data_1O3F
# 
_entry.id   1O3F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O3F         
RCSB  RCSB001755   
WWPDB D_1000001755 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1C5R 
_pdbx_database_related.details        'Bovine trypsin complex with different inhibitor' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        1O3F 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-06 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Katz, B.A.'          1  
'Elrod, K.'           2  
'Verner, E.'          3  
'Mackman, R.L.'       4  
'Luong, C.'           5  
'Shrader, W.D.'       6  
'Sendzik, M.'         7  
'Spencer, J.R.'       8  
'Sprengeler, P.A.'    9  
'Kolesnikov, A.'      10 
'Tai, V.W.'           11 
'Hui, H.C.'           12 
'Breitenbucher, J.G.' 13 
'Allen, D.'           14 
'Janc, J.W.'          15 
# 
_citation.id                        primary 
_citation.title                     
;Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease
inhibitors.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            329 
_citation.page_first                93 
_citation.page_last                 120 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12742021 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(03)00399-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Katz, B.A.'          1  
primary 'Elrod, K.'           2  
primary 'Verner, E.'          3  
primary 'Mackman, R.L.'       4  
primary 'Luong, C.'           5  
primary 'Shrader, W.D.'       6  
primary 'Sendzik, M.'         7  
primary 'Spencer, J.R.'       8  
primary 'Sprengeler, P.A.'    9  
primary 'Kolesnikov, A.'      10 
primary 'Tai, V.W.'           11 
primary 'Hui, H.C.'           12 
primary 'Breitenbucher, J.G.' 13 
primary 'Allen, D.'           14 
primary 'Janc, J.W.'          15 
# 
_cell.entry_id           1O3F 
_cell.length_a           63.70 
_cell.length_b           63.33 
_cell.length_c           69.32 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.entry_id                         1O3F 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     orthorhombic 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat BETA-TRYPSIN                                                      23324.287 1   3.4.21.4 ? ? ? 
2 non-polymer syn 'CALCIUM ION'                                                     40.078    1   ?        ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                                                    35.453    1   ?        ? ? ? 
4 non-polymer syn "3-{5-[AMINO(IMINIO)METHYL]-1H-INDOL-2-YL}-1,1'-BIPHENYL-2-OLATE" 327.379   1   ?        ? ? ? 
5 water       nat water                                                             18.015    150 ?        ? ? ? 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.4.21.4 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   CYS n 
1 8   GLY n 
1 9   ALA n 
1 10  ASN n 
1 11  THR n 
1 12  VAL n 
1 13  PRO n 
1 14  TYR n 
1 15  GLN n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  HIS n 
1 24  PHE n 
1 25  CYS n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  SER n 
1 33  GLN n 
1 34  TRP n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  GLY n 
1 46  ILE n 
1 47  GLN n 
1 48  VAL n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  GLU n 
1 53  ASP n 
1 54  ASN n 
1 55  ILE n 
1 56  ASN n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  ASN n 
1 62  GLU n 
1 63  GLN n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  HIS n 
1 74  PRO n 
1 75  SER n 
1 76  TYR n 
1 77  ASN n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  LEU n 
1 82  ASN n 
1 83  ASN n 
1 84  ASP n 
1 85  ILE n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  ARG n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 ALA n 
1 111 SER n 
1 112 ALA n 
1 113 GLY n 
1 114 THR n 
1 115 GLN n 
1 116 CYS n 
1 117 LEU n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 LYS n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 SER n 
1 131 TYR n 
1 132 PRO n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 CYS n 
1 138 LEU n 
1 139 LYS n 
1 140 ALA n 
1 141 PRO n 
1 142 ILE n 
1 143 LEU n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 LYS n 
1 150 SER n 
1 151 ALA n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 GLN n 
1 156 ILE n 
1 157 THR n 
1 158 SER n 
1 159 ASN n 
1 160 MET n 
1 161 PHE n 
1 162 CYS n 
1 163 ALA n 
1 164 GLY n 
1 165 TYR n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLY n 
1 170 LYS n 
1 171 ASP n 
1 172 SER n 
1 173 CYS n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 SER n 
1 178 GLY n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LEU n 
1 188 GLN n 
1 189 GLY n 
1 190 ILE n 
1 191 VAL n 
1 192 SER n 
1 193 TRP n 
1 194 GLY n 
1 195 SER n 
1 196 GLY n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 PRO n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 THR n 
1 208 LYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ASN n 
1 212 TYR n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 ILE n 
1 217 LYS n 
1 218 GLN n 
1 219 THR n 
1 220 ILE n 
1 221 ALA n 
1 222 SER n 
1 223 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 PANCREAS 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TRY1_BOVIN 
_struct_ref.pdbx_db_accession          P00760 
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_seq_one_letter_code   
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1O3F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 223 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00760 
_struct_ref_seq.db_align_beg                  21 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  243 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       245 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
696 non-polymer         . "3-{5-[AMINO(IMINIO)METHYL]-1H-INDOL-2-YL}-1,1'-BIPHENYL-2-OLATE" CRA_8696 'C21 H17 N3 O'   327.379 
ALA 'L-peptide linking' y ALANINE                                                           ?        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                          ?        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ?        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ?        'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                                                     ?        'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'                                                    ?        'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                                                          ?        'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                         ?        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ?        'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                           ?        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                         ?        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                             ?        'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                        ?        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ?        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                            ?        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                        ?        'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                     ?        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                           ?        'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                            ?        'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                         ?        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                        ?        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                          ?        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                            ?        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1O3F 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.95 
_exptl_crystal.density_Matthews      3.00 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              8.10 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    'magnesium sulfate soak at target pH (6.08). vapor diffusion at 298 K, pH 8.10' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2001-05-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0.80 
_reflns.d_resolution_high            1.55 
_reflns.d_resolution_low             46.76 
_reflns.number_all                   41459 
_reflns.number_obs                   28071 
_reflns.percent_possible_obs         67.7 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_netI_over_sigmaI        6.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.88 
_reflns.entry_id                     1O3F 
_reflns.pdbx_Rsym_value              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.55 
_reflns_shell.d_res_low              1.65 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.251 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      6980 
_reflns_shell.percent_possible_obs   35.1 
_reflns_shell.meanI_over_sigI_obs    1.0 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1O3F 
_refine.ls_d_res_high                            1.55 
_refine.ls_d_res_low                             7.0 
_refine.pdbx_ls_sigma_F                          1.60 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     40875 
_refine.ls_number_reflns_obs                     27558 
_refine.ls_number_reflns_R_free                  2798 
_refine.ls_percent_reflns_obs                    67.42 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.189 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.213 
_refine.pdbx_stereochemistry_target_values       'X-PLOR force field' 
_refine.details                                  
;Residues simultaneously refined in two or more conformations are:
Val53, Leu66, Ser86, Lys87, Ser113, Ser130, Lys159, Asp165, Ser166
Gln175, Ser217, Lys230, Ser236, Ser244.

HOH383 makes short H-bonds with OgSer195 and O6' of the inhibitor
HOH384 makes short H-bonds with OgSer195 and O6' of the inhibitor

His40 and HIS91 are MONOPROTONATED ON THE EPSILON NITROGEN.
His57 is doubly protonated.
;
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3344 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             450 
_refine_hist.number_atoms_total               3837 
_refine_hist.d_res_high                       1.55 
_refine_hist.d_res_low                        7.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 3.7   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1O3F 
_struct.title                     
'Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors' 
_struct.pdbx_descriptor           'BETA-TRYPSIN (E.C.3.4.21.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O3F 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'serine protease, short hydrogen bond, inhibition mechanism, shift of pKa, trypsin, thrombin, urokinase, factor Xa, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 38  ? TYR A 42  ? ALA A 55  TYR A 59  5 ? 5  
HELX_P HELX_P2 2 SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 ? 9  
HELX_P HELX_P3 3 TYR A 212 ? SER A 222 ? TYR A 234 SER A 244 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7   SG ? ? ? 1_555 A CYS 137 SG  ? ? A CYS 22  A CYS 157 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2 disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 41  SG  ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG  ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG  ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG  ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG  ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc1 metalc ? ? B CA  .   CA ? ? ? 1_555 A GLU 52  OE2 ? ? A CA  247 A GLU 70  1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc2 metalc ? ? B CA  .   CA ? ? ? 1_555 A ASN 54  O   ? ? A CA  247 A ASN 72  1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc3 metalc ? ? B CA  .   CA ? ? ? 1_555 A GLU 62  OE2 ? ? A CA  247 A GLU 80  1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc4 metalc ? ? B CA  .   CA ? ? ? 1_555 E HOH .   O   ? ? A CA  247 A HOH 560 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc5 metalc ? ? B CA  .   CA ? ? ? 1_555 A VAL 57  O   ? ? A CA  247 A VAL 75  1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc6 metalc ? ? B CA  .   CA ? ? ? 1_555 E HOH .   O   ? ? A CA  247 A HOH 248 1_555 ? ? ? ? ? ? ? 2.289 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 5   ? THR A 6   ? TYR A 20  THR A 21  
A 2 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 
A 3 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 
A 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 
A 5 LYS A 186 ? TRP A 193 ? LYS A 204 TRP A 215 
A 6 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 
A 7 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 
B 1 GLN A 15  ? ASN A 19  ? GLN A 30  ASN A 34  
B 2 HIS A 23  ? LEU A 29  ? HIS A 40  LEU A 46  
B 3 TRP A 34  ? SER A 37  ? TRP A 51  SER A 54  
B 4 MET A 86  ? LEU A 90  ? MET A 104 LEU A 108 
B 5 GLN A 63  ? VAL A 72  ? GLN A 81  VAL A 90  
B 6 GLN A 47  ? LEU A 50  ? GLN A 64  LEU A 66  
B 7 GLN A 15  ? ASN A 19  ? GLN A 30  ASN A 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 5   ? N TYR A 20  O CYS A 137 ? O CYS A 157 
A 2 3 O LEU A 138 ? O LEU A 158 N ILE A 118 ? N ILE A 138 
A 3 4 N LEU A 117 ? N LEU A 137 O VAL A 182 ? O VAL A 200 
A 4 5 N CYS A 183 ? N CYS A 201 O LYS A 186 ? O LYS A 204 
A 5 6 N TRP A 193 ? N TRP A 215 O VAL A 205 ? O VAL A 227 
A 6 7 O TYR A 206 ? O TYR A 228 N PHE A 161 ? N PHE A 181 
B 1 2 N LEU A 18  ? N LEU A 33  O CYS A 25  ? O CYS A 42  
B 2 3 N SER A 28  ? N SER A 45  O VAL A 36  ? O VAL A 53  
B 3 4 N VAL A 35  ? N VAL A 52  O ILE A 88  ? O ILE A 106 
B 4 5 O LEU A 87  ? O LEU A 105 N ILE A 71  ? N ILE A 89  
B 5 6 O ILE A 65  ? O ILE A 83  N VAL A 48  ? N VAL A 65  
B 6 7 O GLN A 47  ? O GLN A 64  N ASN A 19  ? N ASN A 34  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 247'  
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 260'  
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 696 A 246' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  GLU A 52  ? GLU A 70  . ? 1_555 ? 
2  AC1 6  ASN A 54  ? ASN A 72  . ? 1_555 ? 
3  AC1 6  VAL A 57  ? VAL A 75  . ? 1_555 ? 
4  AC1 6  GLU A 62  ? GLU A 80  . ? 1_555 ? 
5  AC1 6  HOH E .   ? HOH A 248 . ? 1_555 ? 
6  AC1 6  HOH E .   ? HOH A 560 . ? 1_555 ? 
7  AC2 1  GLY A 154 ? GLY A 174 . ? 1_555 ? 
8  AC3 13 CYS A 25  ? CYS A 42  . ? 1_555 ? 
9  AC3 13 HIS A 40  ? HIS A 57  . ? 1_555 ? 
10 AC3 13 ASP A 171 ? ASP A 189 . ? 1_555 ? 
11 AC3 13 SER A 172 ? SER A 190 . ? 1_555 ? 
12 AC3 13 GLN A 174 ? GLN A 192 . ? 1_555 ? 
13 AC3 13 SER A 177 ? SER A 195 . ? 1_555 ? 
14 AC3 13 VAL A 191 ? VAL A 213 . ? 1_555 ? 
15 AC3 13 GLY A 194 ? GLY A 216 . ? 1_555 ? 
16 AC3 13 GLY A 196 ? GLY A 219 . ? 1_555 ? 
17 AC3 13 GLY A 204 ? GLY A 226 . ? 1_555 ? 
18 AC3 13 HOH E .   ? HOH A 383 . ? 1_555 ? 
19 AC3 13 HOH E .   ? HOH A 384 . ? 1_555 ? 
20 AC3 13 HOH E .   ? HOH A 685 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1O3F 
_atom_sites.fract_transf_matrix[1][1]   0.015699 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015790 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014426 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ILE A 1 1   ? 52.855 -3.489  26.916 1.00 15.47 ? 16  ILE A N     1 
ATOM   2    C  CA    . ILE A 1 1   ? 52.853 -3.699  25.432 1.00 14.57 ? 16  ILE A CA    1 
ATOM   3    C  C     . ILE A 1 1   ? 53.267 -5.177  25.353 1.00 14.36 ? 16  ILE A C     1 
ATOM   4    O  O     . ILE A 1 1   ? 54.255 -5.529  25.968 1.00 11.06 ? 16  ILE A O     1 
ATOM   5    C  CB    . ILE A 1 1   ? 53.933 -2.781  24.726 1.00 13.61 ? 16  ILE A CB    1 
ATOM   6    C  CG1   . ILE A 1 1   ? 53.679 -1.221  24.931 1.00 13.64 ? 16  ILE A CG1   1 
ATOM   7    C  CG2   . ILE A 1 1   ? 54.092 -3.094  23.211 1.00 13.57 ? 16  ILE A CG2   1 
ATOM   8    C  CD1   . ILE A 1 1   ? 52.420 -0.707  24.195 1.00 12.68 ? 16  ILE A CD1   1 
ATOM   9    H  H1    . ILE A 1 1   ? 53.218 -4.358  27.372 1.00 16.35 ? 16  ILE A H1    1 
ATOM   10   H  H2    . ILE A 1 1   ? 51.910 -3.311  27.288 1.00 15.37 ? 16  ILE A H2    1 
ATOM   11   H  H3    . ILE A 1 1   ? 53.495 -2.713  27.136 1.00 15.49 ? 16  ILE A H3    1 
ATOM   12   H  HA    . ILE A 1 1   ? 51.859 -3.573  25.029 1.00 14.16 ? 16  ILE A HA    1 
ATOM   13   H  HB    . ILE A 1 1   ? 54.891 -3.022  25.173 1.00 13.52 ? 16  ILE A HB    1 
ATOM   14   H  HG12  . ILE A 1 1   ? 53.636 -0.963  25.980 1.00 13.36 ? 16  ILE A HG12  1 
ATOM   15   H  HG13  . ILE A 1 1   ? 54.530 -0.686  24.525 1.00 13.60 ? 16  ILE A HG13  1 
ATOM   16   H  HG21  . ILE A 1 1   ? 53.162 -2.973  22.673 1.00 13.41 ? 16  ILE A HG21  1 
ATOM   17   H  HG22  . ILE A 1 1   ? 54.433 -4.111  23.067 1.00 13.44 ? 16  ILE A HG22  1 
ATOM   18   H  HG23  . ILE A 1 1   ? 54.835 -2.440  22.774 1.00 13.11 ? 16  ILE A HG23  1 
ATOM   19   H  HD11  . ILE A 1 1   ? 51.519 -1.194  24.518 1.00 13.78 ? 16  ILE A HD11  1 
ATOM   20   H  HD12  . ILE A 1 1   ? 52.538 -0.852  23.129 1.00 13.11 ? 16  ILE A HD12  1 
ATOM   21   H  HD13  . ILE A 1 1   ? 52.315 0.358   24.362 1.00 13.84 ? 16  ILE A HD13  1 
ATOM   22   N  N     . VAL A 1 2   ? 52.525 -5.944  24.624 1.00 15.93 ? 17  VAL A N     1 
ATOM   23   C  CA    . VAL A 1 2   ? 52.811 -7.395  24.455 1.00 16.12 ? 17  VAL A CA    1 
ATOM   24   C  C     . VAL A 1 2   ? 53.288 -7.524  22.998 1.00 16.93 ? 17  VAL A C     1 
ATOM   25   O  O     . VAL A 1 2   ? 52.649 -7.000  22.107 1.00 19.08 ? 17  VAL A O     1 
ATOM   26   C  CB    . VAL A 1 2   ? 51.510 -8.218  24.656 1.00 14.68 ? 17  VAL A CB    1 
ATOM   27   C  CG1   . VAL A 1 2   ? 51.821 -9.714  24.418 1.00 14.49 ? 17  VAL A CG1   1 
ATOM   28   C  CG2   . VAL A 1 2   ? 50.981 -8.040  26.099 1.00 15.83 ? 17  VAL A CG2   1 
ATOM   29   H  H     . VAL A 1 2   ? 51.751 -5.587  24.143 1.00 14.95 ? 17  VAL A H     1 
ATOM   30   H  HA    . VAL A 1 2   ? 53.605 -7.700  25.122 1.00 16.23 ? 17  VAL A HA    1 
ATOM   31   H  HB    . VAL A 1 2   ? 50.766 -7.898  23.943 1.00 14.61 ? 17  VAL A HB    1 
ATOM   32   H  HG11  . VAL A 1 2   ? 52.585 -10.054 25.103 1.00 14.85 ? 17  VAL A HG11  1 
ATOM   33   H  HG12  . VAL A 1 2   ? 52.172 -9.884  23.407 1.00 14.29 ? 17  VAL A HG12  1 
ATOM   34   H  HG13  . VAL A 1 2   ? 50.933 -10.312 24.562 1.00 14.59 ? 17  VAL A HG13  1 
ATOM   35   H  HG21  . VAL A 1 2   ? 50.776 -7.001  26.310 1.00 15.82 ? 17  VAL A HG21  1 
ATOM   36   H  HG22  . VAL A 1 2   ? 51.693 -8.399  26.823 1.00 15.05 ? 17  VAL A HG22  1 
ATOM   37   H  HG23  . VAL A 1 2   ? 50.059 -8.588  26.225 1.00 15.53 ? 17  VAL A HG23  1 
ATOM   38   N  N     . GLY A 1 3   ? 54.390 -8.189  22.810 1.00 18.60 ? 18  GLY A N     1 
ATOM   39   C  CA    . GLY A 1 3   ? 54.951 -8.404  21.452 1.00 17.40 ? 18  GLY A CA    1 
ATOM   40   C  C     . GLY A 1 3   ? 55.625 -7.226  20.849 1.00 16.87 ? 18  GLY A C     1 
ATOM   41   O  O     . GLY A 1 3   ? 55.826 -7.230  19.649 1.00 19.06 ? 18  GLY A O     1 
ATOM   42   H  H     . GLY A 1 3   ? 54.872 -8.558  23.579 1.00 18.80 ? 18  GLY A H     1 
ATOM   43   H  HA2   . GLY A 1 3   ? 55.660 -9.216  21.500 1.00 17.97 ? 18  GLY A HA2   1 
ATOM   44   H  HA3   . GLY A 1 3   ? 54.139 -8.701  20.801 1.00 17.98 ? 18  GLY A HA3   1 
ATOM   45   N  N     . GLY A 1 4   ? 55.983 -6.265  21.641 1.00 19.09 ? 19  GLY A N     1 
ATOM   46   C  CA    . GLY A 1 4   ? 56.654 -5.043  21.108 1.00 18.86 ? 19  GLY A CA    1 
ATOM   47   C  C     . GLY A 1 4   ? 58.158 -5.117  21.319 1.00 20.19 ? 19  GLY A C     1 
ATOM   48   O  O     . GLY A 1 4   ? 58.690 -6.192  21.560 1.00 21.95 ? 19  GLY A O     1 
ATOM   49   H  H     . GLY A 1 4   ? 55.817 -6.339  22.603 1.00 18.56 ? 19  GLY A H     1 
ATOM   50   H  HA2   . GLY A 1 4   ? 56.437 -4.930  20.057 1.00 18.02 ? 19  GLY A HA2   1 
ATOM   51   H  HA3   . GLY A 1 4   ? 56.267 -4.186  21.637 1.00 19.79 ? 19  GLY A HA3   1 
ATOM   52   N  N     . TYR A 1 5   ? 58.831 -4.000  21.220 1.00 20.98 ? 20  TYR A N     1 
ATOM   53   C  CA    . TYR A 1 5   ? 60.295 -3.972  21.408 1.00 18.98 ? 20  TYR A CA    1 
ATOM   54   C  C     . TYR A 1 5   ? 60.673 -2.811  22.293 1.00 17.90 ? 20  TYR A C     1 
ATOM   55   O  O     . TYR A 1 5   ? 59.871 -1.943  22.545 1.00 15.62 ? 20  TYR A O     1 
ATOM   56   C  CB    . TYR A 1 5   ? 60.972 -3.822  20.068 1.00 18.65 ? 20  TYR A CB    1 
ATOM   57   C  CG    . TYR A 1 5   ? 60.481 -2.604  19.302 1.00 17.02 ? 20  TYR A CG    1 
ATOM   58   C  CD1   . TYR A 1 5   ? 59.364 -2.655  18.506 1.00 17.76 ? 20  TYR A CD1   1 
ATOM   59   C  CD2   . TYR A 1 5   ? 61.184 -1.429  19.401 1.00 18.44 ? 20  TYR A CD2   1 
ATOM   60   C  CE1   . TYR A 1 5   ? 58.969 -1.551  17.825 1.00 18.75 ? 20  TYR A CE1   1 
ATOM   61   C  CE2   . TYR A 1 5   ? 60.789 -0.321  18.720 1.00 19.37 ? 20  TYR A CE2   1 
ATOM   62   C  CZ    . TYR A 1 5   ? 59.681 -0.382  17.930 1.00 19.20 ? 20  TYR A CZ    1 
ATOM   63   O  OH    . TYR A 1 5   ? 59.288 0.732   17.237 1.00 21.55 ? 20  TYR A OH    1 
ATOM   64   H  H     . TYR A 1 5   ? 58.380 -3.149  21.024 1.00 20.23 ? 20  TYR A H     1 
ATOM   65   H  HA    . TYR A 1 5   ? 60.616 -4.887  21.882 1.00 19.89 ? 20  TYR A HA    1 
ATOM   66   H  HB2   . TYR A 1 5   ? 62.037 -3.721  20.222 1.00 19.32 ? 20  TYR A HB2   1 
ATOM   67   H  HB3   . TYR A 1 5   ? 60.802 -4.703  19.467 1.00 19.10 ? 20  TYR A HB3   1 
ATOM   68   H  HD1   . TYR A 1 5   ? 58.784 -3.561  18.410 1.00 18.10 ? 20  TYR A HD1   1 
ATOM   69   H  HD2   . TYR A 1 5   ? 62.063 -1.367  20.023 1.00 18.78 ? 20  TYR A HD2   1 
ATOM   70   H  HE1   . TYR A 1 5   ? 58.088 -1.614  17.201 1.00 18.51 ? 20  TYR A HE1   1 
ATOM   71   H  HE2   . TYR A 1 5   ? 61.355 0.598   18.814 1.00 18.42 ? 20  TYR A HE2   1 
ATOM   72   H  HH    . TYR A 1 5   ? 58.659 0.399   16.588 1.00 20.77 ? 20  TYR A HH    1 
ATOM   73   N  N     . THR A 1 6   ? 61.887 -2.823  22.721 1.00 14.78 ? 21  THR A N     1 
ATOM   74   C  CA    . THR A 1 6   ? 62.404 -1.767  23.591 1.00 16.19 ? 21  THR A CA    1 
ATOM   75   C  C     . THR A 1 6   ? 62.545 -0.522  22.741 1.00 16.21 ? 21  THR A C     1 
ATOM   76   O  O     . THR A 1 6   ? 63.262 -0.548  21.766 1.00 13.40 ? 21  THR A O     1 
ATOM   77   C  CB    . THR A 1 6   ? 63.750 -2.193  24.127 1.00 17.01 ? 21  THR A CB    1 
ATOM   78   O  OG1   . THR A 1 6   ? 63.497 -3.376  24.887 1.00 20.34 ? 21  THR A OG1   1 
ATOM   79   C  CG2   . THR A 1 6   ? 64.324 -1.137  25.111 1.00 17.62 ? 21  THR A CG2   1 
ATOM   80   H  H     . THR A 1 6   ? 62.474 -3.554  22.451 1.00 17.53 ? 21  THR A H     1 
ATOM   81   H  HA    . THR A 1 6   ? 61.682 -1.586  24.374 1.00 17.49 ? 21  THR A HA    1 
ATOM   82   H  HB    . THR A 1 6   ? 64.437 -2.392  23.315 1.00 16.78 ? 21  THR A HB    1 
ATOM   83   H  HG1   . THR A 1 6   ? 63.687 -3.206  25.819 1.00 17.79 ? 21  THR A HG1   1 
ATOM   84   H  HG21  . THR A 1 6   ? 63.654 -0.952  25.939 1.00 16.82 ? 21  THR A HG21  1 
ATOM   85   H  HG22  . THR A 1 6   ? 64.472 -0.204  24.583 1.00 16.78 ? 21  THR A HG22  1 
ATOM   86   H  HG23  . THR A 1 6   ? 65.284 -1.448  25.494 1.00 16.78 ? 21  THR A HG23  1 
ATOM   87   N  N     . CYS A 1 7   ? 61.892 0.545   23.111 1.00 15.22 ? 22  CYS A N     1 
ATOM   88   C  CA    . CYS A 1 7   ? 62.023 1.759   22.284 1.00 13.29 ? 22  CYS A CA    1 
ATOM   89   C  C     . CYS A 1 7   ? 63.419 2.337   22.123 1.00 16.13 ? 22  CYS A C     1 
ATOM   90   O  O     . CYS A 1 7   ? 63.805 2.701   21.031 1.00 16.04 ? 22  CYS A O     1 
ATOM   91   C  CB    . CYS A 1 7   ? 61.181 2.823   22.861 1.00 13.41 ? 22  CYS A CB    1 
ATOM   92   S  SG    . CYS A 1 7   ? 59.429 2.445   23.053 1.00 10.07 ? 22  CYS A SG    1 
ATOM   93   H  H     . CYS A 1 7   ? 61.319 0.555   23.907 1.00 13.92 ? 22  CYS A H     1 
ATOM   94   H  HA    . CYS A 1 7   ? 61.654 1.522   21.295 1.00 13.67 ? 22  CYS A HA    1 
ATOM   95   H  HB2   . CYS A 1 7   ? 61.557 3.114   23.826 1.00 12.58 ? 22  CYS A HB2   1 
ATOM   96   H  HB3   . CYS A 1 7   ? 61.258 3.692   22.221 1.00 13.60 ? 22  CYS A HB3   1 
ATOM   97   N  N     . GLY A 1 8   ? 64.137 2.420   23.205 1.00 16.30 ? 23  GLY A N     1 
ATOM   98   C  CA    . GLY A 1 8   ? 65.503 2.997   23.163 1.00 18.57 ? 23  GLY A CA    1 
ATOM   99   C  C     . GLY A 1 8   ? 65.241 4.276   24.005 1.00 19.38 ? 23  GLY A C     1 
ATOM   100  O  O     . GLY A 1 8   ? 64.220 4.932   23.845 1.00 18.15 ? 23  GLY A O     1 
ATOM   101  H  H     . GLY A 1 8   ? 63.781 2.100   24.054 1.00 17.52 ? 23  GLY A H     1 
ATOM   102  H  HA2   . GLY A 1 8   ? 66.211 2.335   23.638 1.00 18.95 ? 23  GLY A HA2   1 
ATOM   103  H  HA3   . GLY A 1 8   ? 65.791 3.250   22.150 1.00 17.92 ? 23  GLY A HA3   1 
ATOM   104  N  N     . ALA A 1 9   ? 66.145 4.608   24.873 1.00 20.14 ? 24  ALA A N     1 
ATOM   105  C  CA    . ALA A 1 9   ? 65.954 5.804   25.721 1.00 16.83 ? 24  ALA A CA    1 
ATOM   106  C  C     . ALA A 1 9   ? 65.658 7.097   24.999 1.00 16.58 ? 24  ALA A C     1 
ATOM   107  O  O     . ALA A 1 9   ? 66.349 7.522   24.103 1.00 19.54 ? 24  ALA A O     1 
ATOM   108  C  CB    . ALA A 1 9   ? 67.191 6.018   26.574 1.00 15.63 ? 24  ALA A CB    1 
ATOM   109  H  H     . ALA A 1 9   ? 66.958 4.064   24.959 1.00 17.46 ? 24  ALA A H     1 
ATOM   110  H  HA    . ALA A 1 9   ? 65.125 5.582   26.374 1.00 17.29 ? 24  ALA A HA    1 
ATOM   111  H  HB1   . ALA A 1 9   ? 68.046 6.162   25.933 1.00 15.59 ? 24  ALA A HB1   1 
ATOM   112  H  HB2   . ALA A 1 9   ? 67.355 5.166   27.212 1.00 16.24 ? 24  ALA A HB2   1 
ATOM   113  H  HB3   . ALA A 1 9   ? 67.071 6.898   27.190 1.00 16.06 ? 24  ALA A HB3   1 
ATOM   114  N  N     . ASN A 1 10  ? 64.603 7.687   25.446 1.00 21.48 ? 25  ASN A N     1 
ATOM   115  C  CA    . ASN A 1 10  ? 64.070 8.979   24.949 1.00 20.85 ? 25  ASN A CA    1 
ATOM   116  C  C     . ASN A 1 10  ? 63.754 9.081   23.469 1.00 19.87 ? 25  ASN A C     1 
ATOM   117  O  O     . ASN A 1 10  ? 63.801 10.176  22.933 1.00 21.56 ? 25  ASN A O     1 
ATOM   118  C  CB    . ASN A 1 10  ? 65.067 10.115  25.326 1.00 24.62 ? 25  ASN A CB    1 
ATOM   119  C  CG    . ASN A 1 10  ? 65.434 10.079  26.826 1.00 23.28 ? 25  ASN A CG    1 
ATOM   120  O  OD1   . ASN A 1 10  ? 66.561 9.799   27.187 1.00 25.35 ? 25  ASN A OD1   1 
ATOM   121  N  ND2   . ASN A 1 10  ? 64.562 10.336  27.755 1.00 25.95 ? 25  ASN A ND2   1 
ATOM   122  H  H     . ASN A 1 10  ? 64.113 7.238   26.167 1.00 20.34 ? 25  ASN A H     1 
ATOM   123  H  HA    . ASN A 1 10  ? 63.160 9.171   25.490 1.00 22.45 ? 25  ASN A HA    1 
ATOM   124  H  HB2   . ASN A 1 10  ? 65.961 9.996   24.728 1.00 23.57 ? 25  ASN A HB2   1 
ATOM   125  H  HB3   . ASN A 1 10  ? 64.622 11.070  25.082 1.00 23.51 ? 25  ASN A HB3   1 
ATOM   126  H  HD21  . ASN A 1 10  ? 64.819 10.300  28.702 1.00 25.32 ? 25  ASN A HD21  1 
ATOM   127  H  HD22  . ASN A 1 10  ? 63.642 10.567  27.522 1.00 24.49 ? 25  ASN A HD22  1 
ATOM   128  N  N     . THR A 1 11  ? 63.415 7.980   22.851 1.00 16.95 ? 26  THR A N     1 
ATOM   129  C  CA    . THR A 1 11  ? 63.089 8.007   21.406 1.00 16.35 ? 26  THR A CA    1 
ATOM   130  C  C     . THR A 1 11  ? 61.619 8.347   21.226 1.00 14.17 ? 26  THR A C     1 
ATOM   131  O  O     . THR A 1 11  ? 61.138 8.530   20.124 1.00 12.96 ? 26  THR A O     1 
ATOM   132  C  CB    . THR A 1 11  ? 63.428 6.617   20.799 1.00 18.85 ? 26  THR A CB    1 
ATOM   133  O  OG1   . THR A 1 11  ? 62.795 5.642   21.619 1.00 19.49 ? 26  THR A OG1   1 
ATOM   134  C  CG2   . THR A 1 11  ? 64.926 6.344   20.923 1.00 20.65 ? 26  THR A CG2   1 
ATOM   135  H  H     . THR A 1 11  ? 63.377 7.124   23.328 1.00 17.50 ? 26  THR A H     1 
ATOM   136  H  HA    . THR A 1 11  ? 63.677 8.778   20.928 1.00 16.60 ? 26  THR A HA    1 
ATOM   137  H  HB    . THR A 1 11  ? 63.075 6.533   19.778 1.00 18.90 ? 26  THR A HB    1 
ATOM   138  H  HG1   . THR A 1 11  ? 63.449 5.214   22.188 1.00 19.02 ? 26  THR A HG1   1 
ATOM   139  H  HG21  . THR A 1 11  ? 65.263 6.387   21.951 1.00 20.11 ? 26  THR A HG21  1 
ATOM   140  H  HG22  . THR A 1 11  ? 65.474 7.086   20.359 1.00 20.01 ? 26  THR A HG22  1 
ATOM   141  H  HG23  . THR A 1 11  ? 65.161 5.375   20.511 1.00 20.59 ? 26  THR A HG23  1 
ATOM   142  N  N     . VAL A 1 12  ? 60.901 8.424   22.306 1.00 13.81 ? 27  VAL A N     1 
ATOM   143  C  CA    . VAL A 1 12  ? 59.447 8.758   22.240 1.00 12.66 ? 27  VAL A CA    1 
ATOM   144  C  C     . VAL A 1 12  ? 59.329 9.914   23.254 1.00 11.24 ? 27  VAL A C     1 
ATOM   145  O  O     . VAL A 1 12  ? 58.871 9.740   24.362 1.00 9.89  ? 27  VAL A O     1 
ATOM   146  C  CB    . VAL A 1 12  ? 58.578 7.534   22.661 1.00 11.48 ? 27  VAL A CB    1 
ATOM   147  C  CG1   . VAL A 1 12  ? 57.111 7.805   22.289 1.00 11.46 ? 27  VAL A CG1   1 
ATOM   148  C  CG2   . VAL A 1 12  ? 59.038 6.275   21.872 1.00 10.64 ? 27  VAL A CG2   1 
ATOM   149  H  H     . VAL A 1 12  ? 61.343 8.260   23.163 1.00 14.00 ? 27  VAL A H     1 
ATOM   150  H  HA    . VAL A 1 12  ? 59.184 9.094   21.247 1.00 13.19 ? 27  VAL A HA    1 
ATOM   151  H  HB    . VAL A 1 12  ? 58.645 7.365   23.725 1.00 11.45 ? 27  VAL A HB    1 
ATOM   152  H  HG11  . VAL A 1 12  ? 57.014 7.953   21.224 1.00 11.63 ? 27  VAL A HG11  1 
ATOM   153  H  HG12  . VAL A 1 12  ? 56.754 8.689   22.799 1.00 11.34 ? 27  VAL A HG12  1 
ATOM   154  H  HG13  . VAL A 1 12  ? 56.490 6.971   22.580 1.00 11.73 ? 27  VAL A HG13  1 
ATOM   155  H  HG21  . VAL A 1 12  ? 60.076 6.042   22.072 1.00 11.00 ? 27  VAL A HG21  1 
ATOM   156  H  HG22  . VAL A 1 12  ? 58.924 6.438   20.809 1.00 10.63 ? 27  VAL A HG22  1 
ATOM   157  H  HG23  . VAL A 1 12  ? 58.450 5.412   22.150 1.00 11.04 ? 27  VAL A HG23  1 
ATOM   158  N  N     . PRO A 1 13  ? 59.769 11.075  22.858 1.00 12.55 ? 28  PRO A N     1 
ATOM   159  C  CA    . PRO A 1 13  ? 59.922 12.208  23.783 1.00 12.52 ? 28  PRO A CA    1 
ATOM   160  C  C     . PRO A 1 13  ? 58.639 12.793  24.300 1.00 10.65 ? 28  PRO A C     1 
ATOM   161  O  O     . PRO A 1 13  ? 58.717 13.541  25.246 1.00 7.20  ? 28  PRO A O     1 
ATOM   162  C  CB    . PRO A 1 13  ? 60.773 13.197  22.991 1.00 15.78 ? 28  PRO A CB    1 
ATOM   163  C  CG    . PRO A 1 13  ? 60.312 12.963  21.529 1.00 16.57 ? 28  PRO A CG    1 
ATOM   164  C  CD    . PRO A 1 13  ? 60.195 11.427  21.465 1.00 15.32 ? 28  PRO A CD    1 
ATOM   165  H  HA    . PRO A 1 13  ? 60.482 11.871  24.640 1.00 11.85 ? 28  PRO A HA    1 
ATOM   166  H  HB2   . PRO A 1 13  ? 60.569 14.216  23.296 1.00 15.91 ? 28  PRO A HB2   1 
ATOM   167  H  HB3   . PRO A 1 13  ? 61.827 12.995  23.121 1.00 15.38 ? 28  PRO A HB3   1 
ATOM   168  H  HG2   . PRO A 1 13  ? 59.373 13.454  21.302 1.00 15.55 ? 28  PRO A HG2   1 
ATOM   169  H  HG3   . PRO A 1 13  ? 61.073 13.315  20.847 1.00 16.08 ? 28  PRO A HG3   1 
ATOM   170  H  HD2   . PRO A 1 13  ? 59.446 11.120  20.748 1.00 14.87 ? 28  PRO A HD2   1 
ATOM   171  H  HD3   . PRO A 1 13  ? 61.150 10.969  21.248 1.00 14.52 ? 28  PRO A HD3   1 
ATOM   172  N  N     . TYR A 1 14  ? 57.528 12.457  23.714 1.00 9.22  ? 29  TYR A N     1 
ATOM   173  C  CA    . TYR A 1 14  ? 56.223 13.003  24.180 1.00 8.73  ? 29  TYR A CA    1 
ATOM   174  C  C     . TYR A 1 14  ? 55.504 12.094  25.171 1.00 10.05 ? 29  TYR A C     1 
ATOM   175  O  O     . TYR A 1 14  ? 54.455 12.472  25.674 1.00 8.83  ? 29  TYR A O     1 
ATOM   176  C  CB    . TYR A 1 14  ? 55.298 13.244  22.962 1.00 10.27 ? 29  TYR A CB    1 
ATOM   177  C  CG    . TYR A 1 14  ? 55.276 12.016  22.053 1.00 10.87 ? 29  TYR A CG    1 
ATOM   178  C  CD1   . TYR A 1 14  ? 56.135 11.961  20.990 1.00 10.25 ? 29  TYR A CD1   1 
ATOM   179  C  CD2   . TYR A 1 14  ? 54.422 10.958  22.284 1.00 11.71 ? 29  TYR A CD2   1 
ATOM   180  C  CE1   . TYR A 1 14  ? 56.150 10.871  20.169 1.00 13.04 ? 29  TYR A CE1   1 
ATOM   181  C  CE2   . TYR A 1 14  ? 54.431 9.850   21.458 1.00 11.51 ? 29  TYR A CE2   1 
ATOM   182  C  CZ    . TYR A 1 14  ? 55.302 9.797   20.385 1.00 12.66 ? 29  TYR A CZ    1 
ATOM   183  O  OH    . TYR A 1 14  ? 55.376 8.720   19.523 1.00 13.71 ? 29  TYR A OH    1 
ATOM   184  H  H     . TYR A 1 14  ? 57.564 11.839  22.959 1.00 10.49 ? 29  TYR A H     1 
ATOM   185  H  HA    . TYR A 1 14  ? 56.405 13.952  24.662 1.00 9.48  ? 29  TYR A HA    1 
ATOM   186  H  HB2   . TYR A 1 14  ? 54.293 13.462  23.294 1.00 10.46 ? 29  TYR A HB2   1 
ATOM   187  H  HB3   . TYR A 1 14  ? 55.652 14.100  22.405 1.00 10.39 ? 29  TYR A HB3   1 
ATOM   188  H  HD1   . TYR A 1 14  ? 56.810 12.783  20.790 1.00 10.42 ? 29  TYR A HD1   1 
ATOM   189  H  HD2   . TYR A 1 14  ? 53.730 10.993  23.117 1.00 12.43 ? 29  TYR A HD2   1 
ATOM   190  H  HE1   . TYR A 1 14  ? 56.837 10.859  19.334 1.00 13.01 ? 29  TYR A HE1   1 
ATOM   191  H  HE2   . TYR A 1 14  ? 53.753 9.034   21.662 1.00 12.13 ? 29  TYR A HE2   1 
ATOM   192  H  HH    . TYR A 1 14  ? 55.124 7.950   20.053 1.00 12.97 ? 29  TYR A HH    1 
ATOM   193  N  N     . GLN A 1 15  ? 56.089 10.945  25.428 1.00 11.88 ? 30  GLN A N     1 
ATOM   194  C  CA    . GLN A 1 15  ? 55.489 9.943   26.373 1.00 10.97 ? 30  GLN A CA    1 
ATOM   195  C  C     . GLN A 1 15  ? 55.675 10.324  27.835 1.00 11.02 ? 30  GLN A C     1 
ATOM   196  O  O     . GLN A 1 15  ? 56.783 10.660  28.237 1.00 13.87 ? 30  GLN A O     1 
ATOM   197  C  CB    . GLN A 1 15  ? 56.164 8.586   26.095 1.00 11.76 ? 30  GLN A CB    1 
ATOM   198  C  CG    . GLN A 1 15  ? 55.845 7.436   27.100 1.00 13.20 ? 30  GLN A CG    1 
ATOM   199  C  CD    . GLN A 1 15  ? 54.518 6.758   26.791 1.00 14.06 ? 30  GLN A CD    1 
ATOM   200  O  OE1   . GLN A 1 15  ? 53.648 6.627   27.629 1.00 16.06 ? 30  GLN A OE1   1 
ATOM   201  N  NE2   . GLN A 1 15  ? 54.302 6.301   25.595 1.00 11.08 ? 30  GLN A NE2   1 
ATOM   202  H  H     . GLN A 1 15  ? 56.945 10.744  24.991 1.00 11.96 ? 30  GLN A H     1 
ATOM   203  H  HA    . GLN A 1 15  ? 54.429 9.876   26.161 1.00 12.55 ? 30  GLN A HA    1 
ATOM   204  H  HB2   . GLN A 1 15  ? 55.897 8.264   25.100 1.00 12.51 ? 30  GLN A HB2   1 
ATOM   205  H  HB3   . GLN A 1 15  ? 57.236 8.737   26.135 1.00 12.49 ? 30  GLN A HB3   1 
ATOM   206  H  HG2   . GLN A 1 15  ? 56.630 6.695   27.050 1.00 13.64 ? 30  GLN A HG2   1 
ATOM   207  H  HG3   . GLN A 1 15  ? 55.816 7.796   28.115 1.00 13.68 ? 30  GLN A HG3   1 
ATOM   208  H  HE21  . GLN A 1 15  ? 53.453 5.862   25.408 1.00 13.24 ? 30  GLN A HE21  1 
ATOM   209  H  HE22  . GLN A 1 15  ? 54.954 6.373   24.867 1.00 12.50 ? 30  GLN A HE22  1 
ATOM   210  N  N     . VAL A 1 16  ? 54.617 10.274  28.596 1.00 13.33 ? 31  VAL A N     1 
ATOM   211  C  CA    . VAL A 1 16  ? 54.774 10.621  30.029 1.00 12.63 ? 31  VAL A CA    1 
ATOM   212  C  C     . VAL A 1 16  ? 54.205 9.424   30.819 1.00 12.84 ? 31  VAL A C     1 
ATOM   213  O  O     . VAL A 1 16  ? 53.461 8.620   30.293 1.00 7.37  ? 31  VAL A O     1 
ATOM   214  C  CB    . VAL A 1 16  ? 53.981 12.003  30.385 1.00 14.42 ? 31  VAL A CB    1 
ATOM   215  C  CG1   . VAL A 1 16  ? 53.987 13.008  29.222 1.00 13.68 ? 31  VAL A CG1   1 
ATOM   216  C  CG2   . VAL A 1 16  ? 52.544 11.842  30.806 1.00 13.02 ? 31  VAL A CG2   1 
ATOM   217  H  H     . VAL A 1 16  ? 53.736 10.008  28.248 1.00 14.10 ? 31  VAL A H     1 
ATOM   218  H  HA    . VAL A 1 16  ? 55.823 10.723  30.269 1.00 13.69 ? 31  VAL A HA    1 
ATOM   219  H  HB    . VAL A 1 16  ? 54.504 12.456  31.216 1.00 13.96 ? 31  VAL A HB    1 
ATOM   220  H  HG11  . VAL A 1 16  ? 53.469 12.599  28.363 1.00 14.15 ? 31  VAL A HG11  1 
ATOM   221  H  HG12  . VAL A 1 16  ? 55.004 13.227  28.923 1.00 14.31 ? 31  VAL A HG12  1 
ATOM   222  H  HG13  . VAL A 1 16  ? 53.506 13.933  29.511 1.00 13.71 ? 31  VAL A HG13  1 
ATOM   223  H  HG21  . VAL A 1 16  ? 52.480 11.241  31.704 1.00 13.69 ? 31  VAL A HG21  1 
ATOM   224  H  HG22  . VAL A 1 16  ? 51.972 11.361  30.028 1.00 13.10 ? 31  VAL A HG22  1 
ATOM   225  H  HG23  . VAL A 1 16  ? 52.112 12.810  31.014 1.00 13.37 ? 31  VAL A HG23  1 
ATOM   226  N  N     . SER A 1 17  ? 54.579 9.362   32.057 1.00 9.37  ? 32  SER A N     1 
ATOM   227  C  CA    . SER A 1 17  ? 54.136 8.311   32.998 1.00 13.02 ? 32  SER A CA    1 
ATOM   228  C  C     . SER A 1 17  ? 53.315 9.098   34.043 1.00 12.05 ? 32  SER A C     1 
ATOM   229  O  O     . SER A 1 17  ? 53.801 10.110  34.512 1.00 10.93 ? 32  SER A O     1 
ATOM   230  C  CB    . SER A 1 17  ? 55.401 7.662   33.631 1.00 11.42 ? 32  SER A CB    1 
ATOM   231  O  OG    . SER A 1 17  ? 54.960 6.862   34.721 1.00 12.29 ? 32  SER A OG    1 
ATOM   232  H  H     . SER A 1 17  ? 55.186 10.050  32.403 1.00 12.57 ? 32  SER A H     1 
ATOM   233  H  HA    . SER A 1 17  ? 53.496 7.603   32.484 1.00 11.82 ? 32  SER A HA    1 
ATOM   234  H  HB2   . SER A 1 17  ? 55.904 7.023   32.914 1.00 12.26 ? 32  SER A HB2   1 
ATOM   235  H  HB3   . SER A 1 17  ? 56.088 8.413   33.988 1.00 12.10 ? 32  SER A HB3   1 
ATOM   236  H  HG    . SER A 1 17  ? 54.665 6.046   34.305 1.00 11.72 ? 32  SER A HG    1 
ATOM   237  N  N     . LEU A 1 18  ? 52.137 8.642   34.388 1.00 11.95 ? 33  LEU A N     1 
ATOM   238  C  CA    . LEU A 1 18  ? 51.294 9.338   35.405 1.00 10.86 ? 33  LEU A CA    1 
ATOM   239  C  C     . LEU A 1 18  ? 51.694 8.452   36.602 1.00 10.07 ? 33  LEU A C     1 
ATOM   240  O  O     . LEU A 1 18  ? 51.613 7.226   36.569 1.00 7.39  ? 33  LEU A O     1 
ATOM   241  C  CB    . LEU A 1 18  ? 49.787 9.219   35.044 1.00 10.24 ? 33  LEU A CB    1 
ATOM   242  C  CG    . LEU A 1 18  ? 49.463 9.908   33.687 1.00 10.13 ? 33  LEU A CG    1 
ATOM   243  C  CD1   . LEU A 1 18  ? 47.941 9.888   33.552 1.00 12.25 ? 33  LEU A CD1   1 
ATOM   244  C  CD2   . LEU A 1 18  ? 50.005 11.337  33.635 1.00 12.69 ? 33  LEU A CD2   1 
ATOM   245  H  H     . LEU A 1 18  ? 51.795 7.818   33.980 1.00 12.27 ? 33  LEU A H     1 
ATOM   246  H  HA    . LEU A 1 18  ? 51.638 10.352  35.551 1.00 10.80 ? 33  LEU A HA    1 
ATOM   247  H  HB2   . LEU A 1 18  ? 49.537 8.166   34.981 1.00 10.09 ? 33  LEU A HB2   1 
ATOM   248  H  HB3   . LEU A 1 18  ? 49.199 9.645   35.845 1.00 10.39 ? 33  LEU A HB3   1 
ATOM   249  H  HG    . LEU A 1 18  ? 49.886 9.328   32.875 1.00 11.09 ? 33  LEU A HG    1 
ATOM   250  H  HD11  . LEU A 1 18  ? 47.448 10.375  34.381 1.00 11.81 ? 33  LEU A HD11  1 
ATOM   251  H  HD12  . LEU A 1 18  ? 47.587 8.865   33.524 1.00 12.00 ? 33  LEU A HD12  1 
ATOM   252  H  HD13  . LEU A 1 18  ? 47.627 10.361  32.632 1.00 12.61 ? 33  LEU A HD13  1 
ATOM   253  H  HD21  . LEU A 1 18  ? 51.082 11.350  33.726 1.00 12.02 ? 33  LEU A HD21  1 
ATOM   254  H  HD22  . LEU A 1 18  ? 49.582 11.942  34.423 1.00 12.25 ? 33  LEU A HD22  1 
ATOM   255  H  HD23  . LEU A 1 18  ? 49.751 11.786  32.686 1.00 12.65 ? 33  LEU A HD23  1 
ATOM   256  N  N     . ASN A 1 19  ? 52.134 9.127   37.616 1.00 8.01  ? 34  ASN A N     1 
ATOM   257  C  CA    . ASN A 1 19  ? 52.600 8.481   38.862 1.00 9.12  ? 34  ASN A CA    1 
ATOM   258  C  C     . ASN A 1 19  ? 51.979 8.909   40.168 1.00 10.55 ? 34  ASN A C     1 
ATOM   259  O  O     . ASN A 1 19  ? 51.798 10.092  40.356 1.00 11.35 ? 34  ASN A O     1 
ATOM   260  C  CB    . ASN A 1 19  ? 54.149 8.721   38.859 1.00 9.96  ? 34  ASN A CB    1 
ATOM   261  C  CG    . ASN A 1 19  ? 54.823 8.026   40.030 1.00 12.48 ? 34  ASN A CG    1 
ATOM   262  O  OD1   . ASN A 1 19  ? 54.694 8.401   41.174 1.00 12.86 ? 34  ASN A OD1   1 
ATOM   263  N  ND2   . ASN A 1 19  ? 55.561 6.994   39.821 1.00 12.60 ? 34  ASN A ND2   1 
ATOM   264  H  H     . ASN A 1 19  ? 52.166 10.107  37.567 1.00 10.04 ? 34  ASN A H     1 
ATOM   265  H  HA    . ASN A 1 19  ? 52.432 7.419   38.759 1.00 9.21  ? 34  ASN A HA    1 
ATOM   266  H  HB2   . ASN A 1 19  ? 54.586 8.363   37.940 1.00 9.46  ? 34  ASN A HB2   1 
ATOM   267  H  HB3   . ASN A 1 19  ? 54.351 9.780   38.940 1.00 10.27 ? 34  ASN A HB3   1 
ATOM   268  H  HD21  . ASN A 1 19  ? 55.711 6.643   38.917 1.00 12.68 ? 34  ASN A HD21  1 
ATOM   269  H  HD22  . ASN A 1 19  ? 55.982 6.548   40.588 1.00 13.28 ? 34  ASN A HD22  1 
ATOM   270  N  N     . SER A 1 20  ? 51.638 7.983   41.028 1.00 10.17 ? 37  SER A N     1 
ATOM   271  C  CA    . SER A 1 20  ? 51.050 8.354   42.361 1.00 14.69 ? 37  SER A CA    1 
ATOM   272  C  C     . SER A 1 20  ? 51.774 7.434   43.357 1.00 14.96 ? 37  SER A C     1 
ATOM   273  O  O     . SER A 1 20  ? 51.224 6.857   44.273 1.00 17.29 ? 37  SER A O     1 
ATOM   274  C  CB    . SER A 1 20  ? 49.477 8.128   42.375 1.00 18.46 ? 37  SER A CB    1 
ATOM   275  O  OG    . SER A 1 20  ? 49.235 6.865   41.743 1.00 24.46 ? 37  SER A OG    1 
ATOM   276  H  H     . SER A 1 20  ? 51.748 7.031   40.810 1.00 11.41 ? 37  SER A H     1 
ATOM   277  H  HA    . SER A 1 20  ? 51.298 9.382   42.586 1.00 15.50 ? 37  SER A HA    1 
ATOM   278  H  HB2   . SER A 1 20  ? 49.120 8.087   43.396 1.00 18.49 ? 37  SER A HB2   1 
ATOM   279  H  HB3   . SER A 1 20  ? 48.962 8.918   41.845 1.00 17.12 ? 37  SER A HB3   1 
ATOM   280  H  HG    . SER A 1 20  ? 48.633 6.335   42.284 1.00 21.07 ? 37  SER A HG    1 
ATOM   281  N  N     . GLY A 1 21  ? 53.051 7.304   43.159 1.00 13.62 ? 38  GLY A N     1 
ATOM   282  C  CA    . GLY A 1 21  ? 53.882 6.433   44.042 1.00 13.48 ? 38  GLY A CA    1 
ATOM   283  C  C     . GLY A 1 21  ? 54.208 5.132   43.289 1.00 11.78 ? 38  GLY A C     1 
ATOM   284  O  O     . GLY A 1 21  ? 54.875 4.262   43.804 1.00 9.78  ? 38  GLY A O     1 
ATOM   285  H  H     . GLY A 1 21  ? 53.473 7.793   42.422 1.00 14.41 ? 38  GLY A H     1 
ATOM   286  H  HA2   . GLY A 1 21  ? 54.802 6.951   44.266 1.00 12.03 ? 38  GLY A HA2   1 
ATOM   287  H  HA3   . GLY A 1 21  ? 53.353 6.215   44.957 1.00 13.10 ? 38  GLY A HA3   1 
ATOM   288  N  N     . TYR A 1 22  ? 53.711 5.016   42.092 1.00 13.15 ? 39  TYR A N     1 
ATOM   289  C  CA    . TYR A 1 22  ? 53.902 3.864   41.180 1.00 13.38 ? 39  TYR A CA    1 
ATOM   290  C  C     . TYR A 1 22  ? 53.310 4.375   39.876 1.00 13.41 ? 39  TYR A C     1 
ATOM   291  O  O     . TYR A 1 22  ? 52.554 5.330   39.893 1.00 15.03 ? 39  TYR A O     1 
ATOM   292  C  CB    . TYR A 1 22  ? 53.126 2.571   41.605 1.00 12.88 ? 39  TYR A CB    1 
ATOM   293  C  CG    . TYR A 1 22  ? 51.636 2.845   41.823 1.00 15.64 ? 39  TYR A CG    1 
ATOM   294  C  CD1   . TYR A 1 22  ? 51.214 3.434   42.993 1.00 16.24 ? 39  TYR A CD1   1 
ATOM   295  C  CD2   . TYR A 1 22  ? 50.701 2.538   40.858 1.00 17.53 ? 39  TYR A CD2   1 
ATOM   296  C  CE1   . TYR A 1 22  ? 49.897 3.715   43.196 1.00 18.36 ? 39  TYR A CE1   1 
ATOM   297  C  CE2   . TYR A 1 22  ? 49.376 2.823   41.071 1.00 19.70 ? 39  TYR A CE2   1 
ATOM   298  C  CZ    . TYR A 1 22  ? 48.981 3.412   42.241 1.00 17.81 ? 39  TYR A CZ    1 
ATOM   299  O  OH    . TYR A 1 22  ? 47.670 3.705   42.484 1.00 24.84 ? 39  TYR A OH    1 
ATOM   300  H  H     . TYR A 1 22  ? 53.158 5.739   41.734 1.00 15.02 ? 39  TYR A H     1 
ATOM   301  H  HA    . TYR A 1 22  ? 54.958 3.675   41.064 1.00 12.98 ? 39  TYR A HA    1 
ATOM   302  H  HB2   . TYR A 1 22  ? 53.240 1.827   40.829 1.00 13.29 ? 39  TYR A HB2   1 
ATOM   303  H  HB3   . TYR A 1 22  ? 53.552 2.176   42.511 1.00 14.00 ? 39  TYR A HB3   1 
ATOM   304  H  HD1   . TYR A 1 22  ? 51.923 3.680   43.769 1.00 16.47 ? 39  TYR A HD1   1 
ATOM   305  H  HD2   . TYR A 1 22  ? 50.996 2.072   39.926 1.00 16.88 ? 39  TYR A HD2   1 
ATOM   306  H  HE1   . TYR A 1 22  ? 49.592 4.182   44.118 1.00 17.74 ? 39  TYR A HE1   1 
ATOM   307  H  HE2   . TYR A 1 22  ? 48.650 2.573   40.310 1.00 18.98 ? 39  TYR A HE2   1 
ATOM   308  H  HH    . TYR A 1 22  ? 47.166 3.067   41.961 1.00 22.10 ? 39  TYR A HH    1 
ATOM   309  N  N     . HIS A 1 23  ? 53.661 3.734   38.801 1.00 14.85 ? 40  HIS A N     1 
ATOM   310  C  CA    . HIS A 1 23  ? 53.174 4.101   37.429 1.00 14.11 ? 40  HIS A CA    1 
ATOM   311  C  C     . HIS A 1 23  ? 51.787 3.468   37.289 1.00 12.89 ? 40  HIS A C     1 
ATOM   312  O  O     . HIS A 1 23  ? 51.626 2.298   37.570 1.00 14.41 ? 40  HIS A O     1 
ATOM   313  C  CB    . HIS A 1 23  ? 54.145 3.502   36.327 1.00 14.02 ? 40  HIS A CB    1 
ATOM   314  C  CG    . HIS A 1 23  ? 53.536 3.553   34.920 1.00 10.41 ? 40  HIS A CG    1 
ATOM   315  N  ND1   . HIS A 1 23  ? 53.548 4.626   34.165 1.00 12.10 ? 40  HIS A ND1   1 
ATOM   316  C  CD2   . HIS A 1 23  ? 52.877 2.538   34.273 1.00 9.97  ? 40  HIS A CD2   1 
ATOM   317  C  CE1   . HIS A 1 23  ? 52.911 4.293   33.077 1.00 11.40 ? 40  HIS A CE1   1 
ATOM   318  N  NE2   . HIS A 1 23  ? 52.516 3.064   33.141 1.00 11.20 ? 40  HIS A NE2   1 
ATOM   319  H  H     . HIS A 1 23  ? 54.264 2.972   38.905 1.00 13.75 ? 40  HIS A H     1 
ATOM   320  H  HA    . HIS A 1 23  ? 53.093 5.177   37.354 1.00 14.29 ? 40  HIS A HA    1 
ATOM   321  H  HB2   . HIS A 1 23  ? 55.079 4.036   36.313 1.00 13.95 ? 40  HIS A HB2   1 
ATOM   322  H  HB3   . HIS A 1 23  ? 54.338 2.466   36.556 1.00 13.57 ? 40  HIS A HB3   1 
ATOM   323  H  HD2   . HIS A 1 23  ? 52.704 1.530   34.625 1.00 10.86 ? 40  HIS A HD2   1 
ATOM   324  H  HE1   . HIS A 1 23  ? 52.735 4.951   32.233 1.00 11.78 ? 40  HIS A HE1   1 
ATOM   325  H  HE2   . HIS A 1 23  ? 52.008 2.607   32.424 1.00 11.73 ? 40  HIS A HE2   1 
ATOM   326  N  N     . PHE A 1 24  ? 50.803 4.210   36.891 1.00 10.19 ? 41  PHE A N     1 
ATOM   327  C  CA    . PHE A 1 24  ? 49.451 3.609   36.726 1.00 13.84 ? 41  PHE A CA    1 
ATOM   328  C  C     . PHE A 1 24  ? 48.903 3.906   35.310 1.00 12.68 ? 41  PHE A C     1 
ATOM   329  O  O     . PHE A 1 24  ? 47.977 3.239   34.890 1.00 18.39 ? 41  PHE A O     1 
ATOM   330  C  CB    . PHE A 1 24  ? 48.481 4.131   37.819 1.00 12.04 ? 41  PHE A CB    1 
ATOM   331  C  CG    . PHE A 1 24  ? 48.178 5.608   37.804 1.00 12.37 ? 41  PHE A CG    1 
ATOM   332  C  CD1   . PHE A 1 24  ? 48.921 6.482   38.559 1.00 13.47 ? 41  PHE A CD1   1 
ATOM   333  C  CD2   . PHE A 1 24  ? 47.144 6.069   37.024 1.00 10.97 ? 41  PHE A CD2   1 
ATOM   334  C  CE1   . PHE A 1 24  ? 48.636 7.828   38.538 1.00 16.20 ? 41  PHE A CE1   1 
ATOM   335  C  CE2   . PHE A 1 24  ? 46.864 7.412   37.007 1.00 13.91 ? 41  PHE A CE2   1 
ATOM   336  C  CZ    . PHE A 1 24  ? 47.602 8.296   37.758 1.00 16.72 ? 41  PHE A CZ    1 
ATOM   337  H  H     . PHE A 1 24  ? 50.959 5.167   36.708 1.00 11.93 ? 41  PHE A H     1 
ATOM   338  H  HA    . PHE A 1 24  ? 49.523 2.536   36.832 1.00 12.94 ? 41  PHE A HA    1 
ATOM   339  H  HB2   . PHE A 1 24  ? 47.550 3.587   37.737 1.00 13.01 ? 41  PHE A HB2   1 
ATOM   340  H  HB3   . PHE A 1 24  ? 48.913 3.897   38.777 1.00 12.14 ? 41  PHE A HB3   1 
ATOM   341  H  HD1   . PHE A 1 24  ? 49.729 6.111   39.178 1.00 13.56 ? 41  PHE A HD1   1 
ATOM   342  H  HD2   . PHE A 1 24  ? 46.557 5.385   36.424 1.00 11.99 ? 41  PHE A HD2   1 
ATOM   343  H  HE1   . PHE A 1 24  ? 49.221 8.514   39.134 1.00 16.22 ? 41  PHE A HE1   1 
ATOM   344  H  HE2   . PHE A 1 24  ? 46.055 7.777   36.395 1.00 14.99 ? 41  PHE A HE2   1 
ATOM   345  H  HZ    . PHE A 1 24  ? 47.368 9.351   37.731 1.00 15.66 ? 41  PHE A HZ    1 
ATOM   346  N  N     . CYS A 1 25  ? 49.423 4.861   34.581 1.00 13.68 ? 42  CYS A N     1 
ATOM   347  C  CA    . CYS A 1 25  ? 48.910 5.138   33.207 1.00 11.37 ? 42  CYS A CA    1 
ATOM   348  C  C     . CYS A 1 25  ? 49.942 5.939   32.441 1.00 9.62  ? 42  CYS A C     1 
ATOM   349  O  O     . CYS A 1 25  ? 50.862 6.498   33.021 1.00 9.55  ? 42  CYS A O     1 
ATOM   350  C  CB    . CYS A 1 25  ? 47.609 5.950   33.254 1.00 10.97 ? 42  CYS A CB    1 
ATOM   351  S  SG    . CYS A 1 25  ? 46.023 5.079   33.518 1.00 9.88  ? 42  CYS A SG    1 
ATOM   352  H  H     . CYS A 1 25  ? 50.161 5.417   34.909 1.00 13.79 ? 42  CYS A H     1 
ATOM   353  H  HA    . CYS A 1 25  ? 48.759 4.198   32.698 1.00 9.96  ? 42  CYS A HA    1 
ATOM   354  H  HB2   . CYS A 1 25  ? 47.707 6.679   34.043 1.00 11.96 ? 42  CYS A HB2   1 
ATOM   355  H  HB3   . CYS A 1 25  ? 47.505 6.501   32.329 1.00 11.78 ? 42  CYS A HB3   1 
ATOM   356  N  N     . GLY A 1 26  ? 49.770 5.996   31.152 1.00 9.91  ? 43  GLY A N     1 
ATOM   357  C  CA    . GLY A 1 26  ? 50.713 6.763   30.284 1.00 10.82 ? 43  GLY A CA    1 
ATOM   358  C  C     . GLY A 1 26  ? 49.958 8.036   29.863 1.00 9.13  ? 43  GLY A C     1 
