data_1O3Q
# 
_entry.id   1O3Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O3Q         
NDB   PD0398       
RCSB  RCSB001766   
WWPDB D_1000001766 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2003-04-08 
_pdbx_database_PDB_obs_spr.pdb_id           1O3Q 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1DB7 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1O3R . unspecified 
PDB 1O3S . unspecified 
PDB 1O3T . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O3Q 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, S.'         1 
'Vojtechovsky, J.' 2 
'Parkinson, G.N.'  3 
'Ebright, R.H.'    4 
'Berman, H.M.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
;
J.Mol.Biol. 314 63 74 2001 JMOBAK UK 0022-2836 0070 ? 11724532 10.1006/jmbi.2001.5089 
1       
;Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
;
J.Mol.Biol. 314 75 82 2001 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.2001.5090 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, S.'         1  
primary 'Vojtechovsky, J.' 2  
primary 'Parkinson, G.N.'  3  
primary 'Ebright, R.H.'    4  
primary 'Berman, H.M.'     5  
1       'Chen, S.'         6  
1       'Gunasekera, A.'   7  
1       'Zhang, X.'        8  
1       'Kunkel, T.A.'     9  
1       'Ebright, R.H.'    10 
1       'Berman, H.M.'     11 
# 
_cell.entry_id           1O3Q 
_cell.length_a           77.150 
_cell.length_b           77.150 
_cell.length_c           143.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1O3Q 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.cell_setting                     trigonal 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'"             3405.273  1  ? ? ? ? 
2 polymer     syn "5'-D(*CP*TP*AP*GP*AP*TP*CP*AP*CP*AP*TP*TP*TP*TP*T)-3'" 4533.970  1  ? ? ? ? 
3 polymer     man 'CATABOLITE GENE ACTIVATOR PROTEIN'                     22558.072 1  ? ? ? ? 
4 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                  329.206   2  ? ? ? ? 
5 water       nat water                                                   18.015    41 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'CAP, CAMP RECEPTOR PROTEIN, CAMP-REGULATORY PROTEIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DA)(DA)(DT)(DG)(DT)(DG)(DA)(DT)' AAAAATGTGAT B ? 
2 polydeoxyribonucleotide no no '(DC)(DT)(DA)(DG)(DA)(DT)(DC)(DA)(DC)(DA)(DT)(DT)(DT)(DT)(DT)' CTAGATCACATTTTT C ? 
3 'polypeptide(L)'        no no 
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DG  n 
1 8   DT  n 
1 9   DG  n 
1 10  DA  n 
1 11  DT  n 
2 1   DC  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DC  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
3 1   ASP n 
3 2   PRO n 
3 3   THR n 
3 4   LEU n 
3 5   GLU n 
3 6   TRP n 
3 7   PHE n 
3 8   LEU n 
3 9   SER n 
3 10  HIS n 
3 11  CYS n 
3 12  HIS n 
3 13  ILE n 
3 14  HIS n 
3 15  LYS n 
3 16  TYR n 
3 17  PRO n 
3 18  SER n 
3 19  LYS n 
3 20  SER n 
3 21  THR n 
3 22  LEU n 
3 23  ILE n 
3 24  HIS n 
3 25  GLN n 
3 26  GLY n 
3 27  GLU n 
3 28  LYS n 
3 29  ALA n 
3 30  GLU n 
3 31  THR n 
3 32  LEU n 
3 33  TYR n 
3 34  TYR n 
3 35  ILE n 
3 36  VAL n 
3 37  LYS n 
3 38  GLY n 
3 39  SER n 
3 40  VAL n 
3 41  ALA n 
3 42  VAL n 
3 43  LEU n 
3 44  ILE n 
3 45  LYS n 
3 46  ASP n 
3 47  GLU n 
3 48  GLU n 
3 49  GLY n 
3 50  LYS n 
3 51  GLU n 
3 52  MET n 
3 53  ILE n 
3 54  LEU n 
3 55  SER n 
3 56  TYR n 
3 57  LEU n 
3 58  ASN n 
3 59  GLN n 
3 60  GLY n 
3 61  ASP n 
3 62  PHE n 
3 63  ILE n 
3 64  GLY n 
3 65  GLU n 
3 66  LEU n 
3 67  GLY n 
3 68  LEU n 
3 69  PHE n 
3 70  GLU n 
3 71  GLU n 
3 72  GLY n 
3 73  GLN n 
3 74  GLU n 
3 75  ARG n 
3 76  SER n 
3 77  ALA n 
3 78  TRP n 
3 79  VAL n 
3 80  ARG n 
3 81  ALA n 
3 82  LYS n 
3 83  THR n 
3 84  ALA n 
3 85  CYS n 
3 86  GLU n 
3 87  VAL n 
3 88  ALA n 
3 89  GLU n 
3 90  ILE n 
3 91  SER n 
3 92  TYR n 
3 93  LYS n 
3 94  LYS n 
3 95  PHE n 
3 96  ARG n 
3 97  GLN n 
3 98  LEU n 
3 99  ILE n 
3 100 GLN n 
3 101 VAL n 
3 102 ASN n 
3 103 PRO n 
3 104 ASP n 
3 105 ILE n 
3 106 LEU n 
3 107 MET n 
3 108 ARG n 
3 109 LEU n 
3 110 SER n 
3 111 ALA n 
3 112 GLN n 
3 113 MET n 
3 114 ALA n 
3 115 ARG n 
3 116 ARG n 
3 117 LEU n 
3 118 GLN n 
3 119 VAL n 
3 120 THR n 
3 121 SER n 
3 122 GLU n 
3 123 LYS n 
3 124 VAL n 
3 125 GLY n 
3 126 ASN n 
3 127 LEU n 
3 128 ALA n 
3 129 PHE n 
3 130 LEU n 
3 131 ASP n 
3 132 VAL n 
3 133 THR n 
3 134 GLY n 
3 135 ARG n 
3 136 ILE n 
3 137 ALA n 
3 138 GLN n 
3 139 THR n 
3 140 LEU n 
3 141 LEU n 
3 142 ASN n 
3 143 LEU n 
3 144 ALA n 
3 145 LYS n 
3 146 GLN n 
3 147 PRO n 
3 148 ASP n 
3 149 ALA n 
3 150 MET n 
3 151 THR n 
3 152 HIS n 
3 153 PRO n 
3 154 ASP n 
3 155 GLY n 
3 156 MET n 
3 157 GLN n 
3 158 ILE n 
3 159 LYS n 
3 160 ILE n 
3 161 THR n 
3 162 ARG n 
3 163 GLN n 
3 164 GLU n 
3 165 ILE n 
3 166 GLY n 
3 167 GLN n 
3 168 ILE n 
3 169 VAL n 
3 170 GLY n 
3 171 CYS n 
3 172 SER n 
3 173 ARG n 
3 174 GLU n 
3 175 THR n 
3 176 VAL n 
3 177 GLY n 
3 178 ARG n 
3 179 ILE n 
3 180 LEU n 
3 181 LYS n 
3 182 MET n 
3 183 LEU n 
3 184 GLU n 
3 185 ASP n 
3 186 GLN n 
3 187 ASN n 
3 188 LEU n 
3 189 ILE n 
3 190 SER n 
3 191 ALA n 
3 192 HIS n 
3 193 GLY n 
3 194 LYS n 
3 195 THR n 
3 196 ILE n 
3 197 VAL n 
3 198 VAL n 
3 199 TYR n 
3 200 GLY n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP CRP_ECOLI P0ACJ8 9 
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
? 
2 1 PDB 1O3Q      1O3Q   ? ? ? 
3 2 PDB 1O3Q      1O3Q   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O3Q A 1 ? 200 ? P0ACJ8 9  ? 208 ? 8  207 
2 2 1O3Q B 1 ? 11  ? 1O3Q   -2 ? 9   ? -2 9   
3 3 1O3Q C 1 ? 15  ? 1O3Q   13 ? -2  ? 13 -2  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                  'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ?                  'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1O3Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      4.01 
_exptl_crystal.density_percent_sol   69.1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.23 
_exptl_crystal_grow.pdbx_details    
;PEG 8000, 1,4-DIOXANE, MES, NACL, MGCL2, CAMP, pH 6.23, 
VAPOR DIFFUSION, HANGING DROP at 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 1,4-DIOXANE 1  2  3  
1 2 1 MES         4  5  6  
1 3 1 NACL        7  8  9  
1 4 1 MGCL2       10 11 12 
1 5 1 CAMP        13 14 15 
1 6 1 'PEG 8000'  16 17 18 
1 7 2 'PEG 8000'  19 20 21 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           108.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   1997-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.100 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1O3Q 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   9976 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.9000 
_reflns.B_iso_Wilson_estimate        39.99 
_reflns.pdbx_redundancy              5.300 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.422 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        5.30 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1O3Q 
_refine.ls_number_reflns_obs                     9976 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               2648334.31 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          0.2521 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.252 
_refine.ls_R_factor_R_free                       0.318 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.900 
_refine.ls_number_reflns_R_free                  987 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               57.50 
_refine.aniso_B[1][1]                            5.94 
_refine.aniso_B[2][2]                            5.94 
_refine.aniso_B[3][3]                            -11.89 
_refine.aniso_B[1][2]                            20.46 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.419 
_refine.solvent_model_param_bsol                 66.42 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1O3Q 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.48 
_refine_analyze.Luzzati_sigma_a_free            0.31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1581 
_refine_hist.pdbx_number_atoms_nucleic_acid   527 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             41 
_refine_hist.number_atoms_total               2193 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.50  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.10 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.15  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.630 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.190 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.540 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            5.070 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             1512 
_refine_ls_shell.R_factor_R_work                  0.279 
_refine_ls_shell.percent_reflns_obs               98.70 
_refine_ls_shell.R_factor_R_free                  0.347 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            9.40 
_refine_ls_shell.number_reflns_R_free             156 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 CMP.PARAM         CMP.TOP     'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1O3Q 
_struct.title                     'PROTEIN-DNA RECOGNITION AND DNA DEFORMATION REVEALED IN CRYSTAL STRUCTURES OF CAP-DNA COMPLEXES' 
_struct.pdbx_descriptor           'CATABOLITE GENE ACTIVATOR PROTEIN/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O3Q 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            
'PROTEIN-DNA COMPLEX, CAP, CAP-DNA, CATABOLITE GENE ACTIVATOR PROTEIN, CAMP RECEPTOR PROTEIN, CRP, GENE REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP C 1   ? SER C 9   ? ASP A 8   SER A 16  1 ? 9  
HELX_P HELX_P2 2 GLU C 65  ? PHE C 69  ? GLU A 72  PHE A 76  5 ? 5  
HELX_P HELX_P3 3 TYR C 92  ? ASN C 102 ? TYR A 99  ASN A 109 1 ? 11 
HELX_P HELX_P4 4 ASN C 102 ? LEU C 130 ? ASN A 109 LEU A 137 1 ? 29 
HELX_P HELX_P5 5 ASP C 131 ? LYS C 145 ? ASP A 138 LYS A 152 1 ? 15 
HELX_P HELX_P6 6 THR C 161 ? GLY C 170 ? THR A 168 GLY A 177 1 ? 10 
HELX_P HELX_P7 7 SER C 172 ? GLN C 186 ? SER A 179 GLN A 193 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 1  N1 ? ? ? 1_555 B DT 15 N3 ? ? B DA -2 C DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 15 O4 ? ? B DA -2 C DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 14 N3 ? ? B DA -1 C DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 14 O4 ? ? B DA -1 C DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 15 N3 ? ? B DA -1 C DT -2 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog6  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 13 N3 ? ? B DA 1  C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 13 O4 ? ? B DA 1  C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 11 O4 ? ? B DA 2  C DT 3  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog9  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 12 N3 ? ? B DA 2  C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 12 O4 ? ? B DA 2  C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 11 N3 ? ? B DA 3  C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 11 O4 ? ? B DA 3  C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 10 N1 ? ? B DT 4  C DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 10 N6 ? ? B DT 4  C DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC 9  N3 ? ? B DG 5  C DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC 9  O2 ? ? B DG 5  C DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC 9  N4 ? ? B DG 5  C DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 8  N1 ? ? B DT 6  C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 8  N6 ? ? B DT 6  C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 7  N3 ? ? B DG 7  C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 7  O2 ? ? B DG 7  C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 7  N4 ? ? B DG 7  C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 6  N3 ? ? B DA 8  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 6  O4 ? ? B DA 8  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 5  N1 ? ? B DT 9  C DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 5  N6 ? ? B DT 9  C DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? B DC 1  N3 ? ? ? 1_555 B DG 4  N1 ? ? C DC 13 C DG 10 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? B DC 1  N4 ? ? ? 1_555 B DG 4  O6 ? ? C DC 13 C DG 10 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? B DC 1  O2 ? ? ? 1_555 B DG 4  N2 ? ? C DC 13 C DG 10 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? B DT 2  N3 ? ? ? 1_555 B DA 3  N1 ? ? C DT 12 C DA 11 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? B DT 2  O4 ? ? ? 1_555 B DA 3  N6 ? ? C DT 12 C DA 11 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? B DA 3  N1 ? ? ? 1_555 B DT 2  N3 ? ? C DA 11 C DT 12 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? B DA 3  N6 ? ? ? 1_555 B DT 2  O4 ? ? C DA 11 C DT 12 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? B DG 4  N1 ? ? ? 1_555 B DC 1  N3 ? ? C DG 10 C DC 13 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? B DG 4  N2 ? ? ? 1_555 B DC 1  O2 ? ? C DG 10 C DC 13 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? B DG 4  O6 ? ? ? 1_555 B DC 1  N4 ? ? C DG 10 C DC 13 5_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS C 12  ? TYR C 16  ? HIS A 19  TYR A 23  
A 2 CYS C 85  ? SER C 91  ? CYS A 92  SER A 98  
A 3 THR C 31  ? LYS C 37  ? THR A 38  LYS A 44  
A 4 PHE C 62  ? ILE C 63  ? PHE A 69  ILE A 70  
B 1 THR C 21  ? ILE C 23  ? THR A 28  ILE A 30  
B 2 TRP C 78  ? ALA C 81  ? TRP A 85  ALA A 88  
B 3 VAL C 40  ? LYS C 45  ? VAL A 47  LYS A 52  
B 4 GLU C 51  ? LEU C 57  ? GLU A 58  LEU A 64  
C 1 MET C 150 ? HIS C 152 ? MET A 157 HIS A 159 
C 2 GLY C 155 ? LYS C 159 ? GLY A 162 LYS A 166 
C 3 THR C 195 ? TYR C 199 ? THR A 202 TYR A 206 
C 4 ILE C 189 ? HIS C 192 ? ILE A 196 HIS A 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS C 14  ? N HIS A 21  O VAL C 87  ? O VAL A 94  
A 2 3 O ALA C 88  ? O ALA A 95  N TYR C 34  ? N TYR A 41  
A 3 4 N TYR C 33  ? N TYR A 40  O ILE C 63  ? O ILE A 70  
B 1 2 N ILE C 23  ? N ILE A 30  O VAL C 79  ? O VAL A 86  
B 2 3 O ARG C 80  ? O ARG A 87  N ALA C 41  ? N ALA A 48  
B 3 4 N VAL C 42  ? N VAL A 49  O SER C 55  ? O SER A 62  
C 1 2 N MET C 150 ? N MET A 157 O GLN C 157 ? O GLN A 164 
C 2 3 N ILE C 158 ? N ILE A 165 O ILE C 196 ? O ILE A 203 
C 3 4 O VAL C 197 ? O VAL A 204 N SER C 190 ? N SER A 197 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CMP A 1' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CMP A 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 VAL C 42  ? VAL A 49  . ? 1_555 ? 
2  AC1 11 ILE C 63  ? ILE A 70  . ? 1_555 ? 
3  AC1 11 GLY C 64  ? GLY A 71  . ? 1_555 ? 
4  AC1 11 GLU C 65  ? GLU A 72  . ? 1_555 ? 
5  AC1 11 LEU C 66  ? LEU A 73  . ? 1_555 ? 
6  AC1 11 ARG C 75  ? ARG A 82  . ? 1_555 ? 
7  AC1 11 SER C 76  ? SER A 83  . ? 1_555 ? 
8  AC1 11 ALA C 77  ? ALA A 84  . ? 1_555 ? 
9  AC1 11 LEU C 117 ? LEU A 124 . ? 5_555 ? 
10 AC1 11 THR C 120 ? THR A 127 . ? 1_555 ? 
11 AC1 11 SER C 121 ? SER A 128 . ? 5_555 ? 
12 AC2 10 LYS C 50  ? LYS A 57  . ? 1_555 ? 
13 AC2 10 GLU C 51  ? GLU A 58  . ? 1_555 ? 
14 AC2 10 MET C 52  ? MET A 59  . ? 1_555 ? 
15 AC2 10 ALA C 128 ? ALA A 135 . ? 5_555 ? 
16 AC2 10 GLN C 163 ? GLN A 170 . ? 1_555 ? 
17 AC2 10 GLY C 166 ? GLY A 173 . ? 1_555 ? 
18 AC2 10 GLN C 167 ? GLN A 174 . ? 1_555 ? 
19 AC2 10 CYS C 171 ? CYS A 178 . ? 1_555 ? 
20 AC2 10 ARG C 173 ? ARG A 180 . ? 1_555 ? 
21 AC2 10 DA  B 5   ? DA  C 9   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1O3Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O3Q 
_atom_sites.fract_transf_matrix[1][1]   0.012962 
_atom_sites.fract_transf_matrix[1][2]   0.007483 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014967 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006983 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 54.171 14.512  7.132  1.00 84.54 ? -2  DA  B "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 52.813 14.041  7.148  1.00 84.54 ? -2  DA  B "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 51.842 14.924  7.902  1.00 84.54 ? -2  DA  B "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 50.595 14.203  8.051  1.00 84.54 ? -2  DA  B "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 52.265 15.281  9.327  1.00 84.54 ? -2  DA  B "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 51.706 16.542  9.728  1.00 84.54 ? -2  DA  B "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 51.715 14.130  10.144 1.00 82.96 ? -2  DA  B "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 50.437 13.756  9.399  1.00 84.54 ? -2  DA  B "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 50.249 12.306  9.352  1.00 84.54 ? -2  DA  B N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 50.930 11.412  8.545  1.00 84.54 ? -2  DA  B C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 50.581 10.158  8.726  1.00 84.54 ? -2  DA  B N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 49.598 10.224  9.711  1.00 84.54 ? -2  DA  B C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 48.825 9.224   10.356 1.00 84.54 ? -2  DA  B C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 48.928 7.918   10.085 1.00 83.62 ? -2  DA  B N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 47.940 9.627   11.304 1.00 84.54 ? -2  DA  B N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 47.842 10.949  11.579 1.00 84.54 ? -2  DA  B C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 48.508 11.980  11.041 1.00 84.54 ? -2  DA  B N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 49.381 11.547  10.104 1.00 84.54 ? -2  DA  B C4    1 
ATOM   19   P P     . DA  A 1 2   ? 52.215 17.244  11.092 1.00 84.54 ? -1  DA  B P     1 
ATOM   20   O OP1   . DA  A 1 2   ? 51.776 18.680  11.081 1.00 84.54 ? -1  DA  B OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? 53.675 16.920  11.235 1.00 84.54 ? -1  DA  B OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? 51.381 16.489  12.236 1.00 84.54 ? -1  DA  B "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? 51.963 16.196  13.516 1.00 84.54 ? -1  DA  B "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? 50.884 15.922  14.544 1.00 84.54 ? -1  DA  B "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? 50.078 14.792  14.106 1.00 84.54 ? -1  DA  B "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? 51.436 15.504  15.907 1.00 84.54 ? -1  DA  B "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? 50.560 15.925  16.962 1.00 84.54 ? -1  DA  B "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? 51.551 13.992  15.785 1.00 84.54 ? -1  DA  B "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? 50.369 13.627  14.887 1.00 84.54 ? -1  DA  B "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? 50.697 12.543  13.956 1.00 84.54 ? -1  DA  B N9    1 
ATOM   31   C C8    . DA  A 1 2   ? 51.599 12.597  12.913 1.00 84.54 ? -1  DA  B C8    1 
ATOM   32   N N7    . DA  A 1 2   ? 51.739 11.460  12.268 1.00 84.54 ? -1  DA  B N7    1 
ATOM   33   C C5    . DA  A 1 2   ? 50.866 10.598  12.922 1.00 84.54 ? -1  DA  B C5    1 
ATOM   34   C C6    . DA  A 1 2   ? 50.549 9.232   12.721 1.00 84.54 ? -1  DA  B C6    1 
ATOM   35   N N6    . DA  A 1 2   ? 51.101 8.471   11.769 1.00 81.26 ? -1  DA  B N6    1 
ATOM   36   N N1    . DA  A 1 2   ? 49.626 8.675   13.538 1.00 84.54 ? -1  DA  B N1    1 
ATOM   37   C C2    . DA  A 1 2   ? 49.064 9.444   14.492 1.00 84.54 ? -1  DA  B C2    1 
ATOM   38   N N3    . DA  A 1 2   ? 49.284 10.735  14.785 1.00 84.54 ? -1  DA  B N3    1 
ATOM   39   C C4    . DA  A 1 2   ? 50.204 11.258  13.956 1.00 84.54 ? -1  DA  B C4    1 
ATOM   40   P P     . DA  A 1 3   ? 50.784 15.371  18.468 1.00 84.54 ? 1   DA  B P     1 
ATOM   41   O OP1   . DA  A 1 3   ? 50.339 16.455  19.408 1.00 84.54 ? 1   DA  B OP1   1 
ATOM   42   O OP2   . DA  A 1 3   ? 52.172 14.806  18.596 1.00 84.54 ? 1   DA  B OP2   1 
ATOM   43   O "O5'" . DA  A 1 3   ? 49.730 14.172  18.542 1.00 84.54 ? 1   DA  B "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 3   ? 48.461 14.294  17.882 1.00 84.54 ? 1   DA  B "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 3   ? 47.548 13.152  18.267 1.00 84.54 ? 1   DA  B "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 3   ? 48.057 11.918  17.693 1.00 84.54 ? 1   DA  B "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 3   ? 47.467 12.899  19.772 1.00 84.54 ? 1   DA  B "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 3   ? 46.175 12.368  20.103 1.00 84.01 ? 1   DA  B "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 3   ? 48.612 11.926  20.005 1.00 84.54 ? 1   DA  B "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 3   ? 48.634 11.100  18.713 1.00 84.54 ? 1   DA  B "C1'" 1 
ATOM   51   N N9    . DA  A 1 3   ? 49.983 10.743  18.273 1.00 84.54 ? 1   DA  B N9    1 
ATOM   52   C C8    . DA  A 1 3   ? 51.137 11.478  18.443 1.00 84.54 ? 1   DA  B C8    1 
ATOM   53   N N7    . DA  A 1 3   ? 52.202 10.921  17.914 1.00 84.54 ? 1   DA  B N7    1 
ATOM   54   C C5    . DA  A 1 3   ? 51.722 9.736   17.359 1.00 84.54 ? 1   DA  B C5    1 
ATOM   55   C C6    . DA  A 1 3   ? 52.360 8.688   16.642 1.00 84.54 ? 1   DA  B C6    1 
ATOM   56   N N6    . DA  A 1 3   ? 53.670 8.676   16.344 1.00 84.54 ? 1   DA  B N6    1 
ATOM   57   N N1    . DA  A 1 3   ? 51.594 7.644   16.240 1.00 84.54 ? 1   DA  B N1    1 
ATOM   58   C C2    . DA  A 1 3   ? 50.285 7.658   16.543 1.00 84.54 ? 1   DA  B C2    1 
ATOM   59   N N3    . DA  A 1 3   ? 49.571 8.585   17.203 1.00 84.54 ? 1   DA  B N3    1 
ATOM   60   C C4    . DA  A 1 3   ? 50.358 9.608   17.585 1.00 84.54 ? 1   DA  B C4    1 
ATOM   61   P P     . DA  A 1 4   ? 45.866 11.860  21.599 1.00 84.54 ? 2   DA  B P     1 
ATOM   62   O OP1   . DA  A 1 4   ? 44.585 12.485  22.037 1.00 84.54 ? 2   DA  B OP1   1 
ATOM   63   O OP2   . DA  A 1 4   ? 47.094 12.049  22.427 1.00 84.54 ? 2   DA  B OP2   1 
ATOM   64   O "O5'" . DA  A 1 4   ? 45.626 10.287  21.402 1.00 84.54 ? 2   DA  B "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 4   ? 46.603 9.494   20.724 1.00 84.54 ? 2   DA  B "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 4   ? 46.600 8.062   21.215 1.00 84.54 ? 2   DA  B "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 4   ? 47.713 7.404   20.557 1.00 84.54 ? 2   DA  B "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 4   ? 46.850 7.853   22.712 1.00 84.54 ? 2   DA  B "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 4   ? 46.269 6.599   23.130 1.00 84.54 ? 2   DA  B "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 4   ? 48.363 7.829   22.795 1.00 84.54 ? 2   DA  B "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 4   ? 48.769 7.167   21.486 1.00 84.54 ? 2   DA  B "C1'" 1 
ATOM   72   N N9    . DA  A 1 4   ? 49.997 7.728   20.925 1.00 84.54 ? 2   DA  B N9    1 
ATOM   73   C C8    . DA  A 1 4   ? 50.361 9.056   20.848 1.00 84.54 ? 2   DA  B C8    1 
ATOM   74   N N7    . DA  A 1 4   ? 51.553 9.249   20.330 1.00 84.54 ? 2   DA  B N7    1 
ATOM   75   C C5    . DA  A 1 4   ? 51.999 7.966   20.038 1.00 84.54 ? 2   DA  B C5    1 
ATOM   76   C C6    . DA  A 1 4   ? 53.196 7.486   19.479 1.00 84.54 ? 2   DA  B C6    1 
ATOM   77   N N6    . DA  A 1 4   ? 54.204 8.277   19.096 1.00 84.54 ? 2   DA  B N6    1 
ATOM   78   N N1    . DA  A 1 4   ? 53.326 6.148   19.324 1.00 84.54 ? 2   DA  B N1    1 
ATOM   79   C C2    . DA  A 1 4   ? 52.315 5.358   19.705 1.00 84.54 ? 2   DA  B C2    1 
ATOM   80   N N3    . DA  A 1 4   ? 51.143 5.689   20.246 1.00 84.54 ? 2   DA  B N3    1 
ATOM   81   C C4    . DA  A 1 4   ? 51.046 7.022   20.389 1.00 84.54 ? 2   DA  B C4    1 
ATOM   82   P P     . DA  A 1 5   ? 46.771 5.866   24.487 1.00 83.78 ? 3   DA  B P     1 
