HOH 46  286 102 HOH HOH B . 
D 2 HOH 47  287 103 HOH HOH B . 
D 2 HOH 48  288 104 HOH HOH B . 
D 2 HOH 49  289 110 HOH HOH B . 
D 2 HOH 50  290 111 HOH HOH B . 
D 2 HOH 51  291 121 HOH HOH B . 
D 2 HOH 52  292 123 HOH HOH B . 
D 2 HOH 53  293 124 HOH HOH B . 
D 2 HOH 54  294 126 HOH HOH B . 
D 2 HOH 55  295 128 HOH HOH B . 
D 2 HOH 56  296 131 HOH HOH B . 
D 2 HOH 57  297 134 HOH HOH B . 
D 2 HOH 58  298 138 HOH HOH B . 
D 2 HOH 59  299 141 HOH HOH B . 
D 2 HOH 60  300 142 HOH HOH B . 
D 2 HOH 61  301 147 HOH HOH B . 
D 2 HOH 62  302 148 HOH HOH B . 
D 2 HOH 63  303 156 HOH HOH B . 
D 2 HOH 64  304 157 HOH HOH B . 
D 2 HOH 65  305 158 HOH HOH B . 
D 2 HOH 66  306 161 HOH HOH B . 
D 2 HOH 67  307 162 HOH HOH B . 
D 2 HOH 68  308 163 HOH HOH B . 
D 2 HOH 69  309 164 HOH HOH B . 
D 2 HOH 70  310 165 HOH HOH B . 
D 2 HOH 71  311 166 HOH HOH B . 
D 2 HOH 72  312 167 HOH HOH B . 
D 2 HOH 73  313 171 HOH HOH B . 
D 2 HOH 74  314 177 HOH HOH B . 
D 2 HOH 75  315 180 HOH HOH B . 
D 2 HOH 76  316 182 HOH HOH B . 
D 2 HOH 77  317 184 HOH HOH B . 
D 2 HOH 78  318 185 HOH HOH B . 
D 2 HOH 79  319 186 HOH HOH B . 
D 2 HOH 80  320 187 HOH HOH B . 
D 2 HOH 81  321 188 HOH HOH B . 
D 2 HOH 82  322 190 HOH HOH B . 
D 2 HOH 83  323 192 HOH HOH B . 
D 2 HOH 84  324 193 HOH HOH B . 
D 2 HOH 85  325 194 HOH HOH B . 
D 2 HOH 86  326 205 HOH HOH B . 
D 2 HOH 87  327 209 HOH HOH B . 
D 2 HOH 88  328 210 HOH HOH B . 
D 2 HOH 89  329 213 HOH HOH B . 
D 2 HOH 90  330 224 HOH HOH B . 
D 2 HOH 91  331 225 HOH HOH B . 
D 2 HOH 92  332 231 HOH HOH B . 
D 2 HOH 93  333 232 HOH HOH B . 
D 2 HOH 94  334 233 HOH HOH B . 
D 2 HOH 95  335 234 HOH HOH B . 
D 2 HOH 96  336 239 HOH HOH B . 
D 2 HOH 97  337 240 HOH HOH B . 
D 2 HOH 98  338 241 HOH HOH B . 
D 2 HOH 99  339 242 HOH HOH B . 
D 2 HOH 100 340 243 HOH HOH B . 
D 2 HOH 101 341 245 HOH HOH B . 
D 2 HOH 102 342 246 HOH HOH B . 
D 2 HOH 103 343 249 HOH HOH B . 
D 2 HOH 104 344 254 HOH HOH B . 
D 2 HOH 105 345 255 HOH HOH B . 
D 2 HOH 106 346 257 HOH HOH B . 
D 2 HOH 107 347 260 HOH HOH B . 
D 2 HOH 108 348 262 HOH HOH B . 
D 2 HOH 109 349 263 HOH HOH B . 
D 2 HOH 110 350 265 HOH HOH B . 
D 2 HOH 111 351 267 HOH HOH B . 
D 2 HOH 112 352 268 HOH HOH B . 
D 2 HOH 113 353 269 HOH HOH B . 
D 2 HOH 114 354 271 HOH HOH B . 
D 2 HOH 115 355 272 HOH HOH B . 
D 2 HOH 116 356 274 HOH HOH B . 
D 2 HOH 117 357 277 HOH HOH B . 
D 2 HOH 118 358 278 HOH HOH B . 
D 2 HOH 119 359 280 HOH HOH B . 
D 2 HOH 120 360 281 HOH HOH B . 
D 2 HOH 121 361 283 HOH HOH B . 
D 2 HOH 122 362 284 HOH HOH B . 
D 2 HOH 123 363 286 HOH HOH B . 
D 2 HOH 124 364 288 HOH HOH B . 
D 2 HOH 125 365 290 HOH HOH B . 
D 2 HOH 126 366 291 HOH HOH B . 
D 2 HOH 127 367 296 HOH HOH B . 
D 2 HOH 128 368 297 HOH HOH B . 
D 2 HOH 129 369 298 HOH HOH B . 
D 2 HOH 130 370 301 HOH HOH B . 
D 2 HOH 131 371 303 HOH HOH B . 
D 2 HOH 132 372 305 HOH HOH B . 
D 2 HOH 133 373 307 HOH HOH B . 
D 2 HOH 134 374 308 HOH HOH B . 
D 2 HOH 135 375 309 HOH HOH B . 