ATOM   359  O  O     . GLY A 1 26  ? 48.842 8.289   30.281 1.00 7.00  ? 43  GLY A O     1 
ATOM   360  H  H     . GLY A 1 26  ? 49.005 5.538   30.748 1.00 9.99  ? 43  GLY A H     1 
ATOM   361  H  HA2   . GLY A 1 26  ? 51.605 7.027   30.832 1.00 11.43 ? 43  GLY A HA2   1 
ATOM   362  H  HA3   . GLY A 1 26  ? 50.963 6.179   29.415 1.00 10.85 ? 43  GLY A HA3   1 
ATOM   363  N  N     . GLY A 1 27  ? 50.551 8.850   29.051 1.00 11.73 ? 44  GLY A N     1 
ATOM   364  C  CA    . GLY A 1 27  ? 49.875 10.087  28.598 1.00 10.79 ? 44  GLY A CA    1 
ATOM   365  C  C     . GLY A 1 27  ? 50.795 10.658  27.506 1.00 10.98 ? 44  GLY A C     1 
ATOM   366  O  O     . GLY A 1 27  ? 51.865 10.106  27.262 1.00 10.15 ? 44  GLY A O     1 
ATOM   367  H  H     . GLY A 1 27  ? 51.463 8.672   28.716 1.00 13.28 ? 44  GLY A H     1 
ATOM   368  H  HA2   . GLY A 1 27  ? 48.909 9.845   28.184 1.00 9.94  ? 44  GLY A HA2   1 
ATOM   369  H  HA3   . GLY A 1 27  ? 49.767 10.762  29.432 1.00 10.34 ? 44  GLY A HA3   1 
ATOM   370  N  N     . SER A 1 28  ? 50.358 11.724  26.894 1.00 10.83 ? 45  SER A N     1 
ATOM   371  C  CA    . SER A 1 28  ? 51.140 12.394  25.819 1.00 11.39 ? 45  SER A CA    1 
ATOM   372  C  C     . SER A 1 28  ? 51.246 13.890  26.105 1.00 12.07 ? 45  SER A C     1 
ATOM   373  O  O     . SER A 1 28  ? 50.278 14.526  26.468 1.00 11.65 ? 45  SER A O     1 
ATOM   374  C  CB    . SER A 1 28  ? 50.460 12.263  24.461 1.00 13.08 ? 45  SER A CB    1 
ATOM   375  O  OG    . SER A 1 28  ? 50.359 10.878  24.258 1.00 16.42 ? 45  SER A OG    1 
ATOM   376  H  H     . SER A 1 28  ? 49.485 12.095  27.139 1.00 11.09 ? 45  SER A H     1 
ATOM   377  H  HA    . SER A 1 28  ? 52.131 11.962  25.797 1.00 11.89 ? 45  SER A HA    1 
ATOM   378  H  HB2   . SER A 1 28  ? 49.469 12.687  24.465 1.00 13.19 ? 45  SER A HB2   1 
ATOM   379  H  HB3   . SER A 1 28  ? 51.056 12.699  23.674 1.00 12.73 ? 45  SER A HB3   1 
ATOM   380  H  HG    . SER A 1 28  ? 49.420 10.659  24.340 1.00 14.56 ? 45  SER A HG    1 
ATOM   381  N  N     . LEU A 1 29  ? 52.410 14.420  25.918 1.00 11.67 ? 46  LEU A N     1 
ATOM   382  C  CA    . LEU A 1 29  ? 52.649 15.865  26.156 1.00 11.39 ? 46  LEU A CA    1 
ATOM   383  C  C     . LEU A 1 29  ? 52.192 16.594  24.871 1.00 12.24 ? 46  LEU A C     1 
ATOM   384  O  O     . LEU A 1 29  ? 52.775 16.312  23.833 1.00 13.62 ? 46  LEU A O     1 
ATOM   385  C  CB    . LEU A 1 29  ? 54.164 16.049  26.395 1.00 10.22 ? 46  LEU A CB    1 
ATOM   386  C  CG    . LEU A 1 29  ? 54.534 17.521  26.776 1.00 10.93 ? 46  LEU A CG    1 
ATOM   387  C  CD1   . LEU A 1 29  ? 53.941 17.861  28.151 1.00 11.51 ? 46  LEU A CD1   1 
ATOM   388  C  CD2   . LEU A 1 29  ? 56.068 17.635  26.800 1.00 11.87 ? 46  LEU A CD2   1 
ATOM   389  H  H     . LEU A 1 29  ? 53.150 13.850  25.614 1.00 11.37 ? 46  LEU A H     1 
ATOM   390  H  HA    . LEU A 1 29  ? 52.056 16.183  27.001 1.00 12.78 ? 46  LEU A HA    1 
ATOM   391  H  HB2   . LEU A 1 29  ? 54.503 15.376  27.170 1.00 10.79 ? 46  LEU A HB2   1 
ATOM   392  H  HB3   . LEU A 1 29  ? 54.682 15.793  25.479 1.00 9.86  ? 46  LEU A HB3   1 
ATOM   393  H  HG    . LEU A 1 29  ? 54.138 18.217  26.050 1.00 11.29 ? 46  LEU A HG    1 
ATOM   394  H  HD11  . LEU A 1 29  ? 54.290 17.176  28.910 1.00 11.98 ? 46  LEU A HD11  1 
ATOM   395  H  HD12  . LEU A 1 29  ? 52.860 17.818  28.122 1.00 11.36 ? 46  LEU A HD12  1 
ATOM   396  H  HD13  . LEU A 1 29  ? 54.214 18.868  28.436 1.00 11.89 ? 46  LEU A HD13  1 
ATOM   397  H  HD21  . LEU A 1 29  ? 56.475 17.453  25.816 1.00 12.50 ? 46  LEU A HD21  1 
ATOM   398  H  HD22  . LEU A 1 29  ? 56.489 16.908  27.479 1.00 12.10 ? 46  LEU A HD22  1 
ATOM   399  H  HD23  . LEU A 1 29  ? 56.368 18.621  27.119 1.00 12.30 ? 46  LEU A HD23  1 
ATOM   400  N  N     . ILE A 1 30  ? 51.220 17.481  24.888 1.00 14.06 ? 47  ILE A N     1 
ATOM   401  C  CA    . ILE A 1 30  ? 50.845 18.143  23.589 1.00 15.07 ? 47  ILE A CA    1 
ATOM   402  C  C     . ILE A 1 30  ? 51.348 19.605  23.573 1.00 14.00 ? 47  ILE A C     1 
ATOM   403  O  O     . ILE A 1 30  ? 51.195 20.261  22.580 1.00 13.91 ? 47  ILE A O     1 
ATOM   404  C  CB    . ILE A 1 30  ? 49.284 18.068  23.358 1.00 16.24 ? 47  ILE A CB    1 
ATOM   405  C  CG1   . ILE A 1 30  ? 48.465 18.629  24.510 1.00 18.78 ? 47  ILE A CG1   1 
ATOM   406  C  CG2   . ILE A 1 30  ? 48.895 16.583  23.125 1.00 16.63 ? 47  ILE A CG2   1 
ATOM   407  C  CD1   . ILE A 1 30  ? 47.014 18.781  23.993 1.00 21.58 ? 47  ILE A CD1   1 
ATOM   408  H  H     . ILE A 1 30  ? 50.758 17.709  25.729 1.00 15.61 ? 47  ILE A H     1 
ATOM   409  H  HA    . ILE A 1 30  ? 51.333 17.640  22.767 1.00 12.86 ? 47  ILE A HA    1 
ATOM   410  H  HB    . ILE A 1 30  ? 49.082 18.622  22.448 1.00 16.43 ? 47  ILE A HB    1 
ATOM   411  H  HG12  . ILE A 1 30  ? 48.509 17.981  25.376 1.00 17.76 ? 47  ILE A HG12  1 
ATOM   412  H  HG13  . ILE A 1 30  ? 48.835 19.608  24.783 1.00 18.42 ? 47  ILE A HG13  1 
ATOM   413  H  HG21  . ILE A 1 30  ? 49.152 15.982  23.985 1.00 16.99 ? 47  ILE A HG21  1 
ATOM   414  H  HG22  . ILE A 1 30  ? 49.428 16.209  22.261 1.00 17.04 ? 47  ILE A HG22  1 
ATOM   415  H  HG23  . ILE A 1 30  ? 47.843 16.476  22.920 1.00 16.87 ? 47  ILE A HG23  1 
ATOM   416  H  HD11  . ILE A 1 30  ? 46.594 17.842  23.675 1.00 20.55 ? 47  ILE A HD11  1 
ATOM   417  H  HD12  . ILE A 1 30  ? 46.988 19.460  23.150 1.00 20.23 ? 47  ILE A HD12  1 
ATOM   418  H  HD13  . ILE A 1 30  ? 46.384 19.177  24.775 1.00 20.82 ? 47  ILE A HD13  1 
ATOM   419  N  N     . ASN A 1 31  ? 51.893 20.124  24.631 1.00 16.36 ? 48  ASN A N     1 
ATOM   420  C  CA    . ASN A 1 31  ? 52.445 21.532  24.639 1.00 16.81 ? 48  ASN A CA    1 
ATOM   421  C  C     . ASN A 1 31  ? 53.228 21.591  25.927 1.00 18.08 ? 48  ASN A C     1 
ATOM   422  O  O     . ASN A 1 31  ? 53.240 20.589  26.613 1.00 14.27 ? 48  ASN A O     1 
ATOM   423  C  CB    . ASN A 1 31  ? 51.399 22.698  24.594 1.00 18.55 ? 48  ASN A CB    1 
ATOM   424  C  CG    . ASN A 1 31  ? 50.418 22.842  25.691 1.00 19.57 ? 48  ASN A CG    1 
ATOM   425  O  OD1   . ASN A 1 31  ? 50.752 22.749  26.848 1.00 19.67 ? 48  ASN A OD1   1 
ATOM   426  N  ND2   . ASN A 1 31  ? 49.182 23.083  25.367 1.00 25.74 ? 48  ASN A ND2   1 
ATOM   427  H  H     . ASN A 1 31  ? 51.958 19.602  25.463 1.00 17.14 ? 48  ASN A H     1 
ATOM   428  H  HA    . ASN A 1 31  ? 53.126 21.636  23.809 1.00 18.99 ? 48  ASN A HA    1 
ATOM   429  H  HB2   . ASN A 1 31  ? 51.957 23.622  24.550 1.00 18.27 ? 48  ASN A HB2   1 
ATOM   430  H  HB3   . ASN A 1 31  ? 50.867 22.611  23.661 1.00 18.62 ? 48  ASN A HB3   1 
ATOM   431  H  HD21  . ASN A 1 31  ? 48.496 23.200  26.059 1.00 24.62 ? 48  ASN A HD21  1 
ATOM   432  H  HD22  . ASN A 1 31  ? 48.927 23.154  24.421 1.00 23.75 ? 48  ASN A HD22  1 
ATOM   433  N  N     . SER A 1 32  ? 53.855 22.668  26.311 1.00 17.72 ? 49  SER A N     1 
ATOM   434  C  CA    . SER A 1 32  ? 54.632 22.610  27.596 1.00 18.90 ? 49  SER A CA    1 
ATOM   435  C  C     . SER A 1 32  ? 53.906 22.563  28.921 1.00 15.28 ? 49  SER A C     1 
ATOM   436  O  O     . SER A 1 32  ? 54.544 22.359  29.941 1.00 17.38 ? 49  SER A O     1 
ATOM   437  C  CB    . SER A 1 32  ? 55.610 23.795  27.602 1.00 21.01 ? 49  SER A CB    1 
ATOM   438  O  OG    . SER A 1 32  ? 54.828 24.909  27.177 1.00 24.80 ? 49  SER A OG    1 
ATOM   439  H  H     . SER A 1 32  ? 53.821 23.494  25.785 1.00 19.20 ? 49  SER A H     1 
ATOM   440  H  HA    . SER A 1 32  ? 55.226 21.708  27.551 1.00 18.63 ? 49  SER A HA    1 
ATOM   441  H  HB2   . SER A 1 32  ? 55.994 23.957  28.598 1.00 21.18 ? 49  SER A HB2   1 
ATOM   442  H  HB3   . SER A 1 32  ? 56.436 23.629  26.922 1.00 20.81 ? 49  SER A HB3   1 
ATOM   443  H  HG    . SER A 1 32  ? 54.918 25.615  27.831 1.00 23.89 ? 49  SER A HG    1 
ATOM   444  N  N     . GLN A 1 33  ? 52.624 22.757  28.923 1.00 15.59 ? 50  GLN A N     1 
ATOM   445  C  CA    . GLN A 1 33  ? 51.919 22.703  30.222 1.00 18.13 ? 50  GLN A CA    1 
ATOM   446  C  C     . GLN A 1 33  ? 50.726 21.757  30.178 1.00 12.54 ? 50  GLN A C     1 
ATOM   447  O  O     . GLN A 1 33  ? 50.065 21.632  31.190 1.00 13.73 ? 50  GLN A O     1 
ATOM   448  C  CB    . GLN A 1 33  ? 51.474 24.171  30.614 1.00 24.23 ? 50  GLN A CB    1 
ATOM   449  C  CG    . GLN A 1 33  ? 51.777 24.296  32.152 1.00 31.44 ? 50  GLN A CG    1 
ATOM   450  C  CD    . GLN A 1 33  ? 51.595 25.730  32.687 1.00 35.80 ? 50  GLN A CD    1 
ATOM   451  O  OE1   . GLN A 1 33  ? 51.642 26.666  31.909 1.00 38.81 ? 50  GLN A OE1   1 
ATOM   452  N  NE2   . GLN A 1 33  ? 51.399 25.944  33.969 1.00 36.70 ? 50  GLN A NE2   1 
ATOM   453  H  H     . GLN A 1 33  ? 52.139 22.931  28.086 1.00 15.48 ? 50  GLN A H     1 
ATOM   454  H  HA    . GLN A 1 33  ? 52.594 22.304  30.966 1.00 17.76 ? 50  GLN A HA    1 
ATOM   455  H  HB2   . GLN A 1 33  ? 52.026 24.926  30.073 1.00 23.73 ? 50  GLN A HB2   1 
ATOM   456  H  HB3   . GLN A 1 33  ? 50.420 24.322  30.428 1.00 24.04 ? 50  GLN A HB3   1 
ATOM   457  H  HG2   . GLN A 1 33  ? 51.112 23.638  32.697 1.00 31.29 ? 50  GLN A HG2   1 
ATOM   458  H  HG3   . GLN A 1 33  ? 52.796 23.997  32.356 1.00 31.36 ? 50  GLN A HG3   1 
ATOM   459  H  HE21  . GLN A 1 33  ? 51.286 26.860  34.298 1.00 36.28 ? 50  GLN A HE21  1 
ATOM   460  H  HE22  . GLN A 1 33  ? 51.364 25.196  34.607 1.00 35.88 ? 50  GLN A HE22  1 
ATOM   461  N  N     . TRP A 1 34  ? 50.447 21.122  29.069 1.00 13.38 ? 51  TRP A N     1 
ATOM   462  C  CA    . TRP A 1 34  ? 49.275 20.205  29.029 1.00 15.17 ? 51  TRP A CA    1 
ATOM   463  C  C     . TRP A 1 34  ? 49.601 18.766  28.500 1.00 13.43 ? 51  TRP A C     1 
ATOM   464  O  O     . TRP A 1 34  ? 50.390 18.585  27.581 1.00 11.62 ? 51  TRP A O     1 
ATOM   465  C  CB    . TRP A 1 34  ? 48.136 20.817  28.119 1.00 14.04 ? 51  TRP A CB    1 
ATOM   466  C  CG    . TRP A 1 34  ? 47.478 22.096  28.692 1.00 13.02 ? 51  TRP A CG    1 
ATOM   467  C  CD1   . TRP A 1 34  ? 47.921 23.373  28.501 1.00 15.57 ? 51  TRP A CD1   1 
ATOM   468  C  CD2   . TRP A 1 34  ? 46.349 22.142  29.442 1.00 11.83 ? 51  TRP A CD2   1 
ATOM   469  N  NE1   . TRP A 1 34  ? 47.027 24.101  29.145 1.00 14.37 ? 51  TRP A NE1   1 
ATOM   470  C  CE2   . TRP A 1 34  ? 46.041 23.466  29.745 1.00 12.61 ? 51  TRP A CE2   1 
ATOM   471  C  CE3   . TRP A 1 34  ? 45.519 21.132  29.902 1.00 14.71 ? 51  TRP A CE3   1 
ATOM   472  C  CZ2   . TRP A 1 34  ? 44.916 23.787  30.490 1.00 12.06 ? 51  TRP A CZ2   1 
ATOM   473  C  CZ3   . TRP A 1 34  ? 44.385 21.434  30.657 1.00 16.68 ? 51  TRP A CZ3   1 
ATOM   474  C  CH2   . TRP A 1 34  ? 44.085 22.760  30.948 1.00 15.70 ? 51  TRP A CH2   1 
ATOM   475  H  H     . TRP A 1 34  ? 51.000 21.241  28.269 1.00 12.85 ? 51  TRP A H     1 
ATOM   476  H  HA    . TRP A 1 34  ? 48.876 20.118  30.032 1.00 14.52 ? 51  TRP A HA    1 
ATOM   477  H  HB2   . TRP A 1 34  ? 48.534 21.050  27.144 1.00 14.06 ? 51  TRP A HB2   1 
ATOM   478  H  HB3   . TRP A 1 34  ? 47.360 20.077  27.984 1.00 14.26 ? 51  TRP A HB3   1 
ATOM   479  H  HD1   . TRP A 1 34  ? 48.792 23.716  27.959 1.00 15.10 ? 51  TRP A HD1   1 
ATOM   480  H  HE1   . TRP A 1 34  ? 47.064 25.092  29.188 1.00 15.56 ? 51  TRP A HE1   1 
ATOM   481  H  HE3   . TRP A 1 34  ? 45.755 20.103  29.677 1.00 14.48 ? 51  TRP A HE3   1 
ATOM   482  H  HZ2   . TRP A 1 34  ? 44.688 24.826  30.717 1.00 12.20 ? 51  TRP A HZ2   1 
ATOM   483  H  HZ3   . TRP A 1 34  ? 43.744 20.640  31.014 1.00 15.57 ? 51  TRP A HZ3   1 
ATOM   484  H  HH2   . TRP A 1 34  ? 43.207 23.000  31.529 1.00 15.40 ? 51  TRP A HH2   1 
ATOM   485  N  N     . VAL A 1 35  ? 48.949 17.813  29.117 1.00 12.62 ? 52  VAL A N     1 
ATOM   486  C  CA    . VAL A 1 35  ? 49.077 16.369  28.794 1.00 10.87 ? 52  VAL A CA    1 
ATOM   487  C  C     . VAL A 1 35  ? 47.687 15.813  28.487 1.00 12.87 ? 52  VAL A C     1 
ATOM   488  O  O     . VAL A 1 35  ? 46.712 16.247  29.077 1.00 12.86 ? 52  VAL A O     1 
ATOM   489  C  CB    . VAL A 1 35  ? 49.677 15.616  30.015 1.00 12.89 ? 52  VAL A CB    1 
ATOM   490  C  CG1   . VAL A 1 35  ? 49.567 14.057  29.871 1.00 12.35 ? 52  VAL A CG1   1 
ATOM   491  C  CG2   . VAL A 1 35  ? 51.147 16.006  30.178 1.00 10.89 ? 52  VAL A CG2   1 
ATOM   492  H  H     . VAL A 1 35  ? 48.331 18.055  29.844 1.00 11.08 ? 52  VAL A H     1 
ATOM   493  H  HA    . VAL A 1 35  ? 49.701 16.276  27.917 1.00 12.20 ? 52  VAL A HA    1 
ATOM   494  H  HB    . VAL A 1 35  ? 49.138 15.908  30.901 1.00 12.29 ? 52  VAL A HB    1 
ATOM   495  H  HG11  . VAL A 1 35  ? 50.095 13.716  28.989 1.00 12.29 ? 52  VAL A HG11  1 
ATOM   496  H  HG12  . VAL A 1 35  ? 48.534 13.749  29.791 1.00 12.36 ? 52  VAL A HG12  1 
ATOM   497  H  HG13  . VAL A 1 35  ? 49.984 13.570  30.740 1.00 12.53 ? 52  VAL A HG13  1 
ATOM   498  H  HG21  . VAL A 1 35  ? 51.236 17.072  30.340 1.00 11.17 ? 52  VAL A HG21  1 
ATOM   499  H  HG22  . VAL A 1 35  ? 51.728 15.738  29.308 1.00 11.39 ? 52  VAL A HG22  1 
ATOM   500  H  HG23  . VAL A 1 35  ? 51.562 15.506  31.038 1.00 11.86 ? 52  VAL A HG23  1 
ATOM   501  N  N     . VAL A 1 36  ? 47.630 14.873  27.583 1.00 10.32 ? 53  VAL A N     1 
ATOM   502  C  CA    . VAL A 1 36  ? 46.340 14.253  27.227 1.00 12.01 ? 53  VAL A CA    1 
ATOM   503  C  C     . VAL A 1 36  ? 46.518 12.748  27.657 1.00 10.29 ? 53  VAL A C     1 
ATOM   504  O  O     . VAL A 1 36  ? 47.541 12.108  27.400 1.00 11.59 ? 53  VAL A O     1 
ATOM   505  C  CB    A VAL A 1 36  ? 46.130 14.485  25.692 0.25 11.27 ? 53  VAL A CB    1 
ATOM   506  C  CB    B VAL A 1 36  ? 46.101 14.307  25.689 0.73 13.73 ? 53  VAL A CB    1 
ATOM   507  C  CG1   A VAL A 1 36  ? 47.248 13.848  24.862 0.25 11.12 ? 53  VAL A CG1   1 
ATOM   508  C  CG1   B VAL A 1 36  ? 44.728 13.715  25.312 0.73 15.78 ? 53  VAL A CG1   1 
ATOM   509  C  CG2   A VAL A 1 36  ? 44.748 13.975  25.235 0.25 12.08 ? 53  VAL A CG2   1 
ATOM   510  C  CG2   B VAL A 1 36  ? 46.212 15.744  25.155 0.73 15.84 ? 53  VAL A CG2   1 
ATOM   511  H  H     . VAL A 1 36  ? 48.448 14.573  27.134 1.00 11.88 ? 53  VAL A H     1 
ATOM   512  H  HA    . VAL A 1 36  ? 45.534 14.712  27.788 1.00 11.75 ? 53  VAL A HA    1 
ATOM   513  H  HB    A VAL A 1 36  ? 46.150 15.553  25.522 0.25 11.70 ? 53  VAL A HB    1 
ATOM   514  H  HB    B VAL A 1 36  ? 46.861 13.697  25.217 0.73 14.04 ? 53  VAL A HB    1 
ATOM   515  H  HG11  A VAL A 1 36  ? 47.278 12.775  25.005 0.25 11.07 ? 53  VAL A HG11  1 
ATOM   516  H  HG11  B VAL A 1 36  ? 43.926 14.247  25.808 0.73 15.06 ? 53  VAL A HG11  1 
ATOM   517  H  HG12  A VAL A 1 36  ? 48.198 14.269  25.155 0.25 11.06 ? 53  VAL A HG12  1 
ATOM   518  H  HG12  B VAL A 1 36  ? 44.685 12.672  25.600 0.73 14.89 ? 53  VAL A HG12  1 
ATOM   519  H  HG13  A VAL A 1 36  ? 47.090 14.060  23.817 0.25 11.09 ? 53  VAL A HG13  1 
ATOM   520  H  HG13  B VAL A 1 36  ? 44.572 13.769  24.245 0.73 15.56 ? 53  VAL A HG13  1 
ATOM   521  H  HG21  A VAL A 1 36  ? 43.967 14.497  25.772 0.25 11.51 ? 53  VAL A HG21  1 
ATOM   522  H  HG21  B VAL A 1 36  ? 47.201 16.132  25.356 0.73 14.91 ? 53  VAL A HG21  1 
ATOM   523  H  HG22  A VAL A 1 36  ? 44.647 12.915  25.424 0.25 11.60 ? 53  VAL A HG22  1 
ATOM   524  H  HG22  B VAL A 1 36  ? 45.491 16.395  25.617 0.73 14.81 ? 53  VAL A HG22  1 
ATOM   525  H  HG23  A VAL A 1 36  ? 44.608 14.155  24.179 0.25 11.70 ? 53  VAL A HG23  1 
ATOM   526  H  HG23  B VAL A 1 36  ? 46.048 15.753  24.088 0.73 14.93 ? 53  VAL A HG23  1 
ATOM   527  N  N     . SER A 1 37  ? 45.503 12.266  28.317 1.00 8.48  ? 54  SER A N     1 
ATOM   528  C  CA    . SER A 1 37  ? 45.499 10.860  28.790 1.00 7.03  ? 54  SER A CA    1 
ATOM   529  C  C     . SER A 1 37  ? 44.050 10.362  28.673 1.00 11.04 ? 54  SER A C     1 
ATOM   530  O  O     . SER A 1 37  ? 43.206 10.961  28.028 1.00 9.55  ? 54  SER A O     1 
ATOM   531  C  CB    . SER A 1 37  ? 46.064 10.844  30.215 1.00 3.63  ? 54  SER A CB    1 
ATOM   532  O  OG    . SER A 1 37  ? 46.065 9.475   30.645 1.00 6.67  ? 54  SER A OG    1 
ATOM   533  H  H     . SER A 1 37  ? 44.723 12.838  28.492 1.00 8.87  ? 54  SER A H     1 
ATOM   534  H  HA    . SER A 1 37  ? 46.122 10.279  28.122 1.00 9.85  ? 54  SER A HA    1 
ATOM   535  H  HB2   . SER A 1 37  ? 47.081 11.204  30.219 1.00 5.80  ? 54  SER A HB2   1 
ATOM   536  H  HB3   . SER A 1 37  ? 45.465 11.437  30.891 1.00 5.38  ? 54  SER A HB3   1 
ATOM   537  H  HG    . SER A 1 37  ? 46.978 9.159   30.774 1.00 4.73  ? 54  SER A HG    1 
ATOM   538  N  N     . ALA A 1 38  ? 43.770 9.274   29.316 1.00 12.19 ? 55  ALA A N     1 
ATOM   539  C  CA    . ALA A 1 38  ? 42.415 8.715   29.243 1.00 12.83 ? 55  ALA A CA    1 
ATOM   540  C  C     . ALA A 1 38  ? 41.666 9.103   30.476 1.00 12.02 ? 55  ALA A C     1 
ATOM   541  O  O     . ALA A 1 38  ? 42.251 9.185   31.531 1.00 5.05  ? 55  ALA A O     1 
ATOM   542  C  CB    . ALA A 1 38  ? 42.540 7.196   29.140 1.00 13.24 ? 55  ALA A CB    1 
ATOM   543  H  H     . ALA A 1 38  ? 44.474 8.852   29.861 1.00 9.33  ? 55  ALA A H     1 
ATOM   544  H  HA    . ALA A 1 38  ? 41.919 9.112   28.367 1.00 13.34 ? 55  ALA A HA    1 
ATOM   545  H  HB1   . ALA A 1 38  ? 43.053 6.826   30.018 1.00 12.24 ? 55  ALA A HB1   1 
ATOM   546  H  HB2   . ALA A 1 38  ? 43.105 6.947   28.253 1.00 12.00 ? 55  ALA A HB2   1 
ATOM   547  H  HB3   . ALA A 1 38  ? 41.571 6.740   29.075 1.00 12.24 ? 55  ALA A HB3   1 
ATOM   548  N  N     . ALA A 1 39  ? 40.389 9.324   30.304 1.00 8.33  ? 56  ALA A N     1 
ATOM   549  C  CA    . ALA A 1 39  ? 39.516 9.710   31.457 1.00 9.13  ? 56  ALA A CA    1 
ATOM   550  C  C     . ALA A 1 39  ? 39.500 8.663   32.533 1.00 9.73  ? 56  ALA A C     1 
ATOM   551  O  O     . ALA A 1 39  ? 39.459 8.982   33.696 1.00 9.17  ? 56  ALA A O     1 
ATOM   552  C  CB    . ALA A 1 39  ? 38.051 9.918   31.017 1.00 10.29 ? 56  ALA A CB    1 
ATOM   553  H  H     . ALA A 1 39  ? 40.018 9.245   29.406 1.00 10.65 ? 56  ALA A H     1 
ATOM   554  H  HA    . ALA A 1 39  ? 39.910 10.612  31.901 1.00 9.32  ? 56  ALA A HA    1 
ATOM   555  H  HB1   . ALA A 1 39  ? 37.636 9.024   30.581 1.00 9.85  ? 56  ALA A HB1   1 
ATOM   556  H  HB2   . ALA A 1 39  ? 37.966 10.734  30.313 1.00 9.61  ? 56  ALA A HB2   1 
ATOM   557  H  HB3   . ALA A 1 39  ? 37.448 10.156  31.883 1.00 9.81  ? 56  ALA A HB3   1 
ATOM   558  N  N     . HIS A 1 40  ? 39.533 7.425   32.154 1.00 9.23  ? 57  HIS A N     1 
ATOM   559  C  CA    . HIS A 1 40  ? 39.507 6.412   33.227 1.00 7.30  ? 57  HIS A CA    1 
ATOM   560  C  C     . HIS A 1 40  ? 40.813 6.371   34.005 1.00 10.48 ? 57  HIS A C     1 
ATOM   561  O  O     . HIS A 1 40  ? 40.895 5.639   34.971 1.00 10.30 ? 57  HIS A O     1 
ATOM   562  C  CB    . HIS A 1 40  ? 39.158 5.011   32.629 1.00 10.07 ? 57  HIS A CB    1 
ATOM   563  C  CG    . HIS A 1 40  ? 40.228 4.199   31.895 1.00 11.56 ? 57  HIS A CG    1 
ATOM   564  N  ND1   . HIS A 1 40  ? 40.381 4.047   30.602 1.00 12.91 ? 57  HIS A ND1   1 
ATOM   565  C  CD2   . HIS A 1 40  ? 41.228 3.441   32.498 1.00 13.68 ? 57  HIS A CD2   1 
ATOM   566  C  CE1   . HIS A 1 40  ? 41.386 3.260   30.384 1.00 12.30 ? 57  HIS A CE1   1 
ATOM   567  N  NE2   . HIS A 1 40  ? 41.897 2.892   31.516 1.00 15.03 ? 57  HIS A NE2   1 
ATOM   568  H  H     . HIS A 1 40  ? 39.578 7.209   31.214 1.00 7.20  ? 57  HIS A H     1 
ATOM   569  H  HA    . HIS A 1 40  ? 38.725 6.683   33.921 1.00 8.89  ? 57  HIS A HA    1 
ATOM   570  H  HB2   . HIS A 1 40  ? 38.876 4.430   33.497 1.00 10.16 ? 57  HIS A HB2   1 
ATOM   571  H  HB3   . HIS A 1 40  ? 38.273 5.077   32.011 1.00 8.92  ? 57  HIS A HB3   1 
ATOM   572  H  HD1   . HIS A 1 40  ? 39.826 4.426   29.893 1.00 11.95 ? 57  HIS A HD1   1 
ATOM   573  H  HD2   . HIS A 1 40  ? 41.406 3.339   33.563 1.00 13.20 ? 57  HIS A HD2   1 
ATOM   574  H  HE1   . HIS A 1 40  ? 41.758 2.954   29.420 1.00 13.30 ? 57  HIS A HE1   1 
ATOM   575  H  HE2   . HIS A 1 40  ? 42.665 2.275   31.608 1.00 14.23 ? 57  HIS A HE2   1 
ATOM   576  N  N     . CYS A 1 41  ? 41.816 7.119   33.626 1.00 5.37  ? 58  CYS A N     1 
ATOM   577  C  CA    . CYS A 1 41  ? 43.090 7.092   34.410 1.00 11.99 ? 58  CYS A CA    1 
ATOM   578  C  C     . CYS A 1 41  ? 43.019 8.195   35.492 1.00 14.26 ? 58  CYS A C     1 
ATOM   579  O  O     . CYS A 1 41  ? 43.939 8.435   36.248 1.00 15.89 ? 58  CYS A O     1 
ATOM   580  C  CB    . CYS A 1 41  ? 44.245 7.423   33.545 1.00 10.48 ? 58  CYS A CB    1 
ATOM   581  S  SG    . CYS A 1 41  ? 44.727 6.134   32.387 1.00 12.75 ? 58  CYS A SG    1 
ATOM   582  H  H     . CYS A 1 41  ? 41.764 7.705   32.842 1.00 8.89  ? 58  CYS A H     1 
ATOM   583  H  HA    . CYS A 1 41  ? 43.205 6.131   34.891 1.00 11.95 ? 58  CYS A HA    1 
ATOM   584  H  HB2   . CYS A 1 41  ? 44.055 8.322   32.978 1.00 11.50 ? 58  CYS A HB2   1 
ATOM   585  H  HB3   . CYS A 1 41  ? 45.102 7.623   34.170 1.00 11.42 ? 58  CYS A HB3   1 
ATOM   586  N  N     . TYR A 1 42  ? 41.919 8.869   35.564 1.00 17.16 ? 59  TYR A N     1 
ATOM   587  C  CA    . TYR A 1 42  ? 41.790 9.945   36.572 1.00 19.30 ? 59  TYR A CA    1 
ATOM   588  C  C     . TYR A 1 42  ? 41.859 9.577   38.054 1.00 18.29 ? 59  TYR A C     1 
ATOM   589  O  O     . TYR A 1 42  ? 41.259 8.622   38.478 1.00 18.22 ? 59  TYR A O     1 
ATOM   590  C  CB    . TYR A 1 42  ? 40.438 10.678  36.333 1.00 21.20 ? 59  TYR A CB    1 
ATOM   591  C  CG    . TYR A 1 42  ? 40.247 11.713  37.427 1.00 22.80 ? 59  TYR A CG    1 
ATOM   592  C  CD1   . TYR A 1 42  ? 39.574 11.364  38.579 1.00 26.24 ? 59  TYR A CD1   1 
ATOM   593  C  CD2   . TYR A 1 42  ? 40.774 12.964  37.299 1.00 22.98 ? 59  TYR A CD2   1 
ATOM   594  C  CE1   . TYR A 1 42  ? 39.431 12.259  39.604 1.00 27.48 ? 59  TYR A CE1   1 
ATOM   595  C  CE2   . TYR A 1 42  ? 40.631 13.859  38.323 1.00 27.51 ? 59  TYR A CE2   1 
ATOM   596  C  CZ    . TYR A 1 42  ? 39.962 13.518  39.482 1.00 30.63 ? 59  TYR A CZ    1 
ATOM   597  O  OH    . TYR A 1 42  ? 39.843 14.450  40.490 1.00 33.50 ? 59  TYR A OH    1 
ATOM   598  H  H     . TYR A 1 42  ? 41.177 8.671   34.957 1.00 15.90 ? 59  TYR A H     1 
ATOM   599  H  HA    . TYR A 1 42  ? 42.585 10.648  36.374 1.00 19.51 ? 59  TYR A HA    1 
ATOM   600  H  HB2   . TYR A 1 42  ? 40.405 11.153  35.364 1.00 21.34 ? 59  TYR A HB2   1 
ATOM   601  H  HB3   . TYR A 1 42  ? 39.639 9.958   36.406 1.00 20.93 ? 59  TYR A HB3   1 
ATOM   602  H  HD1   . TYR A 1 42  ? 39.152 10.372  38.680 1.00 26.33 ? 59  TYR A HD1   1 
ATOM   603  H  HD2   . TYR A 1 42  ? 41.295 13.247  36.399 1.00 24.34 ? 59  TYR A HD2   1 
ATOM   604  H  HE1   . TYR A 1 42  ? 38.903 11.958  40.497 1.00 28.69 ? 59  TYR A HE1   1 
ATOM   605  H  HE2   . TYR A 1 42  ? 41.043 14.852  38.239 1.00 27.85 ? 59  TYR A HE2   1 
ATOM   606  H  HH    . TYR A 1 42  ? 39.153 14.153  41.094 1.00 32.77 ? 59  TYR A HH    1 
ATOM   607  N  N     . LYS A 1 43  ? 42.587 10.332  38.818 1.00 18.13 ? 60  LYS A N     1 
ATOM   608  C  CA    . LYS A 1 43  ? 42.687 10.093  40.277 1.00 21.37 ? 60  LYS A CA    1 
ATOM   609  C  C     . LYS A 1 43  ? 43.295 11.391  40.800 1.00 22.46 ? 60  LYS A C     1 
ATOM   610  O  O     . LYS A 1 43  ? 43.689 12.249  40.021 1.00 19.31 ? 60  LYS A O     1 
ATOM   611  C  CB    . LYS A 1 43  ? 43.574 8.931   40.607 1.00 23.79 ? 60  LYS A CB    1 
ATOM   612  C  CG    . LYS A 1 43  ? 45.027 9.187   40.338 1.00 27.22 ? 60  LYS A CG    1 
ATOM   613  C  CD    . LYS A 1 43  ? 45.826 8.144   41.119 1.00 29.59 ? 60  LYS A CD    1 
ATOM   614  C  CE    . LYS A 1 43  ? 45.482 6.782   40.581 1.00 31.89 ? 60  LYS A CE    1 
ATOM   615  N  NZ    . LYS A 1 43  ? 46.319 5.789   41.290 1.00 36.11 ? 60  LYS A NZ    1 
ATOM   616  H  H     . LYS A 1 43  ? 43.086 11.088  38.452 1.00 20.10 ? 60  LYS A H     1 
ATOM   617  H  HA    . LYS A 1 43  ? 41.693 9.965   40.688 1.00 22.31 ? 60  LYS A HA    1 
ATOM   618  H  HB2   . LYS A 1 43  ? 43.425 8.724   41.656 1.00 24.17 ? 60  LYS A HB2   1 
ATOM   619  H  HB3   . LYS A 1 43  ? 43.224 8.081   40.041 1.00 23.65 ? 60  LYS A HB3   1 
ATOM   620  H  HG2   . LYS A 1 43  ? 45.219 9.109   39.277 1.00 27.21 ? 60  LYS A HG2   1 
ATOM   621  H  HG3   . LYS A 1 43  ? 45.342 10.163  40.678 1.00 26.91 ? 60  LYS A HG3   1 
ATOM   622  H  HD2   . LYS A 1 43  ? 46.885 8.314   40.975 1.00 29.78 ? 60  LYS A HD2   1 
ATOM   623  H  HD3   . LYS A 1 43  ? 45.617 8.189   42.178 1.00 29.14 ? 60  LYS A HD3   1 
ATOM   624  H  HE2   . LYS A 1 43  ? 44.446 6.519   40.729 1.00 32.23 ? 60  LYS A HE2   1 
ATOM   625  H  HE3   . LYS A 1 43  ? 45.723 6.735   39.531 1.00 32.18 ? 60  LYS A HE3   1 
ATOM   626  H  HZ1   . LYS A 1 43  ? 45.706 5.117   41.795 1.00 35.55 ? 60  LYS A HZ1   1 
ATOM   627  H  HZ2   . LYS A 1 43  ? 46.940 6.276   41.968 1.00 34.96 ? 60  LYS A HZ2   1 
ATOM   628  H  HZ3   . LYS A 1 43  ? 46.899 5.276   40.595 1.00 35.45 ? 60  LYS A HZ3   1 
ATOM   629  N  N     . SER A 1 44  ? 43.395 11.544  42.082 1.00 25.34 ? 61  SER A N     1 
ATOM   630  C  CA    . SER A 1 44  ? 43.988 12.800  42.589 1.00 25.99 ? 61  SER A CA    1 
ATOM   631  C  C     . SER A 1 44  ? 45.399 12.397  42.993 1.00 23.34 ? 61  SER A C     1 
ATOM   632  O  O     . SER A 1 44  ? 45.706 11.222  43.099 1.00 23.87 ? 61  SER A O     1 
ATOM   633  C  CB    . SER A 1 44  ? 43.115 13.293  43.773 1.00 29.17 ? 61  SER A CB    1 
ATOM   634  O  OG    . SER A 1 44  ? 43.042 12.176  44.663 1.00 30.29 ? 61  SER A OG    1 
ATOM   635  H  H     . SER A 1 44  ? 43.105 10.857  42.717 1.00 24.89 ? 61  SER A H     1 
ATOM   636  H  HA    . SER A 1 44  ? 44.032 13.547  41.808 1.00 26.32 ? 61  SER A HA    1 
ATOM   637  H  HB2   . SER A 1 44  ? 43.581 14.130  44.276 1.00 28.52 ? 61  SER A HB2   1 
ATOM   638  H  HB3   . SER A 1 44  ? 42.130 13.576  43.427 1.00 28.04 ? 61  SER A HB3   1 
ATOM   639  H  HG    . SER A 1 44  ? 42.150 11.811  44.623 1.00 30.44 ? 61  SER A HG    1 
ATOM   640  N  N     . GLY A 1 45  ? 46.239 13.363  43.185 1.00 22.16 ? 62  GLY A N     1 
ATOM   641  C  CA    . GLY A 1 45  ? 47.633 13.070  43.590 1.00 23.07 ? 62  GLY A CA    1 
ATOM   642  C  C     . GLY A 1 45  ? 48.435 12.600  42.397 1.00 24.96 ? 62  GLY A C     1 
ATOM   643  O  O     . GLY A 1 45  ? 49.218 11.670  42.529 1.00 31.40 ? 62  GLY A O     1 
ATOM   644  H  H     . GLY A 1 45  ? 45.960 14.292  43.053 1.00 22.81 ? 62  GLY A H     1 
ATOM   645  H  HA2   . GLY A 1 45  ? 48.086 13.961  43.994 1.00 24.08 ? 62  GLY A HA2   1 
ATOM   646  H  HA3   . GLY A 1 45  ? 47.623 12.292  44.343 1.00 23.63 ? 62  GLY A HA3   1 
ATOM   647  N  N     . ILE A 1 46  ? 48.259 13.225  41.271 1.00 20.13 ? 63  ILE A N     1 
ATOM   648  C  CA    . ILE A 1 46  ? 49.033 12.784  40.079 1.00 19.89 ? 63  ILE A CA    1 
ATOM   649  C  C     . ILE A 1 46  ? 50.319 13.608  39.895 1.00 17.43 ? 63  ILE A C     1 
ATOM   650  O  O     . ILE A 1 46  ? 50.315 14.830  39.947 1.00 17.98 ? 63  ILE A O     1 
ATOM   651  C  CB    . ILE A 1 46  ? 48.166 12.944  38.757 1.00 16.80 ? 63  ILE A CB    1 
ATOM   652  C  CG1   . ILE A 1 46  ? 46.965 11.996  38.826 1.00 18.35 ? 63  ILE A CG1   1 
ATOM   653  C  CG2   . ILE A 1 46  ? 48.999 12.643  37.488 1.00 19.86 ? 63  ILE A CG2   1 
ATOM   654  C  CD1   . ILE A 1 46  ? 46.085 12.052  37.560 1.00 17.38 ? 63  ILE A CD1   1 
ATOM   655  H  H     . ILE A 1 46  ? 47.630 13.976  41.207 1.00 22.18 ? 63  ILE A H     1 
ATOM   656  H  HA    . ILE A 1 46  ? 49.301 11.742  40.203 1.00 18.82 ? 63  ILE A HA    1 
ATOM   657  H  HB    . ILE A 1 46  ? 47.822 13.969  38.708 1.00 18.03 ? 63  ILE A HB    1 
ATOM   658  H  HG12  . ILE A 1 46  ? 47.299 10.986  39.015 1.00 17.61 ? 63  ILE A HG12  1 
ATOM   659  H  HG13  . ILE A 1 46  ? 46.351 12.304  39.665 1.00 18.37 ? 63  ILE A HG13  1 
ATOM   660  H  HG21  . ILE A 1 46  ? 49.343 11.617  37.488 1.00 18.19 ? 63  ILE A HG21  1 
ATOM   661  H  HG22  . ILE A 1 46  ? 49.860 13.292  37.421 1.00 18.12 ? 63  ILE A HG22  1 
ATOM   662  H  HG23  . ILE A 1 46  ? 48.406 12.813  36.603 1.00 18.75 ? 63  ILE A HG23  1 
ATOM   663  H  HD11  . ILE A 1 46  ? 46.625 11.734  36.681 1.00 18.22 ? 63  ILE A HD11  1 
ATOM   664  H  HD12  . ILE A 1 46  ? 45.712 13.054  37.405 1.00 18.00 ? 63  ILE A HD12  1 
ATOM   665  H  HD13  . ILE A 1 46  ? 45.239 11.393  37.687 1.00 17.86 ? 63  ILE A HD13  1 
ATOM   666  N  N     . GLN A 1 47  ? 51.386 12.899  39.691 1.00 14.62 ? 64  GLN A N     1 
ATOM   667  C  CA    . GLN A 1 47  ? 52.684 13.565  39.450 1.00 13.46 ? 64  GLN A CA    1 
ATOM   668  C  C     . GLN A 1 47  ? 52.936 13.086  37.995 1.00 15.13 ? 64  GLN A C     1 
ATOM   669  O  O     . GLN A 1 47  ? 52.832 11.904  37.699 1.00 15.87 ? 64  GLN A O     1 
ATOM   670  C  CB    . GLN A 1 47  ? 53.811 13.040  40.343 1.00 13.55 ? 64  GLN A CB    1 
ATOM   671  C  CG    . GLN A 1 47  ? 55.092 13.794  39.987 1.00 15.08 ? 64  GLN A CG    1 
ATOM   672  C  CD    . GLN A 1 47  ? 56.183 13.301  40.904 1.00 16.42 ? 64  GLN A CD    1 
ATOM   673  O  OE1   . GLN A 1 47  ? 56.519 12.146  40.863 1.00 18.45 ? 64  GLN A OE1   1 
ATOM   674  N  NE2   . GLN A 1 47  ? 56.767 14.093  41.743 1.00 18.02 ? 64  GLN A NE2   1 
ATOM   675  H  H     . GLN A 1 47  ? 51.351 11.917  39.695 1.00 14.49 ? 64  GLN A H     1 
ATOM   676  H  HA    . GLN A 1 47  ? 52.573 14.640  39.480 1.00 15.14 ? 64  GLN A HA    1 
ATOM   677  H  HB2   . GLN A 1 47  ? 53.592 13.163  41.392 1.00 14.20 ? 64  GLN A HB2   1 
ATOM   678  H  HB3   . GLN A 1 47  ? 53.969 11.991  40.139 1.00 15.39 ? 64  GLN A HB3   1 
ATOM   679  H  HG2   . GLN A 1 47  ? 55.395 13.595  38.968 1.00 15.68 ? 64  GLN A HG2   1 
ATOM   680  H  HG3   . GLN A 1 47  ? 54.968 14.859  40.125 1.00 16.07 ? 64  GLN A HG3   1 
ATOM   681  H  HE21  . GLN A 1 47  ? 57.486 13.746  42.319 1.00 17.16 ? 64  GLN A HE21  1 
ATOM   682  H  HE22  . GLN A 1 47  ? 56.508 15.035  41.816 1.00 17.29 ? 64  GLN A HE22  1 
ATOM   683  N  N     . VAL A 1 48  ? 53.264 13.992  37.130 1.00 9.55  ? 65  VAL A N     1 
ATOM   684  C  CA    . VAL A 1 48  ? 53.532 13.647  35.716 1.00 11.27 ? 65  VAL A CA    1 
ATOM   685  C  C     . VAL A 1 48  ? 55.057 13.517  35.597 1.00 12.85 ? 65  VAL A C     1 
ATOM   686  O  O     . VAL A 1 48  ? 55.790 14.399  36.027 1.00 10.18 ? 65  VAL A O     1 
ATOM   687  C  CB    . VAL A 1 48  ? 53.002 14.789  34.808 1.00 11.89 ? 65  VAL A CB    1 
ATOM   688  C  CG1   . VAL A 1 48  ? 53.309 14.520  33.316 1.00 14.42 ? 65  VAL A CG1   1 
ATOM   689  C  CG2   . VAL A 1 48  ? 51.477 14.900  34.999 1.00 15.12 ? 65  VAL A CG2   1 
ATOM   690  H  H     . VAL A 1 48  ? 53.342 14.921  37.410 1.00 12.22 ? 65  VAL A H     1 
ATOM   691  H  HA    . VAL A 1 48  ? 53.067 12.698  35.484 1.00 11.51 ? 65  VAL A HA    1 
ATOM   692  H  HB    . VAL A 1 48  ? 53.483 15.711  35.107 1.00 12.81 ? 65  VAL A HB    1 
ATOM   693  H  HG11  . VAL A 1 48  ? 52.871 13.587  32.989 1.00 13.43 ? 65  VAL A HG11  1 
ATOM   694  H  HG12  . VAL A 1 48  ? 54.378 14.470  33.170 1.00 13.61 ? 65  VAL A HG12  1 
ATOM   695  H  HG13  . VAL A 1 48  ? 52.936 15.319  32.696 1.00 13.10 ? 65  VAL A HG13  1 
ATOM   696  H  HG21  . VAL A 1 48  ? 51.258 15.145  36.029 1.00 14.58 ? 65  VAL A HG21  1 
ATOM   697  H  HG22  . VAL A 1 48  ? 50.991 13.963  34.757 1.00 14.61 ? 65  VAL A HG22  1 
ATOM   698  H  HG23  . VAL A 1 48  ? 51.058 15.673  34.372 1.00 14.56 ? 65  VAL A HG23  1 
ATOM   699  N  N     . ARG A 1 49  A 55.487 12.421  35.029 1.00 9.64  ? 65  ARG A N     1 
ATOM   700  C  CA    . ARG A 1 49  A 56.930 12.202  34.861 1.00 9.23  ? 65  ARG A CA    1 
ATOM   701  C  C     . ARG A 1 49  A 57.248 12.102  33.370 1.00 10.87 ? 65  ARG A C     1 
ATOM   702  O  O     . ARG A 1 49  A 56.841 11.186  32.658 1.00 13.09 ? 65  ARG A O     1 
ATOM   703  C  CB    . ARG A 1 49  A 57.312 10.933  35.614 1.00 7.97  ? 65  ARG A CB    1 
ATOM   704  C  CG    . ARG A 1 49  A 56.952 11.051  37.126 1.00 8.90  ? 65  ARG A CG    1 
ATOM   705  C  CD    . ARG A 1 49  A 57.505 9.804   37.865 1.00 9.58  ? 65  ARG A CD    1 
ATOM   706  N  NE    . ARG A 1 49  A 57.339 10.026  39.324 1.00 13.26 ? 65  ARG A NE    1 
ATOM   707  C  CZ    . ARG A 1 49  A 58.119 9.465   40.219 1.00 13.06 ? 65  ARG A CZ    1 
ATOM   708  N  NH1   . ARG A 1 49  A 58.113 9.928   41.436 1.00 16.24 ? 65  ARG A NH1   1 
ATOM   709  N  NH2   . ARG A 1 49  A 58.869 8.455   39.896 1.00 12.74 ? 65  ARG A NH2   1 
ATOM   710  H  H     . ARG A 1 49  A 54.842 11.750  34.718 1.00 12.64 ? 65  ARG A H     1 
ATOM   711  H  HA    . ARG A 1 49  A 57.466 13.045  35.278 1.00 11.27 ? 65  ARG A HA    1 
ATOM   712  H  HB2   . ARG A 1 49  A 56.791 10.100  35.167 1.00 9.82  ? 65  ARG A HB2   1 
ATOM   713  H  HB3   . ARG A 1 49  A 58.374 10.779  35.493 1.00 9.08  ? 65  ARG A HB3   1 
ATOM   714  H  HG2   . ARG A 1 49  A 57.380 11.944  37.563 1.00 9.39  ? 65  ARG A HG2   1 
ATOM   715  H  HG3   . ARG A 1 49  A 55.881 11.100  37.262 1.00 8.77  ? 65  ARG A HG3   1 
ATOM   716  H  HD2   . ARG A 1 49  A 56.938 8.923   37.602 1.00 11.15 ? 65  ARG A HD2   1 
ATOM   717  H  HD3   . ARG A 1 49  A 58.551 9.642   37.655 1.00 10.51 ? 65  ARG A HD3   1 
ATOM   718  H  HE    . ARG A 1 49  A 56.618 10.615  39.625 1.00 12.38 ? 65  ARG A HE    1 
ATOM   719  H  HH11  . ARG A 1 49  A 58.696 9.507   42.130 1.00 15.63 ? 65  ARG A HH11  1 
ATOM   720  H  HH12  . ARG A 1 49  A 57.531 10.700  41.682 1.00 15.10 ? 65  ARG A HH12  1 
ATOM   721  H  HH21  . ARG A 1 49  A 59.462 8.023   40.574 1.00 13.17 ? 65  ARG A HH21  1 
ATOM   722  H  HH22  . ARG A 1 49  A 58.847 8.118   38.964 1.00 13.15 ? 65  ARG A HH22  1 
ATOM   723  N  N     . LEU A 1 50  ? 58.005 13.102  33.015 1.00 11.27 ? 66  LEU A N     1 
ATOM   724  C  CA    . LEU A 1 50  ? 58.514 13.340  31.630 1.00 10.58 ? 66  LEU A CA    1 
ATOM   725  C  C     . LEU A 1 50  ? 60.002 12.885  31.543 1.00 11.54 ? 66  LEU A C     1 
ATOM   726  O  O     . LEU A 1 50  ? 60.692 12.743  32.544 1.00 11.39 ? 66  LEU A O     1 
ATOM   727  C  CB    A LEU A 1 50  ? 58.454 14.872  31.310 0.50 10.60 ? 66  LEU A CB    1 
ATOM   728  C  CB    B LEU A 1 50  ? 58.443 14.860  31.270 0.49 11.39 ? 66  LEU A CB    1 
ATOM   729  C  CG    A LEU A 1 50  ? 57.069 15.517  31.665 0.50 11.55 ? 66  LEU A CG    1 
ATOM   730  C  CG    B LEU A 1 50  ? 57.019 15.490  31.492 0.49 12.76 ? 66  LEU A CG    1 
ATOM   731  C  CD1   A LEU A 1 50  ? 57.179 17.061  31.723 0.50 11.81 ? 66  LEU A CD1   1 
ATOM   732  C  CD1   B LEU A 1 50  ? 56.795 15.946  32.971 0.49 13.54 ? 66  LEU A CD1   1 
ATOM   733  C  CD2   A LEU A 1 50  ? 56.071 15.146  30.577 0.50 12.22 ? 66  LEU A CD2   1 
ATOM   734  C  CD2   B LEU A 1 50  ? 56.880 16.702  30.559 0.49 13.74 ? 66  LEU A CD2   1 
ATOM   735  H  H     . LEU A 1 50  ? 58.269 13.752  33.703 1.00 11.02 ? 66  LEU A H     1 
ATOM   736  H  HA    . LEU A 1 50  ? 57.927 12.779  30.918 1.00 11.18 ? 66  LEU A HA    1 
ATOM   737  H  HB2   A LEU A 1 50  ? 59.239 15.356  31.871 0.50 10.65 ? 66  LEU A HB2   1 
ATOM   738  H  HB2   B LEU A 1 50  ? 59.186 15.387  31.850 0.49 11.44 ? 66  LEU A HB2   1 
ATOM   739  H  HB3   A LEU A 1 50  ? 58.683 15.006  30.262 0.50 10.19 ? 66  LEU A HB3   1 
ATOM   740  H  HB3   B LEU A 1 50  ? 58.730 14.949  30.231 0.49 11.04 ? 66  LEU A HB3   1 
ATOM   741  H  HG    A LEU A 1 50  ? 56.711 15.154  32.620 0.50 11.93 ? 66  LEU A HG    1 
ATOM   742  H  HG    B LEU A 1 50  ? 56.261 14.761  31.234 0.49 12.45 ? 66  LEU A HG    1 
ATOM   743  H  HD11  A LEU A 1 50  ? 57.520 17.460  30.778 0.50 11.79 ? 66  LEU A HD11  1 
ATOM   744  H  HD11  B LEU A 1 50  ? 57.517 16.698  33.260 0.49 13.84 ? 66  LEU A HD11  1 
ATOM   745  H  HD12  A LEU A 1 50  ? 57.873 17.361  32.496 0.50 11.64 ? 66  LEU A HD12  1 
ATOM   746  H  HD12  B LEU A 1 50  ? 56.877 15.127  33.668 0.49 13.72 ? 66  LEU A HD12  1 
ATOM   747  H  HD13  A LEU A 1 50  ? 56.217 17.494  31.959 0.50 11.64 ? 66  LEU A HD13  1 
ATOM   748  H  HD13  B LEU A 1 50  ? 55.809 16.372  33.088 0.49 13.39 ? 66  LEU A HD13  1 
ATOM   749  H  HD21  A LEU A 1 50  ? 55.974 14.073  30.542 0.50 12.26 ? 66  LEU A HD21  1 
ATOM   750  H  HD21  B LEU A 1 50  ? 56.976 16.386  29.529 0.49 13.36 ? 66  LEU A HD21  1 
ATOM   751  H  HD22  A LEU A 1 50  ? 56.406 15.486  29.604 0.50 11.92 ? 66  LEU A HD22  1 
ATOM   752  H  HD22  B LEU A 1 50  ? 57.646 17.436  30.762 0.49 13.31 ? 66  LEU A HD22  1 
ATOM   753  H  HD23  A LEU A 1 50  ? 55.099 15.575  30.776 0.50 12.12 ? 66  LEU A HD23  1 
ATOM   754  H  HD23  B LEU A 1 50  ? 55.913 17.170  30.682 0.49 13.07 ? 66  LEU A HD23  1 
ATOM   755  N  N     . GLY A 1 51  ? 60.431 12.683  30.323 1.00 11.00 ? 69  GLY A N     1 
ATOM   756  C  CA    . GLY A 1 51  ? 61.847 12.251  29.980 1.00 10.91 ? 69  GLY A CA    1 
ATOM   757  C  C     . GLY A 1 51  ? 62.307 10.924  30.559 1.00 10.44 ? 69  GLY A C     1 
ATOM   758  O  O     . GLY A 1 51  ? 63.491 10.709  30.760 1.00 10.76 ? 69  GLY A O     1 
ATOM   759  H  H     . GLY A 1 51  ? 59.792 12.820  29.591 1.00 11.52 ? 69  GLY A H     1 
ATOM   760  H  HA2   . GLY A 1 51  ? 61.951 12.219  28.908 1.00 11.45 ? 69  GLY A HA2   1 
ATOM   761  H  HA3   . GLY A 1 51  ? 62.519 13.009  30.357 1.00 11.16 ? 69  GLY A HA3   1 
ATOM   762  N  N     . GLU A 1 52  ? 61.355 10.060  30.780 1.00 11.38 ? 70  GLU A N     1 
ATOM   763  C  CA    . GLU A 1 52  ? 61.637 8.733   31.349 1.00 6.78  ? 70  GLU A CA    1 
ATOM   764  C  C     . GLU A 1 52  ? 61.910 7.622   30.376 1.00 9.36  ? 70  GLU A C     1 
ATOM   765  O  O     . GLU A 1 52  ? 61.453 7.622   29.249 1.00 10.83 ? 70  GLU A O     1 
ATOM   766  C  CB    . GLU A 1 52  ? 60.431 8.239   32.182 1.00 10.05 ? 70  GLU A CB    1 
ATOM   767  C  CG    . GLU A 1 52  ? 60.128 8.960   33.527 1.00 10.79 ? 70  GLU A CG    1 
ATOM   768  C  CD    . GLU A 1 52  ? 61.041 8.420   34.605 1.00 11.78 ? 70  GLU A CD    1 
ATOM   769  O  OE1   . GLU A 1 52  ? 60.698 8.561   35.754 1.00 13.27 ? 70  GLU A OE1   1 
ATOM   770  O  OE2   . GLU A 1 52  ? 62.052 7.904   34.221 1.00 11.23 ? 70  GLU A OE2   1 
ATOM   771  H  H     . GLU A 1 52  ? 60.429 10.302  30.554 1.00 9.19  ? 70  GLU A H     1 
ATOM   772  H  HA    . GLU A 1 52  ? 62.516 8.845   31.957 1.00 10.72 ? 70  GLU A HA    1 
ATOM   773  H  HB2   . GLU A 1 52  ? 59.555 8.342   31.564 1.00 10.32 ? 70  GLU A HB2   1 
ATOM   774  H  HB3   . GLU A 1 52  ? 60.510 7.175   32.361 1.00 9.78  ? 70  GLU A HB3   1 
ATOM   775  H  HG2   . GLU A 1 52  ? 60.277 10.029  33.438 1.00 10.80 ? 70  GLU A HG2   1 
ATOM   776  H  HG3   . GLU A 1 52  ? 59.104 8.770   33.810 1.00 10.68 ? 70  GLU A HG3   1 
ATOM   777  N  N     . ASP A 1 53  ? 62.683 6.692   30.864 1.00 12.48 ? 71  ASP A N     1 
ATOM   778  C  CA    . ASP A 1 53  ? 62.993 5.486   30.037 1.00 12.39 ? 71  ASP A CA    1 
ATOM   779  C  C     . ASP A 1 53  ? 62.784 4.451   31.144 1.00 11.43 ? 71  ASP A C     1 
ATOM   780  O  O     . ASP A 1 53  ? 61.741 3.830   31.240 1.00 10.69 ? 71  ASP A O     1 
ATOM   781  C  CB    . ASP A 1 53  ? 64.434 5.421   29.500 1.00 13.93 ? 71  ASP A CB    1 
ATOM   782  C  CG    . ASP A 1 53  ? 64.481 4.185   28.570 1.00 14.95 ? 71  ASP A CG    1 
ATOM   783  O  OD1   . ASP A 1 53  ? 65.549 3.616   28.513 1.00 16.09 ? 71  ASP A OD1   1 
ATOM   784  O  OD2   . ASP A 1 53  ? 63.480 3.861   27.962 1.00 16.76 ? 71  ASP A OD2   1 
ATOM   785  H  H     . ASP A 1 53  ? 63.056 6.786   31.753 1.00 9.73  ? 71  ASP A H     1 
ATOM   786  H  HA    . ASP A 1 53  ? 62.224 5.356   29.288 1.00 12.33 ? 71  ASP A HA    1 
ATOM   787  H  HB2   . ASP A 1 53  ? 64.660 6.297   28.910 1.00 13.46 ? 71  ASP A HB2   1 
ATOM   788  H  HB3   . ASP A 1 53  ? 65.184 5.305   30.263 1.00 13.39 ? 71  ASP A HB3   1 
ATOM   789  N  N     . ASN A 1 54  ? 63.749 4.275   32.009 1.00 12.12 ? 72  ASN A N     1 
ATOM   790  C  CA    . ASN A 1 54  ? 63.581 3.278   33.120 1.00 12.55 ? 72  ASN A CA    1 
ATOM   791  C  C     . ASN A 1 54  ? 62.755 4.005   34.192 1.00 12.52 ? 72  ASN A C     1 
ATOM   792  O  O     . ASN A 1 54  ? 63.299 4.943   34.773 1.00 13.49 ? 72  ASN A O     1 
ATOM   793  C  CB    . ASN A 1 54  ? 64.953 2.876   33.683 1.00 13.86 ? 72  ASN A CB    1 
ATOM   794  C  CG    . ASN A 1 54  ? 64.842 1.831   34.786 1.00 11.89 ? 72  ASN A CG    1 
ATOM   795  O  OD1   . ASN A 1 54  ? 63.928 1.769   35.585 1.00 13.37 ? 72  ASN A OD1   1 
ATOM   796  N  ND2   . ASN A 1 54  ? 65.782 0.968   34.883 1.00 15.24 ? 72  ASN A ND2   1 
ATOM   797  H  H     . ASN A 1 54  ? 64.578 4.779   31.921 1.00 10.95 ? 72  ASN A H     1 
ATOM   798  H  HA    . ASN A 1 54  ? 63.039 2.417   32.758 1.00 14.00 ? 72  ASN A HA    1 
ATOM   799  H  HB2   . ASN A 1 54  ? 65.544 2.447   32.888 1.00 13.11 ? 72  ASN A HB2   1 
ATOM   800  H  HB3   . ASN A 1 54  ? 65.493 3.714   34.091 1.00 13.96 ? 72  ASN A HB3   1 
ATOM   801  H  HD21  . ASN A 1 54  ? 65.754 0.297   35.595 1.00 14.83 ? 72  ASN A HD21  1 
ATOM   802  H  HD22  . ASN A 1 54  ? 66.527 0.982   34.245 1.00 14.46 ? 72  ASN A HD22  1 
ATOM   803  N  N     . ILE A 1 55  ? 61.537 3.660   34.466 1.00 10.96 ? 73  ILE A N     1 
ATOM   804  C  CA    . ILE A 1 55  ? 60.723 4.366   35.498 1.00 13.22 ? 73  ILE A CA    1 
ATOM   805  C  C     . ILE A 1 55  ? 61.082 4.028   36.934 1.00 13.13 ? 73  ILE A C     1 
ATOM   806  O  O     . ILE A 1 55  ? 60.475 4.566   37.834 1.00 15.45 ? 73  ILE A O     1 
ATOM   807  C  CB    . ILE A 1 55  ? 59.198 4.063   35.281 1.00 12.71 ? 73  ILE A CB    1 
ATOM   808  C  CG1   . ILE A 1 55  ? 58.913 2.538   35.166 1.00 15.13 ? 73  ILE A CG1   1 
ATOM   809  C  CG2   . ILE A 1 55  ? 58.725 4.778   33.992 1.00 10.98 ? 73  ILE A CG2   1 
ATOM   810  C  CD1   . ILE A 1 55  ? 57.404 2.345   35.387 1.00 16.64 ? 73  ILE A CD1   1 
ATOM   811  H  H     . ILE A 1 55  ? 61.126 2.903   33.977 1.00 12.86 ? 73  ILE A H     1 
ATOM   812  H  HA    . ILE A 1 55  ? 60.861 5.425   35.381 1.00 14.11 ? 73  ILE A HA    1 
ATOM   813  H  HB    . ILE A 1 55  ? 58.657 4.450   36.132 1.00 12.82 ? 73  ILE A HB    1 
ATOM   814  H  HG12  . ILE A 1 55  ? 59.189 2.154   34.191 1.00 14.05 ? 73  ILE A HG12  1 
ATOM   815  H  HG13  . ILE A 1 55  ? 59.459 1.982   35.916 1.00 15.08 ? 73  ILE A HG13  1 
ATOM   816  H  HG21  . ILE A 1 55  ? 59.292 4.431   33.142 1.00 12.15 ? 73  ILE A HG21  1 
ATOM   817  H  HG22  . ILE A 1 55  ? 58.831 5.848   34.055 1.00 11.33 ? 73  ILE A HG22  1 
ATOM   818  H  HG23  . ILE A 1 55  ? 57.684 4.567   33.799 1.00 11.93 ? 73  ILE A HG23  1 
ATOM   819  H  HD11  . ILE A 1 55  ? 56.826 2.869   34.639 1.00 15.41 ? 73  ILE A HD11  1 
ATOM   820  H  HD12  . ILE A 1 55  ? 57.127 2.707   36.365 1.00 15.61 ? 73  ILE A HD12  1 
ATOM   821  H  HD13  . ILE A 1 55  ? 57.154 1.296   35.331 1.00 15.72 ? 73  ILE A HD13  1 
ATOM   822  N  N     . ASN A 1 56  ? 62.026 3.173   37.132 1.00 15.64 ? 74  ASN A N     1 
ATOM   823  C  CA    . ASN A 1 56  ? 62.413 2.830   38.531 1.00 18.19 ? 74  ASN A CA    1 
ATOM   824  C  C     . ASN A 1 56  ? 63.788 3.399   38.860 1.00 19.22 ? 74  ASN A C     1 
ATOM   825  O  O     . ASN A 1 56  ? 64.216 3.285   39.986 1.00 18.55 ? 74  ASN A O     1 
ATOM   826  C  CB    . ASN A 1 56  ? 62.460 1.322   38.704 1.00 19.71 ? 74  ASN A CB    1 
ATOM   827  C  CG    . ASN A 1 56  ? 61.031 0.820   38.690 1.00 22.81 ? 74  ASN A CG    1 
ATOM   828  O  OD1   . ASN A 1 56  ? 60.217 1.238   39.490 1.00 26.61 ? 74  ASN A OD1   1 
ATOM   829  N  ND2   . ASN A 1 56  ? 60.665 -0.061  37.812 1.00 25.18 ? 74  ASN A ND2   1 
ATOM   830  H  H     . ASN A 1 56  ? 62.479 2.738   36.381 1.00 16.77 ? 74  ASN A H     1 
ATOM   831  H  HA    . ASN A 1 56  ? 61.698 3.244   39.232 1.00 17.72 ? 74  ASN A HA    1 
ATOM   832  H  HB2   . ASN A 1 56  ? 63.038 0.859   37.921 1.00 20.01 ? 74  ASN A HB2   1 
ATOM   833  H  HB3   . ASN A 1 56  ? 62.905 1.085   39.661 1.00 20.32 ? 74  ASN A HB3   1 
ATOM   834  H  HD21  . ASN A 1 56  ? 59.741 -0.398  37.781 1.00 24.38 ? 74  ASN A HD21  1 
ATOM   835  H  HD22  . ASN A 1 56  ? 61.303 -0.408  37.162 1.00 24.56 ? 74  ASN A HD22  1 
ATOM   836  N  N     . VAL A 1 57  ? 64.447 3.982   37.887 1.00 16.48 ? 75  VAL A N     1 
ATOM   837  C  CA    . VAL A 1 57  ? 65.806 4.583   38.090 1.00 16.24 ? 75  VAL A CA    1 
ATOM   838  C  C     . VAL A 1 57  ? 65.935 6.017   37.621 1.00 16.02 ? 75  VAL A C     1 
ATOM   839  O  O     . VAL A 1 57  ? 65.518 6.264   36.501 1.00 15.09 ? 75  VAL A O     1 
ATOM   840  C  CB    . VAL A 1 57  ? 66.887 3.795   37.296 1.00 17.00 ? 75  VAL A CB    1 
ATOM   841  C  CG1   . VAL A 1 57  ? 68.310 4.439   37.434 1.00 14.92 ? 75  VAL A CG1   1 
ATOM   842  C  CG2   . VAL A 1 57  ? 66.849 2.338   37.748 1.00 17.84 ? 75  VAL A CG2   1 
ATOM   843  H  H     . VAL A 1 57  ? 64.011 3.997   37.019 1.00 18.23 ? 75  VAL A H     1 
ATOM   844  H  HA    . VAL A 1 57  ? 66.036 4.563   39.151 1.00 17.19 ? 75  VAL A HA    1 
ATOM   845  H  HB    . VAL A 1 57  ? 66.645 3.814   36.245 1.00 16.47 ? 75  VAL A HB    1 
ATOM   846  H  HG11  . VAL A 1 57  ? 68.588 4.493   38.476 1.00 15.34 ? 75  VAL A HG11  1 
ATOM   847  H  HG12  . VAL A 1 57  ? 68.356 5.442   37.041 1.00 15.06 ? 75  VAL A HG12  1 
ATOM   848  H  HG13  . VAL A 1 57  ? 69.047 3.853   36.904 1.00 15.52 ? 75  VAL A HG13  1 
ATOM   849  H  HG21  . VAL A 1 57  ? 65.877 1.910   37.538 1.00 18.03 ? 75  VAL A HG21  1 
ATOM   850  H  HG22  . VAL A 1 57  ? 67.021 2.273   38.810 1.00 17.77 ? 75  VAL A HG22  1 
ATOM   851  H  HG23  . VAL A 1 57  ? 67.592 1.761   37.223 1.00 17.87 ? 75  VAL A HG23  1 
ATOM   852  N  N     . VAL A 1 58  ? 66.472 6.930   38.340 1.00 15.16 ? 76  VAL A N     1 
ATOM   853  C  CA    . VAL A 1 58  ? 66.628 8.342   37.879 1.00 16.25 ? 76  VAL A CA    1 
ATOM   854  C  C     . VAL A 1 58  ? 67.959 8.219   37.071 1.00 18.42 ? 76  VAL A C     1 
ATOM   855  O  O     . VAL A 1 58  ? 69.032 8.048   37.610 1.00 18.93 ? 76  VAL A O     1 
ATOM   856  C  CB    . VAL A 1 58  ? 66.800 9.304   39.090 1.00 16.46 ? 76  VAL A CB    1 
ATOM   857  C  CG1   . VAL A 1 58  ? 67.144 10.731  38.576 1.00 17.36 ? 76  VAL A CG1   1 
ATOM   858  C  CG2   . VAL A 1 58  ? 65.488 9.351   39.883 1.00 15.54 ? 76  VAL A CG2   1 
ATOM   859  H  H     . VAL A 1 58  ? 66.801 6.687   39.233 1.00 17.08 ? 76  VAL A H     1 
ATOM   860  H  HA    . VAL A 1 58  ? 65.807 8.629   37.264 1.00 17.07 ? 76  VAL A HA    1 
ATOM   861  H  HB    . VAL A 1 58  ? 67.599 8.944   39.733 1.00 16.14 ? 76  VAL A HB    1 
ATOM   862  H  HG11  . VAL A 1 58  ? 66.363 11.144  37.953 1.00 17.15 ? 76  VAL A HG11  1 
ATOM   863  H  HG12  . VAL A 1 58  ? 68.067 10.719  38.011 1.00 16.32 ? 76  VAL A HG12  1 
ATOM   864  H  HG13  . VAL A 1 58  ? 67.292 11.386  39.420 1.00 17.17 ? 76  VAL A HG13  1 
ATOM   865  H  HG21  . VAL A 1 58  ? 65.256 8.358   40.240 1.00 16.62 ? 76  VAL A HG21  1 
ATOM   866  H  HG22  . VAL A 1 58  ? 64.657 9.732   39.309 1.00 15.66 ? 76  VAL A HG22  1 
ATOM   867  H  HG23  . VAL A 1 58  ? 65.630 9.980   40.749 1.00 16.23 ? 76  VAL A HG23  1 
ATOM   868  N  N     . GLU A 1 59  ? 67.827 8.321   35.779 1.00 16.07 ? 77  GLU A N     1 
ATOM   869  C  CA    . GLU A 1 59  ? 68.989 8.204   34.865 1.00 17.14 ? 77  GLU A CA    1 
ATOM   870  C  C     . GLU A 1 59  ? 69.441 9.538   34.300 1.00 15.70 ? 77  GLU A C     1 
ATOM   871  O  O     . GLU A 1 59  ? 70.488 9.625   33.692 1.00 15.46 ? 77  GLU A O     1 
ATOM   872  C  CB    . GLU A 1 59  ? 68.596 7.267   33.685 1.00 17.31 ? 77  GLU A CB    1 
ATOM   873  C  CG    . GLU A 1 59  ? 68.156 5.841   34.088 1.00 17.88 ? 77  GLU A CG    1 
ATOM   874  C  CD    . GLU A 1 59  ? 67.712 5.079   32.807 1.00 19.60 ? 77  GLU A CD    1 
ATOM   875  O  OE1   . GLU A 1 59  ? 68.512 4.307   32.314 1.00 20.54 ? 77  GLU A OE1   1 
ATOM   876  O  OE2   . GLU A 1 59  ? 66.602 5.289   32.360 1.00 18.80 ? 77  GLU A OE2   1 
ATOM   877  H  H     . GLU A 1 59  ? 66.969 8.494   35.385 1.00 16.40 ? 77  GLU A H     1 
ATOM   878  H  HA    . GLU A 1 59  ? 69.829 7.784   35.412 1.00 16.27 ? 77  GLU A HA    1 
ATOM   879  H  HB2   . GLU A 1 59  ? 67.864 7.750   33.055 1.00 17.26 ? 77  GLU A HB2   1 
ATOM   880  H  HB3   . GLU A 1 59  ? 69.490 7.158   33.083 1.00 17.44 ? 77  GLU A HB3   1 
ATOM   881  H  HG2   . GLU A 1 59  ? 69.018 5.328   34.498 1.00 18.51 ? 77  GLU A HG2   1 
ATOM   882  H  HG3   . GLU A 1 59  ? 67.378 5.823   34.829 1.00 18.46 ? 77  GLU A HG3   1 
ATOM   883  N  N     . GLY A 1 60  ? 68.631 10.514  34.515 1.00 14.07 ? 78  GLY A N     1 
ATOM   884  C  CA    . GLY A 1 60  ? 68.883 11.890  34.032 1.00 13.88 ? 78  GLY A CA    1 
ATOM   885  C  C     . GLY A 1 60  ? 67.827 12.082  32.938 1.00 15.80 ? 78  GLY A C     1 