ATOM   83   O OP1   . DA  A 1 5   ? 45.653 4.968   24.858 1.00 82.44 ? 3   DA  B OP1   1 
ATOM   84   O OP2   . DA  A 1 5   ? 47.291 6.834   25.484 1.00 81.65 ? 3   DA  B OP2   1 
ATOM   85   O "O5'" . DA  A 1 5   ? 47.992 4.950   24.021 1.00 82.65 ? 3   DA  B "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 5   ? 47.761 3.834   23.170 1.00 82.65 ? 3   DA  B "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 5   ? 48.895 2.834   23.242 1.00 82.78 ? 3   DA  B "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 5   ? 50.077 3.404   22.628 1.00 84.54 ? 3   DA  B "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 5   ? 49.322 2.480   24.670 1.00 82.65 ? 3   DA  B "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 5   ? 49.848 1.137   24.700 1.00 82.39 ? 3   DA  B "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 5   ? 50.388 3.521   24.962 1.00 81.67 ? 3   DA  B "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 5   ? 51.070 3.621   23.614 1.00 81.64 ? 3   DA  B "C1'" 1 
ATOM   93   N N9    . DA  A 1 5   ? 51.809 4.843   23.303 1.00 84.20 ? 3   DA  B N9    1 
ATOM   94   C C8    . DA  A 1 5   ? 51.497 6.153   23.575 1.00 84.54 ? 3   DA  B C8    1 
ATOM   95   N N7    . DA  A 1 5   ? 52.437 7.003   23.229 1.00 84.54 ? 3   DA  B N7    1 
ATOM   96   C C5    . DA  A 1 5   ? 53.426 6.200   22.672 1.00 84.54 ? 3   DA  B C5    1 
ATOM   97   C C6    . DA  A 1 5   ? 54.688 6.491   22.115 1.00 84.18 ? 3   DA  B C6    1 
ATOM   98   N N6    . DA  A 1 5   ? 55.206 7.718   22.041 1.00 80.73 ? 3   DA  B N6    1 
ATOM   99   N N1    . DA  A 1 5   ? 55.415 5.458   21.633 1.00 84.54 ? 3   DA  B N1    1 
ATOM   100  C C2    . DA  A 1 5   ? 54.908 4.222   21.719 1.00 84.54 ? 3   DA  B C2    1 
ATOM   101  N N3    . DA  A 1 5   ? 53.745 3.821   22.230 1.00 84.54 ? 3   DA  B N3    1 
ATOM   102  C C4    . DA  A 1 5   ? 53.042 4.871   22.694 1.00 84.54 ? 3   DA  B C4    1 
ATOM   103  P P     . DT  A 1 6   ? 50.510 0.538   26.053 1.00 83.73 ? 4   DT  B P     1 
ATOM   104  O OP1   . DT  A 1 6   ? 49.783 -0.688  26.421 1.00 82.33 ? 4   DT  B OP1   1 
ATOM   105  O OP2   . DT  A 1 6   ? 50.747 1.597   27.066 1.00 80.14 ? 4   DT  B OP2   1 
ATOM   106  O "O5'" . DT  A 1 6   ? 51.931 0.045   25.570 1.00 78.57 ? 4   DT  B "O5'" 1 
ATOM   107  C "C5'" . DT  A 1 6   ? 52.702 0.879   24.744 1.00 74.56 ? 4   DT  B "C5'" 1 
ATOM   108  C "C4'" . DT  A 1 6   ? 53.996 0.200   24.411 1.00 71.96 ? 4   DT  B "C4'" 1 
ATOM   109  O "O4'" . DT  A 1 6   ? 54.852 1.239   23.908 1.00 72.01 ? 4   DT  B "O4'" 1 
ATOM   110  C "C3'" . DT  A 1 6   ? 54.695 -0.333  25.650 1.00 70.45 ? 4   DT  B "C3'" 1 
ATOM   111  O "O3'" . DT  A 1 6   ? 55.512 -1.447  25.325 1.00 74.68 ? 4   DT  B "O3'" 1 
ATOM   112  C "C2'" . DT  A 1 6   ? 55.500 0.859   26.127 1.00 73.77 ? 4   DT  B "C2'" 1 
ATOM   113  C "C1'" . DT  A 1 6   ? 55.865 1.549   24.838 1.00 70.60 ? 4   DT  B "C1'" 1 
ATOM   114  N N1    . DT  A 1 6   ? 55.943 3.001   24.897 1.00 74.63 ? 4   DT  B N1    1 
ATOM   115  C C2    . DT  A 1 6   ? 57.003 3.581   24.258 1.00 80.43 ? 4   DT  B C2    1 
ATOM   116  O O2    . DT  A 1 6   ? 57.874 2.930   23.702 1.00 84.54 ? 4   DT  B O2    1 
ATOM   117  N N3    . DT  A 1 6   ? 57.010 4.953   24.285 1.00 82.93 ? 4   DT  B N3    1 
ATOM   118  C C4    . DT  A 1 6   ? 56.079 5.775   24.883 1.00 82.12 ? 4   DT  B C4    1 
ATOM   119  O O4    . DT  A 1 6   ? 56.203 6.989   24.812 1.00 84.54 ? 4   DT  B O4    1 
ATOM   120  C C5    . DT  A 1 6   ? 55.004 5.099   25.557 1.00 80.41 ? 4   DT  B C5    1 
ATOM   121  C C7    . DT  A 1 6   ? 53.963 5.919   26.242 1.00 77.71 ? 4   DT  B C7    1 
ATOM   122  C C6    . DT  A 1 6   ? 54.989 3.757   25.536 1.00 77.63 ? 4   DT  B C6    1 
ATOM   123  P P     . DG  A 1 7   ? 56.603 -1.959  26.381 1.00 84.54 ? 5   DG  B P     1 
ATOM   124  O OP1   . DG  A 1 7   ? 56.887 -3.387  26.080 1.00 83.66 ? 5   DG  B OP1   1 
ATOM   125  O OP2   . DG  A 1 7   ? 56.182 -1.567  27.750 1.00 82.64 ? 5   DG  B OP2   1 
ATOM   126  O "O5'" . DG  A 1 7   ? 57.895 -1.103  26.009 1.00 84.54 ? 5   DG  B "O5'" 1 
ATOM   127  C "C5'" . DG  A 1 7   ? 58.533 -1.270  24.748 1.00 84.46 ? 5   DG  B "C5'" 1 
ATOM   128  C "C4'" . DG  A 1 7   ? 59.992 -0.880  24.823 1.00 84.21 ? 5   DG  B "C4'" 1 
ATOM   129  O "O4'" . DG  A 1 7   ? 60.136 0.555   24.933 1.00 84.54 ? 5   DG  B "O4'" 1 
ATOM   130  C "C3'" . DG  A 1 7   ? 60.741 -1.432  26.030 1.00 82.74 ? 5   DG  B "C3'" 1 
ATOM   131  O "O3'" . DG  A 1 7   ? 62.112 -1.578  25.643 1.00 84.54 ? 5   DG  B "O3'" 1 
ATOM   132  C "C2'" . DG  A 1 7   ? 60.548 -0.342  27.077 1.00 80.62 ? 5   DG  B "C2'" 1 
ATOM   133  C "C1'" . DG  A 1 7   ? 60.609 0.919   26.225 1.00 83.15 ? 5   DG  B "C1'" 1 
ATOM   134  N N9    . DG  A 1 7   ? 59.838 2.087   26.645 1.00 84.54 ? 5   DG  B N9    1 
ATOM   135  C C8    . DG  A 1 7   ? 58.558 2.106   27.143 1.00 84.54 ? 5   DG  B C8    1 
ATOM   136  N N7    . DG  A 1 7   ? 58.092 3.318   27.304 1.00 84.54 ? 5   DG  B N7    1 
ATOM   137  C C5    . DG  A 1 7   ? 59.136 4.150   26.915 1.00 84.54 ? 5   DG  B C5    1 
ATOM   138  C C6    . DG  A 1 7   ? 59.215 5.570   26.857 1.00 84.42 ? 5   DG  B C6    1 
ATOM   139  O O6    . DG  A 1 7   ? 58.353 6.405   27.138 1.00 84.54 ? 5   DG  B O6    1 
ATOM   140  N N1    . DG  A 1 7   ? 60.456 5.997   26.410 1.00 84.54 ? 5   DG  B N1    1 
ATOM   141  C C2    . DG  A 1 7   ? 61.496 5.177   26.059 1.00 84.54 ? 5   DG  B C2    1 
ATOM   142  N N2    . DG  A 1 7   ? 62.617 5.806   25.660 1.00 84.54 ? 5   DG  B N2    1 
ATOM   143  N N3    . DG  A 1 7   ? 61.440 3.849   26.099 1.00 84.54 ? 5   DG  B N3    1 
ATOM   144  C C4    . DG  A 1 7   ? 60.235 3.408   26.533 1.00 84.54 ? 5   DG  B C4    1 
ATOM   145  P P     . DT  A 1 8   ? 62.906 -2.942  25.964 1.00 84.54 ? 6   DT  B P     1 
ATOM   146  O OP1   . DT  A 1 8   ? 63.991 -3.016  24.939 1.00 84.54 ? 6   DT  B OP1   1 
ATOM   147  O OP2   . DT  A 1 8   ? 61.936 -4.076  26.110 1.00 84.54 ? 6   DT  B OP2   1 
ATOM   148  O "O5'" . DT  A 1 8   ? 63.528 -2.631  27.394 1.00 84.54 ? 6   DT  B "O5'" 1 
ATOM   149  C "C5'" . DT  A 1 8   ? 63.454 -1.305  27.887 1.00 84.54 ? 6   DT  B "C5'" 1 
ATOM   150  C "C4'" . DT  A 1 8   ? 64.594 -0.493  27.320 1.00 84.54 ? 6   DT  B "C4'" 1 
ATOM   151  O "O4'" . DT  A 1 8   ? 64.188 0.883   27.103 1.00 84.54 ? 6   DT  B "O4'" 1 
ATOM   152  C "C3'" . DT  A 1 8   ? 65.782 -0.422  28.253 1.00 84.54 ? 6   DT  B "C3'" 1 
ATOM   153  O "O3'" . DT  A 1 8   ? 66.991 -0.406  27.507 1.00 84.54 ? 6   DT  B "O3'" 1 
ATOM   154  C "C2'" . DT  A 1 8   ? 65.488 0.820   29.083 1.00 84.54 ? 6   DT  B "C2'" 1 
ATOM   155  C "C1'" . DT  A 1 8   ? 64.731 1.737   28.114 1.00 84.54 ? 6   DT  B "C1'" 1 
ATOM   156  N N1    . DT  A 1 8   ? 63.574 2.421   28.755 1.00 84.54 ? 6   DT  B N1    1 
ATOM   157  C C2    . DT  A 1 8   ? 63.571 3.786   28.918 1.00 84.54 ? 6   DT  B C2    1 
ATOM   158  O O2    . DT  A 1 8   ? 64.488 4.499   28.578 1.00 84.54 ? 6   DT  B O2    1 
ATOM   159  N N3    . DT  A 1 8   ? 62.435 4.291   29.496 1.00 84.54 ? 6   DT  B N3    1 
ATOM   160  C C4    . DT  A 1 8   ? 61.326 3.585   29.916 1.00 84.54 ? 6   DT  B C4    1 
ATOM   161  O O4    . DT  A 1 8   ? 60.376 4.171   30.415 1.00 84.54 ? 6   DT  B O4    1 
ATOM   162  C C5    . DT  A 1 8   ? 61.393 2.166   29.721 1.00 84.54 ? 6   DT  B C5    1 
ATOM   163  C C7    . DT  A 1 8   ? 60.229 1.324   30.137 1.00 81.99 ? 6   DT  B C7    1 
ATOM   164  C C6    . DT  A 1 8   ? 62.500 1.660   29.167 1.00 84.54 ? 6   DT  B C6    1 
ATOM   165  P P     . DG  A 1 9   ? 68.352 -0.909  28.202 1.00 84.54 ? 7   DG  B P     1 
ATOM   166  O OP1   . DG  A 1 9   ? 69.033 -1.908  27.308 1.00 84.54 ? 7   DG  B OP1   1 
ATOM   167  O OP2   . DG  A 1 9   ? 68.010 -1.289  29.609 1.00 84.54 ? 7   DG  B OP2   1 
ATOM   168  O "O5'" . DG  A 1 9   ? 69.181 0.447   28.273 1.00 84.54 ? 7   DG  B "O5'" 1 
ATOM   169  C "C5'" . DG  A 1 9   ? 68.607 1.567   28.921 1.00 81.64 ? 7   DG  B "C5'" 1 
ATOM   170  C "C4'" . DG  A 1 9   ? 69.405 1.876   30.155 1.00 83.41 ? 7   DG  B "C4'" 1 
ATOM   171  O "O4'" . DG  A 1 9   ? 68.517 2.528   31.096 1.00 84.54 ? 7   DG  B "O4'" 1 
ATOM   172  C "C3'" . DG  A 1 9   ? 69.847 0.590   30.844 1.00 83.93 ? 7   DG  B "C3'" 1 
ATOM   173  O "O3'" . DG  A 1 9   ? 71.170 0.729   31.394 1.00 84.54 ? 7   DG  B "O3'" 1 
ATOM   174  C "C2'" . DG  A 1 9   ? 68.705 0.282   31.792 1.00 82.63 ? 7   DG  B "C2'" 1 
ATOM   175  C "C1'" . DG  A 1 9   ? 68.209 1.663   32.193 1.00 84.54 ? 7   DG  B "C1'" 1 
ATOM   176  N N9    . DG  A 1 9   ? 66.762 1.704   32.428 1.00 84.54 ? 7   DG  B N9    1 
ATOM   177  C C8    . DG  A 1 9   ? 65.907 0.640   32.318 1.00 84.54 ? 7   DG  B C8    1 
ATOM   178  N N7    . DG  A 1 9   ? 64.663 0.948   32.565 1.00 84.54 ? 7   DG  B N7    1 
ATOM   179  C C5    . DG  A 1 9   ? 64.690 2.299   32.865 1.00 84.54 ? 7   DG  B C5    1 
ATOM   180  C C6    . DG  A 1 9   ? 63.633 3.176   33.215 1.00 84.54 ? 7   DG  B C6    1 
ATOM   181  O O6    . DG  A 1 9   ? 62.430 2.926   33.321 1.00 82.71 ? 7   DG  B O6    1 
ATOM   182  N N1    . DG  A 1 9   ? 64.096 4.464   33.448 1.00 84.54 ? 7   DG  B N1    1 
ATOM   183  C C2    . DG  A 1 9   ? 65.411 4.862   33.352 1.00 84.54 ? 7   DG  B C2    1 
ATOM   184  N N2    . DG  A 1 9   ? 65.660 6.153   33.615 1.00 84.54 ? 7   DG  B N2    1 
ATOM   185  N N3    . DG  A 1 9   ? 66.409 4.051   33.023 1.00 84.54 ? 7   DG  B N3    1 
ATOM   186  C C4    . DG  A 1 9   ? 65.979 2.790   32.793 1.00 84.54 ? 7   DG  B C4    1 
ATOM   187  P P     . DA  A 1 10  ? 71.430 0.516   32.969 1.00 84.22 ? 8   DA  B P     1 
ATOM   188  O OP1   . DA  A 1 10  ? 72.907 0.410   33.164 1.00 84.22 ? 8   DA  B OP1   1 
ATOM   189  O OP2   . DA  A 1 10  ? 70.547 -0.573  33.486 1.00 84.22 ? 8   DA  B OP2   1 
ATOM   190  O "O5'" . DA  A 1 10  ? 70.955 1.916   33.569 1.00 84.22 ? 8   DA  B "O5'" 1 
ATOM   191  C "C5'" . DA  A 1 10  ? 71.255 3.132   32.876 1.00 83.10 ? 8   DA  B "C5'" 1 
ATOM   192  C "C4'" . DA  A 1 10  ? 71.097 4.317   33.801 1.00 84.22 ? 8   DA  B "C4'" 1 
ATOM   193  O "O4'" . DA  A 1 10  ? 69.691 4.493   34.115 1.00 84.22 ? 8   DA  B "O4'" 1 
ATOM   194  C "C3'" . DA  A 1 10  ? 71.788 4.115   35.155 1.00 83.94 ? 8   DA  B "C3'" 1 
ATOM   195  O "O3'" . DA  A 1 10  ? 72.161 5.394   35.679 1.00 84.22 ? 8   DA  B "O3'" 1 
ATOM   196  C "C2'" . DA  A 1 10  ? 70.710 3.451   35.998 1.00 83.87 ? 8   DA  B "C2'" 1 
ATOM   197  C "C1'" . DA  A 1 10  ? 69.449 4.147   35.489 1.00 84.22 ? 8   DA  B "C1'" 1 
ATOM   198  N N9    . DA  A 1 10  ? 68.194 3.384   35.573 1.00 84.22 ? 8   DA  B N9    1 
ATOM   199  C C8    . DA  A 1 10  ? 67.978 2.054   35.307 1.00 84.22 ? 8   DA  B C8    1 
ATOM   200  N N7    . DA  A 1 10  ? 66.727 1.680   35.465 1.00 84.22 ? 8   DA  B N7    1 
ATOM   201  C C5    . DA  A 1 10  ? 66.076 2.839   35.863 1.00 84.22 ? 8   DA  B C5    1 
ATOM   202  C C6    . DA  A 1 10  ? 64.732 3.108   36.195 1.00 84.22 ? 8   DA  B C6    1 
ATOM   203  N N6    . DA  A 1 10  ? 63.764 2.193   36.172 1.00 84.22 ? 8   DA  B N6    1 
ATOM   204  N N1    . DA  A 1 10  ? 64.417 4.367   36.562 1.00 84.22 ? 8   DA  B N1    1 
ATOM   205  C C2    . DA  A 1 10  ? 65.389 5.289   36.594 1.00 84.22 ? 8   DA  B C2    1 
ATOM   206  N N3    . DA  A 1 10  ? 66.684 5.162   36.307 1.00 84.22 ? 8   DA  B N3    1 
ATOM   207  C C4    . DA  A 1 10  ? 66.967 3.896   35.944 1.00 84.22 ? 8   DA  B C4    1 
ATOM   208  P P     . DT  A 1 11  ? 72.845 5.513   37.136 1.00 84.22 ? 9   DT  B P     1 
ATOM   209  O OP1   . DT  A 1 11  ? 74.243 6.034   36.988 1.00 84.22 ? 9   DT  B OP1   1 
ATOM   210  O OP2   . DT  A 1 11  ? 72.593 4.254   37.907 1.00 84.22 ? 9   DT  B OP2   1 
ATOM   211  O "O5'" . DT  A 1 11  ? 71.980 6.661   37.811 1.00 84.22 ? 9   DT  B "O5'" 1 
ATOM   212  C "C5'" . DT  A 1 11  ? 70.556 6.595   37.765 1.00 84.22 ? 9   DT  B "C5'" 1 
ATOM   213  C "C4'" . DT  A 1 11  ? 69.995 6.955   39.116 1.00 84.22 ? 9   DT  B "C4'" 1 
ATOM   214  O "O4'" . DT  A 1 11  ? 68.659 6.397   39.187 1.00 84.22 ? 9   DT  B "O4'" 1 
ATOM   215  C "C3'" . DT  A 1 11  ? 70.795 6.253   40.216 1.00 84.22 ? 9   DT  B "C3'" 1 
ATOM   216  O "O3'" . DT  A 1 11  ? 70.677 6.912   41.474 1.00 84.22 ? 9   DT  B "O3'" 1 
ATOM   217  C "C2'" . DT  A 1 11  ? 70.103 4.907   40.323 1.00 84.22 ? 9   DT  B "C2'" 1 
ATOM   218  C "C1'" . DT  A 1 11  ? 68.656 5.298   40.085 1.00 84.22 ? 9   DT  B "C1'" 1 
ATOM   219  N N1    . DT  A 1 11  ? 67.780 4.247   39.546 1.00 84.22 ? 9   DT  B N1    1 
ATOM   220  C C2    . DT  A 1 11  ? 66.429 4.504   39.528 1.00 84.22 ? 9   DT  B C2    1 
ATOM   221  O O2    . DT  A 1 11  ? 65.955 5.567   39.884 1.00 84.22 ? 9   DT  B O2    1 
ATOM   222  N N3    . DT  A 1 11  ? 65.654 3.468   39.080 1.00 84.22 ? 9   DT  B N3    1 
ATOM   223  C C4    . DT  A 1 11  ? 66.088 2.230   38.649 1.00 84.22 ? 9   DT  B C4    1 
ATOM   224  O O4    . DT  A 1 11  ? 65.270 1.395   38.270 1.00 84.22 ? 9   DT  B O4    1 
ATOM   225  C C5    . DT  A 1 11  ? 67.521 2.034   38.671 1.00 84.22 ? 9   DT  B C5    1 
ATOM   226  C C7    . DT  A 1 11  ? 68.080 0.726   38.206 1.00 82.43 ? 9   DT  B C7    1 
ATOM   227  C C6    . DT  A 1 11  ? 68.287 3.043   39.111 1.00 84.22 ? 9   DT  B C6    1 
ATOM   228  O "O5'" . DC  B 2 1   ? 68.927 -8.988  54.062 1.00 83.70 ? 13  DC  C "O5'" 1 
ATOM   229  C "C5'" . DC  B 2 1   ? 68.832 -8.309  52.809 1.00 83.70 ? 13  DC  C "C5'" 1 
ATOM   230  C "C4'" . DC  B 2 1   ? 67.556 -8.655  52.086 1.00 83.70 ? 13  DC  C "C4'" 1 
ATOM   231  O "O4'" . DC  B 2 1   ? 66.536 -7.694  52.470 1.00 83.70 ? 13  DC  C "O4'" 1 
ATOM   232  C "C3'" . DC  B 2 1   ? 67.692 -8.500  50.569 1.00 83.70 ? 13  DC  C "C3'" 1 
ATOM   233  O "O3'" . DC  B 2 1   ? 66.782 -9.389  49.914 1.00 83.70 ? 13  DC  C "O3'" 1 
ATOM   234  C "C2'" . DC  B 2 1   ? 67.335 -7.044  50.341 1.00 83.70 ? 13  DC  C "C2'" 1 
ATOM   235  C "C1'" . DC  B 2 1   ? 66.249 -6.820  51.382 1.00 83.70 ? 13  DC  C "C1'" 1 
ATOM   236  N N1    . DC  B 2 1   ? 66.200 -5.450  51.916 1.00 83.70 ? 13  DC  C N1    1 
ATOM   237  C C2    . DC  B 2 1   ? 65.065 -4.646  51.672 1.00 83.70 ? 13  DC  C C2    1 
ATOM   238  O O2    . DC  B 2 1   ? 64.100 -5.128  51.029 1.00 83.70 ? 13  DC  C O2    1 
ATOM   239  N N3    . DC  B 2 1   ? 65.053 -3.377  52.143 1.00 83.70 ? 13  DC  C N3    1 
ATOM   240  C C4    . DC  B 2 1   ? 66.100 -2.914  52.836 1.00 83.70 ? 13  DC  C C4    1 
ATOM   241  N N4    . DC  B 2 1   ? 66.057 -1.663  53.292 1.00 83.70 ? 13  DC  C N4    1 
ATOM   242  C C5    . DC  B 2 1   ? 67.247 -3.716  53.098 1.00 83.70 ? 13  DC  C C5    1 
ATOM   243  C C6    . DC  B 2 1   ? 67.252 -4.964  52.629 1.00 83.70 ? 13  DC  C C6    1 
ATOM   244  P P     . DT  B 2 2   ? 66.327 -9.106  48.399 1.00 83.72 ? 12  DT  C P     1 
ATOM   245  O OP1   . DT  B 2 2   ? 65.553 -10.310 47.957 1.00 83.72 ? 12  DT  C OP1   1 
ATOM   246  O OP2   . DT  B 2 2   ? 67.489 -8.626  47.597 1.00 83.72 ? 12  DT  C OP2   1 
ATOM   247  O "O5'" . DT  B 2 2   ? 65.311 -7.878  48.511 1.00 83.72 ? 12  DT  C "O5'" 1 
ATOM   248  C "C5'" . DT  B 2 2   ? 63.928 -8.089  48.815 1.00 83.72 ? 12  DT  C "C5'" 1 
ATOM   249  C "C4'" . DT  B 2 2   ? 63.054 -7.261  47.901 1.00 83.72 ? 12  DT  C "C4'" 1 
ATOM   250  O "O4'" . DT  B 2 2   ? 63.129 -5.863  48.282 1.00 83.72 ? 12  DT  C "O4'" 1 
ATOM   251  C "C3'" . DT  B 2 2   ? 63.597 -7.317  46.469 1.00 83.72 ? 12  DT  C "C3'" 1 
ATOM   252  O "O3'" . DT  B 2 2   ? 62.554 -6.973  45.565 1.00 83.72 ? 12  DT  C "O3'" 1 
ATOM   253  C "C2'" . DT  B 2 2   ? 64.582 -6.164  46.442 1.00 83.72 ? 12  DT  C "C2'" 1 
ATOM   254  C "C1'" . DT  B 2 2   ? 63.786 -5.162  47.247 1.00 83.72 ? 12  DT  C "C1'" 1 
ATOM   255  N N1    . DT  B 2 2   ? 64.430 -3.955  47.784 1.00 83.72 ? 12  DT  C N1    1 
ATOM   256  C C2    . DT  B 2 2   ? 63.587 -3.006  48.293 1.00 83.72 ? 12  DT  C C2    1 
ATOM   257  O O2    . DT  B 2 2   ? 62.378 -3.167  48.353 1.00 83.72 ? 12  DT  C O2    1 
ATOM   258  N N3    . DT  B 2 2   ? 64.205 -1.860  48.723 1.00 83.72 ? 12  DT  C N3    1 
ATOM   259  C C4    . DT  B 2 2   ? 65.559 -1.578  48.691 1.00 83.72 ? 12  DT  C C4    1 
ATOM   260  O O4    . DT  B 2 2   ? 65.973 -0.489  49.101 1.00 83.72 ? 12  DT  C O4    1 
ATOM   261  C C5    . DT  B 2 2   ? 66.392 -2.632  48.155 1.00 83.72 ? 12  DT  C C5    1 
ATOM   262  C C7    . DT  B 2 2   ? 67.872 -2.414  48.076 1.00 83.72 ? 12  DT  C C7    1 
ATOM   263  C C6    . DT  B 2 2   ? 65.795 -3.758  47.742 1.00 83.72 ? 12  DT  C C6    1 
ATOM   264  P P     . DA  B 2 3   ? 61.720 -8.122  44.831 1.00 84.54 ? 11  DA  C P     1 
ATOM   265  O OP1   . DA  B 2 3   ? 62.306 -9.447  45.172 1.00 84.54 ? 11  DA  C OP1   1 
ATOM   266  O OP2   . DA  B 2 3   ? 61.641 -7.692  43.402 1.00 82.52 ? 11  DA  C OP2   1 
ATOM   267  O "O5'" . DA  B 2 3   ? 60.268 -7.980  45.479 1.00 83.72 ? 11  DA  C "O5'" 1 
ATOM   268  C "C5'" . DA  B 2 3   ? 59.226 -7.445  44.685 1.00 78.16 ? 11  DA  C "C5'" 1 
ATOM   269  C "C4'" . DA  B 2 3   ? 58.430 -6.382  45.412 1.00 75.55 ? 11  DA  C "C4'" 1 
ATOM   270  O "O4'" . DA  B 2 3   ? 59.290 -5.418  46.066 1.00 79.11 ? 11  DA  C "O4'" 1 
ATOM   271  C "C3'" . DA  B 2 3   ? 57.699 -5.572  44.348 1.00 73.08 ? 11  DA  C "C3'" 1 
ATOM   272  O "O3'" . DA  B 2 3   ? 56.428 -5.130  44.736 1.00 68.60 ? 11  DA  C "O3'" 1 
ATOM   273  C "C2'" . DA  B 2 3   ? 58.634 -4.427  44.027 1.00 76.03 ? 11  DA  C "C2'" 1 
ATOM   274  C "C1'" . DA  B 2 3   ? 59.252 -4.159  45.382 1.00 79.09 ? 11  DA  C "C1'" 1 
ATOM   275  N N9    . DA  B 2 3   ? 60.620 -3.653  45.292 1.00 82.24 ? 11  DA  C N9    1 
ATOM   276  C C8    . DA  B 2 3   ? 61.744 -4.380  45.006 1.00 82.80 ? 11  DA  C C8    1 
ATOM   277  N N7    . DA  B 2 3   ? 62.844 -3.674  45.006 1.00 84.22 ? 11  DA  C N7    1 
ATOM   278  C C5    . DA  B 2 3   ? 62.417 -2.394  45.310 1.00 83.08 ? 11  DA  C C5    1 
ATOM   279  C C6    . DA  B 2 3   ? 63.108 -1.192  45.463 1.00 84.22 ? 11  DA  C C6    1 
ATOM   280  N N6    . DA  B 2 3   ? 64.431 -1.086  45.336 1.00 84.22 ? 11  DA  C N6    1 
ATOM   281  N N1    . DA  B 2 3   ? 62.392 -0.087  45.756 1.00 84.22 ? 11  DA  C N1    1 
ATOM   282  C C2    . DA  B 2 3   ? 61.067 -0.202  45.889 1.00 84.22 ? 11  DA  C C2    1 
ATOM   283  N N3    . DA  B 2 3   ? 60.300 -1.286  45.775 1.00 84.22 ? 11  DA  C N3    1 
ATOM   284  C C4    . DA  B 2 3   ? 61.049 -2.362  45.481 1.00 84.03 ? 11  DA  C C4    1 
ATOM   285  P P     . DG  B 2 4   ? 55.434 -4.625  43.603 1.00 65.93 ? 10  DG  C P     1 
ATOM   286  O OP1   . DG  B 2 4   ? 54.048 -4.988  43.984 1.00 70.21 ? 10  DG  C OP1   1 
ATOM   287  O OP2   . DG  B 2 4   ? 55.992 -5.053  42.303 1.00 66.41 ? 10  DG  C OP2   1 
ATOM   288  O "O5'" . DG  B 2 4   ? 55.617 -3.067  43.649 1.00 57.12 ? 10  DG  C "O5'" 1 
ATOM   289  C "C5'" . DG  B 2 4   ? 55.785 -2.352  42.475 1.00 58.13 ? 10  DG  C "C5'" 1 
ATOM   290  C "C4'" . DG  B 2 4   ? 55.638 -0.891  42.780 1.00 59.74 ? 10  DG  C "C4'" 1 
ATOM   291  O "O4'" . DG  B 2 4   ? 56.862 -0.446  43.408 1.00 61.46 ? 10  DG  C "O4'" 1 
ATOM   292  C "C3'" . DG  B 2 4   ? 55.493 -0.056  41.524 1.00 57.28 ? 10  DG  C "C3'" 1 
ATOM   293  O "O3'" . DG  B 2 4   ? 54.669 1.053   41.775 1.00 53.64 ? 10  DG  C "O3'" 1 
ATOM   294  C "C2'" . DG  B 2 4   ? 56.920 0.276   41.160 1.00 62.70 ? 10  DG  C "C2'" 1 
ATOM   295  C "C1'" . DG  B 2 4   ? 57.613 0.359   42.510 1.00 67.90 ? 10  DG  C "C1'" 1 
ATOM   296  N N9    . DG  B 2 4   ? 58.960 -0.191  42.453 1.00 75.42 ? 10  DG  C N9    1 
ATOM   297  C C8    . DG  B 2 4   ? 59.309 -1.515  42.333 1.00 78.21 ? 10  DG  C C8    1 
ATOM   298  N N7    . DG  B 2 4   ? 60.600 -1.702  42.284 1.00 82.36 ? 10  DG  C N7    1 
ATOM   299  C C5    . DG  B 2 4   ? 61.134 -0.422  42.382 1.00 82.85 ? 10  DG  C C5    1 
ATOM   300  C C6    . DG  B 2 4   ? 62.482 0.013   42.395 1.00 84.22 ? 10  DG  C C6    1 
ATOM   301  O O6    . DG  B 2 4   ? 63.507 -0.663  42.302 1.00 84.22 ? 10  DG  C O6    1 
ATOM   302  N N1    . DG  B 2 4   ? 62.577 1.391   42.533 1.00 84.22 ? 10  DG  C N1    1 
ATOM   303  C C2    . DG  B 2 4   ? 61.514 2.249   42.640 1.00 84.22 ? 10  DG  C C2    1 
ATOM   304  N N2    . DG  B 2 4   ? 61.807 3.563   42.766 1.00 82.82 ? 10  DG  C N2    1 
ATOM   305  N N3    . DG  B 2 4   ? 60.250 1.858   42.624 1.00 84.22 ? 10  DG  C N3    1 
ATOM   306  C C4    . DG  B 2 4   ? 60.138 0.518   42.494 1.00 80.65 ? 10  DG  C C4    1 
ATOM   307  P P     . DA  B 2 5   ? 54.442 2.109   40.631 1.00 63.79 ? 9   DA  C P     1 
ATOM   308  O OP1   . DA  B 2 5   ? 53.128 2.805   40.793 1.00 67.51 ? 9   DA  C OP1   1 
ATOM   309  O OP2   . DA  B 2 5   ? 54.735 1.380   39.381 1.00 59.71 ? 9   DA  C OP2   1 
ATOM   310  O "O5'" . DA  B 2 5   ? 55.568 3.161   40.987 1.00 66.16 ? 9   DA  C "O5'" 1 
ATOM   311  C "C5'" . DA  B 2 5   ? 55.554 3.789   42.262 1.00 73.50 ? 9   DA  C "C5'" 1 
ATOM   312  C "C4'" . DA  B 2 5   ? 56.154 5.168   42.164 1.00 76.07 ? 9   DA  C "C4'" 1 
ATOM   313  O "O4'" . DA  B 2 5   ? 57.587 5.020   42.039 1.00 76.74 ? 9   DA  C "O4'" 1 
ATOM   314  C "C3'" . DA  B 2 5   ? 55.705 5.916   40.915 1.00 76.65 ? 9   DA  C "C3'" 1 
ATOM   315  O "O3'" . DA  B 2 5   ? 55.637 7.330   41.161 1.00 78.35 ? 9   DA  C "O3'" 1 
ATOM   316  C "C2'" . DA  B 2 5   ? 56.736 5.483   39.886 1.00 77.25 ? 9   DA  C "C2'" 1 
ATOM   317  C "C1'" . DA  B 2 5   ? 58.004 5.306   40.716 1.00 78.27 ? 9   DA  C "C1'" 1 
ATOM   318  N N9    . DA  B 2 5   ? 58.839 4.187   40.293 1.00 80.23 ? 9   DA  C N9    1 
ATOM   319  C C8    . DA  B 2 5   ? 58.443 2.893   40.093 1.00 80.60 ? 9   DA  C C8    1 
ATOM   320  N N7    . DA  B 2 5   ? 59.417 2.088   39.755 1.00 81.68 ? 9   DA  C N7    1 
ATOM   321  C C5    . DA  B 2 5   ? 60.532 2.913   39.714 1.00 82.80 ? 9   DA  C C5    1 
ATOM   322  C C6    . DA  B 2 5   ? 61.882 2.668   39.414 1.00 83.76 ? 9   DA  C C6    1 
ATOM   323  N N6    . DA  B 2 5   ? 62.368 1.465   39.090 1.00 84.22 ? 9   DA  C N6    1 
ATOM   324  N N1    . DA  B 2 5   ? 62.733 3.714   39.463 1.00 84.22 ? 9   DA  C N1    1 
ATOM   325  C C2    . DA  B 2 5   ? 62.253 4.918   39.796 1.00 83.83 ? 9   DA  C C2    1 
ATOM   326  N N3    . DA  B 2 5   ? 61.011 5.273   40.098 1.00 84.22 ? 9   DA  C N3    1 
ATOM   327  C C4    . DA  B 2 5   ? 60.188 4.211   40.038 1.00 83.19 ? 9   DA  C C4    1 
ATOM   328  P P     . DT  B 2 6   ? 55.474 8.354   39.934 1.00 83.46 ? 8   DT  C P     1 
ATOM   329  O OP1   . DT  B 2 6   ? 55.012 9.645   40.482 1.00 84.22 ? 8   DT  C OP1   1 
ATOM   330  O OP2   . DT  B 2 6   ? 54.698 7.695   38.857 1.00 83.50 ? 8   DT  C OP2   1 
ATOM   331  O "O5'" . DT  B 2 6   ? 56.977 8.556   39.468 1.00 84.22 ? 8   DT  C "O5'" 1 
ATOM   332  C "C5'" . DT  B 2 6   ? 57.990 8.736   40.441 1.00 80.95 ? 8   DT  C "C5'" 1 
ATOM   333  C "C4'" . DT  B 2 6   ? 59.175 9.433   39.822 1.00 81.66 ? 8   DT  C "C4'" 1 
ATOM   334  O "O4'" . DT  B 2 6   ? 60.114 8.438   39.337 1.00 82.39 ? 8   DT  C "O4'" 1 
ATOM   335  C "C3'" . DT  B 2 6   ? 58.762 10.239  38.592 1.00 81.38 ? 8   DT  C "C3'" 1 
ATOM   336  O "O3'" . DT  B 2 6   ? 59.630 11.374  38.464 1.00 82.69 ? 8   DT  C "O3'" 1 
ATOM   337  C "C2'" . DT  B 2 6   ? 58.915 9.225   37.465 1.00 84.22 ? 8   DT  C "C2'" 1 
ATOM   338  C "C1'" . DT  B 2 6   ? 60.148 8.456   37.920 1.00 83.64 ? 8   DT  C "C1'" 1 
ATOM   339  N N1    . DT  B 2 6   ? 60.329 7.072   37.453 1.00 84.22 ? 8   DT  C N1    1 
ATOM   340  C C2    . DT  B 2 6   ? 61.615 6.639   37.252 1.00 84.22 ? 8   DT  C C2    1 
ATOM   341  O O2    . DT  B 2 6   ? 62.588 7.341   37.435 1.00 84.22 ? 8   DT  C O2    1 
ATOM   342  N N3    . DT  B 2 6   ? 61.724 5.343   36.825 1.00 84.22 ? 8   DT  C N3    1 
ATOM   343  C C4    . DT  B 2 6   ? 60.696 4.457   36.586 1.00 84.22 ? 8   DT  C C4    1 
ATOM   344  O O4    . DT  B 2 6   ? 60.947 3.322   36.206 1.00 83.87 ? 8   DT  C O4    1 
ATOM   345  C C5    . DT  B 2 6   ? 59.370 4.979   36.817 1.00 84.12 ? 8   DT  C C5    1 