D 2 HOH 136 376 312 HOH HOH B . 
D 2 HOH 137 377 313 HOH HOH B . 
D 2 HOH 138 378 314 HOH HOH B . 
D 2 HOH 139 379 318 HOH HOH B . 
D 2 HOH 140 380 319 HOH HOH B . 
D 2 HOH 141 381 321 HOH HOH B . 
D 2 HOH 142 382 322 HOH HOH B . 
D 2 HOH 143 383 324 HOH HOH B . 
D 2 HOH 144 384 326 HOH HOH B . 
D 2 HOH 145 385 329 HOH HOH B . 
D 2 HOH 146 386 332 HOH HOH B . 
D 2 HOH 147 387 334 HOH HOH B . 
D 2 HOH 148 388 337 HOH HOH B . 
D 2 HOH 149 389 338 HOH HOH B . 
D 2 HOH 150 390 340 HOH HOH B . 
D 2 HOH 151 391 341 HOH HOH B . 
D 2 HOH 152 392 346 HOH HOH B . 
D 2 HOH 153 393 347 HOH HOH B . 
D 2 HOH 154 394 349 HOH HOH B . 
D 2 HOH 155 395 350 HOH HOH B . 
D 2 HOH 156 396 351 HOH HOH B . 
D 2 HOH 157 397 352 HOH HOH B . 
D 2 HOH 158 398 354 HOH HOH B . 
D 2 HOH 159 399 355 HOH HOH B . 
D 2 HOH 160 400 357 HOH HOH B . 
D 2 HOH 161 401 358 HOH HOH B . 
D 2 HOH 162 402 359 HOH HOH B . 
D 2 HOH 163 403 362 HOH HOH B . 
D 2 HOH 164 404 363 HOH HOH B . 
D 2 HOH 165 405 366 HOH HOH B . 
D 2 HOH 166 406 367 HOH HOH B . 
D 2 HOH 167 407 373 HOH HOH B . 
D 2 HOH 168 408 374 HOH HOH B . 
D 2 HOH 169 409 378 HOH HOH B . 
D 2 HOH 170 410 379 HOH HOH B . 
D 2 HOH 171 411 383 HOH HOH B . 
D 2 HOH 172 412 384 HOH HOH B . 
D 2 HOH 173 413 387 HOH HOH B . 
D 2 HOH 174 414 389 HOH HOH B . 
D 2 HOH 175 415 391 HOH HOH B . 
D 2 HOH 176 416 392 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2130  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  23070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-13 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-07-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
2 4 'Structure model' software                     
3 5 'Structure model' pdbx_database_related        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice 'data collection' .         ? 1  
MOSFLM  'data reduction'  .         ? 2  
SCALA   'data scaling'    .         ? 3  
CCP4    'data reduction'  .         ? 4  
SnB     phasing           .         ? 5  
MLPHARE phasing           .         ? 6  
CCP4    'model building'  .         ? 7  
SOLVE   phasing           .         ? 8  
CNS     refinement        1.1       ? 9  
CCP4    'data scaling'    '(SCALA)' ? 10 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;
BIOMOLECULE:  
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 2 CHAIN(S). THE BIOLOGICAL UNIT IS 
UNKNOWN.
;
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             101 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             101 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.369 
_pdbx_validate_rmsd_bond.bond_target_value         1.774 
_pdbx_validate_rmsd_bond.bond_deviation            -0.405 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.056 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 196 ? ? 73.26   -7.98   
2 1 ASP B 196 ? ? 33.96   59.10   
3 1 ASP B 198 ? ? -167.68 -149.24 
4 1 LEU B 235 ? ? -67.30  48.25   
5 1 LEU B 236 ? ? -150.66 43.03   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -11 ? A MET 1   
2  1 Y 1 A GLY -10 ? A GLY 2   
3  1 Y 1 A SER -9  ? A SER 3   
4  1 Y 1 A ASP -8  ? A ASP 4   
5  1 Y 1 A LYS -7  ? A LYS 5   
6  1 Y 1 A ILE -6  ? A ILE 6   
7  1 Y 1 A HIS -5  ? A HIS 7   
8  1 Y 1 A HIS -4  ? A HIS 8   
9  1 Y 1 A HIS -3  ? A HIS 9   
10 1 Y 1 A HIS -2  ? A HIS 10  
11 1 Y 1 A LYS 237 ? A LYS 249 
12 1 Y 1 A GLU 238 ? A GLU 250 
13 1 Y 1 A ARG 239 ? A ARG 251 
14 1 Y 1 A SER 240 ? A SER 252 
15 1 Y 1 B MET -11 ? B MET 1   
16 1 Y 1 B GLY -10 ? B GLY 2   
17 1 Y 1 B SER -9  ? B SER 3   
18 1 Y 1 B ASP -8  ? B ASP 4   
19 1 Y 1 B LYS -7  ? B LYS 5   
20 1 Y 1 B ILE -6  ? B ILE 6   
21 1 Y 1 B HIS -5  ? B HIS 7   
22 1 Y 1 B HIS -4  ? B HIS 8   
23 1 Y 1 B HIS -3  ? B HIS 9   
24 1 Y 1 B HIS -2  ? B HIS 10  
25 1 Y 1 B GLU 238 ? B GLU 250 
26 1 Y 1 B ARG 239 ? B ARG 251 
27 1 Y 1 B SER 240 ? B SER 252 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#