ATOM   886  O  O     . GLY A 1 60  ? 67.388 11.114  32.333 1.00 17.49 ? 78  GLY A O     1 
ATOM   887  H  H     . GLY A 1 60  ? 67.820 10.357  35.017 1.00 16.00 ? 78  GLY A H     1 
ATOM   888  H  HA2   . GLY A 1 60  ? 68.735 12.608  34.824 1.00 15.00 ? 78  GLY A HA2   1 
ATOM   889  H  HA3   . GLY A 1 60  ? 69.871 11.977  33.614 1.00 13.06 ? 78  GLY A HA3   1 
ATOM   890  N  N     . ASN A 1 61  ? 67.460 13.309  32.745 1.00 16.82 ? 79  ASN A N     1 
ATOM   891  C  CA    . ASN A 1 61  ? 66.458 13.827  31.747 1.00 14.25 ? 79  ASN A CA    1 
ATOM   892  C  C     . ASN A 1 61  ? 65.061 13.829  32.254 1.00 14.54 ? 79  ASN A C     1 
ATOM   893  O  O     . ASN A 1 61  ? 64.172 14.290  31.564 1.00 16.84 ? 79  ASN A O     1 
ATOM   894  C  CB    . ASN A 1 61  ? 66.375 13.034  30.436 1.00 20.63 ? 79  ASN A CB    1 
ATOM   895  C  CG    . ASN A 1 61  ? 67.713 13.140  29.772 1.00 25.95 ? 79  ASN A CG    1 
ATOM   896  O  OD1   . ASN A 1 61  ? 68.215 14.220  29.516 1.00 29.90 ? 79  ASN A OD1   1 
ATOM   897  N  ND2   . ASN A 1 61  ? 68.338 12.045  29.472 1.00 29.42 ? 79  ASN A ND2   1 
ATOM   898  H  H     . ASN A 1 61  ? 67.885 13.977  33.333 1.00 15.69 ? 79  ASN A H     1 
ATOM   899  H  HA    . ASN A 1 61  ? 66.732 14.845  31.523 1.00 17.21 ? 79  ASN A HA    1 
ATOM   900  H  HB2   . ASN A 1 61  ? 66.121 12.002  30.618 1.00 20.64 ? 79  ASN A HB2   1 
ATOM   901  H  HB3   . ASN A 1 61  ? 65.632 13.464  29.779 1.00 20.09 ? 79  ASN A HB3   1 
ATOM   902  H  HD21  . ASN A 1 61  ? 67.946 11.164  29.674 1.00 28.46 ? 79  ASN A HD21  1 
ATOM   903  H  HD22  . ASN A 1 61  ? 69.216 12.090  29.039 1.00 29.39 ? 79  ASN A HD22  1 
ATOM   904  N  N     . GLU A 1 62  ? 64.874 13.330  33.434 1.00 15.08 ? 80  GLU A N     1 
ATOM   905  C  CA    . GLU A 1 62  ? 63.517 13.294  34.000 1.00 11.41 ? 80  GLU A CA    1 
ATOM   906  C  C     . GLU A 1 62  ? 63.128 14.662  34.541 1.00 11.50 ? 80  GLU A C     1 
ATOM   907  O  O     . GLU A 1 62  ? 63.967 15.434  34.961 1.00 12.96 ? 80  GLU A O     1 
ATOM   908  C  CB    . GLU A 1 62  ? 63.377 12.352  35.225 1.00 13.29 ? 80  GLU A CB    1 
ATOM   909  C  CG    . GLU A 1 62  ? 63.557 10.903  34.807 1.00 14.76 ? 80  GLU A CG    1 
ATOM   910  C  CD    . GLU A 1 62  ? 64.992 10.359  35.044 1.00 16.44 ? 80  GLU A CD    1 
ATOM   911  O  OE1   . GLU A 1 62  ? 65.932 11.110  35.075 1.00 17.17 ? 80  GLU A OE1   1 
ATOM   912  O  OE2   . GLU A 1 62  ? 65.092 9.164   35.184 1.00 17.84 ? 80  GLU A OE2   1 
ATOM   913  H  H     . GLU A 1 62  ? 65.655 13.005  33.932 1.00 14.50 ? 80  GLU A H     1 
ATOM   914  H  HA    . GLU A 1 62  ? 62.837 13.019  33.209 1.00 11.55 ? 80  GLU A HA    1 
ATOM   915  H  HB2   . GLU A 1 62  ? 64.098 12.640  35.979 1.00 12.15 ? 80  GLU A HB2   1 
ATOM   916  H  HB3   . GLU A 1 62  ? 62.396 12.498  35.652 1.00 13.16 ? 80  GLU A HB3   1 
ATOM   917  H  HG2   . GLU A 1 62  ? 62.847 10.331  35.378 1.00 13.59 ? 80  GLU A HG2   1 
ATOM   918  H  HG3   . GLU A 1 62  ? 63.329 10.813  33.750 1.00 14.41 ? 80  GLU A HG3   1 
ATOM   919  N  N     . GLN A 1 63  ? 61.849 14.896  34.495 1.00 13.67 ? 81  GLN A N     1 
ATOM   920  C  CA    . GLN A 1 63  ? 61.245 16.145  34.996 1.00 13.85 ? 81  GLN A CA    1 
ATOM   921  C  C     . GLN A 1 63  ? 59.978 15.572  35.640 1.00 11.61 ? 81  GLN A C     1 
ATOM   922  O  O     . GLN A 1 63  ? 59.199 14.912  34.968 1.00 10.76 ? 81  GLN A O     1 
ATOM   923  C  CB    . GLN A 1 63  ? 60.847 17.129  33.879 1.00 15.01 ? 81  GLN A CB    1 
ATOM   924  C  CG    . GLN A 1 63  ? 62.076 17.754  33.201 1.00 18.70 ? 81  GLN A CG    1 
ATOM   925  C  CD    . GLN A 1 63  ? 61.592 18.739  32.118 1.00 15.40 ? 81  GLN A CD    1 
ATOM   926  O  OE1   . GLN A 1 63  ? 60.764 19.587  32.383 1.00 14.50 ? 81  GLN A OE1   1 
ATOM   927  N  NE2   . GLN A 1 63  ? 62.062 18.660  30.919 1.00 16.00 ? 81  GLN A NE2   1 
ATOM   928  H  H     . GLN A 1 63  ? 61.248 14.218  34.109 1.00 15.02 ? 81  GLN A H     1 
ATOM   929  H  HA    . GLN A 1 63  ? 61.887 16.594  35.742 1.00 13.10 ? 81  GLN A HA    1 
ATOM   930  H  HB2   . GLN A 1 63  ? 60.253 16.617  33.144 1.00 15.62 ? 81  GLN A HB2   1 
ATOM   931  H  HB3   . GLN A 1 63  ? 60.240 17.914  34.309 1.00 15.57 ? 81  GLN A HB3   1 
ATOM   932  H  HG2   . GLN A 1 63  ? 62.679 18.287  33.921 1.00 17.71 ? 81  GLN A HG2   1 
ATOM   933  H  HG3   . GLN A 1 63  ? 62.675 16.985  32.732 1.00 17.79 ? 81  GLN A HG3   1 
ATOM   934  H  HE21  . GLN A 1 63  ? 61.736 19.264  30.221 1.00 15.88 ? 81  GLN A HE21  1 
ATOM   935  H  HE22  . GLN A 1 63  ? 62.750 17.994  30.698 1.00 14.27 ? 81  GLN A HE22  1 
ATOM   936  N  N     . PHE A 1 64  ? 59.836 15.827  36.907 1.00 13.98 ? 82  PHE A N     1 
ATOM   937  C  CA    . PHE A 1 64  ? 58.665 15.360  37.705 1.00 15.04 ? 82  PHE A CA    1 
ATOM   938  C  C     . PHE A 1 64  ? 57.868 16.625  38.001 1.00 17.05 ? 82  PHE A C     1 
ATOM   939  O  O     . PHE A 1 64  ? 58.379 17.490  38.709 1.00 16.06 ? 82  PHE A O     1 
ATOM   940  C  CB    . PHE A 1 64  ? 59.104 14.735  39.045 1.00 15.06 ? 82  PHE A CB    1 
ATOM   941  C  CG    . PHE A 1 64  ? 59.831 13.391  38.885 1.00 15.65 ? 82  PHE A CG    1 
ATOM   942  C  CD1   . PHE A 1 64  ? 60.017 12.759  37.668 1.00 10.08 ? 82  PHE A CD1   1 
ATOM   943  C  CD2   . PHE A 1 64  ? 60.305 12.788  40.020 1.00 14.33 ? 82  PHE A CD2   1 
ATOM   944  C  CE1   . PHE A 1 64  ? 60.667 11.545  37.613 1.00 13.22 ? 82  PHE A CE1   1 
ATOM   945  C  CE2   . PHE A 1 64  ? 60.945 11.591  39.960 1.00 15.83 ? 82  PHE A CE2   1 
ATOM   946  C  CZ    . PHE A 1 64  ? 61.128 10.966  38.761 1.00 11.71 ? 82  PHE A CZ    1 
ATOM   947  H  H     . PHE A 1 64  ? 60.530 16.353  37.364 1.00 15.10 ? 82  PHE A H     1 
ATOM   948  H  HA    . PHE A 1 64  ? 58.062 14.682  37.116 1.00 16.44 ? 82  PHE A HA    1 
ATOM   949  H  HB2   . PHE A 1 64  ? 59.752 15.418  39.577 1.00 15.12 ? 82  PHE A HB2   1 
ATOM   950  H  HB3   . PHE A 1 64  ? 58.232 14.572  39.659 1.00 15.25 ? 82  PHE A HB3   1 
ATOM   951  H  HD1   . PHE A 1 64  ? 59.657 13.206  36.755 1.00 12.97 ? 82  PHE A HD1   1 
ATOM   952  H  HD2   . PHE A 1 64  ? 60.168 13.267  40.981 1.00 15.19 ? 82  PHE A HD2   1 
ATOM   953  H  HE1   . PHE A 1 64  ? 60.800 11.062  36.662 1.00 11.71 ? 82  PHE A HE1   1 
ATOM   954  H  HE2   . PHE A 1 64  ? 61.303 11.140  40.873 1.00 14.46 ? 82  PHE A HE2   1 
ATOM   955  H  HZ    . PHE A 1 64  ? 61.638 10.015  38.746 1.00 13.64 ? 82  PHE A HZ    1 
ATOM   956  N  N     . ILE A 1 65  ? 56.666 16.711  37.474 1.00 13.48 ? 83  ILE A N     1 
ATOM   957  C  CA    . ILE A 1 65  ? 55.851 17.918  37.720 1.00 12.15 ? 83  ILE A CA    1 
ATOM   958  C  C     . ILE A 1 65  ? 54.477 17.520  38.231 1.00 14.43 ? 83  ILE A C     1 
ATOM   959  O  O     . ILE A 1 65  ? 53.894 16.572  37.751 1.00 13.92 ? 83  ILE A O     1 
ATOM   960  C  CB    . ILE A 1 65  ? 55.762 18.717  36.376 1.00 10.85 ? 83  ILE A CB    1 
ATOM   961  C  CG1   . ILE A 1 65  ? 57.213 18.919  35.794 1.00 10.86 ? 83  ILE A CG1   1 
ATOM   962  C  CG2   . ILE A 1 65  ? 55.053 20.065  36.695 1.00 12.56 ? 83  ILE A CG2   1 
ATOM   963  C  CD1   . ILE A 1 65  ? 57.226 19.765  34.508 1.00 11.87 ? 83  ILE A CD1   1 
ATOM   964  H  H     . ILE A 1 65  ? 56.287 15.991  36.925 1.00 13.83 ? 83  ILE A H     1 
ATOM   965  H  HA    . ILE A 1 65  ? 56.329 18.524  38.475 1.00 13.64 ? 83  ILE A HA    1 
ATOM   966  H  HB    . ILE A 1 65  ? 55.150 18.171  35.670 1.00 11.57 ? 83  ILE A HB    1 
ATOM   967  H  HG12  . ILE A 1 65  ? 57.868 19.368  36.523 1.00 10.19 ? 83  ILE A HG12  1 
ATOM   968  H  HG13  . ILE A 1 65  ? 57.617 17.952  35.528 1.00 11.25 ? 83  ILE A HG13  1 
ATOM   969  H  HG21  . ILE A 1 65  ? 55.616 20.639  37.418 1.00 11.74 ? 83  ILE A HG21  1 
ATOM   970  H  HG22  . ILE A 1 65  ? 54.061 19.891  37.083 1.00 11.37 ? 83  ILE A HG22  1 
ATOM   971  H  HG23  . ILE A 1 65  ? 54.958 20.654  35.794 1.00 12.47 ? 83  ILE A HG23  1 
ATOM   972  H  HD11  . ILE A 1 65  ? 56.825 20.749  34.695 1.00 11.32 ? 83  ILE A HD11  1 
ATOM   973  H  HD12  . ILE A 1 65  ? 56.628 19.292  33.747 1.00 11.35 ? 83  ILE A HD12  1 
ATOM   974  H  HD13  . ILE A 1 65  ? 58.235 19.879  34.136 1.00 9.98  ? 83  ILE A HD13  1 
ATOM   975  N  N     . SER A 1 66  ? 53.962 18.224  39.187 1.00 14.03 ? 84  SER A N     1 
ATOM   976  C  CA    . SER A 1 66  ? 52.616 17.857  39.688 1.00 17.77 ? 84  SER A CA    1 
ATOM   977  C  C     . SER A 1 66  ? 51.567 18.422  38.712 1.00 15.83 ? 84  SER A C     1 
ATOM   978  O  O     . SER A 1 66  ? 51.773 19.399  38.003 1.00 12.32 ? 84  SER A O     1 
ATOM   979  C  CB    . SER A 1 66  ? 52.358 18.469  41.067 1.00 17.51 ? 84  SER A CB    1 
ATOM   980  O  OG    . SER A 1 66  ? 53.339 17.841  41.894 1.00 24.78 ? 84  SER A OG    1 
ATOM   981  H  H     . SER A 1 66  ? 54.449 18.979  39.579 1.00 15.35 ? 84  SER A H     1 
ATOM   982  H  HA    . SER A 1 66  ? 52.531 16.780  39.717 1.00 16.50 ? 84  SER A HA    1 
ATOM   983  H  HB2   . SER A 1 66  ? 52.495 19.540  41.058 1.00 18.51 ? 84  SER A HB2   1 
ATOM   984  H  HB3   . SER A 1 66  ? 51.360 18.224  41.410 1.00 18.81 ? 84  SER A HB3   1 
ATOM   985  H  HG    . SER A 1 66  ? 52.879 17.066  42.276 1.00 22.77 ? 84  SER A HG    1 
ATOM   986  N  N     . ALA A 1 67  ? 50.453 17.767  38.735 1.00 16.74 ? 85  ALA A N     1 
ATOM   987  C  CA    . ALA A 1 67  ? 49.316 18.159  37.874 1.00 18.19 ? 85  ALA A CA    1 
ATOM   988  C  C     . ALA A 1 67  ? 48.636 19.292  38.651 1.00 18.87 ? 85  ALA A C     1 
ATOM   989  O  O     . ALA A 1 67  ? 48.524 19.145  39.848 1.00 18.01 ? 85  ALA A O     1 
ATOM   990  C  CB    . ALA A 1 67  ? 48.347 16.968  37.729 1.00 18.69 ? 85  ALA A CB    1 
ATOM   991  H  H     . ALA A 1 67  ? 50.352 16.994  39.337 1.00 17.85 ? 85  ALA A H     1 
ATOM   992  H  HA    . ALA A 1 67  ? 49.682 18.519  36.920 1.00 18.08 ? 85  ALA A HA    1 
ATOM   993  H  HB1   . ALA A 1 67  ? 47.989 16.687  38.708 1.00 18.81 ? 85  ALA A HB1   1 
ATOM   994  H  HB2   . ALA A 1 67  ? 48.824 16.112  37.278 1.00 18.62 ? 85  ALA A HB2   1 
ATOM   995  H  HB3   . ALA A 1 67  ? 47.496 17.263  37.133 1.00 18.98 ? 85  ALA A HB3   1 
ATOM   996  N  N     . SER A 1 68  ? 48.212 20.348  38.018 1.00 16.29 ? 86  SER A N     1 
ATOM   997  C  CA    . SER A 1 68  ? 47.543 21.447  38.739 1.00 16.98 ? 86  SER A CA    1 
ATOM   998  C  C     . SER A 1 68  ? 46.049 21.056  38.659 1.00 20.54 ? 86  SER A C     1 
ATOM   999  O  O     . SER A 1 68  ? 45.332 21.271  39.620 1.00 25.26 ? 86  SER A O     1 
ATOM   1000 C  CB    A SER A 1 68  ? 47.841 22.745  38.001 0.51 16.50 ? 86  SER A CB    1 
ATOM   1001 C  CB    B SER A 1 68  ? 47.805 22.784  38.027 0.36 16.19 ? 86  SER A CB    1 
ATOM   1002 O  OG    A SER A 1 68  ? 47.622 23.764  38.964 0.51 20.46 ? 86  SER A OG    1 
ATOM   1003 O  OG    B SER A 1 68  ? 47.895 22.485  36.641 0.36 18.91 ? 86  SER A OG    1 
ATOM   1004 H  H     . SER A 1 68  ? 48.314 20.453  37.061 1.00 17.02 ? 86  SER A H     1 
ATOM   1005 H  HA    . SER A 1 68  ? 47.878 21.469  39.765 1.00 17.06 ? 86  SER A HA    1 
ATOM   1006 H  HB2   A SER A 1 68  ? 48.860 22.793  37.653 0.51 17.38 ? 86  SER A HB2   1 
ATOM   1007 H  HB2   B SER A 1 68  ? 46.968 23.451  38.188 0.36 16.76 ? 86  SER A HB2   1 
ATOM   1008 H  HB3   A SER A 1 68  ? 47.166 22.893  37.170 0.51 17.24 ? 86  SER A HB3   1 
ATOM   1009 H  HB3   B SER A 1 68  ? 48.715 23.248  38.373 0.36 16.65 ? 86  SER A HB3   1 
ATOM   1010 H  HG    A SER A 1 68  ? 47.041 23.442  39.665 0.51 19.33 ? 86  SER A HG    1 
ATOM   1011 H  HG    B SER A 1 68  ? 48.722 22.831  36.277 0.36 18.57 ? 86  SER A HG    1 
ATOM   1012 N  N     . LYS A 1 69  ? 45.591 20.530  37.547 1.00 20.46 ? 87  LYS A N     1 
ATOM   1013 C  CA    . LYS A 1 69  ? 44.143 20.110  37.451 1.00 19.79 ? 87  LYS A CA    1 
ATOM   1014 C  C     . LYS A 1 69  ? 44.008 19.074  36.348 1.00 18.21 ? 87  LYS A C     1 
ATOM   1015 O  O     . LYS A 1 69  ? 44.820 19.058  35.438 1.00 16.64 ? 87  LYS A O     1 
ATOM   1016 C  CB    A LYS A 1 69  ? 43.203 21.308  37.113 0.38 20.27 ? 87  LYS A CB    1 
ATOM   1017 C  CB    B LYS A 1 69  ? 43.198 21.339  37.113 0.23 19.66 ? 87  LYS A CB    1 
ATOM   1018 C  CG    A LYS A 1 69  ? 43.710 22.149  35.922 0.38 20.84 ? 87  LYS A CG    1 
ATOM   1019 C  CG    B LYS A 1 69  ? 43.555 22.037  35.761 0.23 19.99 ? 87  LYS A CG    1 
ATOM   1020 C  CD    A LYS A 1 69  ? 42.499 22.919  35.303 0.38 22.02 ? 87  LYS A CD    1 
ATOM   1021 C  CD    B LYS A 1 69  ? 42.317 22.868  35.239 0.23 20.67 ? 87  LYS A CD    1 
ATOM   1022 C  CE    A LYS A 1 69  ? 41.715 23.772  36.327 0.38 21.09 ? 87  LYS A CE    1 
ATOM   1023 C  CE    B LYS A 1 69  ? 42.096 24.214  35.979 0.23 20.18 ? 87  LYS A CE    1 
ATOM   1024 N  NZ    A LYS A 1 69  ? 40.588 24.431  35.621 0.38 20.26 ? 87  LYS A NZ    1 
ATOM   1025 N  NZ    B LYS A 1 69  ? 43.126 25.210  35.554 0.23 20.18 ? 87  LYS A NZ    1 
ATOM   1026 H  H     . LYS A 1 69  ? 46.186 20.404  36.775 1.00 20.49 ? 87  LYS A H     1 
ATOM   1027 H  HA    . LYS A 1 69  ? 43.846 19.661  38.393 1.00 17.82 ? 87  LYS A HA    1 
ATOM   1028 H  HB2   A LYS A 1 69  ? 42.220 20.907  36.899 0.38 20.44 ? 87  LYS A HB2   1 
ATOM   1029 H  HB2   B LYS A 1 69  ? 42.181 20.973  37.083 0.23 19.70 ? 87  LYS A HB2   1 
ATOM   1030 H  HB3   A LYS A 1 69  ? 43.114 21.925  37.997 0.38 20.50 ? 87  LYS A HB3   1 
ATOM   1031 H  HB3   B LYS A 1 69  ? 43.262 22.049  37.925 0.23 19.73 ? 87  LYS A HB3   1 
ATOM   1032 H  HG2   A LYS A 1 69  ? 44.464 22.852  36.249 0.38 20.96 ? 87  LYS A HG2   1 
ATOM   1033 H  HG2   B LYS A 1 69  ? 44.407 22.691  35.901 0.23 20.02 ? 87  LYS A HG2   1 
ATOM   1034 H  HG3   A LYS A 1 69  ? 44.142 21.506  35.168 0.38 21.11 ? 87  LYS A HG3   1 
ATOM   1035 H  HG3   B LYS A 1 69  ? 43.824 21.300  35.018 0.23 20.16 ? 87  LYS A HG3   1 
ATOM   1036 H  HD2   A LYS A 1 69  ? 42.856 23.583  34.524 0.38 21.76 ? 87  LYS A HD2   1 
ATOM   1037 H  HD2   B LYS A 1 69  ? 42.475 23.099  34.194 0.23 20.38 ? 87  LYS A HD2   1 
ATOM   1038 H  HD3   A LYS A 1 69  ? 41.806 22.222  34.852 0.38 21.82 ? 87  LYS A HD3   1 
ATOM   1039 H  HD3   B LYS A 1 69  ? 41.405 22.289  35.315 0.23 20.38 ? 87  LYS A HD3   1 
ATOM   1040 H  HE2   A LYS A 1 69  ? 41.294 23.165  37.117 0.38 21.10 ? 87  LYS A HE2   1 
ATOM   1041 H  HE2   B LYS A 1 69  ? 41.118 24.611  35.737 0.23 19.96 ? 87  LYS A HE2   1 
ATOM   1042 H  HE3   A LYS A 1 69  ? 42.334 24.541  36.765 0.38 21.25 ? 87  LYS A HE3   1 
ATOM   1043 H  HE3   B LYS A 1 69  ? 42.151 24.088  37.051 0.23 20.14 ? 87  LYS A HE3   1 
ATOM   1044 H  HZ1   A LYS A 1 69  ? 40.719 25.461  35.660 0.38 20.12 ? 87  LYS A HZ1   1 
ATOM   1045 H  HZ1   B LYS A 1 69  ? 42.657 26.036  35.131 0.23 19.60 ? 87  LYS A HZ1   1 
ATOM   1046 H  HZ2   A LYS A 1 69  ? 39.689 24.170  36.073 0.38 20.09 ? 87  LYS A HZ2   1 
ATOM   1047 H  HZ2   B LYS A 1 69  ? 43.760 24.778  34.851 0.23 19.79 ? 87  LYS A HZ2   1 
ATOM   1048 H  HZ3   A LYS A 1 69  ? 40.578 24.123  34.629 0.38 20.34 ? 87  LYS A HZ3   1 
ATOM   1049 H  HZ3   B LYS A 1 69  ? 43.680 25.511  36.381 0.23 19.77 ? 87  LYS A HZ3   1 
ATOM   1050 N  N     . SER A 1 70  ? 43.007 18.260  36.459 1.00 14.24 ? 88  SER A N     1 
ATOM   1051 C  CA    . SER A 1 70  ? 42.791 17.222  35.424 1.00 13.68 ? 88  SER A CA    1 
ATOM   1052 C  C     . SER A 1 70  ? 41.371 17.502  35.005 1.00 16.98 ? 88  SER A C     1 
ATOM   1053 O  O     . SER A 1 70  ? 40.542 17.702  35.871 1.00 18.53 ? 88  SER A O     1 
ATOM   1054 C  CB    . SER A 1 70  ? 42.905 15.842  36.033 1.00 15.84 ? 88  SER A CB    1 
ATOM   1055 O  OG    . SER A 1 70  ? 44.202 15.797  36.641 1.00 21.91 ? 88  SER A OG    1 
ATOM   1056 H  H     . SER A 1 70  ? 42.391 18.325  37.219 1.00 15.27 ? 88  SER A H     1 
ATOM   1057 H  HA    . SER A 1 70  ? 43.453 17.383  34.589 1.00 15.66 ? 88  SER A HA    1 
ATOM   1058 H  HB2   . SER A 1 70  ? 42.136 15.722  36.777 1.00 17.06 ? 88  SER A HB2   1 
ATOM   1059 H  HB3   . SER A 1 70  ? 42.814 15.075  35.274 1.00 16.70 ? 88  SER A HB3   1 
ATOM   1060 H  HG    . SER A 1 70  ? 44.813 15.342  36.050 1.00 18.50 ? 88  SER A HG    1 
ATOM   1061 N  N     . ILE A 1 71  ? 41.126 17.501  33.735 1.00 12.43 ? 89  ILE A N     1 
ATOM   1062 C  CA    . ILE A 1 71  ? 39.782 17.769  33.174 1.00 13.83 ? 89  ILE A CA    1 
ATOM   1063 C  C     . ILE A 1 71  ? 39.262 16.550  32.421 1.00 10.25 ? 89  ILE A C     1 
ATOM   1064 O  O     . ILE A 1 71  ? 39.661 16.296  31.292 1.00 9.53  ? 89  ILE A O     1 
ATOM   1065 C  CB    . ILE A 1 71  ? 39.887 19.017  32.222 1.00 13.42 ? 89  ILE A CB    1 
ATOM   1066 C  CG1   . ILE A 1 71  ? 40.480 20.231  33.038 1.00 15.15 ? 89  ILE A CG1   1 
ATOM   1067 C  CG2   . ILE A 1 71  ? 38.489 19.376  31.639 1.00 13.16 ? 89  ILE A CG2   1 
ATOM   1068 C  CD1   . ILE A 1 71  ? 40.536 21.548  32.192 1.00 16.70 ? 89  ILE A CD1   1 
ATOM   1069 H  H     . ILE A 1 71  ? 41.855 17.313  33.117 1.00 13.72 ? 89  ILE A H     1 
ATOM   1070 H  HA    . ILE A 1 71  ? 39.103 17.983  33.990 1.00 13.36 ? 89  ILE A HA    1 
ATOM   1071 H  HB    . ILE A 1 71  ? 40.541 18.760  31.402 1.00 13.77 ? 89  ILE A HB    1 
ATOM   1072 H  HG12  . ILE A 1 71  ? 39.889 20.395  33.928 1.00 14.95 ? 89  ILE A HG12  1 
ATOM   1073 H  HG13  . ILE A 1 71  ? 41.488 19.991  33.347 1.00 14.89 ? 89  ILE A HG13  1 
ATOM   1074 H  HG21  . ILE A 1 71  ? 37.783 19.614  32.422 1.00 13.07 ? 89  ILE A HG21  1 
ATOM   1075 H  HG22  . ILE A 1 71  ? 38.101 18.538  31.080 1.00 12.98 ? 89  ILE A HG22  1 
ATOM   1076 H  HG23  . ILE A 1 71  ? 38.559 20.218  30.966 1.00 13.19 ? 89  ILE A HG23  1 
ATOM   1077 H  HD11  . ILE A 1 71  ? 39.550 21.851  31.869 1.00 16.20 ? 89  ILE A HD11  1 
ATOM   1078 H  HD12  . ILE A 1 71  ? 41.161 21.420  31.320 1.00 16.12 ? 89  ILE A HD12  1 
ATOM   1079 H  HD13  . ILE A 1 71  ? 40.934 22.350  32.792 1.00 15.86 ? 89  ILE A HD13  1 
ATOM   1080 N  N     . VAL A 1 72  ? 38.395 15.825  33.065 1.00 14.16 ? 90  VAL A N     1 
ATOM   1081 C  CA    . VAL A 1 72  ? 37.819 14.618  32.416 1.00 14.14 ? 90  VAL A CA    1 
ATOM   1082 C  C     . VAL A 1 72  ? 36.752 15.137  31.456 1.00 13.41 ? 90  VAL A C     1 
ATOM   1083 O  O     . VAL A 1 72  ? 36.040 16.072  31.777 1.00 13.96 ? 90  VAL A O     1 
ATOM   1084 C  CB    . VAL A 1 72  ? 37.210 13.719  33.518 1.00 14.56 ? 90  VAL A CB    1 
ATOM   1085 C  CG1   . VAL A 1 72  ? 36.258 12.670  32.942 1.00 15.59 ? 90  VAL A CG1   1 
ATOM   1086 C  CG2   . VAL A 1 72  ? 38.353 13.045  34.310 1.00 14.96 ? 90  VAL A CG2   1 
ATOM   1087 H  H     . VAL A 1 72  ? 38.118 16.080  33.970 1.00 12.76 ? 90  VAL A H     1 
ATOM   1088 H  HA    . VAL A 1 72  ? 38.594 14.118  31.855 1.00 15.62 ? 90  VAL A HA    1 
ATOM   1089 H  HB    . VAL A 1 72  ? 36.640 14.335  34.196 1.00 15.16 ? 90  VAL A HB    1 
ATOM   1090 H  HG11  . VAL A 1 72  ? 36.755 12.052  32.215 1.00 15.44 ? 90  VAL A HG11  1 
ATOM   1091 H  HG12  . VAL A 1 72  ? 35.422 13.150  32.458 1.00 14.97 ? 90  VAL A HG12  1 
ATOM   1092 H  HG13  . VAL A 1 72  ? 35.867 12.047  33.733 1.00 15.38 ? 90  VAL A HG13  1 
ATOM   1093 H  HG21  . VAL A 1 72  ? 38.957 13.799  34.794 1.00 13.91 ? 90  VAL A HG21  1 
ATOM   1094 H  HG22  . VAL A 1 72  ? 38.988 12.469  33.652 1.00 13.58 ? 90  VAL A HG22  1 
ATOM   1095 H  HG23  . VAL A 1 72  ? 37.961 12.392  35.074 1.00 12.89 ? 90  VAL A HG23  1 
ATOM   1096 N  N     . HIS A 1 73  ? 36.645 14.533  30.310 1.00 12.42 ? 91  HIS A N     1 
ATOM   1097 C  CA    . HIS A 1 73  ? 35.624 14.997  29.346 1.00 10.16 ? 91  HIS A CA    1 
ATOM   1098 C  C     . HIS A 1 73  ? 34.231 14.932  30.042 1.00 11.38 ? 91  HIS A C     1 
ATOM   1099 O  O     . HIS A 1 73  ? 33.907 13.941  30.681 1.00 10.95 ? 91  HIS A O     1 
ATOM   1100 C  CB    . HIS A 1 73  ? 35.674 14.094  28.141 1.00 11.04 ? 91  HIS A CB    1 
ATOM   1101 C  CG    . HIS A 1 73  ? 34.771 14.653  27.050 1.00 9.80  ? 91  HIS A CG    1 
ATOM   1102 N  ND1   . HIS A 1 73  ? 33.451 14.519  27.088 1.00 13.24 ? 91  HIS A ND1   1 
ATOM   1103 C  CD2   . HIS A 1 73  ? 35.164 15.358  25.913 1.00 11.08 ? 91  HIS A CD2   1 
ATOM   1104 C  CE1   . HIS A 1 73  ? 33.053 15.129  25.999 1.00 10.50 ? 91  HIS A CE1   1 
ATOM   1105 N  NE2   . HIS A 1 73  ? 34.047 15.615  25.318 1.00 10.83 ? 91  HIS A NE2   1 
ATOM   1106 H  H     . HIS A 1 73  ? 37.231 13.779  30.081 1.00 15.60 ? 91  HIS A H     1 
ATOM   1107 H  HA    . HIS A 1 73  ? 35.881 16.000  29.060 1.00 10.33 ? 91  HIS A HA    1 
ATOM   1108 H  HB2   . HIS A 1 73  ? 36.679 14.038  27.763 1.00 11.38 ? 91  HIS A HB2   1 
ATOM   1109 H  HB3   . HIS A 1 73  ? 35.336 13.101  28.397 1.00 11.31 ? 91  HIS A HB3   1 
ATOM   1110 H  HD2   . HIS A 1 73  ? 36.167 15.623  25.601 1.00 9.32  ? 91  HIS A HD2   1 
ATOM   1111 H  HE1   . HIS A 1 73  ? 32.018 15.222  25.693 1.00 11.30 ? 91  HIS A HE1   1 
ATOM   1112 H  HE2   . HIS A 1 73  ? 33.958 16.112  24.461 1.00 9.49  ? 91  HIS A HE2   1 
ATOM   1113 N  N     . PRO A 1 74  ? 33.410 15.957  29.935 1.00 9.84  ? 92  PRO A N     1 
ATOM   1114 C  CA    . PRO A 1 74  ? 32.084 16.023  30.651 1.00 11.78 ? 92  PRO A CA    1 
ATOM   1115 C  C     . PRO A 1 74  ? 31.098 14.874  30.287 1.00 10.54 ? 92  PRO A C     1 
ATOM   1116 O  O     . PRO A 1 74  ? 30.264 14.482  31.082 1.00 10.20 ? 92  PRO A O     1 
ATOM   1117 C  CB    . PRO A 1 74  ? 31.550 17.416  30.298 1.00 11.08 ? 92  PRO A CB    1 
ATOM   1118 C  CG    . PRO A 1 74  ? 32.794 18.223  29.889 1.00 14.00 ? 92  PRO A CG    1 
ATOM   1119 C  CD    . PRO A 1 74  ? 33.649 17.201  29.128 1.00 10.15 ? 92  PRO A CD    1 
ATOM   1120 H  HA    . PRO A 1 74  ? 32.276 15.965  31.714 1.00 10.62 ? 92  PRO A HA    1 
ATOM   1121 H  HB2   . PRO A 1 74  ? 30.836 17.380  29.485 1.00 12.43 ? 92  PRO A HB2   1 
ATOM   1122 H  HB3   . PRO A 1 74  ? 31.077 17.854  31.166 1.00 11.76 ? 92  PRO A HB3   1 
ATOM   1123 H  HG2   . PRO A 1 74  ? 32.517 19.044  29.239 1.00 12.30 ? 92  PRO A HG2   1 
ATOM   1124 H  HG3   . PRO A 1 74  ? 33.313 18.598  30.762 1.00 12.90 ? 92  PRO A HG3   1 
ATOM   1125 H  HD2   . PRO A 1 74  ? 33.336 17.063  28.101 1.00 11.33 ? 92  PRO A HD2   1 
ATOM   1126 H  HD3   . PRO A 1 74  ? 34.680 17.512  29.176 1.00 11.75 ? 92  PRO A HD3   1 
ATOM   1127 N  N     . SER A 1 75  ? 31.222 14.358  29.100 1.00 15.98 ? 93  SER A N     1 
ATOM   1128 C  CA    . SER A 1 75  ? 30.345 13.256  28.629 1.00 17.21 ? 93  SER A CA    1 
ATOM   1129 C  C     . SER A 1 75  ? 31.049 11.881  28.723 1.00 16.44 ? 93  SER A C     1 
ATOM   1130 O  O     . SER A 1 75  ? 30.671 10.944  28.041 1.00 18.69 ? 93  SER A O     1 
ATOM   1131 C  CB    . SER A 1 75  ? 29.935 13.560  27.163 1.00 16.32 ? 93  SER A CB    1 
ATOM   1132 O  OG    . SER A 1 75  ? 29.379 14.879  27.201 1.00 17.77 ? 93  SER A OG    1 
ATOM   1133 H  H     . SER A 1 75  ? 31.911 14.715  28.504 1.00 16.85 ? 93  SER A H     1 
ATOM   1134 H  HA    . SER A 1 75  ? 29.453 13.223  29.243 1.00 16.89 ? 93  SER A HA    1 
ATOM   1135 H  HB2   . SER A 1 75  ? 30.772 13.515  26.480 1.00 16.89 ? 93  SER A HB2   1 
ATOM   1136 H  HB3   . SER A 1 75  ? 29.175 12.858  26.839 1.00 17.43 ? 93  SER A HB3   1 
ATOM   1137 H  HG    . SER A 1 75  ? 28.410 14.751  27.240 1.00 16.04 ? 93  SER A HG    1 
ATOM   1138 N  N     . TYR A 1 76  ? 32.041 11.784  29.554 1.00 12.78 ? 94  TYR A N     1 
ATOM   1139 C  CA    . TYR A 1 76  ? 32.759 10.481  29.706 1.00 12.35 ? 94  TYR A CA    1 
ATOM   1140 C  C     . TYR A 1 76  ? 31.758 9.483   30.355 1.00 14.96 ? 94  TYR A C     1 
ATOM   1141 O  O     . TYR A 1 76  ? 31.072 9.828   31.295 1.00 14.44 ? 94  TYR A O     1 
ATOM   1142 C  CB    . TYR A 1 76  ? 34.016 10.704  30.620 1.00 10.73 ? 94  TYR A CB    1 
ATOM   1143 C  CG    . TYR A 1 76  ? 34.568 9.386   31.164 1.00 10.74 ? 94  TYR A CG    1 
ATOM   1144 C  CD1   . TYR A 1 76  ? 34.666 9.185   32.517 1.00 12.64 ? 94  TYR A CD1   1 
ATOM   1145 C  CD2   . TYR A 1 76  ? 34.970 8.393   30.308 1.00 13.07 ? 94  TYR A CD2   1 
ATOM   1146 C  CE1   . TYR A 1 76  ? 35.165 8.000   33.016 1.00 15.64 ? 94  TYR A CE1   1 
ATOM   1147 C  CE2   . TYR A 1 76  ? 35.470 7.206   30.798 1.00 15.09 ? 94  TYR A CE2   1 
ATOM   1148 C  CZ    . TYR A 1 76  ? 35.569 7.007   32.154 1.00 15.58 ? 94  TYR A CZ    1 
ATOM   1149 O  OH    . TYR A 1 76  ? 36.074 5.825   32.636 1.00 16.81 ? 94  TYR A OH    1 
ATOM   1150 H  H     . TYR A 1 76  ? 32.320 12.563  30.078 1.00 13.41 ? 94  TYR A H     1 
ATOM   1151 H  HA    . TYR A 1 76  ? 33.052 10.108  28.744 1.00 13.49 ? 94  TYR A HA    1 
ATOM   1152 H  HB2   . TYR A 1 76  ? 34.798 11.181  30.048 1.00 11.41 ? 94  TYR A HB2   1 
ATOM   1153 H  HB3   . TYR A 1 76  ? 33.755 11.343  31.449 1.00 11.51 ? 94  TYR A HB3   1 
ATOM   1154 H  HD1   . TYR A 1 76  ? 34.354 9.955   33.207 1.00 12.65 ? 94  TYR A HD1   1 
ATOM   1155 H  HD2   . TYR A 1 76  ? 34.896 8.540   29.238 1.00 13.54 ? 94  TYR A HD2   1 
ATOM   1156 H  HE1   . TYR A 1 76  ? 35.227 7.870   34.087 1.00 14.39 ? 94  TYR A HE1   1 
ATOM   1157 H  HE2   . TYR A 1 76  ? 35.776 6.433   30.112 1.00 15.22 ? 94  TYR A HE2   1 
ATOM   1158 H  HH    . TYR A 1 76  ? 36.003 5.867   33.598 1.00 16.29 ? 94  TYR A HH    1 
ATOM   1159 N  N     . ASN A 1 77  ? 31.699 8.288   29.847 1.00 13.81 ? 95  ASN A N     1 
ATOM   1160 C  CA    . ASN A 1 77  ? 30.770 7.248   30.396 1.00 15.95 ? 95  ASN A CA    1 
ATOM   1161 C  C     . ASN A 1 77  ? 31.707 6.171   30.889 1.00 14.19 ? 95  ASN A C     1 
ATOM   1162 O  O     . ASN A 1 77  ? 32.391 5.566   30.083 1.00 20.60 ? 95  ASN A O     1 
ATOM   1163 C  CB    . ASN A 1 77  ? 29.875 6.712   29.261 1.00 20.43 ? 95  ASN A CB    1 
ATOM   1164 C  CG    . ASN A 1 77  ? 28.938 5.660   29.824 1.00 24.12 ? 95  ASN A CG    1 
ATOM   1165 O  OD1   . ASN A 1 77  ? 29.329 4.713   30.470 1.00 25.42 ? 95  ASN A OD1   1 
ATOM   1166 N  ND2   . ASN A 1 77  ? 27.672 5.743   29.623 1.00 29.73 ? 95  ASN A ND2   1 
ATOM   1167 H  H     . ASN A 1 77  ? 32.280 8.056   29.087 1.00 12.36 ? 95  ASN A H     1 
ATOM   1168 H  HA    . ASN A 1 77  ? 30.199 7.649   31.217 1.00 16.22 ? 95  ASN A HA    1 
ATOM   1169 H  HB2   . ASN A 1 77  ? 29.300 7.504   28.812 1.00 20.23 ? 95  ASN A HB2   1 
ATOM   1170 H  HB3   . ASN A 1 77  ? 30.483 6.249   28.497 1.00 20.82 ? 95  ASN A HB3   1 
ATOM   1171 H  HD21  . ASN A 1 77  ? 27.084 5.056   30.002 1.00 29.30 ? 95  ASN A HD21  1 
ATOM   1172 H  HD22  . ASN A 1 77  ? 27.294 6.480   29.101 1.00 28.59 ? 95  ASN A HD22  1 
ATOM   1173 N  N     . SER A 1 78  ? 31.737 5.924   32.157 1.00 15.85 ? 96  SER A N     1 
ATOM   1174 C  CA    . SER A 1 78  ? 32.664 4.880   32.653 1.00 20.32 ? 96  SER A CA    1 
ATOM   1175 C  C     . SER A 1 78  ? 32.204 3.452   32.358 1.00 21.59 ? 96  SER A C     1 
ATOM   1176 O  O     . SER A 1 78  ? 32.962 2.518   32.522 1.00 25.17 ? 96  SER A O     1 
ATOM   1177 C  CB    . SER A 1 78  ? 32.821 5.066   34.138 1.00 22.34 ? 96  SER A CB    1 
ATOM   1178 O  OG    . SER A 1 78  ? 31.482 5.186   34.613 1.00 27.79 ? 96  SER A OG    1 
ATOM   1179 H  H     . SER A 1 78  ? 31.166 6.403   32.796 1.00 16.04 ? 96  SER A H     1 
ATOM   1180 H  HA    . SER A 1 78  ? 33.624 5.023   32.171 1.00 19.65 ? 96  SER A HA    1 
ATOM   1181 H  HB2   . SER A 1 78  ? 33.286 4.188   34.566 1.00 23.27 ? 96  SER A HB2   1 
ATOM   1182 H  HB3   . SER A 1 78  ? 33.389 5.954   34.375 1.00 23.61 ? 96  SER A HB3   1 
ATOM   1183 H  HG    . SER A 1 78  ? 31.308 6.119   34.819 1.00 26.19 ? 96  SER A HG    1 
ATOM   1184 N  N     . ASN A 1 79  ? 30.988 3.319   31.927 1.00 22.89 ? 97  ASN A N     1 
ATOM   1185 C  CA    . ASN A 1 79  ? 30.460 1.954   31.618 1.00 25.78 ? 97  ASN A CA    1 
ATOM   1186 C  C     . ASN A 1 79  ? 30.769 1.581   30.195 1.00 22.88 ? 97  ASN A C     1 
ATOM   1187 O  O     . ASN A 1 79  ? 31.009 0.427   29.922 1.00 25.10 ? 97  ASN A O     1 
ATOM   1188 C  CB    . ASN A 1 79  ? 28.924 1.877   31.804 1.00 26.31 ? 97  ASN A CB    1 
ATOM   1189 C  CG    . ASN A 1 79  ? 28.588 2.094   33.282 0.41 26.36 ? 97  ASN A CG    1 
ATOM   1190 O  OD1   . ASN A 1 79  ? 28.886 1.287   34.136 0.41 25.20 ? 97  ASN A OD1   1 
ATOM   1191 N  ND2   . ASN A 1 79  ? 27.971 3.170   33.655 0.41 27.74 ? 97  ASN A ND2   1 
ATOM   1192 H  H     . ASN A 1 79  ? 30.433 4.116   31.815 1.00 23.74 ? 97  ASN A H     1 
ATOM   1193 H  HA    . ASN A 1 79  ? 30.937 1.240   32.278 1.00 25.15 ? 97  ASN A HA    1 
ATOM   1194 H  HB2   . ASN A 1 79  ? 28.404 2.595   31.187 1.00 26.66 ? 97  ASN A HB2   1 
ATOM   1195 H  HB3   . ASN A 1 79  ? 28.603 0.882   31.528 1.00 26.93 ? 97  ASN A HB3   1 
ATOM   1196 H  HD21  . ASN A 1 79  ? 27.781 3.301   34.605 0.41 27.49 ? 97  ASN A HD21  1 
ATOM   1197 H  HD22  . ASN A 1 79  ? 27.701 3.842   32.994 0.41 27.49 ? 97  ASN A HD22  1 
ATOM   1198 N  N     . THR A 1 80  ? 30.758 2.516   29.306 1.00 21.14 ? 98  THR A N     1 
ATOM   1199 C  CA    . THR A 1 80  ? 31.062 2.185   27.882 1.00 19.33 ? 98  THR A CA    1 
ATOM   1200 C  C     . THR A 1 80  ? 32.441 2.666   27.434 1.00 20.56 ? 98  THR A C     1 
ATOM   1201 O  O     . THR A 1 80  ? 32.930 2.222   26.408 1.00 23.40 ? 98  THR A O     1 
ATOM   1202 C  CB    . THR A 1 80  ? 30.020 2.844   27.007 1.00 17.69 ? 98  THR A CB    1 
ATOM   1203 O  OG1   . THR A 1 80  ? 30.158 4.239   27.253 1.00 18.63 ? 98  THR A OG1   1 
ATOM   1204 C  CG2   . THR A 1 80  ? 28.641 2.569   27.567 1.00 17.32 ? 98  THR A CG2   1 
ATOM   1205 H  H     . THR A 1 80  ? 30.543 3.441   29.548 1.00 21.09 ? 98  THR A H     1 
ATOM   1206 H  HA    . THR A 1 80  ? 31.025 1.115   27.744 1.00 20.14 ? 98  THR A HA    1 
ATOM   1207 H  HB    . THR A 1 80  ? 30.136 2.634   25.952 1.00 17.68 ? 98  THR A HB    1 
ATOM   1208 H  HG1   . THR A 1 80  ? 29.433 4.681   26.779 1.00 17.78 ? 98  THR A HG1   1 
ATOM   1209 H  HG21  . THR A 1 80  ? 28.541 2.957   28.570 1.00 16.60 ? 98  THR A HG21  1 
ATOM   1210 H  HG22  . THR A 1 80  ? 28.470 1.504   27.589 1.00 16.62 ? 98  THR A HG22  1 
ATOM   1211 H  HG23  . THR A 1 80  ? 27.896 3.033   26.936 1.00 16.30 ? 98  THR A HG23  1 
ATOM   1212 N  N     . LEU A 1 81  ? 32.990 3.560   28.224 1.00 17.58 ? 99  LEU A N     1 
ATOM   1213 C  CA    . LEU A 1 81  ? 34.306 4.217   28.027 1.00 16.49 ? 99  LEU A CA    1 
ATOM   1214 C  C     . LEU A 1 81  ? 34.216 5.132   26.818 1.00 15.24 ? 99  LEU A C     1 
ATOM   1215 O  O     . LEU A 1 81  ? 35.211 5.425   26.167 1.00 16.83 ? 99  LEU A O     1 
ATOM   1216 C  CB    . LEU A 1 81  ? 35.463 3.207   27.784 1.00 20.42 ? 99  LEU A CB    1 
ATOM   1217 C  CG    . LEU A 1 81  ? 35.864 2.482   29.079 1.00 20.76 ? 99  LEU A CG    1 
ATOM   1218 C  CD1   . LEU A 1 81  ? 37.176 1.741   28.817 1.00 23.74 ? 99  LEU A CD1   1 
ATOM   1219 C  CD2   . LEU A 1 81  ? 36.051 3.420   30.306 1.00 22.99 ? 99  LEU A CD2   1 
ATOM   1220 H  H     . LEU A 1 81  ? 32.491 3.828   29.023 1.00 18.68 ? 99  LEU A H     1 
ATOM   1221 H  HA    . LEU A 1 81  ? 34.509 4.838   28.881 1.00 18.05 ? 99  LEU A HA    1 
ATOM   1222 H  HB2   . LEU A 1 81  ? 35.153 2.480   27.046 1.00 19.60 ? 99  LEU A HB2   1 
ATOM   1223 H  HB3   . LEU A 1 81  ? 36.303 3.746   27.377 1.00 19.68 ? 99  LEU A HB3   1 
ATOM   1224 H  HG    . LEU A 1 81  ? 35.087 1.766   29.319 1.00 21.84 ? 99  LEU A HG    1 
ATOM   1225 H  HD11  . LEU A 1 81  ? 37.966 2.407   28.516 1.00 22.61 ? 99  LEU A HD11  1 
ATOM   1226 H  HD12  . LEU A 1 81  ? 37.011 1.008   28.037 1.00 23.11 ? 99  LEU A HD12  1 
ATOM   1227 H  HD13  . LEU A 1 81  ? 37.482 1.207   29.708 1.00 22.31 ? 99  LEU A HD13  1 
ATOM   1228 H  HD21  . LEU A 1 81  ? 35.115 3.892   30.577 1.00 22.55 ? 99  LEU A HD21  1 
ATOM   1229 H  HD22  . LEU A 1 81  ? 36.781 4.188   30.120 1.00 22.46 ? 99  LEU A HD22  1 
ATOM   1230 H  HD23  . LEU A 1 81  ? 36.363 2.850   31.170 1.00 21.75 ? 99  LEU A HD23  1 
ATOM   1231 N  N     . ASN A 1 82  ? 33.010 5.564   26.545 1.00 13.15 ? 100 ASN A N     1 
ATOM   1232 C  CA    . ASN A 1 82  ? 32.824 6.486   25.392 1.00 15.53 ? 100 ASN A CA    1 
ATOM   1233 C  C     . ASN A 1 82  ? 33.378 7.828   25.966 1.00 12.38 ? 100 ASN A C     1 
ATOM   1234 O  O     . ASN A 1 82  ? 33.162 8.131   27.129 1.00 13.13 ? 100 ASN A O     1 
ATOM   1235 C  CB    . ASN A 1 82  ? 31.351 6.626   25.055 1.00 13.83 ? 100 ASN A CB    1 
ATOM   1236 C  CG    . ASN A 1 82  ? 31.154 7.425   23.773 1.00 15.21 ? 100 ASN A CG    1 
ATOM   1237 O  OD1   . ASN A 1 82  ? 31.886 7.340   22.811 1.00 14.68 ? 100 ASN A OD1   1 
ATOM   1238 N  ND2   . ASN A 1 82  ? 30.161 8.239   23.671 1.00 18.20 ? 100 ASN A ND2   1 
ATOM   1239 H  H     . ASN A 1 82  ? 32.253 5.275   27.101 1.00 13.66 ? 100 ASN A H     1 
ATOM   1240 H  HA    . ASN A 1 82  ? 33.414 6.157   24.550 1.00 15.04 ? 100 ASN A HA    1 
ATOM   1241 H  HB2   . ASN A 1 82  ? 30.899 5.653   24.935 1.00 14.98 ? 100 ASN A HB2   1 
ATOM   1242 H  HB3   . ASN A 1 82  ? 30.861 7.145   25.866 1.00 14.75 ? 100 ASN A HB3   1 
ATOM   1243 H  HD21  . ASN A 1 82  ? 30.021 8.754   22.851 1.00 17.86 ? 100 ASN A HD21  1 
ATOM   1244 H  HD22  . ASN A 1 82  ? 29.535 8.350   24.420 1.00 18.16 ? 100 ASN A HD22  1 
ATOM   1245 N  N     . ASN A 1 83  ? 34.069 8.564   25.135 1.00 13.29 ? 101 ASN A N     1 
ATOM   1246 C  CA    . ASN A 1 83  ? 34.709 9.885   25.462 1.00 13.79 ? 101 ASN A CA    1 
ATOM   1247 C  C     . ASN A 1 83  ? 35.769 9.655   26.553 1.00 13.10 ? 101 ASN A C     1 
ATOM   1248 O  O     . ASN A 1 83  ? 35.862 10.348  27.553 1.00 10.58 ? 101 ASN A O     1 
ATOM   1249 C  CB    . ASN A 1 83  ? 33.685 10.948  25.988 1.00 11.93 ? 101 ASN A CB    1 
ATOM   1250 C  CG    . ASN A 1 83  ? 32.606 11.144  24.961 1.00 13.69 ? 101 ASN A CG    1 
ATOM   1251 O  OD1   . ASN A 1 83  ? 32.855 11.518  23.834 1.00 10.58 ? 101 ASN A OD1   1 
ATOM   1252 N  ND2   . ASN A 1 83  ? 31.380 10.903  25.287 1.00 14.09 ? 101 ASN A ND2   1 
ATOM   1253 H  H     . ASN A 1 83  ? 34.185 8.221   24.221 1.00 15.21 ? 101 ASN A H     1 
ATOM   1254 H  HA    . ASN A 1 83  ? 35.193 10.268  24.585 1.00 14.15 ? 101 ASN A HA    1 
ATOM   1255 H  HB2   . ASN A 1 83  ? 33.243 10.638  26.913 1.00 13.45 ? 101 ASN A HB2   1 
ATOM   1256 H  HB3   . ASN A 1 83  ? 34.197 11.887  26.135 1.00 13.20 ? 101 ASN A HB3   1 
ATOM   1257 H  HD21  . ASN A 1 83  ? 30.670 11.021  24.624 1.00 13.77 ? 101 ASN A HD21  1 
ATOM   1258 H  HD22  . ASN A 1 83  ? 31.141 10.603  26.189 1.00 13.97 ? 101 ASN A HD22  1 
ATOM   1259 N  N     . ASP A 1 84  ? 36.578 8.665   26.322 1.00 10.43 ? 102 ASP A N     1 
ATOM   1260 C  CA    . ASP A 1 84  ? 37.652 8.343   27.316 1.00 11.64 ? 102 ASP A CA    1 
ATOM   1261 C  C     . ASP A 1 84  ? 38.907 9.207   27.039 1.00 13.61 ? 102 ASP A C     1 
ATOM   1262 O  O     . ASP A 1 84  ? 39.902 8.738   26.526 1.00 5.10  ? 102 ASP A O     1 
ATOM   1263 C  CB    . ASP A 1 84  ? 37.980 6.849   27.200 1.00 12.80 ? 102 ASP A CB    1 
ATOM   1264 C  CG    . ASP A 1 84  ? 38.871 6.299   28.345 1.00 11.75 ? 102 ASP A CG    1 
ATOM   1265 O  OD1   . ASP A 1 84  ? 38.914 6.925   29.390 1.00 14.66 ? 102 ASP A OD1   1 
ATOM   1266 O  OD2   . ASP A 1 84  ? 39.462 5.255   28.104 1.00 12.94 ? 102 ASP A OD2   1 
ATOM   1267 H  H     . ASP A 1 84  ? 36.476 8.140   25.495 1.00 10.02 ? 102 ASP A H     1 
ATOM   1268 H  HA    . ASP A 1 84  ? 37.270 8.567   28.302 1.00 13.37 ? 102 ASP A HA    1 
ATOM   1269 H  HB2   . ASP A 1 84  ? 37.067 6.281   27.167 1.00 12.85 ? 102 ASP A HB2   1 
ATOM   1270 H  HB3   . ASP A 1 84  ? 38.518 6.712   26.266 1.00 13.00 ? 102 ASP A HB3   1 
ATOM   1271 N  N     . ILE A 1 85  ? 38.819 10.467  27.387 1.00 11.16 ? 103 ILE A N     1 
ATOM   1272 C  CA    . ILE A 1 85  ? 39.930 11.418  27.188 1.00 11.72 ? 103 ILE A CA    1 
ATOM   1273 C  C     . ILE A 1 85  ? 39.907 12.379  28.392 1.00 11.86 ? 103 ILE A C     1 
ATOM   1274 O  O     . ILE A 1 85  ? 38.860 12.685  28.959 1.00 7.91  ? 103 ILE A O     1 
ATOM   1275 C  CB    . ILE A 1 85  ? 39.700 12.124  25.804 1.00 11.49 ? 103 ILE A CB    1 
ATOM   1276 C  CG1   . ILE A 1 85  ? 40.845 13.086  25.495 1.00 14.29 ? 103 ILE A CG1   1 
ATOM   1277 C  CG2   . ILE A 1 85  ? 38.343 12.780  25.740 1.00 12.37 ? 103 ILE A CG2   1 
ATOM   1278 C  CD1   . ILE A 1 85  ? 40.728 13.661  24.080 1.00 13.33 ? 103 ILE A CD1   1 
ATOM   1279 H  H     . ILE A 1 85  ? 37.991 10.809  27.793 1.00 12.82 ? 103 ILE A H     1 
ATOM   1280 H  HA    . ILE A 1 85  ? 40.859 10.863  27.175 1.00 12.40 ? 103 ILE A HA    1 
ATOM   1281 H  HB    . ILE A 1 85  ? 39.723 11.354  25.048 1.00 13.88 ? 103 ILE A HB    1 
ATOM   1282 H  HG12  . ILE A 1 85  ? 40.857 13.896  26.214 1.00 14.09 ? 103 ILE A HG12  1 
ATOM   1283 H  HG13  . ILE A 1 85  ? 41.783 12.552  25.572 1.00 14.32 ? 103 ILE A HG13  1 
ATOM   1284 H  HG21  . ILE A 1 85  ? 38.268 13.526  26.516 1.00 12.71 ? 103 ILE A HG21  1 
ATOM   1285 H  HG22  . ILE A 1 85  ? 37.564 12.051  25.896 1.00 11.91 ? 103 ILE A HG22  1 
ATOM   1286 H  HG23  . ILE A 1 85  ? 38.166 13.255  24.788 1.00 11.53 ? 103 ILE A HG23  1 
ATOM   1287 H  HD11  . ILE A 1 85  ? 39.834 14.257  23.973 1.00 14.54 ? 103 ILE A HD11  1 
ATOM   1288 H  HD12  . ILE A 1 85  ? 40.706 12.862  23.352 1.00 14.51 ? 103 ILE A HD12  1 
ATOM   1289 H  HD13  . ILE A 1 85  ? 41.584 14.289  23.881 1.00 13.94 ? 103 ILE A HD13  1 
ATOM   1290 N  N     . MET A 1 86  ? 41.079 12.806  28.750 1.00 13.47 ? 104 MET A N     1 
ATOM   1291 C  CA    . MET A 1 86  ? 41.300 13.732  29.879 1.00 10.91 ? 104 MET A CA    1 
ATOM   1292 C  C     . MET A 1 86  ? 42.486 14.622  29.568 1.00 11.51 ? 104 MET A C     1 
ATOM   1293 O  O     . MET A 1 86  ? 43.434 14.184  28.941 1.00 8.95  ? 104 MET A O     1 
ATOM   1294 C  CB    . MET A 1 86  ? 41.550 12.864  31.099 1.00 14.47 ? 104 MET A CB    1 
ATOM   1295 C  CG    . MET A 1 86  ? 42.149 13.566  32.264 1.00 17.16 ? 104 MET A CG    1 
ATOM   1296 S  SD    . MET A 1 86  ? 42.292 12.473  33.692 1.00 17.05 ? 104 MET A SD    1 
ATOM   1297 C  CE    . MET A 1 86  ? 43.790 11.535  33.325 1.00 17.54 ? 104 MET A CE    1 
ATOM   1298 H  H     . MET A 1 86  ? 41.877 12.508  28.253 1.00 15.01 ? 104 MET A H     1 
ATOM   1299 H  HA    . MET A 1 86  ? 40.417 14.343  30.002 1.00 12.24 ? 104 MET A HA    1 
ATOM   1300 H  HB2   . MET A 1 86  ? 40.603 12.470  31.425 1.00 14.22 ? 104 MET A HB2   1 
ATOM   1301 H  HB3   . MET A 1 86  ? 42.199 12.039  30.848 1.00 14.16 ? 104 MET A HB3   1 
ATOM   1302 H  HG2   . MET A 1 86  ? 43.131 13.939  32.009 1.00 16.57 ? 104 MET A HG2   1 
ATOM   1303 H  HG3   . MET A 1 86  ? 41.530 14.408  32.541 1.00 16.34 ? 104 MET A HG3   1 
ATOM   1304 H  HE1   . MET A 1 86  ? 44.498 12.158  32.804 1.00 18.10 ? 104 MET A HE1   1 
ATOM   1305 H  HE2   . MET A 1 86  ? 43.552 10.660  32.734 1.00 17.71 ? 104 MET A HE2   1 
ATOM   1306 H  HE3   . MET A 1 86  ? 44.250 11.222  34.252 1.00 18.28 ? 104 MET A HE3   1 
ATOM   1307 N  N     . LEU A 1 87  ? 42.408 15.834  30.024 1.00 10.11 ? 105 LEU A N     1 
ATOM   1308 C  CA    . LEU A 1 87  ? 43.521 16.796  29.799 1.00 11.11 ? 105 LEU A CA    1 
ATOM   1309 C  C     . LEU A 1 87  ? 44.086 17.039  31.209 1.00 10.84 ? 105 LEU A C     1 
ATOM   1310 O  O     . LEU A 1 87  ? 43.329 17.115  32.158 1.00 12.25 ? 105 LEU A O     1 
ATOM   1311 C  CB    . LEU A 1 87  ? 43.007 18.145  29.233 1.00 14.10 ? 105 LEU A CB    1 
ATOM   1312 C  CG    . LEU A 1 87  ? 42.461 18.009  27.790 1.00 16.55 ? 105 LEU A CG    1 
ATOM   1313 C  CD1   . LEU A 1 87  ? 41.813 19.337  27.358 1.00 18.14 ? 105 LEU A CD1   1 
ATOM   1314 C  CD2   . LEU A 1 87  ? 43.627 17.772  26.830 1.00 19.81 ? 105 LEU A CD2   1 
ATOM   1315 H  H     . LEU A 1 87  ? 41.609 16.115  30.522 1.00 10.86 ? 105 LEU A H     1 
ATOM   1316 H  HA    . LEU A 1 87  ? 44.288 16.346  29.185 1.00 11.44 ? 105 LEU A HA    1 
ATOM   1317 H  HB2   . LEU A 1 87  ? 42.230 18.509  29.889 1.00 14.36 ? 105 LEU A HB2   1 
ATOM   1318 H  HB3   . LEU A 1 87  ? 43.823 18.855  29.268 1.00 13.75 ? 105 LEU A HB3   1 
ATOM   1319 H  HG    . LEU A 1 87  ? 41.743 17.200  27.726 1.00 17.05 ? 105 LEU A HG    1 
ATOM   1320 H  HD11  . LEU A 1 87  ? 42.525 20.151  27.370 1.00 17.20 ? 105 LEU A HD11  1 
ATOM   1321 H  HD12  . LEU A 1 87  ? 40.996 19.581  28.024 1.00 17.75 ? 105 LEU A HD12  1 
ATOM   1322 H  HD13  . LEU A 1 87  ? 41.407 19.242  26.363 1.00 17.43 ? 105 LEU A HD13  1 
ATOM   1323 H  HD21  . LEU A 1 87  ? 44.132 16.852  27.095 1.00 18.91 ? 105 LEU A HD21  1 
ATOM   1324 H  HD22  . LEU A 1 87  ? 44.343 18.582  26.870 1.00 18.68 ? 105 LEU A HD22  1 
ATOM   1325 H  HD23  . LEU A 1 87  ? 43.264 17.681  25.817 1.00 18.82 ? 105 LEU A HD23  1 
ATOM   1326 N  N     . ILE A 1 88  ? 45.367 17.156  31.338 1.00 11.15 ? 106 ILE A N     1 
ATOM   1327 C  CA    . ILE A 1 88  ? 45.996 17.405  32.673 1.00 11.07 ? 106 ILE A CA    1 
ATOM   1328 C  C     . ILE A 1 88  ? 46.821 18.677  32.490 1.00 14.45 ? 106 ILE A C     1 
ATOM   1329 O  O     . ILE A 1 88  ? 47.582 18.717  31.536 1.00 8.45  ? 106 ILE A O     1 
ATOM   1330 C  CB    . ILE A 1 88  ? 46.948 16.267  33.062 1.00 14.26 ? 106 ILE A CB    1 
ATOM   1331 C  CG1   . ILE A 1 88  ? 46.127 14.951  33.113 1.00 17.22 ? 106 ILE A CG1   1 
ATOM   1332 C  CG2   . ILE A 1 88  ? 47.615 16.567  34.442 1.00 14.73 ? 106 ILE A CG2   1 
ATOM   1333 C  CD1   . ILE A 1 88  ? 47.062 13.741  33.409 1.00 18.51 ? 106 ILE A CD1   1 
ATOM   1334 H  H     . ILE A 1 88  ? 45.944 17.085  30.550 1.00 12.89 ? 106 ILE A H     1 
ATOM   1335 H  HA    . ILE A 1 88  ? 45.229 17.583  33.412 1.00 12.16 ? 106 ILE A HA    1 
ATOM   1336 H  HB    . ILE A 1 88  ? 47.726 16.210  32.318 1.00 13.93 ? 106 ILE A HB    1 
ATOM   1337 H  HG12  . ILE A 1 88  ? 45.354 15.017  33.865 1.00 16.90 ? 106 ILE A HG12  1 
ATOM   1338 H  HG13  . ILE A 1 88  ? 45.647 14.799  32.156 1.00 17.22 ? 106 ILE A HG13  1 
ATOM   1339 H  HG21  . ILE A 1 88  ? 46.871 16.660  35.220 1.00 14.72 ? 106 ILE A HG21  1 
ATOM   1340 H  HG22  . ILE A 1 88  ? 48.168 17.497  34.391 1.00 14.97 ? 106 ILE A HG22  1 
ATOM   1341 H  HG23  . ILE A 1 88  ? 48.312 15.790  34.715 1.00 15.11 ? 106 ILE A HG23  1 
ATOM   1342 H  HD11  . ILE A 1 88  ? 47.533 13.851  34.376 1.00 18.10 ? 106 ILE A HD11  1 
ATOM   1343 H  HD12  . ILE A 1 88  ? 47.832 13.668  32.652 1.00 17.68 ? 106 ILE A HD12  1 
ATOM   1344 H  HD13  . ILE A 1 88  ? 46.492 12.823  33.417 1.00 17.74 ? 106 ILE A HD13  1 
ATOM   1345 N  N     . LYS A 1 89  ? 46.660 19.629  33.377 1.00 14.84 ? 107 LYS A N     1 
ATOM   1346 C  CA    . LYS A 1 89  ? 47.435 20.874  33.251 1.00 13.19 ? 107 LYS A CA    1 
ATOM   1347 C  C     . LYS A 1 89  ? 48.560 20.678  34.264 1.00 10.87 ? 107 LYS A C     1 
ATOM   1348 O  O     . LYS A 1 89  ? 48.319 20.227  35.362 1.00 14.21 ? 107 LYS A O     1 
ATOM   1349 C  CB    . LYS A 1 89  ? 46.601 22.083  33.656 1.00 16.37 ? 107 LYS A CB    1 
ATOM   1350 C  CG    . LYS A 1 89  ? 47.362 23.316  33.163 1.00 18.54 ? 107 LYS A CG    1 
ATOM   1351 C  CD    . LYS A 1 89  ? 46.629 24.573  33.524 1.00 21.33 ? 107 LYS A CD    1 
ATOM   1352 C  CE    . LYS A 1 89  ? 47.375 25.698  32.794 1.00 26.34 ? 107 LYS A CE    1 
ATOM   1353 N  NZ    . LYS A 1 89  ? 46.852 27.009  33.257 1.00 29.97 ? 107 LYS A NZ    1 
ATOM   1354 H  H     . LYS A 1 89  ? 46.040 19.516  34.126 1.00 15.49 ? 107 LYS A H     1 
ATOM   1355 H  HA    . LYS A 1 89  ? 47.832 20.952  32.247 1.00 12.78 ? 107 LYS A HA    1 
ATOM   1356 H  HB2   . LYS A 1 89  ? 45.628 22.029  33.195 1.00 15.87 ? 107 LYS A HB2   1 
ATOM   1357 H  HB3   . LYS A 1 89  ? 46.492 22.112  34.730 1.00 16.17 ? 107 LYS A HB3   1 
ATOM   1358 H  HG2   . LYS A 1 89  ? 48.344 23.349  33.611 1.00 18.87 ? 107 LYS A HG2   1 
ATOM   1359 H  HG3   . LYS A 1 89  ? 47.473 23.257  32.087 1.00 18.45 ? 107 LYS A HG3   1 
ATOM   1360 H  HD2   . LYS A 1 89  ? 45.605 24.557  33.175 1.00 21.30 ? 107 LYS A HD2   1 
ATOM   1361 H  HD3   . LYS A 1 89  ? 46.633 24.740  34.590 1.00 21.54 ? 107 LYS A HD3   1 
ATOM   1362 H  HE2   . LYS A 1 89  ? 48.438 25.675  32.977 1.00 26.02 ? 107 LYS A HE2   1 
ATOM   1363 H  HE3   . LYS A 1 89  ? 47.202 25.642  31.728 1.00 26.12 ? 107 LYS A HE3   1 
ATOM   1364 H  HZ1   . LYS A 1 89  ? 46.105 26.856  33.965 1.00 29.90 ? 107 LYS A HZ1   1 
ATOM   1365 H  HZ2   . LYS A 1 89  ? 46.464 27.536  32.446 1.00 29.67 ? 107 LYS A HZ2   1 
ATOM   1366 H  HZ3   . LYS A 1 89  ? 47.625 27.556  33.689 1.00 30.07 ? 107 LYS A HZ3   1 
ATOM   1367 N  N     . LEU A 1 90  ? 49.750 21.019  33.894 1.00 11.10 ? 108 LEU A N     1 
ATOM   1368 C  CA    . LEU A 1 90  ? 50.927 20.876  34.789 1.00 14.36 ? 108 LEU A CA    1 
ATOM   1369 C  C     . LEU A 1 90  ? 51.050 22.152  35.639 1.00 12.58 ? 108 LEU A C     1 
ATOM   1370 O  O     . LEU A 1 90  ? 50.693 23.235  35.187 1.00 12.78 ? 108 LEU A O     1 
ATOM   1371 C  CB    . LEU A 1 90  ? 52.201 20.736  33.969 1.00 13.26 ? 108 LEU A CB    1 
ATOM   1372 C  CG    . LEU A 1 90  ? 52.124 19.588  32.953 1.00 17.09 ? 108 LEU A CG    1 
ATOM   1373 C  CD1   . LEU A 1 90  ? 53.486 19.442  32.273 1.00 16.68 ? 108 LEU A CD1   1 
ATOM   1374 C  CD2   . LEU A 1 90  ? 51.783 18.305  33.695 1.00 18.51 ? 108 LEU A CD2   1 
ATOM   1375 H  H     . LEU A 1 90  ? 49.867 21.382  32.991 1.00 10.21 ? 108 LEU A H     1 
ATOM   1376 H  HA    . LEU A 1 90  ? 50.774 20.025  35.439 1.00 13.35 ? 108 LEU A HA    1 
ATOM   1377 H  HB2   . LEU A 1 90  ? 52.381 21.675  33.461 1.00 14.08 ? 108 LEU A HB2   1 
ATOM   1378 H  HB3   . LEU A 1 90  ? 53.032 20.571  34.639 1.00 15.17 ? 108 LEU A HB3   1 
ATOM   1379 H  HG    . LEU A 1 90  ? 51.362 19.789  32.210 1.00 16.55 ? 108 LEU A HG    1 
ATOM   1380 H  HD11  . LEU A 1 90  ? 54.253 19.227  33.006 1.00 16.75 ? 108 LEU A HD11  1 
ATOM   1381 H  HD12  . LEU A 1 90  ? 53.759 20.357  31.763 1.00 17.34 ? 108 LEU A HD12  1 
ATOM   1382 H  HD13  . LEU A 1 90  ? 53.462 18.648  31.540 1.00 17.20 ? 108 LEU A HD13  1 
ATOM   1383 H  HD21  . LEU A 1 90  ? 50.814 18.371  34.170 1.00 18.00 ? 108 LEU A HD21  1 
ATOM   1384 H  HD22  . LEU A 1 90  ? 52.525 18.087  34.454 1.00 18.07 ? 108 LEU A HD22  1 
ATOM   1385 H  HD23  . LEU A 1 90  ? 51.747 17.483  32.996 1.00 18.62 ? 108 LEU A HD23  1 
ATOM   1386 N  N     . LYS A 1 91  ? 51.549 21.966  36.833 1.00 14.02 ? 109 LYS A N     1 
ATOM   1387 C  CA    . LYS A 1 91  ? 51.753 23.075  37.820 1.00 18.27 ? 109 LYS A CA    1 
ATOM   1388 C  C     . LYS A 1 91  ? 52.752 24.081  37.191 1.00 21.06 ? 109 LYS A C     1 
ATOM   1389 O  O     . LYS A 1 91  ? 52.533 25.269  37.308 1.00 24.02 ? 109 LYS A O     1 
ATOM   1390 C  CB    . LYS A 1 91  ? 52.288 22.460  39.131 1.00 19.71 ? 109 LYS A CB    1 
ATOM   1391 C  CG    . LYS A 1 91  ? 52.308 23.539  40.211 1.00 21.17 ? 109 LYS A CG    1 
ATOM   1392 C  CD    . LYS A 1 91  ? 52.795 23.033  41.589 0.26 20.48 ? 109 LYS A CD    1 
ATOM   1393 C  CE    . LYS A 1 91  ? 51.701 22.197  42.285 0.26 20.72 ? 109 LYS A CE    1 
ATOM   1394 N  NZ    . LYS A 1 91  ? 52.113 21.901  43.691 0.17 20.59 ? 109 LYS A NZ    1 
ATOM   1395 H  H     . LYS A 1 91  ? 51.801 21.049  37.081 1.00 14.55 ? 109 LYS A H     1 
ATOM   1396 H  HA    . LYS A 1 91  ? 50.814 23.581  37.973 1.00 16.68 ? 109 LYS A HA    1 
ATOM   1397 H  HB2   . LYS A 1 91  ? 51.652 21.641  39.436 1.00 19.46 ? 109 LYS A HB2   1 
ATOM   1398 H  HB3   . LYS A 1 91  ? 53.296 22.099  38.970 1.00 19.60 ? 109 LYS A HB3   1 
ATOM   1399 H  HG2   . LYS A 1 91  ? 52.973 24.333  39.894 1.00 21.40 ? 109 LYS A HG2   1 
ATOM   1400 H  HG3   . LYS A 1 91  ? 51.317 23.963  40.313 1.00 21.33 ? 109 LYS A HG3   1 
ATOM   1401 H  HD2   . LYS A 1 91  ? 53.694 22.444  41.473 0.26 20.76 ? 109 LYS A HD2   1 
ATOM   1402 H  HD3   . LYS A 1 91  ? 53.042 23.886  42.208 0.26 20.69 ? 109 LYS A HD3   1 
ATOM   1403 H  HE2   . LYS A 1 91  ? 50.765 22.735  42.314 0.26 20.55 ? 109 LYS A HE2   1 
ATOM   1404 H  HE3   . LYS A 1 91  ? 51.548 21.262  41.771 0.26 20.48 ? 109 LYS A HE3   1 
ATOM   1405 H  HZ1   . LYS A 1 91  ? 51.415 22.301  44.349 0.17 20.13 ? 109 LYS A HZ1   1 
ATOM   1406 H  HZ2   . LYS A 1 91  ? 53.043 22.329  43.876 0.17 20.21 ? 109 LYS A HZ2   1 
ATOM   1407 H  HZ3   . LYS A 1 91  ? 52.173 20.872  43.831 0.17 20.06 ? 109 LYS A HZ3   1 
ATOM   1408 N  N     . SER A 1 92  ? 53.825 23.650  36.581 1.00 20.15 ? 110 SER A N     1 
ATOM   1409 C  CA    . SER A 1 92  ? 54.774 24.605  35.944 1.00 19.45 ? 110 SER A CA    1 
ATOM   1410 C  C     . SER A 1 92  ? 55.014 24.024  34.548 1.00 20.26 ? 110 SER A C     1 
ATOM   1411 O  O     . SER A 1 92  ? 54.763 22.855  34.308 1.00 17.74 ? 110 SER A O     1 
ATOM   1412 C  CB    . SER A 1 92  ? 56.071 24.634  36.719 0.76 19.63 ? 110 SER A CB    1 