ATOM   346  C C7    . DT  B 2 6   ? 58.192 4.090   36.581 1.00 84.22 ? 8   DT  C C7    1 
ATOM   347  C C6    . DT  B 2 6   ? 59.255 6.246   37.235 1.00 84.22 ? 8   DT  C C6    1 
ATOM   348  P P     . DC  B 2 7   ? 59.486 12.350  37.203 1.00 84.54 ? 7   DC  C P     1 
ATOM   349  O OP1   . DC  B 2 7   ? 58.930 13.654  37.649 1.00 84.54 ? 7   DC  C OP1   1 
ATOM   350  O OP2   . DC  B 2 7   ? 58.768 11.567  36.183 1.00 84.54 ? 7   DC  C OP2   1 
ATOM   351  O "O5'" . DC  B 2 7   ? 60.980 12.528  36.685 1.00 84.54 ? 7   DC  C "O5'" 1 
ATOM   352  C "C5'" . DC  B 2 7   ? 61.843 11.393  36.617 1.00 84.54 ? 7   DC  C "C5'" 1 
ATOM   353  C "C4'" . DC  B 2 7   ? 62.876 11.602  35.535 1.00 84.29 ? 7   DC  C "C4'" 1 
ATOM   354  O "O4'" . DC  B 2 7   ? 63.221 10.320  34.953 1.00 83.84 ? 7   DC  C "O4'" 1 
ATOM   355  C "C3'" . DC  B 2 7   ? 62.268 12.408  34.395 1.00 84.38 ? 7   DC  C "C3'" 1 
ATOM   356  O "O3'" . DC  B 2 7   ? 63.284 13.162  33.753 1.00 84.54 ? 7   DC  C "O3'" 1 
ATOM   357  C "C2'" . DC  B 2 7   ? 61.675 11.349  33.498 1.00 84.54 ? 7   DC  C "C2'" 1 
ATOM   358  C "C1'" . DC  B 2 7   ? 62.643 10.190  33.652 1.00 83.65 ? 7   DC  C "C1'" 1 
ATOM   359  N N1    . DC  B 2 7   ? 62.004 8.860   33.556 1.00 84.54 ? 7   DC  C N1    1 
ATOM   360  C C2    . DC  B 2 7   ? 62.676 7.736   34.068 1.00 84.54 ? 7   DC  C C2    1 
ATOM   361  O O2    . DC  B 2 7   ? 63.763 7.889   34.625 1.00 84.54 ? 7   DC  C O2    1 
ATOM   362  N N3    . DC  B 2 7   ? 62.109 6.515   33.937 1.00 84.54 ? 7   DC  C N3    1 
ATOM   363  C C4    . DC  B 2 7   ? 60.928 6.389   33.319 1.00 84.54 ? 7   DC  C C4    1 
ATOM   364  N N4    . DC  B 2 7   ? 60.418 5.155   33.201 1.00 84.54 ? 7   DC  C N4    1 
ATOM   365  C C5    . DC  B 2 7   ? 60.225 7.516   32.798 1.00 84.54 ? 7   DC  C C5    1 
ATOM   366  C C6    . DC  B 2 7   ? 60.790 8.721   32.941 1.00 84.12 ? 7   DC  C C6    1 
ATOM   367  P P     . DA  B 2 8   ? 62.880 14.485  32.923 1.00 84.54 ? 6   DA  C P     1 
ATOM   368  O OP1   . DA  B 2 8   ? 63.285 15.662  33.765 1.00 84.54 ? 6   DA  C OP1   1 
ATOM   369  O OP2   . DA  B 2 8   ? 61.479 14.374  32.427 1.00 84.54 ? 6   DA  C OP2   1 
ATOM   370  O "O5'" . DA  B 2 8   ? 63.852 14.377  31.664 1.00 84.54 ? 6   DA  C "O5'" 1 
ATOM   371  C "C5'" . DA  B 2 8   ? 64.275 13.104  31.208 1.00 84.54 ? 6   DA  C "C5'" 1 
ATOM   372  C "C4'" . DA  B 2 8   ? 64.322 13.080  29.699 1.00 84.54 ? 6   DA  C "C4'" 1 
ATOM   373  O "O4'" . DA  B 2 8   ? 63.730 11.837  29.258 1.00 84.54 ? 6   DA  C "O4'" 1 
ATOM   374  C "C3'" . DA  B 2 8   ? 63.448 14.170  29.088 1.00 84.54 ? 6   DA  C "C3'" 1 
ATOM   375  O "O3'" . DA  B 2 8   ? 63.990 14.486  27.794 1.00 84.54 ? 6   DA  C "O3'" 1 
ATOM   376  C "C2'" . DA  B 2 8   ? 62.086 13.510  29.006 1.00 84.54 ? 6   DA  C "C2'" 1 
ATOM   377  C "C1'" . DA  B 2 8   ? 62.471 12.093  28.635 1.00 84.54 ? 6   DA  C "C1'" 1 
ATOM   378  N N9    . DA  B 2 8   ? 61.535 11.024  28.994 1.00 84.54 ? 6   DA  C N9    1 
ATOM   379  C C8    . DA  B 2 8   ? 60.172 11.098  29.125 1.00 84.54 ? 6   DA  C C8    1 
ATOM   380  N N7    . DA  B 2 8   ? 59.598 9.937   29.332 1.00 84.54 ? 6   DA  C N7    1 
ATOM   381  C C5    . DA  B 2 8   ? 60.659 9.042   29.372 1.00 84.54 ? 6   DA  C C5    1 
ATOM   382  C C6    . DA  B 2 8   ? 60.720 7.652   29.537 1.00 84.54 ? 6   DA  C C6    1 
ATOM   383  N N6    . DA  B 2 8   ? 59.643 6.879   29.687 1.00 84.54 ? 6   DA  C N6    1 
ATOM   384  N N1    . DA  B 2 8   ? 61.941 7.070   29.536 1.00 84.54 ? 6   DA  C N1    1 
ATOM   385  C C2    . DA  B 2 8   ? 63.016 7.833   29.365 1.00 84.54 ? 6   DA  C C2    1 
ATOM   386  N N3    . DA  B 2 8   ? 63.089 9.146   29.184 1.00 84.54 ? 6   DA  C N3    1 
ATOM   387  C C4    . DA  B 2 8   ? 61.860 9.700   29.197 1.00 84.54 ? 6   DA  C C4    1 
ATOM   388  P P     . DC  B 2 9   ? 63.103 15.282  26.711 1.00 84.54 ? 5   DC  C P     1 
ATOM   389  O OP1   . DC  B 2 9   ? 63.128 16.748  27.025 1.00 84.54 ? 5   DC  C OP1   1 
ATOM   390  O OP2   . DC  B 2 9   ? 61.795 14.591  26.498 1.00 84.54 ? 5   DC  C OP2   1 
ATOM   391  O "O5'" . DC  B 2 9   ? 63.899 15.048  25.355 1.00 84.54 ? 5   DC  C "O5'" 1 
ATOM   392  C "C5'" . DC  B 2 9   ? 63.378 14.191  24.346 1.00 83.65 ? 5   DC  C "C5'" 1 
ATOM   393  C "C4'" . DC  B 2 9   ? 64.339 13.053  24.102 1.00 84.54 ? 5   DC  C "C4'" 1 
ATOM   394  O "O4'" . DC  B 2 9   ? 64.024 11.984  25.046 1.00 84.54 ? 5   DC  C "O4'" 1 
ATOM   395  C "C3'" . DC  B 2 9   ? 64.130 12.441  22.722 1.00 84.54 ? 5   DC  C "C3'" 1 
ATOM   396  O "O3'" . DC  B 2 9   ? 65.340 11.980  22.120 1.00 84.54 ? 5   DC  C "O3'" 1 
ATOM   397  C "C2'" . DC  B 2 9   ? 63.099 11.353  22.958 1.00 84.54 ? 5   DC  C "C2'" 1 
ATOM   398  C "C1'" . DC  B 2 9   ? 63.415 10.871  24.371 1.00 84.54 ? 5   DC  C "C1'" 1 
ATOM   399  N N1    . DC  B 2 9   ? 62.184 10.472  25.101 1.00 84.54 ? 5   DC  C N1    1 
ATOM   400  C C2    . DC  B 2 9   ? 62.224 9.386   26.012 1.00 84.54 ? 5   DC  C C2    1 
ATOM   401  O O2    . DC  B 2 9   ? 63.308 8.826   26.253 1.00 84.54 ? 5   DC  C O2    1 
ATOM   402  N N3    . DC  B 2 9   ? 61.070 8.976   26.600 1.00 84.54 ? 5   DC  C N3    1 
ATOM   403  C C4    . DC  B 2 9   ? 59.918 9.604   26.332 1.00 84.54 ? 5   DC  C C4    1 
ATOM   404  N N4    . DC  B 2 9   ? 58.806 9.156   26.932 1.00 84.54 ? 5   DC  C N4    1 
ATOM   405  C C5    . DC  B 2 9   ? 59.855 10.721  25.440 1.00 84.54 ? 5   DC  C C5    1 
ATOM   406  C C6    . DC  B 2 9   ? 61.000 11.121  24.860 1.00 84.54 ? 5   DC  C C6    1 
ATOM   407  P P     . DA  B 2 10  ? 65.297 11.431  20.605 1.00 84.54 ? 4   DA  C P     1 
ATOM   408  O OP1   . DA  B 2 10  ? 66.630 11.635  19.952 1.00 84.54 ? 4   DA  C OP1   1 
ATOM   409  O OP2   . DA  B 2 10  ? 64.053 11.929  19.930 1.00 83.46 ? 4   DA  C OP2   1 
ATOM   410  O "O5'" . DA  B 2 10  ? 65.058 9.877   20.810 1.00 84.54 ? 4   DA  C "O5'" 1 
ATOM   411  C "C5'" . DA  B 2 10  ? 66.136 8.963   20.890 1.00 83.82 ? 4   DA  C "C5'" 1 
ATOM   412  C "C4'" . DA  B 2 10  ? 65.725 7.677   20.220 1.00 84.54 ? 4   DA  C "C4'" 1 
ATOM   413  O "O4'" . DA  B 2 10  ? 64.485 7.227   20.840 1.00 84.54 ? 4   DA  C "O4'" 1 
ATOM   414  C "C3'" . DA  B 2 10  ? 65.376 7.909   18.749 1.00 84.54 ? 4   DA  C "C3'" 1 
ATOM   415  O "O3'" . DA  B 2 10  ? 65.632 6.700   18.015 1.00 84.54 ? 4   DA  C "O3'" 1 
ATOM   416  C "C2'" . DA  B 2 10  ? 63.904 8.284   18.795 1.00 83.87 ? 4   DA  C "C2'" 1 
ATOM   417  C "C1'" . DA  B 2 10  ? 63.396 7.399   19.929 1.00 84.54 ? 4   DA  C "C1'" 1 
ATOM   418  N N9    . DA  B 2 10  ? 62.234 7.905   20.664 1.00 84.54 ? 4   DA  C N9    1 
ATOM   419  C C8    . DA  B 2 10  ? 61.756 9.197   20.693 1.00 84.54 ? 4   DA  C C8    1 
ATOM   420  N N7    . DA  B 2 10  ? 60.654 9.337   21.393 1.00 84.54 ? 4   DA  C N7    1 
ATOM   421  C C5    . DA  B 2 10  ? 60.397 8.056   21.873 1.00 84.54 ? 4   DA  C C5    1 
ATOM   422  C C6    . DA  B 2 10  ? 59.365 7.532   22.680 1.00 84.54 ? 4   DA  C C6    1 
ATOM   423  N N6    . DA  B 2 10  ? 58.355 8.262   23.159 1.00 84.54 ? 4   DA  C N6    1 
ATOM   424  N N1    . DA  B 2 10  ? 59.404 6.215   22.975 1.00 84.54 ? 4   DA  C N1    1 
ATOM   425  C C2    . DA  B 2 10  ? 60.409 5.479   22.482 1.00 84.54 ? 4   DA  C C2    1 
ATOM   426  N N3    . DA  B 2 10  ? 61.430 5.851   21.710 1.00 84.54 ? 4   DA  C N3    1 
ATOM   427  C C4    . DA  B 2 10  ? 61.368 7.166   21.439 1.00 84.54 ? 4   DA  C C4    1 
ATOM   428  P P     . DT  B 2 11  ? 64.533 6.134   16.979 1.00 84.54 ? 3   DT  C P     1 
ATOM   429  O OP1   . DT  B 2 11  ? 65.213 5.019   16.253 1.00 84.54 ? 3   DT  C OP1   1 
ATOM   430  O OP2   . DT  B 2 11  ? 63.931 7.280   16.213 1.00 84.54 ? 3   DT  C OP2   1 
ATOM   431  O "O5'" . DT  B 2 11  ? 63.408 5.477   17.911 1.00 84.54 ? 3   DT  C "O5'" 1 
ATOM   432  C "C5'" . DT  B 2 11  ? 63.776 4.564   18.956 1.00 84.54 ? 3   DT  C "C5'" 1 
ATOM   433  C "C4'" . DT  B 2 11  ? 62.860 3.359   18.977 1.00 84.54 ? 3   DT  C "C4'" 1 
ATOM   434  O "O4'" . DT  B 2 11  ? 61.615 3.693   19.653 1.00 83.75 ? 3   DT  C "O4'" 1 
ATOM   435  C "C3'" . DT  B 2 11  ? 62.455 2.928   17.569 1.00 84.54 ? 3   DT  C "C3'" 1 
ATOM   436  O "O3'" . DT  B 2 11  ? 62.272 1.512   17.488 1.00 84.54 ? 3   DT  C "O3'" 1 
ATOM   437  C "C2'" . DT  B 2 11  ? 61.179 3.719   17.328 1.00 84.54 ? 3   DT  C "C2'" 1 
ATOM   438  C "C1'" . DT  B 2 11  ? 60.544 3.741   18.716 1.00 84.01 ? 3   DT  C "C1'" 1 
ATOM   439  N N1    . DT  B 2 11  ? 59.694 4.918   19.027 1.00 84.54 ? 3   DT  C N1    1 
ATOM   440  C C2    . DT  B 2 11  ? 58.498 4.701   19.692 1.00 84.54 ? 3   DT  C C2    1 
ATOM   441  O O2    . DT  B 2 11  ? 58.123 3.598   20.056 1.00 84.54 ? 3   DT  C O2    1 
ATOM   442  N N3    . DT  B 2 11  ? 57.752 5.833   19.915 1.00 84.54 ? 3   DT  C N3    1 
ATOM   443  C C4    . DT  B 2 11  ? 58.068 7.128   19.549 1.00 84.54 ? 3   DT  C C4    1 
ATOM   444  O O4    . DT  B 2 11  ? 57.300 8.048   19.813 1.00 84.54 ? 3   DT  C O4    1 
ATOM   445  C C5    . DT  B 2 11  ? 59.323 7.286   18.865 1.00 84.54 ? 3   DT  C C5    1 
ATOM   446  C C7    . DT  B 2 11  ? 59.725 8.659   18.425 1.00 84.54 ? 3   DT  C C7    1 
ATOM   447  C C6    . DT  B 2 11  ? 60.073 6.190   18.646 1.00 84.54 ? 3   DT  C C6    1 
ATOM   448  P P     . DT  B 2 12  ? 61.665 0.865   16.142 1.00 84.54 ? 2   DT  C P     1 
ATOM   449  O OP1   . DT  B 2 12  ? 61.612 -0.609  16.377 1.00 84.54 ? 2   DT  C OP1   1 
ATOM   450  O OP2   . DT  B 2 12  ? 62.393 1.399   14.952 1.00 84.54 ? 2   DT  C OP2   1 
ATOM   451  O "O5'" . DT  B 2 12  ? 60.187 1.462   16.087 1.00 84.54 ? 2   DT  C "O5'" 1 
ATOM   452  C "C5'" . DT  B 2 12  ? 59.088 0.676   15.637 1.00 84.54 ? 2   DT  C "C5'" 1 
ATOM   453  C "C4'" . DT  B 2 12  ? 58.321 0.120   16.818 1.00 83.15 ? 2   DT  C "C4'" 1 
ATOM   454  O "O4'" . DT  B 2 12  ? 58.016 1.178   17.753 1.00 79.86 ? 2   DT  C "O4'" 1 
ATOM   455  C "C3'" . DT  B 2 12  ? 56.968 -0.469  16.438 1.00 81.53 ? 2   DT  C "C3'" 1 
ATOM   456  O "O3'" . DT  B 2 12  ? 56.624 -1.489  17.367 1.00 84.54 ? 2   DT  C "O3'" 1 
ATOM   457  C "C2'" . DT  B 2 12  ? 56.038 0.722   16.527 1.00 77.35 ? 2   DT  C "C2'" 1 
ATOM   458  C "C1'" . DT  B 2 12  ? 56.629 1.504   17.686 1.00 79.06 ? 2   DT  C "C1'" 1 
ATOM   459  N N1    . DT  B 2 12  ? 56.528 2.963   17.546 1.00 80.99 ? 2   DT  C N1    1 
ATOM   460  C C2    . DT  B 2 12  ? 55.489 3.596   18.177 1.00 84.54 ? 2   DT  C C2    1 
ATOM   461  O O2    . DT  B 2 12  ? 54.634 3.001   18.811 1.00 84.54 ? 2   DT  C O2    1 
ATOM   462  N N3    . DT  B 2 12  ? 55.482 4.961   18.041 1.00 84.54 ? 2   DT  C N3    1 
ATOM   463  C C4    . DT  B 2 12  ? 56.388 5.737   17.342 1.00 84.54 ? 2   DT  C C4    1 
ATOM   464  O O4    . DT  B 2 12  ? 56.255 6.962   17.319 1.00 84.54 ? 2   DT  C O4    1 
ATOM   465  C C5    . DT  B 2 12  ? 57.447 5.002   16.685 1.00 84.54 ? 2   DT  C C5    1 
ATOM   466  C C7    . DT  B 2 12  ? 58.473 5.755   15.895 1.00 84.54 ? 2   DT  C C7    1 
ATOM   467  C C6    . DT  B 2 12  ? 57.461 3.668   16.817 1.00 82.03 ? 2   DT  C C6    1 
ATOM   468  P P     . DT  B 2 13  ? 55.270 -2.325  17.168 1.00 84.54 ? 1   DT  C P     1 
ATOM   469  O OP1   . DT  B 2 13  ? 55.332 -3.380  18.228 1.00 84.54 ? 1   DT  C OP1   1 
ATOM   470  O OP2   . DT  B 2 13  ? 55.196 -2.727  15.731 1.00 84.54 ? 1   DT  C OP2   1 
ATOM   471  O "O5'" . DT  B 2 13  ? 54.108 -1.259  17.497 1.00 84.54 ? 1   DT  C "O5'" 1 
ATOM   472  C "C5'" . DT  B 2 13  ? 52.880 -1.220  16.751 1.00 83.17 ? 1   DT  C "C5'" 1 
ATOM   473  C "C4'" . DT  B 2 13  ? 51.855 -0.359  17.463 1.00 84.51 ? 1   DT  C "C4'" 1 
ATOM   474  O "O4'" . DT  B 2 13  ? 52.320 1.010   17.489 1.00 84.54 ? 1   DT  C "O4'" 1 
ATOM   475  C "C3'" . DT  B 2 13  ? 50.504 -0.298  16.726 1.00 84.54 ? 1   DT  C "C3'" 1 
ATOM   476  O "O3'" . DT  B 2 13  ? 49.453 0.063   17.659 1.00 84.54 ? 1   DT  C "O3'" 1 
ATOM   477  C "C2'" . DT  B 2 13  ? 50.703 0.861   15.763 1.00 84.54 ? 1   DT  C "C2'" 1 
ATOM   478  C "C1'" . DT  B 2 13  ? 51.489 1.807   16.648 1.00 84.54 ? 1   DT  C "C1'" 1 
ATOM   479  N N1    . DT  B 2 13  ? 52.302 2.885   16.060 1.00 84.54 ? 1   DT  C N1    1 
ATOM   480  C C2    . DT  B 2 13  ? 51.850 4.179   16.251 1.00 84.54 ? 1   DT  C C2    1 
ATOM   481  O O2    . DT  B 2 13  ? 50.769 4.438   16.765 1.00 84.54 ? 1   DT  C O2    1 
ATOM   482  N N3    . DT  B 2 13  ? 52.712 5.158   15.817 1.00 84.54 ? 1   DT  C N3    1 
ATOM   483  C C4    . DT  B 2 13  ? 53.945 4.974   15.211 1.00 84.54 ? 1   DT  C C4    1 
ATOM   484  O O4    . DT  B 2 13  ? 54.633 5.954   14.911 1.00 84.54 ? 1   DT  C O4    1 
ATOM   485  C C5    . DT  B 2 13  ? 54.324 3.589   14.993 1.00 84.54 ? 1   DT  C C5    1 
ATOM   486  C C7    . DT  B 2 13  ? 55.626 3.292   14.328 1.00 84.54 ? 1   DT  C C7    1 
ATOM   487  C C6    . DT  B 2 13  ? 53.488 2.629   15.408 1.00 84.54 ? 1   DT  C C6    1 
ATOM   488  P P     . DT  B 2 14  ? 48.221 -0.941  17.944 1.00 84.54 ? -1  DT  C P     1 
ATOM   489  O OP1   . DT  B 2 14  ? 47.451 -0.345  19.066 1.00 84.54 ? -1  DT  C OP1   1 
ATOM   490  O OP2   . DT  B 2 14  ? 48.719 -2.353  18.045 1.00 82.68 ? -1  DT  C OP2   1 
ATOM   491  O "O5'" . DT  B 2 14  ? 47.298 -0.794  16.661 1.00 84.54 ? -1  DT  C "O5'" 1 
ATOM   492  C "C5'" . DT  B 2 14  ? 47.333 0.404   15.904 1.00 84.54 ? -1  DT  C "C5'" 1 
ATOM   493  C "C4'" . DT  B 2 14  ? 46.782 1.542   16.725 1.00 83.62 ? -1  DT  C "C4'" 1 
ATOM   494  O "O4'" . DT  B 2 14  ? 47.742 2.622   16.676 1.00 84.54 ? -1  DT  C "O4'" 1 
ATOM   495  C "C3'" . DT  B 2 14  ? 45.491 2.113   16.138 1.00 84.54 ? -1  DT  C "C3'" 1 
ATOM   496  O "O3'" . DT  B 2 14  ? 44.665 2.692   17.157 1.00 84.43 ? -1  DT  C "O3'" 1 
ATOM   497  C "C2'" . DT  B 2 14  ? 45.996 3.161   15.161 1.00 84.54 ? -1  DT  C "C2'" 1 
ATOM   498  C "C1'" . DT  B 2 14  ? 47.231 3.695   15.881 1.00 84.54 ? -1  DT  C "C1'" 1 
ATOM   499  N N1    . DT  B 2 14  ? 48.321 4.188   15.012 1.00 84.54 ? -1  DT  C N1    1 
ATOM   500  C C2    . DT  B 2 14  ? 48.428 5.552   14.816 1.00 84.54 ? -1  DT  C C2    1 
ATOM   501  O O2    . DT  B 2 14  ? 47.664 6.368   15.322 1.00 84.54 ? -1  DT  C O2    1 
ATOM   502  N N3    . DT  B 2 14  ? 49.468 5.931   13.998 1.00 84.54 ? -1  DT  C N3    1 
ATOM   503  C C4    . DT  B 2 14  ? 50.389 5.107   13.382 1.00 84.54 ? -1  DT  C C4    1 
ATOM   504  O O4    . DT  B 2 14  ? 51.268 5.593   12.684 1.00 84.54 ? -1  DT  C O4    1 
ATOM   505  C C5    . DT  B 2 14  ? 50.218 3.692   13.634 1.00 84.54 ? -1  DT  C C5    1 
ATOM   506  C C7    . DT  B 2 14  ? 51.176 2.724   13.018 1.00 84.54 ? -1  DT  C C7    1 
ATOM   507  C C6    . DT  B 2 14  ? 49.204 3.309   14.421 1.00 84.54 ? -1  DT  C C6    1 
ATOM   508  P P     . DT  B 2 15  ? 43.221 3.280   16.766 1.00 84.54 ? -2  DT  C P     1 
ATOM   509  O OP1   . DT  B 2 15  ? 42.346 3.216   17.965 1.00 84.54 ? -2  DT  C OP1   1 
ATOM   510  O OP2   . DT  B 2 15  ? 42.796 2.593   15.514 1.00 84.54 ? -2  DT  C OP2   1 
ATOM   511  O "O5'" . DT  B 2 15  ? 43.491 4.817   16.402 1.00 84.54 ? -2  DT  C "O5'" 1 
ATOM   512  C "C5'" . DT  B 2 15  ? 43.260 5.856   17.361 1.00 84.54 ? -2  DT  C "C5'" 1 
ATOM   513  C "C4'" . DT  B 2 15  ? 42.644 7.075   16.706 1.00 84.54 ? -2  DT  C "C4'" 1 
ATOM   514  O "O4'" . DT  B 2 15  ? 43.611 7.707   15.829 1.00 83.76 ? -2  DT  C "O4'" 1 
ATOM   515  C "C3'" . DT  B 2 15  ? 41.441 6.765   15.815 1.00 84.54 ? -2  DT  C "C3'" 1 
ATOM   516  O "O3'" . DT  B 2 15  ? 40.603 7.925   15.659 1.00 83.99 ? -2  DT  C "O3'" 1 
ATOM   517  C "C2'" . DT  B 2 15  ? 42.091 6.496   14.468 1.00 84.54 ? -2  DT  C "C2'" 1 
ATOM   518  C "C1'" . DT  B 2 15  ? 43.243 7.503   14.462 1.00 84.54 ? -2  DT  C "C1'" 1 
ATOM   519  N N1    . DT  B 2 15  ? 44.464 7.112   13.709 1.00 84.54 ? -2  DT  C N1    1 
ATOM   520  C C2    . DT  B 2 15  ? 45.428 8.078   13.516 1.00 84.54 ? -2  DT  C C2    1 
ATOM   521  O O2    . DT  B 2 15  ? 45.299 9.240   13.890 1.00 83.58 ? -2  DT  C O2    1 
ATOM   522  N N3    . DT  B 2 15  ? 46.563 7.631   12.866 1.00 84.54 ? -2  DT  C N3    1 
ATOM   523  C C4    . DT  B 2 15  ? 46.817 6.347   12.399 1.00 84.54 ? -2  DT  C C4    1 
ATOM   524  O O4    . DT  B 2 15  ? 47.898 6.084   11.860 1.00 84.54 ? -2  DT  C O4    1 
ATOM   525  C C5    . DT  B 2 15  ? 45.752 5.398   12.611 1.00 84.54 ? -2  DT  C C5    1 
ATOM   526  C C7    . DT  B 2 15  ? 45.935 3.992   12.131 1.00 84.54 ? -2  DT  C C7    1 
ATOM   527  C C6    . DT  B 2 15  ? 44.642 5.822   13.239 1.00 84.54 ? -2  DT  C C6    1 
ATOM   528  N N     . ASP C 3 1   ? 12.283 -9.540  30.960 1.00 84.54 ? 8   ASP A N     1 
ATOM   529  C CA    . ASP C 3 1   ? 11.231 -9.468  32.016 1.00 84.54 ? 8   ASP A CA    1 
ATOM   530  C C     . ASP C 3 1   ? 10.344 -8.246  31.817 1.00 84.54 ? 8   ASP A C     1 
ATOM   531  O O     . ASP C 3 1   ? 10.770 -7.226  31.264 1.00 83.37 ? 8   ASP A O     1 
ATOM   532  C CB    . ASP C 3 1   ? 11.851 -9.393  33.420 1.00 84.54 ? 8   ASP A CB    1 
ATOM   533  C CG    . ASP C 3 1   ? 12.474 -8.035  33.718 1.00 84.54 ? 8   ASP A CG    1 
ATOM   534  O OD1   . ASP C 3 1   ? 13.657 -7.826  33.370 1.00 84.54 ? 8   ASP A OD1   1 
ATOM   535  O OD2   . ASP C 3 1   ? 11.770 -7.173  34.297 1.00 82.28 ? 8   ASP A OD2   1 
ATOM   536  N N     . PRO C 3 2   ? 9.091  -8.336  32.279 1.00 84.54 ? 9   PRO A N     1 
ATOM   537  C CA    . PRO C 3 2   ? 8.163  -7.212  32.137 1.00 84.54 ? 9   PRO A CA    1 
ATOM   538  C C     . PRO C 3 2   ? 8.771  -5.938  32.735 1.00 84.54 ? 9   PRO A C     1 
ATOM   539  O O     . PRO C 3 2   ? 9.466  -5.199  32.035 1.00 84.30 ? 9   PRO A O     1 
ATOM   540  C CB    . PRO C 3 2   ? 6.929  -7.691  32.897 1.00 84.54 ? 9   PRO A CB    1 
ATOM   541  C CG    . PRO C 3 2   ? 6.995  -9.201  32.732 1.00 84.54 ? 9   PRO A CG    1 
ATOM   542  C CD    . PRO C 3 2   ? 8.452  -9.482  32.952 1.00 83.21 ? 9   PRO A CD    1 
ATOM   543  N N     . THR C 3 3   ? 8.523  -5.720  34.030 1.00 84.54 ? 10  THR A N     1 
ATOM   544  C CA    . THR C 3 3   ? 8.997  -4.553  34.781 1.00 84.54 ? 10  THR A CA    1 
ATOM   545  C C     . THR C 3 3   ? 10.173 -3.757  34.204 1.00 84.54 ? 10  THR A C     1 
ATOM   546  O O     . THR C 3 3   ? 10.167 -2.521  34.257 1.00 84.54 ? 10  THR A O     1 
ATOM   547  C CB    . THR C 3 3   ? 9.323  -4.941  36.250 1.00 84.54 ? 10  THR A CB    1 
ATOM   548  O OG1   . THR C 3 3   ? 8.095  -5.142  36.966 1.00 84.54 ? 10  THR A OG1   1 
ATOM   549  C CG2   . THR C 3 3   ? 10.122 -3.837  36.950 1.00 83.19 ? 10  THR A CG2   1 
ATOM   550  N N     . LEU C 3 4   ? 11.182 -4.447  33.672 1.00 84.54 ? 11  LEU A N     1 
ATOM   551  C CA    . LEU C 3 4   ? 12.341 -3.771  33.075 1.00 84.06 ? 11  LEU A CA    1 
ATOM   552  C C     . LEU C 3 4   ? 11.902 -2.840  31.942 1.00 84.54 ? 11  LEU A C     1 
ATOM   553  O O     . LEU C 3 4   ? 12.325 -1.672  31.878 1.00 84.54 ? 11  LEU A O     1 
ATOM   554  C CB    . LEU C 3 4   ? 13.321 -4.794  32.509 1.00 84.29 ? 11  LEU A CB    1 
ATOM   555  C CG    . LEU C 3 4   ? 14.377 -4.218  31.566 1.00 84.54 ? 11  LEU A CG    1 
ATOM   556  C CD1   . LEU C 3 4   ? 15.365 -3.370  32.372 1.00 84.54 ? 11  LEU A CD1   1 
ATOM   557  C CD2   . LEU C 3 4   ? 15.086 -5.351  30.836 1.00 82.23 ? 11  LEU A CD2   1 
ATOM   558  N N     . GLU C 3 5   ? 11.057 -3.369  31.051 1.00 84.26 ? 12  GLU A N     1 
ATOM   559  C CA    . GLU C 3 5   ? 10.547 -2.613  29.909 1.00 82.90 ? 12  GLU A CA    1 
ATOM   560  C C     . GLU C 3 5   ? 9.498  -1.558  30.241 1.00 79.65 ? 12  GLU A C     1 
ATOM   561  O O     . GLU C 3 5   ? 9.171  -0.713  29.412 1.00 81.23 ? 12  GLU A O     1 
ATOM   562  C CB    . GLU C 3 5   ? 10.006 -3.564  28.851 1.00 81.08 ? 12  GLU A CB    1 
ATOM   563  C CG    . GLU C 3 5   ? 11.088 -4.088  27.942 1.00 84.38 ? 12  GLU A CG    1 
ATOM   564  C CD    . GLU C 3 5   ? 10.518 -4.759  26.709 1.00 84.54 ? 12  GLU A CD    1 
ATOM   565  O OE1   . GLU C 3 5   ? 11.290 -4.984  25.739 1.00 84.54 ? 12  GLU A OE1   1 
ATOM   566  O OE2   . GLU C 3 5   ? 9.297  -5.058  26.717 1.00 84.54 ? 12  GLU A OE2   1 
ATOM   567  N N     . TRP C 3 6   ? 8.955  -1.613  31.444 1.00 74.49 ? 13  TRP A N     1 
ATOM   568  C CA    . TRP C 3 6   ? 7.986  -0.614  31.845 1.00 74.70 ? 13  TRP A CA    1 
ATOM   569  C C     . TRP C 3 6   ? 8.848  0.578   32.218 1.00 74.76 ? 13  TRP A C     1 
ATOM   570  O O     . TRP C 3 6   ? 8.544  1.727   31.890 1.00 72.85 ? 13  TRP A O     1 
ATOM   571  C CB    . TRP C 3 6   ? 7.192  -1.092  33.054 1.00 71.63 ? 13  TRP A CB    1 
ATOM   572  C CG    . TRP C 3 6   ? 6.548  0.020   33.803 1.00 70.18 ? 13  TRP A CG    1 
ATOM   573  C CD1   . TRP C 3 6   ? 5.552  0.850   33.361 1.00 69.48 ? 13  TRP A CD1   1 
ATOM   574  C CD2   . TRP C 3 6   ? 6.870  0.448   35.127 1.00 68.76 ? 13  TRP A CD2   1 
ATOM   575  N NE1   . TRP C 3 6   ? 5.235  1.774   34.337 1.00 69.65 ? 13  TRP A NE1   1 
ATOM   576  C CE2   . TRP C 3 6   ? 6.030  1.547   35.431 1.00 69.86 ? 13  TRP A CE2   1 
ATOM   577  C CE3   . TRP C 3 6   ? 7.786  0.012   36.087 1.00 66.97 ? 13  TRP A CE3   1 
ATOM   578  C CZ2   . TRP C 3 6   ? 6.084  2.216   36.660 1.00 71.44 ? 13  TRP A CZ2   1 
ATOM   579  C CZ3   . TRP C 3 6   ? 7.840  0.680   37.315 1.00 72.81 ? 13  TRP A CZ3   1 
ATOM   580  C CH2   . TRP C 3 6   ? 6.993  1.770   37.588 1.00 71.39 ? 13  TRP A CH2   1 
ATOM   581  N N     . PHE C 3 7   ? 9.933  0.276   32.920 1.00 74.73 ? 14  PHE A N     1 
ATOM   582  C CA    . PHE C 3 7   ? 10.893 1.282   33.336 1.00 74.37 ? 14  PHE A CA    1 
ATOM   583  C C     . PHE C 3 7   ? 11.468 1.859   32.059 1.00 74.26 ? 14  PHE A C     1 
ATOM   584  O O     . PHE C 3 7   ? 11.394 3.057   31.826 1.00 73.65 ? 14  PHE A O     1 
ATOM   585  C CB    . PHE C 3 7   ? 11.999 0.624   34.148 1.00 74.39 ? 14  PHE A CB    1 
ATOM   586  C CG    . PHE C 3 7   ? 13.242 1.456   34.291 1.00 72.01 ? 14  PHE A CG    1 
ATOM   587  C CD1   . PHE C 3 7   ? 13.311 2.472   35.236 1.00 71.49 ? 14  PHE A CD1   1 
ATOM   588  C CD2   . PHE C 3 7   ? 14.372 1.171   33.525 1.00 68.90 ? 14  PHE A CD2   1 
ATOM   589  C CE1   . PHE C 3 7   ? 14.489 3.184   35.422 1.00 70.36 ? 14  PHE A CE1   1 
ATOM   590  C CE2   . PHE C 3 7   ? 15.550 1.876   33.699 1.00 63.43 ? 14  PHE A CE2   1 
ATOM   591  C CZ    . PHE C 3 7   ? 15.612 2.882   34.648 1.00 67.44 ? 14  PHE A CZ    1 
ATOM   592  N N     . LEU C 3 8   ? 12.030 0.998   31.218 1.00 73.75 ? 15  LEU A N     1 
ATOM   593  C CA    . LEU C 3 8   ? 12.608 1.478   29.977 1.00 75.11 ? 15  LEU A CA    1 
ATOM   594  C C     . LEU C 3 8   ? 11.630 2.421   29.293 1.00 74.11 ? 15  LEU A C     1 
ATOM   595  O O     . LEU C 3 8   ? 11.955 3.567   28.992 1.00 72.76 ? 15  LEU A O     1 
ATOM   596  C CB    . LEU C 3 8   ? 12.959 0.309   29.051 1.00 76.30 ? 15  LEU A CB    1 
ATOM   597  C CG    . LEU C 3 8   ? 14.138 -0.567  29.483 1.00 78.80 ? 15  LEU A CG    1 
ATOM   598  C CD1   . LEU C 3 8   ? 14.562 -1.439  28.315 1.00 75.85 ? 15  LEU A CD1   1 
ATOM   599  C CD2   . LEU C 3 8   ? 15.307 0.299   29.932 1.00 78.09 ? 15  LEU A CD2   1 
ATOM   600  N N     . SER C 3 9   ? 10.419 1.935   29.072 1.00 75.16 ? 16  SER A N     1 
ATOM   601  C CA    . SER C 3 9   ? 9.380  2.723   28.427 1.00 74.67 ? 16  SER A CA    1 
ATOM   602  C C     . SER C 3 9   ? 9.245  4.135   29.018 1.00 71.87 ? 16  SER A C     1 
ATOM   603  O O     . SER C 3 9   ? 8.479  4.945   28.495 1.00 70.27 ? 16  SER A O     1 
ATOM   604  C CB    . SER C 3 9   ? 8.034  2.002   28.538 1.00 76.07 ? 16  SER A CB    1 
ATOM   605  O OG    . SER C 3 9   ? 7.525  2.093   29.861 1.00 78.01 ? 16  SER A OG    1 
ATOM   606  N N     . HIS C 3 10  ? 9.966  4.427   30.102 1.00 66.83 ? 17  HIS A N     1 
ATOM   607  C CA    . HIS C 3 10  ? 9.904  5.758   30.707 1.00 65.08 ? 17  HIS A CA    1 
ATOM   608  C C     . HIS C 3 10  ? 11.240 6.454   30.705 1.00 61.60 ? 17  HIS A C     1 
ATOM   609  O O     . HIS C 3 10  ? 11.460 7.382   31.478 1.00 60.82 ? 17  HIS A O     1 
ATOM   610  C CB    . HIS C 3 10  ? 9.405  5.691   32.135 1.00 68.96 ? 17  HIS A CB    1 