ATOM   1413 O  OG    . SER A 1 92  ? 56.423 23.266  36.824 0.76 24.11 ? 110 SER A OG    1 
ATOM   1414 H  H     . SER A 1 92  ? 54.058 22.701  36.509 1.00 20.41 ? 110 SER A H     1 
ATOM   1415 H  HA    . SER A 1 92  ? 54.323 25.584  35.844 1.00 19.48 ? 110 SER A HA    1 
ATOM   1416 H  HB2   . SER A 1 92  ? 56.843 25.157  36.170 0.76 20.70 ? 110 SER A HB2   1 
ATOM   1417 H  HB3   . SER A 1 92  ? 55.937 25.050  37.705 0.76 20.59 ? 110 SER A HB3   1 
ATOM   1418 H  HG    . SER A 1 92  ? 56.595 23.064  37.749 0.76 22.58 ? 110 SER A HG    1 
ATOM   1419 N  N     . ALA A 1 93  ? 55.487 24.823  33.650 1.00 18.20 ? 111 ALA A N     1 
ATOM   1420 C  CA    . ALA A 1 93  ? 55.709 24.283  32.305 1.00 20.37 ? 111 ALA A CA    1 
ATOM   1421 C  C     . ALA A 1 93  ? 56.952 23.437  32.331 1.00 19.46 ? 111 ALA A C     1 
ATOM   1422 O  O     . ALA A 1 93  ? 57.826 23.636  33.153 1.00 19.43 ? 111 ALA A O     1 
ATOM   1423 C  CB    . ALA A 1 93  ? 55.878 25.432  31.334 1.00 21.72 ? 111 ALA A CB    1 
ATOM   1424 H  H     . ALA A 1 93  ? 55.693 25.756  33.865 1.00 20.41 ? 111 ALA A H     1 
ATOM   1425 H  HA    . ALA A 1 93  ? 54.867 23.657  32.039 1.00 19.87 ? 111 ALA A HA    1 
ATOM   1426 H  HB1   . ALA A 1 93  ? 56.728 26.034  31.621 1.00 21.61 ? 111 ALA A HB1   1 
ATOM   1427 H  HB2   . ALA A 1 93  ? 54.987 26.042  31.325 1.00 22.07 ? 111 ALA A HB2   1 
ATOM   1428 H  HB3   . ALA A 1 93  ? 56.051 25.046  30.344 1.00 21.47 ? 111 ALA A HB3   1 
ATOM   1429 N  N     . ALA A 1 94  ? 56.986 22.533  31.403 1.00 18.23 ? 112 ALA A N     1 
ATOM   1430 C  CA    . ALA A 1 94  ? 58.150 21.612  31.292 1.00 19.01 ? 112 ALA A CA    1 
ATOM   1431 C  C     . ALA A 1 94  ? 59.217 22.239  30.385 1.00 17.80 ? 112 ALA A C     1 
ATOM   1432 O  O     . ALA A 1 94  ? 58.837 23.052  29.558 1.00 16.31 ? 112 ALA A O     1 
ATOM   1433 C  CB    . ALA A 1 94  ? 57.679 20.296  30.657 1.00 16.95 ? 112 ALA A CB    1 
ATOM   1434 H  H     . ALA A 1 94  ? 56.235 22.463  30.780 1.00 18.01 ? 112 ALA A H     1 
ATOM   1435 H  HA    . ALA A 1 94  ? 58.570 21.452  32.278 1.00 17.81 ? 112 ALA A HA    1 
ATOM   1436 H  HB1   . ALA A 1 94  ? 57.271 20.473  29.673 1.00 16.92 ? 112 ALA A HB1   1 
ATOM   1437 H  HB2   . ALA A 1 94  ? 56.923 19.831  31.269 1.00 17.69 ? 112 ALA A HB2   1 
ATOM   1438 H  HB3   . ALA A 1 94  ? 58.525 19.627  30.567 1.00 17.71 ? 112 ALA A HB3   1 
ATOM   1439 N  N     . SER A 1 95  ? 60.468 21.867  30.532 1.00 18.40 ? 113 SER A N     1 
ATOM   1440 C  CA    . SER A 1 95  ? 61.529 22.445  29.654 1.00 18.99 ? 113 SER A CA    1 
ATOM   1441 C  C     . SER A 1 95  ? 61.567 21.479  28.480 1.00 18.80 ? 113 SER A C     1 
ATOM   1442 O  O     . SER A 1 95  ? 61.901 20.322  28.680 1.00 17.56 ? 113 SER A O     1 
ATOM   1443 C  CB    A SER A 1 95  ? 62.915 22.428  30.332 0.43 19.23 ? 113 SER A CB    1 
ATOM   1444 C  CB    B SER A 1 95  ? 62.881 22.470  30.406 0.25 18.69 ? 113 SER A CB    1 
ATOM   1445 O  OG    A SER A 1 95  ? 62.696 22.838  31.682 0.43 21.68 ? 113 SER A OG    1 
ATOM   1446 O  OG    B SER A 1 95  ? 62.919 21.271  31.181 0.25 19.86 ? 113 SER A OG    1 
ATOM   1447 H  H     . SER A 1 95  ? 60.749 21.212  31.213 1.00 19.26 ? 113 SER A H     1 
ATOM   1448 H  HA    . SER A 1 95  ? 61.262 23.435  29.313 1.00 19.91 ? 113 SER A HA    1 
ATOM   1449 H  HB2   A SER A 1 95  ? 63.364 21.443  30.303 0.43 19.97 ? 113 SER A HB2   1 
ATOM   1450 H  HB2   B SER A 1 95  ? 63.700 22.474  29.698 0.25 18.65 ? 113 SER A HB2   1 
ATOM   1451 H  HB3   A SER A 1 95  ? 63.576 23.127  29.837 0.43 19.63 ? 113 SER A HB3   1 
ATOM   1452 H  HB3   B SER A 1 95  ? 62.947 23.337  31.049 0.25 18.71 ? 113 SER A HB3   1 
ATOM   1453 H  HG    A SER A 1 95  ? 61.883 23.358  31.732 0.43 20.82 ? 113 SER A HG    1 
ATOM   1454 H  HG    B SER A 1 95  ? 63.186 20.556  30.582 0.25 19.64 ? 113 SER A HG    1 
ATOM   1455 N  N     . LEU A 1 96  ? 61.240 21.957  27.319 1.00 19.10 ? 114 LEU A N     1 
ATOM   1456 C  CA    . LEU A 1 96  ? 61.247 21.078  26.144 1.00 20.90 ? 114 LEU A CA    1 
ATOM   1457 C  C     . LEU A 1 96  ? 62.657 21.110  25.603 1.00 24.93 ? 114 LEU A C     1 
ATOM   1458 O  O     . LEU A 1 96  ? 63.353 22.100  25.691 1.00 25.57 ? 114 LEU A O     1 
ATOM   1459 C  CB    . LEU A 1 96  ? 60.245 21.611  25.135 1.00 19.33 ? 114 LEU A CB    1 
ATOM   1460 C  CG    . LEU A 1 96  ? 58.853 21.717  25.787 1.00 23.16 ? 114 LEU A CG    1 
ATOM   1461 C  CD1   . LEU A 1 96  ? 57.818 22.150  24.764 1.00 24.31 ? 114 LEU A CD1   1 
ATOM   1462 C  CD2   . LEU A 1 96  ? 58.415 20.362  26.383 1.00 24.96 ? 114 LEU A CD2   1 
ATOM   1463 H  H     . LEU A 1 96  ? 60.991 22.901  27.216 1.00 20.01 ? 114 LEU A H     1 
ATOM   1464 H  HA    . LEU A 1 96  ? 61.010 20.069  26.447 1.00 21.67 ? 114 LEU A HA    1 
ATOM   1465 H  HB2   . LEU A 1 96  ? 60.581 22.576  24.787 1.00 21.12 ? 114 LEU A HB2   1 
ATOM   1466 H  HB3   . LEU A 1 96  ? 60.231 20.939  24.290 1.00 21.34 ? 114 LEU A HB3   1 
ATOM   1467 H  HG    . LEU A 1 96  ? 58.889 22.464  26.567 1.00 23.05 ? 114 LEU A HG    1 
ATOM   1468 H  HD11  . LEU A 1 96  ? 57.754 21.438  23.953 1.00 24.18 ? 114 LEU A HD11  1 
ATOM   1469 H  HD12  . LEU A 1 96  ? 58.090 23.114  24.355 1.00 24.12 ? 114 LEU A HD12  1 
ATOM   1470 H  HD13  . LEU A 1 96  ? 56.837 22.245  25.207 1.00 23.79 ? 114 LEU A HD13  1 
ATOM   1471 H  HD21  . LEU A 1 96  ? 59.085 20.043  27.169 1.00 24.31 ? 114 LEU A HD21  1 
ATOM   1472 H  HD22  . LEU A 1 96  ? 58.401 19.598  25.616 1.00 24.55 ? 114 LEU A HD22  1 
ATOM   1473 H  HD23  . LEU A 1 96  ? 57.427 20.454  26.809 1.00 24.36 ? 114 LEU A HD23  1 
ATOM   1474 N  N     . ASN A 1 97  ? 63.056 20.010  25.059 1.00 26.83 ? 115 ASN A N     1 
ATOM   1475 C  CA    . ASN A 1 97  ? 64.404 19.837  24.481 1.00 29.15 ? 115 ASN A CA    1 
ATOM   1476 C  C     . ASN A 1 97  ? 64.292 18.643  23.534 1.00 30.49 ? 115 ASN A C     1 
ATOM   1477 O  O     . ASN A 1 97  ? 63.208 18.351  23.062 1.00 33.03 ? 115 ASN A O     1 
ATOM   1478 C  CB    . ASN A 1 97  ? 65.396 19.583  25.629 1.00 29.82 ? 115 ASN A CB    1 
ATOM   1479 C  CG    . ASN A 1 97  ? 64.930 18.453  26.550 1.00 29.81 ? 115 ASN A CG    1 
ATOM   1480 O  OD1   . ASN A 1 97  ? 64.659 17.363  26.109 1.00 31.08 ? 115 ASN A OD1   1 
ATOM   1481 N  ND2   . ASN A 1 97  ? 64.814 18.636  27.828 1.00 32.26 ? 115 ASN A ND2   1 
ATOM   1482 H  H     . ASN A 1 97  ? 62.433 19.250  25.014 1.00 28.14 ? 115 ASN A H     1 
ATOM   1483 H  HA    . ASN A 1 97  ? 64.665 20.725  23.927 1.00 27.54 ? 115 ASN A HA    1 
ATOM   1484 H  HB2   . ASN A 1 97  ? 66.369 19.330  25.235 1.00 30.43 ? 115 ASN A HB2   1 
ATOM   1485 H  HB3   . ASN A 1 97  ? 65.496 20.490  26.204 1.00 30.31 ? 115 ASN A HB3   1 
ATOM   1486 H  HD21  . ASN A 1 97  ? 64.522 17.902  28.414 1.00 32.01 ? 115 ASN A HD21  1 
ATOM   1487 H  HD22  . ASN A 1 97  ? 65.018 19.508  28.220 1.00 31.87 ? 115 ASN A HD22  1 
ATOM   1488 N  N     . SER A 1 98  ? 65.359 17.958  23.256 1.00 32.66 ? 116 SER A N     1 
ATOM   1489 C  CA    . SER A 1 98  ? 65.239 16.797  22.328 1.00 34.55 ? 116 SER A CA    1 
ATOM   1490 C  C     . SER A 1 98  ? 64.695 15.563  23.043 1.00 32.02 ? 116 SER A C     1 
ATOM   1491 O  O     . SER A 1 98  ? 64.177 14.681  22.398 1.00 36.43 ? 116 SER A O     1 
ATOM   1492 C  CB    . SER A 1 98  ? 66.645 16.494  21.712 1.00 36.74 ? 116 SER A CB    1 
ATOM   1493 O  OG    . SER A 1 98  ? 67.611 16.578  22.772 1.00 40.02 ? 116 SER A OG    1 
ATOM   1494 H  H     . SER A 1 98  ? 66.231 18.185  23.643 1.00 31.59 ? 116 SER A H     1 
ATOM   1495 H  HA    . SER A 1 98  ? 64.539 17.054  21.542 1.00 34.22 ? 116 SER A HA    1 
ATOM   1496 H  HB2   . SER A 1 98  ? 66.643 15.490  21.299 1.00 37.18 ? 116 SER A HB2   1 
ATOM   1497 H  HB3   . SER A 1 98  ? 66.887 17.195  20.923 1.00 37.11 ? 116 SER A HB3   1 
ATOM   1498 H  HG    . SER A 1 98  ? 68.191 15.809  22.637 1.00 39.07 ? 116 SER A HG    1 
ATOM   1499 N  N     . ARG A 1 99  ? 64.820 15.530  24.340 1.00 27.65 ? 117 ARG A N     1 
ATOM   1500 C  CA    . ARG A 1 99  ? 64.328 14.369  25.141 1.00 26.84 ? 117 ARG A CA    1 
ATOM   1501 C  C     . ARG A 1 99  ? 62.906 14.568  25.649 1.00 25.10 ? 117 ARG A C     1 
ATOM   1502 O  O     . ARG A 1 99  ? 62.283 13.586  26.004 1.00 26.31 ? 117 ARG A O     1 
ATOM   1503 C  CB    . ARG A 1 99  ? 65.267 14.119  26.381 1.00 28.81 ? 117 ARG A CB    1 
ATOM   1504 C  CG    . ARG A 1 99  ? 66.578 13.352  25.964 1.00 30.71 ? 117 ARG A CG    1 
ATOM   1505 C  CD    . ARG A 1 99  ? 67.547 14.158  25.107 0.43 30.69 ? 117 ARG A CD    1 
ATOM   1506 N  NE    . ARG A 1 99  ? 68.702 14.494  25.978 0.43 31.87 ? 117 ARG A NE    1 
ATOM   1507 C  CZ    . ARG A 1 99  ? 69.038 15.735  26.213 0.43 33.30 ? 117 ARG A CZ    1 
ATOM   1508 N  NH1   . ARG A 1 99  ? 68.124 16.655  26.388 0.43 31.72 ? 117 ARG A NH1   1 
ATOM   1509 N  NH2   . ARG A 1 99  ? 70.313 16.004  26.256 0.43 35.46 ? 117 ARG A NH2   1 
ATOM   1510 H  H     . ARG A 1 99  ? 65.242 16.288  24.787 1.00 29.11 ? 117 ARG A H     1 
ATOM   1511 H  HA    . ARG A 1 99  ? 64.318 13.496  24.501 1.00 27.24 ? 117 ARG A HA    1 
ATOM   1512 H  HB2   . ARG A 1 99  ? 65.508 15.057  26.862 1.00 28.47 ? 117 ARG A HB2   1 
ATOM   1513 H  HB3   . ARG A 1 99  ? 64.733 13.516  27.105 1.00 28.48 ? 117 ARG A HB3   1 
ATOM   1514 H  HG2   . ARG A 1 99  ? 67.092 13.019  26.856 1.00 30.46 ? 117 ARG A HG2   1 
ATOM   1515 H  HG3   . ARG A 1 99  ? 66.315 12.473  25.398 1.00 31.10 ? 117 ARG A HG3   1 
ATOM   1516 H  HD2   . ARG A 1 99  ? 67.906 13.557  24.285 0.25 31.00 ? 117 ARG A HD2   1 
ATOM   1517 H  HD3   . ARG A 1 99  ? 67.110 15.062  24.715 0.25 31.06 ? 117 ARG A HD3   1 
ATOM   1518 H  HE    . ARG A 1 99  ? 69.220 13.768  26.384 0.25 31.70 ? 117 ARG A HE    1 
ATOM   1519 H  HH11  . ARG A 1 99  ? 68.393 17.601  26.569 0.43 31.76 ? 117 ARG A HH11  1 
ATOM   1520 H  HH12  . ARG A 1 99  ? 67.156 16.409  26.347 0.43 32.16 ? 117 ARG A HH12  1 
ATOM   1521 H  HH21  . ARG A 1 99  ? 70.625 16.937  26.433 0.43 34.81 ? 117 ARG A HH21  1 
ATOM   1522 H  HH22  . ARG A 1 99  ? 70.977 15.268  26.115 0.43 34.75 ? 117 ARG A HH22  1 
ATOM   1523 N  N     . VAL A 1 100 ? 62.435 15.771  25.703 1.00 21.85 ? 118 VAL A N     1 
ATOM   1524 C  CA    . VAL A 1 100 ? 61.066 16.036  26.177 1.00 18.08 ? 118 VAL A CA    1 
ATOM   1525 C  C     . VAL A 1 100 ? 60.527 16.960  25.088 1.00 19.86 ? 118 VAL A C     1 
ATOM   1526 O  O     . VAL A 1 100 ? 60.981 18.089  24.978 1.00 18.44 ? 118 VAL A O     1 
ATOM   1527 C  CB    . VAL A 1 100 ? 61.167 16.696  27.606 1.00 16.40 ? 118 VAL A CB    1 
ATOM   1528 C  CG1   . VAL A 1 100 ? 59.759 17.064  28.138 1.00 15.50 ? 118 VAL A CG1   1 
ATOM   1529 C  CG2   . VAL A 1 100 ? 61.813 15.691  28.629 1.00 14.61 ? 118 VAL A CG2   1 
ATOM   1530 H  H     . VAL A 1 100 ? 62.992 16.531  25.425 1.00 22.48 ? 118 VAL A H     1 
ATOM   1531 H  HA    . VAL A 1 100 ? 60.499 15.116  26.183 1.00 20.28 ? 118 VAL A HA    1 
ATOM   1532 H  HB    . VAL A 1 100 ? 61.771 17.591  27.538 1.00 16.48 ? 118 VAL A HB    1 
ATOM   1533 H  HG11  . VAL A 1 100 ? 59.137 16.185  28.200 1.00 15.16 ? 118 VAL A HG11  1 
ATOM   1534 H  HG12  . VAL A 1 100 ? 59.281 17.771  27.474 1.00 15.14 ? 118 VAL A HG12  1 
ATOM   1535 H  HG13  . VAL A 1 100 ? 59.822 17.519  29.116 1.00 14.83 ? 118 VAL A HG13  1 
ATOM   1536 H  HG21  . VAL A 1 100 ? 62.810 15.431  28.303 1.00 15.71 ? 118 VAL A HG21  1 
ATOM   1537 H  HG22  . VAL A 1 100 ? 61.230 14.787  28.708 1.00 15.38 ? 118 VAL A HG22  1 
ATOM   1538 H  HG23  . VAL A 1 100 ? 61.889 16.139  29.607 1.00 16.03 ? 118 VAL A HG23  1 
ATOM   1539 N  N     . ALA A 1 101 ? 59.593 16.470  24.320 1.00 18.00 ? 119 ALA A N     1 
ATOM   1540 C  CA    . ALA A 1 101 ? 58.996 17.270  23.217 1.00 17.07 ? 119 ALA A CA    1 
ATOM   1541 C  C     . ALA A 1 101 ? 57.499 17.024  23.154 1.00 17.91 ? 119 ALA A C     1 
ATOM   1542 O  O     . ALA A 1 101 ? 57.046 16.001  23.633 1.00 16.82 ? 119 ALA A O     1 
ATOM   1543 C  CB    . ALA A 1 101 ? 59.657 16.833  21.939 1.00 17.68 ? 119 ALA A CB    1 
ATOM   1544 H  H     . ALA A 1 101 ? 59.256 15.558  24.466 1.00 17.93 ? 119 ALA A H     1 
ATOM   1545 H  HA    . ALA A 1 101 ? 59.176 18.318  23.405 1.00 17.95 ? 119 ALA A HA    1 
ATOM   1546 H  HB1   . ALA A 1 101 ? 59.460 15.788  21.749 1.00 17.63 ? 119 ALA A HB1   1 
ATOM   1547 H  HB2   . ALA A 1 101 ? 60.724 16.983  21.999 1.00 17.57 ? 119 ALA A HB2   1 
ATOM   1548 H  HB3   . ALA A 1 101 ? 59.259 17.407  21.116 1.00 17.61 ? 119 ALA A HB3   1 
ATOM   1549 N  N     . SER A 1 102 ? 56.742 17.907  22.571 1.00 17.10 ? 120 SER A N     1 
ATOM   1550 C  CA    . SER A 1 102 ? 55.270 17.636  22.531 1.00 18.11 ? 120 SER A CA    1 
ATOM   1551 C  C     . SER A 1 102 ? 54.960 16.978  21.188 1.00 15.39 ? 120 SER A C     1 
ATOM   1552 O  O     . SER A 1 102 ? 55.832 16.991  20.333 1.00 14.39 ? 120 SER A O     1 
ATOM   1553 C  CB    . SER A 1 102 ? 54.524 18.971  22.688 1.00 17.60 ? 120 SER A CB    1 
ATOM   1554 O  OG    . SER A 1 102 ? 55.106 19.844  21.729 1.00 20.45 ? 120 SER A OG    1 
ATOM   1555 H  H     . SER A 1 102 ? 57.133 18.713  22.170 1.00 17.27 ? 120 SER A H     1 
ATOM   1556 H  HA    . SER A 1 102 ? 55.003 16.957  23.332 1.00 17.64 ? 120 SER A HA    1 
ATOM   1557 H  HB2   . SER A 1 102 ? 53.478 18.844  22.451 1.00 18.09 ? 120 SER A HB2   1 
ATOM   1558 H  HB3   . SER A 1 102 ? 54.638 19.379  23.682 1.00 17.73 ? 120 SER A HB3   1 
ATOM   1559 H  HG    . SER A 1 102 ? 55.685 19.331  21.124 1.00 19.88 ? 120 SER A HG    1 
ATOM   1560 N  N     . ILE A 1 103 ? 53.776 16.442  21.055 1.00 14.23 ? 121 ILE A N     1 
ATOM   1561 C  CA    . ILE A 1 103 ? 53.364 15.787  19.788 1.00 16.60 ? 121 ILE A CA    1 
ATOM   1562 C  C     . ILE A 1 103 ? 52.159 16.655  19.301 1.00 15.17 ? 121 ILE A C     1 
ATOM   1563 O  O     . ILE A 1 103 ? 51.420 17.215  20.111 1.00 17.12 ? 121 ILE A O     1 
ATOM   1564 C  CB    . ILE A 1 103 ? 52.995 14.255  20.116 1.00 14.90 ? 121 ILE A CB    1 
ATOM   1565 C  CG1   . ILE A 1 103 ? 52.673 13.398  18.842 1.00 15.03 ? 121 ILE A CG1   1 
ATOM   1566 C  CG2   . ILE A 1 103 ? 51.861 14.065  21.129 1.00 13.20 ? 121 ILE A CG2   1 
ATOM   1567 C  CD1   . ILE A 1 103 ? 53.957 13.331  18.016 1.00 13.20 ? 121 ILE A CD1   1 
ATOM   1568 H  H     . ILE A 1 103 ? 53.134 16.469  21.797 1.00 14.79 ? 121 ILE A H     1 
ATOM   1569 H  HA    . ILE A 1 103 ? 54.173 15.864  19.074 1.00 15.77 ? 121 ILE A HA    1 
ATOM   1570 H  HB    . ILE A 1 103 ? 53.877 13.824  20.569 1.00 15.14 ? 121 ILE A HB    1 
ATOM   1571 H  HG12  . ILE A 1 103 ? 52.384 12.397  19.125 1.00 13.74 ? 121 ILE A HG12  1 
ATOM   1572 H  HG13  . ILE A 1 103 ? 51.871 13.828  18.259 1.00 13.87 ? 121 ILE A HG13  1 
ATOM   1573 H  HG21  . ILE A 1 103 ? 50.953 14.528  20.770 1.00 14.43 ? 121 ILE A HG21  1 
ATOM   1574 H  HG22  . ILE A 1 103 ? 52.129 14.512  22.075 1.00 14.14 ? 121 ILE A HG22  1 
ATOM   1575 H  HG23  . ILE A 1 103 ? 51.673 13.013  21.291 1.00 13.91 ? 121 ILE A HG23  1 
ATOM   1576 H  HD11  . ILE A 1 103 ? 54.752 12.869  18.583 1.00 13.76 ? 121 ILE A HD11  1 
ATOM   1577 H  HD12  . ILE A 1 103 ? 54.288 14.310  17.718 1.00 14.22 ? 121 ILE A HD12  1 
ATOM   1578 H  HD13  . ILE A 1 103 ? 53.791 12.745  17.125 1.00 14.39 ? 121 ILE A HD13  1 
ATOM   1579 N  N     . SER A 1 104 ? 52.028 16.714  18.005 1.00 14.22 ? 122 SER A N     1 
ATOM   1580 C  CA    . SER A 1 104 ? 50.963 17.477  17.334 1.00 16.27 ? 122 SER A CA    1 
ATOM   1581 C  C     . SER A 1 104 ? 49.654 16.745  17.302 1.00 15.32 ? 122 SER A C     1 
ATOM   1582 O  O     . SER A 1 104 ? 49.621 15.531  17.200 1.00 14.55 ? 122 SER A O     1 
ATOM   1583 C  CB    . SER A 1 104 ? 51.336 17.734  15.892 1.00 21.61 ? 122 SER A CB    1 
ATOM   1584 O  OG    . SER A 1 104 ? 52.583 18.413  15.987 1.00 29.29 ? 122 SER A OG    1 
ATOM   1585 H  H     . SER A 1 104 ? 52.668 16.241  17.435 1.00 13.76 ? 122 SER A H     1 
ATOM   1586 H  HA    . SER A 1 104 ? 50.840 18.409  17.856 1.00 15.84 ? 122 SER A HA    1 
ATOM   1587 H  HB2   . SER A 1 104 ? 51.461 16.807  15.355 1.00 21.95 ? 122 SER A HB2   1 
ATOM   1588 H  HB3   . SER A 1 104 ? 50.604 18.354  15.389 1.00 21.82 ? 122 SER A HB3   1 
ATOM   1589 H  HG    . SER A 1 104 ? 53.283 17.779  15.758 1.00 27.48 ? 122 SER A HG    1 
ATOM   1590 N  N     . LEU A 1 105 ? 48.621 17.519  17.371 1.00 15.59 ? 123 LEU A N     1 
ATOM   1591 C  CA    . LEU A 1 105 ? 47.252 16.976  17.335 1.00 18.96 ? 123 LEU A CA    1 
ATOM   1592 C  C     . LEU A 1 105 ? 47.002 16.840  15.823 1.00 20.35 ? 123 LEU A C     1 
ATOM   1593 O  O     . LEU A 1 105 ? 47.627 17.528  15.037 1.00 19.85 ? 123 LEU A O     1 
ATOM   1594 C  CB    . LEU A 1 105 ? 46.218 17.977  17.912 1.00 19.55 ? 123 LEU A CB    1 
ATOM   1595 C  CG    . LEU A 1 105 ? 46.378 18.178  19.434 1.00 20.82 ? 123 LEU A CG    1 
ATOM   1596 C  CD1   . LEU A 1 105 ? 45.390 19.264  19.890 1.00 21.68 ? 123 LEU A CD1   1 
ATOM   1597 C  CD2   . LEU A 1 105 ? 46.030 16.874  20.182 1.00 21.19 ? 123 LEU A CD2   1 
ATOM   1598 H  H     . LEU A 1 105 ? 48.752 18.488  17.445 1.00 18.60 ? 123 LEU A H     1 
ATOM   1599 H  HA    . LEU A 1 105 ? 47.238 16.005  17.806 1.00 19.28 ? 123 LEU A HA    1 
ATOM   1600 H  HB2   . LEU A 1 105 ? 46.352 18.921  17.400 1.00 20.38 ? 123 LEU A HB2   1 
ATOM   1601 H  HB3   . LEU A 1 105 ? 45.226 17.624  17.668 1.00 20.10 ? 123 LEU A HB3   1 
ATOM   1602 H  HG    . LEU A 1 105 ? 47.394 18.472  19.670 1.00 21.29 ? 123 LEU A HG    1 
ATOM   1603 H  HD11  . LEU A 1 105 ? 44.368 18.979  19.683 1.00 20.40 ? 123 LEU A HD11  1 
ATOM   1604 H  HD12  . LEU A 1 105 ? 45.595 20.198  19.386 1.00 20.41 ? 123 LEU A HD12  1 
ATOM   1605 H  HD13  . LEU A 1 105 ? 45.492 19.434  20.954 1.00 20.51 ? 123 LEU A HD13  1 
ATOM   1606 H  HD21  . LEU A 1 105 ? 46.708 16.080  19.901 1.00 20.98 ? 123 LEU A HD21  1 
ATOM   1607 H  HD22  . LEU A 1 105 ? 45.017 16.560  19.969 1.00 20.72 ? 123 LEU A HD22  1 
ATOM   1608 H  HD23  . LEU A 1 105 ? 46.131 17.024  21.249 1.00 21.25 ? 123 LEU A HD23  1 
ATOM   1609 N  N     . PRO A 1 106 ? 46.120 15.985  15.413 1.00 21.64 ? 124 PRO A N     1 
ATOM   1610 C  CA    . PRO A 1 106 ? 45.847 15.837  13.957 1.00 23.30 ? 124 PRO A CA    1 
ATOM   1611 C  C     . PRO A 1 106 ? 44.873 16.873  13.389 1.00 23.08 ? 124 PRO A C     1 
ATOM   1612 O  O     . PRO A 1 106 ? 44.098 17.490  14.096 1.00 21.84 ? 124 PRO A O     1 
ATOM   1613 C  CB    . PRO A 1 106 ? 45.320 14.427  13.856 1.00 21.69 ? 124 PRO A CB    1 
ATOM   1614 C  CG    . PRO A 1 106 ? 44.498 14.285  15.178 1.00 22.11 ? 124 PRO A CG    1 
ATOM   1615 C  CD    . PRO A 1 106 ? 45.318 15.055  16.253 1.00 21.01 ? 124 PRO A CD    1 
ATOM   1616 H  HA    . PRO A 1 106 ? 46.779 15.918  13.413 1.00 23.44 ? 124 PRO A HA    1 
ATOM   1617 H  HB2   . PRO A 1 106 ? 44.670 14.327  12.996 1.00 22.30 ? 124 PRO A HB2   1 
ATOM   1618 H  HB3   . PRO A 1 106 ? 46.120 13.708  13.781 1.00 22.25 ? 124 PRO A HB3   1 
ATOM   1619 H  HG2   . PRO A 1 106 ? 43.512 14.709  15.053 1.00 21.83 ? 124 PRO A HG2   1 
ATOM   1620 H  HG3   . PRO A 1 106 ? 44.410 13.245  15.460 1.00 22.41 ? 124 PRO A HG3   1 
ATOM   1621 H  HD2   . PRO A 1 106 ? 44.683 15.615  16.922 1.00 21.07 ? 124 PRO A HD2   1 
ATOM   1622 H  HD3   . PRO A 1 106 ? 45.974 14.410  16.812 1.00 20.65 ? 124 PRO A HD3   1 
ATOM   1623 N  N     . THR A 1 107 ? 44.940 17.026  12.115 1.00 27.46 ? 125 THR A N     1 
ATOM   1624 C  CA    . THR A 1 107 ? 44.047 17.975  11.417 1.00 31.58 ? 125 THR A CA    1 
ATOM   1625 C  C     . THR A 1 107 ? 42.959 17.143  10.742 1.00 30.42 ? 125 THR A C     1 
ATOM   1626 O  O     . THR A 1 107 ? 41.938 17.677  10.352 1.00 34.08 ? 125 THR A O     1 
ATOM   1627 C  CB    . THR A 1 107 ? 44.884 18.757  10.403 1.00 35.72 ? 125 THR A CB    1 
ATOM   1628 O  OG1   . THR A 1 107 ? 45.885 17.845  9.932  1.00 38.37 ? 125 THR A OG1   1 
ATOM   1629 C  CG2   . THR A 1 107 ? 45.644 19.866  11.178 1.00 37.56 ? 125 THR A CG2   1 
ATOM   1630 H  H     . THR A 1 107 ? 45.587 16.529  11.576 1.00 27.73 ? 125 THR A H     1 
ATOM   1631 H  HA    . THR A 1 107 ? 43.567 18.625  12.137 1.00 32.01 ? 125 THR A HA    1 
ATOM   1632 H  HB    . THR A 1 107 ? 44.276 19.121  9.582  1.00 35.69 ? 125 THR A HB    1 
ATOM   1633 H  HG1   . THR A 1 107 ? 46.764 18.170  10.148 1.00 37.20 ? 125 THR A HG1   1 
ATOM   1634 H  HG21  . THR A 1 107 ? 46.285 19.449  11.945 1.00 37.24 ? 125 THR A HG21  1 
ATOM   1635 H  HG22  . THR A 1 107 ? 44.929 20.515  11.666 1.00 36.96 ? 125 THR A HG22  1 
ATOM   1636 H  HG23  . THR A 1 107 ? 46.246 20.468  10.511 1.00 37.42 ? 125 THR A HG23  1 
ATOM   1637 N  N     . SER A 1 108 ? 43.199 15.871  10.608 1.00 24.58 ? 127 SER A N     1 
ATOM   1638 C  CA    . SER A 1 108 ? 42.216 14.989  9.982  1.00 25.46 ? 127 SER A CA    1 
ATOM   1639 C  C     . SER A 1 108 ? 42.377 13.639  10.632 1.00 22.00 ? 127 SER A C     1 
ATOM   1640 O  O     . SER A 1 108 ? 43.424 13.384  11.191 1.00 18.38 ? 127 SER A O     1 
ATOM   1641 C  CB    . SER A 1 108 ? 42.531 14.949  8.497  1.00 29.50 ? 127 SER A CB    1 
ATOM   1642 O  OG    . SER A 1 108 ? 43.939 14.693  8.507  1.00 34.88 ? 127 SER A OG    1 
ATOM   1643 H  H     . SER A 1 108 ? 44.031 15.463  10.915 1.00 25.59 ? 127 SER A H     1 
ATOM   1644 H  HA    . SER A 1 108 ? 41.223 15.367  10.185 1.00 25.77 ? 127 SER A HA    1 
ATOM   1645 H  HB2   . SER A 1 108 ? 42.003 14.146  7.998  1.00 29.44 ? 127 SER A HB2   1 
ATOM   1646 H  HB3   . SER A 1 108 ? 42.316 15.897  8.022  1.00 29.19 ? 127 SER A HB3   1 
ATOM   1647 H  HG    . SER A 1 108 ? 44.048 13.771  8.230  1.00 33.20 ? 127 SER A HG    1 
ATOM   1648 N  N     . CYS A 1 109 ? 41.372 12.825  10.527 1.00 21.44 ? 128 CYS A N     1 
ATOM   1649 C  CA    . CYS A 1 109 ? 41.417 11.471  11.118 1.00 21.56 ? 128 CYS A CA    1 
ATOM   1650 C  C     . CYS A 1 109 ? 42.248 10.567  10.190 1.00 23.41 ? 128 CYS A C     1 
ATOM   1651 O  O     . CYS A 1 109 ? 42.405 10.859  9.016  1.00 27.16 ? 128 CYS A O     1 
ATOM   1652 C  CB    . CYS A 1 109 ? 40.004 10.946  11.221 1.00 20.74 ? 128 CYS A CB    1 
ATOM   1653 S  SG    . CYS A 1 109 ? 38.878 11.942  12.207 1.00 20.48 ? 128 CYS A SG    1 
ATOM   1654 H  H     . CYS A 1 109 ? 40.567 13.109  10.046 1.00 21.99 ? 128 CYS A H     1 
ATOM   1655 H  HA    . CYS A 1 109 ? 41.893 11.534  12.085 1.00 22.41 ? 128 CYS A HA    1 
ATOM   1656 H  HB2   . CYS A 1 109 ? 39.601 10.871  10.222 1.00 21.10 ? 128 CYS A HB2   1 
ATOM   1657 H  HB3   . CYS A 1 109 ? 40.016 9.945   11.627 1.00 20.75 ? 128 CYS A HB3   1 
ATOM   1658 N  N     . ALA A 1 110 ? 42.728 9.486   10.729 1.00 22.39 ? 129 ALA A N     1 
ATOM   1659 C  CA    . ALA A 1 110 ? 43.549 8.564   9.906  1.00 20.27 ? 129 ALA A CA    1 
ATOM   1660 C  C     . ALA A 1 110 ? 42.678 7.497   9.294  1.00 21.97 ? 129 ALA A C     1 
ATOM   1661 O  O     . ALA A 1 110 ? 41.587 7.246   9.767  1.00 26.67 ? 129 ALA A O     1 
ATOM   1662 C  CB    . ALA A 1 110 ? 44.595 7.912   10.779 1.00 19.71 ? 129 ALA A CB    1 
ATOM   1663 H  H     . ALA A 1 110 ? 42.545 9.284   11.670 1.00 22.60 ? 129 ALA A H     1 
ATOM   1664 H  HA    . ALA A 1 110 ? 44.025 9.136   9.119  1.00 20.15 ? 129 ALA A HA    1 
ATOM   1665 H  HB1   . ALA A 1 110 ? 44.136 7.360   11.585 1.00 20.25 ? 129 ALA A HB1   1 
ATOM   1666 H  HB2   . ALA A 1 110 ? 45.247 8.668   11.192 1.00 20.38 ? 129 ALA A HB2   1 
ATOM   1667 H  HB3   . ALA A 1 110 ? 45.192 7.233   10.188 1.00 20.13 ? 129 ALA A HB3   1 
ATOM   1668 N  N     . SER A 1 111 ? 43.186 6.892   8.271  1.00 22.93 ? 130 SER A N     1 
ATOM   1669 C  CA    . SER A 1 111 ? 42.462 5.834   7.563  1.00 22.84 ? 130 SER A CA    1 
ATOM   1670 C  C     . SER A 1 111 ? 42.933 4.446   7.981  1.00 21.44 ? 130 SER A C     1 
ATOM   1671 O  O     . SER A 1 111 ? 44.021 4.259   8.504  1.00 21.29 ? 130 SER A O     1 
ATOM   1672 C  CB    A SER A 1 111 ? 42.674 6.081   6.065  0.45 24.47 ? 130 SER A CB    1 
ATOM   1673 C  CB    B SER A 1 111 ? 42.677 6.036   6.036  0.46 23.65 ? 130 SER A CB    1 
ATOM   1674 O  OG    A SER A 1 111 ? 41.986 7.316   5.853  0.45 26.20 ? 130 SER A OG    1 
ATOM   1675 O  OG    B SER A 1 111 ? 44.046 6.380   5.850  0.46 24.44 ? 130 SER A OG    1 
ATOM   1676 H  H     . SER A 1 111 ? 44.077 7.131   7.937  1.00 23.19 ? 130 SER A H     1 
ATOM   1677 H  HA    . SER A 1 111 ? 41.409 5.918   7.792  1.00 23.02 ? 130 SER A HA    1 
ATOM   1678 H  HB2   A SER A 1 111 ? 43.721 6.191   5.814  0.45 24.69 ? 130 SER A HB2   1 
ATOM   1679 H  HB2   B SER A 1 111 ? 42.490 5.117   5.496  0.46 23.97 ? 130 SER A HB2   1 
ATOM   1680 H  HB3   A SER A 1 111 ? 42.241 5.296   5.461  0.45 25.03 ? 130 SER A HB3   1 
ATOM   1681 H  HB3   B SER A 1 111 ? 42.057 6.829   5.646  0.46 23.93 ? 130 SER A HB3   1 
ATOM   1682 H  HG    A SER A 1 111 ? 42.658 8.010   5.705  0.45 25.83 ? 130 SER A HG    1 
ATOM   1683 H  HG    B SER A 1 111 ? 44.070 7.303   5.538  0.46 23.90 ? 130 SER A HG    1 
ATOM   1684 N  N     . ALA A 1 112 ? 42.073 3.500   7.741  1.00 21.84 ? 132 ALA A N     1 
ATOM   1685 C  CA    . ALA A 1 112 ? 42.406 2.089   8.084  1.00 22.28 ? 132 ALA A CA    1 
ATOM   1686 C  C     . ALA A 1 112 ? 43.703 1.782   7.327  1.00 22.73 ? 132 ALA A C     1 
ATOM   1687 O  O     . ALA A 1 112 ? 43.897 2.296   6.233  1.00 21.48 ? 132 ALA A O     1 
ATOM   1688 C  CB    . ALA A 1 112 ? 41.300 1.145   7.591  1.00 20.33 ? 132 ALA A CB    1 
ATOM   1689 H  H     . ALA A 1 112 ? 41.200 3.709   7.344  1.00 22.12 ? 132 ALA A H     1 
ATOM   1690 H  HA    . ALA A 1 112 ? 42.573 2.020   9.151  1.00 22.15 ? 132 ALA A HA    1 
ATOM   1691 H  HB1   . ALA A 1 112 ? 41.211 1.228   6.518  1.00 20.89 ? 132 ALA A HB1   1 
ATOM   1692 H  HB2   . ALA A 1 112 ? 40.354 1.404   8.043  1.00 20.98 ? 132 ALA A HB2   1 
ATOM   1693 H  HB3   . ALA A 1 112 ? 41.544 0.122   7.836  1.00 20.76 ? 132 ALA A HB3   1 
ATOM   1694 N  N     . GLY A 1 113 ? 44.551 0.974   7.900  1.00 20.77 ? 133 GLY A N     1 
ATOM   1695 C  CA    . GLY A 1 113 ? 45.808 0.670   7.177  1.00 22.31 ? 133 GLY A CA    1 
ATOM   1696 C  C     . GLY A 1 113 ? 46.949 1.529   7.680  1.00 22.58 ? 133 GLY A C     1 
ATOM   1697 O  O     . GLY A 1 113 ? 48.077 1.089   7.598  1.00 26.97 ? 133 GLY A O     1 
ATOM   1698 H  H     . GLY A 1 113 ? 44.376 0.571   8.778  1.00 21.74 ? 133 GLY A H     1 
ATOM   1699 H  HA2   . GLY A 1 113 ? 46.056 -0.367  7.348  1.00 21.58 ? 133 GLY A HA2   1 
ATOM   1700 H  HA3   . GLY A 1 113 ? 45.679 0.827   6.117  1.00 22.86 ? 133 GLY A HA3   1 
ATOM   1701 N  N     . THR A 1 114 ? 46.661 2.716   8.164  1.00 20.88 ? 134 THR A N     1 
ATOM   1702 C  CA    . THR A 1 114 ? 47.741 3.612   8.681  1.00 20.23 ? 134 THR A CA    1 
ATOM   1703 C  C     . THR A 1 114 ? 48.525 2.891   9.792  1.00 18.27 ? 134 THR A C     1 
ATOM   1704 O  O     . THR A 1 114 ? 47.932 2.322   10.686 1.00 18.33 ? 134 THR A O     1 
ATOM   1705 C  CB    . THR A 1 114 ? 47.084 4.892   9.224  1.00 19.57 ? 134 THR A CB    1 
ATOM   1706 O  OG1   . THR A 1 114 ? 46.420 5.468   8.102  1.00 19.95 ? 134 THR A OG1   1 
ATOM   1707 C  CG2   . THR A 1 114 ? 48.146 5.934   9.605  1.00 17.96 ? 134 THR A CG2   1 
ATOM   1708 H  H     . THR A 1 114 ? 45.731 3.026   8.189  1.00 20.47 ? 134 THR A H     1 
ATOM   1709 H  HA    . THR A 1 114 ? 48.411 3.827   7.862  1.00 19.57 ? 134 THR A HA    1 
ATOM   1710 H  HB    . THR A 1 114 ? 46.395 4.690   10.035 1.00 19.68 ? 134 THR A HB    1 
ATOM   1711 H  HG1   . THR A 1 114 ? 45.553 5.038   8.024  1.00 19.74 ? 134 THR A HG1   1 
ATOM   1712 H  HG21  . THR A 1 114 ? 48.757 6.207   8.758  1.00 18.52 ? 134 THR A HG21  1 
ATOM   1713 H  HG22  . THR A 1 114 ? 48.791 5.542   10.378 1.00 18.36 ? 134 THR A HG22  1 
ATOM   1714 H  HG23  . THR A 1 114 ? 47.669 6.821   9.998  1.00 18.70 ? 134 THR A HG23  1 
ATOM   1715 N  N     . GLN A 1 115 ? 49.826 2.982   9.693  1.00 18.86 ? 135 GLN A N     1 
ATOM   1716 C  CA    . GLN A 1 115 ? 50.756 2.343   10.669 1.00 19.12 ? 135 GLN A CA    1 
ATOM   1717 C  C     . GLN A 1 115 ? 51.034 3.400   11.721 1.00 16.50 ? 135 GLN A C     1 
ATOM   1718 O  O     . GLN A 1 115 ? 51.378 4.523   11.378 1.00 18.70 ? 135 GLN A O     1 
ATOM   1719 C  CB    . GLN A 1 115 ? 52.039 1.956   9.911  0.48 20.42 ? 135 GLN A CB    1 
ATOM   1720 C  CG    . GLN A 1 115 ? 52.748 0.738   10.528 0.57 24.79 ? 135 GLN A CG    1 
ATOM   1721 C  CD    . GLN A 1 115 ? 51.881 -0.502  10.273 0.57 26.09 ? 135 GLN A CD    1 
ATOM   1722 O  OE1   . GLN A 1 115 ? 51.249 -0.628  9.245  0.57 27.74 ? 135 GLN A OE1   1 
ATOM   1723 N  NE2   . GLN A 1 115 ? 51.812 -1.449  11.155 0.57 27.67 ? 135 GLN A NE2   1 
ATOM   1724 H  H     . GLN A 1 115 ? 50.197 3.494   8.944  1.00 19.58 ? 135 GLN A H     1 
ATOM   1725 H  HA    . GLN A 1 115 ? 50.252 1.498   11.117 1.00 18.30 ? 135 GLN A HA    1 
ATOM   1726 H  HB2   . GLN A 1 115 ? 51.775 1.697   8.895  0.48 21.00 ? 135 GLN A HB2   1 
ATOM   1727 H  HB3   . GLN A 1 115 ? 52.718 2.795   9.875  0.48 20.97 ? 135 GLN A HB3   1 
ATOM   1728 H  HG2   . GLN A 1 115 ? 53.707 0.586   10.050 0.57 23.95 ? 135 GLN A HG2   1 
ATOM   1729 H  HG3   . GLN A 1 115 ? 52.888 0.870   11.591 0.57 24.04 ? 135 GLN A HG3   1 
ATOM   1730 H  HE21  . GLN A 1 115 ? 51.252 -2.226  10.949 0.57 26.87 ? 135 GLN A HE21  1 
ATOM   1731 H  HE22  . GLN A 1 115 ? 52.303 -1.393  11.998 0.57 26.71 ? 135 GLN A HE22  1 
ATOM   1732 N  N     . CYS A 1 116 ? 50.886 3.005   12.944 1.00 15.35 ? 136 CYS A N     1 
ATOM   1733 C  CA    . CYS A 1 116 ? 51.108 3.912   14.099 1.00 14.63 ? 136 CYS A CA    1 
ATOM   1734 C  C     . CYS A 1 116 ? 52.064 3.259   15.081 1.00 17.17 ? 136 CYS A C     1 
ATOM   1735 O  O     . CYS A 1 116 ? 52.338 2.079   14.977 1.00 16.47 ? 136 CYS A O     1 
ATOM   1736 C  CB    . CYS A 1 116 ? 49.765 4.155   14.757 1.00 16.20 ? 136 CYS A CB    1 
ATOM   1737 S  SG    . CYS A 1 116 ? 48.412 4.720   13.677 1.00 15.32 ? 136 CYS A SG    1 
ATOM   1738 H  H     . CYS A 1 116 ? 50.616 2.079   13.135 1.00 15.74 ? 136 CYS A H     1 
ATOM   1739 H  HA    . CYS A 1 116 ? 51.534 4.841   13.755 1.00 15.74 ? 136 CYS A HA    1 
ATOM   1740 H  HB2   . CYS A 1 116 ? 49.442 3.234   15.220 1.00 15.68 ? 136 CYS A HB2   1 
ATOM   1741 H  HB3   . CYS A 1 116 ? 49.895 4.882   15.546 1.00 15.64 ? 136 CYS A HB3   1 
ATOM   1742 N  N     . LEU A 1 117 ? 52.523 4.049   16.010 1.00 16.17 ? 137 LEU A N     1 
ATOM   1743 C  CA    . LEU A 1 117 ? 53.467 3.608   17.069 1.00 15.74 ? 137 LEU A CA    1 
ATOM   1744 C  C     . LEU A 1 117 ? 52.713 3.768   18.379 1.00 14.67 ? 137 LEU A C     1 
ATOM   1745 O  O     . LEU A 1 117 ? 52.180 4.837   18.638 1.00 9.24  ? 137 LEU A O     1 
ATOM   1746 C  CB    . LEU A 1 117 ? 54.702 4.513   17.101 1.00 16.56 ? 137 LEU A CB    1 
ATOM   1747 C  CG    . LEU A 1 117 ? 55.678 4.078   18.226 1.00 14.96 ? 137 LEU A CG    1 
ATOM   1748 C  CD1   . LEU A 1 117 ? 56.375 2.805   17.796 1.00 15.44 ? 137 LEU A CD1   1 
ATOM   1749 C  CD2   . LEU A 1 117 ? 56.756 5.140   18.391 1.00 17.39 ? 137 LEU A CD2   1 
ATOM   1750 H  H     . LEU A 1 117 ? 52.219 4.984   16.004 1.00 18.08 ? 137 LEU A H     1 
ATOM   1751 H  HA    . LEU A 1 117 ? 53.718 2.568   16.912 1.00 17.01 ? 137 LEU A HA    1 
ATOM   1752 H  HB2   . LEU A 1 117 ? 55.181 4.488   16.135 1.00 16.07 ? 137 LEU A HB2   1 
ATOM   1753 H  HB3   . LEU A 1 117 ? 54.364 5.523   17.282 1.00 16.38 ? 137 LEU A HB3   1 
ATOM   1754 H  HG    . LEU A 1 117 ? 55.172 3.920   19.167 1.00 16.03 ? 137 LEU A HG    1 
ATOM   1755 H  HD11  . LEU A 1 117 ? 56.945 2.958   16.892 1.00 14.58 ? 137 LEU A HD11  1 
ATOM   1756 H  HD12  . LEU A 1 117 ? 55.665 2.007   17.637 1.00 15.70 ? 137 LEU A HD12  1 
ATOM   1757 H  HD13  . LEU A 1 117 ? 57.057 2.503   18.577 1.00 15.58 ? 137 LEU A HD13  1 
ATOM   1758 H  HD21  . LEU A 1 117 ? 56.325 6.101   18.636 1.00 17.13 ? 137 LEU A HD21  1 
ATOM   1759 H  HD22  . LEU A 1 117 ? 57.341 5.242   17.487 1.00 16.53 ? 137 LEU A HD22  1 
ATOM   1760 H  HD23  . LEU A 1 117 ? 57.427 4.859   19.190 1.00 16.90 ? 137 LEU A HD23  1 
ATOM   1761 N  N     . ILE A 1 118 ? 52.693 2.729   19.156 1.00 14.96 ? 138 ILE A N     1 
ATOM   1762 C  CA    . ILE A 1 118 ? 52.004 2.720   20.472 1.00 14.88 ? 138 ILE A CA    1 
ATOM   1763 C  C     . ILE A 1 118 ? 53.149 2.428   21.447 1.00 13.73 ? 138 ILE A C     1 
ATOM   1764 O  O     . ILE A 1 118 ? 54.016 1.632   21.112 1.00 13.89 ? 138 ILE A O     1 
ATOM   1765 C  CB    . ILE A 1 118 ? 50.952 1.597   20.440 1.00 15.84 ? 138 ILE A CB    1 
ATOM   1766 C  CG1   . ILE A 1 118 ? 50.035 1.804   19.186 1.00 16.32 ? 138 ILE A CG1   1 
ATOM   1767 C  CG2   . ILE A 1 118 ? 50.131 1.580   21.773 1.00 15.44 ? 138 ILE A CG2   1 
ATOM   1768 C  CD1   . ILE A 1 118 ? 49.155 0.584   18.940 1.00 18.18 ? 138 ILE A CD1   1 
ATOM   1769 H  H     . ILE A 1 118 ? 53.154 1.908   18.873 1.00 15.28 ? 138 ILE A H     1 
ATOM   1770 H  HA    . ILE A 1 118 ? 51.573 3.689   20.670 1.00 15.82 ? 138 ILE A HA    1 
ATOM   1771 H  HB    . ILE A 1 118 ? 51.467 0.647   20.356 1.00 17.20 ? 138 ILE A HB    1 
ATOM   1772 H  HG12  . ILE A 1 118 ? 49.426 2.685   19.306 1.00 17.25 ? 138 ILE A HG12  1 
ATOM   1773 H  HG13  . ILE A 1 118 ? 50.640 1.937   18.299 1.00 17.24 ? 138 ILE A HG13  1 
ATOM   1774 H  HG21  . ILE A 1 118 ? 49.631 2.531   21.911 1.00 16.84 ? 138 ILE A HG21  1 
ATOM   1775 H  HG22  . ILE A 1 118 ? 50.789 1.405   22.613 1.00 16.20 ? 138 ILE A HG22  1 
ATOM   1776 H  HG23  . ILE A 1 118 ? 49.397 0.791   21.744 1.00 16.54 ? 138 ILE A HG23  1 
ATOM   1777 H  HD11  . ILE A 1 118 ? 48.504 0.393   19.781 1.00 17.95 ? 138 ILE A HD11  1 
ATOM   1778 H  HD12  . ILE A 1 118 ? 49.775 -0.285  18.771 1.00 17.65 ? 138 ILE A HD12  1 
ATOM   1779 H  HD13  . ILE A 1 118 ? 48.541 0.745   18.067 1.00 17.56 ? 138 ILE A HD13  1 
ATOM   1780 N  N     . SER A 1 119 ? 53.130 3.054   22.594 1.00 14.30 ? 139 SER A N     1 
ATOM   1781 C  CA    . SER A 1 119 ? 54.208 2.827   23.585 1.00 13.09 ? 139 SER A CA    1 
ATOM   1782 C  C     . SER A 1 119 ? 53.708 2.852   25.021 1.00 13.82 ? 139 SER A C     1 
ATOM   1783 O  O     . SER A 1 119 ? 52.609 3.311   25.303 1.00 14.42 ? 139 SER A O     1 
ATOM   1784 C  CB    . SER A 1 119 ? 55.304 3.907   23.361 1.00 13.66 ? 139 SER A CB    1 
ATOM   1785 O  OG    . SER A 1 119 ? 54.670 5.187   23.203 1.00 10.01 ? 139 SER A OG    1 
ATOM   1786 H  H     . SER A 1 119 ? 52.409 3.677   22.822 1.00 15.63 ? 139 SER A H     1 
ATOM   1787 H  HA    . SER A 1 119 ? 54.633 1.851   23.395 1.00 14.32 ? 139 SER A HA    1 
ATOM   1788 H  HB2   . SER A 1 119 ? 55.983 3.930   24.202 1.00 11.83 ? 139 SER A HB2   1 
ATOM   1789 H  HB3   . SER A 1 119 ? 55.872 3.678   22.468 1.00 12.96 ? 139 SER A HB3   1 
ATOM   1790 H  HG    . SER A 1 119 ? 54.833 5.475   22.291 1.00 9.40  ? 139 SER A HG    1 
ATOM   1791 N  N     . GLY A 1 120 ? 54.520 2.370   25.917 1.00 14.44 ? 140 GLY A N     1 
ATOM   1792 C  CA    . GLY A 1 120 ? 54.087 2.376   27.330 1.00 11.60 ? 140 GLY A CA    1 
ATOM   1793 C  C     . GLY A 1 120 ? 54.844 1.391   28.191 1.00 11.28 ? 140 GLY A C     1 
ATOM   1794 O  O     . GLY A 1 120 ? 55.618 0.581   27.702 1.00 10.70 ? 140 GLY A O     1 
ATOM   1795 H  H     . GLY A 1 120 ? 55.399 2.000   25.667 1.00 14.83 ? 140 GLY A H     1 
ATOM   1796 H  HA2   . GLY A 1 120 ? 54.233 3.372   27.730 1.00 13.10 ? 140 GLY A HA2   1 
ATOM   1797 H  HA3   . GLY A 1 120 ? 53.036 2.145   27.375 1.00 12.48 ? 140 GLY A HA3   1 
ATOM   1798 N  N     . TRP A 1 121 ? 54.583 1.479   29.467 1.00 10.53 ? 141 TRP A N     1 
ATOM   1799 C  CA    . TRP A 1 121 ? 55.237 0.602   30.490 1.00 10.45 ? 141 TRP A CA    1 
ATOM   1800 C  C     . TRP A 1 121 ? 54.261 -0.433  31.032 1.00 10.74 ? 141 TRP A C     1 
ATOM   1801 O  O     . TRP A 1 121 ? 54.387 -0.890  32.151 1.00 13.22 ? 141 TRP A O     1 
ATOM   1802 C  CB    . TRP A 1 121 ? 55.740 1.490   31.656 1.00 11.03 ? 141 TRP A CB    1 
ATOM   1803 C  CG    . TRP A 1 121 ? 56.948 2.367   31.277 1.00 11.54 ? 141 TRP A CG    1 
ATOM   1804 C  CD1   . TRP A 1 121 ? 58.250 1.923   31.278 1.00 13.16 ? 141 TRP A CD1   1 
ATOM   1805 C  CD2   . TRP A 1 121 ? 56.929 3.690   30.918 1.00 14.54 ? 141 TRP A CD2   1 
ATOM   1806 N  NE1   . TRP A 1 121 ? 58.945 2.993   30.928 1.00 13.80 ? 141 TRP A NE1   1 
ATOM   1807 C  CE2   . TRP A 1 121 ? 58.253 4.103   30.689 1.00 14.56 ? 141 TRP A CE2   1 
ATOM   1808 C  CE3   . TRP A 1 121 ? 55.890 4.615   30.772 1.00 14.30 ? 141 TRP A CE3   1 
ATOM   1809 C  CZ2   . TRP A 1 121 ? 58.532 5.409   30.326 1.00 14.26 ? 141 TRP A CZ2   1 
ATOM   1810 C  CZ3   . TRP A 1 121 ? 56.162 5.932   30.408 1.00 14.28 ? 141 TRP A CZ3   1 
ATOM   1811 C  CH2   . TRP A 1 121 ? 57.492 6.330   30.186 1.00 15.07 ? 141 TRP A CH2   1 
ATOM   1812 H  H     . TRP A 1 121 ? 53.935 2.151   29.769 1.00 9.84  ? 141 TRP A H     1 
ATOM   1813 H  HA    . TRP A 1 121 ? 56.077 0.101   30.030 1.00 11.99 ? 141 TRP A HA    1 
ATOM   1814 H  HB2   . TRP A 1 121 ? 54.943 2.127   32.017 1.00 11.07 ? 141 TRP A HB2   1 
ATOM   1815 H  HB3   . TRP A 1 121 ? 56.040 0.865   32.483 1.00 11.15 ? 141 TRP A HB3   1 
ATOM   1816 H  HD1   . TRP A 1 121 ? 58.628 0.936   31.516 1.00 13.65 ? 141 TRP A HD1   1 
ATOM   1817 H  HE1   . TRP A 1 121 ? 59.925 2.981   30.859 1.00 13.06 ? 141 TRP A HE1   1 
ATOM   1818 H  HE3   . TRP A 1 121 ? 54.867 4.303   30.940 1.00 14.13 ? 141 TRP A HE3   1 
ATOM   1819 H  HZ2   . TRP A 1 121 ? 59.553 5.711   30.155 1.00 14.21 ? 141 TRP A HZ2   1 
ATOM   1820 H  HZ3   . TRP A 1 121 ? 55.343 6.631   30.292 1.00 13.58 ? 141 TRP A HZ3   1 
ATOM   1821 H  HH2   . TRP A 1 121 ? 57.718 7.348   29.903 1.00 14.28 ? 141 TRP A HH2   1 
ATOM   1822 N  N     . GLY A 1 122 ? 53.319 -0.815  30.225 1.00 9.30  ? 142 GLY A N     1 
ATOM   1823 C  CA    . GLY A 1 122 ? 52.324 -1.804  30.676 1.00 9.87  ? 142 GLY A CA    1 
ATOM   1824 C  C     . GLY A 1 122 ? 52.854 -3.210  30.552 1.00 13.35 ? 142 GLY A C     1 
ATOM   1825 O  O     . GLY A 1 122 ? 53.944 -3.451  30.074 1.00 12.63 ? 142 GLY A O     1 
ATOM   1826 H  H     . GLY A 1 122 ? 53.295 -0.432  29.327 1.00 10.67 ? 142 GLY A H     1 
ATOM   1827 H  HA2   . GLY A 1 122 ? 52.114 -1.623  31.720 1.00 10.76 ? 142 GLY A HA2   1 
ATOM   1828 H  HA3   . GLY A 1 122 ? 51.413 -1.705  30.107 1.00 9.13  ? 142 GLY A HA3   1 
ATOM   1829 N  N     . ASN A 1 123 ? 52.011 -4.069  31.003 1.00 16.06 ? 143 ASN A N     1 
ATOM   1830 C  CA    . ASN A 1 123 ? 52.270 -5.533  31.012 1.00 17.85 ? 143 ASN A CA    1 
ATOM   1831 C  C     . ASN A 1 123 ? 52.735 -6.057  29.633 1.00 15.32 ? 143 ASN A C     1 
ATOM   1832 O  O     . ASN A 1 123 ? 52.194 -5.632  28.612 1.00 14.32 ? 143 ASN A O     1 
ATOM   1833 C  CB    . ASN A 1 123 ? 50.966 -6.160  31.459 1.00 19.98 ? 143 ASN A CB    1 
ATOM   1834 C  CG    . ASN A 1 123 ? 51.162 -7.627  31.737 1.00 25.12 ? 143 ASN A CG    1 
ATOM   1835 O  OD1   . ASN A 1 123 ? 52.255 -8.147  31.834 1.00 25.21 ? 143 ASN A OD1   1 
ATOM   1836 N  ND2   . ASN A 1 123 ? 50.118 -8.359  31.883 1.00 26.97 ? 143 ASN A ND2   1 
ATOM   1837 H  H     . ASN A 1 123 ? 51.154 -3.745  31.358 1.00 14.87 ? 143 ASN A H     1 
ATOM   1838 H  HA    . ASN A 1 123 ? 53.042 -5.740  31.740 1.00 17.39 ? 143 ASN A HA    1 
ATOM   1839 H  HB2   . ASN A 1 123 ? 50.606 -5.692  32.363 1.00 20.84 ? 143 ASN A HB2   1 
ATOM   1840 H  HB3   . ASN A 1 123 ? 50.224 -6.057  30.681 1.00 20.44 ? 143 ASN A HB3   1 
ATOM   1841 H  HD21  . ASN A 1 123 ? 49.210 -7.997  31.832 1.00 26.71 ? 143 ASN A HD21  1 
ATOM   1842 H  HD22  . ASN A 1 123 ? 50.230 -9.311  32.044 1.00 27.27 ? 143 ASN A HD22  1 
ATOM   1843 N  N     . THR A 1 124 ? 53.708 -6.935  29.638 1.00 17.01 ? 144 THR A N     1 
ATOM   1844 C  CA    . THR A 1 124 ? 54.220 -7.502  28.373 1.00 18.05 ? 144 THR A CA    1 
ATOM   1845 C  C     . THR A 1 124 ? 53.744 -8.969  28.203 1.00 20.92 ? 144 THR A C     1 
ATOM   1846 O  O     . THR A 1 124 ? 54.115 -9.596  27.229 1.00 19.49 ? 144 THR A O     1 
ATOM   1847 C  CB    . THR A 1 124 ? 55.779 -7.350  28.421 1.00 19.35 ? 144 THR A CB    1 
ATOM   1848 O  OG1   . THR A 1 124 ? 56.144 -7.904  29.678 1.00 24.17 ? 144 THR A OG1   1 
ATOM   1849 C  CG2   . THR A 1 124 ? 56.195 -5.870  28.628 1.00 17.21 ? 144 THR A CG2   1 
ATOM   1850 H  H     . THR A 1 124 ? 54.141 -7.241  30.470 1.00 16.93 ? 144 THR A H     1 
ATOM   1851 H  HA    . THR A 1 124 ? 53.807 -6.950  27.550 1.00 17.19 ? 144 THR A HA    1 
ATOM   1852 H  HB    . THR A 1 124 ? 56.294 -7.844  27.606 1.00 19.86 ? 144 THR A HB    1 
ATOM   1853 H  HG1   . THR A 1 124 ? 56.514 -8.783  29.492 1.00 22.99 ? 144 THR A HG1   1 
ATOM   1854 H  HG21  . THR A 1 124 ? 55.779 -5.511  29.554 1.00 17.13 ? 144 THR A HG21  1 
ATOM   1855 H  HG22  . THR A 1 124 ? 55.835 -5.255  27.818 1.00 17.71 ? 144 THR A HG22  1 
ATOM   1856 H  HG23  . THR A 1 124 ? 57.268 -5.793  28.674 1.00 17.75 ? 144 THR A HG23  1 
ATOM   1857 N  N     . LYS A 1 125 ? 52.943 -9.473  29.109 1.00 25.50 ? 145 LYS A N     1 
ATOM   1858 C  CA    . LYS A 1 125 ? 52.418 -10.877 29.018 1.00 29.38 ? 145 LYS A CA    1 
ATOM   1859 C  C     . LYS A 1 125 ? 50.894 -10.809 28.865 1.00 31.63 ? 145 LYS A C     1 
ATOM   1860 O  O     . LYS A 1 125 ? 50.244 -10.030 29.527 1.00 31.65 ? 145 LYS A O     1 
ATOM   1861 C  CB    . LYS A 1 125 ? 52.686 -11.640 30.268 1.00 29.62 ? 145 LYS A CB    1 
ATOM   1862 C  CG    . LYS A 1 125 ? 54.190 -11.845 30.463 1.00 30.19 ? 145 LYS A CG    1 
ATOM   1863 C  CD    . LYS A 1 125 ? 54.392 -12.605 31.818 0.04 29.69 ? 145 LYS A CD    1 
ATOM   1864 C  CE    . LYS A 1 125 ? 53.701 -13.994 31.817 0.04 29.53 ? 145 LYS A CE    1 
ATOM   1865 N  NZ    . LYS A 1 125 ? 54.201 -14.811 30.679 0.04 29.40 ? 145 LYS A NZ    1 
ATOM   1866 H  H     . LYS A 1 125 ? 52.674 -8.916  29.872 1.00 25.51 ? 145 LYS A H     1 
ATOM   1867 H  HA    . LYS A 1 125 ? 52.835 -11.373 28.156 1.00 29.13 ? 145 LYS A HA    1 
ATOM   1868 H  HB2   . LYS A 1 125 ? 52.253 -11.085 31.092 1.00 29.68 ? 145 LYS A HB2   1 
ATOM   1869 H  HB3   . LYS A 1 125 ? 52.167 -12.584 30.183 1.00 29.81 ? 145 LYS A HB3   1 
ATOM   1870 H  HG2   . LYS A 1 125 ? 54.613 -12.407 29.642 1.00 29.64 ? 145 LYS A HG2   1 
ATOM   1871 H  HG3   . LYS A 1 125 ? 54.682 -10.881 30.494 1.00 30.05 ? 145 LYS A HG3   1 
ATOM   1872 H  HD2   . LYS A 1 125 ? 55.449 -12.736 32.007 0.04 29.79 ? 145 LYS A HD2   1 
ATOM   1873 H  HD3   . LYS A 1 125 ? 53.974 -12.022 32.628 0.04 29.79 ? 145 LYS A HD3   1 
ATOM   1874 H  HE2   . LYS A 1 125 ? 53.931 -14.516 32.735 0.04 29.54 ? 145 LYS A HE2   1 
ATOM   1875 H  HE3   . LYS A 1 125 ? 52.627 -13.913 31.739 0.04 29.53 ? 145 LYS A HE3   1 
ATOM   1876 H  HZ1   . LYS A 1 125 ? 54.642 -15.678 31.046 0.04 29.44 ? 145 LYS A HZ1   1 
ATOM   1877 H  HZ2   . LYS A 1 125 ? 54.904 -14.265 30.143 0.04 29.42 ? 145 LYS A HZ2   1 
ATOM   1878 H  HZ3   . LYS A 1 125 ? 53.405 -15.058 30.057 0.04 29.41 ? 145 LYS A HZ3   1 
ATOM   1879 N  N     . SER A 1 126 ? 50.358 -11.631 28.022 1.00 36.93 ? 146 SER A N     1 
ATOM   1880 C  CA    . SER A 1 126 ? 48.877 -11.681 27.758 1.00 42.66 ? 146 SER A CA    1 
ATOM   1881 C  C     . SER A 1 126 ? 48.188 -12.558 28.786 1.00 45.14 ? 146 SER A C     1 
ATOM   1882 O  O     . SER A 1 126 ? 47.032 -12.377 29.109 1.00 47.19 ? 146 SER A O     1 
ATOM   1883 C  CB    . SER A 1 126 ? 48.660 -12.250 26.358 1.00 43.97 ? 146 SER A CB    1 
ATOM   1884 O  OG    . SER A 1 126 ? 49.706 -13.228 26.247 1.00 47.17 ? 146 SER A OG    1 
ATOM   1885 H  H     . SER A 1 126 ? 50.929 -12.249 27.531 1.00 36.23 ? 146 SER A H     1 
ATOM   1886 H  HA    . SER A 1 126 ? 48.470 -10.681 27.836 1.00 42.43 ? 146 SER A HA    1 
ATOM   1887 H  HB2   . SER A 1 126 ? 47.687 -12.722 26.276 1.00 43.94 ? 146 SER A HB2   1 
ATOM   1888 H  HB3   . SER A 1 126 ? 48.758 -11.489 25.600 1.00 44.15 ? 146 SER A HB3   1 
ATOM   1889 H  HG    . SER A 1 126 ? 49.259 -14.091 26.303 1.00 46.59 ? 146 SER A HG    1 
ATOM   1890 N  N     . SER A 1 127 ? 48.942 -13.499 29.243 1.00 47.35 ? 147 SER A N     1 
ATOM   1891 C  CA    . SER A 1 127 ? 48.457 -14.454 30.259 1.00 51.86 ? 147 SER A CA    1 
ATOM   1892 C  C     . SER A 1 127 ? 49.428 -14.263 31.445 1.00 54.10 ? 147 SER A C     1 
ATOM   1893 O  O     . SER A 1 127 ? 50.407 -14.980 31.547 1.00 57.06 ? 147 SER A O     1 
ATOM   1894 C  CB    . SER A 1 127 ? 48.539 -15.871 29.654 1.00 51.08 ? 147 SER A CB    1 
ATOM   1895 O  OG    . SER A 1 127 ? 47.993 -15.701 28.338 0.31 51.86 ? 147 SER A OG    1 
ATOM   1896 H  H     . SER A 1 127 ? 49.854 -13.591 28.912 1.00 46.86 ? 147 SER A H     1 
ATOM   1897 H  HA    . SER A 1 127 ? 47.449 -14.201 30.565 1.00 52.05 ? 147 SER A HA    1 
ATOM   1898 H  HB2   . SER A 1 127 ? 49.563 -16.217 29.602 1.00 51.73 ? 147 SER A HB2   1 
ATOM   1899 H  HB3   . SER A 1 127 ? 47.948 -16.566 30.233 1.00 51.65 ? 147 SER A HB3   1 
ATOM   1900 H  HG    . SER A 1 127 ? 47.137 -16.143 28.342 0.31 52.08 ? 147 SER A HG    1 
ATOM   1901 N  N     . GLY A 1 128 ? 49.192 -13.312 32.309 1.00 55.36 ? 148 GLY A N     1 
ATOM   1902 C  CA    . GLY A 1 128 ? 50.120 -13.103 33.482 1.00 55.83 ? 148 GLY A CA    1 
ATOM   1903 C  C     . GLY A 1 128 ? 50.555 -11.654 33.509 1.00 54.82 ? 148 GLY A C     1 
ATOM   1904 O  O     . GLY A 1 128 ? 50.164 -10.952 32.608 1.00 56.18 ? 148 GLY A O     1 
ATOM   1905 H  H     . GLY A 1 128 ? 48.420 -12.714 32.196 1.00 56.93 ? 148 GLY A H     1 
ATOM   1906 H  HA2   . GLY A 1 128 ? 49.600 -13.342 34.397 1.00 55.06 ? 148 GLY A HA2   1 
ATOM   1907 H  HA3   . GLY A 1 128 ? 50.996 -13.725 33.378 1.00 55.66 ? 148 GLY A HA3   1 
ATOM   1908 N  N     . THR A 1 129 ? 51.317 -11.238 34.484 1.00 53.41 ? 149 THR A N     1 
ATOM   1909 C  CA    . THR A 1 129 ? 51.783 -9.825  34.587 1.00 52.63 ? 149 THR A CA    1 
ATOM   1910 C  C     . THR A 1 129 ? 53.310 -9.707  34.650 1.00 48.37 ? 149 THR A C     1 
ATOM   1911 O  O     . THR A 1 129 ? 53.901 -10.278 35.543 1.00 46.36 ? 149 THR A O     1 
ATOM   1912 C  CB    . THR A 1 129 ? 51.134 -9.245  35.853 1.00 54.92 ? 149 THR A CB    1 
ATOM   1913 O  OG1   . THR A 1 129 ? 51.317 -10.299 36.790 1.00 58.08 ? 149 THR A OG1   1 
ATOM   1914 C  CG2   . THR A 1 129 ? 49.594 -9.186  35.746 1.00 56.64 ? 149 THR A CG2   1 
ATOM   1915 H  H     . THR A 1 129 ? 51.617 -11.828 35.205 1.00 54.11 ? 149 THR A H     1 
ATOM   1916 H  HA    . THR A 1 129 ? 51.427 -9.270  33.735 1.00 52.72 ? 149 THR A HA    1 
ATOM   1917 H  HB    . THR A 1 129 ? 51.590 -8.331  36.216 1.00 55.34 ? 149 THR A HB    1 
ATOM   1918 H  HG1   . THR A 1 129 ? 52.046 -10.040 37.372 1.00 57.23 ? 149 THR A HG1   1 
ATOM   1919 H  HG21  . THR A 1 129 ? 49.166 -10.160 35.559 1.00 56.54 ? 149 THR A HG21  1 
ATOM   1920 H  HG22  . THR A 1 129 ? 49.298 -8.522  34.947 1.00 56.90 ? 149 THR A HG22  1 
ATOM   1921 H  HG23  . THR A 1 129 ? 49.189 -8.797  36.672 1.00 56.79 ? 149 THR A HG23  1 
ATOM   1922 N  N     . SER A 1 130 ? 53.923 -9.008  33.745 1.00 42.93 ? 150 SER A N     1 
ATOM   1923 C  CA    . SER A 1 130 ? 55.389 -8.829  33.736 1.00 39.53 ? 150 SER A CA    1 
ATOM   1924 C  C     . SER A 1 130 ? 55.429 -7.349  33.363 1.00 32.73 ? 150 SER A C     1 
ATOM   1925 O  O     . SER A 1 130 ? 55.066 -7.011  32.253 1.00 30.08 ? 150 SER A O     1 
ATOM   1926 C  CB    . SER A 1 130 ? 56.007 -9.688  32.649 1.00 40.40 ? 150 SER A CB    1 
ATOM   1927 O  OG    . SER A 1 130 ? 57.393 -9.812  32.962 1.00 42.97 ? 150 SER A OG    1 
ATOM   1928 H  H     . SER A 1 130 ? 53.436 -8.566  33.029 1.00 44.19 ? 150 SER A H     1 
ATOM   1929 H  HA    . SER A 1 130 ? 55.781 -8.991  34.731 1.00 39.17 ? 150 SER A HA    1 
ATOM   1930 H  HB2   . SER A 1 130 ? 55.554 -10.658 32.646 1.00 41.47 ? 150 SER A HB2   1 
ATOM   1931 H  HB3   . SER A 1 130 ? 55.890 -9.218  31.681 1.00 41.35 ? 150 SER A HB3   1 
ATOM   1932 H  HG    . SER A 1 130 ? 57.594 -9.267  33.727 1.00 42.68 ? 150 SER A HG    1 
ATOM   1933 N  N     . TYR A 1 131 ? 55.841 -6.512  34.263 1.00 27.02 ? 151 TYR A N     1 
ATOM   1934 C  CA    . TYR A 1 131 ? 55.887 -5.067  33.933 1.00 26.29 ? 151 TYR A CA    1 
ATOM   1935 C  C     . TYR A 1 131 ? 57.333 -4.691  33.685 1.00 24.49 ? 151 TYR A C     1 
ATOM   1936 O  O     . TYR A 1 131 ? 58.190 -5.037  34.473 1.00 24.43 ? 151 TYR A O     1 
ATOM   1937 C  CB    . TYR A 1 131 ? 55.361 -4.242  35.086 1.00 26.83 ? 151 TYR A CB    1 
ATOM   1938 C  CG    . TYR A 1 131 ? 53.846 -4.381  35.219 1.00 29.82 ? 151 TYR A CG    1 
ATOM   1939 C  CD1   . TYR A 1 131 ? 53.293 -5.187  36.193 1.00 30.62 ? 151 TYR A CD1   1 
ATOM   1940 C  CD2   . TYR A 1 131 ? 53.006 -3.700  34.353 1.00 29.78 ? 151 TYR A CD2   1 
ATOM   1941 C  CE1   . TYR A 1 131 ? 51.925 -5.305  36.291 1.00 31.50 ? 151 TYR A CE1   1 
ATOM   1942 C  CE2   . TYR A 1 131 ? 51.636 -3.826  34.459 1.00 30.24 ? 151 TYR A CE2   1 
ATOM   1943 C  CZ    . TYR A 1 131 ? 51.092 -4.631  35.429 1.00 31.91 ? 151 TYR A CZ    1 
ATOM   1944 O  OH    . TYR A 1 131 ? 49.726 -4.773  35.529 1.00 34.22 ? 151 TYR A OH    1 
ATOM   1945 H  H     . TYR A 1 131 ? 56.125 -6.823  35.150 1.00 26.98 ? 151 TYR A H     1 
ATOM   1946 H  HA    . TYR A 1 131 ? 55.291 -4.886  33.053 1.00 27.06 ? 151 TYR A HA    1 
ATOM   1947 H  HB2   . TYR A 1 131 ? 55.844 -4.535  36.007 1.00 27.39 ? 151 TYR A HB2   1 
ATOM   1948 H  HB3   . TYR A 1 131 ? 55.594 -3.210  34.910 1.00 27.85 ? 151 TYR A HB3   1 
ATOM   1949 H  HD1   . TYR A 1 131 ? 53.927 -5.730  36.881 1.00 30.25 ? 151 TYR A HD1   1 
ATOM   1950 H  HD2   . TYR A 1 131 ? 53.421 -3.060  33.590 1.00 29.96 ? 151 TYR A HD2   1 
ATOM   1951 H  HE1   . TYR A 1 131 ? 51.499 -5.937  37.059 1.00 31.94 ? 151 TYR A HE1   1 
ATOM   1952 H  HE2   . TYR A 1 131 ? 50.988 -3.291  33.780 1.00 30.23 ? 151 TYR A HE2   1 
ATOM   1953 H  HH    . TYR A 1 131 ? 49.417 -4.085  36.135 1.00 33.51 ? 151 TYR A HH    1 
ATOM   1954 N  N     . PRO A 1 132 ? 57.608 -3.997  32.610 1.00 20.88 ? 152 PRO A N     1 
ATOM   1955 C  CA    . PRO A 1 132 ? 58.988 -3.620  32.270 1.00 20.60 ? 152 PRO A CA    1 
ATOM   1956 C  C     . PRO A 1 132 ? 59.490 -2.386  33.039 1.00 20.16 ? 152 PRO A C     1 
ATOM   1957 O  O     . PRO A 1 132 ? 58.729 -1.657  33.647 1.00 18.46 ? 152 PRO A O     1 
ATOM   1958 C  CB    . PRO A 1 132 ? 58.932 -3.396  30.767 1.00 19.36 ? 152 PRO A CB    1 
ATOM   1959 C  CG    . PRO A 1 132 ? 57.536 -2.753  30.593 1.00 19.18 ? 152 PRO A CG    1 
ATOM   1960 C  CD    . PRO A 1 132 ? 56.642 -3.519  31.595 1.00 19.21 ? 152 PRO A CD    1 
ATOM   1961 H  HA    . PRO A 1 132 ? 59.625 -4.461  32.510 1.00 20.43 ? 152 PRO A HA    1 
ATOM   1962 H  HB2   . PRO A 1 132 ? 59.714 -2.727  30.428 1.00 19.42 ? 152 PRO A HB2   1 
ATOM   1963 H  HB3   . PRO A 1 132 ? 58.996 -4.332  30.234 1.00 19.96 ? 152 PRO A HB3   1 
ATOM   1964 H  HG2   . PRO A 1 132 ? 57.569 -1.700  30.831 1.00 19.61 ? 152 PRO A HG2   1 
ATOM   1965 H  HG3   . PRO A 1 132 ? 57.189 -2.888  29.580 1.00 18.92 ? 152 PRO A HG3   1 
ATOM   1966 H  HD2   . PRO A 1 132 ? 55.921 -2.868  32.067 1.00 20.27 ? 152 PRO A HD2   1 
ATOM   1967 H  HD3   . PRO A 1 132 ? 56.139 -4.364  31.148 1.00 20.24 ? 152 PRO A HD3   1 
ATOM   1968 N  N     . ASP A 1 133 ? 60.774 -2.200  32.951 1.00 20.29 ? 153 ASP A N     1 
ATOM   1969 C  CA    . ASP A 1 133 ? 61.399 -1.058  33.618 1.00 20.29 ? 153 ASP A CA    1 
ATOM   1970 C  C     . ASP A 1 133 ? 61.488 0.028   32.576 1.00 18.37 ? 153 ASP A C     1 
ATOM   1971 O  O     . ASP A 1 133 ? 61.246 1.157   32.945 1.00 17.49 ? 153 ASP A O     1 
ATOM   1972 C  CB    . ASP A 1 133 ? 62.849 -1.337  34.091 1.00 24.68 ? 153 ASP A CB    1 
ATOM   1973 C  CG    . ASP A 1 133 ? 62.949 -2.155  35.394 1.00 25.95 ? 153 ASP A CG    1 
ATOM   1974 O  OD1   . ASP A 1 133 ? 62.013 -2.109  36.173 1.00 30.88 ? 153 ASP A OD1   1 
ATOM   1975 O  OD2   . ASP A 1 133 ? 63.985 -2.776  35.542 1.00 31.05 ? 153 ASP A OD2   1 
ATOM   1976 H  H     . ASP A 1 133 ? 61.324 -2.828  32.431 1.00 20.23 ? 153 ASP A H     1 
ATOM   1977 H  HA    . ASP A 1 133 ? 60.767 -0.715  34.425 1.00 22.01 ? 153 ASP A HA    1 
ATOM   1978 H  HB2   . ASP A 1 133 ? 63.392 -1.851  33.310 1.00 23.50 ? 153 ASP A HB2   1 
ATOM   1979 H  HB3   . ASP A 1 133 ? 63.341 -0.389  34.260 1.00 24.24 ? 153 ASP A HB3   1 
ATOM   1980 N  N     . VAL A 1 134 ? 61.822 -0.326  31.351 1.00 13.40 ? 154 VAL A N     1 
ATOM   1981 C  CA    . VAL A 1 134 ? 61.949 0.672   30.272 1.00 13.63 ? 154 VAL A CA    1 
ATOM   1982 C  C     . VAL A 1 134 ? 60.724 0.627   29.350 1.00 14.11 ? 154 VAL A C     1 
ATOM   1983 O  O     . VAL A 1 134 ? 59.931 -0.295  29.398 1.00 13.85 ? 154 VAL A O     1 
ATOM   1984 C  CB    . VAL A 1 134 ? 63.271 0.395   29.506 1.00 15.64 ? 154 VAL A CB    1 
ATOM   1985 C  CG1   . VAL A 1 134 ? 64.409 0.429   30.565 1.00 16.10 ? 154 VAL A CG1   1 
ATOM   1986 C  CG2   . VAL A 1 134 ? 63.272 -0.952  28.724 1.00 15.40 ? 154 VAL A CG2   1 
ATOM   1987 H  H     . VAL A 1 134 ? 61.982 -1.267  31.130 1.00 16.00 ? 154 VAL A H     1 
ATOM   1988 H  HA    . VAL A 1 134 ? 61.985 1.648   30.729 1.00 12.73 ? 154 VAL A HA    1 
ATOM   1989 H  HB    . VAL A 1 134 ? 63.431 1.194   28.794 1.00 15.81 ? 154 VAL A HB    1 
ATOM   1990 H  HG11  . VAL A 1 134 ? 64.265 -0.323  31.327 1.00 15.94 ? 154 VAL A HG11  1 
ATOM   1991 H  HG12  . VAL A 1 134 ? 64.444 1.395   31.046 1.00 16.55 ? 154 VAL A HG12  1 
ATOM   1992 H  HG13  . VAL A 1 134 ? 65.362 0.260   30.085 1.00 16.78 ? 154 VAL A HG13  1 
ATOM   1993 H  HG21  . VAL A 1 134 ? 62.473 -0.971  27.996 1.00 15.00 ? 154 VAL A HG21  1 
ATOM   1994 H  HG22  . VAL A 1 134 ? 63.131 -1.785  29.395 1.00 15.22 ? 154 VAL A HG22  1 
ATOM   1995 H  HG23  . VAL A 1 134 ? 64.210 -1.080  28.203 1.00 14.63 ? 154 VAL A HG23  1 
ATOM   1996 N  N     . LEU A 1 135 ? 60.669 1.652   28.549 1.00 11.17 ? 155 LEU A N     1 
ATOM   1997 C  CA    . LEU A 1 135 ? 59.569 1.850   27.592 1.00 10.92 ? 155 LEU A CA    1 
ATOM   1998 C  C     . LEU A 1 135 ? 59.576 0.882   26.425 1.00 12.65 ? 155 LEU A C     1 
ATOM   1999 O  O     . LEU A 1 135 ? 60.632 0.682   25.835 1.00 16.17 ? 155 LEU A O     1 
ATOM   2000 C  CB    . LEU A 1 135 ? 59.685 3.345   27.151 1.00 7.85  ? 155 LEU A CB    1 
ATOM   2001 C  CG    . LEU A 1 135 ? 58.449 3.790   26.357 1.00 7.06  ? 155 LEU A CG    1 
ATOM   2002 C  CD1   . LEU A 1 135 ? 57.194 3.939   27.248 1.00 6.50  ? 155 LEU A CD1   1 
ATOM   2003 C  CD2   . LEU A 1 135 ? 58.793 5.172   25.765 1.00 9.36  ? 155 LEU A CD2   1 
ATOM   2004 H  H     . LEU A 1 135 ? 61.385 2.314   28.576 1.00 12.81 ? 155 LEU A H     1 
ATOM   2005 H  HA    . LEU A 1 135 ? 58.649 1.725   28.145 1.00 10.88 ? 155 LEU A HA    1 
ATOM   2006 H  HB2   . LEU A 1 135 ? 59.792 3.973   28.024 1.00 8.01  ? 155 LEU A HB2   1 
ATOM   2007 H  HB3   . LEU A 1 135 ? 60.565 3.474   26.539 1.00 7.70  ? 155 LEU A HB3   1 
ATOM   2008 H  HG    . LEU A 1 135 ? 58.246 3.097   25.551 1.00 8.70  ? 155 LEU A HG    1 
ATOM   2009 H  HD11  . LEU A 1 135 ? 57.344 4.662   28.039 1.00 6.69  ? 155 LEU A HD11  1 
ATOM   2010 H  HD12  . LEU A 1 135 ? 56.932 3.001   27.716 1.00 7.70  ? 155 LEU A HD12  1 
ATOM   2011 H  HD13  . LEU A 1 135 ? 56.351 4.263   26.658 1.00 6.87  ? 155 LEU A HD13  1 
ATOM   2012 H  HD21  . LEU A 1 135 ? 59.639 5.081   25.095 1.00 8.64  ? 155 LEU A HD21  1 
ATOM   2013 H  HD22  . LEU A 1 135 ? 59.039 5.883   26.545 1.00 8.87  ? 155 LEU A HD22  1 
ATOM   2014 H  HD23  . LEU A 1 135 ? 57.957 5.554   25.195 1.00 8.50  ? 155 LEU A HD23  1 
ATOM   2015 N  N     . LYS A 1 136 ? 58.395 0.354   26.154 1.00 13.31 ? 156 LYS A N     1 
ATOM   2016 C  CA    . LYS A 1 136 ? 58.191 -0.612  25.046 1.00 11.65 ? 156 LYS A CA    1 
ATOM   2017 C  C     . LYS A 1 136 ? 57.350 0.103   23.979 1.00 13.45 ? 156 LYS A C     1 
ATOM   2018 O  O     . LYS A 1 136 ? 56.533 0.972   24.293 1.00 13.90 ? 156 LYS A O     1 
ATOM   2019 C  CB    . LYS A 1 136 ? 57.446 -1.831  25.551 1.00 10.79 ? 156 LYS A CB    1 
ATOM   2020 C  CG    . LYS A 1 136 ? 58.251 -2.545  26.641 1.00 11.67 ? 156 LYS A CG    1 
ATOM   2021 C  CD    . LYS A 1 136 ? 59.507 -3.171  26.051 1.00 13.04 ? 156 LYS A CD    1 
ATOM   2022 C  CE    . LYS A 1 136 ? 60.239 -3.871  27.191 0.56 14.11 ? 156 LYS A CE    1 
ATOM   2023 N  NZ    . LYS A 1 136 ? 61.409 -4.590  26.646 0.56 17.79 ? 156 LYS A NZ    1 
ATOM   2024 H  H     . LYS A 1 136 ? 57.612 0.604   26.689 1.00 13.38 ? 156 LYS A H     1 
ATOM   2025 H  HA    . LYS A 1 136 ? 59.150 -0.864  24.620 1.00 12.88 ? 156 LYS A HA    1 
ATOM   2026 H  HB2   . LYS A 1 136 ? 56.487 -1.515  25.929 1.00 11.63 ? 156 LYS A HB2   1 
ATOM   2027 H  HB3   . LYS A 1 136 ? 57.272 -2.500  24.717 1.00 11.39 ? 156 LYS A HB3   1 
ATOM   2028 H  HG2   . LYS A 1 136 ? 58.524 -1.841  27.413 1.00 12.20 ? 156 LYS A HG2   1 
ATOM   2029 H  HG3   . LYS A 1 136 ? 57.629 -3.311  27.078 1.00 11.97 ? 156 LYS A HG3   1 
ATOM   2030 H  HD2   . LYS A 1 136 ? 59.252 -3.882  25.277 1.00 12.67 ? 156 LYS A HD2   1 
ATOM   2031 H  HD3   . LYS A 1 136 ? 60.151 -2.415  25.634 1.00 12.81 ? 156 LYS A HD3   1 
ATOM   2032 H  HE2   . LYS A 1 136 ? 60.593 -3.156  27.918 0.56 14.94 ? 156 LYS A HE2   1 
ATOM   2033 H  HE3   . LYS A 1 136 ? 59.601 -4.589  27.682 0.56 14.79 ? 156 LYS A HE3   1 
ATOM   2034 H  HZ1   . LYS A 1 136 ? 61.448 -4.458  25.614 0.56 17.16 ? 156 LYS A HZ1   1 
ATOM   2035 H  HZ2   . LYS A 1 136 ? 61.318 -5.604  26.861 0.56 17.39 ? 156 LYS A HZ2   1 
ATOM   2036 H  HZ3   . LYS A 1 136 ? 62.278 -4.217  27.078 0.56 17.12 ? 156 LYS A HZ3   1 
ATOM   2037 N  N     . CYS A 1 137 ? 57.622 -0.349  22.782 1.00 13.96 ? 157 CYS A N     1 
ATOM   2038 C  CA    . CYS A 1 137 ? 57.005 0.142   21.535 1.00 13.87 ? 157 CYS A CA    1 
ATOM   2039 C  C     . CYS A 1 137 ? 56.413 -0.960  20.701 1.00 13.53 ? 157 CYS A C     1 
ATOM   2040 O  O     . CYS A 1 137 ? 56.880 -2.075  20.797 1.00 12.90 ? 157 CYS A O     1 
ATOM   2041 C  CB    . CYS A 1 137 ? 58.119 0.891   20.723 1.00 12.11 ? 157 CYS A CB    1 
ATOM   2042 S  SG    . CYS A 1 137 ? 58.553 2.582   21.232 1.00 11.94 ? 157 CYS A SG    1 
ATOM   2043 H  H     . CYS A 1 137 ? 58.273 -1.071  22.683 1.00 14.31 ? 157 CYS A H     1 
ATOM   2044 H  HA    . CYS A 1 137 ? 56.220 0.836   21.800 1.00 13.14 ? 157 CYS A HA    1 
ATOM   2045 H  HB2   . CYS A 1 137 ? 59.016 0.290   20.770 1.00 11.81 ? 157 CYS A HB2   1 
ATOM   2046 H  HB3   . CYS A 1 137 ? 57.837 0.930   19.685 1.00 12.62 ? 157 CYS A HB3   1 
ATOM   2047 N  N     . LEU A 1 138 ? 55.418 -0.617  19.933 1.00 12.51 ? 158 LEU A N     1 
ATOM   2048 C  CA    . LEU A 1 138 ? 54.760 -1.584  19.053 1.00 13.70 ? 158 LEU A CA    1 
ATOM   2049 C  C     . LEU A 1 138 ? 54.296 -0.792  17.827 1.00 14.61 ? 158 LEU A C     1 
ATOM   2050 O  O     . LEU A 1 138 ? 53.752 0.288   17.980 1.00 15.84 ? 158 LEU A O     1 
ATOM   2051 C  CB    . LEU A 1 138 ? 53.564 -2.206  19.809 1.00 14.21 ? 158 LEU A CB    1 
ATOM   2052 C  CG    . LEU A 1 138 ? 52.659 -3.100  18.886 1.00 15.17 ? 158 LEU A CG    1 
ATOM   2053 C  CD1   . LEU A 1 138 ? 53.389 -4.385  18.378 1.00 16.25 ? 158 LEU A CD1   1 
ATOM   2054 C  CD2   . LEU A 1 138 ? 51.409 -3.531  19.709 1.00 15.68 ? 158 LEU A CD2   1 
ATOM   2055 H  H     . LEU A 1 138 ? 55.083 0.307   19.934 1.00 13.93 ? 158 LEU A H     1 
ATOM   2056 H  HA    . LEU A 1 138 ? 55.485 -2.328  18.754 1.00 13.78 ? 158 LEU A HA    1 
ATOM   2057 H  HB2   . LEU A 1 138 ? 53.946 -2.785  20.633 1.00 13.89 ? 158 LEU A HB2   1 
ATOM   2058 H  HB3   . LEU A 1 138 ? 52.971 -1.393  20.203 1.00 14.31 ? 158 LEU A HB3   1 
ATOM   2059 H  HG    . LEU A 1 138 ? 52.330 -2.516  18.034 1.00 15.33 ? 158 LEU A HG    1 
ATOM   2060 H  HD11  . LEU A 1 138 ? 53.669 -5.027  19.204 1.00 15.83 ? 158 LEU A HD11  1 
ATOM   2061 H  HD12  . LEU A 1 138 ? 54.281 -4.130  17.824 1.00 15.96 ? 158 LEU A HD12  1 
ATOM   2062 H  HD13  . LEU A 1 138 ? 52.743 -4.931  17.707 1.00 15.58 ? 158 LEU A HD13  1 
ATOM   2063 H  HD21  . LEU A 1 138 ? 50.861 -2.660  20.046 1.00 15.59 ? 158 LEU A HD21  1 
ATOM   2064 H  HD22  . LEU A 1 138 ? 51.711 -4.099  20.580 1.00 15.84 ? 158 LEU A HD22  1 
ATOM   2065 H  HD23  . LEU A 1 138 ? 50.740 -4.133  19.110 1.00 15.53 ? 158 LEU A HD23  1 
ATOM   2066 N  N     . LYS A 1 139 ? 54.514 -1.302  16.657 1.00 16.97 ? 159 LYS A N     1 
ATOM   2067 C  CA    . LYS A 1 139 ? 54.060 -0.590  15.440 1.00 16.10 ? 159 LYS A CA    1 
ATOM   2068 C  C     . LYS A 1 139 ? 52.770 -1.375  15.172 1.00 15.47 ? 159 LYS A C     1 
ATOM   2069 O  O     . LYS A 1 139 ? 52.799 -2.593  15.177 1.00 12.33 ? 159 LYS A O     1 
ATOM   2070 C  CB    A LYS A 1 139 ? 55.117 -0.765  14.353 0.46 17.67 ? 159 LYS A CB    1 
ATOM   2071 C  CB    B LYS A 1 139 ? 55.058 -0.784  14.271 0.43 18.02 ? 159 LYS A CB    1 
ATOM   2072 C  CG    A LYS A 1 139 ? 56.277 0.208   14.719 0.46 20.13 ? 159 LYS A CG    1 
ATOM   2073 C  CG    B LYS A 1 139 ? 56.136 0.337   14.246 0.43 20.81 ? 159 LYS A CG    1 
ATOM   2074 C  CD    A LYS A 1 139 ? 57.519 -0.136  13.896 0.46 21.19 ? 159 LYS A CD    1 
ATOM   2075 C  CD    B LYS A 1 139 ? 55.479 1.658   13.720 0.43 21.93 ? 159 LYS A CD    1 
ATOM   2076 C  CE    A LYS A 1 139 ? 58.594 0.964   14.037 0.46 23.53 ? 159 LYS A CE    1 
ATOM   2077 C  CE    B LYS A 1 139 ? 56.535 2.759   13.535 0.43 24.71 ? 159 LYS A CE    1 
ATOM   2078 N  NZ    A LYS A 1 139 ? 59.899 0.384   13.616 0.46 25.69 ? 159 LYS A NZ    1 
ATOM   2079 N  NZ    B LYS A 1 139 ? 55.860 3.975   12.980 0.43 25.77 ? 159 LYS A NZ    1 
ATOM   2080 H  H     . LYS A 1 139 ? 54.975 -2.163  16.577 1.00 17.60 ? 159 LYS A H     1 
ATOM   2081 H  HA    . LYS A 1 139 ? 53.848 0.447   15.653 1.00 18.07 ? 159 LYS A HA    1 
ATOM   2082 H  HB2   A LYS A 1 139 ? 55.449 -1.794  14.329 0.46 17.80 ? 159 LYS A HB2   1 
ATOM   2083 H  HB2   B LYS A 1 139 ? 55.542 -1.745  14.381 0.43 18.52 ? 159 LYS A HB2   1 
ATOM   2084 H  HB3   A LYS A 1 139 ? 54.685 -0.513  13.395 0.46 17.22 ? 159 LYS A HB3   1 
ATOM   2085 H  HB3   B LYS A 1 139 ? 54.514 -0.800  13.338 0.43 18.07 ? 159 LYS A HB3   1 
ATOM   2086 H  HG2   A LYS A 1 139 ? 55.968 1.223   14.503 0.46 19.88 ? 159 LYS A HG2   1 
ATOM   2087 H  HG2   B LYS A 1 139 ? 56.528 0.487   15.242 0.43 20.30 ? 159 LYS A HG2   1 
ATOM   2088 H  HG3   A LYS A 1 139 ? 56.497 0.137   15.775 0.46 19.69 ? 159 LYS A HG3   1 
ATOM   2089 H  HG3   B LYS A 1 139 ? 56.952 0.030   13.604 0.43 20.33 ? 159 LYS A HG3   1 
ATOM   2090 H  HD2   A LYS A 1 139 ? 57.933 -1.074  14.232 0.46 21.60 ? 159 LYS A HD2   1 
ATOM   2091 H  HD2   B LYS A 1 139 ? 54.993 1.491   12.770 0.43 22.08 ? 159 LYS A HD2   1 
ATOM   2092 H  HD3   A LYS A 1 139 ? 57.264 -0.245  12.852 0.46 21.83 ? 159 LYS A HD3   1 
ATOM   2093 H  HD3   B LYS A 1 139 ? 54.736 2.021   14.417 0.43 22.14 ? 159 LYS A HD3   1 
ATOM   2094 H  HE2   A LYS A 1 139 ? 58.371 1.793   13.381 0.46 23.42 ? 159 LYS A HE2   1 
ATOM   2095 H  HE2   B LYS A 1 139 ? 57.006 3.021   14.474 0.43 24.39 ? 159 LYS A HE2   1 
ATOM   2096 H  HE3   A LYS A 1 139 ? 58.694 1.351   15.037 0.46 23.66 ? 159 LYS A HE3   1 
ATOM   2097 H  HE3   B LYS A 1 139 ? 57.303 2.446   12.843 0.43 24.40 ? 159 LYS A HE3   1 
ATOM   2098 H  HZ1   A LYS A 1 139 ? 60.275 0.919   12.808 0.46 25.39 ? 159 LYS A HZ1   1 
ATOM   2099 H  HZ1   B LYS A 1 139 ? 55.980 4.767   13.644 0.43 25.45 ? 159 LYS A HZ1   1 
ATOM   2100 H  HZ2   A LYS A 1 139 ? 59.762 -0.611  13.340 0.46 25.28 ? 159 LYS A HZ2   1 
ATOM   2101 H  HZ2   B LYS A 1 139 ? 54.846 3.785   12.849 0.43 25.19 ? 159 LYS A HZ2   1 
ATOM   2102 H  HZ3   A LYS A 1 139 ? 60.568 0.431   14.411 0.46 25.44 ? 159 LYS A HZ3   1 
ATOM   2103 H  HZ3   B LYS A 1 139 ? 56.286 4.223   12.065 0.43 25.37 ? 159 LYS A HZ3   1 
ATOM   2104 N  N     . ALA A 1 140 ? 51.658 -0.728  14.963 1.00 18.03 ? 160 ALA A N     1 
ATOM   2105 C  CA    . ALA A 1 140 ? 50.376 -1.475  14.704 1.00 18.15 ? 160 ALA A CA    1 
ATOM   2106 C  C     . ALA A 1 140 ? 49.536 -0.670  13.732 1.00 18.81 ? 160 ALA A C     1 
ATOM   2107 O  O     . ALA A 1 140 ? 49.599 0.543   13.793 1.00 20.88 ? 160 ALA A O     1 
ATOM   2108 C  CB    . ALA A 1 140 ? 49.595 -1.647  16.007 1.00 17.86 ? 160 ALA A CB    1 
ATOM   2109 H  H     . ALA A 1 140 ? 51.648 0.258   14.968 1.00 17.94 ? 160 ALA A H     1 
ATOM   2110 H  HA    . ALA A 1 140 ? 50.608 -2.436  14.275 1.00 19.08 ? 160 ALA A HA    1 
ATOM   2111 H  HB1   . ALA A 1 140 ? 49.356 -0.672  16.406 1.00 18.50 ? 160 ALA A HB1   1 
ATOM   2112 H  HB2   . ALA A 1 140 ? 50.168 -2.196  16.736 1.00 18.39 ? 160 ALA A HB2   1 
ATOM   2113 H  HB3   . ALA A 1 140 ? 48.670 -2.169  15.816 1.00 18.62 ? 160 ALA A HB3   1 
ATOM   2114 N  N     . PRO A 1 141 ? 48.776 -1.296  12.865 1.00 16.32 ? 161 PRO A N     1 
ATOM   2115 C  CA    . PRO A 1 141 ? 47.862 -0.555  11.973 1.00 16.33 ? 161 PRO A CA    1 
ATOM   2116 C  C     . PRO A 1 141 ? 46.444 -0.338  12.515 1.00 15.53 ? 161 PRO A C     1 
ATOM   2117 O  O     . PRO A 1 141 ? 45.975 -1.065  13.376 1.00 15.17 ? 161 PRO A O     1 
ATOM   2118 C  CB    . PRO A 1 141 ? 47.863 -1.389  10.713 1.00 16.61 ? 161 PRO A CB    1 
ATOM   2119 C  CG    . PRO A 1 141 ? 47.846 -2.855  11.297 1.00 16.08 ? 161 PRO A CG    1 
ATOM   2120 C  CD    . PRO A 1 141 ? 48.728 -2.766  12.595 1.00 14.86 ? 161 PRO A CD    1 
ATOM   2121 H  HA    . PRO A 1 141 ? 48.301 0.412   11.779 1.00 16.65 ? 161 PRO A HA    1 
ATOM   2122 H  HB2   . PRO A 1 141 ? 46.977 -1.191  10.126 1.00 16.18 ? 161 PRO A HB2   1 
ATOM   2123 H  HB3   . PRO A 1 141 ? 48.742 -1.190  10.115 1.00 17.32 ? 161 PRO A HB3   1 
ATOM   2124 H  HG2   . PRO A 1 141 ? 46.839 -3.162  11.541 1.00 15.83 ? 161 PRO A HG2   1 
ATOM   2125 H  HG3   . PRO A 1 141 ? 48.270 -3.550  10.588 1.00 15.88 ? 161 PRO A HG3   1 
ATOM   2126 H  HD2   . PRO A 1 141 ? 48.270 -3.279  13.429 1.00 15.97 ? 161 PRO A HD2   1 
ATOM   2127 H  HD3   . PRO A 1 141 ? 49.723 -3.148  12.415 1.00 15.84 ? 161 PRO A HD3   1 
ATOM   2128 N  N     . ILE A 1 142 ? 45.813 0.658   11.968 1.00 15.74 ? 162 ILE A N     1 
ATOM   2129 C  CA    . ILE A 1 142 ? 44.419 0.984   12.375 1.00 15.78 ? 162 ILE A CA    1 
ATOM   2130 C  C     . ILE A 1 142 ? 43.567 -0.009  11.554 1.00 14.51 ? 162 ILE A C     1 
ATOM   2131 O  O     . ILE A 1 142 ? 43.826 -0.174  10.370 1.00 14.49 ? 162 ILE A O     1 
ATOM   2132 C  CB    . ILE A 1 142 ? 44.112 2.447   11.974 1.00 14.74 ? 162 ILE A CB    1 
ATOM   2133 C  CG1   . ILE A 1 142 ? 45.083 3.363   12.809 1.00 15.58 ? 162 ILE A CG1   1 
ATOM   2134 C  CG2   . ILE A 1 142 ? 42.621 2.744   12.229 1.00 14.72 ? 162 ILE A CG2   1 
ATOM   2135 C  CD1   . ILE A 1 142 ? 44.846 4.847   12.536 1.00 17.97 ? 162 ILE A CD1   1 
ATOM   2136 H  H     . ILE A 1 142 ? 46.277 1.193   11.288 1.00 13.60 ? 162 ILE A H     1 
ATOM   2137 H  HA    . ILE A 1 142 ? 44.297 0.796   13.434 1.00 15.32 ? 162 ILE A HA    1 
ATOM   2138 H  HB    . ILE A 1 142 ? 44.303 2.575   10.916 1.00 14.61 ? 162 ILE A HB    1 
ATOM   2139 H  HG12  . ILE A 1 142 ? 44.953 3.183   13.866 1.00 15.64 ? 162 ILE A HG12  1 
ATOM   2140 H  HG13  . ILE A 1 142 ? 46.112 3.133   12.560 1.00 16.23 ? 162 ILE A HG13  1 
ATOM   2141 H  HG21  . ILE A 1 142 ? 42.376 2.613   13.271 1.00 15.28 ? 162 ILE A HG21  1 
ATOM   2142 H  HG22  . ILE A 1 142 ? 42.004 2.072   11.654 1.00 14.86 ? 162 ILE A HG22  1 
ATOM   2143 H  HG23  . ILE A 1 142 ? 42.372 3.753   11.939 1.00 14.31 ? 162 ILE A HG23  1 
ATOM   2144 H  HD11  . ILE A 1 142 ? 43.855 5.131   12.860 1.00 17.22 ? 162 ILE A HD11  1 
ATOM   2145 H  HD12  . ILE A 1 142 ? 44.960 5.081   11.488 1.00 16.89 ? 162 ILE A HD12  1 
ATOM   2146 H  HD13  . ILE A 1 142 ? 45.564 5.431   13.096 1.00 17.08 ? 162 ILE A HD13  1 
ATOM   2147 N  N     . LEU A 1 143 ? 42.579 -0.605  12.165 1.00 15.25 ? 163 LEU A N     1 
ATOM   2148 C  CA    . LEU A 1 143 ? 41.738 -1.578  11.420 1.00 16.29 ? 163 LEU A CA    1 
ATOM   2149 C  C     . LEU A 1 143 ? 40.524 -0.867  10.865 1.00 16.65 ? 163 LEU A C     1 
ATOM   2150 O  O     . LEU A 1 143 ? 40.204 0.224   11.304 1.00 17.59 ? 163 LEU A O     1 
ATOM   2151 C  CB    . LEU A 1 143 ? 41.290 -2.706  12.372 1.00 16.72 ? 163 LEU A CB    1 
ATOM   2152 C  CG    . LEU A 1 143 ? 42.508 -3.363  13.091 1.00 16.93 ? 163 LEU A CG    1 
ATOM   2153 C  CD1   . LEU A 1 143 ? 41.997 -4.492  13.950 1.00 19.96 ? 163 LEU A CD1   1 
ATOM   2154 C  CD2   . LEU A 1 143 ? 43.541 -3.893  12.092 1.00 17.02 ? 163 LEU A CD2   1 
ATOM   2155 H  H     . LEU A 1 143 ? 42.383 -0.407  13.102 1.00 15.08 ? 163 LEU A H     1 
ATOM   2156 H  HA    . LEU A 1 143 ? 42.311 -1.981  10.598 1.00 16.47 ? 163 LEU A HA    1 
ATOM   2157 H  HB2   . LEU A 1 143 ? 40.599 -2.294  13.096 1.00 16.90 ? 163 LEU A HB2   1 
ATOM   2158 H  HB3   . LEU A 1 143 ? 40.755 -3.437  11.779 1.00 17.43 ? 163 LEU A HB3   1 
ATOM   2159 H  HG    . LEU A 1 143 ? 42.989 -2.632  13.725 1.00 17.95 ? 163 LEU A HG    1 
ATOM   2160 H  HD11  . LEU A 1 143 ? 41.505 -5.248  13.353 1.00 18.66 ? 163 LEU A HD11  1 
ATOM   2161 H  HD12  . LEU A 1 143 ? 41.298 -4.103  14.679 1.00 18.46 ? 163 LEU A HD12  1 
ATOM   2162 H  HD13  . LEU A 1 143 ? 42.826 -4.950  14.474 1.00 18.98 ? 163 LEU A HD13  1 
ATOM   2163 H  HD21  . LEU A 1 143 ? 43.939 -3.089  11.487 1.00 17.39 ? 163 LEU A HD21  1 
ATOM   2164 H  HD22  . LEU A 1 143 ? 43.110 -4.631  11.435 1.00 17.20 ? 163 LEU A HD22  1 
ATOM   2165 H  HD23  . LEU A 1 143 ? 44.371 -4.336  12.624 1.00 17.55 ? 163 LEU A HD23  1 
ATOM   2166 N  N     . SER A 1 144 ? 39.859 -1.494  9.935  1.00 17.06 ? 164 SER A N     1 
ATOM   2167 C  CA    . SER A 1 144 ? 38.673 -0.850  9.347  1.00 17.44 ? 164 SER A CA    1 
ATOM   2168 C  C     . SER A 1 144 ? 37.576 -0.918  10.394 1.00 16.81 ? 164 SER A C     1 
ATOM   2169 O  O     . SER A 1 144 ? 37.598 -1.716  11.318 1.00 19.31 ? 164 SER A O     1 
ATOM   2170 C  CB    . SER A 1 144 ? 38.240 -1.611  8.047  1.00 19.35 ? 164 SER A CB    1 
ATOM   2171 O  OG    . SER A 1 144 ? 37.982 -2.962  8.453  1.00 20.67 ? 164 SER A OG    1 
ATOM   2172 H  H     . SER A 1 144 ? 40.128 -2.388  9.629  1.00 16.90 ? 164 SER A H     1 
ATOM   2173 H  HA    . SER A 1 144 ? 38.902 0.184   9.132  1.00 16.43 ? 164 SER A HA    1 
ATOM   2174 H  HB2   . SER A 1 144 ? 37.340 -1.186  7.619  1.00 18.27 ? 164 SER A HB2   1 
ATOM   2175 H  HB3   . SER A 1 144 ? 39.024 -1.585  7.302  1.00 18.10 ? 164 SER A HB3   1 
ATOM   2176 H  HG    . SER A 1 144 ? 38.510 -3.514  7.851  1.00 19.92 ? 164 SER A HG    1 
ATOM   2177 N  N     . ASP A 1 145 ? 36.623 -0.069  10.211 1.00 18.05 ? 165 ASP A N     1 
ATOM   2178 C  CA    . ASP A 1 145 ? 35.486 -0.011  11.147 1.00 18.27 ? 165 ASP A CA    1 
ATOM   2179 C  C     . ASP A 1 145 ? 34.702 -1.295  11.190 1.00 18.37 ? 165 ASP A C     1 
ATOM   2180 O  O     . ASP A 1 145 ? 34.229 -1.670  12.246 1.00 14.90 ? 165 ASP A O     1 
ATOM   2181 C  CB    A ASP A 1 145 ? 34.582 1.162   10.749 0.34 18.56 ? 165 ASP A CB    1 
ATOM   2182 C  CB    B ASP A 1 145 ? 34.585 1.165   10.707 0.32 18.04 ? 165 ASP A CB    1 
ATOM   2183 C  CG    A ASP A 1 145 ? 35.210 2.500   11.204 0.34 18.30 ? 165 ASP A CG    1 
ATOM   2184 C  CG    B ASP A 1 145 ? 33.523 1.489   11.764 0.32 17.37 ? 165 ASP A CG    1 
ATOM   2185 O  OD1   A ASP A 1 145 ? 34.764 3.467   10.612 0.34 21.15 ? 165 ASP A OD1   1 
ATOM   2186 O  OD1   B ASP A 1 145 ? 32.410 1.748   11.338 0.32 17.18 ? 165 ASP A OD1   1 
ATOM   2187 O  OD2   A ASP A 1 145 ? 36.064 2.522   12.088 0.34 16.12 ? 165 ASP A OD2   1 
ATOM   2188 O  OD2   B ASP A 1 145 ? 33.880 1.470   12.930 0.32 15.12 ? 165 ASP A OD2   1 
ATOM   2189 H  H     . ASP A 1 145 ? 36.679 0.540   9.436  1.00 18.59 ? 165 ASP A H     1 
ATOM   2190 H  HA    . ASP A 1 145 ? 35.882 0.152   12.137 1.00 18.96 ? 165 ASP A HA    1 
ATOM   2191 H  HB2   A ASP A 1 145 ? 34.450 1.181   9.675  0.34 18.61 ? 165 ASP A HB2   1 
ATOM   2192 H  HB2   B ASP A 1 145 ? 35.181 2.051   10.543 0.32 18.49 ? 165 ASP A HB2   1 
ATOM   2193 H  HB3   A ASP A 1 145 ? 33.610 1.062   11.213 0.34 18.60 ? 165 ASP A HB3   1 
ATOM   2194 H  HB3   B ASP A 1 145 ? 34.092 0.912   9.776  0.32 18.43 ? 165 ASP A HB3   1 
ATOM   2195 N  N     . SER A 1 146 ? 34.573 -1.939  10.082 1.00 17.71 ? 166 SER A N     1 
ATOM   2196 C  CA    . SER A 1 146 ? 33.817 -3.223  10.034 1.00 18.74 ? 166 SER A CA    1 
ATOM   2197 C  C     . SER A 1 146 ? 34.518 -4.319  10.845 1.00 17.92 ? 166 SER A C     1 
ATOM   2198 O  O     . SER A 1 146 ? 33.871 -5.061  11.563 1.00 20.39 ? 166 SER A O     1 
ATOM   2199 C  CB    A SER A 1 146 ? 33.674 -3.677  8.570  0.43 16.91 ? 166 SER A CB    1 
ATOM   2200 C  CB    B SER A 1 146 ? 33.717 -3.659  8.586  0.18 17.87 ? 166 SER A CB    1 
ATOM   2201 O  OG    A SER A 1 146 ? 34.817 -3.179  7.855  0.43 18.76 ? 166 SER A OG    1 
ATOM   2202 O  OG    B SER A 1 146 ? 33.863 -2.458  7.820  0.18 19.43 ? 166 SER A OG    1 
ATOM   2203 H  H     . SER A 1 146 ? 34.942 -1.636  9.221  1.00 19.53 ? 166 SER A H     1 
ATOM   2204 H  HA    . SER A 1 146 ? 32.831 -3.073  10.454 1.00 18.08 ? 166 SER A HA    1 
ATOM   2205 H  HB2   A SER A 1 146 ? 33.660 -4.758  8.523  0.43 17.72 ? 166 SER A HB2   1 
ATOM   2206 H  HB2   B SER A 1 146 ? 34.524 -4.347  8.379  0.18 18.28 ? 166 SER A HB2   1 
ATOM   2207 H  HB3   A SER A 1 146 ? 32.754 -3.302  8.140  0.43 17.80 ? 166 SER A HB3   1 
ATOM   2208 H  HB3   B SER A 1 146 ? 32.766 -4.131  8.374  0.18 18.24 ? 166 SER A HB3   1 
ATOM   2209 H  HG    A SER A 1 146 ? 35.659 -3.413  8.279  0.43 18.36 ? 166 SER A HG    1 
ATOM   2210 H  HG    B SER A 1 146 ? 33.038 -2.319  7.335  0.18 18.84 ? 166 SER A HG    1 
ATOM   2211 N  N     . SER A 1 147 ? 35.822 -4.410  10.711 1.00 17.10 ? 167 SER A N     1 
ATOM   2212 C  CA    . SER A 1 147 ? 36.518 -5.466  11.486 1.00 17.30 ? 167 SER A CA    1 
ATOM   2213 C  C     . SER A 1 147 ? 36.421 -5.125  12.965 1.00 15.17 ? 167 SER A C     1 
ATOM   2214 O  O     . SER A 1 147 ? 36.269 -6.012  13.773 1.00 13.97 ? 167 SER A O     1 
ATOM   2215 C  CB    . SER A 1 147 ? 37.996 -5.547  11.051 1.00 19.99 ? 167 SER A CB    1 
ATOM   2216 O  OG    . SER A 1 147 ? 37.876 -5.844  9.657  1.00 23.02 ? 167 SER A OG    1 
ATOM   2217 H  H     . SER A 1 147 ? 36.340 -3.815  10.128 1.00 18.34 ? 167 SER A H     1 
ATOM   2218 H  HA    . SER A 1 147 ? 36.021 -6.408  11.310 1.00 17.25 ? 167 SER A HA    1 
ATOM   2219 H  HB2   . SER A 1 147 ? 38.524 -4.612  11.202 1.00 19.47 ? 167 SER A HB2   1 
ATOM   2220 H  HB3   . SER A 1 147 ? 38.514 -6.350  11.561 1.00 19.40 ? 167 SER A HB3   1 
ATOM   2221 H  HG    . SER A 1 147 ? 38.391 -5.171  9.180  1.00 22.53 ? 167 SER A HG    1 
ATOM   2222 N  N     . CYS A 1 148 ? 36.510 -3.864  13.277 1.00 15.20 ? 168 CYS A N     1 
ATOM   2223 C  CA    . CYS A 1 148 ? 36.431 -3.449  14.692 1.00 14.02 ? 168 CYS A CA    1 
ATOM   2224 C  C     . CYS A 1 148 ? 35.068 -3.790  15.268 1.00 15.70 ? 168 CYS A C     1 
ATOM   2225 O  O     . CYS A 1 148 ? 34.996 -4.396  16.319 1.00 14.53 ? 168 CYS A O     1 
ATOM   2226 C  CB    . CYS A 1 148 ? 36.701 -1.950  14.750 1.00 15.92 ? 168 CYS A CB    1 
ATOM   2227 S  SG    . CYS A 1 148 ? 36.958 -1.241  16.392 1.00 12.57 ? 168 CYS A SG    1 
ATOM   2228 H  H     . CYS A 1 148 ? 36.631 -3.196  12.566 1.00 14.97 ? 168 CYS A H     1 
ATOM   2229 H  HA    . CYS A 1 148 ? 37.180 -3.980  15.263 1.00 14.57 ? 168 CYS A HA    1 
ATOM   2230 H  HB2   . CYS A 1 148 ? 37.593 -1.765  14.174 1.00 15.27 ? 168 CYS A HB2   1 
ATOM   2231 H  HB3   . CYS A 1 148 ? 35.884 -1.414  14.295 1.00 14.48 ? 168 CYS A HB3   1 
ATOM   2232 N  N     . LYS A 1 149 ? 34.039 -3.395  14.552 1.00 17.03 ? 169 LYS A N     1 
ATOM   2233 C  CA    . LYS A 1 149 ? 32.630 -3.655  14.988 1.00 17.28 ? 169 LYS A CA    1 
ATOM   2234 C  C     . LYS A 1 149 ? 32.313 -5.126  14.963 1.00 15.72 ? 169 LYS A C     1 
ATOM   2235 O  O     . LYS A 1 149 ? 31.510 -5.553  15.765 1.00 19.15 ? 169 LYS A O     1 
ATOM   2236 C  CB    . LYS A 1 149 ? 31.669 -2.880  14.081 1.00 17.61 ? 169 LYS A CB    1 
ATOM   2237 C  CG    . LYS A 1 149 ? 31.739 -1.394  14.523 1.00 20.70 ? 169 LYS A CG    1 
ATOM   2238 C  CD    . LYS A 1 149 ? 31.015 -0.492  13.521 1.00 24.76 ? 169 LYS A CD    1 
ATOM   2239 C  CE    . LYS A 1 149 ? 30.886 0.958   14.106 0.52 23.74 ? 169 LYS A CE    1 
ATOM   2240 N  NZ    . LYS A 1 149 ? 30.303 1.841   13.054 0.52 25.26 ? 169 LYS A NZ    1 
ATOM   2241 H  H     . LYS A 1 149 ? 34.201 -2.915  13.711 1.00 15.42 ? 169 LYS A H     1 
ATOM   2242 H  HA    . LYS A 1 149 ? 32.540 -3.327  16.012 1.00 18.88 ? 169 LYS A HA    1 
ATOM   2243 H  HB2   . LYS A 1 149 ? 31.931 -3.006  13.040 1.00 18.41 ? 169 LYS A HB2   1 
ATOM   2244 H  HB3   . LYS A 1 149 ? 30.670 -3.263  14.228 1.00 18.27 ? 169 LYS A HB3   1 
ATOM   2245 H  HG2   . LYS A 1 149 ? 31.272 -1.273  15.488 1.00 20.67 ? 169 LYS A HG2   1 
ATOM   2246 H  HG3   . LYS A 1 149 ? 32.773 -1.083  14.591 1.00 20.99 ? 169 LYS A HG3   1 
ATOM   2247 H  HD2   . LYS A 1 149 ? 31.561 -0.473  12.589 1.00 23.76 ? 169 LYS A HD2   1 
ATOM   2248 H  HD3   . LYS A 1 149 ? 30.023 -0.872  13.318 1.00 24.05 ? 169 LYS A HD3   1 
ATOM   2249 H  HE2   . LYS A 1 149 ? 30.210 0.954   14.946 0.52 24.06 ? 169 LYS A HE2   1 
ATOM   2250 H  HE3   . LYS A 1 149 ? 31.826 1.379   14.429 0.52 24.07 ? 169 LYS A HE3   1 
ATOM   2251 H  HZ1   . LYS A 1 149 ? 30.132 1.285   12.191 0.52 24.74 ? 169 LYS A HZ1   1 
ATOM   2252 H  HZ2   . LYS A 1 149 ? 30.969 2.610   12.836 0.52 24.85 ? 169 LYS A HZ2   1 
ATOM   2253 H  HZ3   . LYS A 1 149 ? 29.404 2.242   13.390 0.52 24.96 ? 169 LYS A HZ3   1 
ATOM   2254 N  N     . SER A 1 150 ? 32.915 -5.859  14.078 1.00 13.47 ? 170 SER A N     1 
ATOM   2255 C  CA    . SER A 1 150 ? 32.607 -7.297  14.079 1.00 17.18 ? 170 SER A CA    1 
ATOM   2256 C  C     . SER A 1 150 ? 33.304 -7.942  15.274 1.00 19.46 ? 170 SER A C     1 
ATOM   2257 O  O     . SER A 1 150 ? 32.846 -8.960  15.737 1.00 21.92 ? 170 SER A O     1 
ATOM   2258 C  CB    . SER A 1 150 ? 33.132 -7.949  12.858 1.00 18.04 ? 170 SER A CB    1 
ATOM   2259 O  OG    . SER A 1 150 ? 32.326 -7.341  11.859 1.00 25.03 ? 170 SER A OG    1 
ATOM   2260 H  H     . SER A 1 150 ? 33.539 -5.462  13.435 1.00 14.34 ? 170 SER A H     1 
ATOM   2261 H  HA    . SER A 1 150 ? 31.540 -7.434  14.172 1.00 16.82 ? 170 SER A HA    1 
ATOM   2262 H  HB2   . SER A 1 150 ? 34.181 -7.732  12.699 1.00 19.73 ? 170 SER A HB2   1 
ATOM   2263 H  HB3   . SER A 1 150 ? 32.977 -9.015  12.904 1.00 19.38 ? 170 SER A HB3   1 
ATOM   2264 H  HG    . SER A 1 150 ? 32.815 -6.547  11.579 1.00 23.53 ? 170 SER A HG    1 
ATOM   2265 N  N     . ALA A 1 151 ? 34.373 -7.363  15.748 1.00 20.08 ? 171 ALA A N     1 
ATOM   2266 C  CA    . ALA A 1 151 ? 35.096 -7.953  16.901 1.00 18.14 ? 171 ALA A CA    1 
ATOM   2267 C  C     . ALA A 1 151 ? 34.420 -7.642  18.225 1.00 16.62 ? 171 ALA A C     1 
ATOM   2268 O  O     . ALA A 1 151 ? 34.398 -8.455  19.131 1.00 16.14 ? 171 ALA A O     1 
ATOM   2269 C  CB    . ALA A 1 151 ? 36.526 -7.396  16.927 1.00 20.88 ? 171 ALA A CB    1 
ATOM   2270 H  H     . ALA A 1 151 ? 34.704 -6.533  15.344 1.00 20.82 ? 171 ALA A H     1 
ATOM   2271 H  HA    . ALA A 1 151 ? 35.106 -9.026  16.779 1.00 18.53 ? 171 ALA A HA    1 
ATOM   2272 H  HB1   . ALA A 1 151 ? 36.496 -6.323  17.070 1.00 20.38 ? 171 ALA A HB1   1 
ATOM   2273 H  HB2   . ALA A 1 151 ? 37.043 -7.605  16.008 1.00 19.90 ? 171 ALA A HB2   1 
ATOM   2274 H  HB3   . ALA A 1 151 ? 37.057 -7.844  17.757 1.00 19.68 ? 171 ALA A HB3   1 
ATOM   2275 N  N     . TYR A 1 152 ? 33.891 -6.457  18.289 1.00 15.48 ? 172 TYR A N     1 
ATOM   2276 C  CA    . TYR A 1 152 ? 33.206 -5.986  19.514 1.00 14.18 ? 172 TYR A CA    1 
ATOM   2277 C  C     . TYR A 1 152 ? 31.796 -5.530  19.228 1.00 19.20 ? 172 TYR A C     1 
ATOM   2278 O  O     . TYR A 1 152 ? 31.509 -4.365  19.452 1.00 18.68 ? 172 TYR A O     1 
ATOM   2279 C  CB    . TYR A 1 152 ? 33.994 -4.795  20.116 1.00 13.37 ? 172 TYR A CB    1 
ATOM   2280 C  CG    . TYR A 1 152 ? 35.391 -5.179  20.576 1.00 13.40 ? 172 TYR A CG    1 
ATOM   2281 C  CD1   . TYR A 1 152 ? 35.515 -5.875  21.750 1.00 14.14 ? 172 TYR A CD1   1 
ATOM   2282 C  CD2   . TYR A 1 152 ? 36.527 -4.840  19.870 1.00 12.76 ? 172 TYR A CD2   1 
ATOM   2283 C  CE1   . TYR A 1 152 ? 36.739 -6.235  22.228 1.00 15.60 ? 172 TYR A CE1   1 
ATOM   2284 C  CE2   . TYR A 1 152 ? 37.773 -5.204  20.355 1.00 13.23 ? 172 TYR A CE2   1 
ATOM   2285 C  CZ    . TYR A 1 152 ? 37.869 -5.908  21.548 1.00 14.16 ? 172 TYR A CZ    1 
ATOM   2286 O  OH    . TYR A 1 152 ? 39.070 -6.295  22.083 1.00 16.27 ? 172 TYR A OH    1 
ATOM   2287 H  H     . TYR A 1 152 ? 33.948 -5.864  17.507 1.00 17.14 ? 172 TYR A H     1 
ATOM   2288 H  HA    . TYR A 1 152 ? 33.169 -6.786  20.229 1.00 14.75 ? 172 TYR A HA    1 
ATOM   2289 H  HB2   . TYR A 1 152 ? 34.060 -3.996  19.394 1.00 12.99 ? 172 TYR A HB2   1 
ATOM   2290 H  HB3   . TYR A 1 152 ? 33.452 -4.426  20.974 1.00 13.62 ? 172 TYR A HB3   1 
ATOM   2291 H  HD1   . TYR A 1 152 ? 34.636 -6.139  22.321 1.00 15.06 ? 172 TYR A HD1   1 
ATOM   2292 H  HD2   . TYR A 1 152 ? 36.453 -4.291  18.939 1.00 12.62 ? 172 TYR A HD2   1 
ATOM   2293 H  HE1   . TYR A 1 152 ? 36.794 -6.778  23.147 1.00 13.89 ? 172 TYR A HE1   1 
ATOM   2294 H  HE2   . TYR A 1 152 ? 38.658 -4.929  19.798 1.00 12.32 ? 172 TYR A HE2   1 
ATOM   2295 H  HH    . TYR A 1 152 ? 39.738 -5.800  21.585 1.00 15.11 ? 172 TYR A HH    1 
ATOM   2296 N  N     . PRO A 1 153 ? 30.928 -6.373  18.741 1.00 20.07 ? 173 PRO A N     1 
ATOM   2297 C  CA    . PRO A 1 153 ? 29.571 -5.937  18.407 1.00 20.15 ? 173 PRO A CA    1 
ATOM   2298 C  C     . PRO A 1 153 ? 28.882 -5.166  19.557 1.00 20.17 ? 173 PRO A C     1 
ATOM   2299 O  O     . PRO A 1 153 ? 28.903 -5.560  20.711 1.00 19.24 ? 173 PRO A O     1 
ATOM   2300 C  CB    . PRO A 1 153 ? 28.867 -7.251  17.992 1.00 20.95 ? 173 PRO A CB    1 
ATOM   2301 C  CG    . PRO A 1 153 ? 29.712 -8.365  18.634 1.00 21.51 ? 173 PRO A CG    1 
ATOM   2302 C  CD    . PRO A 1 153 ? 31.136 -7.817  18.471 1.00 21.23 ? 173 PRO A CD    1 
ATOM   2303 H  HA    . PRO A 1 153 ? 29.658 -5.281  17.551 1.00 21.16 ? 173 PRO A HA    1 
ATOM   2304 H  HB2   . PRO A 1 153 ? 27.855 -7.262  18.368 1.00 20.95 ? 173 PRO A HB2   1 
ATOM   2305 H  HB3   . PRO A 1 153 ? 28.858 -7.341  16.915 1.00 21.19 ? 173 PRO A HB3   1 
ATOM   2306 H  HG2   . PRO A 1 153 ? 29.467 -8.493  19.679 1.00 21.11 ? 173 PRO A HG2   1 
ATOM   2307 H  HG3   . PRO A 1 153 ? 29.609 -9.308  18.117 1.00 20.98 ? 173 PRO A HG3   1 
ATOM   2308 H  HD2   . PRO A 1 153 ? 31.820 -8.243  19.186 1.00 21.39 ? 173 PRO A HD2   1 
ATOM   2309 H  HD3   . PRO A 1 153 ? 31.510 -7.954  17.466 1.00 21.69 ? 173 PRO A HD3   1 
ATOM   2310 N  N     . GLY A 1 154 ? 28.308 -4.062  19.170 1.00 20.36 ? 174 GLY A N     1 
ATOM   2311 C  CA    . GLY A 1 154 ? 27.580 -3.169  20.099 1.00 23.19 ? 174 GLY A CA    1 
ATOM   2312 C  C     . GLY A 1 154 ? 28.417 -2.421  21.106 1.00 22.16 ? 174 GLY A C     1 
ATOM   2313 O  O     . GLY A 1 154 ? 27.847 -1.815  21.983 1.00 26.48 ? 174 GLY A O     1 
ATOM   2314 H  H     . GLY A 1 154 ? 28.362 -3.801  18.229 1.00 20.26 ? 174 GLY A H     1 
ATOM   2315 H  HA2   . GLY A 1 154 ? 27.031 -2.446  19.514 1.00 22.07 ? 174 GLY A HA2   1 
ATOM   2316 H  HA3   . GLY A 1 154 ? 26.883 -3.778  20.655 1.00 23.16 ? 174 GLY A HA3   1 
ATOM   2317 N  N     . GLN A 1 155 ? 29.709 -2.431  21.005 1.00 20.80 ? 175 GLN A N     1 
ATOM   2318 C  CA    . GLN A 1 155 ? 30.534 -1.693  22.023 1.00 19.34 ? 175 GLN A CA    1 
ATOM   2319 C  C     . GLN A 1 155 ? 31.439 -0.618  21.423 1.00 18.54 ? 175 GLN A C     1 
ATOM   2320 O  O     . GLN A 1 155 ? 32.139 0.033   22.166 1.00 18.99 ? 175 GLN A O     1 
ATOM   2321 C  CB    A GLN A 1 155 ? 31.417 -2.696  22.740 0.59 20.30 ? 175 GLN A CB    1 
ATOM   2322 C  CB    B GLN A 1 155 ? 31.399 -2.697  22.786 0.33 19.82 ? 175 GLN A CB    1 
ATOM   2323 C  CG    A GLN A 1 155 ? 30.606 -3.896  23.234 0.59 21.25 ? 175 GLN A CG    1 
ATOM   2324 C  CG    B GLN A 1 155 ? 30.495 -3.806  23.334 0.33 20.15 ? 175 GLN A CG    1 
ATOM   2325 C  CD    A GLN A 1 155 ? 31.519 -5.121  23.143 0.59 23.64 ? 175 GLN A CD    1 
ATOM   2326 C  CD    B GLN A 1 155 ? 31.317 -4.660  24.287 0.33 20.99 ? 175 GLN A CD    1 
ATOM   2327 O  OE1   A GLN A 1 155 ? 32.473 -5.244  23.883 0.59 23.27 ? 175 GLN A OE1   1 
ATOM   2328 O  OE1   B GLN A 1 155 ? 31.547 -4.298  25.418 0.33 22.16 ? 175 GLN A OE1   1 
ATOM   2329 N  NE2   A GLN A 1 155 ? 31.272 -6.042  22.255 0.59 25.16 ? 175 GLN A NE2   1 
ATOM   2330 N  NE2   B GLN A 1 155 ? 31.797 -5.796  23.903 0.33 22.33 ? 175 GLN A NE2   1 
ATOM   2331 H  H     . GLN A 1 155 ? 30.131 -2.915  20.264 1.00 20.92 ? 175 GLN A H     1 
ATOM   2332 H  HA    . GLN A 1 155 ? 29.883 -1.201  22.732 1.00 20.44 ? 175 GLN A HA    1 
ATOM   2333 H  HB2   A GLN A 1 155 ? 32.199 -3.028  22.073 0.59 20.32 ? 175 GLN A HB2   1 
ATOM   2334 H  HB2   B GLN A 1 155 ? 32.157 -3.114  22.142 0.33 19.67 ? 175 GLN A HB2   1 
ATOM   2335 H  HB3   A GLN A 1 155 ? 31.896 -2.216  23.581 0.59 20.78 ? 175 GLN A HB3   1 
ATOM   2336 H  HB3   B GLN A 1 155 ? 31.892 -2.193  23.608 0.33 19.97 ? 175 GLN A HB3   1 
ATOM   2337 H  HG2   A GLN A 1 155 ? 30.323 -3.753  24.264 0.59 21.51 ? 175 GLN A HG2   1 
ATOM   2338 H  HG2   B GLN A 1 155 ? 29.662 -3.381  23.874 0.33 20.13 ? 175 GLN A HG2   1 
ATOM   2339 H  HG3   A GLN A 1 155 ? 29.717 -4.080  22.650 0.59 22.02 ? 175 GLN A HG3   1 
ATOM   2340 H  HG3   B GLN A 1 155 ? 30.114 -4.427  22.535 0.33 20.40 ? 175 GLN A HG3   1 
ATOM   2341 H  HE21  A GLN A 1 155 ? 31.841 -6.840  22.194 0.59 25.06 ? 175 GLN A HE21  1 
ATOM   2342 H  HE21  B GLN A 1 155 ? 32.326 -6.314  24.540 0.33 21.88 ? 175 GLN A HE21  1 
ATOM   2343 H  HE22  A GLN A 1 155 ? 30.511 -5.945  21.640 0.59 25.16 ? 175 GLN A HE22  1 
ATOM   2344 H  HE22  B GLN A 1 155 ? 31.637 -6.136  22.997 0.33 22.01 ? 175 GLN A HE22  1 
ATOM   2345 N  N     . ILE A 1 156 ? 31.413 -0.454  20.139 1.00 17.32 ? 176 ILE A N     1 
ATOM   2346 C  CA    . ILE A 1 156 ? 32.297 0.565   19.523 1.00 17.81 ? 176 ILE A CA    1 
ATOM   2347 C  C     . ILE A 1 156 ? 31.474 1.776   19.149 1.00 18.72 ? 176 ILE A C     1 
ATOM   2348 O  O     . ILE A 1 156 ? 30.498 1.595   18.436 1.00 22.33 ? 176 ILE A O     1 
ATOM   2349 C  CB    . ILE A 1 156 ? 32.966 -0.076  18.244 1.00 14.16 ? 176 ILE A CB    1 
ATOM   2350 C  CG1   . ILE A 1 156 ? 33.733 -1.371  18.555 1.00 11.17 ? 176 ILE A CG1   1 
ATOM   2351 C  CG2   . ILE A 1 156 ? 33.910 0.899   17.508 1.00 15.72 ? 176 ILE A CG2   1 
ATOM   2352 C  CD1   . ILE A 1 156 ? 34.882 -1.177  19.594 1.00 11.00 ? 176 ILE A CD1   1 
ATOM   2353 H  H     . ILE A 1 156 ? 30.808 -0.982  19.577 1.00 17.69 ? 176 ILE A H     1 
ATOM   2354 H  HA    . ILE A 1 156 ? 33.048 0.865   20.239 1.00 18.00 ? 176 ILE A HA    1 
ATOM   2355 H  HB    . ILE A 1 156 ? 32.161 -0.301  17.561 1.00 15.12 ? 176 ILE A HB    1 
ATOM   2356 H  HG12  . ILE A 1 156 ? 33.047 -2.105  18.952 1.00 12.43 ? 176 ILE A HG12  1 
ATOM   2357 H  HG13  . ILE A 1 156 ? 34.160 -1.768  17.643 1.00 11.74 ? 176 ILE A HG13  1 
ATOM   2358 H  HG21  . ILE A 1 156 ? 34.720 1.217   18.148 1.00 15.85 ? 176 ILE A HG21  1 
ATOM   2359 H  HG22  . ILE A 1 156 ? 33.369 1.778   17.179 1.00 14.49 ? 176 ILE A HG22  1 
ATOM   2360 H  HG23  . ILE A 1 156 ? 34.336 0.421   16.638 1.00 15.87 ? 176 ILE A HG23  1 
ATOM   2361 H  HD11  . ILE A 1 156 ? 34.508 -0.834  20.547 1.00 10.08 ? 176 ILE A HD11  1 
ATOM   2362 H  HD12  . ILE A 1 156 ? 35.609 -0.471  19.221 1.00 9.89  ? 176 ILE A HD12  1 
ATOM   2363 H  HD13  . ILE A 1 156 ? 35.392 -2.114  19.750 1.00 10.60 ? 176 ILE A HD13  1 
ATOM   2364 N  N     . THR A 1 157 ? 31.867 2.940   19.593 1.00 16.84 ? 177 THR A N     1 
ATOM   2365 C  CA    . THR A 1 157 ? 31.108 4.181   19.260 1.00 16.70 ? 177 THR A CA    1 
ATOM   2366 C  C     . THR A 1 157 ? 31.911 4.911   18.196 1.00 18.00 ? 177 THR A C     1 
ATOM   2367 O  O     . THR A 1 157 ? 33.009 4.500   17.849 1.00 19.26 ? 177 THR A O     1 
ATOM   2368 C  CB    . THR A 1 157 ? 30.978 5.064   20.527 1.00 15.99 ? 177 THR A CB    1 
ATOM   2369 O  OG1   . THR A 1 157 ? 32.302 5.494   20.869 1.00 13.05 ? 177 THR A OG1   1 
ATOM   2370 C  CG2   . THR A 1 157 ? 30.519 4.220   21.726 1.00 14.48 ? 177 THR A CG2   1 
ATOM   2371 H  H     . THR A 1 157 ? 32.664 3.036   20.149 1.00 19.22 ? 177 THR A H     1 
ATOM   2372 H  HA    . THR A 1 157 ? 30.137 3.928   18.857 1.00 17.82 ? 177 THR A HA    1 
ATOM   2373 H  HB    . THR A 1 157 ? 30.333 5.920   20.363 1.00 15.32 ? 177 THR A HB    1 
ATOM   2374 H  HG1   . THR A 1 157 ? 32.211 6.307   21.384 1.00 13.38 ? 177 THR A HG1   1 
ATOM   2375 H  HG21  . THR A 1 157 ? 31.214 3.417   21.920 1.00 14.67 ? 177 THR A HG21  1 
ATOM   2376 H  HG22  . THR A 1 157 ? 29.555 3.789   21.507 1.00 14.45 ? 177 THR A HG22  1 
ATOM   2377 H  HG23  . THR A 1 157 ? 30.422 4.828   22.611 1.00 14.83 ? 177 THR A HG23  1 
ATOM   2378 N  N     . SER A 1 158 ? 31.396 5.993   17.689 1.00 17.61 ? 178 SER A N     1 
ATOM   2379 C  CA    . SER A 1 158 ? 32.161 6.716   16.658 1.00 19.18 ? 178 SER A CA    1 
ATOM   2380 C  C     . SER A 1 158 ? 33.411 7.334   17.267 1.00 15.55 ? 178 SER A C     1 
ATOM   2381 O  O     . SER A 1 158 ? 34.240 7.832   16.541 1.00 17.08 ? 178 SER A O     1 
ATOM   2382 C  CB    . SER A 1 158 ? 31.283 7.805   16.071 1.00 22.27 ? 178 SER A CB    1 
ATOM   2383 O  OG    . SER A 1 158 ? 30.679 8.399   17.222 1.00 26.74 ? 178 SER A OG    1 
ATOM   2384 H  H     . SER A 1 158 ? 30.520 6.353   17.963 1.00 18.16 ? 178 SER A H     1 
ATOM   2385 H  HA    . SER A 1 158 ? 32.456 6.024   15.883 1.00 19.45 ? 178 SER A HA    1 
ATOM   2386 H  HB2   . SER A 1 158 ? 31.887 8.537   15.544 1.00 22.57 ? 178 SER A HB2   1 
ATOM   2387 H  HB3   . SER A 1 158 ? 30.536 7.395   15.407 1.00 22.48 ? 178 SER A HB3   1 
ATOM   2388 H  HG    . SER A 1 158 ? 30.903 9.341   17.215 1.00 25.55 ? 178 SER A HG    1 
ATOM   2389 N  N     . ASN A 1 159 ? 33.554 7.294   18.561 1.00 13.95 ? 179 ASN A N     1 
ATOM   2390 C  CA    . ASN A 1 159 ? 34.783 7.916   19.159 1.00 14.91 ? 179 ASN A CA    1 
ATOM   2391 C  C     . ASN A 1 159 ? 35.850 6.912   19.483 1.00 13.40 ? 179 ASN A C     1 
ATOM   2392 O  O     . ASN A 1 159 ? 36.729 7.201   20.276 1.00 10.16 ? 179 ASN A O     1 
ATOM   2393 C  CB    . ASN A 1 159 ? 34.409 8.663   20.459 1.00 15.85 ? 179 ASN A CB    1 
ATOM   2394 C  CG    . ASN A 1 159 ? 33.349 9.722   20.138 1.00 18.31 ? 179 ASN A CG    1 
ATOM   2395 O  OD1   . ASN A 1 159 ? 33.556 10.541  19.252 1.00 17.49 ? 179 ASN A OD1   1 
ATOM   2396 N  ND2   . ASN A 1 159 ? 32.230 9.730   20.817 1.00 17.26 ? 179 ASN A ND2   1 
ATOM   2397 H  H     . ASN A 1 159 ? 32.872 6.858   19.118 1.00 13.06 ? 179 ASN A H     1 
ATOM   2398 H  HA    . ASN A 1 159 ? 35.203 8.625   18.460 1.00 14.20 ? 179 ASN A HA    1 
ATOM   2399 H  HB2   . ASN A 1 159 ? 34.039 7.980   21.209 1.00 16.80 ? 179 ASN A HB2   1 
ATOM   2400 H  HB3   . ASN A 1 159 ? 35.282 9.167   20.843 1.00 16.88 ? 179 ASN A HB3   1 
ATOM   2401 H  HD21  . ASN A 1 159 ? 31.555 10.411  20.620 1.00 17.88 ? 179 ASN A HD21  1 
ATOM   2402 H  HD22  . ASN A 1 159 ? 32.060 9.066   21.520 1.00 17.12 ? 179 ASN A HD22  1 
ATOM   2403 N  N     . MET A 1 160 ? 35.752 5.779   18.864 1.00 14.25 ? 180 MET A N     1 
ATOM   2404 C  CA    . MET A 1 160 ? 36.737 4.685   19.084 1.00 14.79 ? 180 MET A CA    1 
ATOM   2405 C  C     . MET A 1 160 ? 37.163 4.055   17.778 1.00 15.95 ? 180 MET A C     1 
ATOM   2406 O  O     . MET A 1 160 ? 36.427 4.125   16.805 1.00 16.53 ? 180 MET A O     1 
ATOM   2407 C  CB    . MET A 1 160 ? 36.155 3.524   19.883 1.00 13.76 ? 180 MET A CB    1 
ATOM   2408 C  CG    . MET A 1 160 ? 35.526 3.926   21.195 1.00 14.54 ? 180 MET A CG    1 
ATOM   2409 S  SD    . MET A 1 160 ? 34.641 2.558   21.966 1.00 14.65 ? 180 MET A SD    1 
ATOM   2410 C  CE    . MET A 1 160 ? 33.753 3.450   23.272 1.00 12.85 ? 180 MET A CE    1 
ATOM   2411 H  H     . MET A 1 160 ? 35.017 5.626   18.230 1.00 15.42 ? 180 MET A H     1 
ATOM   2412 H  HA    . MET A 1 160 ? 37.603 5.093   19.576 1.00 14.96 ? 180 MET A HA    1 
ATOM   2413 H  HB2   . MET A 1 160 ? 35.395 3.052   19.278 1.00 14.88 ? 180 MET A HB2   1 
ATOM   2414 H  HB3   . MET A 1 160 ? 36.925 2.787   20.049 1.00 14.16 ? 180 MET A HB3   1 
ATOM   2415 H  HG2   . MET A 1 160 ? 36.288 4.283   21.871 1.00 14.87 ? 180 MET A HG2   1 
ATOM   2416 H  HG3   . MET A 1 160 ? 34.817 4.725   21.026 1.00 15.31 ? 180 MET A HG3   1 
ATOM   2417 H  HE1   . MET A 1 160 ? 33.529 4.451   22.933 1.00 13.26 ? 180 MET A HE1   1 
ATOM   2418 H  HE2   . MET A 1 160 ? 34.314 3.469   24.193 1.00 12.95 ? 180 MET A HE2   1 
ATOM   2419 H  HE3   . MET A 1 160 ? 32.802 2.967   23.442 1.00 13.27 ? 180 MET A HE3   1 
ATOM   2420 N  N     . PHE A 1 161 ? 38.331 3.481   17.800 1.00 15.53 ? 181 PHE A N     1 
ATOM   2421 C  CA    . PHE A 1 161 ? 38.841 2.785   16.590 1.00 14.18 ? 181 PHE A CA    1 
ATOM   2422 C  C     . PHE A 1 161 ? 39.673 1.622   17.125 1.00 13.98 ? 181 PHE A C     1 
ATOM   2423 O  O     . PHE A 1 161 ? 40.117 1.652   18.263 1.00 13.89 ? 181 PHE A O     1 
ATOM   2424 C  CB    . PHE A 1 161 ? 39.743 3.676   15.658 1.00 14.01 ? 181 PHE A CB    1 
ATOM   2425 C  CG    . PHE A 1 161 ? 41.115 4.159   16.164 1.00 12.61 ? 181 PHE A CG    1 
ATOM   2426 C  CD1   . PHE A 1 161 ? 41.246 5.399   16.770 1.00 14.64 ? 181 PHE A CD1   1 
ATOM   2427 C  CD2   . PHE A 1 161 ? 42.245 3.382   16.001 1.00 9.64  ? 181 PHE A CD2   1 
ATOM   2428 C  CE1   . PHE A 1 161 ? 42.472 5.844   17.192 1.00 14.15 ? 181 PHE A CE1   1 
ATOM   2429 C  CE2   . PHE A 1 161 ? 43.464 3.842   16.432 1.00 13.23 ? 181 PHE A CE2   1 
ATOM   2430 C  CZ    . PHE A 1 161 ? 43.579 5.068   17.024 1.00 12.71 ? 181 PHE A CZ    1 
ATOM   2431 H  H     . PHE A 1 161 ? 38.895 3.493   18.609 1.00 16.11 ? 181 PHE A H     1 
ATOM   2432 H  HA    . PHE A 1 161 ? 38.001 2.377   16.041 1.00 14.39 ? 181 PHE A HA    1 
ATOM   2433 H  HB2   . PHE A 1 161 ? 39.920 3.109   14.757 1.00 14.11 ? 181 PHE A HB2   1 
ATOM   2434 H  HB3   . PHE A 1 161 ? 39.161 4.537   15.377 1.00 14.72 ? 181 PHE A HB3   1 
ATOM   2435 H  HD1   . PHE A 1 161 ? 40.380 6.026   16.918 1.00 15.09 ? 181 PHE A HD1   1 
ATOM   2436 H  HD2   . PHE A 1 161 ? 42.181 2.408   15.537 1.00 11.50 ? 181 PHE A HD2   1 
ATOM   2437 H  HE1   . PHE A 1 161 ? 42.557 6.815   17.659 1.00 15.02 ? 181 PHE A HE1   1 
ATOM   2438 H  HE2   . PHE A 1 161 ? 44.343 3.229   16.306 1.00 12.45 ? 181 PHE A HE2   1 
ATOM   2439 H  HZ    . PHE A 1 161 ? 44.546 5.421   17.354 1.00 12.57 ? 181 PHE A HZ    1 
ATOM   2440 N  N     . CYS A 1 162 ? 39.871 0.636   16.298 1.00 11.82 ? 182 CYS A N     1 
ATOM   2441 C  CA    . CYS A 1 162 ? 40.657 -0.553  16.691 1.00 12.15 ? 182 CYS A CA    1 
ATOM   2442 C  C     . CYS A 1 162 ? 41.950 -0.478  15.949 1.00 11.73 ? 182 CYS A C     1 
ATOM   2443 O  O     . CYS A 1 162 ? 41.973 0.039   14.847 1.00 10.17 ? 182 CYS A O     1 
ATOM   2444 C  CB    . CYS A 1 162 ? 39.952 -1.842  16.275 1.00 11.21 ? 182 CYS A CB    1 
ATOM   2445 S  SG    . CYS A 1 162 ? 38.468 -2.332  17.176 1.00 15.77 ? 182 CYS A SG    1 
ATOM   2446 H  H     . CYS A 1 162 ? 39.508 0.680   15.398 1.00 9.93  ? 182 CYS A H     1 
ATOM   2447 H  HA    . CYS A 1 162 ? 40.837 -0.538  17.758 1.00 12.17 ? 182 CYS A HA    1 
ATOM   2448 H  HB2   . CYS A 1 162 ? 39.718 -1.793  15.223 1.00 12.93 ? 182 CYS A HB2   1 
ATOM   2449 H  HB3   . CYS A 1 162 ? 40.656 -2.651  16.404 1.00 13.87 ? 182 CYS A HB3   1 
ATOM   2450 N  N     . ALA A 1 163 ? 42.970 -0.987  16.574 1.00 13.38 ? 183 ALA A N     1 
ATOM   2451 C  CA    . ALA A 1 163 ? 44.330 -1.007  15.967 1.00 14.63 ? 183 ALA A CA    1 
ATOM   2452 C  C     . ALA A 1 163 ? 44.982 -2.278  16.496 1.00 13.35 ? 183 ALA A C     1 
ATOM   2453 O  O     . ALA A 1 163 ? 44.775 -2.664  17.638 1.00 14.19 ? 183 ALA A O     1 
ATOM   2454 C  CB    . ALA A 1 163 ? 45.163 0.213   16.384 1.00 13.50 ? 183 ALA A CB    1 
ATOM   2455 H  H     . ALA A 1 163 ? 42.841 -1.378  17.473 1.00 13.11 ? 183 ALA A H     1 
ATOM   2456 H  HA    . ALA A 1 163 ? 44.233 -1.059  14.891 1.00 14.08 ? 183 ALA A HA    1 
ATOM   2457 H  HB1   . ALA A 1 163 ? 45.317 0.223   17.454 1.00 14.60 ? 183 ALA A HB1   1 
ATOM   2458 H  HB2   . ALA A 1 163 ? 44.665 1.123   16.084 1.00 13.32 ? 183 ALA A HB2   1 
ATOM   2459 H  HB3   . ALA A 1 163 ? 46.132 0.172   15.899 1.00 13.45 ? 183 ALA A HB3   1 
ATOM   2460 N  N     . GLY A 1 164 ? 45.772 -2.913  15.694 1.00 12.27 ? 184 GLY A N     1 
ATOM   2461 C  CA    . GLY A 1 164 ? 46.391 -4.146  16.207 1.00 15.48 ? 184 GLY A CA    1 
ATOM   2462 C  C     . GLY A 1 164 ? 46.461 -5.261  15.174 1.00 12.60 ? 184 GLY A C     1 
ATOM   2463 O  O     . GLY A 1 164 ? 46.454 -5.032  13.968 1.00 12.99 ? 184 GLY A O     1 
ATOM   2464 H  H     . GLY A 1 164 ? 45.954 -2.593  14.780 1.00 13.73 ? 184 GLY A H     1 
ATOM   2465 H  HA2   . GLY A 1 164 ? 47.386 -3.918  16.560 1.00 14.04 ? 184 GLY A HA2   1 
ATOM   2466 H  HA3   . GLY A 1 164 ? 45.817 -4.510  17.050 1.00 15.35 ? 184 GLY A HA3   1 