ATOM   611  C CG    . HIS C 3 10  ? 8.006  5.186   32.249 1.00 78.84 ? 17  HIS A CG    1 
ATOM   612  N ND1   . HIS C 3 10  ? 7.638  3.923   31.836 1.00 77.70 ? 17  HIS A ND1   1 
ATOM   613  C CD2   . HIS C 3 10  ? 6.886  5.768   32.741 1.00 80.03 ? 17  HIS A CD2   1 
ATOM   614  C CE1   . HIS C 3 10  ? 6.351  3.746   32.074 1.00 79.88 ? 17  HIS A CE1   1 
ATOM   615  N NE2   . HIS C 3 10  ? 5.872  4.850   32.623 1.00 81.63 ? 17  HIS A NE2   1 
ATOM   616  N N     . CYS C 3 11  ? 12.123 6.009   29.819 1.00 58.68 ? 18  CYS A N     1 
ATOM   617  C CA    . CYS C 3 11  ? 13.455 6.575   29.707 1.00 60.67 ? 18  CYS A CA    1 
ATOM   618  C C     . CYS C 3 11  ? 13.719 7.079   28.304 1.00 59.71 ? 18  CYS A C     1 
ATOM   619  O O     . CYS C 3 11  ? 13.151 6.565   27.352 1.00 64.64 ? 18  CYS A O     1 
ATOM   620  C CB    . CYS C 3 11  ? 14.509 5.506   30.019 1.00 62.55 ? 18  CYS A CB    1 
ATOM   621  S SG    . CYS C 3 11  ? 14.290 4.608   31.562 1.00 65.81 ? 18  CYS A SG    1 
ATOM   622  N N     . HIS C 3 12  ? 14.570 8.090   28.185 1.00 56.60 ? 19  HIS A N     1 
ATOM   623  C CA    . HIS C 3 12  ? 14.983 8.605   26.888 1.00 55.25 ? 19  HIS A CA    1 
ATOM   624  C C     . HIS C 3 12  ? 16.210 7.756   26.596 1.00 54.65 ? 19  HIS A C     1 
ATOM   625  O O     . HIS C 3 12  ? 17.080 7.629   27.439 1.00 56.76 ? 19  HIS A O     1 
ATOM   626  C CB    . HIS C 3 12  ? 15.475 10.047  26.968 1.00 58.94 ? 19  HIS A CB    1 
ATOM   627  C CG    . HIS C 3 12  ? 14.393 11.070  27.067 1.00 65.33 ? 19  HIS A CG    1 
ATOM   628  N ND1   . HIS C 3 12  ? 14.663 12.417  27.192 1.00 68.74 ? 19  HIS A ND1   1 
ATOM   629  C CD2   . HIS C 3 12  ? 13.046 10.955  27.071 1.00 68.52 ? 19  HIS A CD2   1 
ATOM   630  C CE1   . HIS C 3 12  ? 13.530 13.088  27.273 1.00 69.28 ? 19  HIS A CE1   1 
ATOM   631  N NE2   . HIS C 3 12  ? 12.533 12.225  27.203 1.00 71.91 ? 19  HIS A NE2   1 
ATOM   632  N N     . ILE C 3 13  ? 16.301 7.155   25.430 1.00 52.30 ? 20  ILE A N     1 
ATOM   633  C CA    . ILE C 3 13  ? 17.498 6.398   25.157 1.00 54.08 ? 20  ILE A CA    1 
ATOM   634  C C     . ILE C 3 13  ? 18.478 7.366   24.465 1.00 52.00 ? 20  ILE A C     1 
ATOM   635  O O     . ILE C 3 13  ? 18.067 8.286   23.768 1.00 52.01 ? 20  ILE A O     1 
ATOM   636  C CB    . ILE C 3 13  ? 17.183 5.149   24.287 1.00 55.71 ? 20  ILE A CB    1 
ATOM   637  C CG1   . ILE C 3 13  ? 18.481 4.546   23.747 1.00 59.75 ? 20  ILE A CG1   1 
ATOM   638  C CG2   . ILE C 3 13  ? 16.288 5.529   23.120 1.00 62.12 ? 20  ILE A CG2   1 
ATOM   639  C CD1   . ILE C 3 13  ? 19.541 4.299   24.811 1.00 64.08 ? 20  ILE A CD1   1 
ATOM   640  N N     . HIS C 3 14  ? 19.771 7.180   24.703 1.00 53.04 ? 21  HIS A N     1 
ATOM   641  C CA    . HIS C 3 14  ? 20.834 8.017   24.123 1.00 49.99 ? 21  HIS A CA    1 
ATOM   642  C C     . HIS C 3 14  ? 21.996 7.118   23.699 1.00 47.69 ? 21  HIS A C     1 
ATOM   643  O O     . HIS C 3 14  ? 22.185 6.035   24.237 1.00 48.59 ? 21  HIS A O     1 
ATOM   644  C CB    . HIS C 3 14  ? 21.380 9.009   25.154 1.00 47.13 ? 21  HIS A CB    1 
ATOM   645  C CG    . HIS C 3 14  ? 20.477 10.162  25.451 1.00 47.72 ? 21  HIS A CG    1 
ATOM   646  N ND1   . HIS C 3 14  ? 20.608 11.387  24.829 1.00 48.39 ? 21  HIS A ND1   1 
ATOM   647  C CD2   . HIS C 3 14  ? 19.496 10.311  26.370 1.00 47.39 ? 21  HIS A CD2   1 
ATOM   648  C CE1   . HIS C 3 14  ? 19.754 12.242  25.360 1.00 45.26 ? 21  HIS A CE1   1 
ATOM   649  N NE2   . HIS C 3 14  ? 19.067 11.616  26.299 1.00 48.89 ? 21  HIS A NE2   1 
ATOM   650  N N     . LYS C 3 15  ? 22.783 7.571   22.741 1.00 44.58 ? 22  LYS A N     1 
ATOM   651  C CA    . LYS C 3 15  ? 23.913 6.788   22.320 1.00 45.16 ? 22  LYS A CA    1 
ATOM   652  C C     . LYS C 3 15  ? 25.123 7.662   22.598 1.00 45.80 ? 22  LYS A C     1 
ATOM   653  O O     . LYS C 3 15  ? 25.046 8.889   22.518 1.00 45.55 ? 22  LYS A O     1 
ATOM   654  C CB    . LYS C 3 15  ? 23.863 6.478   20.820 1.00 48.32 ? 22  LYS A CB    1 
ATOM   655  C CG    . LYS C 3 15  ? 22.533 6.076   20.252 1.00 50.66 ? 22  LYS A CG    1 
ATOM   656  C CD    . LYS C 3 15  ? 22.243 4.616   20.468 1.00 56.52 ? 22  LYS A CD    1 
ATOM   657  C CE    . LYS C 3 15  ? 21.069 4.158   19.599 1.00 56.07 ? 22  LYS A CE    1 
ATOM   658  N NZ    . LYS C 3 15  ? 21.469 4.044   18.161 1.00 63.76 ? 22  LYS A NZ    1 
ATOM   659  N N     . TYR C 3 16  ? 26.231 7.021   22.951 1.00 43.39 ? 23  TYR A N     1 
ATOM   660  C CA    . TYR C 3 16  ? 27.487 7.703   23.200 1.00 41.07 ? 23  TYR A CA    1 
ATOM   661  C C     . TYR C 3 16  ? 28.473 6.889   22.416 1.00 39.98 ? 23  TYR A C     1 
ATOM   662  O O     . TYR C 3 16  ? 28.273 5.704   22.231 1.00 40.33 ? 23  TYR A O     1 
ATOM   663  C CB    . TYR C 3 16  ? 27.864 7.662   24.667 1.00 42.72 ? 23  TYR A CB    1 
ATOM   664  C CG    . TYR C 3 16  ? 26.907 8.387   25.559 1.00 45.38 ? 23  TYR A CG    1 
ATOM   665  C CD1   . TYR C 3 16  ? 25.689 7.822   25.917 1.00 45.42 ? 23  TYR A CD1   1 
ATOM   666  C CD2   . TYR C 3 16  ? 27.217 9.642   26.051 1.00 44.54 ? 23  TYR A CD2   1 
ATOM   667  C CE1   . TYR C 3 16  ? 24.803 8.501   26.747 1.00 45.62 ? 23  TYR A CE1   1 
ATOM   668  C CE2   . TYR C 3 16  ? 26.344 10.321  26.879 1.00 45.45 ? 23  TYR A CE2   1 
ATOM   669  C CZ    . TYR C 3 16  ? 25.143 9.750   27.218 1.00 43.49 ? 23  TYR A CZ    1 
ATOM   670  O OH    . TYR C 3 16  ? 24.278 10.453  28.004 1.00 44.15 ? 23  TYR A OH    1 
ATOM   671  N N     . PRO C 3 17  ? 29.526 7.519   21.900 1.00 42.78 ? 24  PRO A N     1 
ATOM   672  C CA    . PRO C 3 17  ? 30.509 6.761   21.132 1.00 42.27 ? 24  PRO A CA    1 
ATOM   673  C C     . PRO C 3 17  ? 31.714 6.426   21.997 1.00 44.14 ? 24  PRO A C     1 
ATOM   674  O O     . PRO C 3 17  ? 32.046 7.153   22.922 1.00 45.55 ? 24  PRO A O     1 
ATOM   675  C CB    . PRO C 3 17  ? 30.850 7.720   20.008 1.00 42.45 ? 24  PRO A CB    1 
ATOM   676  C CG    . PRO C 3 17  ? 30.880 9.021   20.727 1.00 41.58 ? 24  PRO A CG    1 
ATOM   677  C CD    . PRO C 3 17  ? 29.640 8.960   21.603 1.00 42.56 ? 24  PRO A CD    1 
ATOM   678  N N     . SER C 3 18  ? 32.376 5.320   21.703 1.00 48.70 ? 25  SER A N     1 
ATOM   679  C CA    . SER C 3 18  ? 33.540 4.949   22.487 1.00 50.48 ? 25  SER A CA    1 
ATOM   680  C C     . SER C 3 18  ? 34.429 6.161   22.796 1.00 50.41 ? 25  SER A C     1 
ATOM   681  O O     . SER C 3 18  ? 34.628 7.045   21.961 1.00 49.52 ? 25  SER A O     1 
ATOM   682  C CB    . SER C 3 18  ? 34.361 3.900   21.764 1.00 48.50 ? 25  SER A CB    1 
ATOM   683  O OG    . SER C 3 18  ? 35.699 4.030   22.186 1.00 53.85 ? 25  SER A OG    1 
ATOM   684  N N     . LYS C 3 19  ? 34.946 6.180   24.020 1.00 51.00 ? 26  LYS A N     1 
ATOM   685  C CA    . LYS C 3 19  ? 35.808 7.234   24.530 1.00 45.06 ? 26  LYS A CA    1 
ATOM   686  C C     . LYS C 3 19  ? 35.040 8.451   24.982 1.00 42.80 ? 26  LYS A C     1 
ATOM   687  O O     . LYS C 3 19  ? 35.603 9.310   25.653 1.00 50.85 ? 26  LYS A O     1 
ATOM   688  C CB    . LYS C 3 19  ? 36.852 7.637   23.498 1.00 43.17 ? 26  LYS A CB    1 
ATOM   689  C CG    . LYS C 3 19  ? 37.736 6.492   23.063 1.00 49.72 ? 26  LYS A CG    1 
ATOM   690  C CD    . LYS C 3 19  ? 38.764 6.932   22.028 1.00 55.33 ? 26  LYS A CD    1 
ATOM   691  C CE    . LYS C 3 19  ? 39.563 5.750   21.513 1.00 53.58 ? 26  LYS A CE    1 
ATOM   692  N NZ    . LYS C 3 19  ? 40.221 5.051   22.653 1.00 61.50 ? 26  LYS A NZ    1 
ATOM   693  N N     . SER C 3 20  ? 33.765 8.562   24.650 1.00 35.68 ? 27  SER A N     1 
ATOM   694  C CA    . SER C 3 20  ? 33.063 9.742   25.115 1.00 36.28 ? 27  SER A CA    1 
ATOM   695  C C     . SER C 3 20  ? 32.805 9.656   26.628 1.00 40.87 ? 27  SER A C     1 
ATOM   696  O O     . SER C 3 20  ? 33.097 8.637   27.267 1.00 45.63 ? 27  SER A O     1 
ATOM   697  C CB    . SER C 3 20  ? 31.769 9.949   24.342 1.00 30.63 ? 27  SER A CB    1 
ATOM   698  O OG    . SER C 3 20  ? 30.788 8.994   24.646 1.00 32.23 ? 27  SER A OG    1 
ATOM   699  N N     . THR C 3 21  ? 32.273 10.719  27.212 1.00 37.60 ? 28  THR A N     1 
ATOM   700  C CA    . THR C 3 21  ? 32.022 10.714  28.637 1.00 38.53 ? 28  THR A CA    1 
ATOM   701  C C     . THR C 3 21  ? 30.574 10.963  29.022 1.00 38.23 ? 28  THR A C     1 
ATOM   702  O O     . THR C 3 21  ? 30.041 12.026  28.777 1.00 41.40 ? 28  THR A O     1 
ATOM   703  C CB    . THR C 3 21  ? 32.909 11.747  29.331 1.00 39.69 ? 28  THR A CB    1 
ATOM   704  O OG1   . THR C 3 21  ? 32.354 12.091  30.601 1.00 41.51 ? 28  THR A OG1   1 
ATOM   705  C CG2   . THR C 3 21  ? 33.005 12.975  28.507 1.00 46.34 ? 28  THR A CG2   1 
ATOM   706  N N     . LEU C 3 22  ? 29.963 9.973   29.658 1.00 36.01 ? 29  LEU A N     1 
ATOM   707  C CA    . LEU C 3 22  ? 28.587 10.031  30.098 1.00 33.95 ? 29  LEU A CA    1 
ATOM   708  C C     . LEU C 3 22  ? 28.371 10.792  31.376 1.00 37.40 ? 29  LEU A C     1 
ATOM   709  O O     . LEU C 3 22  ? 27.349 11.458  31.555 1.00 33.89 ? 29  LEU A O     1 
ATOM   710  C CB    . LEU C 3 22  ? 28.052 8.631   30.335 1.00 34.70 ? 29  LEU A CB    1 
ATOM   711  C CG    . LEU C 3 22  ? 27.590 7.805   29.154 1.00 36.49 ? 29  LEU A CG    1 
ATOM   712  C CD1   . LEU C 3 22  ? 28.775 7.095   28.451 1.00 29.61 ? 29  LEU A CD1   1 
ATOM   713  C CD2   . LEU C 3 22  ? 26.579 6.842   29.690 1.00 31.32 ? 29  LEU A CD2   1 
ATOM   714  N N     . ILE C 3 23  ? 29.311 10.665  32.296 1.00 40.04 ? 30  ILE A N     1 
ATOM   715  C CA    . ILE C 3 23  ? 29.148 11.340  33.565 1.00 42.39 ? 30  ILE A CA    1 
ATOM   716  C C     . ILE C 3 23  ? 30.366 12.114  33.979 1.00 43.71 ? 30  ILE A C     1 
ATOM   717  O O     . ILE C 3 23  ? 31.463 11.627  33.936 1.00 45.20 ? 30  ILE A O     1 
ATOM   718  C CB    . ILE C 3 23  ? 28.718 10.332  34.652 1.00 38.06 ? 30  ILE A CB    1 
ATOM   719  C CG1   . ILE C 3 23  ? 27.413 9.667   34.185 1.00 33.39 ? 30  ILE A CG1   1 
ATOM   720  C CG2   . ILE C 3 23  ? 28.493 11.044  36.002 1.00 39.53 ? 30  ILE A CG2   1 
ATOM   721  C CD1   . ILE C 3 23  ? 26.710 8.852   35.205 1.00 39.79 ? 30  ILE A CD1   1 
ATOM   722  N N     . HIS C 3 24  ? 30.144 13.351  34.382 1.00 49.68 ? 31  HIS A N     1 
ATOM   723  C CA    . HIS C 3 24  ? 31.219 14.241  34.777 1.00 52.61 ? 31  HIS A CA    1 
ATOM   724  C C     . HIS C 3 24  ? 31.337 14.262  36.286 1.00 53.95 ? 31  HIS A C     1 
ATOM   725  O O     . HIS C 3 24  ? 30.391 14.555  37.013 1.00 54.20 ? 31  HIS A O     1 
ATOM   726  C CB    . HIS C 3 24  ? 30.937 15.637  34.203 1.00 53.63 ? 31  HIS A CB    1 
ATOM   727  C CG    . HIS C 3 24  ? 30.818 15.648  32.706 1.00 54.93 ? 31  HIS A CG    1 
ATOM   728  N ND1   . HIS C 3 24  ? 31.914 15.693  31.872 1.00 54.69 ? 31  HIS A ND1   1 
ATOM   729  C CD2   . HIS C 3 24  ? 29.737 15.536  31.897 1.00 55.80 ? 31  HIS A CD2   1 
ATOM   730  C CE1   . HIS C 3 24  ? 31.516 15.607  30.615 1.00 54.99 ? 31  HIS A CE1   1 
ATOM   731  N NE2   . HIS C 3 24  ? 30.199 15.508  30.602 1.00 55.69 ? 31  HIS A NE2   1 
ATOM   732  N N     . GLN C 3 25  ? 32.522 13.938  36.757 1.00 54.67 ? 32  GLN A N     1 
ATOM   733  C CA    . GLN C 3 25  ? 32.744 13.885  38.177 1.00 54.79 ? 32  GLN A CA    1 
ATOM   734  C C     . GLN C 3 25  ? 32.499 15.211  38.853 1.00 55.58 ? 32  GLN A C     1 
ATOM   735  O O     . GLN C 3 25  ? 32.890 16.260  38.350 1.00 57.55 ? 32  GLN A O     1 
ATOM   736  C CB    . GLN C 3 25  ? 34.157 13.425  38.448 1.00 55.10 ? 32  GLN A CB    1 
ATOM   737  C CG    . GLN C 3 25  ? 34.253 12.410  39.538 1.00 59.89 ? 32  GLN A CG    1 
ATOM   738  C CD    . GLN C 3 25  ? 35.055 12.894  40.709 1.00 63.08 ? 32  GLN A CD    1 
ATOM   739  O OE1   . GLN C 3 25  ? 34.586 13.709  41.505 1.00 64.90 ? 32  GLN A OE1   1 
ATOM   740  N NE2   . GLN C 3 25  ? 36.288 12.405  40.818 1.00 66.97 ? 32  GLN A NE2   1 
ATOM   741  N N     . GLY C 3 26  ? 31.831 15.156  39.998 1.00 55.33 ? 33  GLY A N     1 
ATOM   742  C CA    . GLY C 3 26  ? 31.570 16.354  40.760 1.00 54.30 ? 33  GLY A CA    1 
ATOM   743  C C     . GLY C 3 26  ? 30.446 17.218  40.266 1.00 56.07 ? 33  GLY A C     1 
ATOM   744  O O     . GLY C 3 26  ? 30.098 18.176  40.932 1.00 56.42 ? 33  GLY A O     1 
ATOM   745  N N     . GLU C 3 27  ? 29.884 16.904  39.105 1.00 57.34 ? 34  GLU A N     1 
ATOM   746  C CA    . GLU C 3 27  ? 28.775 17.683  38.574 1.00 58.31 ? 34  GLU A CA    1 
ATOM   747  C C     . GLU C 3 27  ? 27.579 17.380  39.477 1.00 60.32 ? 34  GLU A C     1 
ATOM   748  O O     . GLU C 3 27  ? 27.603 16.407  40.225 1.00 65.37 ? 34  GLU A O     1 
ATOM   749  C CB    . GLU C 3 27  ? 28.470 17.238  37.149 1.00 62.03 ? 34  GLU A CB    1 
ATOM   750  C CG    . GLU C 3 27  ? 28.310 18.363  36.147 1.00 71.63 ? 34  GLU A CG    1 
ATOM   751  C CD    . GLU C 3 27  ? 29.639 18.934  35.672 1.00 76.28 ? 34  GLU A CD    1 
ATOM   752  O OE1   . GLU C 3 27  ? 30.380 19.513  36.497 1.00 77.92 ? 34  GLU A OE1   1 
ATOM   753  O OE2   . GLU C 3 27  ? 29.941 18.798  34.464 1.00 79.72 ? 34  GLU A OE2   1 
ATOM   754  N N     . LYS C 3 28  ? 26.541 18.207  39.432 1.00 59.81 ? 35  LYS A N     1 
ATOM   755  C CA    . LYS C 3 28  ? 25.365 17.965  40.254 1.00 58.77 ? 35  LYS A CA    1 
ATOM   756  C C     . LYS C 3 28  ? 24.693 16.746  39.645 1.00 58.12 ? 35  LYS A C     1 
ATOM   757  O O     . LYS C 3 28  ? 24.736 16.568  38.438 1.00 59.99 ? 35  LYS A O     1 
ATOM   758  C CB    . LYS C 3 28  ? 24.443 19.178  40.208 1.00 63.09 ? 35  LYS A CB    1 
ATOM   759  C CG    . LYS C 3 28  ? 23.249 19.133  41.168 1.00 73.83 ? 35  LYS A CG    1 
ATOM   760  C CD    . LYS C 3 28  ? 22.463 20.472  41.161 1.00 78.27 ? 35  LYS A CD    1 
ATOM   761  C CE    . LYS C 3 28  ? 21.099 20.343  41.850 1.00 83.22 ? 35  LYS A CE    1 
ATOM   762  N NZ    . LYS C 3 28  ? 21.170 19.680  43.189 1.00 83.84 ? 35  LYS A NZ    1 
ATOM   763  N N     . ALA C 3 29  ? 24.095 15.891  40.469 1.00 56.76 ? 36  ALA A N     1 
ATOM   764  C CA    . ALA C 3 29  ? 23.450 14.681  39.956 1.00 55.44 ? 36  ALA A CA    1 
ATOM   765  C C     . ALA C 3 29  ? 21.931 14.743  39.977 1.00 52.95 ? 36  ALA A C     1 
ATOM   766  O O     . ALA C 3 29  ? 21.310 15.032  41.000 1.00 52.90 ? 36  ALA A O     1 
ATOM   767  C CB    . ALA C 3 29  ? 23.934 13.465  40.730 1.00 55.11 ? 36  ALA A CB    1 
ATOM   768  N N     . GLU C 3 30  ? 21.329 14.444  38.840 1.00 52.30 ? 37  GLU A N     1 
ATOM   769  C CA    . GLU C 3 30  ? 19.890 14.504  38.734 1.00 52.27 ? 37  GLU A CA    1 
ATOM   770  C C     . GLU C 3 30  ? 19.365 13.440  37.811 1.00 50.02 ? 37  GLU A C     1 
ATOM   771  O O     . GLU C 3 30  ? 18.167 13.251  37.678 1.00 50.25 ? 37  GLU A O     1 
ATOM   772  C CB    . GLU C 3 30  ? 19.493 15.889  38.238 1.00 57.93 ? 37  GLU A CB    1 
ATOM   773  C CG    . GLU C 3 30  ? 19.782 16.974  39.268 1.00 68.03 ? 37  GLU A CG    1 
ATOM   774  C CD    . GLU C 3 30  ? 19.915 18.371  38.683 1.00 74.03 ? 37  GLU A CD    1 
ATOM   775  O OE1   . GLU C 3 30  ? 20.090 19.318  39.484 1.00 77.78 ? 37  GLU A OE1   1 
ATOM   776  O OE2   . GLU C 3 30  ? 19.855 18.531  37.442 1.00 77.09 ? 37  GLU A OE2   1 
ATOM   777  N N     . THR C 3 31  ? 20.266 12.711  37.184 1.00 50.25 ? 38  THR A N     1 
ATOM   778  C CA    . THR C 3 31  ? 19.832 11.682  36.266 1.00 49.15 ? 38  THR A CA    1 
ATOM   779  C C     . THR C 3 31  ? 20.349 10.315  36.644 1.00 48.53 ? 38  THR A C     1 
ATOM   780  O O     . THR C 3 31  ? 21.356 10.192  37.317 1.00 50.78 ? 38  THR A O     1 
ATOM   781  C CB    . THR C 3 31  ? 20.294 12.016  34.861 1.00 48.35 ? 38  THR A CB    1 
ATOM   782  O OG1   . THR C 3 31  ? 19.886 13.350  34.560 1.00 49.50 ? 38  THR A OG1   1 
ATOM   783  C CG2   . THR C 3 31  ? 19.698 11.049  33.847 1.00 48.36 ? 38  THR A CG2   1 
ATOM   784  N N     . LEU C 3 32  ? 19.647 9.290   36.195 1.00 43.80 ? 39  LEU A N     1 
ATOM   785  C CA    . LEU C 3 32  ? 20.036 7.938   36.467 1.00 43.43 ? 39  LEU A CA    1 
ATOM   786  C C     . LEU C 3 32  ? 20.186 7.280   35.112 1.00 46.19 ? 39  LEU A C     1 
ATOM   787  O O     . LEU C 3 32  ? 19.369 7.486   34.237 1.00 49.84 ? 39  LEU A O     1 
ATOM   788  C CB    . LEU C 3 32  ? 18.945 7.260   37.274 1.00 43.71 ? 39  LEU A CB    1 
ATOM   789  C CG    . LEU C 3 32  ? 19.165 5.794   37.609 1.00 43.96 ? 39  LEU A CG    1 
ATOM   790  C CD1   . LEU C 3 32  ? 20.082 5.664   38.808 1.00 38.04 ? 39  LEU A CD1   1 
ATOM   791  C CD2   . LEU C 3 32  ? 17.819 5.169   37.877 1.00 42.81 ? 39  LEU A CD2   1 
ATOM   792  N N     . TYR C 3 33  ? 21.228 6.493   34.923 1.00 46.90 ? 40  TYR A N     1 
ATOM   793  C CA    . TYR C 3 33  ? 21.439 5.849   33.638 1.00 48.49 ? 40  TYR A CA    1 
ATOM   794  C C     . TYR C 3 33  ? 21.217 4.335   33.758 1.00 52.30 ? 40  TYR A C     1 
ATOM   795  O O     . TYR C 3 33  ? 21.297 3.773   34.845 1.00 56.42 ? 40  TYR A O     1 
ATOM   796  C CB    . TYR C 3 33  ? 22.879 6.113   33.148 1.00 47.61 ? 40  TYR A CB    1 
ATOM   797  C CG    . TYR C 3 33  ? 23.230 7.575   32.949 1.00 48.46 ? 40  TYR A CG    1 
ATOM   798  C CD1   . TYR C 3 33  ? 23.333 8.448   34.039 1.00 45.70 ? 40  TYR A CD1   1 
ATOM   799  C CD2   . TYR C 3 33  ? 23.350 8.113   31.651 1.00 47.46 ? 40  TYR A CD2   1 
ATOM   800  C CE1   . TYR C 3 33  ? 23.524 9.817   33.844 1.00 47.45 ? 40  TYR A CE1   1 
ATOM   801  C CE2   . TYR C 3 33  ? 23.538 9.463   31.444 1.00 41.12 ? 40  TYR A CE2   1 
ATOM   802  C CZ    . TYR C 3 33  ? 23.617 10.318  32.537 1.00 47.89 ? 40  TYR A CZ    1 
ATOM   803  O OH    . TYR C 3 33  ? 23.737 11.677  32.324 1.00 49.21 ? 40  TYR A OH    1 
ATOM   804  N N     . TYR C 3 34  ? 20.919 3.687   32.636 1.00 50.47 ? 41  TYR A N     1 
ATOM   805  C CA    . TYR C 3 34  ? 20.751 2.249   32.588 1.00 47.97 ? 41  TYR A CA    1 
ATOM   806  C C     . TYR C 3 34  ? 21.424 1.873   31.292 1.00 47.18 ? 41  TYR A C     1 
ATOM   807  O O     . TYR C 3 34  ? 21.078 2.399   30.253 1.00 49.53 ? 41  TYR A O     1 
ATOM   808  C CB    . TYR C 3 34  ? 19.279 1.846   32.538 1.00 53.90 ? 41  TYR A CB    1 
ATOM   809  C CG    . TYR C 3 34  ? 19.095 0.329   32.502 1.00 63.39 ? 41  TYR A CG    1 
ATOM   810  C CD1   . TYR C 3 34  ? 19.070 -0.373  31.296 1.00 63.17 ? 41  TYR A CD1   1 
ATOM   811  C CD2   . TYR C 3 34  ? 18.991 -0.410  33.686 1.00 66.17 ? 41  TYR A CD2   1 
ATOM   812  C CE1   . TYR C 3 34  ? 18.945 -1.759  31.278 1.00 66.57 ? 41  TYR A CE1   1 
ATOM   813  C CE2   . TYR C 3 34  ? 18.866 -1.793  33.668 1.00 63.83 ? 41  TYR A CE2   1 
ATOM   814  C CZ    . TYR C 3 34  ? 18.842 -2.454  32.468 1.00 66.98 ? 41  TYR A CZ    1 
ATOM   815  O OH    . TYR C 3 34  ? 18.704 -3.819  32.465 1.00 74.28 ? 41  TYR A OH    1 
ATOM   816  N N     . ILE C 3 35  ? 22.399 0.980   31.325 1.00 45.40 ? 42  ILE A N     1 
ATOM   817  C CA    . ILE C 3 35  ? 23.057 0.647   30.087 1.00 44.67 ? 42  ILE A CA    1 
ATOM   818  C C     . ILE C 3 35  ? 22.289 -0.452  29.382 1.00 51.65 ? 42  ILE A C     1 
ATOM   819  O O     . ILE C 3 35  ? 22.193 -1.579  29.871 1.00 54.33 ? 42  ILE A O     1 
ATOM   820  C CB    . ILE C 3 35  ? 24.488 0.185   30.305 1.00 40.42 ? 42  ILE A CB    1 
ATOM   821  C CG1   . ILE C 3 35  ? 25.170 1.063   31.349 1.00 36.67 ? 42  ILE A CG1   1 
ATOM   822  C CG2   . ILE C 3 35  ? 25.241 0.247   28.995 1.00 35.20 ? 42  ILE A CG2   1 
ATOM   823  C CD1   . ILE C 3 35  ? 26.642 0.733   31.594 1.00 31.32 ? 42  ILE A CD1   1 
ATOM   824  N N     . VAL C 3 36  ? 21.746 -0.094  28.222 1.00 52.81 ? 43  VAL A N     1 
ATOM   825  C CA    . VAL C 3 36  ? 20.967 -0.972  27.368 1.00 48.98 ? 43  VAL A CA    1 
ATOM   826  C C     . VAL C 3 36  ? 21.895 -1.784  26.488 1.00 50.46 ? 43  VAL A C     1 
ATOM   827  O O     . VAL C 3 36  ? 21.543 -2.870  26.053 1.00 53.98 ? 43  VAL A O     1 
ATOM   828  C CB    . VAL C 3 36  ? 20.025 -0.129  26.515 1.00 47.16 ? 43  VAL A CB    1 
ATOM   829  C CG1   . VAL C 3 36  ? 19.323 -0.965  25.496 1.00 41.33 ? 43  VAL A CG1   1 
ATOM   830  C CG2   . VAL C 3 36  ? 19.038 0.569   27.437 1.00 45.37 ? 43  VAL A CG2   1 
ATOM   831  N N     . LYS C 3 37  ? 23.081 -1.250  26.225 1.00 50.84 ? 44  LYS A N     1 
ATOM   832  C CA    . LYS C 3 37  ? 24.094 -1.941  25.417 1.00 50.25 ? 44  LYS A CA    1 
ATOM   833  C C     . LYS C 3 37  ? 25.400 -1.153  25.380 1.00 47.50 ? 44  LYS A C     1 
ATOM   834  O O     . LYS C 3 37  ? 25.400 0.081   25.360 1.00 42.83 ? 44  LYS A O     1 
ATOM   835  C CB    . LYS C 3 37  ? 23.624 -2.168  23.978 1.00 52.15 ? 44  LYS A CB    1 
ATOM   836  C CG    . LYS C 3 37  ? 24.692 -2.863  23.171 1.00 56.95 ? 44  LYS A CG    1 
ATOM   837  C CD    . LYS C 3 37  ? 24.390 -2.968  21.692 1.00 63.54 ? 44  LYS A CD    1 
ATOM   838  C CE    . LYS C 3 37  ? 24.946 -4.295  21.123 1.00 65.56 ? 44  LYS A CE    1 
ATOM   839  N NZ    . LYS C 3 37  ? 26.327 -4.650  21.602 1.00 65.72 ? 44  LYS A NZ    1 
ATOM   840  N N     . GLY C 3 38  ? 26.513 -1.870  25.352 1.00 44.34 ? 45  GLY A N     1 
ATOM   841  C CA    . GLY C 3 38  ? 27.804 -1.206  25.348 1.00 47.47 ? 45  GLY A CA    1 
ATOM   842  C C     . GLY C 3 38  ? 28.517 -1.325  26.693 1.00 50.07 ? 45  GLY A C     1 
ATOM   843  O O     . GLY C 3 38  ? 28.016 -1.923  27.646 1.00 49.47 ? 45  GLY A O     1 
ATOM   844  N N     . SER C 3 39  ? 29.699 -0.739  26.788 1.00 53.54 ? 46  SER A N     1 
ATOM   845  C CA    . SER C 3 39  ? 30.452 -0.826  28.033 1.00 53.77 ? 46  SER A CA    1 
ATOM   846  C C     . SER C 3 39  ? 31.094 0.485   28.440 1.00 49.18 ? 46  SER A C     1 
ATOM   847  O O     . SER C 3 39  ? 31.549 1.252   27.599 1.00 49.95 ? 46  SER A O     1 
ATOM   848  C CB    . SER C 3 39  ? 31.484 -1.939  27.915 1.00 53.49 ? 46  SER A CB    1 
ATOM   849  O OG    . SER C 3 39  ? 30.780 -3.137  27.663 1.00 57.64 ? 46  SER A OG    1 
ATOM   850  N N     . VAL C 3 40  ? 31.090 0.734   29.744 1.00 43.60 ? 47  VAL A N     1 
ATOM   851  C CA    . VAL C 3 40  ? 31.637 1.952   30.303 1.00 43.47 ? 47  VAL A CA    1 
ATOM   852  C C     . VAL C 3 40  ? 32.644 1.671   31.401 1.00 47.00 ? 47  VAL A C     1 
ATOM   853  O O     . VAL C 3 40  ? 32.715 0.566   31.930 1.00 50.36 ? 47  VAL A O     1 
ATOM   854  C CB    . VAL C 3 40  ? 30.543 2.818   30.916 1.00 37.31 ? 47  VAL A CB    1 
ATOM   855  C CG1   . VAL C 3 40  ? 29.293 2.729   30.079 1.00 36.45 ? 47  VAL A CG1   1 
ATOM   856  C CG2   . VAL C 3 40  ? 30.287 2.386   32.345 1.00 30.85 ? 47  VAL A CG2   1 
ATOM   857  N N     . ALA C 3 41  ? 33.421 2.691   31.741 1.00 46.77 ? 48  ALA A N     1 
ATOM   858  C CA    . ALA C 3 41  ? 34.402 2.571   32.800 1.00 43.12 ? 48  ALA A CA    1 
ATOM   859  C C     . ALA C 3 41  ? 34.163 3.686   33.792 1.00 43.51 ? 48  ALA A C     1 
ATOM   860  O O     . ALA C 3 41  ? 34.072 4.861   33.434 1.00 42.60 ? 48  ALA A O     1 
ATOM   861  C CB    . ALA C 3 41  ? 35.812 2.661   32.246 1.00 42.52 ? 48  ALA A CB    1 
ATOM   862  N N     . VAL C 3 42  ? 34.012 3.296   35.043 1.00 41.77 ? 49  VAL A N     1 
ATOM   863  C CA    . VAL C 3 42  ? 33.836 4.249   36.112 1.00 38.08 ? 49  VAL A CA    1 
ATOM   864  C C     . VAL C 3 42  ? 35.259 4.562   36.507 1.00 38.54 ? 49  VAL A C     1 
ATOM   865  O O     . VAL C 3 42  ? 36.026 3.655   36.755 1.00 40.82 ? 49  VAL A O     1 
ATOM   866  C CB    . VAL C 3 42  ? 33.139 3.596   37.292 1.00 39.44 ? 49  VAL A CB    1 
ATOM   867  C CG1   . VAL C 3 42  ? 33.055 4.563   38.455 1.00 34.01 ? 49  VAL A CG1   1 
ATOM   868  C CG2   . VAL C 3 42  ? 31.767 3.109   36.856 1.00 40.17 ? 49  VAL A CG2   1 
ATOM   869  N N     . LEU C 3 43  ? 35.652 5.818   36.551 1.00 37.88 ? 50  LEU A N     1 
ATOM   870  C CA    . LEU C 3 43  ? 37.019 6.060   36.946 1.00 40.99 ? 50  LEU A CA    1 
ATOM   871  C C     . LEU C 3 43  ? 37.183 7.289   37.828 1.00 41.38 ? 50  LEU A C     1 
ATOM   872  O O     . LEU C 3 43  ? 36.372 8.201   37.758 1.00 38.85 ? 50  LEU A O     1 
ATOM   873  C CB    . LEU C 3 43  ? 37.900 6.135   35.688 1.00 44.19 ? 50  LEU A CB    1 
ATOM   874  C CG    . LEU C 3 43  ? 37.508 7.095   34.561 1.00 45.76 ? 50  LEU A CG    1 
ATOM   875  C CD1   . LEU C 3 43  ? 38.525 8.205   34.524 1.00 50.57 ? 50  LEU A CD1   1 
ATOM   876  C CD2   . LEU C 3 43  ? 37.463 6.401   33.230 1.00 39.08 ? 50  LEU A CD2   1 
ATOM   877  N N     . ILE C 3 44  ? 38.204 7.273   38.691 1.00 42.14 ? 51  ILE A N     1 
ATOM   878  C CA    . ILE C 3 44  ? 38.524 8.410   39.570 1.00 45.78 ? 51  ILE A CA    1 
ATOM   879  C C     . ILE C 3 44  ? 39.911 8.913   39.217 1.00 46.29 ? 51  ILE A C     1 
ATOM   880  O O     . ILE C 3 44  ? 40.686 8.177   38.633 1.00 45.71 ? 51  ILE A O     1 
ATOM   881  C CB    . ILE C 3 44  ? 38.511 8.048   41.061 1.00 41.73 ? 51  ILE A CB    1 
ATOM   882  C CG1   . ILE C 3 44  ? 39.161 6.686   41.282 1.00 42.54 ? 51  ILE A CG1   1 
ATOM   883  C CG2   . ILE C 3 44  ? 37.096 8.076   41.576 1.00 46.78 ? 51  ILE A CG2   1 
ATOM   884  C CD1   . ILE C 3 44  ? 39.498 6.388   42.724 1.00 37.72 ? 51  ILE A CD1   1 
ATOM   885  N N     . LYS C 3 45  ? 40.229 10.158  39.558 1.00 49.65 ? 52  LYS A N     1 
ATOM   886  C CA    . LYS C 3 45  ? 41.541 10.698  39.206 1.00 56.63 ? 52  LYS A CA    1 
ATOM   887  C C     . LYS C 3 45  ? 42.256 11.328  40.374 1.00 60.78 ? 52  LYS A C     1 
ATOM   888  O O     . LYS C 3 45  ? 41.656 11.569  41.409 1.00 66.53 ? 52  LYS A O     1 
ATOM   889  C CB    . LYS C 3 45  ? 41.420 11.778  38.132 1.00 56.64 ? 52  LYS A CB    1 
ATOM   890  C CG    . LYS C 3 45  ? 40.803 11.374  36.822 1.00 54.17 ? 52  LYS A CG    1 
ATOM   891  C CD    . LYS C 3 45  ? 40.643 12.603  35.955 1.00 51.12 ? 52  LYS A CD    1 
ATOM   892  C CE    . LYS C 3 45  ? 39.917 12.278  34.664 1.00 57.79 ? 52  LYS A CE    1 
ATOM   893  N NZ    . LYS C 3 45  ? 39.823 13.475  33.798 1.00 60.48 ? 52  LYS A NZ    1 
ATOM   894  N N     . ASP C 3 46  ? 43.544 11.601  40.203 1.00 64.30 ? 53  ASP A N     1 
ATOM   895  C CA    . ASP C 3 46  ? 44.304 12.257  41.254 1.00 67.35 ? 53  ASP A CA    1 
ATOM   896  C C     . ASP C 3 46  ? 44.668 13.623  40.706 1.00 67.79 ? 53  ASP A C     1 
ATOM   897  O O     . ASP C 3 46  ? 44.496 13.870  39.511 1.00 66.57 ? 53  ASP A O     1 
ATOM   898  C CB    . ASP C 3 46  ? 45.560 11.457  41.640 1.00 69.79 ? 53  ASP A CB    1 
ATOM   899  C CG    . ASP C 3 46  ? 46.617 11.444  40.558 1.00 73.13 ? 53  ASP A CG    1 
ATOM   900  O OD1   . ASP C 3 46  ? 47.666 10.803  40.776 1.00 73.58 ? 53  ASP A OD1   1 
ATOM   901  O OD2   . ASP C 3 46  ? 46.412 12.065  39.501 1.00 75.02 ? 53  ASP A OD2   1 
ATOM   902  N N     . GLU C 3 47  ? 45.139 14.510  41.580 1.00 69.85 ? 54  GLU A N     1 
ATOM   903  C CA    . GLU C 3 47  ? 45.511 15.866  41.197 1.00 71.50 ? 54  GLU A CA    1 
ATOM   904  C C     . GLU C 3 47  ? 46.306 15.908  39.879 1.00 73.19 ? 54  GLU A C     1 
ATOM   905  O O     . GLU C 3 47  ? 45.965 16.648  38.949 1.00 73.57 ? 54  GLU A O     1 
ATOM   906  C CB    . GLU C 3 47  ? 46.285 16.520  42.343 1.00 71.30 ? 54  GLU A CB    1 
ATOM   907  C CG    . GLU C 3 47  ? 47.512 15.761  42.858 1.00 79.06 ? 54  GLU A CG    1 
ATOM   908  C CD    . GLU C 3 47  ? 47.218 14.345  43.383 1.00 84.54 ? 54  GLU A CD    1 
ATOM   909  O OE1   . GLU C 3 47  ? 46.179 14.119  44.056 1.00 84.54 ? 54  GLU A OE1   1 
ATOM   910  O OE2   . GLU C 3 47  ? 48.058 13.448  43.136 1.00 84.54 ? 54  GLU A OE2   1 
ATOM   911  N N     . GLU C 3 48  ? 47.351 15.095  39.793 1.00 71.90 ? 55  GLU A N     1 
ATOM   912  C CA    . GLU C 3 48  ? 48.157 15.021  38.589 1.00 70.06 ? 55  GLU A CA    1 
ATOM   913  C C     . GLU C 3 48  ? 47.276 14.702  37.386 1.00 68.36 ? 55  GLU A C     1 
ATOM   914  O O     . GLU C 3 48  ? 47.648 14.974  36.251 1.00 69.53 ? 55  GLU A O     1 
ATOM   915  C CB    . GLU C 3 48  ? 49.212 13.920  38.736 1.00 74.55 ? 55  GLU A CB    1 
ATOM   916  C CG    . GLU C 3 48  ? 50.611 14.401  39.100 1.00 80.09 ? 55  GLU A CG    1 
ATOM   917  C CD    . GLU C 3 48  ? 50.630 15.248  40.358 1.00 84.54 ? 55  GLU A CD    1 
ATOM   918  O OE1   . GLU C 3 48  ? 50.290 14.725  41.447 1.00 84.54 ? 55  GLU A OE1   1 
ATOM   919  O OE2   . GLU C 3 48  ? 50.984 16.443  40.252 1.00 84.54 ? 55  GLU A OE2   1 
ATOM   920  N N     . GLY C 3 49  ? 46.109 14.120  37.637 1.00 66.11 ? 56  GLY A N     1 
ATOM   921  C CA    . GLY C 3 49  ? 45.222 13.746  36.551 1.00 61.51 ? 56  GLY A CA    1 
ATOM   922  C C     . GLY C 3 49  ? 45.329 12.262  36.213 1.00 61.04 ? 56  GLY A C     1 
ATOM   923  O O     . GLY C 3 49  ? 44.691 11.777  35.272 1.00 59.80 ? 56  GLY A O     1 
ATOM   924  N N     . LYS C 3 50  ? 46.151 11.533  36.966 1.00 59.65 ? 57  LYS A N     1 
ATOM   925  C CA    . LYS C 3 50  ? 46.305 10.102  36.748 1.00 58.47 ? 57  LYS A CA    1 
ATOM   926  C C     . LYS C 3 50  ? 44.982 9.418   37.077 1.00 58.24 ? 57  LYS A C     1 
ATOM   927  O O     . LYS C 3 50  ? 44.304 9.762   38.052 1.00 53.74 ? 57  LYS A O     1 
ATOM   928  C CB    . LYS C 3 50  ? 47.433 9.531   37.619 1.00 57.62 ? 57  LYS A CB    1 
ATOM   929  C CG    . LYS C 3 50  ? 48.832 9.750   37.043 1.00 57.23 ? 57  LYS A CG    1 
ATOM   930  C CD    . LYS C 3 50  ? 49.894 8.975   37.806 1.00 63.12 ? 57  LYS A CD    1 
ATOM   931  C CE    . LYS C 3 50  ? 49.981 9.423   39.261 1.00 68.76 ? 57  LYS A CE    1 
ATOM   932  N NZ    . LYS C 3 50  ? 51.023 8.677   40.025 1.00 70.05 ? 57  LYS A NZ    1 
ATOM   933  N N     . GLU C 3 51  ? 44.623 8.437   36.262 1.00 56.49 ? 58  GLU A N     1 
ATOM   934  C CA    . GLU C 3 51  ? 43.367 7.746   36.439 1.00 56.45 ? 58  GLU A CA    1 
ATOM   935  C C     . GLU C 3 51  ? 43.424 6.426   37.173 1.00 55.49 ? 58  GLU A C     1 
ATOM   936  O O     . GLU C 3 51  ? 44.479 5.821   37.290 1.00 57.02 ? 58  GLU A O     1 
ATOM   937  C CB    . GLU C 3 51  ? 42.720 7.562   35.079 1.00 58.10 ? 58  GLU A CB    1 
ATOM   938  C CG    . GLU C 3 51  ? 42.190 8.858   34.515 1.00 56.28 ? 58  GLU A CG    1 
ATOM   939  C CD    . GLU C 3 51  ? 41.831 8.739   33.063 1.00 54.12 ? 58  GLU A CD    1 
ATOM   940  O OE1   . GLU C 3 51  ? 41.609 7.597   32.621 1.00 54.09 ? 58  GLU A OE1   1 
ATOM   941  O OE2   . GLU C 3 51  ? 41.768 9.780   32.377 1.00 52.98 ? 58  GLU A OE2   1 
ATOM   942  N N     . MET C 3 52  ? 42.258 6.002   37.660 1.00 53.26 ? 59  MET A N     1 
ATOM   943  C CA    . MET C 3 52  ? 42.093 4.770   38.413 1.00 53.23 ? 59  MET A CA    1 
ATOM   944  C C     . MET C 3 52  ? 40.714 4.171   38.123 1.00 53.22 ? 59  MET A C     1 
ATOM   945  O O     . MET C 3 52  ? 39.697 4.689   38.574 1.00 56.06 ? 59  MET A O     1 
ATOM   946  C CB    . MET C 3 52  ? 42.214 5.084   39.893 1.00 53.88 ? 59  MET A CB    1 
ATOM   947  C CG    . MET C 3 52  ? 43.193 4.212   40.670 1.00 60.29 ? 59  MET A CG    1 
ATOM   948  S SD    . MET C 3 52  ? 42.638 2.565   41.048 1.00 57.84 ? 59  MET A SD    1 
ATOM   949  C CE    . MET C 3 52  ? 44.040 1.646   40.685 1.00 56.50 ? 59  MET A CE    1 
ATOM   950  N N     . ILE C 3 53  ? 40.684 3.075   37.375 1.00 50.15 ? 60  ILE A N     1 
ATOM   951  C CA    . ILE C 3 53  ? 39.428 2.429   37.012 1.00 46.58 ? 60  ILE A CA    1 
ATOM   952  C C     . ILE C 3 53  ? 38.855 1.663   38.196 1.00 45.48 ? 60  ILE A C     1 
ATOM   953  O O     . ILE C 3 53  ? 39.415 0.670   38.641 1.00 47.71 ? 60  ILE A O     1 
ATOM   954  C CB    . ILE C 3 53  ? 39.630 1.484   35.768 1.00 46.98 ? 60  ILE A CB    1 
ATOM   955  C CG1   . ILE C 3 53  ? 40.203 2.290   34.599 1.00 41.68 ? 60  ILE A CG1   1 
ATOM   956  C CG2   . ILE C 3 53  ? 38.301 0.890   35.311 1.00 48.29 ? 60  ILE A CG2   1 
ATOM   957  C CD1   . ILE C 3 53  ? 40.492 1.503   33.358 1.00 44.88 ? 60  ILE A CD1   1 
ATOM   958  N N     . LEU C 3 54  ? 37.736 2.161   38.706 1.00 46.45 ? 61  LEU A N     1 
ATOM   959  C CA    . LEU C 3 54  ? 37.026 1.587   39.856 1.00 43.93 ? 61  LEU A CA    1 
ATOM   960  C C     . LEU C 3 54  ? 36.204 0.397   39.439 1.00 41.99 ? 61  LEU A C     1 
ATOM   961  O O     . LEU C 3 54  ? 35.819 -0.441  40.264 1.00 36.82 ? 61  LEU A O     1 
ATOM   962  C CB    . LEU C 3 54  ? 36.047 2.608   40.453 1.00 44.48 ? 61  LEU A CB    1 
ATOM   963  C CG    . LEU C 3 54  ? 36.520 3.642   41.466 1.00 49.43 ? 61  LEU A CG    1 
ATOM   964  C CD1   . LEU C 3 54  ? 35.355 4.516   41.842 1.00 48.55 ? 61  LEU A CD1   1 
ATOM   965  C CD2   . LEU C 3 54  ? 37.082 2.954   42.706 1.00 53.73 ? 61  LEU A CD2   1 
ATOM   966  N N     . SER C 3 55  ? 35.912 0.334   38.150 1.00 40.65 ? 62  SER A N     1 
ATOM   967  C CA    . SER C 3 55  ? 35.073 -0.733  37.677 1.00 43.72 ? 62  SER A CA    1 
ATOM   968  C C     . SER C 3 55  ? 34.658 -0.540  36.242 1.00 42.29 ? 62  SER A C     1 
ATOM   969  O O     . SER C 3 55  ? 34.861 0.517   35.658 1.00 45.20 ? 62  SER A O     1 
ATOM   970  C CB    . SER C 3 55  ? 33.823 -0.796  38.572 1.00 43.77 ? 62  SER A CB    1 
ATOM   971  O OG    . SER C 3 55  ? 32.711 -1.364  37.905 1.00 48.15 ? 62  SER A OG    1 
ATOM   972  N N     . TYR C 3 56  ? 34.107 -1.604  35.677 1.00 40.14 ? 63  TYR A N     1 
ATOM   973  C CA    . TYR C 3 56  ? 33.565 -1.585  34.338 1.00 39.91 ? 63  TYR A CA    1 
ATOM   974  C C     . TYR C 3 56  ? 32.068 -1.828  34.585 1.00 43.16 ? 63  TYR A C     1 
ATOM   975  O O     . TYR C 3 56  ? 31.677 -2.201  35.695 1.00 41.37 ? 63  TYR A O     1 
ATOM   976  C CB    . TYR C 3 56  ? 34.158 -2.712  33.489 1.00 32.99 ? 63  TYR A CB    1 
ATOM   977  C CG    . TYR C 3 56  ? 35.537 -2.421  32.969 1.00 35.87 ? 63  TYR A CG    1 
ATOM   978  C CD1   . TYR C 3 56  ? 35.863 -1.163  32.468 1.00 38.86 ? 63  TYR A CD1   1 
ATOM   979  C CD2   . TYR C 3 56  ? 36.545 -3.386  33.010 1.00 39.59 ? 63  TYR A CD2   1 
ATOM   980  C CE1   . TYR C 3 56  ? 37.181 -0.873  32.031 1.00 43.30 ? 63  TYR A CE1   1 
ATOM   981  C CE2   . TYR C 3 56  ? 37.858 -3.101  32.572 1.00 37.75 ? 63  TYR A CE2   1 
ATOM   982  C CZ    . TYR C 3 56  ? 38.163 -1.846  32.094 1.00 38.33 ? 63  TYR A CZ    1 
ATOM   983  O OH    . TYR C 3 56  ? 39.445 -1.539  31.721 1.00 32.75 ? 63  TYR A OH    1 
ATOM   984  N N     . LEU C 3 57  ? 31.225 -1.565  33.593 1.00 43.30 ? 64  LEU A N     1 
ATOM   985  C CA    . LEU C 3 57  ? 29.801 -1.839  33.738 1.00 44.67 ? 64  LEU A CA    1 
ATOM   986  C C     . LEU C 3 57  ? 29.294 -2.175  32.349 1.00 46.67 ? 64  LEU A C     1 
ATOM   987  O O     . LEU C 3 57  ? 29.859 -1.694  31.369 1.00 46.68 ? 64  LEU A O     1 
ATOM   988  C CB    . LEU C 3 57  ? 29.058 -0.657  34.360 1.00 40.65 ? 64  LEU A CB    1 
ATOM   989  C CG    . LEU C 3 57  ? 29.375 -0.376  35.844 1.00 41.16 ? 64  LEU A CG    1 
ATOM   990  C CD1   . LEU C 3 57  ? 28.482 0.746   36.367 1.00 41.88 ? 64  LEU A CD1   1 
ATOM   991  C CD2   . LEU C 3 57  ? 29.155 -1.610  36.668 1.00 31.61 ? 64  LEU A CD2   1 
ATOM   992  N N     . ASN C 3 58  ? 28.263 -3.023  32.260 1.00 45.65 ? 65  ASN A N     1 
ATOM   993  C CA    . ASN C 3 58  ? 27.748 -3.449  30.966 1.00 47.77 ? 65  ASN A CA    1 
ATOM   994  C C     . ASN C 3 58  ? 26.248 -3.526  30.840 1.00 47.22 ? 65  ASN A C     1 
ATOM   995  O O     . ASN C 3 58  ? 25.523 -3.055  31.714 1.00 46.52 ? 65  ASN A O     1 
ATOM   996  C CB    . ASN C 3 58  ? 28.318 -4.807  30.649 1.00 55.28 ? 65  ASN A CB    1 
ATOM   997  C CG    . ASN C 3 58  ? 29.709 -4.949  31.141 1.00 55.88 ? 65  ASN A CG    1 
ATOM   998  O OD1   . ASN C 3 58  ? 30.657 -4.484  30.500 1.00 60.45 ? 65  ASN A OD1   1 
ATOM   999  N ND2   . ASN C 3 58  ? 29.856 -5.561  32.309 1.00 52.10 ? 65  ASN A ND2   1 
ATOM   1000 N N     . GLN C 3 59  ? 25.787 -4.127  29.739 1.00 46.97 ? 66  GLN A N     1 
ATOM   1001 C CA    . GLN C 3 59  ? 24.358 -4.267  29.508 1.00 50.35 ? 66  GLN A CA    1 
ATOM   1002 C C     . GLN C 3 59  ? 23.810 -4.638  30.866 1.00 48.10 ? 66  GLN A C     1 
ATOM   1003 O O     . GLN C 3 59  ? 24.437 -5.382  31.615 1.00 52.50 ? 66  GLN A O     1 
ATOM   1004 C CB    . GLN C 3 59  ? 24.021 -5.415  28.530 1.00 57.21 ? 66  GLN A CB    1 
ATOM   1005 C CG    . GLN C 3 59  ? 24.230 -5.182  27.007 1.00 67.06 ? 66  GLN A CG    1 
ATOM   1006 C CD    . GLN C 3 59  ? 25.704 -5.121  26.592 1.00 67.59 ? 66  GLN A CD    1 
ATOM   1007 O OE1   . GLN C 3 59  ? 26.041 -5.135  25.388 1.00 61.60 ? 66  GLN A OE1   1 
ATOM   1008 N NE2   . GLN C 3 59  ? 26.592 -5.053  27.591 1.00 65.34 ? 66  GLN A NE2   1 
ATOM   1009 N N     . GLY C 3 60  ? 22.666 -4.093  31.212 1.00 43.24 ? 67  GLY A N     1 
ATOM   1010 C CA    . GLY C 3 60  ? 22.093 -4.460  32.470 1.00 39.24 ? 67  GLY A CA    1 
ATOM   1011 C C     . GLY C 3 60  ? 22.390 -3.558  33.619 1.00 42.78 ? 67  GLY A C     1 
ATOM   1012 O O     . GLY C 3 60  ? 21.554 -3.459  34.506 1.00 45.25 ? 67  GLY A O     1 
ATOM   1013 N N     . ASP C 3 61  ? 23.527 -2.874  33.610 1.00 43.06 ? 68  ASP A N     1 
ATOM   1014 C CA    . ASP C 3 61  ? 23.889 -2.016  34.742 1.00 44.33 ? 68  ASP A CA    1 
ATOM   1015 C C     . ASP C 3 61  ? 23.302 -0.611  34.897 1.00 44.04 ? 68  ASP A C     1 
ATOM   1016 O O     . ASP C 3 61  ? 23.108 0.100   33.923 1.00 48.46 ? 68  ASP A O     1 
ATOM   1017 C CB    . ASP C 3 61  ? 25.406 -1.888  34.800 1.00 46.65 ? 68  ASP A CB    1 
ATOM   1018 C CG    . ASP C 3 61  ? 26.085 -3.179  35.172 1.00 46.24 ? 68  ASP A CG    1 
ATOM   1019 O OD1   . ASP C 3 61  ? 25.550 -3.898  36.047 1.00 46.25 ? 68  ASP A OD1   1 
ATOM   1020 O OD2   . ASP C 3 61  ? 27.159 -3.458  34.606 1.00 43.44 ? 68  ASP A OD2   1 
ATOM   1021 N N     . PHE C 3 62  ? 23.046 -0.211  36.139 1.00 43.62 ? 69  PHE A N     1 
ATOM   1022 C CA    . PHE C 3 62  ? 22.556 1.142   36.437 1.00 46.58 ? 69  PHE A CA    1 
ATOM   1023 C C     . PHE C 3 62  ? 23.768 2.050   36.688 1.00 45.06 ? 69  PHE A C     1 
ATOM   1024 O O     . PHE C 3 62  ? 24.765 1.596   37.240 1.00 44.35 ? 69  PHE A O     1 
ATOM   1025 C CB    . PHE C 3 62  ? 21.699 1.175   37.714 1.00 49.30 ? 69  PHE A CB    1 
ATOM   1026 C CG    . PHE C 3 62  ? 20.283 0.703   37.524 1.00 58.37 ? 69  PHE A CG    1 
ATOM   1027 C CD1   . PHE C 3 62  ? 19.901 -0.586  37.919 1.00 58.31 ? 69  PHE A CD1   1 
ATOM   1028 C CD2   . PHE C 3 62  ? 19.324 1.549   36.937 1.00 58.68 ? 69  PHE A CD2   1 
ATOM   1029 C CE1   . PHE C 3 62  ? 18.584 -1.024  37.731 1.00 59.01 ? 69  PHE A CE1   1 
ATOM   1030 C CE2   . PHE C 3 62  ? 18.008 1.123   36.745 1.00 57.85 ? 69  PHE A CE2   1 
ATOM   1031 C CZ    . PHE C 3 62  ? 17.632 -0.162  37.138 1.00 59.48 ? 69  PHE A CZ    1 
ATOM   1032 N N     . ILE C 3 63  ? 23.698 3.315   36.276 1.00 44.08 ? 70  ILE A N     1 
ATOM   1033 C CA    . ILE C 3 63  ? 24.795 4.258   36.524 1.00 44.77 ? 70  ILE A CA    1 
ATOM   1034 C C     . ILE C 3 63  ? 24.183 5.544   37.013 1.00 42.07 ? 70  ILE A C     1 
ATOM   1035 O O     . ILE C 3 63  ? 23.064 5.864   36.666 1.00 43.39 ? 70  ILE A O     1 
ATOM   1036 C CB    . ILE C 3 63  ? 25.607 4.669   35.264 1.00 48.32 ? 70  ILE A CB    1 
ATOM   1037 C CG1   . ILE C 3 63  ? 25.559 3.592   34.174 1.00 49.18 ? 70  ILE A CG1   1 
ATOM   1038 C CG2   . ILE C 3 63  ? 27.048 4.956   35.674 1.00 45.62 ? 70  ILE A CG2   1 
ATOM   1039 C CD1   . ILE C 3 63  ? 26.194 4.036   32.864 1.00 40.48 ? 70  ILE A CD1   1 
ATOM   1040 N N     . GLY C 3 64  ? 24.926 6.297   37.798 1.00 41.20 ? 71  GLY A N     1 
ATOM   1041 C CA    . GLY C 3 64  ? 24.407 7.550   38.286 1.00 38.86 ? 71  GLY A CA    1 
ATOM   1042 C C     . GLY C 3 64  ? 23.373 7.349   39.359 1.00 44.60 ? 71  GLY A C     1 
ATOM   1043 O O     . GLY C 3 64  ? 22.373 8.050   39.365 1.00 48.17 ? 71  GLY A O     1 
ATOM   1044 N N     . GLU C 3 65  ? 23.605 6.410   40.278 1.00 47.69 ? 72  GLU A N     1 
ATOM   1045 C CA    . GLU C 3 65  ? 22.652 6.163   41.360 1.00 52.50 ? 72  GLU A CA    1 
ATOM   1046 C C     . GLU C 3 65  ? 23.068 6.701   42.706 1.00 55.28 ? 72  GLU A C     1 
ATOM   1047 O O     . GLU C 3 65  ? 22.225 7.114   43.491 1.00 57.46 ? 72  GLU A O     1 
ATOM   1048 C CB    . GLU C 3 65  ? 22.363 4.668   41.555 1.00 49.97 ? 72  GLU A CB    1 
ATOM   1049 C CG    . GLU C 3 65  ? 23.047 3.728   40.592 1.00 55.78 ? 72  GLU A CG    1 
ATOM   1050 C CD    . GLU C 3 65  ? 24.457 3.397   40.998 1.00 61.05 ? 72  GLU A CD    1 
ATOM   1051 O OE1   . GLU C 3 65  ? 24.659 3.080   42.184 1.00 58.90 ? 72  GLU A OE1   1 
ATOM   1052 O OE2   . GLU C 3 65  ? 25.359 3.439   40.136 1.00 63.61 ? 72  GLU A OE2   1 
ATOM   1053 N N     . LEU C 3 66  ? 24.360 6.697   42.990 1.00 58.68 ? 73  LEU A N     1 
ATOM   1054 C CA    . LEU C 3 66  ? 24.797 7.133   44.307 1.00 60.65 ? 73  LEU A CA    1 
ATOM   1055 C C     . LEU C 3 66  ? 24.248 8.472   44.703 1.00 62.15 ? 73  LEU A C     1 
ATOM   1056 O O     . LEU C 3 66  ? 23.917 8.688   45.860 1.00 62.74 ? 73  LEU A O     1 
ATOM   1057 C CB    . LEU C 3 66  ? 26.320 7.132   44.403 1.00 58.94 ? 73  LEU A CB    1 
ATOM   1058 C CG    . LEU C 3 66  ? 26.909 5.755   44.105 1.00 55.49 ? 73  LEU A CG    1 
ATOM   1059 C CD1   . LEU C 3 66  ? 28.382 5.781   44.387 1.00 55.04 ? 73  LEU A CD1   1 
ATOM   1060 C CD2   . LEU C 3 66  ? 26.215 4.695   44.952 1.00 58.55 ? 73  LEU A CD2   1 
ATOM   1061 N N     . GLY C 3 67  ? 24.128 9.365   43.732 1.00 65.87 ? 74  GLY A N     1 
ATOM   1062 C CA    . GLY C 3 67  ? 23.606 10.689  44.019 1.00 69.28 ? 74  GLY A CA    1 
ATOM   1063 C C     . GLY C 3 67  ? 22.096 10.730  43.896 1.00 70.22 ? 74  GLY A C     1 
ATOM   1064 O O     . GLY C 3 67  ? 21.517 11.751  43.537 1.00 69.35 ? 74  GLY A O     1 
ATOM   1065 N N     . LEU C 3 68  ? 21.458 9.614   44.225 1.00 69.35 ? 75  LEU A N     1 
ATOM   1066 C CA    . LEU C 3 68  ? 20.020 9.502   44.120 1.00 64.86 ? 75  LEU A CA    1 
ATOM   1067 C C     . LEU C 3 68  ? 19.295 9.492   45.461 1.00 66.59 ? 75  LEU A C     1 
ATOM   1068 O O     . LEU C 3 68  ? 18.063 9.553   45.495 1.00 67.84 ? 75  LEU A O     1 
ATOM   1069 C CB    . LEU C 3 68  ? 19.680 8.237   43.335 1.00 58.48 ? 75  LEU A CB    1 
ATOM   1070 C CG    . LEU C 3 68  ? 18.233 7.782   43.368 1.00 62.28 ? 75  LEU A CG    1 
ATOM   1071 C CD1   . LEU C 3 68  ? 17.349 8.887   42.847 1.00 65.97 ? 75  LEU A CD1   1 
ATOM   1072 C CD2   . LEU C 3 68  ? 18.062 6.539   42.541 1.00 64.10 ? 75  LEU A CD2   1 
ATOM   1073 N N     . PHE C 3 69  ? 20.027 9.448   46.570 1.00 65.19 ? 76  PHE A N     1 
ATOM   1074 C CA    . PHE C 3 69  ? 19.339 9.375   47.858 1.00 66.45 ? 76  PHE A CA    1 
ATOM   1075 C C     . PHE C 3 69  ? 19.481 10.599  48.760 1.00 70.56 ? 76  PHE A C     1 
ATOM   1076 O O     . PHE C 3 69  ? 19.115 10.557  49.939 1.00 77.20 ? 76  PHE A O     1 
ATOM   1077 C CB    . PHE C 3 69  ? 19.771 8.091   48.620 1.00 56.94 ? 76  PHE A CB    1 
ATOM   1078 C CG    . PHE C 3 69  ? 19.608 6.812   47.816 1.00 48.48 ? 76  PHE A CG    1 
ATOM   1079 C CD1   . PHE C 3 69  ? 20.522 6.475   46.814 1.00 44.87 ? 76  PHE A CD1   1 
ATOM   1080 C CD2   . PHE C 3 69  ? 18.500 5.989   48.007 1.00 44.11 ? 76  PHE A CD2   1 
ATOM   1081 C CE1   . PHE C 3 69  ? 20.322 5.342   46.011 1.00 45.81 ? 76  PHE A CE1   1 
ATOM   1082 C CE2   . PHE C 3 69  ? 18.295 4.860   47.212 1.00 45.24 ? 76  PHE A CE2   1 
ATOM   1083 C CZ    . PHE C 3 69  ? 19.209 4.538   46.208 1.00 44.96 ? 76  PHE A CZ    1 
ATOM   1084 N N     . GLU C 3 70  ? 20.015 11.688  48.224 1.00 72.81 ? 77  GLU A N     1 
ATOM   1085 C CA    . GLU C 3 70  ? 20.167 12.892  49.026 1.00 74.96 ? 77  GLU A CA    1 
ATOM   1086 C C     . GLU C 3 70  ? 20.372 14.151  48.178 1.00 76.93 ? 77  GLU A C     1 
ATOM   1087 O O     . GLU C 3 70  ? 21.236 14.209  47.297 1.00 73.15 ? 77  GLU A O     1 
ATOM   1088 C CB    . GLU C 3 70  ? 21.311 12.719  50.025 1.00 75.42 ? 77  GLU A CB    1 
ATOM   1089 C CG    . GLU C 3 70  ? 21.387 13.848  51.042 1.00 82.48 ? 77  GLU A CG    1 
ATOM   1090 C CD    . GLU C 3 70  ? 22.090 13.437  52.330 1.00 84.54 ? 77  GLU A CD    1 
ATOM   1091 O OE1   . GLU C 3 70  ? 23.272 13.020  52.256 1.00 84.54 ? 77  GLU A OE1   1 
ATOM   1092 O OE2   . GLU C 3 70  ? 21.455 13.531  53.413 1.00 84.54 ? 77  GLU A OE2   1 
ATOM   1093 N N     . GLU C 3 71  ? 19.546 15.156  48.455 1.00 78.95 ? 78  GLU A N     1 
ATOM   1094 C CA    . GLU C 3 71  ? 19.580 16.422  47.735 1.00 77.33 ? 78  GLU A CA    1 
ATOM   1095 C C     . GLU C 3 71  ? 20.979 17.033  47.634 1.00 75.04 ? 78  GLU A C     1 
ATOM   1096 O O     . GLU C 3 71  ? 21.712 17.140  48.628 1.00 71.04 ? 78  GLU A O     1 
ATOM   1097 C CB    . GLU C 3 71  ? 18.633 17.440  48.403 1.00 81.14 ? 78  GLU A CB    1 
ATOM   1098 C CG    . GLU C 3 71  ? 17.155 17.035  48.433 1.00 84.54 ? 78  GLU A CG    1 
ATOM   1099 C CD    . GLU C 3 71  ? 16.511 16.959  47.039 1.00 84.54 ? 78  GLU A CD    1 
ATOM   1100 O OE1   . GLU C 3 71  ? 16.145 18.025  46.468 1.00 84.54 ? 78  GLU A OE1   1 
ATOM   1101 O OE2   . GLU C 3 71  ? 16.379 15.821  46.519 1.00 84.54 ? 78  GLU A OE2   1 
ATOM   1102 N N     . GLY C 3 72  ? 21.332 17.437  46.416 1.00 73.90 ? 79  GLY A N     1 
ATOM   1103 C CA    . GLY C 3 72  ? 22.615 18.073  46.180 1.00 71.25 ? 79  GLY A CA    1 
ATOM   1104 C C     . GLY C 3 72  ? 23.777 17.119  46.123 1.00 67.68 ? 79  GLY A C     1 
ATOM   1105 O O     . GLY C 3 72  ? 24.896 17.455  46.500 1.00 65.52 ? 79  GLY A O     1 
ATOM   1106 N N     . GLN C 3 73  ? 23.511 15.910  45.660 1.00 66.13 ? 80  GLN A N     1 
ATOM   1107 C CA    . GLN C 3 73  ? 24.572 14.940  45.559 1.00 63.26 ? 80  GLN A CA    1 
ATOM   1108 C C     . GLN C 3 73  ? 25.370 15.280  44.320 1.00 58.80 ? 80  GLN A C     1 
ATOM   1109 O O     . GLN C 3 73  ? 24.821 15.763  43.329 1.00 57.14 ? 80  GLN A O     1 
ATOM   1110 C CB    . GLN C 3 73  ? 24.000 13.528  45.440 1.00 67.62 ? 80  GLN A CB    1 
ATOM   1111 C CG    . GLN C 3 73  ? 23.458 12.953  46.730 1.00 71.78 ? 80  GLN A CG    1 
ATOM   1112 C CD    . GLN C 3 73  ? 24.528 12.765  47.782 1.00 76.44 ? 80  GLN A CD    1 
ATOM   1113 O OE1   . GLN C 3 73  ? 24.223 12.652  48.969 1.00 77.77 ? 80  GLN A OE1   1 
ATOM   1114 N NE2   . GLN C 3 73  ? 25.788 12.722  47.356 1.00 75.88 ? 80  GLN A NE2   1 
ATOM   1115 N N     . GLU C 3 74  ? 26.671 15.052  44.385 1.00 52.26 ? 81  GLU A N     1 
ATOM   1116 C CA    . GLU C 3 74  ? 27.498 15.299  43.234 1.00 48.04 ? 81  GLU A CA    1 
ATOM   1117 C C     . GLU C 3 74  ? 28.028 13.968  42.735 1.00 46.83 ? 81  GLU A C     1 
ATOM   1118 O O     . GLU C 3 74  ? 28.136 12.995  43.488 1.00 43.49 ? 81  GLU A O     1 
ATOM   1119 C CB    . GLU C 3 74  ? 28.617 16.252  43.592 1.00 50.59 ? 81  GLU A CB    1 
ATOM   1120 C CG    . GLU C 3 74  ? 28.141 17.689  43.574 1.00 56.55 ? 81  GLU A CG    1 
ATOM   1121 C CD    . GLU C 3 74  ? 29.180 18.673  44.061 1.00 61.01 ? 81  GLU A CD    1 
ATOM   1122 O OE1   . GLU C 3 74  ? 29.030 19.878  43.750 1.00 55.68 ? 81  GLU A OE1   1 
ATOM   1123 O OE2   . GLU C 3 74  ? 30.132 18.237  44.753 1.00 61.82 ? 81  GLU A OE2   1 
ATOM   1124 N N     . ARG C 3 75  ? 28.312 13.905  41.444 1.00 44.05 ? 82  ARG A N     1 
ATOM   1125 C CA    . ARG C 3 75  ? 28.811 12.675  40.874 1.00 41.99 ? 82  ARG A CA    1 
ATOM   1126 C C     . ARG C 3 75  ? 30.158 12.287  41.534 1.00 41.14 ? 82  ARG A C     1 
ATOM   1127 O O     . ARG C 3 75  ? 31.065 13.099  41.699 1.00 42.25 ? 82  ARG A O     1 
ATOM   1128 C CB    . ARG C 3 75  ? 28.914 12.845  39.367 1.00 38.58 ? 82  ARG A CB    1 
ATOM   1129 C CG    . ARG C 3 75  ? 27.604 13.201  38.705 1.00 35.32 ? 82  ARG A CG    1 
ATOM   1130 C CD    . ARG C 3 75  ? 26.602 12.085  38.750 1.00 37.02 ? 82  ARG A CD    1 
ATOM   1131 N NE    . ARG C 3 75  ? 25.532 12.227  37.762 1.00 40.82 ? 82  ARG A NE    1 
ATOM   1132 C CZ    . ARG C 3 75  ? 24.405 11.505  37.756 1.00 46.54 ? 82  ARG A CZ    1 
ATOM   1133 N NH1   . ARG C 3 75  ? 24.192 10.591  38.693 1.00 49.75 ? 82  ARG A NH1   1 
ATOM   1134 N NH2   . ARG C 3 75  ? 23.494 11.667  36.800 1.00 42.42 ? 82  ARG A NH2   1 
ATOM   1135 N N     . SER C 3 76  ? 30.264 11.031  41.916 1.00 37.31 ? 83  SER A N     1 
ATOM   1136 C CA    . SER C 3 76  ? 31.421 10.525  42.609 1.00 34.57 ? 83  SER A CA    1 
ATOM   1137 C C     . SER C 3 76  ? 32.576 10.170  41.729 1.00 35.20 ? 83  SER A C     1 
ATOM   1138 O O     . SER C 3 76  ? 33.706 10.122  42.176 1.00 38.15 ? 83  SER A O     1 
ATOM   1139 C CB    . SER C 3 76  ? 31.015 9.306   43.420 1.00 34.25 ? 83  SER A CB    1 