ATOM   2467 N  N     . TYR A 1 165 A 46.520 -6.438  15.732 1.00 16.15 ? 184 TYR A N     1 
ATOM   2468 C  CA    . TYR A 1 165 A 46.626 -7.723  14.981 1.00 17.31 ? 184 TYR A CA    1 
ATOM   2469 C  C     . TYR A 1 165 A 45.576 -8.737  15.402 1.00 17.26 ? 184 TYR A C     1 
ATOM   2470 O  O     . TYR A 1 165 A 45.596 -9.174  16.544 1.00 17.47 ? 184 TYR A O     1 
ATOM   2471 C  CB    . TYR A 1 165 A 48.018 -8.253  15.256 1.00 17.76 ? 184 TYR A CB    1 
ATOM   2472 C  CG    . TYR A 1 165 A 49.092 -7.238  14.834 1.00 15.95 ? 184 TYR A CG    1 
ATOM   2473 C  CD1   . TYR A 1 165 A 49.621 -7.288  13.562 1.00 19.13 ? 184 TYR A CD1   1 
ATOM   2474 C  CD2   . TYR A 1 165 A 49.553 -6.272  15.717 1.00 16.94 ? 184 TYR A CD2   1 
ATOM   2475 C  CE1   . TYR A 1 165 A 50.581 -6.408  13.177 1.00 19.13 ? 184 TYR A CE1   1 
ATOM   2476 C  CE2   . TYR A 1 165 A 50.533 -5.378  15.320 1.00 17.46 ? 184 TYR A CE2   1 
ATOM   2477 C  CZ    . TYR A 1 165 A 51.037 -5.460  14.046 1.00 16.59 ? 184 TYR A CZ    1 
ATOM   2478 O  OH    . TYR A 1 165 A 51.997 -4.607  13.586 1.00 18.84 ? 184 TYR A OH    1 
ATOM   2479 H  H     . TYR A 1 165 A 46.482 -6.492  16.713 1.00 15.50 ? 184 TYR A H     1 
ATOM   2480 H  HA    . TYR A 1 165 A 46.512 -7.515  13.926 1.00 16.84 ? 184 TYR A HA    1 
ATOM   2481 H  HB2   . TYR A 1 165 A 48.122 -8.460  16.311 1.00 17.27 ? 184 TYR A HB2   1 
ATOM   2482 H  HB3   . TYR A 1 165 A 48.179 -9.177  14.720 1.00 17.95 ? 184 TYR A HB3   1 
ATOM   2483 H  HD1   . TYR A 1 165 A 49.280 -8.027  12.849 1.00 19.12 ? 184 TYR A HD1   1 
ATOM   2484 H  HD2   . TYR A 1 165 A 49.143 -6.212  16.717 1.00 16.09 ? 184 TYR A HD2   1 
ATOM   2485 H  HE1   . TYR A 1 165 A 50.987 -6.458  12.178 1.00 18.25 ? 184 TYR A HE1   1 
ATOM   2486 H  HE2   . TYR A 1 165 A 50.889 -4.631  16.017 1.00 17.34 ? 184 TYR A HE2   1 
ATOM   2487 H  HH    . TYR A 1 165 A 52.195 -3.993  14.308 1.00 19.51 ? 184 TYR A HH    1 
ATOM   2488 N  N     . LEU A 1 166 ? 44.721 -9.096  14.474 1.00 16.58 ? 185 LEU A N     1 
ATOM   2489 C  CA    . LEU A 1 166 ? 43.641 -10.075 14.752 1.00 18.94 ? 185 LEU A CA    1 
ATOM   2490 C  C     . LEU A 1 166 ? 44.193 -11.480 15.023 1.00 19.90 ? 185 LEU A C     1 
ATOM   2491 O  O     . LEU A 1 166 ? 43.518 -12.285 15.633 1.00 20.68 ? 185 LEU A O     1 
ATOM   2492 C  CB    . LEU A 1 166 ? 42.686 -10.138 13.558 1.00 20.96 ? 185 LEU A CB    1 
ATOM   2493 C  CG    . LEU A 1 166 ? 41.998 -8.791  13.297 1.00 20.90 ? 185 LEU A CG    1 
ATOM   2494 C  CD1   . LEU A 1 166 ? 41.100 -8.955  12.078 1.00 23.61 ? 185 LEU A CD1   1 
ATOM   2495 C  CD2   . LEU A 1 166 ? 41.119 -8.343  14.488 1.00 21.59 ? 185 LEU A CD2   1 
ATOM   2496 H  H     . LEU A 1 166 ? 44.791 -8.710  13.573 1.00 16.28 ? 185 LEU A H     1 
ATOM   2497 H  HA    . LEU A 1 166 ? 43.114 -9.751  15.639 1.00 18.33 ? 185 LEU A HA    1 
ATOM   2498 H  HB2   . LEU A 1 166 ? 43.268 -10.406 12.687 1.00 21.15 ? 185 LEU A HB2   1 
ATOM   2499 H  HB3   . LEU A 1 166 ? 41.962 -10.927 13.719 1.00 20.68 ? 185 LEU A HB3   1 
ATOM   2500 H  HG    . LEU A 1 166 ? 42.749 -8.044  13.071 1.00 22.07 ? 185 LEU A HG    1 
ATOM   2501 H  HD11  . LEU A 1 166 ? 40.348 -9.717  12.225 1.00 23.58 ? 185 LEU A HD11  1 
ATOM   2502 H  HD12  . LEU A 1 166 ? 41.689 -9.238  11.214 1.00 23.44 ? 185 LEU A HD12  1 
ATOM   2503 H  HD13  . LEU A 1 166 ? 40.598 -8.029  11.836 1.00 23.67 ? 185 LEU A HD13  1 
ATOM   2504 H  HD21  . LEU A 1 166 ? 41.717 -8.175  15.373 1.00 22.06 ? 185 LEU A HD21  1 
ATOM   2505 H  HD22  . LEU A 1 166 ? 40.371 -9.089  14.696 1.00 21.98 ? 185 LEU A HD22  1 
ATOM   2506 H  HD23  . LEU A 1 166 ? 40.627 -7.413  14.238 1.00 22.01 ? 185 LEU A HD23  1 
ATOM   2507 N  N     . GLU A 1 167 ? 45.388 -11.731 14.570 1.00 24.28 ? 186 GLU A N     1 
ATOM   2508 C  CA    . GLU A 1 167 ? 45.980 -13.076 14.809 1.00 27.26 ? 186 GLU A CA    1 
ATOM   2509 C  C     . GLU A 1 167 ? 46.430 -13.178 16.252 1.00 28.50 ? 186 GLU A C     1 
ATOM   2510 O  O     . GLU A 1 167 ? 46.762 -14.263 16.680 1.00 29.97 ? 186 GLU A O     1 
ATOM   2511 C  CB    . GLU A 1 167 ? 47.210 -13.358 13.914 0.74 27.77 ? 186 GLU A CB    1 
ATOM   2512 C  CG    . GLU A 1 167 ? 48.392 -12.340 14.037 0.74 31.90 ? 186 GLU A CG    1 
ATOM   2513 C  CD    . GLU A 1 167 ? 48.376 -11.294 12.888 0.74 34.35 ? 186 GLU A CD    1 
ATOM   2514 O  OE1   . GLU A 1 167 ? 49.451 -11.055 12.359 0.74 36.22 ? 186 GLU A OE1   1 
ATOM   2515 O  OE2   . GLU A 1 167 ? 47.307 -10.788 12.598 0.74 33.47 ? 186 GLU A OE2   1 
ATOM   2516 H  H     . GLU A 1 167 ? 45.865 -11.033 14.080 1.00 23.80 ? 186 GLU A H     1 
ATOM   2517 H  HA    . GLU A 1 167 ? 45.220 -13.827 14.639 1.00 27.17 ? 186 GLU A HA    1 
ATOM   2518 H  HB2   . GLU A 1 167 ? 47.584 -14.323 14.228 0.74 28.40 ? 186 GLU A HB2   1 
ATOM   2519 H  HB3   . GLU A 1 167 ? 46.891 -13.450 12.887 0.74 28.17 ? 186 GLU A HB3   1 
ATOM   2520 H  HG2   . GLU A 1 167 ? 48.372 -11.819 14.985 0.74 31.67 ? 186 GLU A HG2   1 
ATOM   2521 H  HG3   . GLU A 1 167 ? 49.326 -12.884 13.993 0.74 31.55 ? 186 GLU A HG3   1 
ATOM   2522 N  N     . GLY A 1 168 ? 46.452 -12.070 16.958 1.00 27.61 ? 187 GLY A N     1 
ATOM   2523 C  CA    . GLY A 1 168 ? 46.880 -12.113 18.396 1.00 25.21 ? 187 GLY A CA    1 
ATOM   2524 C  C     . GLY A 1 168 ? 48.396 -11.940 18.505 1.00 24.98 ? 187 GLY A C     1 
ATOM   2525 O  O     . GLY A 1 168 ? 49.058 -11.808 17.488 1.00 25.43 ? 187 GLY A O     1 
ATOM   2526 H  H     . GLY A 1 168 ? 46.200 -11.215 16.557 1.00 26.97 ? 187 GLY A H     1 
ATOM   2527 H  HA2   . GLY A 1 168 ? 46.386 -11.322 18.940 1.00 26.87 ? 187 GLY A HA2   1 
ATOM   2528 H  HA3   . GLY A 1 168 ? 46.604 -13.071 18.815 1.00 25.07 ? 187 GLY A HA3   1 
ATOM   2529 N  N     . GLY A 1 169 ? 48.924 -11.914 19.708 1.00 24.71 ? 188 GLY A N     1 
ATOM   2530 C  CA    . GLY A 1 169 ? 50.415 -11.763 19.834 1.00 22.25 ? 188 GLY A CA    1 
ATOM   2531 C  C     . GLY A 1 169 ? 51.008 -10.397 20.062 1.00 20.84 ? 188 GLY A C     1 
ATOM   2532 O  O     . GLY A 1 169 ? 52.046 -10.299 20.690 1.00 20.45 ? 188 GLY A O     1 
ATOM   2533 H  H     . GLY A 1 169 ? 48.361 -11.996 20.514 1.00 23.88 ? 188 GLY A H     1 
ATOM   2534 H  HA2   . GLY A 1 169 ? 50.735 -12.388 20.656 1.00 21.44 ? 188 GLY A HA2   1 
ATOM   2535 H  HA3   . GLY A 1 169 ? 50.874 -12.154 18.936 1.00 21.56 ? 188 GLY A HA3   1 
ATOM   2536 N  N     . LYS A 1 170 A 50.382 -9.377  19.547 1.00 20.23 ? 188 LYS A N     1 
ATOM   2537 C  CA    . LYS A 1 170 A 50.920 -7.997  19.735 1.00 18.55 ? 188 LYS A CA    1 
ATOM   2538 C  C     . LYS A 1 170 A 49.748 -7.090  20.129 1.00 19.00 ? 188 LYS A C     1 
ATOM   2539 O  O     . LYS A 1 170 A 48.750 -7.079  19.425 1.00 15.77 ? 188 LYS A O     1 
ATOM   2540 C  CB    . LYS A 1 170 A 51.537 -7.527  18.442 1.00 17.46 ? 188 LYS A CB    1 
ATOM   2541 C  CG    . LYS A 1 170 A 52.595 -8.522  17.924 1.00 18.44 ? 188 LYS A CG    1 
ATOM   2542 C  CD    . LYS A 1 170 A 53.291 -7.844  16.725 1.00 20.19 ? 188 LYS A CD    1 
ATOM   2543 C  CE    . LYS A 1 170 A 54.086 -8.850  15.864 0.70 20.42 ? 188 LYS A CE    1 
ATOM   2544 N  NZ    . LYS A 1 170 A 53.148 -9.757  15.137 0.02 20.02 ? 188 LYS A NZ    1 
ATOM   2545 H  H     . LYS A 1 170 A 49.557 -9.508  19.036 1.00 19.77 ? 188 LYS A H     1 
ATOM   2546 H  HA    . LYS A 1 170 A 51.665 -8.015  20.510 1.00 19.30 ? 188 LYS A HA    1 
ATOM   2547 H  HB2   . LYS A 1 170 A 50.753 -7.402  17.715 1.00 18.34 ? 188 LYS A HB2   1 
ATOM   2548 H  HB3   . LYS A 1 170 A 51.992 -6.571  18.638 1.00 18.58 ? 188 LYS A HB3   1 
ATOM   2549 H  HG2   . LYS A 1 170 A 53.311 -8.754  18.700 1.00 18.33 ? 188 LYS A HG2   1 
ATOM   2550 H  HG3   . LYS A 1 170 A 52.119 -9.445  17.622 1.00 18.57 ? 188 LYS A HG3   1 
ATOM   2551 H  HD2   . LYS A 1 170 A 52.562 -7.358  16.094 1.00 19.73 ? 188 LYS A HD2   1 
ATOM   2552 H  HD3   . LYS A 1 170 A 53.983 -7.105  17.105 1.00 20.13 ? 188 LYS A HD3   1 
ATOM   2553 H  HE2   . LYS A 1 170 A 54.696 -8.331  15.139 0.70 20.10 ? 188 LYS A HE2   1 
ATOM   2554 H  HE3   . LYS A 1 170 A 54.732 -9.460  16.475 0.70 20.29 ? 188 LYS A HE3   1 
ATOM   2555 H  HZ1   . LYS A 1 170 A 52.166 -9.500  15.366 0.02 19.97 ? 188 LYS A HZ1   1 
ATOM   2556 H  HZ2   . LYS A 1 170 A 53.324 -10.742 15.421 0.02 19.97 ? 188 LYS A HZ2   1 
ATOM   2557 H  HZ3   . LYS A 1 170 A 53.300 -9.660  14.113 0.02 19.97 ? 188 LYS A HZ3   1 
ATOM   2558 N  N     . ASP A 1 171 ? 49.862 -6.364  21.206 1.00 18.30 ? 189 ASP A N     1 
ATOM   2559 C  CA    . ASP A 1 171 ? 48.749 -5.455  21.654 1.00 16.43 ? 189 ASP A CA    1 
ATOM   2560 C  C     . ASP A 1 171 ? 49.267 -4.559  22.796 1.00 17.12 ? 189 ASP A C     1 
ATOM   2561 O  O     . ASP A 1 171 ? 50.380 -4.730  23.280 1.00 15.25 ? 189 ASP A O     1 
ATOM   2562 C  CB    . ASP A 1 171 ? 47.630 -6.307  22.196 1.00 15.76 ? 189 ASP A CB    1 
ATOM   2563 C  CG    . ASP A 1 171 ? 46.279 -5.651  22.440 1.00 17.12 ? 189 ASP A CG    1 
ATOM   2564 O  OD1   . ASP A 1 171 ? 45.510 -6.298  23.134 1.00 15.99 ? 189 ASP A OD1   1 
ATOM   2565 O  OD2   . ASP A 1 171 ? 46.062 -4.567  21.945 1.00 12.19 ? 189 ASP A OD2   1 
ATOM   2566 H  H     . ASP A 1 171 ? 50.694 -6.404  21.733 1.00 18.21 ? 189 ASP A H     1 
ATOM   2567 H  HA    . ASP A 1 171 ? 48.420 -4.851  20.817 1.00 16.42 ? 189 ASP A HA    1 
ATOM   2568 H  HB2   . ASP A 1 171 ? 47.464 -7.110  21.497 1.00 17.12 ? 189 ASP A HB2   1 
ATOM   2569 H  HB3   . ASP A 1 171 ? 47.965 -6.731  23.134 1.00 15.17 ? 189 ASP A HB3   1 
ATOM   2570 N  N     . SER A 1 172 ? 48.447 -3.623  23.199 1.00 15.07 ? 190 SER A N     1 
ATOM   2571 C  CA    . SER A 1 172 ? 48.831 -2.741  24.306 1.00 15.81 ? 190 SER A CA    1 
ATOM   2572 C  C     . SER A 1 172 ? 48.147 -3.565  25.446 1.00 12.55 ? 190 SER A C     1 
ATOM   2573 O  O     . SER A 1 172 ? 47.404 -4.512  25.191 1.00 9.88  ? 190 SER A O     1 
ATOM   2574 C  CB    . SER A 1 172 ? 48.236 -1.279  24.063 1.00 14.30 ? 190 SER A CB    1 
ATOM   2575 O  OG    . SER A 1 172 ? 46.870 -1.409  23.688 1.00 15.61 ? 190 SER A OG    1 
ATOM   2576 H  H     . SER A 1 172 ? 47.579 -3.488  22.773 1.00 17.22 ? 190 SER A H     1 
ATOM   2577 H  HA    . SER A 1 172 ? 49.900 -2.751  24.429 1.00 16.91 ? 190 SER A HA    1 
ATOM   2578 H  HB2   . SER A 1 172 ? 48.298 -0.702  24.974 1.00 15.05 ? 190 SER A HB2   1 
ATOM   2579 H  HB3   . SER A 1 172 ? 48.784 -0.767  23.283 1.00 14.63 ? 190 SER A HB3   1 
ATOM   2580 H  HG    . SER A 1 172 ? 46.386 -0.712  24.157 1.00 16.19 ? 190 SER A HG    1 
ATOM   2581 N  N     . CYS A 1 173 ? 48.381 -3.220  26.674 1.00 17.43 ? 191 CYS A N     1 
ATOM   2582 C  CA    . CYS A 1 173 ? 47.778 -3.971  27.788 1.00 16.25 ? 191 CYS A CA    1 
ATOM   2583 C  C     . CYS A 1 173 ? 47.705 -3.047  29.001 1.00 14.57 ? 191 CYS A C     1 
ATOM   2584 O  O     . CYS A 1 173 ? 48.045 -1.876  28.884 1.00 11.93 ? 191 CYS A O     1 
ATOM   2585 C  CB    . CYS A 1 173 ? 48.678 -5.222  28.021 1.00 18.67 ? 191 CYS A CB    1 
ATOM   2586 S  SG    . CYS A 1 173 ? 48.002 -6.543  29.044 1.00 17.86 ? 191 CYS A SG    1 
ATOM   2587 H  H     . CYS A 1 173 ? 48.933 -2.463  26.917 1.00 16.56 ? 191 CYS A H     1 
ATOM   2588 H  HA    . CYS A 1 173 ? 46.779 -4.275  27.515 1.00 17.12 ? 191 CYS A HA    1 
ATOM   2589 H  HB2   . CYS A 1 173 ? 48.900 -5.664  27.063 1.00 18.14 ? 191 CYS A HB2   1 
ATOM   2590 H  HB3   . CYS A 1 173 ? 49.611 -4.924  28.475 1.00 18.10 ? 191 CYS A HB3   1 
ATOM   2591 N  N     . GLN A 1 174 ? 47.287 -3.578  30.111 1.00 15.99 ? 192 GLN A N     1 
ATOM   2592 C  CA    . GLN A 1 174 ? 47.164 -2.775  31.370 1.00 17.15 ? 192 GLN A CA    1 
ATOM   2593 C  C     . GLN A 1 174 ? 48.496 -2.151  31.713 1.00 15.55 ? 192 GLN A C     1 
ATOM   2594 O  O     . GLN A 1 174 ? 49.524 -2.802  31.701 1.00 17.02 ? 192 GLN A O     1 
ATOM   2595 C  CB    . GLN A 1 174 ? 46.620 -3.715  32.475 1.00 18.39 ? 192 GLN A CB    1 
ATOM   2596 C  CG    . GLN A 1 174 ? 47.413 -3.867  33.771 0.50 19.89 ? 192 GLN A CG    1 
ATOM   2597 C  CD    . GLN A 1 174 ? 46.427 -4.505  34.740 0.50 19.76 ? 192 GLN A CD    1 
ATOM   2598 O  OE1   . GLN A 1 174 ? 46.044 -3.936  35.746 0.50 22.09 ? 192 GLN A OE1   1 
ATOM   2599 N  NE2   . GLN A 1 174 ? 45.976 -5.692  34.464 0.50 19.69 ? 192 GLN A NE2   1 
ATOM   2600 H  H     . GLN A 1 174 ? 47.056 -4.533  30.096 1.00 16.15 ? 192 GLN A H     1 
ATOM   2601 H  HA    . GLN A 1 174 ? 46.436 -1.999  31.189 1.00 17.08 ? 192 GLN A HA    1 
ATOM   2602 H  HB2   . GLN A 1 174 ? 45.692 -3.257  32.781 1.00 19.11 ? 192 GLN A HB2   1 
ATOM   2603 H  HB3   . GLN A 1 174 ? 46.385 -4.684  32.065 1.00 18.39 ? 192 GLN A HB3   1 
ATOM   2604 H  HG2   . GLN A 1 174 ? 48.258 -4.530  33.638 0.50 19.53 ? 192 GLN A HG2   1 
ATOM   2605 H  HG3   . GLN A 1 174 ? 47.752 -2.929  34.182 0.50 19.28 ? 192 GLN A HG3   1 
ATOM   2606 H  HE21  . GLN A 1 174 ? 45.337 -6.114  35.071 0.50 20.37 ? 192 GLN A HE21  1 
ATOM   2607 H  HE22  . GLN A 1 174 ? 46.272 -6.163  33.658 0.50 19.89 ? 192 GLN A HE22  1 
ATOM   2608 N  N     . GLY A 1 175 ? 48.422 -0.883  32.014 1.00 16.48 ? 193 GLY A N     1 
ATOM   2609 C  CA    . GLY A 1 175 ? 49.633 -0.098  32.360 1.00 15.24 ? 193 GLY A CA    1 
ATOM   2610 C  C     . GLY A 1 175 ? 49.895 0.830   31.179 1.00 14.01 ? 193 GLY A C     1 
ATOM   2611 O  O     . GLY A 1 175 ? 50.559 1.839   31.301 1.00 14.81 ? 193 GLY A O     1 
ATOM   2612 H  H     . GLY A 1 175 ? 47.541 -0.453  32.027 1.00 14.46 ? 193 GLY A H     1 
ATOM   2613 H  HA2   . GLY A 1 175 ? 49.449 0.490   33.244 1.00 15.23 ? 193 GLY A HA2   1 
ATOM   2614 H  HA3   . GLY A 1 175 ? 50.476 -0.748  32.533 1.00 14.62 ? 193 GLY A HA3   1 
ATOM   2615 N  N     . ASP A 1 176 ? 49.366 0.477   30.027 1.00 14.78 ? 194 ASP A N     1 
ATOM   2616 C  CA    . ASP A 1 176 ? 49.560 1.320   28.805 1.00 12.91 ? 194 ASP A CA    1 
ATOM   2617 C  C     . ASP A 1 176 ? 48.408 2.314   28.641 1.00 13.19 ? 194 ASP A C     1 
ATOM   2618 O  O     . ASP A 1 176 ? 48.585 3.278   27.923 1.00 11.94 ? 194 ASP A O     1 
ATOM   2619 C  CB    . ASP A 1 176 ? 49.629 0.468   27.485 1.00 13.43 ? 194 ASP A CB    1 
ATOM   2620 C  CG    . ASP A 1 176 ? 50.847 -0.499  27.413 1.00 15.19 ? 194 ASP A CG    1 
ATOM   2621 O  OD1   . ASP A 1 176 ? 51.900 -0.057  27.827 1.00 11.82 ? 194 ASP A OD1   1 
ATOM   2622 O  OD2   . ASP A 1 176 ? 50.700 -1.626  26.949 1.00 13.33 ? 194 ASP A OD2   1 
ATOM   2623 H  H     . ASP A 1 176 ? 48.843 -0.355  29.976 1.00 16.03 ? 194 ASP A H     1 
ATOM   2624 H  HA    . ASP A 1 176 ? 50.472 1.890   28.913 1.00 14.94 ? 194 ASP A HA    1 
ATOM   2625 H  HB2   . ASP A 1 176 ? 48.711 -0.093  27.380 1.00 13.87 ? 194 ASP A HB2   1 
ATOM   2626 H  HB3   . ASP A 1 176 ? 49.700 1.159   26.658 1.00 13.59 ? 194 ASP A HB3   1 
ATOM   2627 N  N     . SER A 1 177 ? 47.279 2.072   29.280 1.00 10.71 ? 195 SER A N     1 
ATOM   2628 C  CA    . SER A 1 177 ? 46.089 2.983   29.196 1.00 12.39 ? 195 SER A CA    1 
ATOM   2629 C  C     . SER A 1 177 ? 46.512 4.449   29.342 1.00 9.63  ? 195 SER A C     1 
ATOM   2630 O  O     . SER A 1 177 ? 47.371 4.733   30.158 1.00 8.47  ? 195 SER A O     1 
ATOM   2631 C  CB    . SER A 1 177 ? 45.089 2.735   30.335 1.00 14.27 ? 195 SER A CB    1 
ATOM   2632 O  OG    . SER A 1 177 ? 44.476 1.459   30.140 1.00 19.04 ? 195 SER A OG    1 
ATOM   2633 H  H     . SER A 1 177 ? 47.216 1.272   29.834 1.00 11.64 ? 195 SER A H     1 
ATOM   2634 H  HA    . SER A 1 177 ? 45.630 2.864   28.224 1.00 11.08 ? 195 SER A HA    1 
ATOM   2635 H  HB2   . SER A 1 177 ? 45.598 2.794   31.290 1.00 14.53 ? 195 SER A HB2   1 
ATOM   2636 H  HB3   . SER A 1 177 ? 44.343 3.519   30.303 1.00 15.03 ? 195 SER A HB3   1 
ATOM   2637 H  HG    . SER A 1 177 ? 44.191 1.140   31.010 1.00 18.25 ? 195 SER A HG    1 
ATOM   2638 N  N     . GLY A 1 178 ? 45.909 5.290   28.551 1.00 7.23  ? 196 GLY A N     1 
ATOM   2639 C  CA    . GLY A 1 178 ? 46.228 6.751   28.608 1.00 6.57  ? 196 GLY A CA    1 
ATOM   2640 C  C     . GLY A 1 178 ? 47.320 7.139   27.660 1.00 5.54  ? 196 GLY A C     1 
ATOM   2641 O  O     . GLY A 1 178 ? 47.444 8.305   27.320 1.00 5.73  ? 196 GLY A O     1 
ATOM   2642 H  H     . GLY A 1 178 ? 45.237 4.980   27.905 1.00 6.96  ? 196 GLY A H     1 
ATOM   2643 H  HA2   . GLY A 1 178 ? 45.344 7.312   28.359 1.00 6.71  ? 196 GLY A HA2   1 
ATOM   2644 H  HA3   . GLY A 1 178 ? 46.530 7.008   29.615 1.00 7.69  ? 196 GLY A HA3   1 
ATOM   2645 N  N     . GLY A 1 179 ? 48.084 6.190   27.215 1.00 8.66  ? 197 GLY A N     1 
ATOM   2646 C  CA    . GLY A 1 179 ? 49.176 6.554   26.303 1.00 8.22  ? 197 GLY A CA    1 
ATOM   2647 C  C     . GLY A 1 179 ? 48.861 6.778   24.848 1.00 6.59  ? 197 GLY A C     1 
ATOM   2648 O  O     . GLY A 1 179 ? 47.742 6.653   24.385 1.00 2.13  ? 197 GLY A O     1 
ATOM   2649 H  H     . GLY A 1 179 ? 47.940 5.257   27.478 1.00 8.16  ? 197 GLY A H     1 
ATOM   2650 H  HA2   . GLY A 1 179 ? 49.616 7.465   26.685 1.00 7.52  ? 197 GLY A HA2   1 
ATOM   2651 H  HA3   . GLY A 1 179 ? 49.932 5.794   26.373 1.00 8.33  ? 197 GLY A HA3   1 
ATOM   2652 N  N     . PRO A 1 180 ? 49.900 7.126   24.150 1.00 8.97  ? 198 PRO A N     1 
ATOM   2653 C  CA    . PRO A 1 180 ? 49.811 7.528   22.724 1.00 7.46  ? 198 PRO A CA    1 
ATOM   2654 C  C     . PRO A 1 180 ? 49.807 6.482   21.594 1.00 6.86  ? 198 PRO A C     1 
ATOM   2655 O  O     . PRO A 1 180 ? 50.395 5.422   21.741 1.00 12.38 ? 198 PRO A O     1 
ATOM   2656 C  CB    . PRO A 1 180 ? 50.990 8.454   22.523 1.00 10.61 ? 198 PRO A CB    1 
ATOM   2657 C  CG    . PRO A 1 180 ? 52.091 7.814   23.436 1.00 8.95  ? 198 PRO A CG    1 
ATOM   2658 C  CD    . PRO A 1 180 ? 51.309 7.226   24.662 1.00 7.10  ? 198 PRO A CD    1 
ATOM   2659 H  HA    . PRO A 1 180 ? 48.904 8.115   22.623 1.00 8.83  ? 198 PRO A HA    1 
ATOM   2660 H  HB2   . PRO A 1 180 ? 51.304 8.464   21.493 1.00 9.99  ? 198 PRO A HB2   1 
ATOM   2661 H  HB3   . PRO A 1 180 ? 50.746 9.458   22.797 1.00 10.08 ? 198 PRO A HB3   1 
ATOM   2662 H  HG2   . PRO A 1 180 ? 52.662 7.045   22.942 1.00 8.73  ? 198 PRO A HG2   1 
ATOM   2663 H  HG3   . PRO A 1 180 ? 52.757 8.592   23.784 1.00 8.66  ? 198 PRO A HG3   1 
ATOM   2664 H  HD2   . PRO A 1 180 ? 51.672 6.245   24.928 1.00 7.74  ? 198 PRO A HD2   1 
ATOM   2665 H  HD3   . PRO A 1 180 ? 51.366 7.887   25.518 1.00 8.68  ? 198 PRO A HD3   1 
ATOM   2666 N  N     . VAL A 1 181 ? 49.131 6.875   20.553 1.00 8.02  ? 199 VAL A N     1 
ATOM   2667 C  CA    . VAL A 1 181 ? 49.002 6.096   19.315 1.00 11.30 ? 199 VAL A CA    1 
ATOM   2668 C  C     . VAL A 1 181 ? 49.353 7.262   18.373 1.00 11.33 ? 199 VAL A C     1 
ATOM   2669 O  O     . VAL A 1 181 ? 48.542 8.158   18.186 1.00 9.14  ? 199 VAL A O     1 
ATOM   2670 C  CB    . VAL A 1 181 ? 47.599 5.627   19.038 1.00 10.97 ? 199 VAL A CB    1 
ATOM   2671 C  CG1   . VAL A 1 181 ? 47.672 4.910   17.679 1.00 12.73 ? 199 VAL A CG1   1 
ATOM   2672 C  CG2   . VAL A 1 181 ? 47.194 4.673   20.166 1.00 15.34 ? 199 VAL A CG2   1 
ATOM   2673 H  H     . VAL A 1 181 ? 48.674 7.743   20.591 1.00 9.80  ? 199 VAL A H     1 
ATOM   2674 H  HA    . VAL A 1 181 ? 49.756 5.323   19.281 1.00 10.50 ? 199 VAL A HA    1 
ATOM   2675 H  HB    . VAL A 1 181 ? 46.929 6.472   18.988 1.00 13.40 ? 199 VAL A HB    1 
ATOM   2676 H  HG11  . VAL A 1 181 ? 48.359 4.075   17.703 1.00 11.78 ? 199 VAL A HG11  1 
ATOM   2677 H  HG12  . VAL A 1 181 ? 47.994 5.580   16.892 1.00 12.07 ? 199 VAL A HG12  1 
ATOM   2678 H  HG13  . VAL A 1 181 ? 46.696 4.539   17.403 1.00 13.33 ? 199 VAL A HG13  1 
ATOM   2679 H  HG21  . VAL A 1 181 ? 47.202 5.206   21.108 1.00 14.83 ? 199 VAL A HG21  1 
ATOM   2680 H  HG22  . VAL A 1 181 ? 47.884 3.849   20.254 1.00 14.59 ? 199 VAL A HG22  1 
ATOM   2681 H  HG23  . VAL A 1 181 ? 46.201 4.285   19.992 1.00 14.94 ? 199 VAL A HG23  1 
ATOM   2682 N  N     . VAL A 1 182 ? 50.536 7.226   17.827 1.00 9.97  ? 200 VAL A N     1 
ATOM   2683 C  CA    . VAL A 1 182 ? 51.002 8.285   16.911 1.00 13.79 ? 200 VAL A CA    1 
ATOM   2684 C  C     . VAL A 1 182 ? 51.131 7.749   15.505 1.00 13.77 ? 200 VAL A C     1 
ATOM   2685 O  O     . VAL A 1 182 ? 51.762 6.735   15.300 1.00 15.77 ? 200 VAL A O     1 
ATOM   2686 C  CB    . VAL A 1 182 ? 52.347 8.784   17.492 1.00 13.93 ? 200 VAL A CB    1 
ATOM   2687 C  CG1   . VAL A 1 182 ? 53.054 9.815   16.538 1.00 13.73 ? 200 VAL A CG1   1 
ATOM   2688 C  CG2   . VAL A 1 182 ? 52.016 9.514   18.817 1.00 15.01 ? 200 VAL A CG2   1 
ATOM   2689 H  H     . VAL A 1 182 ? 51.136 6.477   18.019 1.00 11.33 ? 200 VAL A H     1 
ATOM   2690 H  HA    . VAL A 1 182 ? 50.260 9.070   16.904 1.00 13.71 ? 200 VAL A HA    1 
ATOM   2691 H  HB    . VAL A 1 182 ? 53.009 7.950   17.669 1.00 13.67 ? 200 VAL A HB    1 
ATOM   2692 H  HG11  . VAL A 1 182 ? 52.446 10.698  16.386 1.00 13.54 ? 200 VAL A HG11  1 
ATOM   2693 H  HG12  . VAL A 1 182 ? 53.251 9.367   15.575 1.00 12.89 ? 200 VAL A HG12  1 
ATOM   2694 H  HG13  . VAL A 1 182 ? 54.000 10.116  16.962 1.00 13.47 ? 200 VAL A HG13  1 
ATOM   2695 H  HG21  . VAL A 1 182 ? 51.545 8.829   19.503 1.00 14.97 ? 200 VAL A HG21  1 
ATOM   2696 H  HG22  . VAL A 1 182 ? 51.352 10.349  18.654 1.00 14.61 ? 200 VAL A HG22  1 
ATOM   2697 H  HG23  . VAL A 1 182 ? 52.920 9.889   19.274 1.00 14.85 ? 200 VAL A HG23  1 
ATOM   2698 N  N     . CYS A 1 183 ? 50.549 8.452   14.585 1.00 17.18 ? 201 CYS A N     1 
ATOM   2699 C  CA    . CYS A 1 183 ? 50.612 8.009   13.179 1.00 19.75 ? 201 CYS A CA    1 
ATOM   2700 C  C     . CYS A 1 183 ? 51.042 9.212   12.370 1.00 20.57 ? 201 CYS A C     1 
ATOM   2701 O  O     . CYS A 1 183 ? 50.413 10.248  12.468 1.00 19.02 ? 201 CYS A O     1 
ATOM   2702 C  CB    . CYS A 1 183 ? 49.241 7.553   12.751 1.00 19.04 ? 201 CYS A CB    1 
ATOM   2703 S  SG    . CYS A 1 183 ? 48.245 6.704   13.999 1.00 15.02 ? 201 CYS A SG    1 
ATOM   2704 H  H     . CYS A 1 183 ? 50.068 9.280   14.802 1.00 17.80 ? 201 CYS A H     1 
ATOM   2705 H  HA    . CYS A 1 183 ? 51.334 7.214   13.084 1.00 19.31 ? 201 CYS A HA    1 
ATOM   2706 H  HB2   . CYS A 1 183 ? 48.667 8.409   12.431 1.00 19.23 ? 201 CYS A HB2   1 
ATOM   2707 H  HB3   . CYS A 1 183 ? 49.348 6.895   11.904 1.00 18.79 ? 201 CYS A HB3   1 
ATOM   2708 N  N     . SER A 1 184 ? 52.079 9.049   11.601 1.00 22.71 ? 202 SER A N     1 
ATOM   2709 C  CA    . SER A 1 184 ? 52.605 10.155  10.753 1.00 25.70 ? 202 SER A CA    1 
ATOM   2710 C  C     . SER A 1 184 ? 52.831 11.438  11.562 1.00 21.66 ? 202 SER A C     1 
ATOM   2711 O  O     . SER A 1 184 ? 52.501 12.533  11.155 1.00 24.09 ? 202 SER A O     1 
ATOM   2712 C  CB    . SER A 1 184 ? 51.610 10.438  9.621  1.00 28.18 ? 202 SER A CB    1 
ATOM   2713 O  OG    . SER A 1 184 ? 51.357 9.180   9.004  1.00 35.04 ? 202 SER A OG    1 
ATOM   2714 H  H     . SER A 1 184 ? 52.521 8.178   11.586 1.00 23.62 ? 202 SER A H     1 
ATOM   2715 H  HA    . SER A 1 184 ? 53.553 9.851   10.335 1.00 24.49 ? 202 SER A HA    1 
ATOM   2716 H  HB2   . SER A 1 184 ? 50.689 10.851  10.008 1.00 29.60 ? 202 SER A HB2   1 
ATOM   2717 H  HB3   . SER A 1 184 ? 52.039 11.124  8.902  1.00 29.12 ? 202 SER A HB3   1 
ATOM   2718 H  HG    . SER A 1 184 ? 51.665 8.442   9.546  1.00 33.17 ? 202 SER A HG    1 
ATOM   2719 N  N     . GLY A 1 185 ? 53.393 11.263  12.715 1.00 19.22 ? 203 GLY A N     1 
ATOM   2720 C  CA    . GLY A 1 185 ? 53.679 12.428  13.578 1.00 20.45 ? 203 GLY A CA    1 
ATOM   2721 C  C     . GLY A 1 185 ? 52.504 13.086  14.224 1.00 19.05 ? 203 GLY A C     1 
ATOM   2722 O  O     . GLY A 1 185 ? 52.706 14.153  14.764 1.00 22.27 ? 203 GLY A O     1 
ATOM   2723 H  H     . GLY A 1 185 ? 53.631 10.358  13.012 1.00 20.24 ? 203 GLY A H     1 
ATOM   2724 H  HA2   . GLY A 1 185 ? 54.364 12.118  14.354 1.00 20.41 ? 203 GLY A HA2   1 
ATOM   2725 H  HA3   . GLY A 1 185 ? 54.168 13.174  12.969 1.00 19.67 ? 203 GLY A HA3   1 
ATOM   2726 N  N     . LYS A 1 186 ? 51.340 12.512  14.186 1.00 16.96 ? 204 LYS A N     1 
ATOM   2727 C  CA    . LYS A 1 186 ? 50.181 13.177  14.838 1.00 16.45 ? 204 LYS A CA    1 
ATOM   2728 C  C     . LYS A 1 186 ? 49.607 12.200  15.855 1.00 15.73 ? 204 LYS A C     1 
ATOM   2729 O  O     . LYS A 1 186 ? 49.618 11.000  15.624 1.00 15.44 ? 204 LYS A O     1 
ATOM   2730 C  CB    . LYS A 1 186 ? 49.056 13.491  13.831 1.00 19.57 ? 204 LYS A CB    1 
ATOM   2731 C  CG    . LYS A 1 186 ? 49.482 14.315  12.596 1.00 24.31 ? 204 LYS A CG    1 
ATOM   2732 C  CD    . LYS A 1 186 ? 49.865 15.752  12.968 1.00 25.73 ? 204 LYS A CD    1 
ATOM   2733 C  CE    . LYS A 1 186 ? 50.146 16.536  11.657 1.00 27.60 ? 204 LYS A CE    1 
ATOM   2734 N  NZ    . LYS A 1 186 ? 50.608 17.916  11.982 0.18 26.82 ? 204 LYS A NZ    1 
ATOM   2735 H  H     . LYS A 1 186 ? 51.215 11.648  13.737 1.00 17.26 ? 204 LYS A H     1 
ATOM   2736 H  HA    . LYS A 1 186 ? 50.502 14.070  15.353 1.00 16.85 ? 204 LYS A HA    1 
ATOM   2737 H  HB2   . LYS A 1 186 ? 48.639 12.556  13.482 1.00 20.12 ? 204 LYS A HB2   1 
ATOM   2738 H  HB3   . LYS A 1 186 ? 48.269 14.016  14.354 1.00 20.11 ? 204 LYS A HB3   1 
ATOM   2739 H  HG2   . LYS A 1 186 ? 50.316 13.824  12.106 1.00 23.95 ? 204 LYS A HG2   1 
ATOM   2740 H  HG3   . LYS A 1 186 ? 48.651 14.332  11.900 1.00 23.71 ? 204 LYS A HG3   1 
ATOM   2741 H  HD2   . LYS A 1 186 ? 49.073 16.245  13.517 1.00 25.77 ? 204 LYS A HD2   1 
ATOM   2742 H  HD3   . LYS A 1 186 ? 50.763 15.748  13.569 1.00 25.71 ? 204 LYS A HD3   1 
ATOM   2743 H  HE2   . LYS A 1 186 ? 50.919 16.045  11.080 1.00 26.85 ? 204 LYS A HE2   1 
ATOM   2744 H  HE3   . LYS A 1 186 ? 49.248 16.612  11.059 1.00 26.65 ? 204 LYS A HE3   1 
ATOM   2745 H  HZ1   . LYS A 1 186 ? 51.562 18.061  11.594 0.18 27.12 ? 204 LYS A HZ1   1 
ATOM   2746 H  HZ2   . LYS A 1 186 ? 50.632 18.043  13.014 0.18 27.22 ? 204 LYS A HZ2   1 
ATOM   2747 H  HZ3   . LYS A 1 186 ? 49.954 18.608  11.564 0.18 27.21 ? 204 LYS A HZ3   1 
ATOM   2748 N  N     . LEU A 1 187 ? 49.104 12.727  16.934 1.00 13.25 ? 209 LEU A N     1 
ATOM   2749 C  CA    . LEU A 1 187 ? 48.515 11.864  17.980 1.00 13.02 ? 209 LEU A CA    1 
ATOM   2750 C  C     . LEU A 1 187 ? 47.096 11.490  17.465 1.00 16.14 ? 209 LEU A C     1 
ATOM   2751 O  O     . LEU A 1 187 ? 46.206 12.317  17.500 1.00 13.79 ? 209 LEU A O     1 
ATOM   2752 C  CB    . LEU A 1 187 ? 48.473 12.689  19.295 1.00 14.03 ? 209 LEU A CB    1 
ATOM   2753 C  CG    . LEU A 1 187 ? 47.859 11.889  20.504 1.00 14.14 ? 209 LEU A CG    1 
ATOM   2754 C  CD1   . LEU A 1 187 ? 48.785 10.733  20.931 1.00 14.23 ? 209 LEU A CD1   1 
ATOM   2755 C  CD2   . LEU A 1 187 ? 47.608 12.855  21.682 1.00 12.24 ? 209 LEU A CD2   1 
ATOM   2756 H  H     . LEU A 1 187 ? 49.119 13.699  17.048 1.00 13.63 ? 209 LEU A H     1 
ATOM   2757 H  HA    . LEU A 1 187 ? 49.119 10.975  18.082 1.00 14.92 ? 209 LEU A HA    1 
ATOM   2758 H  HB2   . LEU A 1 187 ? 49.484 12.999  19.525 1.00 13.51 ? 209 LEU A HB2   1 
ATOM   2759 H  HB3   . LEU A 1 187 ? 47.877 13.571  19.109 1.00 14.14 ? 209 LEU A HB3   1 
ATOM   2760 H  HG    . LEU A 1 187 ? 46.900 11.480  20.218 1.00 14.50 ? 209 LEU A HG    1 
ATOM   2761 H  HD11  . LEU A 1 187 ? 49.763 11.095  21.212 1.00 14.19 ? 209 LEU A HD11  1 
ATOM   2762 H  HD12  . LEU A 1 187 ? 48.899 10.014  20.133 1.00 14.19 ? 209 LEU A HD12  1 
ATOM   2763 H  HD13  . LEU A 1 187 ? 48.343 10.220  21.777 1.00 14.48 ? 209 LEU A HD13  1 
ATOM   2764 H  HD21  . LEU A 1 187 ? 46.929 13.640  21.382 1.00 12.10 ? 209 LEU A HD21  1 
ATOM   2765 H  HD22  . LEU A 1 187 ? 48.533 13.302  22.018 1.00 12.24 ? 209 LEU A HD22  1 
ATOM   2766 H  HD23  . LEU A 1 187 ? 47.157 12.309  22.499 1.00 12.54 ? 209 LEU A HD23  1 
ATOM   2767 N  N     . GLN A 1 188 ? 46.890 10.276  17.001 1.00 12.81 ? 210 GLN A N     1 
ATOM   2768 C  CA    . GLN A 1 188 ? 45.545 9.885   16.502 1.00 14.90 ? 210 GLN A CA    1 
ATOM   2769 C  C     . GLN A 1 188 ? 44.757 9.106   17.574 1.00 11.01 ? 210 GLN A C     1 
ATOM   2770 O  O     . GLN A 1 188 ? 43.541 9.060   17.507 1.00 14.04 ? 210 GLN A O     1 
ATOM   2771 C  CB    . GLN A 1 188 ? 45.683 8.990   15.238 1.00 15.83 ? 210 GLN A CB    1 
ATOM   2772 C  CG    . GLN A 1 188 ? 46.264 9.763   14.022 1.00 19.56 ? 210 GLN A CG    1 
ATOM   2773 C  CD    . GLN A 1 188 ? 45.252 10.742  13.393 1.00 18.13 ? 210 GLN A CD    1 
ATOM   2774 O  OE1   . GLN A 1 188 ? 45.548 11.413  12.429 1.00 21.72 ? 210 GLN A OE1   1 
ATOM   2775 N  NE2   . GLN A 1 188 ? 44.063 10.881  13.871 1.00 20.51 ? 210 GLN A NE2   1 
ATOM   2776 H  H     . GLN A 1 188 ? 47.634 9.632   16.993 1.00 14.67 ? 210 GLN A H     1 
ATOM   2777 H  HA    . GLN A 1 188 ? 44.986 10.785  16.280 1.00 14.42 ? 210 GLN A HA    1 
ATOM   2778 H  HB2   . GLN A 1 188 ? 46.317 8.141   15.449 1.00 17.02 ? 210 GLN A HB2   1 
ATOM   2779 H  HB3   . GLN A 1 188 ? 44.710 8.602   14.969 1.00 16.85 ? 210 GLN A HB3   1 
ATOM   2780 H  HG2   . GLN A 1 188 ? 47.138 10.322  14.326 1.00 18.69 ? 210 GLN A HG2   1 
ATOM   2781 H  HG3   . GLN A 1 188 ? 46.570 9.059   13.259 1.00 18.83 ? 210 GLN A HG3   1 
ATOM   2782 H  HE21  . GLN A 1 188 ? 43.460 11.526  13.448 1.00 20.44 ? 210 GLN A HE21  1 
ATOM   2783 H  HE22  . GLN A 1 188 ? 43.764 10.361  14.637 1.00 20.24 ? 210 GLN A HE22  1 
ATOM   2784 N  N     . GLY A 1 189 ? 45.417 8.504   18.521 1.00 10.28 ? 211 GLY A N     1 
ATOM   2785 C  CA    . GLY A 1 189 ? 44.661 7.757   19.551 1.00 8.49  ? 211 GLY A CA    1 
ATOM   2786 C  C     . GLY A 1 189 ? 45.257 7.771   20.952 1.00 10.02 ? 211 GLY A C     1 
ATOM   2787 O  O     . GLY A 1 189 ? 46.377 8.211   21.173 1.00 9.21  ? 211 GLY A O     1 
ATOM   2788 H  H     . GLY A 1 189 ? 46.398 8.549   18.562 1.00 9.24  ? 211 GLY A H     1 
ATOM   2789 H  HA2   . GLY A 1 189 ? 43.669 8.164   19.609 1.00 9.69  ? 211 GLY A HA2   1 
ATOM   2790 H  HA3   . GLY A 1 189 ? 44.587 6.729   19.236 1.00 8.79  ? 211 GLY A HA3   1 
ATOM   2791 N  N     . ILE A 1 190 ? 44.436 7.285   21.846 1.00 8.23  ? 212 ILE A N     1 
ATOM   2792 C  CA    . ILE A 1 190 ? 44.805 7.174   23.272 1.00 9.56  ? 212 ILE A CA    1 
ATOM   2793 C  C     . ILE A 1 190 ? 44.436 5.693   23.615 1.00 6.46  ? 212 ILE A C     1 
ATOM   2794 O  O     . ILE A 1 190 ? 43.352 5.248   23.276 1.00 9.89  ? 212 ILE A O     1 
ATOM   2795 C  CB    . ILE A 1 190 ? 43.972 8.145   24.156 1.00 7.81  ? 212 ILE A CB    1 
ATOM   2796 C  CG1   . ILE A 1 190 ? 44.230 9.612   23.708 1.00 9.65  ? 212 ILE A CG1   1 
ATOM   2797 C  CG2   . ILE A 1 190 ? 44.326 7.993   25.664 1.00 3.43  ? 212 ILE A CG2   1 
ATOM   2798 C  CD1   . ILE A 1 190 ? 43.140 10.476  24.347 1.00 12.68 ? 212 ILE A CD1   1 
ATOM   2799 H  H     . ILE A 1 190 ? 43.545 6.978   21.576 1.00 8.64  ? 212 ILE A H     1 
ATOM   2800 H  HA    . ILE A 1 190 ? 45.871 7.326   23.369 1.00 8.54  ? 212 ILE A HA    1 
ATOM   2801 H  HB    . ILE A 1 190 ? 42.927 7.893   24.070 1.00 7.88  ? 212 ILE A HB    1 
ATOM   2802 H  HG12  . ILE A 1 190 ? 45.212 9.962   23.997 1.00 9.63  ? 212 ILE A HG12  1 
ATOM   2803 H  HG13  . ILE A 1 190 ? 44.152 9.701   22.635 1.00 10.53 ? 212 ILE A HG13  1 
ATOM   2804 H  HG21  . ILE A 1 190 ? 45.362 8.225   25.856 1.00 5.01  ? 212 ILE A HG21  1 
ATOM   2805 H  HG22  . ILE A 1 190 ? 44.112 6.990   25.995 1.00 6.06  ? 212 ILE A HG22  1 
ATOM   2806 H  HG23  . ILE A 1 190 ? 43.695 8.644   26.252 1.00 6.36  ? 212 ILE A HG23  1 
ATOM   2807 H  HD11  . ILE A 1 190 ? 43.187 10.445  25.426 1.00 12.09 ? 212 ILE A HD11  1 
ATOM   2808 H  HD12  . ILE A 1 190 ? 42.159 10.144  24.036 1.00 12.14 ? 212 ILE A HD12  1 
ATOM   2809 H  HD13  . ILE A 1 190 ? 43.271 11.503  24.035 1.00 12.20 ? 212 ILE A HD13  1 
ATOM   2810 N  N     . VAL A 1 191 ? 45.333 4.991   24.258 1.00 6.20  ? 213 VAL A N     1 
ATOM   2811 C  CA    . VAL A 1 191 ? 45.113 3.573   24.657 1.00 6.94  ? 213 VAL A CA    1 
ATOM   2812 C  C     . VAL A 1 191 ? 43.901 3.581   25.602 1.00 8.09  ? 213 VAL A C     1 
ATOM   2813 O  O     . VAL A 1 191 ? 43.937 4.221   26.641 1.00 5.83  ? 213 VAL A O     1 
ATOM   2814 C  CB    . VAL A 1 191 ? 46.390 3.058   25.366 1.00 5.40  ? 213 VAL A CB    1 
ATOM   2815 C  CG1   . VAL A 1 191 ? 46.200 1.574   25.694 1.00 5.84  ? 213 VAL A CG1   1 
ATOM   2816 C  CG2   . VAL A 1 191 ? 47.687 3.201   24.509 1.00 3.22  ? 213 VAL A CG2   1 
ATOM   2817 H  H     . VAL A 1 191 ? 46.184 5.431   24.484 1.00 8.83  ? 213 VAL A H     1 
ATOM   2818 H  HA    . VAL A 1 191 ? 44.866 2.987   23.792 1.00 8.16  ? 213 VAL A HA    1 
ATOM   2819 H  HB    . VAL A 1 191 ? 46.516 3.624   26.279 1.00 6.69  ? 213 VAL A HB    1 
ATOM   2820 H  HG11  . VAL A 1 191 ? 46.009 1.024   24.788 1.00 6.52  ? 213 VAL A HG11  1 
ATOM   2821 H  HG12  . VAL A 1 191 ? 45.341 1.465   26.337 1.00 6.14  ? 213 VAL A HG12  1 
ATOM   2822 H  HG13  . VAL A 1 191 ? 47.068 1.174   26.198 1.00 6.55  ? 213 VAL A HG13  1 
ATOM   2823 H  HG21  . VAL A 1 191 ? 47.850 4.244   24.266 1.00 5.03  ? 213 VAL A HG21  1 
ATOM   2824 H  HG22  . VAL A 1 191 ? 47.636 2.654   23.581 1.00 4.63  ? 213 VAL A HG22  1 
ATOM   2825 H  HG23  . VAL A 1 191 ? 48.555 2.857   25.051 1.00 4.16  ? 213 VAL A HG23  1 
ATOM   2826 N  N     . SER A 1 192 ? 42.866 2.868   25.252 1.00 9.92  ? 214 SER A N     1 
ATOM   2827 C  CA    . SER A 1 192 ? 41.672 2.863   26.125 1.00 8.60  ? 214 SER A CA    1 
ATOM   2828 C  C     . SER A 1 192 ? 41.335 1.487   26.731 1.00 12.84 ? 214 SER A C     1 
ATOM   2829 O  O     . SER A 1 192 ? 41.453 1.315   27.936 1.00 12.54 ? 214 SER A O     1 
ATOM   2830 C  CB    . SER A 1 192 ? 40.503 3.416   25.266 1.00 9.86  ? 214 SER A CB    1 
ATOM   2831 O  OG    . SER A 1 192 ? 39.369 3.665   26.096 1.00 9.34  ? 214 SER A OG    1 
ATOM   2832 H  H     . SER A 1 192 ? 42.876 2.337   24.431 1.00 10.22 ? 214 SER A H     1 
ATOM   2833 H  HA    . SER A 1 192 ? 41.838 3.560   26.931 1.00 10.49 ? 214 SER A HA    1 
ATOM   2834 H  HB2   . SER A 1 192 ? 40.805 4.354   24.818 1.00 9.03  ? 214 SER A HB2   1 
ATOM   2835 H  HB3   . SER A 1 192 ? 40.236 2.713   24.488 1.00 9.98  ? 214 SER A HB3   1 
ATOM   2836 H  HG    . SER A 1 192 ? 39.214 4.622   25.998 1.00 11.08 ? 214 SER A HG    1 
ATOM   2837 N  N     . TRP A 1 193 ? 40.918 0.536   25.935 1.00 14.48 ? 215 TRP A N     1 
ATOM   2838 C  CA    . TRP A 1 193 ? 40.571 -0.795  26.510 1.00 12.18 ? 215 TRP A CA    1 
ATOM   2839 C  C     . TRP A 1 193 ? 40.772 -1.901  25.493 1.00 14.84 ? 215 TRP A C     1 
ATOM   2840 O  O     . TRP A 1 193 ? 41.260 -1.674  24.394 1.00 17.18 ? 215 TRP A O     1 
ATOM   2841 C  CB    . TRP A 1 193 ? 39.097 -0.764  26.963 1.00 11.49 ? 215 TRP A CB    1 
ATOM   2842 C  CG    . TRP A 1 193 ? 38.069 -0.415  25.873 1.00 11.03 ? 215 TRP A CG    1 
ATOM   2843 C  CD1   . TRP A 1 193 ? 37.763 0.844   25.451 1.00 12.37 ? 215 TRP A CD1   1 
ATOM   2844 C  CD2   . TRP A 1 193 ? 37.284 -1.288  25.198 1.00 8.80  ? 215 TRP A CD2   1 
ATOM   2845 N  NE1   . TRP A 1 193 ? 36.811 0.658   24.551 1.00 11.80 ? 215 TRP A NE1   1 
ATOM   2846 C  CE2   . TRP A 1 193 ? 36.443 -0.583  24.315 1.00 13.88 ? 215 TRP A CE2   1 
ATOM   2847 C  CE3   . TRP A 1 193 ? 37.204 -2.687  25.253 1.00 11.86 ? 215 TRP A CE3   1 
ATOM   2848 C  CZ2   . TRP A 1 193 ? 35.530 -1.266  23.494 1.00 14.10 ? 215 TRP A CZ2   1 
ATOM   2849 C  CZ3   . TRP A 1 193 ? 36.289 -3.363  24.429 1.00 14.26 ? 215 TRP A CZ3   1 
ATOM   2850 C  CH2   . TRP A 1 193 ? 35.457 -2.659  23.554 1.00 14.48 ? 215 TRP A CH2   1 
ATOM   2851 H  H     . TRP A 1 193 ? 40.831 0.669   24.966 1.00 15.00 ? 215 TRP A H     1 
ATOM   2852 H  HA    . TRP A 1 193 ? 41.205 -0.991  27.361 1.00 13.50 ? 215 TRP A HA    1 
ATOM   2853 H  HB2   . TRP A 1 193 ? 38.818 -1.722  27.377 1.00 11.27 ? 215 TRP A HB2   1 
ATOM   2854 H  HB3   . TRP A 1 193 ? 39.003 -0.047  27.760 1.00 10.71 ? 215 TRP A HB3   1 
ATOM   2855 H  HD1   . TRP A 1 193 ? 38.199 1.770   25.790 1.00 11.97 ? 215 TRP A HD1   1 
ATOM   2856 H  HE1   . TRP A 1 193 ? 36.376 1.391   24.069 1.00 12.59 ? 215 TRP A HE1   1 
ATOM   2857 H  HE3   . TRP A 1 193 ? 37.840 -3.242  25.924 1.00 10.20 ? 215 TRP A HE3   1 
ATOM   2858 H  HZ2   . TRP A 1 193 ? 34.879 -0.728  22.819 1.00 13.54 ? 215 TRP A HZ2   1 
ATOM   2859 H  HZ3   . TRP A 1 193 ? 36.223 -4.442  24.466 1.00 14.87 ? 215 TRP A HZ3   1 
ATOM   2860 H  HH2   . TRP A 1 193 ? 34.760 -3.198  22.929 1.00 14.58 ? 215 TRP A HH2   1 
ATOM   2861 N  N     . GLY A 1 194 ? 40.408 -3.088  25.886 1.00 15.92 ? 216 GLY A N     1 
ATOM   2862 C  CA    . GLY A 1 194 ? 40.528 -4.268  24.987 1.00 16.80 ? 216 GLY A CA    1 
ATOM   2863 C  C     . GLY A 1 194 ? 40.063 -5.463  25.815 1.00 16.06 ? 216 GLY A C     1 
ATOM   2864 O  O     . GLY A 1 194 ? 39.889 -5.298  27.004 1.00 16.78 ? 216 GLY A O     1 
ATOM   2865 H  H     . GLY A 1 194 ? 40.049 -3.222  26.800 1.00 15.29 ? 216 GLY A H     1 
ATOM   2866 H  HA2   . GLY A 1 194 ? 39.874 -4.127  24.136 1.00 16.31 ? 216 GLY A HA2   1 
ATOM   2867 H  HA3   . GLY A 1 194 ? 41.547 -4.397  24.665 1.00 16.84 ? 216 GLY A HA3   1 
ATOM   2868 N  N     . SER A 1 195 ? 39.862 -6.603  25.214 1.00 18.96 ? 217 SER A N     1 
ATOM   2869 C  CA    . SER A 1 195 ? 39.413 -7.829  25.982 1.00 19.24 ? 217 SER A CA    1 
ATOM   2870 C  C     . SER A 1 195 ? 40.689 -8.673  26.114 1.00 19.16 ? 217 SER A C     1 
ATOM   2871 O  O     . SER A 1 195 ? 41.162 -9.276  25.159 1.00 21.93 ? 217 SER A O     1 
ATOM   2872 C  CB    A SER A 1 195 ? 38.361 -8.572  25.175 0.15 18.55 ? 217 SER A CB    1 
ATOM   2873 C  CB    B SER A 1 195 ? 38.345 -8.573  25.166 0.61 17.46 ? 217 SER A CB    1 
ATOM   2874 O  OG    A SER A 1 195 ? 37.316 -7.615  25.046 0.15 18.84 ? 217 SER A OG    1 
ATOM   2875 O  OG    B SER A 1 195 ? 37.735 -9.421  26.129 0.61 19.88 ? 217 SER A OG    1 
ATOM   2876 H  H     . SER A 1 195 ? 39.995 -6.679  24.242 1.00 16.30 ? 217 SER A H     1 
ATOM   2877 H  HA    . SER A 1 195 ? 39.043 -7.553  26.961 1.00 19.28 ? 217 SER A HA    1 
ATOM   2878 H  HB2   A SER A 1 195 ? 38.738 -8.859  24.202 0.15 18.75 ? 217 SER A HB2   1 
ATOM   2879 H  HB2   B SER A 1 195 ? 37.612 -7.901  24.753 0.61 18.34 ? 217 SER A HB2   1 
ATOM   2880 H  HB3   A SER A 1 195 ? 37.999 -9.444  25.702 0.15 18.80 ? 217 SER A HB3   1 
ATOM   2881 H  HB3   B SER A 1 195 ? 38.794 -9.173  24.386 0.61 18.25 ? 217 SER A HB3   1 
ATOM   2882 H  HG    A SER A 1 195 ? 37.591 -6.770  25.422 0.15 18.66 ? 217 SER A HG    1 
ATOM   2883 H  HG    B SER A 1 195 ? 36.796 -9.230  26.200 0.61 18.91 ? 217 SER A HG    1 
ATOM   2884 N  N     . GLY A 1 196 ? 41.210 -8.655  27.311 1.00 22.01 ? 219 GLY A N     1 
ATOM   2885 C  CA    . GLY A 1 196 ? 42.463 -9.405  27.628 1.00 19.89 ? 219 GLY A CA    1 
ATOM   2886 C  C     . GLY A 1 196 ? 43.518 -8.560  26.923 1.00 19.27 ? 219 GLY A C     1 
ATOM   2887 O  O     . GLY A 1 196 ? 43.328 -7.359  26.727 1.00 19.46 ? 219 GLY A O     1 
ATOM   2888 H  H     . GLY A 1 196 ? 40.773 -8.129  28.012 1.00 20.88 ? 219 GLY A H     1 
ATOM   2889 H  HA2   . GLY A 1 196 ? 42.654 -9.425  28.689 1.00 21.10 ? 219 GLY A HA2   1 
ATOM   2890 H  HA3   . GLY A 1 196 ? 42.431 -10.399 27.207 1.00 20.11 ? 219 GLY A HA3   1 
ATOM   2891 N  N     . CYS A 1 197 ? 44.583 -9.193  26.579 1.00 17.07 ? 220 CYS A N     1 
ATOM   2892 C  CA    . CYS A 1 197 ? 45.670 -8.522  25.878 1.00 18.58 ? 220 CYS A CA    1 
ATOM   2893 C  C     . CYS A 1 197 ? 46.224 -9.525  24.909 1.00 19.61 ? 220 CYS A C     1 
ATOM   2894 O  O     . CYS A 1 197 ? 46.498 -10.656 25.253 1.00 20.27 ? 220 CYS A O     1 
ATOM   2895 C  CB    . CYS A 1 197 ? 46.796 -8.100  26.826 1.00 19.90 ? 220 CYS A CB    1 
ATOM   2896 S  SG    . CYS A 1 197 ? 46.258 -6.981  28.136 1.00 21.48 ? 220 CYS A SG    1 
ATOM   2897 H  H     . CYS A 1 197 ? 44.687 -10.148 26.784 1.00 17.82 ? 220 CYS A H     1 
ATOM   2898 H  HA    . CYS A 1 197 ? 45.262 -7.681  25.342 1.00 17.59 ? 220 CYS A HA    1 
ATOM   2899 H  HB2   . CYS A 1 197 ? 47.217 -8.984  27.282 1.00 19.96 ? 220 CYS A HB2   1 
ATOM   2900 H  HB3   . CYS A 1 197 ? 47.583 -7.617  26.264 1.00 19.04 ? 220 CYS A HB3   1 
ATOM   2901 N  N     . ALA A 1 198 ? 46.364 -9.040  23.727 1.00 19.91 ? 221 ALA A N     1 
ATOM   2902 C  CA    . ALA A 1 198 ? 46.900 -9.777  22.570 1.00 18.48 ? 221 ALA A CA    1 
ATOM   2903 C  C     . ALA A 1 198 ? 46.182 -11.071 22.252 1.00 20.40 ? 221 ALA A C     1 
ATOM   2904 O  O     . ALA A 1 198 ? 46.835 -11.976 21.784 1.00 16.46 ? 221 ALA A O     1 
ATOM   2905 C  CB    . ALA A 1 198 ? 48.405 -10.009 22.858 1.00 18.54 ? 221 ALA A CB    1 
ATOM   2906 H  H     . ALA A 1 198 ? 46.076 -8.124  23.602 1.00 20.44 ? 221 ALA A H     1 
ATOM   2907 H  HA    . ALA A 1 198 ? 46.806 -9.153  21.697 1.00 19.23 ? 221 ALA A HA    1 
ATOM   2908 H  HB1   . ALA A 1 198 ? 48.506 -10.589 23.761 1.00 18.57 ? 221 ALA A HB1   1 
ATOM   2909 H  HB2   . ALA A 1 198 ? 48.948 -9.087  22.976 1.00 18.12 ? 221 ALA A HB2   1 
ATOM   2910 H  HB3   . ALA A 1 198 ? 48.845 -10.571 22.047 1.00 19.25 ? 221 ALA A HB3   1 
ATOM   2911 N  N     . GLN A 1 199 A 44.898 -11.104 22.482 1.00 20.23 ? 221 GLN A N     1 
ATOM   2912 C  CA    . GLN A 1 199 A 44.143 -12.331 22.185 1.00 19.81 ? 221 GLN A CA    1 
ATOM   2913 C  C     . GLN A 1 199 A 43.701 -12.249 20.706 1.00 22.50 ? 221 GLN A C     1 
ATOM   2914 O  O     . GLN A 1 199 A 43.583 -11.194 20.099 1.00 18.51 ? 221 GLN A O     1 
ATOM   2915 C  CB    . GLN A 1 199 A 42.887 -12.444 23.054 1.00 20.39 ? 221 GLN A CB    1 
ATOM   2916 C  CG    . GLN A 1 199 A 43.188 -12.532 24.553 0.46 19.56 ? 221 GLN A CG    1 
ATOM   2917 C  CD    . GLN A 1 199 A 44.180 -13.666 24.795 0.46 21.32 ? 221 GLN A CD    1 
ATOM   2918 O  OE1   . GLN A 1 199 A 43.994 -14.768 24.315 0.46 22.78 ? 221 GLN A OE1   1 
ATOM   2919 N  NE2   . GLN A 1 199 A 45.239 -13.470 25.515 0.46 20.29 ? 221 GLN A NE2   1 
ATOM   2920 H  H     . GLN A 1 199 A 44.440 -10.318 22.847 1.00 21.31 ? 221 GLN A H     1 
ATOM   2921 H  HA    . GLN A 1 199 A 44.801 -13.175 22.317 1.00 19.95 ? 221 GLN A HA    1 
ATOM   2922 H  HB2   . GLN A 1 199 A 42.237 -11.608 22.851 1.00 19.81 ? 221 GLN A HB2   1 
ATOM   2923 H  HB3   . GLN A 1 199 A 42.371 -13.344 22.751 1.00 20.44 ? 221 GLN A HB3   1 
ATOM   2924 H  HG2   . GLN A 1 199 A 43.609 -11.601 24.900 0.46 20.61 ? 221 GLN A HG2   1 
ATOM   2925 H  HG3   . GLN A 1 199 A 42.283 -12.745 25.100 0.46 19.93 ? 221 GLN A HG3   1 
ATOM   2926 H  HE21  . GLN A 1 199 A 45.402 -12.586 25.921 0.46 21.03 ? 221 GLN A HE21  1 
ATOM   2927 H  HE22  . GLN A 1 199 A 45.875 -14.195 25.658 0.46 20.74 ? 221 GLN A HE22  1 
ATOM   2928 N  N     . LYS A 1 200 ? 43.457 -13.398 20.156 1.00 24.21 ? 222 LYS A N     1 
ATOM   2929 C  CA    . LYS A 1 200 ? 43.027 -13.522 18.742 1.00 24.50 ? 222 LYS A CA    1 
ATOM   2930 C  C     . LYS A 1 200 ? 41.668 -12.866 18.601 1.00 21.86 ? 222 LYS A C     1 
ATOM   2931 O  O     . LYS A 1 200 ? 40.820 -13.011 19.450 1.00 23.17 ? 222 LYS A O     1 
ATOM   2932 C  CB    . LYS A 1 200 ? 42.980 -15.015 18.440 1.00 28.28 ? 222 LYS A CB    1 
ATOM   2933 C  CG    . LYS A 1 200 ? 42.703 -15.294 16.973 1.00 30.94 ? 222 LYS A CG    1 
ATOM   2934 C  CD    . LYS A 1 200 ? 42.708 -16.835 16.786 0.19 30.11 ? 222 LYS A CD    1 
ATOM   2935 C  CE    . LYS A 1 200 ? 42.332 -17.195 15.337 0.19 29.94 ? 222 LYS A CE    1 
ATOM   2936 N  NZ    . LYS A 1 200 ? 40.943 -16.742 15.039 0.19 29.33 ? 222 LYS A NZ    1 
ATOM   2937 H  H     . LYS A 1 200 ? 43.555 -14.213 20.693 1.00 23.73 ? 222 LYS A H     1 
ATOM   2938 H  HA    . LYS A 1 200 ? 43.749 -13.018 18.114 1.00 23.68 ? 222 LYS A HA    1 
ATOM   2939 H  HB2   . LYS A 1 200 ? 43.921 -15.463 18.733 1.00 27.77 ? 222 LYS A HB2   1 
ATOM   2940 H  HB3   . LYS A 1 200 ? 42.185 -15.442 19.039 1.00 27.91 ? 222 LYS A HB3   1 
ATOM   2941 H  HG2   . LYS A 1 200 ? 41.737 -14.889 16.699 1.00 30.58 ? 222 LYS A HG2   1 
ATOM   2942 H  HG3   . LYS A 1 200 ? 43.468 -14.829 16.364 1.00 30.42 ? 222 LYS A HG3   1 
ATOM   2943 H  HD2   . LYS A 1 200 ? 43.689 -17.230 17.017 0.19 30.71 ? 222 LYS A HD2   1 
ATOM   2944 H  HD3   . LYS A 1 200 ? 41.990 -17.280 17.460 0.19 30.64 ? 222 LYS A HD3   1 
ATOM   2945 H  HE2   . LYS A 1 200 ? 43.008 -16.725 14.639 0.19 30.04 ? 222 LYS A HE2   1 
ATOM   2946 H  HE3   . LYS A 1 200 ? 42.379 -18.267 15.203 0.19 30.09 ? 222 LYS A HE3   1 
ATOM   2947 H  HZ1   . LYS A 1 200 ? 40.542 -16.283 15.881 0.19 29.33 ? 222 LYS A HZ1   1 
ATOM   2948 H  HZ2   . LYS A 1 200 ? 40.357 -17.563 14.784 0.19 29.39 ? 222 LYS A HZ2   1 
ATOM   2949 H  HZ3   . LYS A 1 200 ? 40.958 -16.065 14.250 0.19 29.30 ? 222 LYS A HZ3   1 
ATOM   2950 N  N     . ASN A 1 201 ? 41.509 -12.173 17.522 1.00 21.27 ? 223 ASN A N     1 
ATOM   2951 C  CA    . ASN A 1 201 ? 40.255 -11.436 17.175 1.00 22.93 ? 223 ASN A CA    1 
ATOM   2952 C  C     . ASN A 1 201 ? 39.746 -10.435 18.199 1.00 22.26 ? 223 ASN A C     1 
ATOM   2953 O  O     . ASN A 1 201 ? 38.591 -10.039 18.113 1.00 24.32 ? 223 ASN A O     1 
ATOM   2954 C  CB    . ASN A 1 201 ? 39.137 -12.446 16.894 1.00 25.52 ? 223 ASN A CB    1 
ATOM   2955 C  CG    . ASN A 1 201 ? 39.541 -13.192 15.640 1.00 28.17 ? 223 ASN A CG    1 
ATOM   2956 O  OD1   . ASN A 1 201 ? 39.567 -14.402 15.616 1.00 34.72 ? 223 ASN A OD1   1 
ATOM   2957 N  ND2   . ASN A 1 201 ? 39.874 -12.539 14.565 1.00 29.90 ? 223 ASN A ND2   1 
ATOM   2958 H  H     . ASN A 1 201 ? 42.261 -12.141 16.901 1.00 20.66 ? 223 ASN A H     1 
ATOM   2959 H  HA    . ASN A 1 201 ? 40.462 -10.890 16.270 1.00 23.83 ? 223 ASN A HA    1 
ATOM   2960 H  HB2   . ASN A 1 201 ? 39.063 -13.146 17.715 1.00 25.40 ? 223 ASN A HB2   1 
ATOM   2961 H  HB3   . ASN A 1 201 ? 38.175 -11.984 16.740 1.00 24.99 ? 223 ASN A HB3   1 
ATOM   2962 H  HD21  . ASN A 1 201 ? 40.167 -13.043 13.778 1.00 29.50 ? 223 ASN A HD21  1 
ATOM   2963 H  HD22  . ASN A 1 201 ? 39.832 -11.563 14.536 1.00 29.32 ? 223 ASN A HD22  1 
ATOM   2964 N  N     . LYS A 1 202 ? 40.586 -10.029 19.114 1.00 20.84 ? 224 LYS A N     1 
ATOM   2965 C  CA    . LYS A 1 202 ? 40.180 -9.038  20.160 1.00 19.20 ? 224 LYS A CA    1 
ATOM   2966 C  C     . LYS A 1 202 ? 41.258 -7.932  20.155 1.00 19.32 ? 224 LYS A C     1 
ATOM   2967 O  O     . LYS A 1 202 ? 42.094 -7.866  21.052 1.00 19.45 ? 224 LYS A O     1 
ATOM   2968 C  CB    . LYS A 1 202 ? 40.095 -9.739  21.551 1.00 22.61 ? 224 LYS A CB    1 
ATOM   2969 C  CG    . LYS A 1 202 ? 38.971 -10.831 21.583 1.00 24.96 ? 224 LYS A CG    1 
ATOM   2970 C  CD    . LYS A 1 202 ? 37.589 -10.164 21.315 1.00 27.64 ? 224 LYS A CD    1 
ATOM   2971 C  CE    . LYS A 1 202 ? 36.464 -11.203 21.217 0.36 27.11 ? 224 LYS A CE    1 
ATOM   2972 N  NZ    . LYS A 1 202 ? 35.177 -10.489 20.987 0.36 27.60 ? 224 LYS A NZ    1 
ATOM   2973 H  H     . LYS A 1 202 ? 41.508 -10.370 19.125 1.00 20.17 ? 224 LYS A H     1 
ATOM   2974 H  HA    . LYS A 1 202 ? 39.234 -8.589  19.909 1.00 20.19 ? 224 LYS A HA    1 
ATOM   2975 H  HB2   . LYS A 1 202 ? 41.051 -10.191 21.765 1.00 22.59 ? 224 LYS A HB2   1 
ATOM   2976 H  HB3   . LYS A 1 202 ? 39.915 -8.971  22.289 1.00 22.02 ? 224 LYS A HB3   1 
ATOM   2977 H  HG2   . LYS A 1 202 ? 39.174 -11.575 20.824 1.00 25.05 ? 224 LYS A HG2   1 
ATOM   2978 H  HG3   . LYS A 1 202 ? 38.977 -11.319 22.548 1.00 24.38 ? 224 LYS A HG3   1 
ATOM   2979 H  HD2   . LYS A 1 202 ? 37.351 -9.449  22.091 1.00 27.11 ? 224 LYS A HD2   1 
ATOM   2980 H  HD3   . LYS A 1 202 ? 37.594 -9.644  20.369 1.00 27.08 ? 224 LYS A HD3   1 
ATOM   2981 H  HE2   . LYS A 1 202 ? 36.631 -11.872 20.383 0.36 27.41 ? 224 LYS A HE2   1 
ATOM   2982 H  HE3   . LYS A 1 202 ? 36.381 -11.779 22.126 0.36 27.33 ? 224 LYS A HE3   1 
ATOM   2983 H  HZ1   . LYS A 1 202 ? 34.765 -10.793 20.082 0.36 27.39 ? 224 LYS A HZ1   1 
ATOM   2984 H  HZ2   . LYS A 1 202 ? 35.347 -9.463  20.957 0.36 27.23 ? 224 LYS A HZ2   1 
ATOM   2985 H  HZ3   . LYS A 1 202 ? 34.514 -10.704 21.759 0.36 27.42 ? 224 LYS A HZ3   1 
ATOM   2986 N  N     . PRO A 1 203 ? 41.233 -7.101  19.134 1.00 13.74 ? 225 PRO A N     1 
ATOM   2987 C  CA    . PRO A 1 203 ? 42.212 -6.000  19.005 1.00 15.60 ? 225 PRO A CA    1 
ATOM   2988 C  C     . PRO A 1 203 ? 42.054 -4.917  20.091 1.00 13.38 ? 225 PRO A C     1 
ATOM   2989 O  O     . PRO A 1 203 ? 41.085 -4.899  20.826 1.00 14.75 ? 225 PRO A O     1 
ATOM   2990 C  CB    . PRO A 1 203 ? 41.974 -5.512  17.568 1.00 15.76 ? 225 PRO A CB    1 
ATOM   2991 C  CG    . PRO A 1 203 ? 40.473 -5.754  17.344 1.00 17.21 ? 225 PRO A CG    1 
ATOM   2992 C  CD    . PRO A 1 203 ? 40.278 -7.123  17.991 1.00 16.31 ? 225 PRO A CD    1 
ATOM   2993 H  HA    . PRO A 1 203 ? 43.203 -6.422  19.092 1.00 14.90 ? 225 PRO A HA    1 