ATOM   1140 O OG    . SER C 3 76  ? 30.353 8.368   42.586 1.00 36.91 ? 83  SER A OG    1 
ATOM   1141 N N     . ALA C 3 77  ? 32.317 9.898   40.470 1.00 34.59 ? 84  ALA A N     1 
ATOM   1142 C CA    . ALA C 3 77  ? 33.417 9.549   39.599 1.00 34.10 ? 84  ALA A CA    1 
ATOM   1143 C C     . ALA C 3 77  ? 33.025 9.863   38.170 1.00 35.75 ? 84  ALA A C     1 
ATOM   1144 O O     . ALA C 3 77  ? 31.896 10.257  37.914 1.00 38.00 ? 84  ALA A O     1 
ATOM   1145 C CB    . ALA C 3 77  ? 33.749 8.087   39.760 1.00 29.22 ? 84  ALA A CB    1 
ATOM   1146 N N     . TRP C 3 78  ? 33.967 9.712   37.251 1.00 35.65 ? 85  TRP A N     1 
ATOM   1147 C CA    . TRP C 3 78  ? 33.706 9.951   35.851 1.00 39.29 ? 85  TRP A CA    1 
ATOM   1148 C C     . TRP C 3 78  ? 33.267 8.635   35.271 1.00 42.61 ? 85  TRP A C     1 
ATOM   1149 O O     . TRP C 3 78  ? 33.691 7.583   35.728 1.00 45.97 ? 85  TRP A O     1 
ATOM   1150 C CB    . TRP C 3 78  ? 34.979 10.364  35.118 1.00 42.59 ? 85  TRP A CB    1 
ATOM   1151 C CG    . TRP C 3 78  ? 35.809 11.357  35.851 1.00 48.91 ? 85  TRP A CG    1 
ATOM   1152 C CD1   . TRP C 3 78  ? 36.580 11.155  36.993 1.00 48.88 ? 85  TRP A CD1   1 
ATOM   1153 C CD2   . TRP C 3 78  ? 35.895 12.731  35.555 1.00 44.02 ? 85  TRP A CD2   1 
ATOM   1154 N NE1   . TRP C 3 78  ? 37.126 12.343  37.412 1.00 42.16 ? 85  TRP A NE1   1 
ATOM   1155 C CE2   . TRP C 3 78  ? 36.718 13.327  36.548 1.00 44.37 ? 85  TRP A CE2   1 
ATOM   1156 C CE3   . TRP C 3 78  ? 35.354 13.526  34.554 1.00 41.89 ? 85  TRP A CE3   1 
ATOM   1157 C CZ2   . TRP C 3 78  ? 36.997 14.675  36.557 1.00 46.42 ? 85  TRP A CZ2   1 
ATOM   1158 C CZ3   . TRP C 3 78  ? 35.630 14.864  34.561 1.00 51.63 ? 85  TRP A CZ3   1 
ATOM   1159 C CH2   . TRP C 3 78  ? 36.446 15.434  35.557 1.00 50.95 ? 85  TRP A CH2   1 
ATOM   1160 N N     . VAL C 3 79  ? 32.416 8.692   34.259 1.00 44.25 ? 86  VAL A N     1 
ATOM   1161 C CA    . VAL C 3 79  ? 31.991 7.491   33.565 1.00 43.21 ? 86  VAL A CA    1 
ATOM   1162 C C     . VAL C 3 79  ? 32.280 7.730   32.089 1.00 40.17 ? 86  VAL A C     1 
ATOM   1163 O O     . VAL C 3 79  ? 31.741 8.648   31.491 1.00 36.28 ? 86  VAL A O     1 
ATOM   1164 C CB    . VAL C 3 79  ? 30.502 7.207   33.751 1.00 45.77 ? 86  VAL A CB    1 
ATOM   1165 C CG1   . VAL C 3 79  ? 30.175 5.900   33.070 1.00 44.46 ? 86  VAL A CG1   1 
ATOM   1166 C CG2   . VAL C 3 79  ? 30.155 7.141   35.229 1.00 43.82 ? 86  VAL A CG2   1 
ATOM   1167 N N     . ARG C 3 80  ? 33.146 6.894   31.525 1.00 41.33 ? 87  ARG A N     1 
ATOM   1168 C CA    . ARG C 3 80  ? 33.572 6.985   30.121 1.00 41.61 ? 87  ARG A CA    1 
ATOM   1169 C C     . ARG C 3 80  ? 33.133 5.733   29.404 1.00 43.19 ? 87  ARG A C     1 
ATOM   1170 O O     . ARG C 3 80  ? 33.098 4.660   29.999 1.00 39.68 ? 87  ARG A O     1 
ATOM   1171 C CB    . ARG C 3 80  ? 35.090 7.073   30.051 1.00 42.39 ? 87  ARG A CB    1 
ATOM   1172 C CG    . ARG C 3 80  ? 35.676 7.547   28.763 1.00 40.76 ? 87  ARG A CG    1 
ATOM   1173 C CD    . ARG C 3 80  ? 37.195 7.556   28.859 1.00 47.71 ? 87  ARG A CD    1 
ATOM   1174 N NE    . ARG C 3 80  ? 37.755 8.586   29.751 1.00 54.81 ? 87  ARG A NE    1 
ATOM   1175 C CZ    . ARG C 3 80  ? 38.823 8.403   30.539 1.00 55.75 ? 87  ARG A CZ    1 
ATOM   1176 N NH1   . ARG C 3 80  ? 39.448 7.229   30.566 1.00 53.96 ? 87  ARG A NH1   1 
ATOM   1177 N NH2   . ARG C 3 80  ? 39.292 9.400   31.280 1.00 56.07 ? 87  ARG A NH2   1 
ATOM   1178 N N     . ALA C 3 81  ? 32.808 5.872   28.123 1.00 44.88 ? 88  ALA A N     1 
ATOM   1179 C CA    . ALA C 3 81  ? 32.365 4.738   27.333 1.00 45.72 ? 88  ALA A CA    1 
ATOM   1180 C C     . ALA C 3 81  ? 33.546 3.902   26.872 1.00 47.82 ? 88  ALA A C     1 
ATOM   1181 O O     . ALA C 3 81  ? 34.490 4.384   26.253 1.00 43.99 ? 88  ALA A O     1 
ATOM   1182 C CB    . ALA C 3 81  ? 31.573 5.213   26.153 1.00 49.45 ? 88  ALA A CB    1 
ATOM   1183 N N     . LYS C 3 82  ? 33.484 2.627   27.208 1.00 53.18 ? 89  LYS A N     1 
ATOM   1184 C CA    . LYS C 3 82  ? 34.531 1.695   26.860 1.00 54.02 ? 89  LYS A CA    1 
ATOM   1185 C C     . LYS C 3 82  ? 34.279 1.418   25.409 1.00 51.08 ? 89  LYS A C     1 
ATOM   1186 O O     . LYS C 3 82  ? 35.201 1.384   24.610 1.00 52.38 ? 89  LYS A O     1 
ATOM   1187 C CB    . LYS C 3 82  ? 34.409 0.408   27.694 1.00 55.34 ? 89  LYS A CB    1 
ATOM   1188 C CG    . LYS C 3 82  ? 35.743 -0.120  28.166 1.00 61.72 ? 89  LYS A CG    1 
ATOM   1189 C CD    . LYS C 3 82  ? 36.672 -0.329  26.964 1.00 72.74 ? 89  LYS A CD    1 
ATOM   1190 C CE    . LYS C 3 82  ? 38.160 -0.281  27.341 1.00 79.22 ? 89  LYS A CE    1 
ATOM   1191 N NZ    . LYS C 3 82  ? 38.558 -1.364  28.283 1.00 83.53 ? 89  LYS A NZ    1 
ATOM   1192 N N     . THR C 3 83  ? 33.005 1.246   25.076 1.00 49.13 ? 90  THR A N     1 
ATOM   1193 C CA    . THR C 3 83  ? 32.603 0.974   23.705 1.00 49.94 ? 90  THR A CA    1 
ATOM   1194 C C     . THR C 3 83  ? 31.424 1.853   23.357 1.00 49.74 ? 90  THR A C     1 
ATOM   1195 O O     . THR C 3 83  ? 30.955 2.626   24.181 1.00 50.12 ? 90  THR A O     1 
ATOM   1196 C CB    . THR C 3 83  ? 32.140 -0.483  23.514 1.00 45.73 ? 90  THR A CB    1 
ATOM   1197 O OG1   . THR C 3 83  ? 30.904 -0.676  24.197 1.00 41.92 ? 90  THR A OG1   1 
ATOM   1198 C CG2   . THR C 3 83  ? 33.147 -1.435  24.058 1.00 43.72 ? 90  THR A CG2   1 
ATOM   1199 N N     . ALA C 3 84  ? 30.945 1.722   22.129 1.00 48.95 ? 91  ALA A N     1 
ATOM   1200 C CA    . ALA C 3 84  ? 29.796 2.488   21.700 1.00 47.20 ? 91  ALA A CA    1 
ATOM   1201 C C     . ALA C 3 84  ? 28.651 2.071   22.614 1.00 49.45 ? 91  ALA A C     1 
ATOM   1202 O O     . ALA C 3 84  ? 28.447 0.883   22.853 1.00 55.81 ? 91  ALA A O     1 
ATOM   1203 C CB    . ALA C 3 84  ? 29.474 2.168   20.266 1.00 37.93 ? 91  ALA A CB    1 
ATOM   1204 N N     . CYS C 3 85  ? 27.897 3.039   23.119 1.00 48.88 ? 92  CYS A N     1 
ATOM   1205 C CA    . CYS C 3 85  ? 26.805 2.724   24.016 1.00 53.14 ? 92  CYS A CA    1 
ATOM   1206 C C     . CYS C 3 85  ? 25.418 3.262   23.699 1.00 55.47 ? 92  CYS A C     1 
ATOM   1207 O O     . CYS C 3 85  ? 25.241 4.240   22.985 1.00 59.86 ? 92  CYS A O     1 
ATOM   1208 C CB    . CYS C 3 85  ? 27.177 3.153   25.432 1.00 55.06 ? 92  CYS A CB    1 
ATOM   1209 S SG    . CYS C 3 85  ? 28.386 2.098   26.145 1.00 61.39 ? 92  CYS A SG    1 
ATOM   1210 N N     . GLU C 3 86  ? 24.438 2.578   24.266 1.00 55.03 ? 93  GLU A N     1 
ATOM   1211 C CA    . GLU C 3 86  ? 23.039 2.914   24.159 1.00 54.01 ? 93  GLU A CA    1 
ATOM   1212 C C     . GLU C 3 86  ? 22.687 2.902   25.657 1.00 56.29 ? 93  GLU A C     1 
ATOM   1213 O O     . GLU C 3 86  ? 22.784 1.863   26.317 1.00 60.37 ? 93  GLU A O     1 
ATOM   1214 C CB    . GLU C 3 86  ? 22.308 1.812   23.404 1.00 51.90 ? 93  GLU A CB    1 
ATOM   1215 C CG    . GLU C 3 86  ? 21.004 2.249   22.809 1.00 60.09 ? 93  GLU A CG    1 
ATOM   1216 C CD    . GLU C 3 86  ? 20.330 1.165   21.991 1.00 66.32 ? 93  GLU A CD    1 
ATOM   1217 O OE1   . GLU C 3 86  ? 21.017 0.493   21.181 1.00 70.02 ? 93  GLU A OE1   1 
ATOM   1218 O OE2   . GLU C 3 86  ? 19.104 0.995   22.153 1.00 67.15 ? 93  GLU A OE2   1 
ATOM   1219 N N     . VAL C 3 87  ? 22.324 4.058   26.202 1.00 51.72 ? 94  VAL A N     1 
ATOM   1220 C CA    . VAL C 3 87  ? 22.020 4.160   27.618 1.00 46.12 ? 94  VAL A CA    1 
ATOM   1221 C C     . VAL C 3 87  ? 20.654 4.784   27.862 1.00 46.86 ? 94  VAL A C     1 
ATOM   1222 O O     . VAL C 3 87  ? 20.334 5.828   27.325 1.00 44.70 ? 94  VAL A O     1 
ATOM   1223 C CB    . VAL C 3 87  ? 23.114 5.004   28.334 1.00 44.65 ? 94  VAL A CB    1 
ATOM   1224 C CG1   . VAL C 3 87  ? 22.795 5.197   29.791 1.00 41.89 ? 94  VAL A CG1   1 
ATOM   1225 C CG2   . VAL C 3 87  ? 24.441 4.325   28.205 1.00 41.61 ? 94  VAL A CG2   1 
ATOM   1226 N N     . ALA C 3 88  ? 19.834 4.119   28.663 1.00 48.14 ? 95  ALA A N     1 
ATOM   1227 C CA    . ALA C 3 88  ? 18.532 4.646   28.995 1.00 47.04 ? 95  ALA A CA    1 
ATOM   1228 C C     . ALA C 3 88  ? 18.785 5.667   30.069 1.00 48.86 ? 95  ALA A C     1 
ATOM   1229 O O     . ALA C 3 88  ? 19.613 5.471   30.951 1.00 51.18 ? 95  ALA A O     1 
ATOM   1230 C CB    . ALA C 3 88  ? 17.660 3.580   29.519 1.00 50.86 ? 95  ALA A CB    1 
ATOM   1231 N N     . GLU C 3 89  ? 18.070 6.773   29.991 1.00 47.90 ? 96  GLU A N     1 
ATOM   1232 C CA    . GLU C 3 89  ? 18.237 7.828   30.958 1.00 42.35 ? 96  GLU A CA    1 
ATOM   1233 C C     . GLU C 3 89  ? 16.861 8.237   31.425 1.00 40.56 ? 96  GLU A C     1 
ATOM   1234 O O     . GLU C 3 89  ? 15.902 8.142   30.693 1.00 38.35 ? 96  GLU A O     1 
ATOM   1235 C CB    . GLU C 3 89  ? 19.009 8.983   30.322 1.00 43.69 ? 96  GLU A CB    1 
ATOM   1236 C CG    . GLU C 3 89  ? 20.425 8.567   29.925 1.00 47.36 ? 96  GLU A CG    1 
ATOM   1237 C CD    . GLU C 3 89  ? 21.216 9.645   29.201 1.00 46.95 ? 96  GLU A CD    1 
ATOM   1238 O OE1   . GLU C 3 89  ? 21.117 10.841  29.580 1.00 44.05 ? 96  GLU A OE1   1 
ATOM   1239 O OE2   . GLU C 3 89  ? 21.956 9.279   28.261 1.00 39.98 ? 96  GLU A OE2   1 
ATOM   1240 N N     . ILE C 3 90  ? 16.778 8.656   32.675 1.00 42.54 ? 97  ILE A N     1 
ATOM   1241 C CA    . ILE C 3 90  ? 15.533 9.047   33.289 1.00 42.94 ? 97  ILE A CA    1 
ATOM   1242 C C     . ILE C 3 90  ? 15.886 9.966   34.429 1.00 43.44 ? 97  ILE A C     1 
ATOM   1243 O O     . ILE C 3 90  ? 16.888 9.783   35.107 1.00 40.98 ? 97  ILE A O     1 
ATOM   1244 C CB    . ILE C 3 90  ? 14.772 7.816   33.843 1.00 42.73 ? 97  ILE A CB    1 
ATOM   1245 C CG1   . ILE C 3 90  ? 13.555 8.276   34.637 1.00 41.82 ? 97  ILE A CG1   1 
ATOM   1246 C CG2   . ILE C 3 90  ? 15.683 7.004   34.744 1.00 41.26 ? 97  ILE A CG2   1 
ATOM   1247 C CD1   . ILE C 3 90  ? 12.554 7.209   34.811 1.00 40.98 ? 97  ILE A CD1   1 
ATOM   1248 N N     . SER C 3 91  ? 15.058 10.972  34.628 1.00 47.63 ? 98  SER A N     1 
ATOM   1249 C CA    . SER C 3 91  ? 15.298 11.929  35.687 1.00 53.95 ? 98  SER A CA    1 
ATOM   1250 C C     . SER C 3 91  ? 15.245 11.226  37.037 1.00 54.11 ? 98  SER A C     1 
ATOM   1251 O O     . SER C 3 91  ? 14.596 10.185  37.178 1.00 54.55 ? 98  SER A O     1 
ATOM   1252 C CB    . SER C 3 91  ? 14.213 12.992  35.658 1.00 56.76 ? 98  SER A CB    1 
ATOM   1253 O OG    . SER C 3 91  ? 13.155 12.614  36.530 1.00 63.89 ? 98  SER A OG    1 
ATOM   1254 N N     . TYR C 3 92  ? 15.918 11.791  38.032 1.00 54.32 ? 99  TYR A N     1 
ATOM   1255 C CA    . TYR C 3 92  ? 15.863 11.202  39.358 1.00 55.34 ? 99  TYR A CA    1 
ATOM   1256 C C     . TYR C 3 92  ? 14.399 11.277  39.752 1.00 60.90 ? 99  TYR A C     1 
ATOM   1257 O O     . TYR C 3 92  ? 13.766 10.262  40.058 1.00 60.12 ? 99  TYR A O     1 
ATOM   1258 C CB    . TYR C 3 92  ? 16.716 11.998  40.352 1.00 50.42 ? 99  TYR A CB    1 
ATOM   1259 C CG    . TYR C 3 92  ? 18.159 11.550  40.421 1.00 50.40 ? 99  TYR A CG    1 
ATOM   1260 C CD1   . TYR C 3 92  ? 18.585 10.383  39.784 1.00 50.10 ? 99  TYR A CD1   1 
ATOM   1261 C CD2   . TYR C 3 92  ? 19.090 12.261  41.156 1.00 50.48 ? 99  TYR A CD2   1 
ATOM   1262 C CE1   . TYR C 3 92  ? 19.895 9.940   39.887 1.00 48.63 ? 99  TYR A CE1   1 
ATOM   1263 C CE2   . TYR C 3 92  ? 20.399 11.826  41.262 1.00 49.39 ? 99  TYR A CE2   1 
ATOM   1264 C CZ    . TYR C 3 92  ? 20.794 10.663  40.634 1.00 51.04 ? 99  TYR A CZ    1 
ATOM   1265 O OH    . TYR C 3 92  ? 22.074 10.194  40.802 1.00 50.57 ? 99  TYR A OH    1 
ATOM   1266 N N     . LYS C 3 93  ? 13.877 12.502  39.709 1.00 68.52 ? 100 LYS A N     1 
ATOM   1267 C CA    . LYS C 3 93  ? 12.484 12.813  40.030 1.00 70.04 ? 100 LYS A CA    1 
ATOM   1268 C C     . LYS C 3 93  ? 11.524 11.816  39.398 1.00 69.66 ? 100 LYS A C     1 
ATOM   1269 O O     . LYS C 3 93  ? 10.707 11.195  40.089 1.00 68.15 ? 100 LYS A O     1 
ATOM   1270 C CB    . LYS C 3 93  ? 12.155 14.222  39.544 1.00 70.42 ? 100 LYS A CB    1 
ATOM   1271 C CG    . LYS C 3 93  ? 10.699 14.556  39.630 1.00 74.00 ? 100 LYS A CG    1 
ATOM   1272 C CD    . LYS C 3 93  ? 10.453 16.051  39.512 1.00 78.08 ? 100 LYS A CD    1 
ATOM   1273 C CE    . LYS C 3 93  ? 8.966  16.357  39.702 1.00 81.22 ? 100 LYS A CE    1 
ATOM   1274 N NZ    . LYS C 3 93  ? 8.415  15.779  40.977 1.00 79.53 ? 100 LYS A NZ    1 
ATOM   1275 N N     . LYS C 3 94  ? 11.626 11.670  38.082 1.00 67.56 ? 101 LYS A N     1 
ATOM   1276 C CA    . LYS C 3 94  ? 10.778 10.732  37.360 1.00 70.25 ? 101 LYS A CA    1 
ATOM   1277 C C     . LYS C 3 94  ? 10.937 9.355   37.994 1.00 70.34 ? 101 LYS A C     1 
ATOM   1278 O O     . LYS C 3 94  ? 9.969  8.777   38.470 1.00 68.99 ? 101 LYS A O     1 
ATOM   1279 C CB    . LYS C 3 94  ? 11.187 10.667  35.883 1.00 70.20 ? 101 LYS A CB    1 
ATOM   1280 C CG    . LYS C 3 94  ? 10.311 9.773   35.005 1.00 70.08 ? 101 LYS A CG    1 
ATOM   1281 C CD    . LYS C 3 94  ? 9.364  10.589  34.105 1.00 71.51 ? 101 LYS A CD    1 
ATOM   1282 C CE    . LYS C 3 94  ? 8.628  9.721   33.065 1.00 70.37 ? 101 LYS A CE    1 
ATOM   1283 N NZ    . LYS C 3 94  ? 9.539  9.004   32.128 1.00 65.94 ? 101 LYS A NZ    1 
ATOM   1284 N N     . PHE C 3 95  ? 12.168 8.844   38.008 1.00 71.12 ? 102 PHE A N     1 
ATOM   1285 C CA    . PHE C 3 95  ? 12.463 7.530   38.577 1.00 70.42 ? 102 PHE A CA    1 
ATOM   1286 C C     . PHE C 3 95  ? 11.824 7.341   39.947 1.00 70.98 ? 102 PHE A C     1 
ATOM   1287 O O     . PHE C 3 95  ? 11.134 6.345   40.179 1.00 69.93 ? 102 PHE A O     1 
ATOM   1288 C CB    . PHE C 3 95  ? 13.977 7.324   38.692 1.00 66.99 ? 102 PHE A CB    1 
ATOM   1289 C CG    . PHE C 3 95  ? 14.387 5.928   39.123 1.00 61.24 ? 102 PHE A CG    1 
ATOM   1290 C CD1   . PHE C 3 95  ? 14.275 4.851   38.250 1.00 61.98 ? 102 PHE A CD1   1 
ATOM   1291 C CD2   . PHE C 3 95  ? 14.942 5.709   40.378 1.00 57.47 ? 102 PHE A CD2   1 
ATOM   1292 C CE1   . PHE C 3 95  ? 14.719 3.585   38.619 1.00 61.09 ? 102 PHE A CE1   1 
ATOM   1293 C CE2   . PHE C 3 95  ? 15.390 4.452   40.756 1.00 55.45 ? 102 PHE A CE2   1 
ATOM   1294 C CZ    . PHE C 3 95  ? 15.280 3.389   39.877 1.00 61.46 ? 102 PHE A CZ    1 
ATOM   1295 N N     . ARG C 3 96  ? 12.048 8.289   40.853 1.00 71.33 ? 103 ARG A N     1 
ATOM   1296 C CA    . ARG C 3 96  ? 11.476 8.182   42.189 1.00 73.29 ? 103 ARG A CA    1 
ATOM   1297 C C     . ARG C 3 96  ? 10.019 7.724   42.126 1.00 74.30 ? 103 ARG A C     1 
ATOM   1298 O O     . ARG C 3 96  ? 9.593  6.806   42.836 1.00 71.97 ? 103 ARG A O     1 
ATOM   1299 C CB    . ARG C 3 96  ? 11.582 9.516   42.923 1.00 71.16 ? 103 ARG A CB    1 
ATOM   1300 C CG    . ARG C 3 96  ? 12.998 9.878   43.327 1.00 71.70 ? 103 ARG A CG    1 
ATOM   1301 C CD    . ARG C 3 96  ? 13.015 10.582  44.683 1.00 75.36 ? 103 ARG A CD    1 
ATOM   1302 N NE    . ARG C 3 96  ? 14.328 11.136  45.012 1.00 78.08 ? 103 ARG A NE    1 
ATOM   1303 C CZ    . ARG C 3 96  ? 14.937 12.070  44.290 1.00 78.52 ? 103 ARG A CZ    1 
ATOM   1304 N NH1   . ARG C 3 96  ? 14.339 12.547  43.206 1.00 81.33 ? 103 ARG A NH1   1 
ATOM   1305 N NH2   . ARG C 3 96  ? 16.142 12.517  44.636 1.00 76.79 ? 103 ARG A NH2   1 
ATOM   1306 N N     . GLN C 3 97  ? 9.255  8.363   41.257 1.00 77.38 ? 104 GLN A N     1 
ATOM   1307 C CA    . GLN C 3 97  ? 7.862  7.999   41.102 1.00 80.84 ? 104 GLN A CA    1 
ATOM   1308 C C     . GLN C 3 97  ? 7.704  6.502   40.773 1.00 82.38 ? 104 GLN A C     1 
ATOM   1309 O O     . GLN C 3 97  ? 7.033  5.776   41.510 1.00 83.09 ? 104 GLN A O     1 
ATOM   1310 C CB    . GLN C 3 97  ? 7.238  8.867   40.017 1.00 82.08 ? 104 GLN A CB    1 
ATOM   1311 C CG    . GLN C 3 97  ? 7.312  10.365  40.307 1.00 82.03 ? 104 GLN A CG    1 
ATOM   1312 C CD    . GLN C 3 97  ? 6.745  11.183  39.157 1.00 84.54 ? 104 GLN A CD    1 
ATOM   1313 O OE1   . GLN C 3 97  ? 5.919  10.676  38.382 1.00 84.54 ? 104 GLN A OE1   1 
ATOM   1314 N NE2   . GLN C 3 97  ? 7.170  12.450  39.038 1.00 83.77 ? 104 GLN A NE2   1 
ATOM   1315 N N     . LEU C 3 98  ? 8.323  6.034   39.688 1.00 83.42 ? 105 LEU A N     1 
ATOM   1316 C CA    . LEU C 3 98  ? 8.225  4.619   39.305 1.00 83.52 ? 105 LEU A CA    1 
ATOM   1317 C C     . LEU C 3 98  ? 8.289  3.722   40.531 1.00 84.54 ? 105 LEU A C     1 
ATOM   1318 O O     . LEU C 3 98  ? 7.475  2.815   40.685 1.00 84.54 ? 105 LEU A O     1 
ATOM   1319 C CB    . LEU C 3 98  ? 9.361  4.214   38.374 1.00 80.79 ? 105 LEU A CB    1 
ATOM   1320 C CG    . LEU C 3 98  ? 9.623  5.022   37.120 1.00 80.45 ? 105 LEU A CG    1 
ATOM   1321 C CD1   . LEU C 3 98  ? 10.641 4.272   36.312 1.00 84.04 ? 105 LEU A CD1   1 
ATOM   1322 C CD2   . LEU C 3 98  ? 8.356  5.214   36.318 1.00 82.52 ? 105 LEU A CD2   1 
ATOM   1323 N N     . ILE C 3 99  ? 9.280  3.977   41.385 1.00 84.39 ? 106 ILE A N     1 
ATOM   1324 C CA    . ILE C 3 99  ? 9.478  3.215   42.622 1.00 84.54 ? 106 ILE A CA    1 
ATOM   1325 C C     . ILE C 3 99  ? 8.156  3.119   43.403 1.00 84.54 ? 106 ILE A C     1 
ATOM   1326 O O     . ILE C 3 99  ? 7.689  2.022   43.753 1.00 83.05 ? 106 ILE A O     1 
ATOM   1327 C CB    . ILE C 3 99  ? 10.532 3.908   43.569 1.00 84.54 ? 106 ILE A CB    1 
ATOM   1328 C CG1   . ILE C 3 99  ? 11.897 4.037   42.876 1.00 84.54 ? 106 ILE A CG1   1 
ATOM   1329 C CG2   . ILE C 3 99  ? 10.660 3.122   44.888 1.00 84.54 ? 106 ILE A CG2   1 
ATOM   1330 C CD1   . ILE C 3 99  ? 12.920 4.837   43.695 1.00 81.68 ? 106 ILE A CD1   1 
ATOM   1331 N N     . GLN C 3 100 ? 7.574  4.282   43.684 1.00 83.07 ? 107 GLN A N     1 
ATOM   1332 C CA    . GLN C 3 100 ? 6.332  4.340   44.427 1.00 80.73 ? 107 GLN A CA    1 
ATOM   1333 C C     . GLN C 3 100 ? 5.312  3.420   43.803 1.00 79.83 ? 107 GLN A C     1 
ATOM   1334 O O     . GLN C 3 100 ? 4.638  2.672   44.505 1.00 82.90 ? 107 GLN A O     1 
ATOM   1335 C CB    . GLN C 3 100 ? 5.778  5.758   44.454 1.00 82.70 ? 107 GLN A CB    1 
ATOM   1336 C CG    . GLN C 3 100 ? 6.774  6.799   44.923 1.00 84.54 ? 107 GLN A CG    1 
ATOM   1337 C CD    . GLN C 3 100 ? 6.104  8.116   45.271 1.00 84.54 ? 107 GLN A CD    1 
ATOM   1338 O OE1   . GLN C 3 100 ? 5.533  8.267   46.355 1.00 84.54 ? 107 GLN A OE1   1 
ATOM   1339 N NE2   . GLN C 3 100 ? 6.155  9.074   44.344 1.00 83.18 ? 107 GLN A NE2   1 
ATOM   1340 N N     . VAL C 3 101 ? 5.187  3.453   42.486 1.00 75.55 ? 108 VAL A N     1 
ATOM   1341 C CA    . VAL C 3 101 ? 4.202  2.583   41.878 1.00 74.74 ? 108 VAL A CA    1 
ATOM   1342 C C     . VAL C 3 101 ? 4.737  1.175   41.815 1.00 76.61 ? 108 VAL A C     1 
ATOM   1343 O O     . VAL C 3 101 ? 3.961  0.221   41.793 1.00 79.48 ? 108 VAL A O     1 
ATOM   1344 C CB    . VAL C 3 101 ? 3.778  3.056   40.450 1.00 73.49 ? 108 VAL A CB    1 
ATOM   1345 C CG1   . VAL C 3 101 ? 4.398  4.398   40.150 1.00 71.41 ? 108 VAL A CG1   1 
ATOM   1346 C CG2   . VAL C 3 101 ? 4.133  2.002   39.397 1.00 62.00 ? 108 VAL A CG2   1 
ATOM   1347 N N     . ASN C 3 102 ? 6.061  1.041   41.798 1.00 77.60 ? 109 ASN A N     1 
ATOM   1348 C CA    . ASN C 3 102 ? 6.684  -0.279  41.722 1.00 78.70 ? 109 ASN A CA    1 
ATOM   1349 C C     . ASN C 3 102 ? 7.998  -0.337  42.473 1.00 80.23 ? 109 ASN A C     1 
ATOM   1350 O O     . ASN C 3 102 ? 9.016  0.144   41.980 1.00 82.16 ? 109 ASN A O     1 
ATOM   1351 C CB    . ASN C 3 102 ? 6.929  -0.678  40.267 1.00 76.21 ? 109 ASN A CB    1 
ATOM   1352 C CG    . ASN C 3 102 ? 7.249  -2.141  40.129 1.00 75.21 ? 109 ASN A CG    1 
ATOM   1353 O OD1   . ASN C 3 102 ? 6.774  -2.943  40.910 1.00 74.26 ? 109 ASN A OD1   1 
ATOM   1354 N ND2   . ASN C 3 102 ? 8.042  -2.500  39.129 1.00 79.77 ? 109 ASN A ND2   1 
ATOM   1355 N N     . PRO C 3 103 ? 7.994  -0.934  43.678 1.00 81.21 ? 110 PRO A N     1 
ATOM   1356 C CA    . PRO C 3 103 ? 9.184  -1.070  44.526 1.00 81.02 ? 110 PRO A CA    1 
ATOM   1357 C C     . PRO C 3 103 ? 10.185 -2.141  44.081 1.00 78.03 ? 110 PRO A C     1 
ATOM   1358 O O     . PRO C 3 103 ? 11.196 -2.357  44.743 1.00 76.99 ? 110 PRO A O     1 
ATOM   1359 C CB    . PRO C 3 103 ? 8.589  -1.366  45.893 1.00 79.58 ? 110 PRO A CB    1 
ATOM   1360 C CG    . PRO C 3 103 ? 7.416  -2.202  45.529 1.00 81.25 ? 110 PRO A CG    1 
ATOM   1361 C CD    . PRO C 3 103 ? 6.803  -1.436  44.379 1.00 80.11 ? 110 PRO A CD    1 
ATOM   1362 N N     . ASP C 3 104 ? 9.906  -2.802  42.963 1.00 76.18 ? 111 ASP A N     1 
ATOM   1363 C CA    . ASP C 3 104 ? 10.804 -3.828  42.448 1.00 75.15 ? 111 ASP A CA    1 
ATOM   1364 C C     . ASP C 3 104 ? 12.003 -3.168  41.807 1.00 73.08 ? 111 ASP A C     1 
ATOM   1365 O O     . ASP C 3 104 ? 13.139 -3.625  41.950 1.00 71.33 ? 111 ASP A O     1 
ATOM   1366 C CB    . ASP C 3 104 ? 10.129 -4.655  41.366 1.00 78.73 ? 111 ASP A CB    1 
ATOM   1367 C CG    . ASP C 3 104 ? 8.829  -5.239  41.815 1.00 83.56 ? 111 ASP A CG    1 
ATOM   1368 O OD1   . ASP C 3 104 ? 8.839  -6.022  42.784 1.00 84.54 ? 111 ASP A OD1   1 
ATOM   1369 O OD2   . ASP C 3 104 ? 7.799  -4.917  41.195 1.00 84.54 ? 111 ASP A OD2   1 
ATOM   1370 N N     . ILE C 3 105 ? 11.738 -2.097  41.070 1.00 70.93 ? 112 ILE A N     1 
ATOM   1371 C CA    . ILE C 3 105 ? 12.810 -1.407  40.379 1.00 70.22 ? 112 ILE A CA    1 
ATOM   1372 C C     . ILE C 3 105 ? 13.839 -0.945  41.405 1.00 65.76 ? 112 ILE A C     1 
ATOM   1373 O O     . ILE C 3 105 ? 15.024 -1.212  41.258 1.00 64.55 ? 112 ILE A O     1 
ATOM   1374 C CB    . ILE C 3 105 ? 12.257 -0.213  39.484 1.00 70.20 ? 112 ILE A CB    1 
ATOM   1375 C CG1   . ILE C 3 105 ? 13.195 0.021   38.284 1.00 71.32 ? 112 ILE A CG1   1 
ATOM   1376 C CG2   . ILE C 3 105 ? 12.130 1.089   40.302 1.00 71.12 ? 112 ILE A CG2   1 
ATOM   1377 C CD1   . ILE C 3 105 ? 13.486 -1.234  37.423 1.00 69.88 ? 112 ILE A CD1   1 
ATOM   1378 N N     . LEU C 3 106 ? 13.375 -0.301  42.465 1.00 62.81 ? 113 LEU A N     1 
ATOM   1379 C CA    . LEU C 3 106 ? 14.258 0.194   43.499 1.00 62.62 ? 113 LEU A CA    1 
ATOM   1380 C C     . LEU C 3 106 ? 15.047 -0.946  44.135 1.00 69.14 ? 113 LEU A C     1 
ATOM   1381 O O     . LEU C 3 106 ? 16.211 -0.773  44.527 1.00 68.73 ? 113 LEU A O     1 
ATOM   1382 C CB    . LEU C 3 106 ? 13.436 0.932   44.544 1.00 54.76 ? 113 LEU A CB    1 
ATOM   1383 C CG    . LEU C 3 106 ? 14.093 1.312   45.862 1.00 49.77 ? 113 LEU A CG    1 
ATOM   1384 C CD1   . LEU C 3 106 ? 14.265 0.048   46.634 1.00 52.21 ? 113 LEU A CD1   1 
ATOM   1385 C CD2   . LEU C 3 106 ? 15.413 2.014   45.670 1.00 48.56 ? 113 LEU A CD2   1 
ATOM   1386 N N     . MET C 3 107 ? 14.403 -2.109  44.243 1.00 72.16 ? 114 MET A N     1 
ATOM   1387 C CA    . MET C 3 107 ? 15.033 -3.292  44.823 1.00 71.39 ? 114 MET A CA    1 
ATOM   1388 C C     . MET C 3 107 ? 16.170 -3.675  43.895 1.00 70.02 ? 114 MET A C     1 
ATOM   1389 O O     . MET C 3 107 ? 17.313 -3.750  44.324 1.00 70.21 ? 114 MET A O     1 
ATOM   1390 C CB    . MET C 3 107 ? 14.012 -4.432  44.931 1.00 74.55 ? 114 MET A CB    1 
ATOM   1391 C CG    . MET C 3 107 ? 14.448 -5.662  45.751 1.00 78.50 ? 114 MET A CG    1 
ATOM   1392 S SD    . MET C 3 107 ? 14.669 -5.456  47.567 1.00 84.08 ? 114 MET A SD    1 
ATOM   1393 C CE    . MET C 3 107 ? 13.766 -3.911  47.917 1.00 73.87 ? 114 MET A CE    1 
ATOM   1394 N N     . ARG C 3 108 ? 15.843 -3.882  42.618 1.00 69.01 ? 115 ARG A N     1 
ATOM   1395 C CA    . ARG C 3 108 ? 16.815 -4.251  41.570 1.00 66.30 ? 115 ARG A CA    1 
ATOM   1396 C C     . ARG C 3 108 ? 18.058 -3.354  41.510 1.00 63.58 ? 115 ARG A C     1 
ATOM   1397 O O     . ARG C 3 108 ? 19.160 -3.810  41.189 1.00 62.76 ? 115 ARG A O     1 
ATOM   1398 C CB    . ARG C 3 108 ? 16.138 -4.216  40.203 1.00 64.61 ? 115 ARG A CB    1 
ATOM   1399 C CG    . ARG C 3 108 ? 15.191 -5.354  39.959 1.00 67.81 ? 115 ARG A CG    1 
ATOM   1400 C CD    . ARG C 3 108 ? 15.916 -6.510  39.299 1.00 73.57 ? 115 ARG A CD    1 
ATOM   1401 N NE    . ARG C 3 108 ? 15.908 -6.436  37.838 1.00 77.04 ? 115 ARG A NE    1 
ATOM   1402 C CZ    . ARG C 3 108 ? 14.808 -6.549  37.098 1.00 83.97 ? 115 ARG A CZ    1 
ATOM   1403 N NH1   . ARG C 3 108 ? 13.630 -6.732  37.687 1.00 84.38 ? 115 ARG A NH1   1 
ATOM   1404 N NH2   . ARG C 3 108 ? 14.879 -6.507  35.770 1.00 84.43 ? 115 ARG A NH2   1 