ATOM   2994 H  HB2   . PRO A 1 203 ? 42.215 -4.458  17.501 1.00 16.03 ? 225 PRO A HB2   1 
ATOM   2995 H  HB3   . PRO A 1 203 ? 42.587 -6.073  16.879 1.00 16.15 ? 225 PRO A HB3   1 
ATOM   2996 H  HG2   . PRO A 1 203 ? 39.865 -4.996  17.825 1.00 16.21 ? 225 PRO A HG2   1 
ATOM   2997 H  HG3   . PRO A 1 203 ? 40.238 -5.781  16.290 1.00 15.89 ? 225 PRO A HG3   1 
ATOM   2998 H  HD2   . PRO A 1 203 ? 39.263 -7.235  18.349 1.00 16.08 ? 225 PRO A HD2   1 
ATOM   2999 H  HD3   . PRO A 1 203 ? 40.543 -7.928  17.323 1.00 16.17 ? 225 PRO A HD3   1 
ATOM   3000 N  N     . GLY A 1 204 ? 43.013 -4.030  20.172 1.00 11.43 ? 226 GLY A N     1 
ATOM   3001 C  CA    . GLY A 1 204 ? 42.910 -2.951  21.212 1.00 10.14 ? 226 GLY A CA    1 
ATOM   3002 C  C     . GLY A 1 204 ? 41.970 -1.884  20.637 1.00 10.09 ? 226 GLY A C     1 
ATOM   3003 O  O     . GLY A 1 204 ? 41.861 -1.746  19.433 1.00 8.00  ? 226 GLY A O     1 
ATOM   3004 H  H     . GLY A 1 204 ? 43.782 -4.065  19.560 1.00 10.59 ? 226 GLY A H     1 
ATOM   3005 H  HA2   . GLY A 1 204 ? 42.495 -3.353  22.123 1.00 10.04 ? 226 GLY A HA2   1 
ATOM   3006 H  HA3   . GLY A 1 204 ? 43.885 -2.527  21.378 1.00 11.67 ? 226 GLY A HA3   1 
ATOM   3007 N  N     . VAL A 1 205 ? 41.322 -1.169  21.519 1.00 8.88  ? 227 VAL A N     1 
ATOM   3008 C  CA    . VAL A 1 205 ? 40.379 -0.092  21.145 1.00 8.77  ? 227 VAL A CA    1 
ATOM   3009 C  C     . VAL A 1 205 ? 41.031 1.170   21.710 1.00 6.98  ? 227 VAL A C     1 
ATOM   3010 O  O     . VAL A 1 205 ? 41.555 1.211   22.820 1.00 8.28  ? 227 VAL A O     1 
ATOM   3011 C  CB    . VAL A 1 205 ? 39.035 -0.340  21.784 1.00 9.18  ? 227 VAL A CB    1 
ATOM   3012 C  CG1   . VAL A 1 205 ? 38.061 0.661   21.195 1.00 9.07  ? 227 VAL A CG1   1 
ATOM   3013 C  CG2   . VAL A 1 205 ? 38.555 -1.729  21.408 1.00 10.60 ? 227 VAL A CG2   1 
ATOM   3014 H  H     . VAL A 1 205 ? 41.441 -1.332  22.480 1.00 8.37  ? 227 VAL A H     1 
ATOM   3015 H  HA    . VAL A 1 205 ? 40.320 -0.037  20.063 1.00 9.26  ? 227 VAL A HA    1 
ATOM   3016 H  HB    . VAL A 1 205 ? 39.087 -0.240  22.861 1.00 9.37  ? 227 VAL A HB    1 
ATOM   3017 H  HG11  . VAL A 1 205 ? 37.982 0.525   20.124 1.00 9.94  ? 227 VAL A HG11  1 
ATOM   3018 H  HG12  . VAL A 1 205 ? 38.388 1.667   21.398 1.00 9.80  ? 227 VAL A HG12  1 
ATOM   3019 H  HG13  . VAL A 1 205 ? 37.083 0.523   21.634 1.00 9.92  ? 227 VAL A HG13  1 
ATOM   3020 H  HG21  . VAL A 1 205 ? 39.249 -2.473  21.769 1.00 10.38 ? 227 VAL A HG21  1 
ATOM   3021 H  HG22  . VAL A 1 205 ? 38.464 -1.837  20.336 1.00 9.91  ? 227 VAL A HG22  1 
ATOM   3022 H  HG23  . VAL A 1 205 ? 37.593 -1.923  21.864 1.00 10.09 ? 227 VAL A HG23  1 
ATOM   3023 N  N     . TYR A 1 206 ? 40.975 2.166   20.888 1.00 10.34 ? 228 TYR A N     1 
ATOM   3024 C  CA    . TYR A 1 206 ? 41.557 3.502   21.175 1.00 9.84  ? 228 TYR A CA    1 
ATOM   3025 C  C     . TYR A 1 206 ? 40.574 4.673   21.018 1.00 10.65 ? 228 TYR A C     1 
ATOM   3026 O  O     . TYR A 1 206 ? 39.649 4.620   20.214 1.00 12.67 ? 228 TYR A O     1 
ATOM   3027 C  CB    . TYR A 1 206 ? 42.764 3.649   20.194 1.00 10.00 ? 228 TYR A CB    1 
ATOM   3028 C  CG    . TYR A 1 206 ? 43.738 2.486   20.416 1.00 9.44  ? 228 TYR A CG    1 
ATOM   3029 C  CD1   . TYR A 1 206 ? 44.734 2.620   21.340 1.00 10.52 ? 228 TYR A CD1   1 
ATOM   3030 C  CD2   . TYR A 1 206 ? 43.622 1.285   19.732 1.00 10.25 ? 228 TYR A CD2   1 
ATOM   3031 C  CE1   . TYR A 1 206 ? 45.604 1.576   21.590 1.00 12.77 ? 228 TYR A CE1   1 
ATOM   3032 C  CE2   . TYR A 1 206 ? 44.488 0.240   19.975 1.00 10.34 ? 228 TYR A CE2   1 
ATOM   3033 C  CZ    . TYR A 1 206 ? 45.486 0.380   20.908 1.00 12.52 ? 228 TYR A CZ    1 
ATOM   3034 O  OH    . TYR A 1 206 ? 46.354 -0.660  21.140 1.00 13.34 ? 228 TYR A OH    1 
ATOM   3035 H  H     . TYR A 1 206 ? 40.522 2.040   20.025 1.00 10.42 ? 228 TYR A H     1 
ATOM   3036 H  HA    . TYR A 1 206 ? 41.930 3.496   22.187 1.00 11.06 ? 228 TYR A HA    1 
ATOM   3037 H  HB2   . TYR A 1 206 ? 42.417 3.629   19.169 1.00 10.10 ? 228 TYR A HB2   1 
ATOM   3038 H  HB3   . TYR A 1 206 ? 43.275 4.589   20.342 1.00 10.02 ? 228 TYR A HB3   1 
ATOM   3039 H  HD1   . TYR A 1 206 ? 44.846 3.555   21.869 1.00 10.83 ? 228 TYR A HD1   1 
ATOM   3040 H  HD2   . TYR A 1 206 ? 42.840 1.156   18.995 1.00 9.45  ? 228 TYR A HD2   1 
ATOM   3041 H  HE1   . TYR A 1 206 ? 46.385 1.706   22.322 1.00 11.31 ? 228 TYR A HE1   1 
ATOM   3042 H  HE2   . TYR A 1 206 ? 44.378 -0.683  19.427 1.00 10.70 ? 228 TYR A HE2   1 
ATOM   3043 H  HH    . TYR A 1 206 ? 46.520 -0.776  22.080 1.00 12.29 ? 228 TYR A HH    1 
ATOM   3044 N  N     . THR A 1 207 ? 40.825 5.707   21.791 1.00 13.40 ? 229 THR A N     1 
ATOM   3045 C  CA    . THR A 1 207 ? 39.959 6.916   21.726 1.00 11.34 ? 229 THR A CA    1 
ATOM   3046 C  C     . THR A 1 207 ? 40.444 7.587   20.437 1.00 9.76  ? 229 THR A C     1 
ATOM   3047 O  O     . THR A 1 207 ? 41.637 7.739   20.224 1.00 10.99 ? 229 THR A O     1 
ATOM   3048 C  CB    . THR A 1 207 ? 40.235 7.792   22.945 1.00 9.96  ? 229 THR A CB    1 
ATOM   3049 O  OG1   . THR A 1 207 ? 39.913 6.972   24.064 1.00 11.47 ? 229 THR A OG1   1 
ATOM   3050 C  CG2   . THR A 1 207 ? 39.258 8.932   23.078 1.00 11.62 ? 229 THR A CG2   1 
ATOM   3051 H  H     . THR A 1 207 ? 41.583 5.699   22.414 1.00 11.73 ? 229 THR A H     1 
ATOM   3052 H  HA    . THR A 1 207 ? 38.921 6.627   21.622 1.00 10.83 ? 229 THR A HA    1 
ATOM   3053 H  HB    . THR A 1 207 ? 41.253 8.141   22.984 1.00 11.40 ? 229 THR A HB    1 
ATOM   3054 H  HG1   . THR A 1 207 ? 39.545 6.146   23.732 1.00 11.90 ? 229 THR A HG1   1 
ATOM   3055 H  HG21  . THR A 1 207 ? 38.245 8.578   23.177 1.00 10.81 ? 229 THR A HG21  1 
ATOM   3056 H  HG22  . THR A 1 207 ? 39.328 9.580   22.218 1.00 11.20 ? 229 THR A HG22  1 
ATOM   3057 H  HG23  . THR A 1 207 ? 39.514 9.503   23.961 1.00 11.04 ? 229 THR A HG23  1 
ATOM   3058 N  N     . LYS A 1 208 ? 39.477 7.957   19.638 1.00 8.45  ? 230 LYS A N     1 
ATOM   3059 C  CA    . LYS A 1 208 ? 39.709 8.633   18.313 1.00 7.80  ? 230 LYS A CA    1 
ATOM   3060 C  C     . LYS A 1 208 ? 39.904 10.174  18.594 1.00 10.18 ? 230 LYS A C     1 
ATOM   3061 O  O     . LYS A 1 208 ? 38.969 10.965  18.648 1.00 12.96 ? 230 LYS A O     1 
ATOM   3062 C  CB    A LYS A 1 208 ? 38.464 8.316   17.457 0.66 10.49 ? 230 LYS A CB    1 
ATOM   3063 C  CB    B LYS A 1 208 ? 38.452 8.341   17.433 0.31 9.59  ? 230 LYS A CB    1 
ATOM   3064 C  CG    A LYS A 1 208 ? 38.745 8.565   15.958 0.66 10.55 ? 230 LYS A CG    1 
ATOM   3065 C  CG    B LYS A 1 208 ? 38.652 8.791   15.954 0.31 9.47  ? 230 LYS A CG    1 
ATOM   3066 C  CD    A LYS A 1 208 ? 37.522 8.138   15.143 0.66 13.08 ? 230 LYS A CD    1 
ATOM   3067 C  CD    B LYS A 1 208 ? 37.386 8.498   15.086 0.31 10.41 ? 230 LYS A CD    1 
ATOM   3068 C  CE    A LYS A 1 208 ? 37.792 8.330   13.651 0.66 16.86 ? 230 LYS A CE    1 
ATOM   3069 C  CE    B LYS A 1 208 ? 37.126 6.989   14.941 0.31 11.93 ? 230 LYS A CE    1 
ATOM   3070 N  NZ    A LYS A 1 208 ? 36.611 7.820   12.912 0.66 18.38 ? 230 LYS A NZ    1 
ATOM   3071 N  NZ    B LYS A 1 208 ? 35.919 6.744   14.099 0.31 13.86 ? 230 LYS A NZ    1 
ATOM   3072 H  H     . LYS A 1 208 ? 38.557 7.775   19.930 1.00 8.06  ? 230 LYS A H     1 
ATOM   3073 H  HA    . LYS A 1 208 ? 40.606 8.224   17.864 1.00 8.47  ? 230 LYS A HA    1 
ATOM   3074 H  HB2   A LYS A 1 208 ? 38.182 7.283   17.597 0.66 9.86  ? 230 LYS A HB2   1 
ATOM   3075 H  HB2   B LYS A 1 208 ? 38.238 7.285   17.471 0.31 9.14  ? 230 LYS A HB2   1 
ATOM   3076 H  HB3   A LYS A 1 208 ? 37.645 8.947   17.777 0.66 9.58  ? 230 LYS A HB3   1 
ATOM   3077 H  HB3   B LYS A 1 208 ? 37.613 8.884   17.846 0.31 9.02  ? 230 LYS A HB3   1 
ATOM   3078 H  HG2   A LYS A 1 208 ? 38.926 9.620   15.788 0.66 10.88 ? 230 LYS A HG2   1 
ATOM   3079 H  HG2   B LYS A 1 208 ? 38.828 9.859   15.916 0.31 9.84  ? 230 LYS A HG2   1 
ATOM   3080 H  HG3   A LYS A 1 208 ? 39.612 8.005   15.635 0.66 10.79 ? 230 LYS A HG3   1 
ATOM   3081 H  HG3   B LYS A 1 208 ? 39.509 8.297   15.518 0.31 9.93  ? 230 LYS A HG3   1 
ATOM   3082 H  HD2   A LYS A 1 208 ? 37.264 7.105   15.323 0.66 13.37 ? 230 LYS A HD2   1 
ATOM   3083 H  HD2   B LYS A 1 208 ? 36.512 8.967   15.512 0.31 10.62 ? 230 LYS A HD2   1 
ATOM   3084 H  HD3   A LYS A 1 208 ? 36.666 8.749   15.396 0.66 13.09 ? 230 LYS A HD3   1 
ATOM   3085 H  HD3   B LYS A 1 208 ? 37.522 8.920   14.098 0.31 10.54 ? 230 LYS A HD3   1 
ATOM   3086 H  HE2   A LYS A 1 208 ? 37.901 9.377   13.408 0.66 16.34 ? 230 LYS A HE2   1 
ATOM   3087 H  HE2   B LYS A 1 208 ? 37.967 6.509   14.465 0.31 11.90 ? 230 LYS A HE2   1 
ATOM   3088 H  HE3   A LYS A 1 208 ? 38.661 7.789   13.310 0.66 15.89 ? 230 LYS A HE3   1 
ATOM   3089 H  HE3   B LYS A 1 208 ? 36.943 6.531   15.901 0.31 12.32 ? 230 LYS A HE3   1 
ATOM   3090 H  HZ1   A LYS A 1 208 ? 36.205 8.591   12.344 0.66 18.25 ? 230 LYS A HZ1   1 
ATOM   3091 H  HZ1   B LYS A 1 208 ? 35.519 7.650   13.781 0.31 12.97 ? 230 LYS A HZ1   1 
ATOM   3092 H  HZ2   A LYS A 1 208 ? 35.899 7.469   13.585 0.66 18.21 ? 230 LYS A HZ2   1 
ATOM   3093 H  HZ2   B LYS A 1 208 ? 35.208 6.225   14.653 0.31 12.91 ? 230 LYS A HZ2   1 
ATOM   3094 H  HZ3   A LYS A 1 208 ? 36.905 7.046   12.282 0.66 18.32 ? 230 LYS A HZ3   1 
ATOM   3095 H  HZ3   B LYS A 1 208 ? 36.195 6.174   13.274 0.31 13.01 ? 230 LYS A HZ3   1 
ATOM   3096 N  N     . VAL A 1 209 ? 41.136 10.543  18.767 1.00 9.08  ? 231 VAL A N     1 
ATOM   3097 C  CA    . VAL A 1 209 ? 41.491 11.963  19.061 1.00 12.00 ? 231 VAL A CA    1 
ATOM   3098 C  C     . VAL A 1 209 ? 41.041 12.985  18.019 1.00 13.50 ? 231 VAL A C     1 
ATOM   3099 O  O     . VAL A 1 209 ? 40.683 14.082  18.392 1.00 14.35 ? 231 VAL A O     1 
ATOM   3100 C  CB    . VAL A 1 209 ? 43.049 11.991  19.279 1.00 9.08  ? 231 VAL A CB    1 
ATOM   3101 C  CG1   . VAL A 1 209 ? 43.602 13.453  19.529 1.00 8.38  ? 231 VAL A CG1   1 
ATOM   3102 C  CG2   . VAL A 1 209 ? 43.416 11.159  20.526 1.00 10.58 ? 231 VAL A CG2   1 
ATOM   3103 H  H     . VAL A 1 209 ? 41.847 9.870   18.694 1.00 11.26 ? 231 VAL A H     1 
ATOM   3104 H  HA    . VAL A 1 209 ? 40.991 12.229  19.979 1.00 10.59 ? 231 VAL A HA    1 
ATOM   3105 H  HB    . VAL A 1 209 ? 43.546 11.592  18.405 1.00 10.34 ? 231 VAL A HB    1 
ATOM   3106 H  HG11  . VAL A 1 209 ? 43.160 13.901  20.409 1.00 7.71  ? 231 VAL A HG11  1 
ATOM   3107 H  HG12  . VAL A 1 209 ? 43.385 14.087  18.680 1.00 7.63  ? 231 VAL A HG12  1 
ATOM   3108 H  HG13  . VAL A 1 209 ? 44.677 13.418  19.651 1.00 7.93  ? 231 VAL A HG13  1 
ATOM   3109 H  HG21  . VAL A 1 209 ? 43.082 10.140  20.412 1.00 9.45  ? 231 VAL A HG21  1 
ATOM   3110 H  HG22  . VAL A 1 209 ? 42.970 11.566  21.421 1.00 9.90  ? 231 VAL A HG22  1 
ATOM   3111 H  HG23  . VAL A 1 209 ? 44.489 11.153  20.661 1.00 9.56  ? 231 VAL A HG23  1 
ATOM   3112 N  N     . CYS A 1 210 ? 41.060 12.658  16.761 1.00 18.23 ? 232 CYS A N     1 
ATOM   3113 C  CA    . CYS A 1 210 ? 40.630 13.645  15.726 1.00 18.85 ? 232 CYS A CA    1 
ATOM   3114 C  C     . CYS A 1 210 ? 39.203 14.202  15.996 1.00 20.65 ? 232 CYS A C     1 
ATOM   3115 O  O     . CYS A 1 210 ? 38.846 15.274  15.513 1.00 20.31 ? 232 CYS A O     1 
ATOM   3116 C  CB    . CYS A 1 210 ? 40.731 12.953  14.340 1.00 18.73 ? 232 CYS A CB    1 
ATOM   3117 S  SG    . CYS A 1 210 ? 39.635 11.558  14.037 1.00 18.57 ? 232 CYS A SG    1 
ATOM   3118 H  H     . CYS A 1 210 ? 41.356 11.761  16.493 1.00 18.61 ? 232 CYS A H     1 
ATOM   3119 H  HA    . CYS A 1 210 ? 41.325 14.473  15.750 1.00 20.28 ? 232 CYS A HA    1 
ATOM   3120 H  HB2   . CYS A 1 210 ? 40.525 13.691  13.577 1.00 18.67 ? 232 CYS A HB2   1 
ATOM   3121 H  HB3   . CYS A 1 210 ? 41.750 12.628  14.194 1.00 18.24 ? 232 CYS A HB3   1 
ATOM   3122 N  N     . ASN A 1 211 ? 38.453 13.462  16.765 1.00 14.13 ? 233 ASN A N     1 
ATOM   3123 C  CA    . ASN A 1 211 ? 37.054 13.892  17.108 1.00 14.30 ? 233 ASN A CA    1 
ATOM   3124 C  C     . ASN A 1 211 ? 37.039 14.883  18.252 1.00 14.01 ? 233 ASN A C     1 
ATOM   3125 O  O     . ASN A 1 211 ? 36.011 15.476  18.481 1.00 16.10 ? 233 ASN A O     1 
ATOM   3126 C  CB    . ASN A 1 211 ? 36.126 12.753  17.625 1.00 13.83 ? 233 ASN A CB    1 
ATOM   3127 C  CG    . ASN A 1 211 ? 35.720 11.801  16.520 1.00 14.44 ? 233 ASN A CG    1 
ATOM   3128 O  OD1   . ASN A 1 211 ? 36.008 12.010  15.359 1.00 16.88 ? 233 ASN A OD1   1 
ATOM   3129 N  ND2   . ASN A 1 211 ? 35.046 10.743  16.822 1.00 17.89 ? 233 ASN A ND2   1 
ATOM   3130 H  H     . ASN A 1 211 ? 38.819 12.620  17.108 1.00 16.22 ? 233 ASN A H     1 
ATOM   3131 H  HA    . ASN A 1 211 ? 36.613 14.352  16.236 1.00 13.89 ? 233 ASN A HA    1 
ATOM   3132 H  HB2   . ASN A 1 211 ? 36.618 12.195  18.410 1.00 13.56 ? 233 ASN A HB2   1 
ATOM   3133 H  HB3   . ASN A 1 211 ? 35.225 13.179  18.039 1.00 13.16 ? 233 ASN A HB3   1 
ATOM   3134 H  HD21  . ASN A 1 211 ? 34.793 10.092  16.131 1.00 16.76 ? 233 ASN A HD21  1 
ATOM   3135 H  HD22  . ASN A 1 211 ? 34.781 10.587  17.755 1.00 16.08 ? 233 ASN A HD22  1 
ATOM   3136 N  N     . TYR A 1 212 ? 38.134 15.057  18.930 1.00 8.83  ? 234 TYR A N     1 
ATOM   3137 C  CA    . TYR A 1 212 ? 38.194 15.999  20.087 1.00 11.59 ? 234 TYR A CA    1 
ATOM   3138 C  C     . TYR A 1 212 ? 39.103 17.173  19.916 1.00 10.70 ? 234 TYR A C     1 
ATOM   3139 O  O     . TYR A 1 212 ? 39.263 17.891  20.871 1.00 11.18 ? 234 TYR A O     1 
ATOM   3140 C  CB    . TYR A 1 212 ? 38.660 15.203  21.300 1.00 9.51  ? 234 TYR A CB    1 
ATOM   3141 C  CG    . TYR A 1 212 ? 37.730 14.041  21.619 1.00 10.46 ? 234 TYR A CG    1 
ATOM   3142 C  CD1   . TYR A 1 212 ? 36.608 14.272  22.391 1.00 9.40  ? 234 TYR A CD1   1 
ATOM   3143 C  CD2   . TYR A 1 212 ? 37.972 12.765  21.152 1.00 12.41 ? 234 TYR A CD2   1 
ATOM   3144 C  CE1   . TYR A 1 212 ? 35.754 13.267  22.688 1.00 13.33 ? 234 TYR A CE1   1 
ATOM   3145 C  CE2   . TYR A 1 212 ? 37.094 11.753  21.462 1.00 10.96 ? 234 TYR A CE2   1 
ATOM   3146 C  CZ    . TYR A 1 212 ? 35.992 12.004  22.225 1.00 12.22 ? 234 TYR A CZ    1 
ATOM   3147 O  OH    . TYR A 1 212 ? 35.108 11.006  22.531 1.00 13.94 ? 234 TYR A OH    1 
ATOM   3148 H  H     . TYR A 1 212 ? 38.933 14.558  18.666 1.00 10.71 ? 234 TYR A H     1 
ATOM   3149 H  HA    . TYR A 1 212 ? 37.202 16.376  20.289 1.00 10.34 ? 234 TYR A HA    1 
ATOM   3150 H  HB2   . TYR A 1 212 ? 39.650 14.823  21.094 1.00 10.03 ? 234 TYR A HB2   1 
ATOM   3151 H  HB3   . TYR A 1 212 ? 38.718 15.858  22.159 1.00 9.59  ? 234 TYR A HB3   1 
ATOM   3152 H  HD1   . TYR A 1 212 ? 36.393 15.263  22.769 1.00 10.55 ? 234 TYR A HD1   1 
ATOM   3153 H  HD2   . TYR A 1 212 ? 38.838 12.552  20.545 1.00 11.49 ? 234 TYR A HD2   1 
ATOM   3154 H  HE1   . TYR A 1 212 ? 34.880 13.465  23.294 1.00 12.59 ? 234 TYR A HE1   1 
ATOM   3155 H  HE2   . TYR A 1 212 ? 37.288 10.761  21.088 1.00 11.96 ? 234 TYR A HE2   1 
ATOM   3156 H  HH    . TYR A 1 212 ? 35.605 10.199  22.668 1.00 14.58 ? 234 TYR A HH    1 
ATOM   3157 N  N     . VAL A 1 213 ? 39.680 17.391  18.777 1.00 13.43 ? 235 VAL A N     1 
ATOM   3158 C  CA    . VAL A 1 213 ? 40.598 18.559  18.656 1.00 15.74 ? 235 VAL A CA    1 
ATOM   3159 C  C     . VAL A 1 213 ? 39.969 19.922  19.017 1.00 14.23 ? 235 VAL A C     1 
ATOM   3160 O  O     . VAL A 1 213 ? 40.601 20.666  19.748 1.00 15.17 ? 235 VAL A O     1 
ATOM   3161 C  CB    . VAL A 1 213 ? 41.174 18.517  17.195 1.00 19.93 ? 235 VAL A CB    1 
ATOM   3162 C  CG1   . VAL A 1 213 ? 42.189 19.670  16.996 1.00 22.39 ? 235 VAL A CG1   1 
ATOM   3163 C  CG2   . VAL A 1 213 ? 41.957 17.157  17.019 1.00 21.82 ? 235 VAL A CG2   1 
ATOM   3164 H  H     . VAL A 1 213 ? 39.495 16.806  18.017 1.00 14.65 ? 235 VAL A H     1 
ATOM   3165 H  HA    . VAL A 1 213 ? 41.400 18.391  19.360 1.00 15.91 ? 235 VAL A HA    1 
ATOM   3166 H  HB    . VAL A 1 213 ? 40.366 18.606  16.479 1.00 19.88 ? 235 VAL A HB    1 
ATOM   3167 H  HG11  . VAL A 1 213 ? 42.997 19.600  17.710 1.00 21.63 ? 235 VAL A HG11  1 
ATOM   3168 H  HG12  . VAL A 1 213 ? 41.698 20.624  17.124 1.00 21.78 ? 235 VAL A HG12  1 
ATOM   3169 H  HG13  . VAL A 1 213 ? 42.601 19.629  15.996 1.00 21.76 ? 235 VAL A HG13  1 
ATOM   3170 H  HG21  . VAL A 1 213 ? 41.297 16.314  17.165 1.00 21.22 ? 235 VAL A HG21  1 
ATOM   3171 H  HG22  . VAL A 1 213 ? 42.755 17.085  17.743 1.00 20.63 ? 235 VAL A HG22  1 
ATOM   3172 H  HG23  . VAL A 1 213 ? 42.389 17.090  16.030 1.00 21.06 ? 235 VAL A HG23  1 
ATOM   3173 N  N     . SER A 1 214 ? 38.789 20.248  18.544 1.00 13.81 ? 236 SER A N     1 
ATOM   3174 C  CA    . SER A 1 214 ? 38.186 21.569  18.897 1.00 12.43 ? 236 SER A CA    1 
ATOM   3175 C  C     . SER A 1 214 ? 37.952 21.594  20.399 1.00 13.79 ? 236 SER A C     1 
ATOM   3176 O  O     . SER A 1 214 ? 38.163 22.608  21.035 1.00 13.98 ? 236 SER A O     1 
ATOM   3177 C  CB    A SER A 1 214 ? 36.842 21.737  18.157 0.39 13.07 ? 236 SER A CB    1 
ATOM   3178 C  CB    B SER A 1 214 ? 36.855 21.760  18.124 0.37 10.62 ? 236 SER A CB    1 
ATOM   3179 O  OG    A SER A 1 214 ? 36.972 20.906  16.995 0.39 17.66 ? 236 SER A OG    1 
ATOM   3180 O  OG    B SER A 1 214 ? 36.216 20.480  18.124 0.37 11.87 ? 236 SER A OG    1 
ATOM   3181 H  H     . SER A 1 214 ? 38.275 19.658  17.962 1.00 12.65 ? 236 SER A H     1 
ATOM   3182 H  HA    . SER A 1 214 ? 38.868 22.362  18.629 1.00 12.04 ? 236 SER A HA    1 
ATOM   3183 H  HB2   A SER A 1 214 ? 35.997 21.425  18.755 0.39 14.14 ? 236 SER A HB2   1 
ATOM   3184 H  HB2   B SER A 1 214 ? 36.228 22.479  18.634 0.37 11.30 ? 236 SER A HB2   1 
ATOM   3185 H  HB3   A SER A 1 214 ? 36.702 22.770  17.871 0.39 14.09 ? 236 SER A HB3   1 
ATOM   3186 H  HB3   B SER A 1 214 ? 37.029 22.099  17.112 0.37 11.13 ? 236 SER A HB3   1 
ATOM   3187 H  HG    A SER A 1 214 ? 36.767 21.435  16.201 0.39 15.84 ? 236 SER A HG    1 
ATOM   3188 H  HG    B SER A 1 214 ? 35.253 20.661  18.179 0.37 11.17 ? 236 SER A HG    1 
ATOM   3189 N  N     . TRP A 1 215 ? 37.527 20.480  20.950 1.00 14.91 ? 237 TRP A N     1 
ATOM   3190 C  CA    . TRP A 1 215 ? 37.262 20.414  22.428 1.00 13.06 ? 237 TRP A CA    1 
ATOM   3191 C  C     . TRP A 1 215 ? 38.567 20.641  23.182 1.00 14.39 ? 237 TRP A C     1 
ATOM   3192 O  O     . TRP A 1 215 ? 38.580 21.393  24.138 1.00 16.15 ? 237 TRP A O     1 
ATOM   3193 C  CB    . TRP A 1 215 ? 36.696 19.032  22.830 1.00 14.09 ? 237 TRP A CB    1 
ATOM   3194 C  CG    . TRP A 1 215 ? 36.439 19.022  24.339 1.00 13.73 ? 237 TRP A CG    1 
ATOM   3195 C  CD1   . TRP A 1 215 ? 35.410 19.654  24.944 1.00 16.43 ? 237 TRP A CD1   1 
ATOM   3196 C  CD2   . TRP A 1 215 ? 37.195 18.409  25.299 1.00 16.78 ? 237 TRP A CD2   1 
ATOM   3197 N  NE1   . TRP A 1 215 ? 35.596 19.395  26.222 1.00 16.76 ? 237 TRP A NE1   1 
ATOM   3198 C  CE2   . TRP A 1 215 ? 36.641 18.652  26.560 1.00 17.16 ? 237 TRP A CE2   1 
ATOM   3199 C  CE3   . TRP A 1 215 ? 38.357 17.626  25.210 1.00 16.77 ? 237 TRP A CE3   1 
ATOM   3200 C  CZ2   . TRP A 1 215 ? 37.250 18.118  27.706 1.00 19.41 ? 237 TRP A CZ2   1 
ATOM   3201 C  CZ3   . TRP A 1 215 ? 38.962 17.092  26.347 1.00 16.43 ? 237 TRP A CZ3   1 
ATOM   3202 C  CH2   . TRP A 1 215 ? 38.410 17.337  27.603 1.00 16.33 ? 237 TRP A CH2   1 
ATOM   3203 H  H     . TRP A 1 215 ? 37.389 19.688  20.381 1.00 14.59 ? 237 TRP A H     1 
ATOM   3204 H  HA    . TRP A 1 215 ? 36.567 21.199  22.695 1.00 12.44 ? 237 TRP A HA    1 
ATOM   3205 H  HB2   . TRP A 1 215 ? 35.772 18.834  22.311 1.00 14.02 ? 237 TRP A HB2   1 
ATOM   3206 H  HB3   . TRP A 1 215 ? 37.401 18.249  22.592 1.00 14.19 ? 237 TRP A HB3   1 
ATOM   3207 H  HD1   . TRP A 1 215 ? 34.625 20.239  24.491 1.00 16.52 ? 237 TRP A HD1   1 
ATOM   3208 H  HE1   . TRP A 1 215 ? 34.968 19.747  26.889 1.00 16.66 ? 237 TRP A HE1   1 
ATOM   3209 H  HE3   . TRP A 1 215 ? 38.794 17.430  24.242 1.00 17.28 ? 237 TRP A HE3   1 
ATOM   3210 H  HZ2   . TRP A 1 215 ? 36.826 18.312  28.680 1.00 17.72 ? 237 TRP A HZ2   1 
ATOM   3211 H  HZ3   . TRP A 1 215 ? 39.855 16.491  26.253 1.00 15.84 ? 237 TRP A HZ3   1 
ATOM   3212 H  HH2   . TRP A 1 215 ? 38.876 16.926  28.487 1.00 16.99 ? 237 TRP A HH2   1 
ATOM   3213 N  N     . ILE A 1 216 ? 39.628 20.004  22.761 1.00 13.61 ? 238 ILE A N     1 
ATOM   3214 C  CA    . ILE A 1 216 ? 40.942 20.192  23.465 1.00 12.60 ? 238 ILE A CA    1 
ATOM   3215 C  C     . ILE A 1 216 ? 41.369 21.665  23.357 1.00 16.46 ? 238 ILE A C     1 
ATOM   3216 O  O     . ILE A 1 216 ? 41.748 22.269  24.348 1.00 15.74 ? 238 ILE A O     1 
ATOM   3217 C  CB    . ILE A 1 216 ? 42.012 19.248  22.812 1.00 11.29 ? 238 ILE A CB    1 
ATOM   3218 C  CG1   . ILE A 1 216 ? 41.676 17.782  23.164 1.00 11.30 ? 238 ILE A CG1   1 
ATOM   3219 C  CG2   . ILE A 1 216 ? 43.449 19.591  23.292 1.00 11.45 ? 238 ILE A CG2   1 
ATOM   3220 C  CD1   . ILE A 1 216 ? 42.532 16.823  22.300 1.00 14.39 ? 238 ILE A CD1   1 
ATOM   3221 H  H     . ILE A 1 216 ? 39.554 19.408  21.984 1.00 14.92 ? 238 ILE A H     1 
ATOM   3222 H  HA    . ILE A 1 216 ? 40.797 19.957  24.507 1.00 12.98 ? 238 ILE A HA    1 
ATOM   3223 H  HB    . ILE A 1 216 ? 41.977 19.392  21.741 1.00 11.40 ? 238 ILE A HB    1 
ATOM   3224 H  HG12  . ILE A 1 216 ? 41.839 17.595  24.214 1.00 11.41 ? 238 ILE A HG12  1 
ATOM   3225 H  HG13  . ILE A 1 216 ? 40.634 17.590  22.953 1.00 12.57 ? 238 ILE A HG13  1 
ATOM   3226 H  HG21  . ILE A 1 216 ? 43.517 19.498  24.366 1.00 12.07 ? 238 ILE A HG21  1 
ATOM   3227 H  HG22  . ILE A 1 216 ? 43.709 20.608  23.035 1.00 10.44 ? 238 ILE A HG22  1 
ATOM   3228 H  HG23  . ILE A 1 216 ? 44.190 18.948  22.844 1.00 11.04 ? 238 ILE A HG23  1 
ATOM   3229 H  HD11  . ILE A 1 216 ? 43.582 16.957  22.507 1.00 12.64 ? 238 ILE A HD11  1 
ATOM   3230 H  HD12  . ILE A 1 216 ? 42.360 16.996  21.246 1.00 12.05 ? 238 ILE A HD12  1 
ATOM   3231 H  HD13  . ILE A 1 216 ? 42.270 15.800  22.515 1.00 12.41 ? 238 ILE A HD13  1 
ATOM   3232 N  N     . LYS A 1 217 ? 41.298 22.181  22.155 1.00 15.61 ? 239 LYS A N     1 
ATOM   3233 C  CA    . LYS A 1 217 ? 41.689 23.596  21.914 1.00 17.21 ? 239 LYS A CA    1 
ATOM   3234 C  C     . LYS A 1 217 ? 40.884 24.570  22.716 1.00 16.04 ? 239 LYS A C     1 
ATOM   3235 O  O     . LYS A 1 217 ? 41.473 25.434  23.333 1.00 13.98 ? 239 LYS A O     1 
ATOM   3236 C  CB    . LYS A 1 217 ? 41.536 23.923  20.420 1.00 20.65 ? 239 LYS A CB    1 
ATOM   3237 C  CG    . LYS A 1 217 ? 42.616 23.159  19.601 1.00 22.96 ? 239 LYS A CG    1 
ATOM   3238 C  CD    . LYS A 1 217 ? 42.448 23.476  18.099 0.15 21.60 ? 239 LYS A CD    1 
ATOM   3239 C  CE    . LYS A 1 217 ? 43.653 22.908  17.321 0.15 21.98 ? 239 LYS A CE    1 
ATOM   3240 N  NZ    . LYS A 1 217 ? 43.469 23.161  15.865 0.15 22.11 ? 239 LYS A NZ    1 
ATOM   3241 H  H     . LYS A 1 217 ? 40.982 21.626  21.407 1.00 16.56 ? 239 LYS A H     1 
ATOM   3242 H  HA    . LYS A 1 217 ? 42.721 23.700  22.219 1.00 17.86 ? 239 LYS A HA    1 
ATOM   3243 H  HB2   . LYS A 1 217 ? 40.537 23.666  20.093 1.00 20.51 ? 239 LYS A HB2   1 
ATOM   3244 H  HB3   . LYS A 1 217 ? 41.677 24.986  20.294 1.00 20.71 ? 239 LYS A HB3   1 
ATOM   3245 H  HG2   . LYS A 1 217 ? 43.601 23.458  19.937 1.00 22.57 ? 239 LYS A HG2   1 
ATOM   3246 H  HG3   . LYS A 1 217 ? 42.510 22.095  19.774 1.00 22.42 ? 239 LYS A HG3   1 
ATOM   3247 H  HD2   . LYS A 1 217 ? 41.538 23.023  17.729 0.15 21.89 ? 239 LYS A HD2   1 
ATOM   3248 H  HD3   . LYS A 1 217 ? 42.389 24.544  17.940 0.15 21.87 ? 239 LYS A HD3   1 
ATOM   3249 H  HE2   . LYS A 1 217 ? 44.568 23.391  17.634 0.15 21.66 ? 239 LYS A HE2   1 
ATOM   3250 H  HE3   . LYS A 1 217 ? 43.754 21.844  17.474 0.15 21.69 ? 239 LYS A HE3   1 
ATOM   3251 H  HZ1   . LYS A 1 217 ? 44.253 23.745  15.511 0.15 22.15 ? 239 LYS A HZ1   1 
ATOM   3252 H  HZ2   . LYS A 1 217 ? 42.569 23.660  15.709 0.15 22.14 ? 239 LYS A HZ2   1 
ATOM   3253 H  HZ3   . LYS A 1 217 ? 43.453 22.255  15.355 0.15 22.15 ? 239 LYS A HZ3   1 
ATOM   3254 N  N     . GLN A 1 218 ? 39.588 24.422  22.698 1.00 16.03 ? 240 GLN A N     1 
ATOM   3255 C  CA    . GLN A 1 218 ? 38.703 25.354  23.468 1.00 16.95 ? 240 GLN A CA    1 
ATOM   3256 C  C     . GLN A 1 218 ? 38.908 25.189  24.947 1.00 14.19 ? 240 GLN A C     1 
ATOM   3257 O  O     . GLN A 1 218 ? 38.918 26.158  25.678 1.00 13.36 ? 240 GLN A O     1 
ATOM   3258 C  CB    . GLN A 1 218 ? 37.222 25.103  23.140 1.00 18.70 ? 240 GLN A CB    1 
ATOM   3259 C  CG    . GLN A 1 218 ? 36.968 25.435  21.650 1.00 21.76 ? 240 GLN A CG    1 
ATOM   3260 C  CD    . GLN A 1 218 ? 35.509 25.086  21.262 1.00 26.43 ? 240 GLN A CD    1 
ATOM   3261 O  OE1   . GLN A 1 218 ? 34.891 24.205  21.840 1.00 30.62 ? 240 GLN A OE1   1 
ATOM   3262 N  NE2   . GLN A 1 218 ? 34.931 25.740  20.291 1.00 27.26 ? 240 GLN A NE2   1 
ATOM   3263 H  H     . GLN A 1 218 ? 39.198 23.691  22.172 1.00 15.94 ? 240 GLN A H     1 
ATOM   3264 H  HA    . GLN A 1 218 ? 38.980 26.363  23.204 1.00 17.78 ? 240 GLN A HA    1 
ATOM   3265 H  HB2   . GLN A 1 218 ? 36.956 24.076  23.345 1.00 19.07 ? 240 GLN A HB2   1 
ATOM   3266 H  HB3   . GLN A 1 218 ? 36.610 25.741  23.762 1.00 18.61 ? 240 GLN A HB3   1 
ATOM   3267 H  HG2   . GLN A 1 218 ? 37.127 26.493  21.499 1.00 22.05 ? 240 GLN A HG2   1 
ATOM   3268 H  HG3   . GLN A 1 218 ? 37.642 24.893  21.002 1.00 21.94 ? 240 GLN A HG3   1 
ATOM   3269 H  HE21  . GLN A 1 218 ? 34.005 25.533  20.035 1.00 26.65 ? 240 GLN A HE21  1 
ATOM   3270 H  HE22  . GLN A 1 218 ? 35.422 26.442  19.817 1.00 26.56 ? 240 GLN A HE22  1 
ATOM   3271 N  N     . THR A 1 219 ? 39.067 23.983  25.387 1.00 12.76 ? 241 THR A N     1 
ATOM   3272 C  CA    . THR A 1 219 ? 39.282 23.784  26.829 1.00 13.93 ? 241 THR A CA    1 
ATOM   3273 C  C     . THR A 1 219 ? 40.617 24.383  27.318 1.00 14.50 ? 241 THR A C     1 
ATOM   3274 O  O     . THR A 1 219 ? 40.668 24.983  28.379 1.00 15.22 ? 241 THR A O     1 
ATOM   3275 C  CB    . THR A 1 219 ? 39.210 22.286  27.058 1.00 13.31 ? 241 THR A CB    1 
ATOM   3276 O  OG1   . THR A 1 219 ? 37.902 21.942  26.606 1.00 13.16 ? 241 THR A OG1   1 
ATOM   3277 C  CG2   . THR A 1 219 ? 39.215 21.995  28.558 1.00 14.46 ? 241 THR A CG2   1 
ATOM   3278 H  H     . THR A 1 219 ? 39.033 23.212  24.782 1.00 14.53 ? 241 THR A H     1 
ATOM   3279 H  HA    . THR A 1 219 ? 38.481 24.294  27.347 1.00 13.01 ? 241 THR A HA    1 
ATOM   3280 H  HB    . THR A 1 219 ? 39.962 21.734  26.509 1.00 13.96 ? 241 THR A HB    1 
ATOM   3281 H  HG1   . THR A 1 219 ? 37.968 21.380  25.817 1.00 12.50 ? 241 THR A HG1   1 
ATOM   3282 H  HG21  . THR A 1 219 ? 38.366 22.456  29.043 1.00 14.35 ? 241 THR A HG21  1 
ATOM   3283 H  HG22  . THR A 1 219 ? 40.118 22.364  29.025 1.00 13.32 ? 241 THR A HG22  1 
ATOM   3284 H  HG23  . THR A 1 219 ? 39.159 20.928  28.725 1.00 14.57 ? 241 THR A HG23  1 
ATOM   3285 N  N     . ILE A 1 220 ? 41.656 24.201  26.552 1.00 16.18 ? 242 ILE A N     1 
ATOM   3286 C  CA    . ILE A 1 220 ? 43.003 24.740  26.929 1.00 17.68 ? 242 ILE A CA    1 
ATOM   3287 C  C     . ILE A 1 220 ? 42.950 26.263  26.849 1.00 16.19 ? 242 ILE A C     1 
ATOM   3288 O  O     . ILE A 1 220 ? 43.513 26.929  27.692 1.00 18.27 ? 242 ILE A O     1 
ATOM   3289 C  CB    . ILE A 1 220 ? 44.117 24.187  25.937 1.00 18.90 ? 242 ILE A CB    1 
ATOM   3290 C  CG1   . ILE A 1 220 ? 44.373 22.667  26.196 1.00 22.85 ? 242 ILE A CG1   1 
ATOM   3291 C  CG2   . ILE A 1 220 ? 45.440 24.972  26.069 1.00 21.43 ? 242 ILE A CG2   1 
ATOM   3292 C  CD1   . ILE A 1 220 ? 45.475 22.140  25.249 1.00 23.29 ? 242 ILE A CD1   1 
ATOM   3293 H  H     . ILE A 1 220 ? 41.556 23.700  25.711 1.00 15.76 ? 242 ILE A H     1 
ATOM   3294 H  HA    . ILE A 1 220 ? 43.218 24.463  27.953 1.00 18.35 ? 242 ILE A HA    1 
ATOM   3295 H  HB    . ILE A 1 220 ? 43.774 24.313  24.920 1.00 20.10 ? 242 ILE A HB    1 
ATOM   3296 H  HG12  . ILE A 1 220 ? 44.678 22.511  27.222 1.00 22.13 ? 242 ILE A HG12  1 
ATOM   3297 H  HG13  . ILE A 1 220 ? 43.467 22.103  26.025 1.00 22.24 ? 242 ILE A HG13  1 
ATOM   3298 H  HG21  . ILE A 1 220 ? 45.835 24.873  27.071 1.00 20.71 ? 242 ILE A HG21  1 
ATOM   3299 H  HG22  . ILE A 1 220 ? 45.278 26.020  25.865 1.00 20.69 ? 242 ILE A HG22  1 
ATOM   3300 H  HG23  . ILE A 1 220 ? 46.177 24.618  25.366 1.00 20.79 ? 242 ILE A HG23  1 
ATOM   3301 H  HD11  . ILE A 1 220 ? 46.422 22.617  25.449 1.00 22.62 ? 242 ILE A HD11  1 
ATOM   3302 H  HD12  . ILE A 1 220 ? 45.213 22.309  24.214 1.00 22.92 ? 242 ILE A HD12  1 
ATOM   3303 H  HD13  . ILE A 1 220 ? 45.589 21.079  25.410 1.00 22.89 ? 242 ILE A HD13  1 
ATOM   3304 N  N     . ALA A 1 221 ? 42.292 26.756  25.836 1.00 14.68 ? 243 ALA A N     1 
ATOM   3305 C  CA    . ALA A 1 221 ? 42.197 28.222  25.693 1.00 15.98 ? 243 ALA A CA    1 
ATOM   3306 C  C     . ALA A 1 221 ? 41.435 28.838  26.869 1.00 17.59 ? 243 ALA A C     1 
ATOM   3307 O  O     . ALA A 1 221 ? 41.667 29.992  27.160 1.00 20.83 ? 243 ALA A O     1 
ATOM   3308 C  CB    . ALA A 1 221 ? 41.479 28.572  24.414 1.00 17.20 ? 243 ALA A CB    1 
ATOM   3309 H  H     . ALA A 1 221 ? 41.865 26.161  25.182 1.00 13.78 ? 243 ALA A H     1 
ATOM   3310 H  HA    . ALA A 1 221 ? 43.197 28.628  25.699 1.00 17.27 ? 243 ALA A HA    1 
ATOM   3311 H  HB1   . ALA A 1 221 ? 40.474 28.179  24.438 1.00 16.67 ? 243 ALA A HB1   1 
ATOM   3312 H  HB2   . ALA A 1 221 ? 41.995 28.175  23.556 1.00 16.81 ? 243 ALA A HB2   1 
ATOM   3313 H  HB3   . ALA A 1 221 ? 41.431 29.650  24.338 1.00 16.67 ? 243 ALA A HB3   1 
ATOM   3314 N  N     . SER A 1 222 ? 40.556 28.110  27.501 1.00 16.26 ? 244 SER A N     1 
ATOM   3315 C  CA    . SER A 1 222 ? 39.834 28.724  28.641 1.00 16.14 ? 244 SER A CA    1 
ATOM   3316 C  C     . SER A 1 222 ? 40.346 28.297  30.039 1.00 16.34 ? 244 SER A C     1 
ATOM   3317 O  O     . SER A 1 222 ? 39.706 28.598  31.035 1.00 19.28 ? 244 SER A O     1 
ATOM   3318 C  CB    A SER A 1 222 ? 38.301 28.387  28.476 0.61 15.92 ? 244 SER A CB    1 
ATOM   3319 C  CB    B SER A 1 222 ? 38.352 28.362  28.477 0.25 15.59 ? 244 SER A CB    1 
ATOM   3320 O  OG    A SER A 1 222 ? 38.145 26.999  28.161 0.61 15.01 ? 244 SER A OG    1 
ATOM   3321 O  OG    B SER A 1 222 ? 38.055 28.625  27.102 0.25 14.51 ? 244 SER A OG    1 
ATOM   3322 H  H     . SER A 1 222 ? 40.365 27.192  27.216 1.00 17.15 ? 244 SER A H     1 
ATOM   3323 H  HA    . SER A 1 222 ? 39.942 29.801  28.585 1.00 16.31 ? 244 SER A HA    1 
ATOM   3324 H  HB2   A SER A 1 222 ? 37.792 28.589  29.409 0.61 15.82 ? 244 SER A HB2   1 
ATOM   3325 H  HB2   B SER A 1 222 ? 38.183 27.321  28.716 0.25 15.41 ? 244 SER A HB2   1 
ATOM   3326 H  HB3   A SER A 1 222 ? 37.855 28.998  27.705 0.61 15.82 ? 244 SER A HB3   1 
ATOM   3327 H  HB3   B SER A 1 222 ? 37.744 28.986  29.118 0.25 15.46 ? 244 SER A HB3   1 
ATOM   3328 H  HG    A SER A 1 222 ? 38.954 26.528  28.397 0.61 16.58 ? 244 SER A HG    1 
ATOM   3329 H  HG    B SER A 1 222 ? 37.570 29.462  27.086 0.25 15.32 ? 244 SER A HG    1 
ATOM   3330 N  N     . ASN A 1 223 ? 41.470 27.637  30.099 1.00 15.28 ? 245 ASN A N     1 
ATOM   3331 C  CA    . ASN A 1 223 ? 42.019 27.177  31.411 1.00 18.97 ? 245 ASN A CA    1 
ATOM   3332 C  C     . ASN A 1 223 ? 43.504 27.502  31.586 1.00 23.36 ? 245 ASN A C     1 
ATOM   3333 O  O     . ASN A 1 223 ? 44.042 27.033  32.579 1.00 24.06 ? 245 ASN A O     1 
ATOM   3334 C  CB    . ASN A 1 223 ? 41.828 25.639  31.539 1.00 15.44 ? 245 ASN A CB    1 
ATOM   3335 C  CG    . ASN A 1 223 ? 40.412 25.313  32.006 1.00 17.28 ? 245 ASN A CG    1 
ATOM   3336 O  OD1   . ASN A 1 223 ? 40.071 25.416  33.169 1.00 18.12 ? 245 ASN A OD1   1 
ATOM   3337 N  ND2   . ASN A 1 223 ? 39.524 24.921  31.152 1.00 18.71 ? 245 ASN A ND2   1 
ATOM   3338 O  OXT   . ASN A 1 223 ? 44.009 28.188  30.720 1.00 28.13 ? 245 ASN A OXT   1 
ATOM   3339 H  H     . ASN A 1 223 ? 42.000 27.447  29.294 1.00 16.86 ? 245 ASN A H     1 
ATOM   3340 H  HA    . ASN A 1 223 ? 41.491 27.692  32.199 1.00 17.75 ? 245 ASN A HA    1 
ATOM   3341 H  HB2   . ASN A 1 223 ? 42.036 25.168  30.592 1.00 16.64 ? 245 ASN A HB2   1 
ATOM   3342 H  HB3   . ASN A 1 223 ? 42.522 25.251  32.269 1.00 16.85 ? 245 ASN A HB3   1 
ATOM   3343 H  HD21  . ASN A 1 223 ? 38.618 24.700  31.455 1.00 18.79 ? 245 ASN A HD21  1 
ATOM   3344 H  HD22  . ASN A 1 223 ? 39.756 24.841  30.203 1.00 18.54 ? 245 ASN A HD22  1 
HETATM 3345 CA CA    . CA  B 2 .   ? 63.945 6.981   35.246 1.00 28.92 ? 247 CA  A CA    1 
HETATM 3346 CL CL    . CL  C 3 .   ? 27.317 -2.766  16.026 0.86 37.64 ? 260 CL  A CL    1 
HETATM 3347 C  C1    . 696 D 4 .   ? 44.257 -3.090  26.623 1.00 18.56 ? 246 696 A C1    1 
HETATM 3348 C  C2    . 696 D 4 .   ? 44.616 -1.699  26.614 1.00 19.13 ? 246 696 A C2    1 
HETATM 3349 C  C3    . 696 D 4 .   ? 44.597 -0.910  27.763 1.00 17.88 ? 246 696 A C3    1 
HETATM 3350 C  C4    . 696 D 4 .   ? 44.219 -1.522  28.912 1.00 18.19 ? 246 696 A C4    1 
HETATM 3351 C  C5    . 696 D 4 .   ? 43.876 -2.811  28.995 1.00 19.16 ? 246 696 A C5    1 
HETATM 3352 C  C6    . 696 D 4 .   ? 43.874 -3.649  27.875 1.00 18.52 ? 246 696 A C6    1 
HETATM 3353 C  C7    . 696 D 4 .   ? 44.309 -3.833  25.428 1.00 20.16 ? 246 696 A C7    1 
HETATM 3354 N  N1    . 696 D 4 .   ? 44.029 -5.116  25.428 1.00 23.43 ? 246 696 A N1    1 
HETATM 3355 N  N2    . 696 D 4 .   ? 44.639 -3.235  24.300 1.00 19.49 ? 246 696 A N2    1 
HETATM 3356 N  N3    . 696 D 4 .   ? 44.138 -1.027  30.093 1.00 19.80 ? 246 696 A N3    1 
HETATM 3357 C  CN4   . 696 D 4 .   ? 43.563 -3.165  30.236 1.00 21.27 ? 246 696 A CN4   1 
HETATM 3358 C  C8    . 696 D 4 .   ? 43.752 -2.010  30.846 1.00 20.82 ? 246 696 A C8    1 
HETATM 3359 C  "C1'" . 696 D 4 .   ? 43.493 -1.860  32.210 1.00 19.94 ? 246 696 A "C1'" 1 
HETATM 3360 C  "C2'" . 696 D 4 .   ? 43.246 -2.961  33.023 1.00 18.71 ? 246 696 A "C2'" 1 
HETATM 3361 C  "C3'" . 696 D 4 .   ? 42.984 -2.826  34.367 1.00 16.41 ? 246 696 A "C3'" 1 
HETATM 3362 C  "C4'" . 696 D 4 .   ? 42.959 -1.575  34.936 1.00 18.97 ? 246 696 A "C4'" 1 
HETATM 3363 C  "C5'" . 696 D 4 .   ? 43.198 -0.406  34.179 1.00 22.12 ? 246 696 A "C5'" 1 
HETATM 3364 C  "C6'" . 696 D 4 .   ? 43.464 -0.589  32.821 1.00 19.13 ? 246 696 A "C6'" 1 
HETATM 3365 O  "O6'" . 696 D 4 .   ? 43.727 0.521   32.046 1.00 19.93 ? 246 696 A "O6'" 1 
HETATM 3366 C  C1B   . 696 D 4 .   ? 43.138 0.868   34.792 1.00 25.34 ? 246 696 A C1B   1 
HETATM 3367 C  C2B   . 696 D 4 .   ? 44.127 1.828   34.631 1.00 25.64 ? 246 696 A C2B   1 
HETATM 3368 C  C3B   . 696 D 4 .   ? 44.073 3.055   35.257 1.00 25.19 ? 246 696 A C3B   1 
HETATM 3369 C  C4B   . 696 D 4 .   ? 43.017 3.377   36.072 1.00 27.86 ? 246 696 A C4B   1 
HETATM 3370 C  C5B   . 696 D 4 .   ? 41.994 2.458   36.269 1.00 28.85 ? 246 696 A C5B   1 
HETATM 3371 C  C6B   . 696 D 4 .   ? 42.062 1.222   35.631 1.00 28.67 ? 246 696 A C6B   1 
HETATM 3372 H  H2    . 696 D 4 .   ? 44.916 -1.225  25.694 1.00 17.18 ? 246 696 A H2    1 
HETATM 3373 H  H3    . 696 D 4 .   ? 44.866 0.133   27.750 1.00 18.69 ? 246 696 A H3    1 
HETATM 3374 H  H6    . 696 D 4 .   ? 43.588 -4.685  27.964 1.00 18.74 ? 246 696 A H6    1 
HETATM 3375 H  HH11  . 696 D 4 .   ? 43.798 -5.558  26.310 1.00 23.96 ? 246 696 A HH11  1 
HETATM 3376 H  HH12  . 696 D 4 .   ? 44.047 -5.716  24.633 1.00 22.28 ? 246 696 A HH12  1 
HETATM 3377 H  HH21  . 696 D 4 .   ? 44.836 -2.248  24.298 1.00 19.78 ? 246 696 A HH21  1 
HETATM 3378 H  HH22  . 696 D 4 .   ? 44.752 -3.717  23.435 1.00 19.66 ? 246 696 A HH22  1 
HETATM 3379 H  HN3   . 696 D 4 .   ? 44.335 -0.107  30.345 1.00 19.18 ? 246 696 A HN3   1 
HETATM 3380 H  "H2'" . 696 D 4 .   ? 43.261 -3.950  32.590 1.00 18.67 ? 246 696 A "H2'" 1 
HETATM 3381 H  "H3'" . 696 D 4 .   ? 42.798 -3.697  34.974 1.00 17.83 ? 246 696 A "H3'" 1 
HETATM 3382 H  "H4'" . 696 D 4 .   ? 42.749 -1.496  35.992 1.00 18.94 ? 246 696 A "H4'" 1 
HETATM 3383 H  H2B   . 696 D 4 .   ? 44.960 1.612   33.988 1.00 26.51 ? 246 696 A H2B   1 
HETATM 3384 H  H3B   . 696 D 4 .   ? 44.866 3.768   35.113 1.00 26.95 ? 246 696 A H3B   1 
HETATM 3385 H  H4B   . 696 D 4 .   ? 42.986 4.342   36.552 1.00 27.77 ? 246 696 A H4B   1 
HETATM 3386 H  H5B   . 696 D 4 .   ? 41.155 2.699   36.907 1.00 27.61 ? 246 696 A H5B   1 
HETATM 3387 H  H6B   . 696 D 4 .   ? 41.257 0.519   35.789 1.00 28.22 ? 246 696 A H6B   1 
HETATM 3388 O  O     . HOH E 5 .   ? 62.763 7.512   37.133 1.00 14.05 ? 248 HOH A O     1 
HETATM 3389 H  H1    . HOH E 5 .   ? 62.927 7.220   38.088 1.00 15.36 ? 248 HOH A H1    1 
HETATM 3390 H  H2    . HOH E 5 .   ? 61.825 7.756   37.341 1.00 16.27 ? 248 HOH A H2    1 
HETATM 3391 O  O     . HOH E 5 .   ? 37.139 2.040   7.853  1.00 32.42 ? 249 HOH A O     1 
HETATM 3392 H  H1    . HOH E 5 .   ? 37.324 1.540   7.027  1.00 31.59 ? 249 HOH A H1    1 
HETATM 3393 H  H2    . HOH E 5 .   ? 37.756 2.778   7.729  1.00 31.68 ? 249 HOH A H2    1 
HETATM 3394 O  O     . HOH E 5 .   ? 57.253 5.097   41.274 1.00 23.75 ? 250 HOH A O     1 
HETATM 3395 H  H1    . HOH E 5 .   ? 57.992 5.598   41.638 1.00 23.42 ? 250 HOH A H1    1 
HETATM 3396 H  H2    . HOH E 5 .   ? 57.676 4.625   40.527 1.00 23.78 ? 250 HOH A H2    1 
HETATM 3397 O  O     . HOH E 5 .   ? 45.017 -8.198  20.206 1.00 22.60 ? 252 HOH A O     1 
HETATM 3398 H  H1    . HOH E 5 .   ? 44.163 -8.011  20.634 1.00 22.94 ? 252 HOH A H1    1 
HETATM 3399 H  H2    . HOH E 5 .   ? 44.678 -8.696  19.437 1.00 22.88 ? 252 HOH A H2    1 
HETATM 3400 O  O     . HOH E 5 .   ? 36.582 6.071   35.596 1.00 35.47 ? 253 HOH A O     1 
HETATM 3401 H  H1    . HOH E 5 .   ? 37.126 6.266   36.376 1.00 36.30 ? 253 HOH A H1    1 
HETATM 3402 H  H2    . HOH E 5 .   ? 36.557 5.105   35.647 1.00 35.97 ? 253 HOH A H2    1 
HETATM 3403 O  O     . HOH E 5 .   ? 52.404 3.393   29.948 1.00 13.69 ? 254 HOH A O     1 
HETATM 3404 H  H1    . HOH E 5 .   ? 52.104 3.880   29.151 1.00 12.70 ? 254 HOH A H1    1 
HETATM 3405 H  H2    . HOH E 5 .   ? 51.570 3.224   30.405 1.00 12.94 ? 254 HOH A H2    1 
HETATM 3406 O  O     . HOH E 5 .   ? 33.725 16.692  22.555 1.00 28.72 ? 255 HOH A O     1 
HETATM 3407 H  H1    . HOH E 5 .   ? 33.798 17.522  22.084 1.00 29.18 ? 255 HOH A H1    1 
HETATM 3408 H  H2    . HOH E 5 .   ? 33.883 16.071  21.804 1.00 28.72 ? 255 HOH A H2    1 
HETATM 3409 O  O     . HOH E 5 .   ? 60.822 21.081  34.565 1.00 36.61 ? 256 HOH A O     1 
HETATM 3410 H  H1    . HOH E 5 .   ? 60.862 20.571  33.730 1.00 37.25 ? 256 HOH A H1    1 
HETATM 3411 H  H2    . HOH E 5 .   ? 61.053 20.402  35.227 1.00 37.14 ? 256 HOH A H2    1 
HETATM 3412 O  O     . HOH E 5 .   ? 61.064 8.018   25.224 1.00 16.80 ? 258 HOH A O     1 
HETATM 3413 H  H1    . HOH E 5 .   ? 60.260 7.886   24.704 1.00 17.69 ? 258 HOH A H1    1 
HETATM 3414 H  H2    . HOH E 5 .   ? 60.658 8.503   25.983 1.00 18.21 ? 258 HOH A H2    1 
HETATM 3415 O  O     . HOH E 5 .   ? 50.280 19.723  19.964 1.00 36.86 ? 259 HOH A O     1 
HETATM 3416 H  H1    . HOH E 5 .   ? 50.690 20.165  20.726 1.00 36.23 ? 259 HOH A H1    1 
HETATM 3417 H  H2    . HOH E 5 .   ? 50.733 18.859  20.033 1.00 36.72 ? 259 HOH A H2    1 
HETATM 3418 O  O     . HOH E 5 .   ? 53.934 6.530   20.639 1.00 8.21  ? 261 HOH A O     1 
HETATM 3419 H  H1    . HOH E 5 .   ? 53.810 6.065   19.798 1.00 9.94  ? 261 HOH A H1    1 
HETATM 3420 H  H2    . HOH E 5 .   ? 53.040 6.483   21.003 1.00 8.71  ? 261 HOH A H2    1 
HETATM 3421 O  O     . HOH E 5 .   ? 51.255 4.089   27.574 1.00 13.78 ? 262 HOH A O     1 
HETATM 3422 H  H1    . HOH E 5 .   ? 50.315 4.044   27.340 1.00 13.28 ? 262 HOH A H1    1 
HETATM 3423 H  H2    . HOH E 5 .   ? 51.700 3.945   26.715 1.00 12.45 ? 262 HOH A H2    1 
HETATM 3424 O  O     . HOH E 5 .   ? 56.117 -0.993  34.444 1.00 25.02 ? 263 HOH A O     1 
HETATM 3425 H  H1    . HOH E 5 .   ? 55.468 -0.955  33.721 1.00 24.40 ? 263 HOH A H1    1 
HETATM 3426 H  H2    . HOH E 5 .   ? 56.956 -1.100  33.960 1.00 24.71 ? 263 HOH A H2    1 
HETATM 3427 O  O     . HOH E 5 .   ? 55.100 -2.215  28.040 1.00 11.78 ? 264 HOH A O     1 
HETATM 3428 H  H1    . HOH E 5 .   ? 55.145 -2.637  28.917 1.00 10.45 ? 264 HOH A H1    1 
HETATM 3429 H  H2    . HOH E 5 .   ? 55.751 -1.493  28.085 1.00 10.76 ? 264 HOH A H2    1 
HETATM 3430 O  O     . HOH E 5 .   ? 58.372 10.067  30.478 1.00 10.61 ? 266 HOH A O     1 
HETATM 3431 H  H1    . HOH E 5 .   ? 57.768 10.385  31.166 1.00 10.08 ? 266 HOH A H1    1 
HETATM 3432 H  H2    . HOH E 5 .   ? 57.888 10.278  29.656 1.00 9.59  ? 266 HOH A H2    1 
HETATM 3433 O  O     . HOH E 5 .   ? 58.603 12.698  27.937 1.00 17.87 ? 267 HOH A O     1 
HETATM 3434 H  H1    . HOH E 5 .   ? 57.961 11.968  27.888 1.00 18.69 ? 267 HOH A H1    1 
HETATM 3435 H  H2    . HOH E 5 .   ? 58.576 13.053  27.031 1.00 18.66 ? 267 HOH A H2    1 
HETATM 3436 O  O     . HOH E 5 .   ? 31.420 0.660   24.632 1.00 32.73 ? 268 HOH A O     1 
HETATM 3437 H  H1    . HOH E 5 .   ? 32.150 0.983   25.189 1.00 33.46 ? 268 HOH A H1    1 
HETATM 3438 H  H2    . HOH E 5 .   ? 31.878 0.470   23.787 1.00 33.86 ? 268 HOH A H2    1 
HETATM 3439 O  O     . HOH E 5 .   ? 40.369 6.349   11.813 1.00 64.16 ? 269 HOH A O     1 
HETATM 3440 H  H1    . HOH E 5 .   ? 40.776 6.721   10.999 1.00 64.69 ? 269 HOH A H1    1 
HETATM 3441 H  H2    . HOH E 5 .   ? 40.069 5.489   11.475 1.00 64.44 ? 269 HOH A H2    1 
HETATM 3442 O  O     . HOH E 5 .   ? 62.016 11.169  26.659 1.00 24.93 ? 270 HOH A O     1 
HETATM 3443 H  H1    . HOH E 5 .   ? 62.103 12.137  26.491 1.00 26.94 ? 270 HOH A H1    1 
HETATM 3444 H  H2    . HOH E 5 .   ? 61.593 10.893  25.844 1.00 26.72 ? 270 HOH A H2    1 
HETATM 3445 O  O     . HOH E 5 .   ? 67.121 8.971   29.551 1.00 41.48 ? 272 HOH A O     1 
HETATM 3446 H  H1    . HOH E 5 .   ? 67.693 8.185   29.475 1.00 40.73 ? 272 HOH A H1    1 
HETATM 3447 H  H2    . HOH E 5 .   ? 67.025 9.263   28.621 1.00 41.06 ? 272 HOH A H2    1 
HETATM 3448 O  O     . HOH E 5 .   ? 63.064 1.869   25.969 1.00 18.09 ? 273 HOH A O     1 
HETATM 3449 H  H1    . HOH E 5 .   ? 62.790 2.768   25.736 1.00 17.22 ? 273 HOH A H1    1 
HETATM 3450 H  H2    . HOH E 5 .   ? 62.211 1.384   25.939 1.00 17.76 ? 273 HOH A H2    1 
HETATM 3451 O  O     . HOH E 5 .   ? 62.350 6.332   26.975 1.00 20.26 ? 274 HOH A O     1 
HETATM 3452 H  H1    . HOH E 5 .   ? 61.898 6.824   27.687 1.00 20.64 ? 274 HOH A H1    1 
HETATM 3453 H  H2    . HOH E 5 .   ? 61.916 6.725   26.188 1.00 20.25 ? 274 HOH A H2    1 
HETATM 3454 O  O     . HOH E 5 .   ? 59.789 9.188   27.452 1.00 22.72 ? 275 HOH A O     1 
HETATM 3455 H  H1    . HOH E 5 .   ? 60.116 10.087  27.595 1.00 21.31 ? 275 HOH A H1    1 
HETATM 3456 H  H2    . HOH E 5 .   ? 59.976 8.769   28.304 1.00 21.89 ? 275 HOH A H2    1 
HETATM 3457 O  O     . HOH E 5 .   ? 59.176 6.938   37.340 1.00 14.57 ? 277 HOH A O     1 
HETATM 3458 H  H1    . HOH E 5 .   ? 58.233 6.895   37.558 1.00 12.86 ? 277 HOH A H1    1 
HETATM 3459 H  H2    . HOH E 5 .   ? 59.515 6.168   37.830 1.00 15.35 ? 277 HOH A H2    1 
HETATM 3460 O  O     . HOH E 5 .   ? 56.350 6.429   36.983 1.00 17.69 ? 278 HOH A O     1 
HETATM 3461 H  H1    . HOH E 5 .   ? 55.705 6.671   36.277 1.00 18.23 ? 278 HOH A H1    1 
HETATM 3462 H  H2    . HOH E 5 .   ? 56.906 5.813   36.498 1.00 17.80 ? 278 HOH A H2    1 
HETATM 3463 O  O     . HOH E 5 .   ? 46.233 -6.333  18.705 1.00 17.45 ? 280 HOH A O     1 
HETATM 3464 H  H1    . HOH E 5 .   ? 45.729 -6.988  19.229 1.00 15.81 ? 280 HOH A H1    1 
HETATM 3465 H  H2    . HOH E 5 .   ? 47.146 -6.576  18.933 1.00 17.40 ? 280 HOH A H2    1 
HETATM 3466 O  O     . HOH E 5 .   ? 46.485 -2.858  19.837 1.00 18.50 ? 281 HOH A O     1 
HETATM 3467 H  H1    . HOH E 5 .   ? 46.507 -1.942  20.182 1.00 19.46 ? 281 HOH A H1    1 
HETATM 3468 H  H2    . HOH E 5 .   ? 45.977 -2.768  19.017 1.00 18.87 ? 281 HOH A H2    1 
HETATM 3469 O  O     . HOH E 5 .   ? 43.899 -0.016  23.723 1.00 25.55 ? 282 HOH A O     1 
HETATM 3470 H  H1    . HOH E 5 .   ? 44.155 0.371   22.874 1.00 26.66 ? 282 HOH A H1    1 
HETATM 3471 H  H2    . HOH E 5 .   ? 42.935 0.129   23.678 1.00 26.26 ? 282 HOH A H2    1 
HETATM 3472 O  O     . HOH E 5 .   ? 36.093 7.210   23.482 1.00 15.34 ? 283 HOH A O     1 
HETATM 3473 H  H1    . HOH E 5 .   ? 36.591 6.420   23.761 1.00 15.23 ? 283 HOH A H1    1 
HETATM 3474 H  H2    . HOH E 5 .   ? 36.128 7.121   22.520 1.00 15.25 ? 283 HOH A H2    1 
HETATM 3475 O  O     . HOH E 5 .   ? 42.063 10.041  15.667 1.00 16.64 ? 284 HOH A O     1 
HETATM 3476 H  H1    . HOH E 5 .   ? 42.488 9.536   16.389 1.00 18.18 ? 284 HOH A H1    1 
HETATM 3477 H  H2    . HOH E 5 .   ? 41.953 9.368   14.968 1.00 18.78 ? 284 HOH A H2    1 
HETATM 3478 O  O     . HOH E 5 .   ? 47.753 10.095  25.097 1.00 11.53 ? 285 HOH A O     1 
HETATM 3479 H  H1    . HOH E 5 .   ? 47.544 9.201   24.809 1.00 12.71 ? 285 HOH A H1    1 
HETATM 3480 H  H2    . HOH E 5 .   ? 47.559 10.050  26.042 1.00 11.52 ? 285 HOH A H2    1 
HETATM 3481 O  O     . HOH E 5 .   ? 65.805 1.465   26.911 1.00 20.43 ? 286 HOH A O     1 
HETATM 3482 H  H1    . HOH E 5 .   ? 65.814 0.614   27.380 1.00 21.32 ? 286 HOH A H1    1 
HETATM 3483 H  H2    . HOH E 5 .   ? 64.867 1.557   26.656 1.00 21.68 ? 286 HOH A H2    1 
HETATM 3484 O  O     . HOH E 5 .   ? 43.142 -8.871  23.564 1.00 14.56 ? 287 HOH A O     1 
HETATM 3485 H  H1    . HOH E 5 .   ? 42.429 -9.128  24.190 1.00 12.85 ? 287 HOH A H1    1 
HETATM 3486 H  H2    . HOH E 5 .   ? 42.630 -8.666  22.762 1.00 13.72 ? 287 HOH A H2    1 
HETATM 3487 O  O     . HOH E 5 .   ? 67.718 2.947   30.119 1.00 31.38 ? 289 HOH A O     1 
HETATM 3488 H  H1    . HOH E 5 .   ? 67.771 2.385   30.916 1.00 32.37 ? 289 HOH A H1    1 
HETATM 3489 H  H2    . HOH E 5 .   ? 67.100 2.449   29.566 1.00 32.56 ? 289 HOH A H2    1 
HETATM 3490 O  O     . HOH E 5 .   ? 64.536 16.945  30.649 1.00 20.34 ? 290 HOH A O     1 
HETATM 3491 H  H1    . HOH E 5 .   ? 64.330 16.011  30.826 1.00 20.12 ? 290 HOH A H1    1 
HETATM 3492 H  H2    . HOH E 5 .   ? 65.110 17.142  31.408 1.00 19.77 ? 290 HOH A H2    1 
HETATM 3493 O  O     . HOH E 5 .   ? 57.022 -5.975  17.747 1.00 39.27 ? 291 HOH A O     1 
HETATM 3494 H  H1    . HOH E 5 .   ? 56.493 -6.404  18.458 1.00 39.51 ? 291 HOH A H1    1 
HETATM 3495 H  H2    . HOH E 5 .   ? 57.744 -6.606  17.652 1.00 39.45 ? 291 HOH A H2    1 
HETATM 3496 O  O     . HOH E 5 .   ? 36.018 18.289  19.284 1.00 24.51 ? 292 HOH A O     1 
HETATM 3497 H  H1    . HOH E 5 .   ? 36.321 17.652  18.618 1.00 24.48 ? 292 HOH A H1    1 
HETATM 3498 H  H2    . HOH E 5 .   ? 36.196 19.132  18.789 1.00 25.19 ? 292 HOH A H2    1 
HETATM 3499 O  O     . HOH E 5 .   ? 46.733 -6.214  11.505 1.00 32.05 ? 293 HOH A O     1 
HETATM 3500 H  H1    . HOH E 5 .   ? 46.732 -5.780  12.385 1.00 33.09 ? 293 HOH A H1    1 
HETATM 3501 H  H2    . HOH E 5 .   ? 45.918 -5.854  11.120 1.00 32.89 ? 293 HOH A H2    1 
HETATM 3502 O  O     . HOH E 5 .   ? 51.813 6.246   9.534  1.00 41.38 ? 294 HOH A O     1 
HETATM 3503 H  H1    . HOH E 5 .   ? 51.535 5.890   8.670  1.00 41.68 ? 294 HOH A H1    1 
HETATM 3504 H  H2    . HOH E 5 .   ? 51.428 5.592   10.155 1.00 41.17 ? 294 HOH A H2    1 
HETATM 3505 O  O     . HOH E 5 .   ? 41.593 8.415   13.377 1.00 29.87 ? 295 HOH A O     1 
HETATM 3506 H  H1    . HOH E 5 .   ? 40.848 8.993   13.169 1.00 30.21 ? 295 HOH A H1    1 
HETATM 3507 H  H2    . HOH E 5 .   ? 41.293 7.567   12.985 1.00 30.18 ? 295 HOH A H2    1 
HETATM 3508 O  O     . HOH E 5 .   ? 56.010 1.960   39.249 1.00 25.91 ? 296 HOH A O     1 
HETATM 3509 H  H1    . HOH E 5 .   ? 55.966 1.243   38.598 1.00 26.11 ? 296 HOH A H1    1 
HETATM 3510 H  H2    . HOH E 5 .   ? 56.838 2.426   39.021 1.00 25.80 ? 296 HOH A H2    1 
HETATM 3511 O  O     . HOH E 5 .   ? 67.407 6.093   40.969 1.00 17.62 ? 297 HOH A O     1 
HETATM 3512 H  H1    . HOH E 5 .   ? 67.479 6.877   41.557 1.00 18.37 ? 297 HOH A H1    1 
HETATM 3513 H  H2    . HOH E 5 .   ? 68.232 5.625   41.172 1.00 18.88 ? 297 HOH A H2    1 
HETATM 3514 O  O     . HOH E 5 .   ? 32.204 19.766  26.500 1.00 47.20 ? 299 HOH A O     1 
HETATM 3515 H  H1    . HOH E 5 .   ? 31.697 18.938  26.425 1.00 46.65 ? 299 HOH A H1    1 
HETATM 3516 H  H2    . HOH E 5 .   ? 32.283 20.037  25.573 1.00 47.00 ? 299 HOH A H2    1 
HETATM 3517 O  O     . HOH E 5 .   ? 67.585 0.835   32.335 1.00 42.73 ? 300 HOH A O     1 
HETATM 3518 H  H1    . HOH E 5 .   ? 68.236 0.553   32.996 1.00 41.45 ? 300 HOH A H1    1 
HETATM 3519 H  H2    . HOH E 5 .   ? 67.355 -0.009  31.926 1.00 41.34 ? 300 HOH A H2    1 
HETATM 3520 O  O     . HOH E 5 .   ? 56.414 -5.804  24.436 1.00 28.45 ? 302 HOH A O     1 
HETATM 3521 H  H1    . HOH E 5 .   ? 57.261 -6.173  24.737 1.00 28.35 ? 302 HOH A H1    1 
HETATM 3522 H  H2    . HOH E 5 .   ? 55.830 -5.935  25.197 1.00 28.23 ? 302 HOH A H2    1 
HETATM 3523 O  O     . HOH E 5 .   ? 28.581 20.553  24.746 1.00 59.85 ? 307 HOH A O     1 
HETATM 3524 H  H1    . HOH E 5 .   ? 29.410 20.904  25.091 1.00 60.91 ? 307 HOH A H1    1 
HETATM 3525 H  H2    . HOH E 5 .   ? 28.216 21.308  24.268 1.00 61.23 ? 307 HOH A H2    1 
HETATM 3526 O  O     . HOH E 5 .   ? 45.680 -8.716  11.775 1.00 36.85 ? 308 HOH A O     1 
HETATM 3527 H  H1    . HOH E 5 .   ? 46.049 -7.836  11.560 1.00 38.30 ? 308 HOH A H1    1 
HETATM 3528 H  H2    . HOH E 5 .   ? 46.303 -9.300  11.324 1.00 38.05 ? 308 HOH A H2    1 
HETATM 3529 O  O     . HOH E 5 .   ? 49.326 20.519  17.490 1.00 35.56 ? 309 HOH A O     1 
HETATM 3530 H  H1    . HOH E 5 .   ? 49.513 20.341  18.441 1.00 35.78 ? 309 HOH A H1    1 
HETATM 3531 H  H2    . HOH E 5 .   ? 50.187 20.839  17.205 1.00 36.33 ? 309 HOH A H2    1 
HETATM 3532 O  O     . HOH E 5 .   ? 55.755 16.976  41.987 1.00 42.43 ? 312 HOH A O     1 
HETATM 3533 H  H1    . HOH E 5 .   ? 54.832 17.309  41.877 1.00 44.20 ? 312 HOH A H1    1 
HETATM 3534 H  H2    . HOH E 5 .   ? 55.787 16.757  42.939 1.00 43.93 ? 312 HOH A H2    1 
HETATM 3535 O  O     . HOH E 5 .   ? 37.390 4.703   24.323 1.00 25.62 ? 315 HOH A O     1 
HETATM 3536 H  H1    . HOH E 5 .   ? 36.545 4.727   24.808 1.00 25.03 ? 315 HOH A H1    1 
HETATM 3537 H  H2    . HOH E 5 .   ? 37.822 3.932   24.720 1.00 24.90 ? 315 HOH A H2    1 
HETATM 3538 O  O     . HOH E 5 .   ? 56.130 -7.348  37.227 1.00 41.68 ? 317 HOH A O     1 
HETATM 3539 H  H1    . HOH E 5 .   ? 55.804 -7.755  38.037 1.00 41.83 ? 317 HOH A H1    1 
HETATM 3540 H  H2    . HOH E 5 .   ? 56.999 -7.015  37.490 1.00 42.04 ? 317 HOH A H2    1 
HETATM 3541 O  O     . HOH E 5 .   ? 46.798 6.506   44.273 1.00 37.04 ? 318 HOH A O     1 
HETATM 3542 H  H1    . HOH E 5 .   ? 47.405 6.412   45.037 1.00 36.62 ? 318 HOH A H1    1 
HETATM 3543 H  H2    . HOH E 5 .   ? 46.750 5.604   43.933 1.00 36.80 ? 318 HOH A H2    1 
HETATM 3544 O  O     . HOH E 5 .   ? 35.735 23.398  26.684 1.00 20.33 ? 321 HOH A O     1 
HETATM 3545 H  H1    . HOH E 5 .   ? 35.253 23.205  25.851 1.00 20.08 ? 321 HOH A H1    1 
HETATM 3546 H  H2    . HOH E 5 .   ? 36.510 22.787  26.637 1.00 20.97 ? 321 HOH A H2    1 
HETATM 3547 O  O     . HOH E 5 .   ? 49.358 -1.026  36.242 1.00 44.67 ? 322 HOH A O     1 
HETATM 3548 H  H1    . HOH E 5 .   ? 48.400 -1.209  36.304 1.00 44.00 ? 322 HOH A H1    1 
HETATM 3549 H  H2    . HOH E 5 .   ? 49.340 -0.167  35.807 1.00 44.45 ? 322 HOH A H2    1 
HETATM 3550 O  O     . HOH E 5 .   ? 45.981 9.255   44.695 1.00 50.41 ? 323 HOH A O     1 
HETATM 3551 H  H1    . HOH E 5 .   ? 45.958 9.975   44.024 1.00 51.52 ? 323 HOH A H1    1 
HETATM 3552 H  H2    . HOH E 5 .   ? 46.281 8.475   44.199 1.00 51.46 ? 323 HOH A H2    1 
HETATM 3553 O  O     . HOH E 5 .   ? 39.377 8.249   8.170  1.00 64.51 ? 324 HOH A O     1 
HETATM 3554 H  H1    . HOH E 5 .   ? 40.173 8.011   8.675  1.00 64.50 ? 324 HOH A H1    1 
HETATM 3555 H  H2    . HOH E 5 .   ? 39.739 8.836   7.497  1.00 64.03 ? 324 HOH A H2    1 
HETATM 3556 O  O     . HOH E 5 .   ? 64.663 18.028  36.078 1.00 27.97 ? 326 HOH A O     1 
HETATM 3557 H  H1    . HOH E 5 .   ? 65.100 17.809  36.923 1.00 27.49 ? 326 HOH A H1    1 
HETATM 3558 H  H2    . HOH E 5 .   ? 64.535 17.151  35.670 1.00 27.60 ? 326 HOH A H2    1 
HETATM 3559 O  O     . HOH E 5 .   ? 39.478 2.962   10.884 1.00 33.47 ? 327 HOH A O     1 
HETATM 3560 H  H1    . HOH E 5 .   ? 39.873 2.083   10.779 1.00 33.47 ? 327 HOH A H1    1 
HETATM 3561 H  H2    . HOH E 5 .   ? 39.198 2.927   11.803 1.00 33.39 ? 327 HOH A H2    1 
HETATM 3562 O  O     . HOH E 5 .   ? 68.737 17.311  31.772 1.00 44.29 ? 328 HOH A O     1 
HETATM 3563 H  H1    . HOH E 5 .   ? 68.861 17.303  30.815 1.00 44.24 ? 328 HOH A H1    1 
HETATM 3564 H  H2    . HOH E 5 .   ? 68.815 18.272  31.958 1.00 44.78 ? 328 HOH A H2    1 
HETATM 3565 O  O     . HOH E 5 .   ? 47.619 22.815  21.813 1.00 63.00 ? 331 HOH A O     1 
HETATM 3566 H  H1    . HOH E 5 .   ? 48.175 22.226  21.292 1.00 63.53 ? 331 HOH A H1    1 
HETATM 3567 H  H2    . HOH E 5 .   ? 48.244 23.508  22.098 1.00 63.45 ? 331 HOH A H2    1 
HETATM 3568 O  O     . HOH E 5 .   ? 46.234 14.934  10.557 1.00 39.64 ? 333 HOH A O     1 
HETATM 3569 H  H1    . HOH E 5 .   ? 45.826 15.310  9.758  1.00 39.66 ? 333 HOH A H1    1 
HETATM 3570 H  H2    . HOH E 5 .   ? 45.790 14.076  10.608 1.00 39.27 ? 333 HOH A H2    1 
HETATM 3571 O  O     . HOH E 5 .   ? 68.962 10.090  25.989 1.00 55.33 ? 335 HOH A O     1 
HETATM 3572 H  H1    . HOH E 5 .   ? 69.546 9.450   26.399 1.00 55.21 ? 335 HOH A H1    1 
HETATM 3573 H  H2    . HOH E 5 .   ? 68.082 9.803   26.270 1.00 55.13 ? 335 HOH A H2    1 
HETATM 3574 O  O     . HOH E 5 .   ? 54.462 24.893  24.386 1.00 40.68 ? 336 HOH A O     1 
HETATM 3575 H  H1    . HOH E 5 .   ? 54.570 25.747  23.960 1.00 40.53 ? 336 HOH A H1    1 
HETATM 3576 H  H2    . HOH E 5 .   ? 54.701 25.097  25.313 1.00 40.87 ? 336 HOH A H2    1 
HETATM 3577 O  O     . HOH E 5 .   ? 61.637 19.473  36.748 1.00 44.51 ? 338 HOH A O     1 
HETATM 3578 H  H1    . HOH E 5 .   ? 61.946 18.710  37.267 1.00 43.31 ? 338 HOH A H1    1 
HETATM 3579 H  H2    . HOH E 5 .   ? 62.267 20.170  37.012 1.00 43.71 ? 338 HOH A H2    1 
HETATM 3580 O  O     . HOH E 5 .   ? 47.912 10.372  11.052 1.00 36.01 ? 339 HOH A O     1 
HETATM 3581 H  H1    . HOH E 5 .   ? 47.271 10.936  11.507 1.00 35.61 ? 339 HOH A H1    1 
HETATM 3582 H  H2    . HOH E 5 .   ? 48.733 10.540  11.531 1.00 35.49 ? 339 HOH A H2    1 
HETATM 3583 O  O     . HOH E 5 .   ? 44.243 14.859  39.576 1.00 39.35 ? 342 HOH A O     1 
HETATM 3584 H  H1    . HOH E 5 .   ? 44.117 15.171  38.664 1.00 40.00 ? 342 HOH A H1    1 
HETATM 3585 H  H2    . HOH E 5 .   ? 43.894 13.946  39.561 1.00 39.91 ? 342 HOH A H2    1 
HETATM 3586 O  O     . HOH E 5 .   ? 56.403 -3.751  16.347 1.00 23.56 ? 346 HOH A O     1 
HETATM 3587 H  H1    . HOH E 5 .   ? 55.793 -4.232  15.743 1.00 23.35 ? 346 HOH A H1    1 
HETATM 3588 H  H2    . HOH E 5 .   ? 56.653 -4.498  16.940 1.00 23.52 ? 346 HOH A H2    1 
HETATM 3589 O  O     . HOH E 5 .   ? 60.300 2.923   16.636 1.00 53.04 ? 348 HOH A O     1 
HETATM 3590 H  H1    . HOH E 5 .   ? 60.009 2.060   16.998 1.00 52.90 ? 348 HOH A H1    1 
HETATM 3591 H  H2    . HOH E 5 .   ? 60.785 3.301   17.401 1.00 52.87 ? 348 HOH A H2    1 
HETATM 3592 O  O     . HOH E 5 .   ? 63.198 -5.398  22.941 1.00 55.27 ? 349 HOH A O     1 
HETATM 3593 H  H1    . HOH E 5 .   ? 63.994 -5.929  22.874 1.00 54.71 ? 349 HOH A H1    1 
HETATM 3594 H  H2    . HOH E 5 .   ? 63.380 -4.823  23.710 1.00 55.16 ? 349 HOH A H2    1 
HETATM 3595 O  O     . HOH E 5 .   ? 54.161 15.944  15.814 1.00 55.69 ? 351 HOH A O     1 
HETATM 3596 H  H1    . HOH E 5 .   ? 53.596 15.281  15.357 1.00 55.28 ? 351 HOH A H1    1 
HETATM 3597 H  H2    . HOH E 5 .   ? 54.948 15.398  16.008 1.00 55.01 ? 351 HOH A H2    1 
HETATM 3598 O  O     . HOH E 5 .   ? 56.780 8.978   17.156 1.00 33.52 ? 352 HOH A O     1 
HETATM 3599 H  H1    . HOH E 5 .   ? 57.445 8.338   17.423 1.00 34.24 ? 352 HOH A H1    1 
HETATM 3600 H  H2    . HOH E 5 .   ? 56.169 8.950   17.924 1.00 34.62 ? 352 HOH A H2    1 
HETATM 3601 O  O     . HOH E 5 .   ? 37.352 9.152   35.523 1.00 34.43 ? 354 HOH A O     1 
HETATM 3602 H  H1    . HOH E 5 .   ? 37.121 8.222   35.417 1.00 34.01 ? 354 HOH A H1    1 
HETATM 3603 H  H2    . HOH E 5 .   ? 38.117 9.231   34.923 1.00 34.45 ? 354 HOH A H2    1 
HETATM 3604 O  O     . HOH E 5 .   ? 58.428 17.614  41.349 1.00 38.52 ? 358 HOH A O     1 
HETATM 3605 H  H1    . HOH E 5 .   ? 58.333 17.619  40.380 1.00 38.81 ? 358 HOH A H1    1 
HETATM 3606 H  H2    . HOH E 5 .   ? 57.530 17.351  41.639 1.00 39.10 ? 358 HOH A H2    1 
HETATM 3607 O  O     . HOH E 5 .   ? 30.008 17.252  26.188 1.00 49.87 ? 360 HOH A O     1 
HETATM 3608 H  H1    . HOH E 5 .   ? 29.084 17.541  26.091 1.00 49.50 ? 360 HOH A H1    1 
HETATM 3609 H  H2    . HOH E 5 .   ? 29.860 16.346  26.544 1.00 49.84 ? 360 HOH A H2    1 
HETATM 3610 O  O     . HOH E 5 .   ? 28.762 26.369  28.535 1.00 41.75 ? 361 HOH A O     1 
HETATM 3611 H  H1    . HOH E 5 .   ? 28.570 25.782  27.779 1.00 42.40 ? 361 HOH A H1    1 
HETATM 3612 H  H2    . HOH E 5 .   ? 28.804 27.258  28.113 1.00 42.67 ? 361 HOH A H2    1 
HETATM 3613 O  O     . HOH E 5 .   ? 28.507 6.393   18.684 1.00 37.02 ? 363 HOH A O     1 
HETATM 3614 H  H1    . HOH E 5 .   ? 27.898 6.997   18.255 1.00 36.60 ? 363 HOH A H1    1 
HETATM 3615 H  H2    . HOH E 5 .   ? 27.969 5.589   18.817 1.00 36.59 ? 363 HOH A H2    1 
HETATM 3616 O  O     . HOH E 5 .   ? 28.070 5.682   25.713 1.00 42.27 ? 364 HOH A O     1 
HETATM 3617 H  H1    . HOH E 5 .   ? 27.642 5.632   24.855 1.00 41.27 ? 364 HOH A H1    1 
HETATM 3618 H  H2    . HOH E 5 .   ? 28.066 6.651   25.885 1.00 41.37 ? 364 HOH A H2    1 
HETATM 3619 O  O     . HOH E 5 .   ? 44.791 -11.802 27.994 1.00 43.09 ? 369 HOH A O     1 
HETATM 3620 H  H1    . HOH E 5 .   ? 44.069 -12.084 28.585 1.00 44.30 ? 369 HOH A H1    1 
HETATM 3621 H  H2    . HOH E 5 .   ? 45.590 -11.992 28.535 1.00 44.31 ? 369 HOH A H2    1 
HETATM 3622 O  O     . HOH E 5 .   ? 45.420 2.453   38.924 1.00 57.77 ? 371 HOH A O     1 
HETATM 3623 H  H1    . HOH E 5 .   ? 45.073 3.362   38.821 1.00 57.31 ? 371 HOH A H1    1 
HETATM 3624 H  H2    . HOH E 5 .   ? 45.022 2.174   39.753 1.00 57.14 ? 371 HOH A H2    1 
HETATM 3625 O  O     . HOH E 5 .   ? 36.662 -8.724  13.308 1.00 48.16 ? 374 HOH A O     1 
HETATM 3626 H  H1    . HOH E 5 .   ? 37.084 -9.250  14.016 1.00 47.19 ? 374 HOH A H1    1 
HETATM 3627 H  H2    . HOH E 5 .   ? 36.677 -7.829  13.677 1.00 47.51 ? 374 HOH A H2    1 
HETATM 3628 O  O     . HOH E 5 .   ? 35.132 -7.240  8.250  1.00 41.49 ? 375 HOH A O     1 
HETATM 3629 H  H1    . HOH E 5 .   ? 35.843 -7.714  8.702  1.00 41.20 ? 375 HOH A H1    1 
HETATM 3630 H  H2    . HOH E 5 .   ? 34.388 -7.884  8.257  1.00 41.44 ? 375 HOH A H2    1 
HETATM 3631 O  O     . HOH E 5 .   ? 30.716 -5.217  10.973 1.00 52.00 ? 376 HOH A O     1 
HETATM 3632 H  H1    . HOH E 5 .   ? 30.921 -5.971  11.550 1.00 50.89 ? 376 HOH A H1    1 
HETATM 3633 H  H2    . HOH E 5 .   ? 30.173 -5.639  10.301 1.00 51.15 ? 376 HOH A H2    1 
HETATM 3634 O  O     . HOH E 5 .   ? 29.493 -8.520  10.196 1.00 40.32 ? 377 HOH A O     1 
HETATM 3635 H  H1    . HOH E 5 .   ? 29.272 -8.149  11.069 1.00 40.13 ? 377 HOH A H1    1 
HETATM 3636 H  H2    . HOH E 5 .   ? 30.163 -9.183  10.446 1.00 39.68 ? 377 HOH A H2    1 
HETATM 3637 O  O     . HOH E 5 .   ? 33.969 4.082   15.074 1.00 50.01 ? 380 HOH A O     1 
HETATM 3638 H  H1    . HOH E 5 .   ? 34.818 4.110   15.536 1.00 49.54 ? 380 HOH A H1    1 
HETATM 3639 H  H2    . HOH E 5 .   ? 33.351 4.047   15.814 1.00 49.72 ? 380 HOH A H2    1 
HETATM 3640 O  O     . HOH E 5 .   ? 65.377 9.380   31.876 1.00 15.84 ? 381 HOH A O     1 
HETATM 3641 H  H1    . HOH E 5 .   ? 64.811 9.942   31.293 1.00 15.59 ? 381 HOH A H1    1 
HETATM 3642 H  H2    . HOH E 5 .   ? 66.243 9.795   31.647 1.00 16.01 ? 381 HOH A H2    1 
HETATM 3643 O  O     . HOH E 5 .   ? 30.913 25.016  29.744 1.00 21.66 ? 382 HOH A O     1 
HETATM 3644 H  H1    . HOH E 5 .   ? 31.463 25.047  28.949 1.00 22.54 ? 382 HOH A H1    1 
HETATM 3645 H  H2    . HOH E 5 .   ? 30.109 25.489  29.413 1.00 21.88 ? 382 HOH A H2    1 
HETATM 3646 O  O     . HOH E 5 .   ? 45.657 0.371   31.442 0.98 27.05 ? 383 HOH A O     1 
HETATM 3647 H  H1    . HOH E 5 .   ? 44.852 0.298   31.971 0.98 28.40 ? 383 HOH A H1    1 
HETATM 3648 H  H2    . HOH E 5 .   ? 45.357 0.909   30.703 0.98 27.70 ? 383 HOH A H2    1 
HETATM 3649 O  O     . HOH E 5 .   ? 42.558 0.717   30.375 0.45 16.94 ? 384 HOH A O     1 
HETATM 3650 H  H1    . HOH E 5 .   ? 42.885 0.483   31.262 0.45 19.13 ? 384 HOH A H1    1 
HETATM 3651 H  H2    . HOH E 5 .   ? 43.348 1.090   29.966 0.45 19.37 ? 384 HOH A H2    1 
HETATM 3652 O  O     . HOH E 5 .   ? 66.153 17.159  33.208 1.00 30.42 ? 385 HOH A O     1 
HETATM 3653 H  H1    . HOH E 5 .   ? 65.982 18.092  33.455 1.00 30.90 ? 385 HOH A H1    1 
HETATM 3654 H  H2    . HOH E 5 .   ? 67.054 17.224  32.835 1.00 31.00 ? 385 HOH A H2    1 
HETATM 3655 O  O     . HOH E 5 .   ? 62.656 -3.778  30.879 1.00 31.35 ? 389 HOH A O     1 
HETATM 3656 H  H1    . HOH E 5 .   ? 63.506 -4.031  30.503 1.00 31.32 ? 389 HOH A H1    1 
HETATM 3657 H  H2    . HOH E 5 .   ? 62.105 -4.537  30.598 1.00 31.76 ? 389 HOH A H2    1 
HETATM 3658 O  O     . HOH E 5 .   ? 61.406 20.006  22.177 1.00 36.29 ? 390 HOH A O     1 
HETATM 3659 H  H1    . HOH E 5 .   ? 61.830 19.323  22.738 1.00 36.10 ? 390 HOH A H1    1 
HETATM 3660 H  H2    . HOH E 5 .   ? 62.111 20.173  21.547 1.00 36.06 ? 390 HOH A H2    1 
HETATM 3661 O  O     . HOH E 5 .   ? 55.649 -9.401  25.248 1.00 29.63 ? 391 HOH A O     1 
HETATM 3662 H  H1    . HOH E 5 .   ? 55.675 -10.362 25.130 1.00 29.69 ? 391 HOH A H1    1 
HETATM 3663 H  H2    . HOH E 5 .   ? 55.037 -9.352  26.013 1.00 29.29 ? 391 HOH A H2    1 
HETATM 3664 O  O     . HOH E 5 .   ? 71.429 11.554  31.375 1.00 54.64 ? 392 HOH A O     1 
HETATM 3665 H  H1    . HOH E 5 .   ? 71.041 10.743  31.740 1.00 54.74 ? 392 HOH A H1    1 
HETATM 3666 H  H2    . HOH E 5 .   ? 71.237 12.209  32.054 1.00 54.89 ? 392 HOH A H2    1 
HETATM 3667 O  O     . HOH E 5 .   ? 54.811 8.738   13.430 1.00 44.94 ? 393 HOH A O     1 
HETATM 3668 H  H1    . HOH E 5 .   ? 54.584 7.943   12.920 1.00 45.38 ? 393 HOH A H1    1 
HETATM 3669 H  H2    . HOH E 5 .   ? 55.234 8.365   14.211 1.00 44.90 ? 393 HOH A H2    1 
HETATM 3670 O  O     . HOH E 5 .   ? 55.666 20.244  40.905 1.00 34.94 ? 395 HOH A O     1 
HETATM 3671 H  H1    . HOH E 5 .   ? 55.171 20.355  41.747 1.00 35.01 ? 395 HOH A H1    1 
HETATM 3672 H  H2    . HOH E 5 .   ? 56.447 19.785  41.246 1.00 34.94 ? 395 HOH A H2    1 
HETATM 3673 O  O     . HOH E 5 .   ? 28.889 1.538   23.591 1.00 51.30 ? 397 HOH A O     1 
HETATM 3674 H  H1    . HOH E 5 .   ? 28.360 0.993   24.179 1.00 50.88 ? 397 HOH A H1    1 
HETATM 3675 H  H2    . HOH E 5 .   ? 29.793 1.346   23.913 1.00 50.96 ? 397 HOH A H2    1 
HETATM 3676 O  O     . HOH E 5 .   ? 25.507 3.911   31.098 1.00 53.68 ? 402 HOH A O     1 
HETATM 3677 H  H1    . HOH E 5 .   ? 24.950 4.702   31.270 1.00 54.21 ? 402 HOH A H1    1 
HETATM 3678 H  H2    . HOH E 5 .   ? 25.100 3.559   30.303 1.00 53.94 ? 402 HOH A H2    1 
HETATM 3679 O  O     . HOH E 5 .   ? 38.965 13.898  8.794  1.00 35.35 ? 403 HOH A O     1 
HETATM 3680 H  H1    . HOH E 5 .   ? 38.605 14.608  9.337  1.00 35.08 ? 403 HOH A H1    1 
HETATM 3681 H  H2    . HOH E 5 .   ? 38.287 13.738  8.133  1.00 35.04 ? 403 HOH A H2    1 
HETATM 3682 O  O     . HOH E 5 .   ? 56.790 11.355  15.767 1.00 53.94 ? 404 HOH A O     1 
HETATM 3683 H  H1    . HOH E 5 .   ? 57.153 10.934  14.983 1.00 54.58 ? 404 HOH A H1    1 
HETATM 3684 H  H2    . HOH E 5 .   ? 56.734 10.576  16.364 1.00 54.83 ? 404 HOH A H2    1 
HETATM 3685 O  O     . HOH E 5 .   ? 58.581 20.296  21.437 1.00 28.03 ? 412 HOH A O     1 
HETATM 3686 H  H1    . HOH E 5 .   ? 58.258 21.197  21.600 1.00 28.21 ? 412 HOH A H1    1 
HETATM 3687 H  H2    . HOH E 5 .   ? 59.512 20.343  21.745 1.00 28.06 ? 412 HOH A H2    1 
HETATM 3688 O  O     . HOH E 5 .   ? 69.655 15.313  33.371 1.00 15.16 ? 421 HOH A O     1 
HETATM 3689 H  H1    . HOH E 5 .   ? 69.171 15.977  32.831 1.00 15.45 ? 421 HOH A H1    1 
HETATM 3690 H  H2    . HOH E 5 .   ? 70.409 15.128  32.801 1.00 14.89 ? 421 HOH A H2    1 
HETATM 3691 O  O     . HOH E 5 .   ? 59.689 24.721  27.740 1.00 59.85 ? 430 HOH A O     1 
HETATM 3692 H  H1    . HOH E 5 .   ? 59.023 25.328  27.404 1.00 59.07 ? 430 HOH A H1    1 
HETATM 3693 H  H2    . HOH E 5 .   ? 59.211 24.208  28.422 1.00 59.38 ? 430 HOH A H2    1 
HETATM 3694 O  O     . HOH E 5 .   ? 27.341 18.195  25.713 1.00 46.37 ? 431 HOH A O     1 
HETATM 3695 H  H1    . HOH E 5 .   ? 26.870 17.925  24.912 1.00 47.37 ? 431 HOH A H1    1 
HETATM 3696 H  H2    . HOH E 5 .   ? 27.717 19.063  25.454 1.00 47.42 ? 431 HOH A H2    1 
HETATM 3697 O  O     . HOH E 5 .   ? 38.616 0.776   13.672 1.00 12.65 ? 432 HOH A O     1 
HETATM 3698 H  H1    . HOH E 5 .   ? 37.970 0.162   14.041 1.00 12.93 ? 432 HOH A H1    1 
HETATM 3699 H  H2    . HOH E 5 .   ? 39.062 0.277   12.967 1.00 12.57 ? 432 HOH A H2    1 
HETATM 3700 O  O     . HOH E 5 .   ? 37.653 18.091  16.748 1.00 45.91 ? 434 HOH A O     1 
HETATM 3701 H  H1    . HOH E 5 .   ? 37.255 18.984  16.652 1.00 45.72 ? 434 HOH A H1    1 
HETATM 3702 H  H2    . HOH E 5 .   ? 37.675 17.762  15.846 1.00 45.29 ? 434 HOH A H2    1 
HETATM 3703 O  O     . HOH E 5 .   ? 55.276 27.750  34.438 1.00 51.10 ? 439 HOH A O     1 
HETATM 3704 H  H1    . HOH E 5 .   ? 55.814 28.343  34.974 1.00 50.60 ? 439 HOH A H1    1 
HETATM 3705 H  H2    . HOH E 5 .   ? 54.562 28.318  34.129 1.00 50.75 ? 439 HOH A H2    1 
HETATM 3706 O  O     . HOH E 5 .   ? 40.604 16.251  13.609 1.00 56.08 ? 442 HOH A O     1 
HETATM 3707 H  H1    . HOH E 5 .   ? 39.869 15.927  14.157 1.00 56.38 ? 442 HOH A H1    1 
HETATM 3708 H  H2    . HOH E 5 .   ? 40.993 16.950  14.138 1.00 56.36 ? 442 HOH A H2    1 
HETATM 3709 O  O     . HOH E 5 .   ? 54.658 -5.214  14.740 1.00 58.82 ? 450 HOH A O     1 
HETATM 3710 H  H1    . HOH E 5 .   ? 54.189 -4.943  13.938 1.00 59.24 ? 450 HOH A H1    1 
HETATM 3711 H  H2    . HOH E 5 .   ? 54.001 -5.772  15.165 1.00 58.98 ? 450 HOH A H2    1 
HETATM 3712 O  O     . HOH E 5 .   ? 46.181 8.020   7.493  1.00 50.85 ? 480 HOH A O     1 
HETATM 3713 H  H1    . HOH E 5 .   ? 46.980 8.408   7.868  1.00 51.37 ? 480 HOH A H1    1 
HETATM 3714 H  H2    . HOH E 5 .   ? 46.341 7.057   7.640  1.00 51.56 ? 480 HOH A H2    1 
HETATM 3715 O  O     . HOH E 5 .   ? 67.172 -0.880  27.639 1.00 47.57 ? 489 HOH A O     1 
HETATM 3716 H  H1    . HOH E 5 .   ? 67.566 -0.205  27.070 1.00 47.75 ? 489 HOH A H1    1 
HETATM 3717 H  H2    . HOH E 5 .   ? 67.679 -1.664  27.414 1.00 47.60 ? 489 HOH A H2    1 
HETATM 3718 O  O     . HOH E 5 .   ? 55.649 -0.567  37.213 1.00 60.69 ? 497 HOH A O     1 
HETATM 3719 H  H1    . HOH E 5 .   ? 54.681 -0.715  37.209 1.00 61.75 ? 497 HOH A H1    1 
HETATM 3720 H  H2    . HOH E 5 .   ? 55.800 -0.568  36.246 1.00 61.72 ? 497 HOH A H2    1 
HETATM 3721 O  O     . HOH E 5 .   ? 43.861 26.555  22.513 1.00 28.89 ? 502 HOH A O     1 
HETATM 3722 H  H1    . HOH E 5 .   ? 43.472 26.842  21.669 1.00 29.37 ? 502 HOH A H1    1 
HETATM 3723 H  H2    . HOH E 5 .   ? 43.097 26.093  22.901 1.00 29.82 ? 502 HOH A H2    1 
HETATM 3724 O  O     . HOH E 5 .   ? 53.346 6.298   11.793 1.00 39.18 ? 504 HOH A O     1 
HETATM 3725 H  H1    . HOH E 5 .   ? 52.719 5.585   12.006 1.00 38.84 ? 504 HOH A H1    1 
HETATM 3726 H  H2    . HOH E 5 .   ? 53.170 6.353   10.832 1.00 38.42 ? 504 HOH A H2    1 
HETATM 3727 O  O     . HOH E 5 .   ? 35.266 10.553  13.452 1.00 41.92 ? 505 HOH A O     1 
HETATM 3728 H  H1    . HOH E 5 .   ? 35.582 11.074  14.225 1.00 43.76 ? 505 HOH A H1    1 
HETATM 3729 H  H2    . HOH E 5 .   ? 35.551 11.121  12.738 1.00 43.00 ? 505 HOH A H2    1 
HETATM 3730 O  O     . HOH E 5 .   ? 55.848 22.392  21.869 1.00 60.45 ? 508 HOH A O     1 
HETATM 3731 H  H1    . HOH E 5 .   ? 55.191 22.860  22.391 1.00 59.53 ? 508 HOH A H1    1 
HETATM 3732 H  H2    . HOH E 5 .   ? 55.464 21.499  21.764 1.00 60.41 ? 508 HOH A H2    1 
HETATM 3733 O  O     . HOH E 5 .   ? 66.855 14.948  34.836 1.00 39.84 ? 537 HOH A O     1 
HETATM 3734 H  H1    . HOH E 5 .   ? 66.371 15.683  34.406 1.00 38.04 ? 537 HOH A H1    1 
HETATM 3735 H  H2    . HOH E 5 .   ? 67.082 15.323  35.700 1.00 38.65 ? 537 HOH A H2    1 
HETATM 3736 O  O     . HOH E 5 .   ? 68.408 18.777  23.708 1.00 62.83 ? 539 HOH A O     1 
HETATM 3737 H  H1    . HOH E 5 .   ? 68.101 17.897  23.387 1.00 64.15 ? 539 HOH A H1    1 
HETATM 3738 H  H2    . HOH E 5 .   ? 69.038 19.024  23.025 1.00 63.81 ? 539 HOH A H2    1 
HETATM 3739 O  O     . HOH E 5 .   ? 58.731 -3.208  14.948 1.00 52.49 ? 540 HOH A O     1 
HETATM 3740 H  H1    . HOH E 5 .   ? 58.777 -4.033  14.469 1.00 52.57 ? 540 HOH A H1    1 
HETATM 3741 H  H2    . HOH E 5 .   ? 57.939 -3.332  15.506 1.00 52.66 ? 540 HOH A H2    1 
HETATM 3742 O  O     . HOH E 5 .   ? 59.420 20.421  38.774 1.00 54.55 ? 542 HOH A O     1 
HETATM 3743 H  H1    . HOH E 5 .   ? 59.192 19.498  38.585 1.00 54.86 ? 542 HOH A H1    1 
HETATM 3744 H  H2    . HOH E 5 .   ? 59.809 20.699  37.928 1.00 55.04 ? 542 HOH A H2    1 
HETATM 3745 O  O     . HOH E 5 .   ? 45.022 -11.300 10.151 1.00 60.66 ? 547 HOH A O     1 
HETATM 3746 H  H1    . HOH E 5 .   ? 45.362 -11.316 9.237  1.00 60.30 ? 547 HOH A H1    1 
HETATM 3747 H  H2    . HOH E 5 .   ? 44.597 -10.441 10.225 1.00 60.03 ? 547 HOH A H2    1 
HETATM 3748 O  O     . HOH E 5 .   ? 31.407 13.149  22.651 1.00 44.74 ? 548 HOH A O     1 
HETATM 3749 H  H1    . HOH E 5 .   ? 32.019 12.459  22.999 1.00 44.51 ? 548 HOH A H1    1 
HETATM 3750 H  H2    . HOH E 5 .   ? 31.995 13.908  22.650 1.00 44.34 ? 548 HOH A H2    1 
HETATM 3751 O  O     . HOH E 5 .   ? 43.214 8.728   44.692 1.00 56.70 ? 552 HOH A O     1 
HETATM 3752 H  H1    . HOH E 5 .   ? 43.398 7.928   45.193 1.00 57.23 ? 552 HOH A H1    1 
HETATM 3753 H  H2    . HOH E 5 .   ? 44.086 9.173   44.774 1.00 57.00 ? 552 HOH A H2    1 
HETATM 3754 O  O     . HOH E 5 .   ? 69.546 3.086   28.098 1.00 52.85 ? 557 HOH A O     1 
HETATM 3755 H  H1    . HOH E 5 .   ? 70.122 2.414   28.466 1.00 51.73 ? 557 HOH A H1    1 
HETATM 3756 H  H2    . HOH E 5 .   ? 68.940 3.259   28.848 1.00 51.69 ? 557 HOH A H2    1 
HETATM 3757 O  O     . HOH E 5 .   ? 57.680 -0.533  40.312 1.00 54.78 ? 559 HOH A O     1 
HETATM 3758 H  H1    . HOH E 5 .   ? 57.132 -0.609  39.518 1.00 54.63 ? 559 HOH A H1    1 
HETATM 3759 H  H2    . HOH E 5 .   ? 58.408 0.037   40.014 1.00 54.89 ? 559 HOH A H2    1 
HETATM 3760 O  O     . HOH E 5 .   ? 64.820 7.177   33.120 1.00 14.27 ? 560 HOH A O     1 
HETATM 3761 H  H1    . HOH E 5 .   ? 64.941 8.057   32.620 1.00 16.38 ? 560 HOH A H1    1 
HETATM 3762 H  H2    . HOH E 5 .   ? 65.498 6.739   32.558 1.00 16.08 ? 560 HOH A H2    1 
HETATM 3763 O  O     . HOH E 5 .   ? 61.648 3.945   18.827 1.00 53.50 ? 561 HOH A O     1 
HETATM 3764 H  H1    . HOH E 5 .   ? 61.183 4.440   19.510 1.00 55.34 ? 561 HOH A H1    1 
HETATM 3765 H  H2    . HOH E 5 .   ? 62.412 3.617   19.321 1.00 55.38 ? 561 HOH A H2    1 
HETATM 3766 O  O     . HOH E 5 .   ? 44.437 -15.572 21.909 1.00 60.69 ? 567 HOH A O     1 
HETATM 3767 H  H1    . HOH E 5 .   ? 44.182 -15.323 22.826 1.00 62.49 ? 567 HOH A H1    1 
HETATM 3768 H  H2    . HOH E 5 .   ? 45.146 -16.197 22.066 1.00 62.30 ? 567 HOH A H2    1 
HETATM 3769 O  O     . HOH E 5 .   ? 48.524 26.224  26.487 1.00 50.47 ? 588 HOH A O     1 
HETATM 3770 H  H1    . HOH E 5 .   ? 48.527 26.708  27.321 1.00 50.45 ? 588 HOH A H1    1 
HETATM 3771 H  H2    . HOH E 5 .   ? 47.737 26.572  26.052 1.00 50.49 ? 588 HOH A H2    1 
HETATM 3772 O  O     . HOH E 5 .   ? 25.820 -3.200  10.173 1.00 50.29 ? 636 HOH A O     1 
HETATM 3773 H  H1    . HOH E 5 .   ? 25.425 -3.284  9.271  1.00 51.39 ? 636 HOH A H1    1 
HETATM 3774 H  H2    . HOH E 5 .   ? 26.614 -3.716  10.002 1.00 51.40 ? 636 HOH A H2    1 
HETATM 3775 O  O     . HOH E 5 .   ? 43.761 -9.503  18.206 1.00 42.17 ? 650 HOH A O     1 
HETATM 3776 H  H1    . HOH E 5 .   ? 44.560 -9.520  17.631 1.00 43.04 ? 650 HOH A H1    1 
HETATM 3777 H  H2    . HOH E 5 .   ? 43.861 -10.269 18.814 1.00 42.90 ? 650 HOH A H2    1 
HETATM 3778 O  O     . HOH E 5 .   ? 68.576 6.478   29.631 1.00 51.65 ? 664 HOH A O     1 
HETATM 3779 H  H1    . HOH E 5 .   ? 68.745 5.638   30.077 1.00 51.17 ? 664 HOH A H1    1 
HETATM 3780 H  H2    . HOH E 5 .   ? 69.411 6.962   29.790 1.00 51.50 ? 664 HOH A H2    1 
HETATM 3781 O  O     . HOH E 5 .   ? 40.247 -2.794  29.089 1.00 37.00 ? 666 HOH A O     1 
HETATM 3782 H  H1    . HOH E 5 .   ? 40.177 -1.974  29.618 1.00 37.82 ? 666 HOH A H1    1 
HETATM 3783 H  H2    . HOH E 5 .   ? 41.067 -3.176  29.425 1.00 38.15 ? 666 HOH A H2    1 
HETATM 3784 O  O     . HOH E 5 .   ? 28.751 11.544  24.212 1.00 50.51 ? 678 HOH A O     1 
HETATM 3785 H  H1    . HOH E 5 .   ? 29.177 12.265  23.728 1.00 51.69 ? 678 HOH A H1    1 
HETATM 3786 H  H2    . HOH E 5 .   ? 28.228 11.108  23.535 1.00 51.95 ? 678 HOH A H2    1 
HETATM 3787 O  O     . HOH E 5 .   ? 41.186 9.791   43.307 1.00 51.79 ? 683 HOH A O     1 
HETATM 3788 H  H1    . HOH E 5 .   ? 40.477 9.537   43.900 1.00 51.79 ? 683 HOH A H1    1 
HETATM 3789 H  H2    . HOH E 5 .   ? 41.974 9.420   43.778 1.00 51.88 ? 683 HOH A H2    1 
HETATM 3790 O  O     . HOH E 5 .   ? 46.886 0.827   33.868 1.00 42.33 ? 685 HOH A O     1 
HETATM 3791 H  H1    . HOH E 5 .   ? 47.191 1.746   34.056 1.00 42.85 ? 685 HOH A H1    1 
HETATM 3792 H  H2    . HOH E 5 .   ? 46.480 0.870   33.002 1.00 42.14 ? 685 HOH A H2    1 
HETATM 3793 O  O     . HOH E 5 .   ? 48.599 0.408   38.487 1.00 38.88 ? 701 HOH A O     1 
HETATM 3794 H  H1    . HOH E 5 .   ? 47.719 0.363   38.083 1.00 38.96 ? 701 HOH A H1    1 
HETATM 3795 H  H2    . HOH E 5 .   ? 49.079 -0.232  37.942 1.00 39.26 ? 701 HOH A H2    1 
HETATM 3796 O  O     . HOH E 5 .   ? 47.433 -9.816  30.527 1.00 56.09 ? 703 HOH A O     1 
HETATM 3797 H  H1    . HOH E 5 .   ? 47.046 -9.334  29.788 1.00 56.69 ? 703 HOH A H1    1 
HETATM 3798 H  H2    . HOH E 5 .   ? 48.372 -9.864  30.285 1.00 56.70 ? 703 HOH A H2    1 
HETATM 3799 O  O     . HOH E 5 .   ? 30.362 -2.469  18.008 1.00 38.33 ? 705 HOH A O     1 
HETATM 3800 H  H1    . HOH E 5 .   ? 30.922 -2.167  17.292 1.00 38.72 ? 705 HOH A H1    1 
HETATM 3801 H  H2    . HOH E 5 .   ? 30.885 -3.198  18.401 1.00 38.89 ? 705 HOH A H2    1 
HETATM 3802 O  O     . HOH E 5 .   ? 48.695 -4.272  38.808 1.00 52.68 ? 706 HOH A O     1 
HETATM 3803 H  H1    . HOH E 5 .   ? 47.824 -4.006  39.149 1.00 52.09 ? 706 HOH A H1    1 
HETATM 3804 H  H2    . HOH E 5 .   ? 49.249 -3.511  39.005 1.00 52.06 ? 706 HOH A H2    1 
HETATM 3805 O  O     . HOH E 5 .   ? 46.068 27.002  29.119 1.00 50.92 ? 709 HOH A O     1 
HETATM 3806 H  H1    . HOH E 5 .   ? 45.221 27.091  28.648 1.00 51.25 ? 709 HOH A H1    1 
HETATM 3807 H  H2    . HOH E 5 .   ? 45.742 27.407  29.955 1.00 51.64 ? 709 HOH A H2    1 
HETATM 3808 O  O     . HOH E 5 .   ? 49.115 29.386  34.124 1.00 60.39 ? 710 HOH A O     1 
HETATM 3809 H  H1    . HOH E 5 .   ? 48.914 29.691  35.012 1.00 59.80 ? 710 HOH A H1    1 
HETATM 3810 H  H2    . HOH E 5 .   ? 48.402 29.765  33.591 1.00 60.04 ? 710 HOH A H2    1 
HETATM 3811 O  O     . HOH E 5 .   ? 46.651 -0.146  36.609 1.00 59.50 ? 713 HOH A O     1 
HETATM 3812 H  H1    . HOH E 5 .   ? 46.691 0.135   35.680 1.00 57.59 ? 713 HOH A H1    1 
HETATM 3813 H  H2    . HOH E 5 .   ? 45.930 0.403   36.953 1.00 57.73 ? 713 HOH A H2    1 
HETATM 3814 O  O     . HOH E 5 .   ? 53.313 -12.326 21.926 1.00 40.93 ? 714 HOH A O     1 
HETATM 3815 H  H1    . HOH E 5 .   ? 54.149 -11.959 22.207 1.00 41.63 ? 714 HOH A H1    1 
HETATM 3816 H  H2    . HOH E 5 .   ? 53.057 -11.708 21.217 1.00 41.99 ? 714 HOH A H2    1 
HETATM 3817 O  O     . HOH E 5 .   ? 52.314 -13.344 26.500 1.00 55.38 ? 716 HOH A O     1 
HETATM 3818 H  H1    . HOH E 5 .   ? 51.354 -13.417 26.292 1.00 55.32 ? 716 HOH A H1    1 
HETATM 3819 H  H2    . HOH E 5 .   ? 52.683 -13.227 25.617 1.00 55.04 ? 716 HOH A H2    1 
HETATM 3820 O  O     . HOH E 5 .   ? 24.604 -2.945  12.718 1.00 57.84 ? 727 HOH A O     1 
HETATM 3821 H  H1    . HOH E 5 .   ? 25.065 -3.139  11.868 1.00 58.01 ? 727 HOH A H1    1 
HETATM 3822 H  H2    . HOH E 5 .   ? 24.329 -2.042  12.533 1.00 58.00 ? 727 HOH A H2    1 
HETATM 3823 O  O     . HOH E 5 .   ? 39.443 26.557  37.059 1.00 56.93 ? 746 HOH A O     1 
HETATM 3824 H  H1    . HOH E 5 .   ? 39.563 27.353  37.575 1.00 57.45 ? 746 HOH A H1    1 
HETATM 3825 H  H2    . HOH E 5 .   ? 39.442 26.907  36.144 1.00 57.60 ? 746 HOH A H2    1 
HETATM 3826 O  O     . HOH E 5 .   ? 26.630 28.087  30.209 1.00 50.01 ? 750 HOH A O     1 
HETATM 3827 H  H1    . HOH E 5 .   ? 27.152 28.775  29.757 1.00 49.40 ? 750 HOH A H1    1 
HETATM 3828 H  H2    . HOH E 5 .   ? 27.375 27.632  30.665 1.00 48.93 ? 750 HOH A H2    1 
HETATM 3829 O  O     . HOH E 5 .   ? 57.578 14.817  19.149 1.00 62.19 ? 773 HOH A O     1 
HETATM 3830 H  H1    . HOH E 5 .   ? 57.039 15.544  19.497 1.00 61.08 ? 773 HOH A H1    1 
HETATM 3831 H  H2    . HOH E 5 .   ? 57.209 14.679  18.267 1.00 60.80 ? 773 HOH A H2    1 
HETATM 3832 O  O     . HOH E 5 .   ? 58.451 -1.599  36.435 1.00 57.32 ? 803 HOH A O     1 
HETATM 3833 H  H1    . HOH E 5 .   ? 58.379 -1.723  35.477 1.00 57.59 ? 803 HOH A H1    1 
HETATM 3834 H  H2    . HOH E 5 .   ? 57.519 -1.567  36.698 1.00 57.36 ? 803 HOH A H2    1 
HETATM 3835 O  O     . HOH E 5 .   ? 52.640 -0.697  36.974 1.00 49.88 ? 832 HOH A O     1 
HETATM 3836 H  H1    . HOH E 5 .   ? 52.274 -0.461  37.833 1.00 49.88 ? 832 HOH A H1    1 
HETATM 3837 H  H2    . HOH E 5 .   ? 51.844 -0.703  36.428 1.00 49.84 ? 832 HOH A H2    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE A . n 
A 1 2   VAL 2   17  17  VAL VAL A . n 
A 1 3   GLY 3   18  18  GLY GLY A . n 
A 1 4   GLY 4   19  19  GLY GLY A . n 
A 1 5   TYR 5   20  20  TYR TYR A . n 
A 1 6   THR 6   21  21  THR THR A . n 
A 1 7   CYS 7   22  22  CYS CYS A . n 
A 1 8   GLY 8   23  23  GLY GLY A . n 
A 1 9   ALA 9   24  24  ALA ALA A . n 
A 1 10  ASN 10  25  25  ASN ASN A . n 
A 1 11  THR 11  26  26  THR THR A . n 
A 1 12  VAL 12  27  27  VAL VAL A . n 
A 1 13  PRO 13  28  28  PRO PRO A . n 
A 1 14  TYR 14  29  29  TYR TYR A . n 
A 1 15  GLN 15  30  30  GLN GLN A . n 
A 1 16  VAL 16  31  31  VAL VAL A . n 
A 1 17  SER 17  32  32  SER SER A . n 
A 1 18  LEU 18  33  33  LEU LEU A . n 
A 1 19  ASN 19  34  34  ASN ASN A . n 
A 1 20  SER 20  37  37  SER SER A . n 
A 1 21  GLY 21  38  38  GLY GLY A . n 
A 1 22  TYR 22  39  39  TYR TYR A . n 
A 1 23  HIS 23  40  40  HIS HIS A . n 
A 1 24  PHE 24  41  41  PHE PHE A . n 
A 1 25  CYS 25  42  42  CYS CYS A . n 
A 1 26  GLY 26  43  43  GLY GLY A . n 
A 1 27  GLY 27  44  44  GLY GLY A . n 
A 1 28  SER 28  45  45  SER SER A . n 
A 1 29  LEU 29  46  46  LEU LEU A . n 
A 1 30  ILE 30  47  47  ILE ILE A . n 
A 1 31  ASN 31  48  48  ASN ASN A . n 
A 1 32  SER 32  49  49  SER SER A . n 
A 1 33  GLN 33  50  50  GLN GLN A . n 
A 1 34  TRP 34  51  51  TRP TRP A . n 
A 1 35  VAL 35  52  52  VAL VAL A . n 
A 1 36  VAL 36  53  53  VAL VAL A . n 
A 1 37  SER 37  54  54  SER SER A . n 
A 1 38  ALA 38  55  55  ALA ALA A . n 
A 1 39  ALA 39  56  56  ALA ALA A . n 
A 1 40  HIS 40  57  57  HIS HIS A . n 
A 1 41  CYS 41  58  58  CYS CYS A . n 
A 1 42  TYR 42  59  59  TYR TYR A . n 
A 1 43  LYS 43  60  60  LYS LYS A . n 
A 1 44  SER 44  61  61  SER SER A . n 
A 1 45  GLY 45  62  62  GLY GLY A . n 
A 1 46  ILE 46  63  63  ILE ILE A . n 
A 1 47  GLN 47  64  64  GLN GLN A . n 
A 1 48  VAL 48  65  65  VAL VAL A . n 
A 1 49  ARG 49  65  65  ARG ARG A A n 
A 1 50  LEU 50  66  66  LEU LEU A . n 
A 1 51  GLY 51  69  69  GLY GLY A . n 
A 1 52  GLU 52  70  70  GLU GLU A . n 
A 1 53  ASP 53  71  71  ASP ASP A . n 
A 1 54  ASN 54  72  72  ASN ASN A . n 
A 1 55  ILE 55  73  73  ILE ILE A . n 
A 1 56  ASN 56  74  74  ASN ASN A . n 
A 1 57  VAL 57  75  75  VAL VAL A . n 
A 1 58  VAL 58  76  76  VAL VAL A . n 
A 1 59  GLU 59  77  77  GLU GLU A . n 
A 1 60  GLY 60  78  78  GLY GLY A . n 
A 1 61  ASN 61  79  79  ASN ASN A . n 
A 1 62  GLU 62  80  80  GLU GLU A . n 
A 1 63  GLN 63  81  81  GLN GLN A . n 
A 1 64  PHE 64  82  82  PHE PHE A . n 
A 1 65  ILE 65  83  83  ILE ILE A . n 
A 1 66  SER 66  84  84  SER SER A . n 
A 1 67  ALA 67  85  85  ALA ALA A . n 
A 1 68  SER 68  86  86  SER SER A . n 
A 1 69  LYS 69  87  87  LYS LYS A . n 
A 1 70  SER 70  88  88  SER SER A . n 
A 1 71  ILE 71  89  89  ILE ILE A . n 
A 1 72  VAL 72  90  90  VAL VAL A . n 
A 1 73  HIS 73  91  91  HIS HIS A . n 
A 1 74  PRO 74  92  92  PRO PRO A . n 
A 1 75  SER 75  93  93  SER SER A . n 
A 1 76  TYR 76  94  94  TYR TYR A . n 
A 1 77  ASN 77  95  95  ASN ASN A . n 
A 1 78  SER 78  96  96  SER SER A . n 
A 1 79  ASN 79  97  97  ASN ASN A . n 
A 1 80  THR 80  98  98  THR THR A . n 
A 1 81  LEU 81  99  99  LEU LEU A . n 
A 1 82  ASN 82  100 100 ASN ASN A . n 
A 1 83  ASN 83  101 101 ASN ASN A . n 
A 1 84  ASP 84  102 102 ASP ASP A . n 
A 1 85  ILE 85  103 103 ILE ILE A . n 
A 1 86  MET 86  104 104 MET MET A . n 
A 1 87  LEU 87  105 105 LEU LEU A . n 
A 1 88  ILE 88  106 106 ILE ILE A . n 
A 1 89  LYS 89  107 107 LYS LYS A . n 
A 1 90  LEU 90  108 108 LEU LEU A . n 
A 1 91  LYS 91  109 109 LYS LYS A . n 
A 1 92  SER 92  110 110 SER SER A . n 
A 1 93  ALA 93  111 111 ALA ALA A . n 
A 1 94  ALA 94  112 112 ALA ALA A . n 
A 1 95  SER 95  113 113 SER SER A . n 
A 1 96  LEU 96  114 114 LEU LEU A . n 
A 1 97  ASN 97  115 115 ASN ASN A . n 
A 1 98  SER 98  116 116 SER SER A . n 
A 1 99  ARG 99  117 117 ARG ARG A . n 
A 1 100 VAL 100 118 118 VAL VAL A . n 
A 1 101 ALA 101 119 119 ALA ALA A . n 
A 1 102 SER 102 120 120 SER SER A . n 
A 1 103 ILE 103 121 121 ILE ILE A . n 
A 1 104 SER 104 122 122 SER SER A . n 
A 1 105 LEU 105 123 123 LEU LEU A . n 
A 1 106 PRO 106 124 124 PRO PRO A . n 
A 1 107 THR 107 125 125 THR THR A . n 
A 1 108 SER 108 127 127 SER SER A . n 
A 1 109 CYS 109 128 128 CYS CYS A . n 
A 1 110 ALA 110 129 129 ALA ALA A . n 
A 1 111 SER 111 130 130 SER SER A . n 
A 1 112 ALA 112 132 132 ALA ALA A . n 
A 1 113 GLY 113 133 133 GLY GLY A . n 
A 1 114 THR 114 134 134 THR THR A . n 
A 1 115 GLN 115 135 135 GLN GLN A . n 
A 1 116 CYS 116 136 136 CYS CYS A . n 
A 1 117 LEU 117 137 137 LEU LEU A . n 
A 1 118 ILE 118 138 138 ILE ILE A . n 
A 1 119 SER 119 139 139 SER SER A . n 
A 1 120 GLY 120 140 140 GLY GLY A . n 
A 1 121 TRP 121 141 141 TRP TRP A . n 
A 1 122 GLY 122 142 142 GLY GLY A . n 
A 1 123 ASN 123 143 143 ASN ASN A . n 
A 1 124 THR 124 144 144 THR THR A . n 
A 1 125 LYS 125 145 145 LYS LYS A . n 
A 1 126 SER 126 146 146 SER SER A . n 
A 1 127 SER 127 147 147 SER SER A . n 
A 1 128 GLY 128 148 148 GLY GLY A . n 
A 1 129 THR 129 149 149 THR THR A . n 
A 1 130 SER 130 150 150 SER SER A . n 
A 1 131 TYR 131 151 151 TYR TYR A . n 
A 1 132 PRO 132 152 152 PRO PRO A . n 
A 1 133 ASP 133 153 153 ASP ASP A . n 
A 1 134 VAL 134 154 154 VAL VAL A . n 
A 1 135 LEU 135 155 155 LEU LEU A . n 
A 1 136 LYS 136 156 156 LYS LYS A . n 
A 1 137 CYS 137 157 157 CYS CYS A . n 
A 1 138 LEU 138 158 158 LEU LEU A . n 
A 1 139 LYS 139 159 159 LYS LYS A . n 
A 1 140 ALA 140 160 160 ALA ALA A . n 
A 1 141 PRO 141 161 161 PRO PRO A . n 
A 1 142 ILE 142 162 162 ILE ILE A . n 
A 1 143 LEU 143 163 163 LEU LEU A . n 
A 1 144 SER 144 164 164 SER SER A . n 
A 1 145 ASP 145 165 165 ASP ASP A . n 
A 1 146 SER 146 166 166 SER SER A . n 
A 1 147 SER 147 167 167 SER SER A . n 
A 1 148 CYS 148 168 168 CYS CYS A . n 
A 1 149 LYS 149 169 169 LYS LYS A . n 
A 1 150 SER 150 170 170 SER SER A . n 
A 1 151 ALA 151 171 171 ALA ALA A . n 
A 1 152 TYR 152 172 172 TYR TYR A . n 
A 1 153 PRO 153 173 173 PRO PRO A . n 
A 1 154 GLY 154 174 174 GLY GLY A . n 
A 1 155 GLN 155 175 175 GLN GLN A . n 
A 1 156 ILE 156 176 176 ILE ILE A . n 
A 1 157 THR 157 177 177 THR THR A . n 
A 1 158 SER 158 178 178 SER SER A . n 
A 1 159 ASN 159 179 179 ASN ASN A . n 
A 1 160 MET 160 180 180 MET MET A . n 
A 1 161 PHE 161 181 181 PHE PHE A . n 
A 1 162 CYS 162 182 182 CYS CYS A . n 
A 1 163 ALA 163 183 183 ALA ALA A . n 
A 1 164 GLY 164 184 184 GLY GLY A . n 
A 1 165 TYR 165 184 184 TYR TYR A A n 
A 1 166 LEU 166 185 185 LEU LEU A . n 
A 1 167 GLU 167 186 186 GLU GLU A . n 
A 1 168 GLY 168 187 187 GLY GLY A . n 
A 1 169 GLY 169 188 188 GLY GLY A . n 
A 1 170 LYS 170 188 188 LYS LYS A A n 
A 1 171 ASP 171 189 189 ASP ASP A . n 
A 1 172 SER 172 190 190 SER SER A . n 
A 1 173 CYS 173 191 191 CYS CYS A . n 
A 1 174 GLN 174 192 192 GLN GLN A . n 
A 1 175 GLY 175 193 193 GLY GLY A . n 
A 1 176 ASP 176 194 194 ASP ASP A . n 
A 1 177 SER 177 195 195 SER SER A . n 
A 1 178 GLY 178 196 196 GLY GLY A . n 
A 1 179 GLY 179 197 197 GLY GLY A . n 
A 1 180 PRO 180 198 198 PRO PRO A . n 
A 1 181 VAL 181 199 199 VAL VAL A . n 
A 1 182 VAL 182 200 200 VAL VAL A . n 
A 1 183 CYS 183 201 201 CYS CYS A . n 
A 1 184 SER 184 202 202 SER SER A . n 
A 1 185 GLY 185 203 203 GLY GLY A . n 
A 1 186 LYS 186 204 204 LYS LYS A . n 
A 1 187 LEU 187 209 209 LEU LEU A . n 
A 1 188 GLN 188 210 210 GLN GLN A . n 
A 1 189 GLY 189 211 211 GLY GLY A . n 
A 1 190 ILE 190 212 212 ILE ILE A . n 
A 1 191 VAL 191 213 213 VAL VAL A . n 
A 1 192 SER 192 214 214 SER SER A . n 
A 1 193 TRP 193 215 215 TRP TRP A . n 
A 1 194 GLY 194 216 216 GLY GLY A . n 
A 1 195 SER 195 217 217 SER SER A . n 
A 1 196 GLY 196 219 219 GLY GLY A . n 
A 1 197 CYS 197 220 220 CYS CYS A . n 
A 1 198 ALA 198 221 221 ALA ALA A . n 
A 1 199 GLN 199 221 221 GLN GLN A A n 
A 1 200 LYS 200 222 222 LYS LYS A . n 
A 1 201 ASN 201 223 223 ASN ASN A . n 
A 1 202 LYS 202 224 224 LYS LYS A . n 
A 1 203 PRO 203 225 225 PRO PRO A . n 
A 1 204 GLY 204 226 226 GLY GLY A . n 
A 1 205 VAL 205 227 227 VAL VAL A . n 
A 1 206 TYR 206 228 228 TYR TYR A . n 
A 1 207 THR 207 229 229 THR THR A . n 
A 1 208 LYS 208 230 230 LYS LYS A . n 
A 1 209 VAL 209 231 231 VAL VAL A . n 
A 1 210 CYS 210 232 232 CYS CYS A . n 
A 1 211 ASN 211 233 233 ASN ASN A . n 
A 1 212 TYR 212 234 234 TYR TYR A . n 
A 1 213 VAL 213 235 235 VAL VAL A . n 
A 1 214 SER 214 236 236 SER SER A . n 
A 1 215 TRP 215 237 237 TRP TRP A . n 
A 1 216 ILE 216 238 238 ILE ILE A . n 
A 1 217 LYS 217 239 239 LYS LYS A . n 
A 1 218 GLN 218 240 240 GLN GLN A . n 
A 1 219 THR 219 241 241 THR THR A . n 
A 1 220 ILE 220 242 242 ILE ILE A . n 
A 1 221 ALA 221 243 243 ALA ALA A . n 
A 1 222 SER 222 244 244 SER SER A . n 
A 1 223 ASN 223 245 245 ASN ASN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   247 247 CA  CA  A . 
C 3 CL  1   260 260 CL  CL  A . 
D 4 696 1   246 246 696 IND A . 
E 5 HOH 1   248 248 HOH HOH A . 
E 5 HOH 2   249 249 HOH HOH A . 
E 5 HOH 3   250 250 HOH HOH A . 
E 5 HOH 4   252 252 HOH HOH A . 
E 5 HOH 5   253 253 HOH HOH A . 
E 5 HOH 6   254 254 HOH HOH A . 
E 5 HOH 7   255 255 HOH HOH A . 
E 5 HOH 8   256 256 HOH HOH A . 
E 5 HOH 9   258 258 HOH HOH A . 
E 5 HOH 10  259 259 HOH HOH A . 
E 5 HOH 11  261 261 HOH HOH A . 
E 5 HOH 12  262 262 HOH HOH A . 
E 5 HOH 13  263 263 HOH HOH A . 
E 5 HOH 14  264 264 HOH HOH A . 
E 5 HOH 15  266 266 HOH HOH A . 
E 5 HOH 16  267 267 HOH HOH A . 
E 5 HOH 17  268 268 HOH HOH A . 
E 5 HOH 18  269 269 HOH HOH A . 
E 5 HOH 19  270 270 HOH HOH A . 
E 5 HOH 20  272 272 HOH HOH A . 
E 5 HOH 21  273 273 HOH HOH A . 
E 5 HOH 22  274 274 HOH HOH A . 
E 5 HOH 23  275 275 HOH HOH A . 
E 5 HOH 24  277 277 HOH HOH A . 
E 5 HOH 25  278 278 HOH HOH A . 
E 5 HOH 26  280 280 HOH HOH A . 
E 5 HOH 27  281 281 HOH HOH A . 
E 5 HOH 28  282 282 HOH HOH A . 
E 5 HOH 29  283 283 HOH HOH A . 
E 5 HOH 30  284 284 HOH HOH A . 
E 5 HOH 31  285 285 HOH HOH A . 
E 5 HOH 32  286 286 HOH HOH A . 
E 5 HOH 33  287 287 HOH HOH A . 
E 5 HOH 34  289 289 HOH HOH A . 
E 5 HOH 35  290 290 HOH HOH A . 
E 5 HOH 36  291 291 HOH HOH A . 
E 5 HOH 37  292 292 HOH HOH A . 
E 5 HOH 38  293 293 HOH HOH A . 
E 5 HOH 39  294 294 HOH HOH A . 
E 5 HOH 40  295 295 HOH HOH A . 
E 5 HOH 41  296 296 HOH HOH A . 
E 5 HOH 42  297 297 HOH HOH A . 
E 5 HOH 43  299 299 HOH HOH A . 
E 5 HOH 44  300 300 HOH HOH A . 
E 5 HOH 45  302 302 HOH HOH A . 
E 5 HOH 46  307 307 HOH HOH A . 
E 5 HOH 47  308 308 HOH HOH A . 
E 5 HOH 48  309 309 HOH HOH A . 
E 5 HOH 49  312 312 HOH HOH A . 
E 5 HOH 50  315 315 HOH HOH A . 
E 5 HOH 51  317 317 HOH HOH A . 
E 5 HOH 52  318 318 HOH HOH A . 
E 5 HOH 53  321 321 HOH HOH A . 
E 5 HOH 54  322 322 HOH HOH A . 
E 5 HOH 55  323 323 HOH HOH A . 
E 5 HOH 56  324 324 HOH HOH A . 
E 5 HOH 57  326 326 HOH HOH A . 
E 5 HOH 58  327 327 HOH HOH A . 
E 5 HOH 59  328 328 HOH HOH A . 
E 5 HOH 60  331 331 HOH HOH A . 
E 5 HOH 61  333 333 HOH HOH A . 
E 5 HOH 62  335 335 HOH HOH A . 
E 5 HOH 63  336 336 HOH HOH A . 
E 5 HOH 64  338 338 HOH HOH A . 
E 5 HOH 65  339 339 HOH HOH A . 
E 5 HOH 66  342 342 HOH HOH A . 
E 5 HOH 67  346 346 HOH HOH A . 
E 5 HOH 68  348 348 HOH HOH A . 
E 5 HOH 69  349 349 HOH HOH A . 
E 5 HOH 70  351 351 HOH HOH A . 
E 5 HOH 71  352 352 HOH HOH A . 
E 5 HOH 72  354 354 HOH HOH A . 
E 5 HOH 73  358 358 HOH HOH A . 
E 5 HOH 74  360 360 HOH HOH A . 
E 5 HOH 75  361 361 HOH HOH A . 
E 5 HOH 76  363 363 HOH HOH A . 
E 5 HOH 77  364 364 HOH HOH A . 
E 5 HOH 78  369 369 HOH HOH A . 
E 5 HOH 79  371 371 HOH HOH A . 
E 5 HOH 80  374 374 HOH HOH A . 
E 5 HOH 81  375 375 HOH HOH A . 
E 5 HOH 82  376 376 HOH HOH A . 
E 5 HOH 83  377 377 HOH HOH A . 
E 5 HOH 84  380 380 HOH HOH A . 
E 5 HOH 85  381 381 HOH HOH A . 
E 5 HOH 86  382 382 HOH HOH A . 
E 5 HOH 87  383 383 HOH HOH A . 
E 5 HOH 88  384 384 HOH HOH A . 
E 5 HOH 89  385 385 HOH HOH A . 
E 5 HOH 90  389 389 HOH HOH A . 
E 5 HOH 91  390 390 HOH HOH A . 
E 5 HOH 92  391 391 HOH HOH A . 
E 5 HOH 93  392 392 HOH HOH A . 
E 5 HOH 94  393 393 HOH HOH A . 
E 5 HOH 95  395 395 HOH HOH A . 
E 5 HOH 96  397 397 HOH HOH A . 
E 5 HOH 97  402 402 HOH HOH A . 
E 5 HOH 98  403 403 HOH HOH A . 
E 5 HOH 99  404 404 HOH HOH A . 
E 5 HOH 100 412 412 HOH HOH A . 
E 5 HOH 101 421 421 HOH HOH A . 
E 5 HOH 102 430 430 HOH HOH A . 
E 5 HOH 103 431 431 HOH HOH A . 
E 5 HOH 104 432 432 HOH HOH A . 
E 5 HOH 105 434 434 HOH HOH A . 
E 5 HOH 106 439 439 HOH HOH A . 
E 5 HOH 107 442 442 HOH HOH A . 
E 5 HOH 108 450 450 HOH HOH A . 
E 5 HOH 109 480 480 HOH HOH A . 
E 5 HOH 110 489 489 HOH HOH A . 
E 5 HOH 111 497 497 HOH HOH A . 
E 5 HOH 112 502 502 HOH HOH A . 
E 5 HOH 113 504 504 HOH HOH A . 
E 5 HOH 114 505 505 HOH HOH A . 
E 5 HOH 115 508 508 HOH HOH A . 
E 5 HOH 116 537 537 HOH HOH A . 
E 5 HOH 117 539 539 HOH HOH A . 
E 5 HOH 118 540 540 HOH HOH A . 
E 5 HOH 119 542 542 HOH HOH A . 
E 5 HOH 120 547 547 HOH HOH A . 
E 5 HOH 121 548 548 HOH HOH A . 
E 5 HOH 122 552 552 HOH HOH A . 
E 5 HOH 123 557 557 HOH HOH A . 
E 5 HOH 124 559 559 HOH HOH A . 
E 5 HOH 125 560 560 HOH HOH A . 
E 5 HOH 126 561 561 HOH HOH A . 
E 5 HOH 127 567 567 HOH HOH A . 
E 5 HOH 128 588 588 HOH HOH A . 
E 5 HOH 129 636 636 HOH HOH A . 
E 5 HOH 130 650 650 HOH HOH A . 
E 5 HOH 131 664 664 HOH HOH A . 
E 5 HOH 132 666 666 HOH HOH A . 
E 5 HOH 133 678 678 HOH HOH A . 
E 5 HOH 134 683 683 HOH HOH A . 
E 5 HOH 135 685 685 HOH HOH A . 
E 5 HOH 136 701 701 HOH HOH A . 
E 5 HOH 137 703 703 HOH HOH A . 
E 5 HOH 138 705 705 HOH HOH A . 
E 5 HOH 139 706 706 HOH HOH A . 
E 5 HOH 140 709 709 HOH HOH A . 
E 5 HOH 141 710 710 HOH HOH A . 
E 5 HOH 142 713 713 HOH HOH A . 
E 5 HOH 143 714 714 HOH HOH A . 
E 5 HOH 144 716 716 HOH HOH A . 
E 5 HOH 145 727 727 HOH HOH A . 
E 5 HOH 146 746 746 HOH HOH A . 
E 5 HOH 147 750 750 HOH HOH A . 
E 5 HOH 148 773 773 HOH HOH A . 
E 5 HOH 149 803 803 HOH HOH A . 
E 5 HOH 150 832 832 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 52 ? A GLU 70  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? A ASN 54 ? A ASN 72  ? 1_555 91.9  ? 
2  OE2 ? A GLU 52 ? A GLU 70  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 OE2 ? A GLU 62 ? A GLU 80  ? 1_555 90.9  ? 
3  O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 OE2 ? A GLU 62 ? A GLU 80  ? 1_555 162.8 ? 
4  OE2 ? A GLU 52 ? A GLU 70  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 560 ? 1_555 82.5  ? 
5  O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 560 ? 1_555 89.5  ? 
6  OE2 ? A GLU 62 ? A GLU 80  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 560 ? 1_555 74.1  ? 
7  OE2 ? A GLU 52 ? A GLU 70  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? A VAL 57 ? A VAL 75  ? 1_555 169.9 ? 
8  O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? A VAL 57 ? A VAL 75  ? 1_555 91.8  ? 
9  OE2 ? A GLU 62 ? A GLU 80  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? A VAL 57 ? A VAL 75  ? 1_555 88.2  ? 
10 O   ? E HOH .  ? A HOH 560 ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? A VAL 57 ? A VAL 75  ? 1_555 106.9 ? 
11 OE2 ? A GLU 52 ? A GLU 70  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 248 ? 1_555 81.5  ? 
12 O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 248 ? 1_555 104.0 ? 
13 OE2 ? A GLU 62 ? A GLU 80  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 248 ? 1_555 93.2  ? 
14 O   ? E HOH .  ? A HOH 560 ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 248 ? 1_555 159.3 ? 
15 O   ? A VAL 57 ? A VAL 75  ? 1_555 CA ? B CA . ? A CA 247 ? 1_555 O   ? E HOH .  ? A HOH 248 ? 1_555 88.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-09-02 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
bioteX 'data collection' 1.2   ? 1 
bioteX 'data reduction'  1.2   ? 2 
X-PLOR refinement        3.851 ? 3 
bioteX 'data scaling'    .     ? 4 
Quanta 'model building'  .     ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HG  A SER 195 ? ? "O6'" A 696 246 ? ? 1.29 
2  1 OG  A SER 236 ? B H2    A HOH 292 ? ? 1.50 
3  1 OD1 A ASN 101 ? ? H1    A HOH 548 ? ? 1.51 
4  1 OH  A TYR 20  ? ? H1    A HOH 348 ? ? 1.53 
5  1 OD1 A ASN 233 ? ? H1    A HOH 505 ? ? 1.53 
6  1 OG  A SER 116 ? ? H1    A HOH 539 ? ? 1.54 
7  1 O   A ARG 117 ? ? H1    A HOH 270 ? ? 1.54 
8  1 O   A TYR 184 A ? H1    A HOH 650 ? ? 1.54 
9  1 O   A THR 144 ? ? H2    A HOH 391 ? ? 1.55 
10 1 O   A GLY 203 ? ? H1    A HOH 351 ? ? 1.55 
11 1 O   A ALA 129 ? ? H1    A HOH 269 ? ? 1.57 
12 1 O   A SER 61  ? ? H1    A HOH 323 ? ? 1.57 
13 1 O   A HOH 381 ? ? H1    A HOH 560 ? ? 1.58 
14 1 OG  A SER 84  ? ? H1    A HOH 312 ? ? 1.59 
15 1 OG  A SER 195 ? ? HN3   A 696 246 ? ? 1.59 
16 1 O   A GLY 18  ? ? H1    A HOH 291 ? ? 1.60 
17 1 O   A SER 146 ? ? H2    A HOH 369 ? ? 1.60 
18 1 OD1 A ASN 25  ? ? H2    A HOH 272 ? ? 1.60 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ILE 
_pdbx_validate_symm_contact.auth_seq_id_1     73 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    H2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     750 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_556 
_pdbx_validate_symm_contact.dist              1.59 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 A HIS 40 ? ? CD2 A HIS 40 ? ? 1.299 1.373 -0.074 0.011 N 
2 1 NE2 A HIS 91 ? ? CD2 A HIS 91 ? ? 1.291 1.373 -0.082 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG  A TRP 51  ? ? CD1 A TRP 51  ? ? NE1 A TRP 51  ? ? 103.17 110.10 -6.93 1.00 N 
2  1 CD1 A TRP 51  ? ? NE1 A TRP 51  ? ? CE2 A TRP 51  ? ? 117.59 109.00 8.59  0.90 N 
3  1 NE1 A TRP 51  ? ? CE2 A TRP 51  ? ? CZ2 A TRP 51  ? ? 137.75 130.40 7.35  1.10 N 
4  1 NE1 A TRP 51  ? ? CE2 A TRP 51  ? ? CD2 A TRP 51  ? ? 101.16 107.30 -6.14 1.00 N 
5  1 NE  A ARG 117 ? ? CZ  A ARG 117 ? ? NH2 A ARG 117 ? ? 116.95 120.30 -3.35 0.50 N 
6  1 CG  A TRP 141 ? ? CD1 A TRP 141 ? ? NE1 A TRP 141 ? ? 103.65 110.10 -6.45 1.00 N 
7  1 CD1 A TRP 141 ? ? NE1 A TRP 141 ? ? CE2 A TRP 141 ? ? 116.70 109.00 7.70  0.90 N 
8  1 CG  A TRP 215 ? ? CD1 A TRP 215 ? ? NE1 A TRP 215 ? ? 104.02 110.10 -6.08 1.00 N 
9  1 CD1 A TRP 215 ? ? NE1 A TRP 215 ? ? CE2 A TRP 215 ? ? 117.12 109.00 8.12  0.90 N 
10 1 NE1 A TRP 215 ? ? CE2 A TRP 215 ? ? CZ2 A TRP 215 ? ? 138.16 130.40 7.76  1.10 N 
11 1 NE1 A TRP 215 ? ? CE2 A TRP 215 ? ? CD2 A TRP 215 ? ? 101.11 107.30 -6.19 1.00 N 
12 1 CG  A TRP 237 ? ? CD1 A TRP 237 ? ? NE1 A TRP 237 ? ? 103.59 110.10 -6.51 1.00 N 
13 1 CD1 A TRP 237 ? ? NE1 A TRP 237 ? ? CE2 A TRP 237 ? ? 117.96 109.00 8.96  0.90 N 
14 1 NE1 A TRP 237 ? ? CE2 A TRP 237 ? ? CZ2 A TRP 237 ? ? 139.76 130.40 9.36  1.10 N 
15 1 NE1 A TRP 237 ? ? CE2 A TRP 237 ? ? CD2 A TRP 237 ? ? 100.35 107.30 -6.95 1.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 71  ? ? -135.29 -79.54  
2 1 ASN A 79  ? ? 87.76   -3.55   
3 1 ASN A 115 ? ? -160.11 -155.41 
4 1 ASN A 223 ? ? 55.37   17.64   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 65  A ? 0.078 'SIDE CHAIN' 
2 1 ARG A 117 ? ? 0.190 'SIDE CHAIN' 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                                                     CA  
3 'CHLORIDE ION'                                                    CL  
4 "3-{5-[AMINO(IMINIO)METHYL]-1H-INDOL-2-YL}-1,1'-BIPHENYL-2-OLATE" 696 
5 water                                                             HOH 
#