ATOM   1405 N N     . LEU C 3 109 ? 17.865 -2.074  41.806 1.00 56.75 ? 116 LEU A N     1 
ATOM   1406 C CA    . LEU C 3 109 ? 18.947 -1.129  41.769 1.00 50.45 ? 116 LEU A CA    1 
ATOM   1407 C C     . LEU C 3 109 ? 19.835 -1.482  42.944 1.00 51.57 ? 116 LEU A C     1 
ATOM   1408 O O     . LEU C 3 109 ? 21.011 -1.790  42.760 1.00 49.34 ? 116 LEU A O     1 
ATOM   1409 C CB    . LEU C 3 109 ? 18.393 0.287   41.912 1.00 49.27 ? 116 LEU A CB    1 
ATOM   1410 C CG    . LEU C 3 109 ? 19.100 1.464   41.233 1.00 48.42 ? 116 LEU A CG    1 
ATOM   1411 C CD1   . LEU C 3 109 ? 18.562 2.772   41.772 1.00 49.04 ? 116 LEU A CD1   1 
ATOM   1412 C CD2   . LEU C 3 109 ? 20.564 1.409   41.517 1.00 44.57 ? 116 LEU A CD2   1 
ATOM   1413 N N     . SER C 3 110 ? 19.241 -1.455  44.144 1.00 51.61 ? 117 SER A N     1 
ATOM   1414 C CA    . SER C 3 110 ? 19.903 -1.761  45.433 1.00 45.02 ? 117 SER A CA    1 
ATOM   1415 C C     . SER C 3 110 ? 20.721 -3.065  45.412 1.00 43.56 ? 117 SER A C     1 
ATOM   1416 O O     . SER C 3 110 ? 21.759 -3.171  46.066 1.00 43.23 ? 117 SER A O     1 
ATOM   1417 C CB    . SER C 3 110 ? 18.859 -1.841  46.547 1.00 42.86 ? 117 SER A CB    1 
ATOM   1418 O OG    . SER C 3 110 ? 18.249 -0.591  46.792 1.00 40.46 ? 117 SER A OG    1 
ATOM   1419 N N     . ALA C 3 111 ? 20.238 -4.057  44.675 1.00 39.27 ? 118 ALA A N     1 
ATOM   1420 C CA    . ALA C 3 111 ? 20.962 -5.295  44.542 1.00 42.03 ? 118 ALA A CA    1 
ATOM   1421 C C     . ALA C 3 111 ? 22.308 -4.944  43.913 1.00 45.54 ? 118 ALA A C     1 
ATOM   1422 O O     . ALA C 3 111 ? 23.375 -5.345  44.403 1.00 46.78 ? 118 ALA A O     1 
ATOM   1423 C CB    . ALA C 3 111 ? 20.210 -6.240  43.659 1.00 35.15 ? 118 ALA A CB    1 
ATOM   1424 N N     . GLN C 3 112 ? 22.243 -4.172  42.829 1.00 49.46 ? 119 GLN A N     1 
ATOM   1425 C CA    . GLN C 3 112 ? 23.429 -3.738  42.106 1.00 47.12 ? 119 GLN A CA    1 
ATOM   1426 C C     . GLN C 3 112 ? 24.395 -2.938  42.961 1.00 43.98 ? 119 GLN A C     1 
ATOM   1427 O O     . GLN C 3 112 ? 25.605 -3.110  42.857 1.00 42.68 ? 119 GLN A O     1 
ATOM   1428 C CB    . GLN C 3 112 ? 23.008 -2.951  40.881 1.00 46.70 ? 119 GLN A CB    1 
ATOM   1429 C CG    . GLN C 3 112 ? 22.588 -3.860  39.771 1.00 46.49 ? 119 GLN A CG    1 
ATOM   1430 C CD    . GLN C 3 112 ? 22.432 -3.155  38.450 1.00 51.10 ? 119 GLN A CD    1 
ATOM   1431 O OE1   . GLN C 3 112 ? 23.112 -2.169  38.170 1.00 49.16 ? 119 GLN A OE1   1 
ATOM   1432 N NE2   . GLN C 3 112 ? 21.551 -3.672  37.615 1.00 55.81 ? 119 GLN A NE2   1 
ATOM   1433 N N     . MET C 3 113 ? 23.870 -2.068  43.813 1.00 42.42 ? 120 MET A N     1 
ATOM   1434 C CA    . MET C 3 113 ? 24.750 -1.300  44.690 1.00 46.80 ? 120 MET A CA    1 
ATOM   1435 C C     . MET C 3 113 ? 25.418 -2.301  45.646 1.00 45.77 ? 120 MET A C     1 
ATOM   1436 O O     . MET C 3 113 ? 26.612 -2.207  45.928 1.00 39.65 ? 120 MET A O     1 
ATOM   1437 C CB    . MET C 3 113 ? 23.969 -0.253  45.504 1.00 47.19 ? 120 MET A CB    1 
ATOM   1438 C CG    . MET C 3 113 ? 23.168 0.805   44.711 1.00 43.85 ? 120 MET A CG    1 
ATOM   1439 S SD    . MET C 3 113 ? 22.668 2.220   45.800 1.00 51.67 ? 120 MET A SD    1 
ATOM   1440 C CE    . MET C 3 113 ? 21.189 1.639   46.462 1.00 50.64 ? 120 MET A CE    1 
ATOM   1441 N N     . ALA C 3 114 ? 24.622 -3.261  46.125 1.00 46.99 ? 121 ALA A N     1 
ATOM   1442 C CA    . ALA C 3 114 ? 25.076 -4.310  47.040 1.00 43.04 ? 121 ALA A CA    1 
ATOM   1443 C C     . ALA C 3 114 ? 26.218 -5.072  46.406 1.00 42.15 ? 121 ALA A C     1 
ATOM   1444 O O     . ALA C 3 114 ? 27.262 -5.267  47.017 1.00 41.99 ? 121 ALA A O     1 
ATOM   1445 C CB    . ALA C 3 114 ? 23.949 -5.252  47.334 1.00 37.11 ? 121 ALA A CB    1 
ATOM   1446 N N     . ARG C 3 115 ? 26.009 -5.511  45.175 1.00 41.09 ? 122 ARG A N     1 
ATOM   1447 C CA    . ARG C 3 115 ? 27.030 -6.244  44.440 1.00 44.58 ? 122 ARG A CA    1 
ATOM   1448 C C     . ARG C 3 115 ? 28.268 -5.353  44.325 1.00 47.50 ? 122 ARG A C     1 
ATOM   1449 O O     . ARG C 3 115 ? 29.398 -5.782  44.560 1.00 49.00 ? 122 ARG A O     1 
ATOM   1450 C CB    . ARG C 3 115 ? 26.494 -6.580  43.057 1.00 46.17 ? 122 ARG A CB    1 
ATOM   1451 C CG    . ARG C 3 115 ? 27.202 -7.694  42.326 1.00 56.03 ? 122 ARG A CG    1 
ATOM   1452 C CD    . ARG C 3 115 ? 26.358 -8.152  41.094 1.00 71.12 ? 122 ARG A CD    1 
ATOM   1453 N NE    . ARG C 3 115 ? 25.072 -8.795  41.439 1.00 80.17 ? 122 ARG A NE    1 
ATOM   1454 C CZ    . ARG C 3 115 ? 23.887 -8.182  41.534 1.00 81.27 ? 122 ARG A CZ    1 
ATOM   1455 N NH1   . ARG C 3 115 ? 23.771 -6.878  41.308 1.00 84.37 ? 122 ARG A NH1   1 
ATOM   1456 N NH2   . ARG C 3 115 ? 22.807 -8.881  41.863 1.00 77.60 ? 122 ARG A NH2   1 
ATOM   1457 N N     . ARG C 3 116 ? 28.054 -4.094  43.974 1.00 46.78 ? 123 ARG A N     1 
ATOM   1458 C CA    . ARG C 3 116 ? 29.173 -3.185  43.837 1.00 44.68 ? 123 ARG A CA    1 
ATOM   1459 C C     . ARG C 3 116 ? 29.975 -3.034  45.103 1.00 42.78 ? 123 ARG A C     1 
ATOM   1460 O O     . ARG C 3 116 ? 31.186 -3.058  45.060 1.00 41.59 ? 123 ARG A O     1 
ATOM   1461 C CB    . ARG C 3 116 ? 28.684 -1.829  43.350 1.00 43.32 ? 123 ARG A CB    1 
ATOM   1462 C CG    . ARG C 3 116 ? 28.296 -1.932  41.925 1.00 41.31 ? 123 ARG A CG    1 
ATOM   1463 C CD    . ARG C 3 116 ? 27.624 -0.716  41.397 1.00 44.90 ? 123 ARG A CD    1 
ATOM   1464 N NE    . ARG C 3 116 ? 26.929 -1.073  40.169 1.00 42.72 ? 123 ARG A NE    1 
ATOM   1465 C CZ    . ARG C 3 116 ? 26.300 -0.202  39.410 1.00 39.20 ? 123 ARG A CZ    1 
ATOM   1466 N NH1   . ARG C 3 116 ? 26.308 1.069   39.781 1.00 35.58 ? 123 ARG A NH1   1 
ATOM   1467 N NH2   . ARG C 3 116 ? 25.668 -0.603  38.310 1.00 34.45 ? 123 ARG A NH2   1 
ATOM   1468 N N     . LEU C 3 117 ? 29.304 -2.881  46.232 1.00 42.59 ? 124 LEU A N     1 
ATOM   1469 C CA    . LEU C 3 117 ? 30.012 -2.720  47.481 1.00 43.04 ? 124 LEU A CA    1 
ATOM   1470 C C     . LEU C 3 117 ? 30.939 -3.905  47.696 1.00 44.89 ? 124 LEU A C     1 
ATOM   1471 O O     . LEU C 3 117 ? 32.048 -3.749  48.210 1.00 47.03 ? 124 LEU A O     1 
ATOM   1472 C CB    . LEU C 3 117 ? 29.029 -2.575  48.648 1.00 39.09 ? 124 LEU A CB    1 
ATOM   1473 C CG    . LEU C 3 117 ? 29.654 -2.132  49.972 1.00 38.08 ? 124 LEU A CG    1 
ATOM   1474 C CD1   . LEU C 3 117 ? 30.697 -1.069  49.733 1.00 43.07 ? 124 LEU A CD1   1 
ATOM   1475 C CD2   . LEU C 3 117 ? 28.587 -1.597  50.883 1.00 41.21 ? 124 LEU A CD2   1 
ATOM   1476 N N     . GLN C 3 118 ? 30.510 -5.091  47.285 1.00 44.68 ? 125 GLN A N     1 
ATOM   1477 C CA    . GLN C 3 118 ? 31.357 -6.269  47.466 1.00 46.08 ? 125 GLN A CA    1 
ATOM   1478 C C     . GLN C 3 118 ? 32.628 -6.180  46.620 1.00 42.19 ? 125 GLN A C     1 
ATOM   1479 O O     . GLN C 3 118 ? 33.721 -6.315  47.116 1.00 40.49 ? 125 GLN A O     1 
ATOM   1480 C CB    . GLN C 3 118 ? 30.567 -7.552  47.147 1.00 48.65 ? 125 GLN A CB    1 
ATOM   1481 C CG    . GLN C 3 118 ? 29.620 -7.975  48.286 1.00 60.29 ? 125 GLN A CG    1 
ATOM   1482 C CD    . GLN C 3 118 ? 28.447 -8.846  47.828 1.00 69.10 ? 125 GLN A CD    1 
ATOM   1483 O OE1   . GLN C 3 118 ? 27.563 -9.191  48.618 1.00 74.09 ? 125 GLN A OE1   1 
ATOM   1484 N NE2   . GLN C 3 118 ? 28.435 -9.196  46.547 1.00 73.96 ? 125 GLN A NE2   1 
ATOM   1485 N N     . VAL C 3 119 ? 32.475 -5.935  45.339 1.00 41.44 ? 126 VAL A N     1 
ATOM   1486 C CA    . VAL C 3 119 ? 33.612 -5.837  44.454 1.00 37.91 ? 126 VAL A CA    1 
ATOM   1487 C C     . VAL C 3 119 ? 34.576 -4.748  44.895 1.00 39.03 ? 126 VAL A C     1 
ATOM   1488 O O     . VAL C 3 119 ? 35.789 -4.926  44.873 1.00 44.42 ? 126 VAL A O     1 
ATOM   1489 C CB    . VAL C 3 119 ? 33.148 -5.525  43.006 1.00 35.09 ? 126 VAL A CB    1 
ATOM   1490 C CG1   . VAL C 3 119 ? 34.308 -5.666  42.040 1.00 33.69 ? 126 VAL A CG1   1 
ATOM   1491 C CG2   . VAL C 3 119 ? 32.019 -6.445  42.612 1.00 24.93 ? 126 VAL A CG2   1 
ATOM   1492 N N     . THR C 3 120 ? 34.049 -3.605  45.290 1.00 38.09 ? 127 THR A N     1 
ATOM   1493 C CA    . THR C 3 120 ? 34.930 -2.521  45.678 1.00 36.47 ? 127 THR A CA    1 
ATOM   1494 C C     . THR C 3 120 ? 35.617 -2.861  46.963 1.00 34.07 ? 127 THR A C     1 
ATOM   1495 O O     . THR C 3 120 ? 36.768 -2.536  47.161 1.00 36.28 ? 127 THR A O     1 
ATOM   1496 C CB    . THR C 3 120 ? 34.184 -1.183  45.830 1.00 37.34 ? 127 THR A CB    1 
ATOM   1497 O OG1   . THR C 3 120 ? 33.417 -0.916  44.643 1.00 40.13 ? 127 THR A OG1   1 
ATOM   1498 C CG2   . THR C 3 120 ? 35.185 -0.060  46.025 1.00 37.74 ? 127 THR A CG2   1 
ATOM   1499 N N     . SER C 3 121 ? 34.915 -3.526  47.855 1.00 35.35 ? 128 SER A N     1 
ATOM   1500 C CA    . SER C 3 121 ? 35.547 -3.909  49.098 1.00 34.65 ? 128 SER A CA    1 
ATOM   1501 C C     . SER C 3 121 ? 36.644 -4.926  48.783 1.00 32.74 ? 128 SER A C     1 
ATOM   1502 O O     . SER C 3 121 ? 37.746 -4.861  49.303 1.00 34.62 ? 128 SER A O     1 
ATOM   1503 C CB    . SER C 3 121 ? 34.503 -4.490  50.014 1.00 36.36 ? 128 SER A CB    1 
ATOM   1504 O OG    . SER C 3 121 ? 33.416 -3.592  50.099 1.00 41.62 ? 128 SER A OG    1 
ATOM   1505 N N     . GLU C 3 122 ? 36.330 -5.856  47.904 1.00 33.30 ? 129 GLU A N     1 
ATOM   1506 C CA    . GLU C 3 122 ? 37.259 -6.883  47.483 1.00 37.10 ? 129 GLU A CA    1 
ATOM   1507 C C     . GLU C 3 122 ? 38.472 -6.231  46.880 1.00 38.04 ? 129 GLU A C     1 
ATOM   1508 O O     . GLU C 3 122 ? 39.603 -6.676  47.082 1.00 35.37 ? 129 GLU A O     1 
ATOM   1509 C CB    . GLU C 3 122 ? 36.583 -7.779  46.452 1.00 41.72 ? 129 GLU A CB    1 
ATOM   1510 C CG    . GLU C 3 122 ? 37.457 -8.789  45.757 1.00 55.31 ? 129 GLU A CG    1 
ATOM   1511 C CD    . GLU C 3 122 ? 36.629 -9.761  44.916 1.00 66.18 ? 129 GLU A CD    1 
ATOM   1512 O OE1   . GLU C 3 122 ? 35.789 -9.295  44.112 1.00 73.85 ? 129 GLU A OE1   1 
ATOM   1513 O OE2   . GLU C 3 122 ? 36.804 -10.993 45.058 1.00 70.17 ? 129 GLU A OE2   1 
ATOM   1514 N N     . LYS C 3 123 ? 38.222 -5.165  46.136 1.00 39.41 ? 130 LYS A N     1 
ATOM   1515 C CA    . LYS C 3 123 ? 39.285 -4.449  45.459 1.00 41.21 ? 130 LYS A CA    1 
ATOM   1516 C C     . LYS C 3 123 ? 40.159 -3.712  46.476 1.00 41.21 ? 130 LYS A C     1 
ATOM   1517 O O     . LYS C 3 123 ? 41.351 -3.475  46.236 1.00 40.77 ? 130 LYS A O     1 
ATOM   1518 C CB    . LYS C 3 123 ? 38.680 -3.482  44.435 1.00 40.85 ? 130 LYS A CB    1 
ATOM   1519 C CG    . LYS C 3 123 ? 39.712 -2.773  43.595 1.00 42.46 ? 130 LYS A CG    1 
ATOM   1520 C CD    . LYS C 3 123 ? 39.070 -1.839  42.615 1.00 48.57 ? 130 LYS A CD    1 
ATOM   1521 C CE    . LYS C 3 123 ? 38.028 -2.548  41.780 1.00 52.00 ? 130 LYS A CE    1 
ATOM   1522 N NZ    . LYS C 3 123 ? 38.529 -3.750  41.050 1.00 54.36 ? 130 LYS A NZ    1 
ATOM   1523 N N     . VAL C 3 124 ? 39.559 -3.344  47.611 1.00 36.53 ? 131 VAL A N     1 
ATOM   1524 C CA    . VAL C 3 124 ? 40.315 -2.675  48.654 1.00 32.90 ? 131 VAL A CA    1 
ATOM   1525 C C     . VAL C 3 124 ? 41.274 -3.685  49.237 1.00 32.37 ? 131 VAL A C     1 
ATOM   1526 O O     . VAL C 3 124 ? 42.424 -3.374  49.483 1.00 31.43 ? 131 VAL A O     1 
ATOM   1527 C CB    . VAL C 3 124 ? 39.443 -2.162  49.786 1.00 30.58 ? 131 VAL A CB    1 
ATOM   1528 C CG1   . VAL C 3 124 ? 40.340 -1.563  50.889 1.00 24.45 ? 131 VAL A CG1   1 
ATOM   1529 C CG2   . VAL C 3 124 ? 38.479 -1.134  49.253 1.00 23.65 ? 131 VAL A CG2   1 
ATOM   1530 N N     . GLY C 3 125 ? 40.791 -4.899  49.449 1.00 30.12 ? 132 GLY A N     1 
ATOM   1531 C CA    . GLY C 3 125 ? 41.652 -5.924  49.988 1.00 33.21 ? 132 GLY A CA    1 
ATOM   1532 C C     . GLY C 3 125 ? 42.816 -6.122  49.046 1.00 36.27 ? 132 GLY A C     1 
ATOM   1533 O O     . GLY C 3 125 ? 43.978 -6.013  49.424 1.00 36.02 ? 132 GLY A O     1 
ATOM   1534 N N     . ASN C 3 126 ? 42.479 -6.409  47.795 1.00 40.66 ? 133 ASN A N     1 
ATOM   1535 C CA    . ASN C 3 126 ? 43.450 -6.646  46.737 1.00 39.20 ? 133 ASN A CA    1 
ATOM   1536 C C     . ASN C 3 126 ? 44.638 -5.709  46.787 1.00 40.83 ? 133 ASN A C     1 
ATOM   1537 O O     . ASN C 3 126 ? 45.763 -6.145  46.714 1.00 42.99 ? 133 ASN A O     1 
ATOM   1538 C CB    . ASN C 3 126 ? 42.747 -6.541  45.397 1.00 33.20 ? 133 ASN A CB    1 
ATOM   1539 C CG    . ASN C 3 126 ? 41.954 -7.775  45.069 1.00 35.51 ? 133 ASN A CG    1 
ATOM   1540 O OD1   . ASN C 3 126 ? 41.035 -7.735  44.277 1.00 35.61 ? 133 ASN A OD1   1 
ATOM   1541 N ND2   . ASN C 3 126 ? 42.327 -8.890  45.663 1.00 36.26 ? 133 ASN A ND2   1 
ATOM   1542 N N     . LEU C 3 127 ? 44.388 -4.417  46.911 1.00 44.60 ? 134 LEU A N     1 
ATOM   1543 C CA    . LEU C 3 127 ? 45.475 -3.450  46.983 1.00 44.39 ? 134 LEU A CA    1 
ATOM   1544 C C     . LEU C 3 127 ? 46.230 -3.564  48.311 1.00 44.73 ? 134 LEU A C     1 
ATOM   1545 O O     . LEU C 3 127 ? 47.447 -3.601  48.352 1.00 50.97 ? 134 LEU A O     1 
ATOM   1546 C CB    . LEU C 3 127 ? 44.920 -2.038  46.847 1.00 35.66 ? 134 LEU A CB    1 
ATOM   1547 C CG    . LEU C 3 127 ? 44.234 -1.717  45.540 1.00 27.88 ? 134 LEU A CG    1 
ATOM   1548 C CD1   . LEU C 3 127 ? 43.180 -0.719  45.798 1.00 34.39 ? 134 LEU A CD1   1 
ATOM   1549 C CD2   . LEU C 3 127 ? 45.221 -1.166  44.544 1.00 31.27 ? 134 LEU A CD2   1 
ATOM   1550 N N     . ALA C 3 128 ? 45.497 -3.609  49.404 1.00 40.87 ? 135 ALA A N     1 
ATOM   1551 C CA    . ALA C 3 128 ? 46.119 -3.690  50.698 1.00 39.74 ? 135 ALA A CA    1 
ATOM   1552 C C     . ALA C 3 128 ? 46.887 -4.997  50.787 1.00 44.27 ? 135 ALA A C     1 
ATOM   1553 O O     . ALA C 3 128 ? 47.965 -5.058  51.355 1.00 41.96 ? 135 ALA A O     1 
ATOM   1554 C CB    . ALA C 3 128 ? 45.038 -3.626  51.782 1.00 32.58 ? 135 ALA A CB    1 
ATOM   1555 N N     . PHE C 3 129 ? 46.346 -6.035  50.161 1.00 49.96 ? 136 PHE A N     1 
ATOM   1556 C CA    . PHE C 3 129 ? 46.926 -7.372  50.247 1.00 48.54 ? 136 PHE A CA    1 
ATOM   1557 C C     . PHE C 3 129 ? 47.807 -7.993  49.179 1.00 47.89 ? 136 PHE A C     1 
ATOM   1558 O O     . PHE C 3 129 ? 48.576 -8.877  49.498 1.00 56.39 ? 136 PHE A O     1 
ATOM   1559 C CB    . PHE C 3 129 ? 45.815 -8.368  50.534 1.00 43.18 ? 136 PHE A CB    1 
ATOM   1560 C CG    . PHE C 3 129 ? 45.131 -8.149  51.827 1.00 39.40 ? 136 PHE A CG    1 
ATOM   1561 C CD1   . PHE C 3 129 ? 45.864 -7.898  52.980 1.00 43.32 ? 136 PHE A CD1   1 
ATOM   1562 C CD2   . PHE C 3 129 ? 43.751 -8.257  51.913 1.00 40.19 ? 136 PHE A CD2   1 
ATOM   1563 C CE1   . PHE C 3 129 ? 45.231 -7.762  54.200 1.00 43.92 ? 136 PHE A CE1   1 
ATOM   1564 C CE2   . PHE C 3 129 ? 43.103 -8.126  53.129 1.00 42.57 ? 136 PHE A CE2   1 
ATOM   1565 C CZ    . PHE C 3 129 ? 43.845 -7.878  54.278 1.00 46.24 ? 136 PHE A CZ    1 
ATOM   1566 N N     . LEU C 3 130 ? 47.699 -7.590  47.928 1.00 44.91 ? 137 LEU A N     1 
ATOM   1567 C CA    . LEU C 3 130 ? 48.533 -8.203  46.896 1.00 43.85 ? 137 LEU A CA    1 
ATOM   1568 C C     . LEU C 3 130 ? 49.528 -7.240  46.266 1.00 45.47 ? 137 LEU A C     1 
ATOM   1569 O O     . LEU C 3 130 ? 49.324 -6.021  46.296 1.00 43.93 ? 137 LEU A O     1 
ATOM   1570 C CB    . LEU C 3 130 ? 47.662 -8.767  45.779 1.00 43.44 ? 137 LEU A CB    1 
ATOM   1571 C CG    . LEU C 3 130 ? 46.531 -9.703  46.175 1.00 42.20 ? 137 LEU A CG    1 
ATOM   1572 C CD1   . LEU C 3 130 ? 45.678 -10.041 44.949 1.00 32.70 ? 137 LEU A CD1   1 
ATOM   1573 C CD2   . LEU C 3 130 ? 47.123 -10.938 46.813 1.00 40.77 ? 137 LEU A CD2   1 
ATOM   1574 N N     . ASP C 3 131 ? 50.604 -7.795  45.701 1.00 47.02 ? 138 ASP A N     1 
ATOM   1575 C CA    . ASP C 3 131 ? 51.610 -6.985  45.004 1.00 47.15 ? 138 ASP A CA    1 
ATOM   1576 C C     . ASP C 3 131 ? 51.143 -6.823  43.579 1.00 42.18 ? 138 ASP A C     1 
ATOM   1577 O O     . ASP C 3 131 ? 50.228 -7.514  43.149 1.00 40.75 ? 138 ASP A O     1 
ATOM   1578 C CB    . ASP C 3 131 ? 53.034 -7.599  45.061 1.00 54.08 ? 138 ASP A CB    1 
ATOM   1579 C CG    . ASP C 3 131 ? 53.076 -9.128  44.816 1.00 63.14 ? 138 ASP A CG    1 
ATOM   1580 O OD1   . ASP C 3 131 ? 54.107 -9.750  45.185 1.00 63.67 ? 138 ASP A OD1   1 
ATOM   1581 O OD2   . ASP C 3 131 ? 52.118 -9.713  44.257 1.00 64.49 ? 138 ASP A OD2   1 
ATOM   1582 N N     . VAL C 3 132 ? 51.739 -5.890  42.857 1.00 40.31 ? 139 VAL A N     1 
ATOM   1583 C CA    . VAL C 3 132 ? 51.349 -5.639  41.487 1.00 37.50 ? 139 VAL A CA    1 
ATOM   1584 C C     . VAL C 3 132 ? 51.252 -6.907  40.648 1.00 41.19 ? 139 VAL A C     1 
ATOM   1585 O O     . VAL C 3 132 ? 50.267 -7.118  39.934 1.00 41.31 ? 139 VAL A O     1 
ATOM   1586 C CB    . VAL C 3 132 ? 52.333 -4.747  40.805 1.00 35.67 ? 139 VAL A CB    1 
ATOM   1587 C CG1   . VAL C 3 132 ? 51.807 -4.383  39.415 1.00 41.20 ? 139 VAL A CG1   1 
ATOM   1588 C CG2   . VAL C 3 132 ? 52.578 -3.538  41.638 1.00 36.95 ? 139 VAL A CG2   1 
ATOM   1589 N N     . THR C 3 133 ? 52.292 -7.736  40.715 1.00 40.11 ? 140 THR A N     1 
ATOM   1590 C CA    . THR C 3 133 ? 52.306 -8.975  39.958 1.00 36.35 ? 140 THR A CA    1 
ATOM   1591 C C     . THR C 3 133 ? 51.037 -9.689  40.284 1.00 32.20 ? 140 THR A C     1 
ATOM   1592 O O     . THR C 3 133 ? 50.289 -10.046 39.389 1.00 34.51 ? 140 THR A O     1 
ATOM   1593 C CB    . THR C 3 133 ? 53.470 -9.927  40.356 1.00 39.88 ? 140 THR A CB    1 
ATOM   1594 O OG1   . THR C 3 133 ? 54.730 -9.297  40.117 1.00 45.02 ? 140 THR A OG1   1 
ATOM   1595 C CG2   . THR C 3 133 ? 53.408 -11.211 39.544 1.00 31.34 ? 140 THR A CG2   1 
ATOM   1596 N N     . GLY C 3 134 ? 50.808 -9.895  41.580 1.00 29.70 ? 141 GLY A N     1 
ATOM   1597 C CA    . GLY C 3 134 ? 49.627 -10.604 42.044 1.00 35.07 ? 141 GLY A CA    1 
ATOM   1598 C C     . GLY C 3 134 ? 48.335 -10.019 41.539 1.00 36.84 ? 141 GLY A C     1 
ATOM   1599 O O     . GLY C 3 134 ? 47.413 -10.745 41.141 1.00 34.70 ? 141 GLY A O     1 
ATOM   1600 N N     . ARG C 3 135 ? 48.284 -8.690  41.559 1.00 38.60 ? 142 ARG A N     1 
ATOM   1601 C CA    . ARG C 3 135 ? 47.121 -7.957  41.094 1.00 38.76 ? 142 ARG A CA    1 
ATOM   1602 C C     . ARG C 3 135 ? 47.035 -8.101  39.591 1.00 37.18 ? 142 ARG A C     1 
ATOM   1603 O O     . ARG C 3 135 ? 46.034 -8.557  39.078 1.00 40.12 ? 142 ARG A O     1 
ATOM   1604 C CB    . ARG C 3 135 ? 47.216 -6.490  41.540 1.00 38.28 ? 142 ARG A CB    1 
ATOM   1605 C CG    . ARG C 3 135 ? 47.513 -6.390  43.059 1.00 45.12 ? 142 ARG A CG    1 
ATOM   1606 C CD    . ARG C 3 135 ? 46.687 -5.357  43.825 1.00 40.27 ? 142 ARG A CD    1 
ATOM   1607 N NE    . ARG C 3 135 ? 46.982 -4.001  43.401 1.00 38.69 ? 142 ARG A NE    1 
ATOM   1608 C CZ    . ARG C 3 135 ? 48.135 -3.395  43.608 1.00 36.68 ? 142 ARG A CZ    1 
ATOM   1609 N NH1   . ARG C 3 135 ? 49.100 -4.026  44.239 1.00 42.16 ? 142 ARG A NH1   1 
ATOM   1610 N NH2   . ARG C 3 135 ? 48.329 -2.170  43.167 1.00 38.79 ? 142 ARG A NH2   1 
ATOM   1611 N N     . ILE C 3 136 ? 48.093 -7.752  38.878 1.00 38.24 ? 143 ILE A N     1 
ATOM   1612 C CA    . ILE C 3 136 ? 48.078 -7.904  37.425 1.00 39.30 ? 143 ILE A CA    1 
ATOM   1613 C C     . ILE C 3 136 ? 47.642 -9.308  37.006 1.00 39.34 ? 143 ILE A C     1 
ATOM   1614 O O     . ILE C 3 136 ? 46.807 -9.460  36.132 1.00 42.09 ? 143 ILE A O     1 
ATOM   1615 C CB    . ILE C 3 136 ? 49.471 -7.623  36.791 1.00 38.45 ? 143 ILE A CB    1 
ATOM   1616 C CG1   . ILE C 3 136 ? 49.805 -6.135  36.940 1.00 40.20 ? 143 ILE A CG1   1 
ATOM   1617 C CG2   . ILE C 3 136 ? 49.488 -8.071  35.328 1.00 26.69 ? 143 ILE A CG2   1 
ATOM   1618 C CD1   . ILE C 3 136 ? 51.046 -5.697  36.218 1.00 40.97 ? 143 ILE A CD1   1 
ATOM   1619 N N     . ALA C 3 137 ? 48.200 -10.333 37.629 1.00 38.77 ? 144 ALA A N     1 
ATOM   1620 C CA    . ALA C 3 137 ? 47.847 -11.705 37.273 1.00 41.58 ? 144 ALA A CA    1 
ATOM   1621 C C     . ALA C 3 137 ? 46.346 -11.943 37.318 1.00 45.03 ? 144 ALA A C     1 
ATOM   1622 O O     . ALA C 3 137 ? 45.747 -12.470 36.367 1.00 43.69 ? 144 ALA A O     1 
ATOM   1623 C CB    . ALA C 3 137 ? 48.532 -12.666 38.200 1.00 35.21 ? 144 ALA A CB    1 
ATOM   1624 N N     . GLN C 3 138 ? 45.757 -11.553 38.447 1.00 48.03 ? 145 GLN A N     1 
ATOM   1625 C CA    . GLN C 3 138 ? 44.337 -11.707 38.696 1.00 45.89 ? 145 GLN A CA    1 
ATOM   1626 C C     . GLN C 3 138 ? 43.514 -10.969 37.651 1.00 45.12 ? 145 GLN A C     1 
ATOM   1627 O O     . GLN C 3 138 ? 42.485 -11.464 37.181 1.00 47.72 ? 145 GLN A O     1 
ATOM   1628 C CB    . GLN C 3 138 ? 44.011 -11.192 40.077 1.00 48.37 ? 145 GLN A CB    1 
ATOM   1629 C CG    . GLN C 3 138 ? 42.646 -11.595 40.500 1.00 59.23 ? 145 GLN A CG    1 
ATOM   1630 C CD    . GLN C 3 138 ? 42.379 -11.246 41.921 1.00 63.49 ? 145 GLN A CD    1 
ATOM   1631 O OE1   . GLN C 3 138 ? 41.763 -10.222 42.211 1.00 64.88 ? 145 GLN A OE1   1 
ATOM   1632 N NE2   . GLN C 3 138 ? 42.860 -12.090 42.837 1.00 67.51 ? 145 GLN A NE2   1 
ATOM   1633 N N     . THR C 3 139 ? 43.962 -9.784  37.282 1.00 37.02 ? 146 THR A N     1 
ATOM   1634 C CA    . THR C 3 139 ? 43.268 -9.038  36.266 1.00 38.93 ? 146 THR A CA    1 
ATOM   1635 C C     . THR C 3 139 ? 43.314 -9.783  34.893 1.00 43.66 ? 146 THR A C     1 
ATOM   1636 O O     . THR C 3 139 ? 42.355 -9.745  34.111 1.00 44.06 ? 146 THR A O     1 
ATOM   1637 C CB    . THR C 3 139 ? 43.912 -7.657  36.164 1.00 36.18 ? 146 THR A CB    1 
ATOM   1638 O OG1   . THR C 3 139 ? 43.980 -7.113  37.479 1.00 33.97 ? 146 THR A OG1   1 
ATOM   1639 C CG2   . THR C 3 139 ? 43.110 -6.713  35.251 1.00 22.45 ? 146 THR A CG2   1 
ATOM   1640 N N     . LEU C 3 140 ? 44.422 -10.464 34.602 1.00 42.04 ? 147 LEU A N     1 
ATOM   1641 C CA    . LEU C 3 140 ? 44.529 -11.168 33.336 1.00 41.24 ? 147 LEU A CA    1 
ATOM   1642 C C     . LEU C 3 140 ? 43.600 -12.386 33.309 1.00 43.14 ? 147 LEU A C     1 
ATOM   1643 O O     . LEU C 3 140 ? 43.059 -12.740 32.250 1.00 38.44 ? 147 LEU A O     1 
ATOM   1644 C CB    . LEU C 3 140 ? 45.991 -11.561 33.063 1.00 35.39 ? 147 LEU A CB    1 
ATOM   1645 C CG    . LEU C 3 140 ? 46.962 -10.404 32.773 1.00 33.90 ? 147 LEU A CG    1 
ATOM   1646 C CD1   . LEU C 3 140 ? 48.367 -10.926 32.552 1.00 23.23 ? 147 LEU A CD1   1 
ATOM   1647 C CD2   . LEU C 3 140 ? 46.509 -9.635  31.549 1.00 29.24 ? 147 LEU A CD2   1 
ATOM   1648 N N     . LEU C 3 141 ? 43.399 -13.012 34.473 1.00 44.28 ? 148 LEU A N     1 
ATOM   1649 C CA    . LEU C 3 141 ? 42.509 -14.175 34.579 1.00 47.98 ? 148 LEU A CA    1 
ATOM   1650 C C     . LEU C 3 141 ? 41.038 -13.779 34.409 1.00 51.32 ? 148 LEU A C     1 
ATOM   1651 O O     . LEU C 3 141 ? 40.283 -14.463 33.716 1.00 51.33 ? 148 LEU A O     1 
ATOM   1652 C CB    . LEU C 3 141 ? 42.690 -14.883 35.925 1.00 48.63 ? 148 LEU A CB    1 
ATOM   1653 C CG    . LEU C 3 141 ? 43.123 -16.359 35.890 1.00 50.15 ? 148 LEU A CG    1 
ATOM   1654 C CD1   . LEU C 3 141 ? 42.074 -17.183 35.192 1.00 47.35 ? 148 LEU A CD1   1 
ATOM   1655 C CD2   . LEU C 3 141 ? 44.482 -16.492 35.159 1.00 53.64 ? 148 LEU A CD2   1 
ATOM   1656 N N     . ASN C 3 142 ? 40.631 -12.678 35.037 1.00 53.12 ? 149 ASN A N     1 
ATOM   1657 C CA    . ASN C 3 142 ? 39.260 -12.206 34.916 1.00 50.83 ? 149 ASN A CA    1 
ATOM   1658 C C     . ASN C 3 142 ? 38.970 -11.816 33.480 1.00 48.79 ? 149 ASN A C     1 
ATOM   1659 O O     . ASN C 3 142 ? 38.051 -12.340 32.863 1.00 52.41 ? 149 ASN A O     1 
ATOM   1660 C CB    . ASN C 3 142 ? 39.032 -11.016 35.835 1.00 57.51 ? 149 ASN A CB    1 
ATOM   1661 C CG    . ASN C 3 142 ? 39.054 -11.405 37.295 1.00 66.52 ? 149 ASN A CG    1 
ATOM   1662 O OD1   . ASN C 3 142 ? 39.133 -10.547 38.173 1.00 74.94 ? 149 ASN A OD1   1 
ATOM   1663 N ND2   . ASN C 3 142 ? 38.981 -12.706 37.568 1.00 67.67 ? 149 ASN A ND2   1 
ATOM   1664 N N     . LEU C 3 143 ? 39.752 -10.894 32.942 1.00 46.37 ? 150 LEU A N     1 
ATOM   1665 C CA    . LEU C 3 143 ? 39.551 -10.480 31.566 1.00 48.94 ? 150 LEU A CA    1 
ATOM   1666 C C     . LEU C 3 143 ? 39.479 -11.702 30.658 1.00 50.82 ? 150 LEU A C     1 
ATOM   1667 O O     . LEU C 3 143 ? 38.500 -11.911 29.950 1.00 49.12 ? 150 LEU A O     1 
ATOM   1668 C CB    . LEU C 3 143 ? 40.694 -9.587  31.126 1.00 49.19 ? 150 LEU A CB    1 
ATOM   1669 C CG    . LEU C 3 143 ? 40.757 -8.296  31.932 1.00 49.88 ? 150 LEU A CG    1 
ATOM   1670 C CD1   . LEU C 3 143 ? 41.978 -7.474  31.539 1.00 51.36 ? 150 LEU A CD1   1 
ATOM   1671 C CD2   . LEU C 3 143 ? 39.492 -7.519  31.683 1.00 48.01 ? 150 LEU A CD2   1 
ATOM   1672 N N     . ALA C 3 144 ? 40.528 -12.513 30.703 1.00 53.87 ? 151 ALA A N     1 
ATOM   1673 C CA    . ALA C 3 144 ? 40.630 -13.725 29.895 1.00 55.52 ? 151 ALA A CA    1 
ATOM   1674 C C     . ALA C 3 144 ? 39.423 -14.635 29.985 1.00 56.88 ? 151 ALA A C     1 
ATOM   1675 O O     . ALA C 3 144 ? 39.181 -15.428 29.079 1.00 53.19 ? 151 ALA A O     1 
ATOM   1676 C CB    . ALA C 3 144 ? 41.862 -14.505 30.294 1.00 56.63 ? 151 ALA A CB    1 
ATOM   1677 N N     . LYS C 3 145 ? 38.669 -14.549 31.074 1.00 58.30 ? 152 LYS A N     1 
ATOM   1678 C CA    . LYS C 3 145 ? 37.516 -15.417 31.193 1.00 60.78 ? 152 LYS A CA    1 
ATOM   1679 C C     . LYS C 3 145 ? 36.194 -14.684 31.049 1.00 62.83 ? 152 LYS A C     1 
ATOM   1680 O O     . LYS C 3 145 ? 35.219 -15.024 31.699 1.00 63.16 ? 152 LYS A O     1 
ATOM   1681 C CB    . LYS C 3 145 ? 37.566 -16.210 32.506 1.00 60.48 ? 152 LYS A CB    1 
ATOM   1682 C CG    . LYS C 3 145 ? 37.287 -15.430 33.760 1.00 61.75 ? 152 LYS A CG    1 
ATOM   1683 C CD    . LYS C 3 145 ? 36.991 -16.360 34.955 1.00 64.57 ? 152 LYS A CD    1 
ATOM   1684 C CE    . LYS C 3 145 ? 38.253 -16.948 35.601 1.00 67.88 ? 152 LYS A CE    1 
ATOM   1685 N NZ    . LYS C 3 145 ? 39.089 -17.732 34.641 1.00 66.20 ? 152 LYS A NZ    1 
ATOM   1686 N N     . GLN C 3 146 ? 36.162 -13.692 30.165 1.00 68.04 ? 153 GLN A N     1 
ATOM   1687 C CA    . GLN C 3 146 ? 34.949 -12.908 29.905 1.00 71.85 ? 153 GLN A CA    1 
ATOM   1688 C C     . GLN C 3 146 ? 34.378 -13.121 28.500 1.00 72.12 ? 153 GLN A C     1 
ATOM   1689 O O     . GLN C 3 146 ? 35.045 -13.659 27.610 1.00 70.21 ? 153 GLN A O     1 
ATOM   1690 C CB    . GLN C 3 146 ? 35.221 -11.412 30.090 1.00 73.79 ? 153 GLN A CB    1 
ATOM   1691 C CG    . GLN C 3 146 ? 35.705 -11.030 31.468 1.00 77.74 ? 153 GLN A CG    1 
ATOM   1692 C CD    . GLN C 3 146 ? 35.888 -9.534  31.610 1.00 84.44 ? 153 GLN A CD    1 
ATOM   1693 O OE1   . GLN C 3 146 ? 36.301 -8.844  30.664 1.00 84.54 ? 153 GLN A OE1   1 
ATOM   1694 N NE2   . GLN C 3 146 ? 35.596 -9.019  32.800 1.00 84.54 ? 153 GLN A NE2   1 
ATOM   1695 N N     . PRO C 3 147 ? 33.122 -12.696 28.290 1.00 74.11 ? 154 PRO A N     1 
ATOM   1696 C CA    . PRO C 3 147 ? 32.430 -12.821 27.006 1.00 73.46 ? 154 PRO A CA    1 
ATOM   1697 C C     . PRO C 3 147 ? 33.206 -12.271 25.814 1.00 71.43 ? 154 PRO A C     1 
ATOM   1698 O O     . PRO C 3 147 ? 33.105 -12.808 24.706 1.00 70.25 ? 154 PRO A O     1 
ATOM   1699 C CB    . PRO C 3 147 ? 31.123 -12.059 27.242 1.00 73.89 ? 154 PRO A CB    1 
ATOM   1700 C CG    . PRO C 3 147 ? 31.449 -11.119 28.390 1.00 76.44 ? 154 PRO A CG    1 
ATOM   1701 C CD    . PRO C 3 147 ? 32.249 -12.031 29.271 1.00 76.91 ? 154 PRO A CD    1 
ATOM   1702 N N     . ASP C 3 148 ? 33.980 -11.212 26.042 1.00 66.60 ? 155 ASP A N     1 
ATOM   1703 C CA    . ASP C 3 148 ? 34.748 -10.606 24.967 1.00 64.98 ? 155 ASP A CA    1 
ATOM   1704 C C     . ASP C 3 148 ? 36.103 -11.276 24.731 1.00 63.97 ? 155 ASP A C     1 
ATOM   1705 O O     . ASP C 3 148 ? 36.666 -11.160 23.647 1.00 63.10 ? 155 ASP A O     1 
ATOM   1706 C CB    . ASP C 3 148 ? 34.950 -9.128  25.247 1.00 65.64 ? 155 ASP A CB    1 
ATOM   1707 C CG    . ASP C 3 148 ? 35.719 -8.888  26.521 1.00 76.05 ? 155 ASP A CG    1 
ATOM   1708 O OD1   . ASP C 3 148 ? 35.958 -7.711  26.857 1.00 78.64 ? 155 ASP A OD1   1 
ATOM   1709 O OD2   . ASP C 3 148 ? 36.085 -9.879  27.191 1.00 81.47 ? 155 ASP A OD2   1 
ATOM   1710 N N     . ALA C 3 149 ? 36.641 -11.967 25.735 1.00 63.70 ? 156 ALA A N     1 
ATOM   1711 C CA    . ALA C 3 149 ? 37.926 -12.638 25.551 1.00 62.44 ? 156 ALA A CA    1 
ATOM   1712 C C     . ALA C 3 149 ? 37.770 -13.484 24.289 1.00 62.29 ? 156 ALA A C     1 
ATOM   1713 O O     . ALA C 3 149 ? 36.661 -13.887 23.967 1.00 61.23 ? 156 ALA A O     1 
ATOM   1714 C CB    . ALA C 3 149 ? 38.244 -13.517 26.746 1.00 58.06 ? 156 ALA A CB    1 
ATOM   1715 N N     . MET C 3 150 ? 38.863 -13.735 23.570 1.00 62.83 ? 157 MET A N     1 
ATOM   1716 C CA    . MET C 3 150 ? 38.810 -14.522 22.336 1.00 62.80 ? 157 MET A CA    1 
ATOM   1717 C C     . MET C 3 150 ? 39.363 -15.911 22.550 1.00 60.12 ? 157 MET A C     1 
ATOM   1718 O O     . MET C 3 150 ? 40.073 -16.156 23.506 1.00 62.64 ? 157 MET A O     1 
ATOM   1719 C CB    . MET C 3 150 ? 39.619 -13.852 21.214 1.00 67.90 ? 157 MET A CB    1 
ATOM   1720 C CG    . MET C 3 150 ? 39.080 -12.520 20.698 1.00 72.15 ? 157 MET A CG    1 
ATOM   1721 S SD    . MET C 3 150 ? 40.395 -11.275 20.720 1.00 83.94 ? 157 MET A SD    1 
ATOM   1722 C CE    . MET C 3 150 ? 39.899 -10.187 22.142 1.00 73.95 ? 157 MET A CE    1 
ATOM   1723 N N     . THR C 3 151 ? 39.033 -16.811 21.635 1.00 58.97 ? 158 THR A N     1 
ATOM   1724 C CA    . THR C 3 151 ? 39.486 -18.198 21.679 1.00 59.59 ? 158 THR A CA    1 
ATOM   1725 C C     . THR C 3 151 ? 40.891 -18.290 21.107 1.00 54.77 ? 158 THR A C     1 
ATOM   1726 O O     . THR C 3 151 ? 41.261 -17.482 20.262 1.00 57.66 ? 158 THR A O     1 
ATOM   1727 C CB    . THR C 3 151 ? 38.524 -19.113 20.867 1.00 62.87 ? 158 THR A CB    1 
ATOM   1728 O OG1   . THR C 3 151 ? 37.419 -19.490 21.699 1.00 62.39 ? 158 THR A OG1   1 
ATOM   1729 C CG2   . THR C 3 151 ? 39.242 -20.375 20.365 1.00 68.21 ? 158 THR A CG2   1 
ATOM   1730 N N     . HIS C 3 152 ? 41.660 -19.283 21.551 1.00 50.43 ? 159 HIS A N     1 
ATOM   1731 C CA    . HIS C 3 152 ? 43.042 -19.448 21.098 1.00 49.82 ? 159 HIS A CA    1 
ATOM   1732 C C     . HIS C 3 152 ? 43.555 -20.830 21.466 1.00 50.34 ? 159 HIS A C     1 
ATOM   1733 O O     . HIS C 3 152 ? 43.427 -21.262 22.601 1.00 52.15 ? 159 HIS A O     1 
ATOM   1734 C CB    . HIS C 3 152 ? 43.925 -18.391 21.784 1.00 49.11 ? 159 HIS A CB    1 
ATOM   1735 C CG    . HIS C 3 152 ? 45.352 -18.371 21.325 1.00 47.26 ? 159 HIS A CG    1 
ATOM   1736 N ND1   . HIS C 3 152 ? 45.882 -17.332 20.589 1.00 48.40 ? 159 HIS A ND1   1 
ATOM   1737 C CD2   . HIS C 3 152 ? 46.379 -19.222 21.561 1.00 46.43 ? 159 HIS A CD2   1 
ATOM   1738 C CE1   . HIS C 3 152 ? 47.171 -17.538 20.395 1.00 43.87 ? 159 HIS A CE1   1 
ATOM   1739 N NE2   . HIS C 3 152 ? 47.497 -18.680 20.973 1.00 48.35 ? 159 HIS A NE2   1 
ATOM   1740 N N     . PRO C 3 153 ? 44.169 -21.537 20.512 1.00 50.61 ? 160 PRO A N     1 
ATOM   1741 C CA    . PRO C 3 153 ? 44.688 -22.877 20.826 1.00 47.11 ? 160 PRO A CA    1 
ATOM   1742 C C     . PRO C 3 153 ? 45.334 -23.038 22.207 1.00 48.33 ? 160 PRO A C     1 
ATOM   1743 O O     . PRO C 3 153 ? 45.118 -24.037 22.893 1.00 49.16 ? 160 PRO A O     1 
ATOM   1744 C CB    . PRO C 3 153 ? 45.705 -23.130 19.709 1.00 43.18 ? 160 PRO A CB    1 
ATOM   1745 C CG    . PRO C 3 153 ? 46.043 -21.738 19.191 1.00 44.17 ? 160 PRO A CG    1 
ATOM   1746 C CD    . PRO C 3 153 ? 44.709 -21.052 19.229 1.00 47.56 ? 160 PRO A CD    1 
ATOM   1747 N N     . ASP C 3 154 ? 46.106 -22.043 22.623 1.00 49.15 ? 161 ASP A N     1 
ATOM   1748 C CA    . ASP C 3 154 ? 46.822 -22.135 23.883 1.00 49.12 ? 161 ASP A CA    1 
ATOM   1749 C C     . ASP C 3 154 ? 46.119 -21.626 25.143 1.00 48.29 ? 161 ASP A C     1 
ATOM   1750 O O     . ASP C 3 154 ? 46.655 -21.739 26.237 1.00 49.78 ? 161 ASP A O     1 
ATOM   1751 C CB    . ASP C 3 154 ? 48.166 -21.429 23.731 1.00 55.05 ? 161 ASP A CB    1 
ATOM   1752 C CG    . ASP C 3 154 ? 48.815 -21.676 22.369 1.00 58.37 ? 161 ASP A CG    1 
ATOM   1753 O OD1   . ASP C 3 154 ? 49.029 -22.851 22.010 1.00 66.23 ? 161 ASP A OD1   1 
ATOM   1754 O OD2   . ASP C 3 154 ? 49.124 -20.695 21.663 1.00 57.41 ? 161 ASP A OD2   1 
ATOM   1755 N N     . GLY C 3 155 ? 44.927 -21.062 24.990 1.00 45.33 ? 162 GLY A N     1 
ATOM   1756 C CA    . GLY C 3 155 ? 44.201 -20.549 26.134 1.00 37.20 ? 162 GLY A CA    1 
ATOM   1757 C C     . GLY C 3 155 ? 43.182 -19.552 25.642 1.00 38.89 ? 162 GLY A C     1 
ATOM   1758 O O     . GLY C 3 155 ? 42.468 -19.815 24.698 1.00 41.55 ? 162 GLY A O     1 
ATOM   1759 N N     . MET C 3 156 ? 43.117 -18.394 26.284 1.00 42.89 ? 163 MET A N     1 
ATOM   1760 C CA    . MET C 3 156 ? 42.178 -17.348 25.905 1.00 43.79 ? 163 MET A CA    1 
ATOM   1761 C C     . MET C 3 156 ? 43.039 -16.136 25.596 1.00 45.46 ? 163 MET A C     1 
ATOM   1762 O O     . MET C 3 156 ? 44.086 -15.955 26.204 1.00 47.97 ? 163 MET A O     1 
ATOM   1763 C CB    . MET C 3 156 ? 41.212 -17.065 27.057 1.00 46.67 ? 163 MET A CB    1 
ATOM   1764 C CG    . MET C 3 156 ? 39.732 -16.873 26.633 1.00 47.50 ? 163 MET A CG    1 
ATOM   1765 S SD    . MET C 3 156 ? 38.949 -18.294 25.824 1.00 46.34 ? 163 MET A SD    1 
ATOM   1766 C CE    . MET C 3 156 ? 39.220 -19.537 27.034 1.00 37.52 ? 163 MET A CE    1 
ATOM   1767 N N     . GLN C 3 157 ? 42.598 -15.317 24.649 1.00 43.52 ? 164 GLN A N     1 
ATOM   1768 C CA    . GLN C 3 157 ? 43.347 -14.150 24.199 1.00 42.07 ? 164 GLN A CA    1 
ATOM   1769 C C     . GLN C 3 157 ? 42.630 -12.834 24.509 1.00 41.41 ? 164 GLN A C     1 
ATOM   1770 O O     . GLN C 3 157 ? 41.452 -12.686 24.199 1.00 44.17 ? 164 GLN A O     1 
ATOM   1771 C CB    . GLN C 3 157 ? 43.545 -14.294 22.689 1.00 42.13 ? 164 GLN A CB    1 
ATOM   1772 C CG    . GLN C 3 157 ? 44.500 -13.316 22.068 1.00 51.25 ? 164 GLN A CG    1 
ATOM   1773 C CD    . GLN C 3 157 ? 44.463 -13.340 20.559 1.00 54.87 ? 164 GLN A CD    1 
ATOM   1774 O OE1   . GLN C 3 157 ? 43.459 -12.974 19.953 1.00 60.64 ? 164 GLN A OE1   1 
ATOM   1775 N NE2   . GLN C 3 157 ? 45.560 -13.772 19.940 1.00 54.38 ? 164 GLN A NE2   1 
ATOM   1776 N N     . ILE C 3 158 ? 43.311 -11.877 25.129 1.00 38.31 ? 165 ILE A N     1 
ATOM   1777 C CA    . ILE C 3 158 ? 42.672 -10.595 25.412 1.00 36.46 ? 165 ILE A CA    1 
ATOM   1778 C C     . ILE C 3 158 ? 43.458 -9.527  24.704 1.00 39.79 ? 165 ILE A C     1 
ATOM   1779 O O     . ILE C 3 158 ? 44.550 -9.789  24.232 1.00 37.01 ? 165 ILE A O     1 
ATOM   1780 C CB    . ILE C 3 158 ? 42.645 -10.252 26.891 1.00 35.64 ? 165 ILE A CB    1 
ATOM   1781 C CG1   . ILE C 3 158 ? 44.077 -10.170 27.441 1.00 43.46 ? 165 ILE A CG1   1 
ATOM   1782 C CG2   . ILE C 3 158 ? 41.824 -11.264 27.631 1.00 39.62 ? 165 ILE A CG2   1 
ATOM   1783 C CD1   . ILE C 3 158 ? 44.197 -9.931  28.983 1.00 37.88 ? 165 ILE A CD1   1 
ATOM   1784 N N     . LYS C 3 159 ? 42.882 -8.331  24.604 1.00 44.61 ? 166 LYS A N     1 
ATOM   1785 C CA    . LYS C 3 159 ? 43.525 -7.187  23.952 1.00 49.35 ? 166 LYS A CA    1 
ATOM   1786 C C     . LYS C 3 159 ? 43.325 -5.997  24.867 1.00 48.46 ? 166 LYS A C     1 
ATOM   1787 O O     . LYS C 3 159 ? 42.205 -5.672  25.210 1.00 53.45 ? 166 LYS A O     1 
ATOM   1788 C CB    . LYS C 3 159 ? 42.901 -6.912  22.580 1.00 52.85 ? 166 LYS A CB    1 
ATOM   1789 C CG    . LYS C 3 159 ? 43.742 -7.410  21.366 1.00 59.43 ? 166 LYS A CG    1 
ATOM   1790 C CD    . LYS C 3 159 ? 42.865 -7.653  20.106 1.00 61.12 ? 166 LYS A CD    1 
ATOM   1791 C CE    . LYS C 3 159 ? 43.671 -7.762  18.811 1.00 60.76 ? 166 LYS A CE    1 
ATOM   1792 N NZ    . LYS C 3 159 ? 44.613 -8.922  18.779 1.00 67.01 ? 166 LYS A NZ    1 
ATOM   1793 N N     . ILE C 3 160 ? 44.418 -5.360  25.267 1.00 45.73 ? 167 ILE A N     1 
ATOM   1794 C CA    . ILE C 3 160 ? 44.365 -4.234  26.177 1.00 43.59 ? 167 ILE A CA    1 
ATOM   1795 C C     . ILE C 3 160 ? 45.763 -3.655  26.300 1.00 42.25 ? 167 ILE A C     1 
ATOM   1796 O O     . ILE C 3 160 ? 46.744 -4.381  26.184 1.00 41.27 ? 167 ILE A O     1 
ATOM   1797 C CB    . ILE C 3 160 ? 43.880 -4.698  27.575 1.00 43.44 ? 167 ILE A CB    1 
ATOM   1798 C CG1   . ILE C 3 160 ? 43.793 -3.513  28.537 1.00 43.47 ? 167 ILE A CG1   1 
ATOM   1799 C CG2   . ILE C 3 160 ? 44.824 -5.742  28.134 1.00 42.74 ? 167 ILE A CG2   1 
ATOM   1800 C CD1   . ILE C 3 160 ? 43.242 -3.877  29.875 1.00 37.02 ? 167 ILE A CD1   1 
ATOM   1801 N N     . THR C 3 161 ? 45.854 -2.353  26.556 1.00 41.51 ? 168 THR A N     1 
ATOM   1802 C CA    . THR C 3 161 ? 47.148 -1.706  26.691 1.00 41.00 ? 168 THR A CA    1 
ATOM   1803 C C     . THR C 3 161 ? 47.690 -1.845  28.093 1.00 41.80 ? 168 THR A C     1 
ATOM   1804 O O     . THR C 3 161 ? 46.942 -2.131  29.019 1.00 43.92 ? 168 THR A O     1 
ATOM   1805 C CB    . THR C 3 161 ? 47.087 -0.213  26.334 1.00 42.64 ? 168 THR A CB    1 
ATOM   1806 O OG1   . THR C 3 161 ? 46.443 0.516   27.380 1.00 44.13 ? 168 THR A OG1   1 
ATOM   1807 C CG2   . THR C 3 161 ? 46.328 -0.015  25.020 1.00 47.95 ? 168 THR A CG2   1 
ATOM   1808 N N     . ARG C 3 162 ? 49.001 -1.677  28.238 1.00 44.20 ? 169 ARG A N     1 
ATOM   1809 C CA    . ARG C 3 162 ? 49.641 -1.767  29.533 1.00 46.65 ? 169 ARG A CA    1 
ATOM   1810 C C     . ARG C 3 162 ? 49.267 -0.525  30.326 1.00 46.70 ? 169 ARG A C     1 
ATOM   1811 O O     . ARG C 3 162 ? 49.422 -0.500  31.541 1.00 51.06 ? 169 ARG A O     1 
ATOM   1812 C CB    . ARG C 3 162 ? 51.166 -1.863  29.403 1.00 48.12 ? 169 ARG A CB    1 
ATOM   1813 C CG    . ARG C 3 162 ? 51.692 -3.151  28.797 1.00 46.88 ? 169 ARG A CG    1 
ATOM   1814 C CD    . ARG C 3 162 ? 52.252 -2.916  27.401 1.00 52.61 ? 169 ARG A CD    1 
ATOM   1815 N NE    . ARG C 3 162 ? 52.247 -4.144  26.613 1.00 52.48 ? 169 ARG A NE    1 
ATOM   1816 C CZ    . ARG C 3 162 ? 53.152 -5.102  26.728 1.00 56.40 ? 169 ARG A CZ    1 
ATOM   1817 N NH1   . ARG C 3 162 ? 54.162 -4.970  27.590 1.00 56.32 ? 169 ARG A NH1   1 
ATOM   1818 N NH2   . ARG C 3 162 ? 53.013 -6.215  26.020 1.00 57.20 ? 169 ARG A NH2   1 
ATOM   1819 N N     . GLN C 3 163 ? 48.764 0.491   29.630 1.00 44.40 ? 170 GLN A N     1 
ATOM   1820 C CA    . GLN C 3 163 ? 48.332 1.735   30.250 1.00 46.57 ? 170 GLN A CA    1 
ATOM   1821 C C     . GLN C 3 163 ? 47.069 1.457   31.072 1.00 47.15 ? 170 GLN A C     1 
ATOM   1822 O O     . GLN C 3 163 ? 47.041 1.662   32.289 1.00 50.95 ? 170 GLN A O     1 
ATOM   1823 C CB    . GLN C 3 163 ? 48.023 2.784   29.177 1.00 52.72 ? 170 GLN A CB    1 
ATOM   1824 C CG    . GLN C 3 163 ? 48.286 4.234   29.614 1.00 65.01 ? 170 GLN A CG    1 
ATOM   1825 C CD    . GLN C 3 163 ? 49.198 4.989   28.632 1.00 75.40 ? 170 GLN A CD    1 
ATOM   1826 O OE1   . GLN C 3 163 ? 48.755 5.442   27.562 1.00 78.89 ? 170 GLN A OE1   1 
ATOM   1827 N NE2   . GLN C 3 163 ? 50.481 5.114   28.989 1.00 71.88 ? 170 GLN A NE2   1 
ATOM   1828 N N     . GLU C 3 164 ? 46.027 0.974   30.411 1.00 43.79 ? 171 GLU A N     1 
ATOM   1829 C CA    . GLU C 3 164 ? 44.781 0.673   31.090 1.00 45.71 ? 171 GLU A CA    1 
ATOM   1830 C C     . GLU C 3 164 ? 44.939 -0.456  32.151 1.00 48.34 ? 171 GLU A C     1 
ATOM   1831 O O     . GLU C 3 164 ? 44.180 -0.526  33.136 1.00 44.23 ? 171 GLU A O     1 
ATOM   1832 C CB    . GLU C 3 164 ? 43.678 0.352   30.046 1.00 42.99 ? 171 GLU A CB    1 
ATOM   1833 C CG    . GLU C 3 164 ? 42.459 -0.356  30.646 1.00 52.34 ? 171 GLU A CG    1 
ATOM   1834 C CD    . GLU C 3 164 ? 41.114 0.106   30.114 1.00 54.99 ? 171 GLU A CD    1 
ATOM   1835 O OE1   . GLU C 3 164 ? 40.768 1.284   30.305 1.00 54.34 ? 171 GLU A OE1   1 
ATOM   1836 O OE2   . GLU C 3 164 ? 40.383 -0.716  29.526 1.00 55.65 ? 171 GLU A OE2   1 
ATOM   1837 N N     . ILE C 3 165 ? 45.923 -1.334  31.973 1.00 46.89 ? 172 ILE A N     1 
ATOM   1838 C CA    . ILE C 3 165 ? 46.095 -2.387  32.959 1.00 46.36 ? 172 ILE A CA    1 
ATOM   1839 C C     . ILE C 3 165 ? 46.611 -1.734  34.219 1.00 49.27 ? 172 ILE A C     1 
ATOM   1840 O O     . ILE C 3 165 ? 46.260 -2.134  35.320 1.00 50.89 ? 172 ILE A O     1 
ATOM   1841 C CB    . ILE C 3 165 ? 47.112 -3.454  32.528 1.00 43.10 ? 172 ILE A CB    1 
ATOM   1842 C CG1   . ILE C 3 165 ? 46.544 -4.294  31.393 1.00 44.63 ? 172 ILE A CG1   1 
ATOM   1843 C CG2   . ILE C 3 165 ? 47.452 -4.337  33.711 1.00 37.48 ? 172 ILE A CG2   1 
ATOM   1844 C CD1   . ILE C 3 165 ? 47.399 -5.492  31.028 1.00 36.46 ? 172 ILE A CD1   1 
ATOM   1845 N N     . GLY C 3 166 ? 47.445 -0.716  34.054 1.00 46.80 ? 173 GLY A N     1 
ATOM   1846 C CA    . GLY C 3 166 ? 48.005 -0.064  35.219 1.00 46.45 ? 173 GLY A CA    1 
ATOM   1847 C C     . GLY C 3 166 ? 47.001 0.741   36.024 1.00 44.35 ? 173 GLY A C     1 
ATOM   1848 O O     . GLY C 3 166 ? 47.170 0.954   37.244 1.00 34.78 ? 173 GLY A O     1 
ATOM   1849 N N     . GLN C 3 167 ? 45.968 1.202   35.325 1.00 40.42 ? 174 GLN A N     1 
ATOM   1850 C CA    . GLN C 3 167 ? 44.930 2.007   35.929 1.00 41.87 ? 174 GLN A CA    1 
ATOM   1851 C C     . GLN C 3 167 ? 43.869 1.108   36.544 1.00 43.72 ? 174 GLN A C     1 
ATOM   1852 O O     . GLN C 3 167 ? 42.904 1.586   37.125 1.00 48.77 ? 174 GLN A O     1 
ATOM   1853 C CB    . GLN C 3 167 ? 44.300 2.905   34.875 1.00 39.42 ? 174 GLN A CB    1 
ATOM   1854 C CG    . GLN C 3 167 ? 45.281 3.339   33.808 1.00 44.85 ? 174 GLN A CG    1 
ATOM   1855 C CD    . GLN C 3 167 ? 44.705 4.348   32.824 1.00 46.68 ? 174 GLN A CD    1 
ATOM   1856 O OE1   . GLN C 3 167 ? 43.862 4.017   31.968 1.00 40.28 ? 174 GLN A OE1   1 
ATOM   1857 N NE2   . GLN C 3 167 ? 45.158 5.600   32.949 1.00 46.44 ? 174 GLN A NE2   1 
ATOM   1858 N N     . ILE C 3 168 ? 44.026 -0.197  36.395 1.00 42.00 ? 175 ILE A N     1 
ATOM   1859 C CA    . ILE C 3 168 ? 43.067 -1.114  36.981 1.00 40.46 ? 175 ILE A CA    1 
ATOM   1860 C C     . ILE C 3 168 ? 43.708 -1.597  38.283 1.00 42.53 ? 175 ILE A C     1 
ATOM   1861 O O     . ILE C 3 168 ? 43.102 -1.538  39.352 1.00 46.53 ? 175 ILE A O     1 
ATOM   1862 C CB    . ILE C 3 168 ? 42.777 -2.341  36.061 1.00 39.41 ? 175 ILE A CB    1 
ATOM   1863 C CG1   . ILE C 3 168 ? 41.918 -1.938  34.858 1.00 36.57 ? 175 ILE A CG1   1 
ATOM   1864 C CG2   . ILE C 3 168 ? 42.094 -3.430  36.857 1.00 31.22 ? 175 ILE A CG2   1 
ATOM   1865 C CD1   . ILE C 3 168 ? 41.598 -3.102  33.906 1.00 24.05 ? 175 ILE A CD1   1 
ATOM   1866 N N     . VAL C 3 169 ? 44.947 -2.049  38.198 1.00 38.90 ? 176 VAL A N     1 
ATOM   1867 C CA    . VAL C 3 169 ? 45.634 -2.534  39.381 1.00 37.30 ? 176 VAL A CA    1 
ATOM   1868 C C     . VAL C 3 169 ? 46.274 -1.425  40.209 1.00 39.45 ? 176 VAL A C     1 
ATOM   1869 O O     . VAL C 3 169 ? 46.657 -1.636  41.353 1.00 40.62 ? 176 VAL A O     1 
ATOM   1870 C CB    . VAL C 3 169 ? 46.694 -3.541  38.999 1.00 28.54 ? 176 VAL A CB    1 
ATOM   1871 C CG1   . VAL C 3 169 ? 46.060 -4.630  38.157 1.00 28.83 ? 176 VAL A CG1   1 
ATOM   1872 C CG2   . VAL C 3 169 ? 47.799 -2.863  38.266 1.00 27.50 ? 176 VAL A CG2   1 
ATOM   1873 N N     . GLY C 3 170 ? 46.392 -0.244  39.628 1.00 39.38 ? 177 GLY A N     1 
ATOM   1874 C CA    . GLY C 3 170 ? 46.986 0.848   40.350 1.00 38.25 ? 177 GLY A CA    1 
ATOM   1875 C C     . GLY C 3 170 ? 48.491 0.859   40.403 1.00 39.21 ? 177 GLY A C     1 
ATOM   1876 O O     . GLY C 3 170 ? 49.066 0.888   41.476 1.00 37.13 ? 177 GLY A O     1 
ATOM   1877 N N     . CYS C 3 171 ? 49.137 0.835   39.245 1.00 41.93 ? 178 CYS A N     1 
ATOM   1878 C CA    . CYS C 3 171 ? 50.599 0.903   39.190 1.00 44.29 ? 178 CYS A CA    1 
ATOM   1879 C C     . CYS C 3 171 ? 50.951 1.693   37.943 1.00 44.60 ? 178 CYS A C     1 
ATOM   1880 O O     . CYS C 3 171 ? 50.054 2.143   37.232 1.00 43.89 ? 178 CYS A O     1 
ATOM   1881 C CB    . CYS C 3 171 ? 51.229 -0.490  39.121 1.00 44.13 ? 178 CYS A CB    1 
ATOM   1882 S SG    . CYS C 3 171 ? 50.979 -1.345  37.573 1.00 51.97 ? 178 CYS A SG    1 
ATOM   1883 N N     . SER C 3 172 ? 52.242 1.867   37.676 1.00 43.42 ? 179 SER A N     1 
ATOM   1884 C CA    . SER C 3 172 ? 52.668 2.611   36.494 1.00 44.51 ? 179 SER A CA    1 
ATOM   1885 C C     . SER C 3 172 ? 52.770 1.725   35.254 1.00 43.78 ? 179 SER A C     1 
ATOM   1886 O O     . SER C 3 172 ? 53.050 0.526   35.341 1.00 42.28 ? 179 SER A O     1 
ATOM   1887 C CB    . SER C 3 172 ? 54.023 3.259   36.748 1.00 45.21 ? 179 SER A CB    1 
ATOM   1888 O OG    . SER C 3 172 ? 55.046 2.282   36.838 1.00 50.70 ? 179 SER A OG    1 
ATOM   1889 N N     . ARG C 3 173 ? 52.553 2.333   34.097 1.00 44.39 ? 180 ARG A N     1 
ATOM   1890 C CA    . ARG C 3 173 ? 52.625 1.627   32.822 1.00 45.20 ? 180 ARG A CA    1 
ATOM   1891 C C     . ARG C 3 173 ? 53.963 0.905   32.691 1.00 46.83 ? 180 ARG A C     1 
ATOM   1892 O O     . ARG C 3 173 ? 54.013 -0.207  32.193 1.00 50.00 ? 180 ARG A O     1 
ATOM   1893 C CB    . ARG C 3 173 ? 52.457 2.608   31.656 1.00 44.12 ? 180 ARG A CB    1 
ATOM   1894 C CG    . ARG C 3 173 ? 53.637 3.566   31.478 1.00 46.99 ? 180 ARG A CG    1 
ATOM   1895 C CD    . ARG C 3 173 ? 53.573 4.267   30.143 1.00 55.23 ? 180 ARG A CD    1 
ATOM   1896 N NE    . ARG C 3 173 ? 54.765 5.067   29.880 1.00 58.16 ? 180 ARG A NE    1 
ATOM   1897 C CZ    . ARG C 3 173 ? 55.978 4.572   29.662 1.00 59.37 ? 180 ARG A CZ    1 
ATOM   1898 N NH1   . ARG C 3 173 ? 56.184 3.270   29.661 1.00 61.82 ? 180 ARG A NH1   1 
ATOM   1899 N NH2   . ARG C 3 173 ? 56.996 5.392   29.477 1.00 63.12 ? 180 ARG A NH2   1 
ATOM   1900 N N     . GLU C 3 174 ? 55.047 1.542   33.125 1.00 49.19 ? 181 GLU A N     1 
ATOM   1901 C CA    . GLU C 3 174 ? 56.360 0.927   33.049 1.00 50.71 ? 181 GLU A CA    1 
ATOM   1902 C C     . GLU C 3 174 ? 56.384 -0.362  33.877 1.00 51.55 ? 181 GLU A C     1 
ATOM   1903 O O     . GLU C 3 174 ? 56.964 -1.364  33.470 1.00 54.51 ? 181 GLU A O     1 
ATOM   1904 C CB    . GLU C 3 174 ? 57.448 1.875   33.563 1.00 53.08 ? 181 GLU A CB    1 
ATOM   1905 C CG    . GLU C 3 174 ? 57.551 3.218   32.863 1.00 59.98 ? 181 GLU A CG    1 
ATOM   1906 C CD    . GLU C 3 174 ? 56.721 4.283   33.554 1.00 67.38 ? 181 GLU A CD    1 
ATOM   1907 O OE1   . GLU C 3 174 ? 57.118 5.474   33.558 1.00 68.45 ? 181 GLU A OE1   1 
ATOM   1908 O OE2   . GLU C 3 174 ? 55.662 3.921   34.097 1.00 66.89 ? 181 GLU A OE2   1 
ATOM   1909 N N     . THR C 3 175 ? 55.752 -0.339  35.040 1.00 48.50 ? 182 THR A N     1 
ATOM   1910 C CA    . THR C 3 175 ? 55.719 -1.510  35.881 1.00 46.40 ? 182 THR A CA    1 
ATOM   1911 C C     . THR C 3 175 ? 54.887 -2.638  35.313 1.00 50.45 ? 182 THR A C     1 
ATOM   1912 O O     . THR C 3 175 ? 55.187 -3.817  35.547 1.00 54.83 ? 182 THR A O     1 
ATOM   1913 C CB    . THR C 3 175 ? 55.206 -1.153  37.238 1.00 45.52 ? 182 THR A CB    1 
ATOM   1914 O OG1   . THR C 3 175 ? 56.222 -0.405  37.889 1.00 52.37 ? 182 THR A OG1   1 
ATOM   1915 C CG2   . THR C 3 175 ? 54.882 -2.394  38.069 1.00 41.30 ? 182 THR A CG2   1 
ATOM   1916 N N     . VAL C 3 176 ? 53.833 -2.303  34.580 1.00 48.16 ? 183 VAL A N     1 
ATOM   1917 C CA    . VAL C 3 176 ? 53.013 -3.359  33.999 1.00 47.45 ? 183 VAL A CA    1 
ATOM   1918 C C     . VAL C 3 176 ? 53.906 -4.165  33.046 1.00 49.62 ? 183 VAL A C     1 
ATOM   1919 O O     . VAL C 3 176 ? 54.049 -5.394  33.197 1.00 48.50 ? 183 VAL A O     1 
ATOM   1920 C CB    . VAL C 3 176 ? 51.800 -2.789  33.243 1.00 43.25 ? 183 VAL A CB    1 
ATOM   1921 C CG1   . VAL C 3 176 ? 51.001 -3.884  32.648 1.00 46.54 ? 183 VAL A CG1   1 
ATOM   1922 C CG2   . VAL C 3 176 ? 50.926 -2.033  34.193 1.00 50.34 ? 183 VAL A CG2   1 
ATOM   1923 N N     . GLY C 3 177 ? 54.536 -3.458  32.103 1.00 45.30 ? 184 GLY A N     1 
ATOM   1924 C CA    . GLY C 3 177 ? 55.410 -4.091  31.135 1.00 43.49 ? 184 GLY A CA    1 
ATOM   1925 C C     . GLY C 3 177 ? 56.508 -4.947  31.730 1.00 43.65 ? 184 GLY A C     1 
ATOM   1926 O O     . GLY C 3 177 ? 56.737 -6.054  31.278 1.00 45.08 ? 184 GLY A O     1 
ATOM   1927 N N     . ARG C 3 178 ? 57.208 -4.444  32.734 1.00 44.35 ? 185 ARG A N     1 
ATOM   1928 C CA    . ARG C 3 178 ? 58.274 -5.221  33.353 1.00 47.46 ? 185 ARG A CA    1 
ATOM   1929 C C     . ARG C 3 178 ? 57.673 -6.530  33.841 1.00 50.94 ? 185 ARG A C     1 
ATOM   1930 O O     . ARG C 3 178 ? 58.271 -7.582  33.678 1.00 51.28 ? 185 ARG A O     1 
ATOM   1931 C CB    . ARG C 3 178 ? 58.883 -4.478  34.560 1.00 50.98 ? 185 ARG A CB    1 
ATOM   1932 C CG    . ARG C 3 178 ? 59.087 -2.982  34.387 1.00 51.02 ? 185 ARG A CG    1 
ATOM   1933 C CD    . ARG C 3 178 ? 60.533 -2.607  34.211 1.00 57.51 ? 185 ARG A CD    1 
ATOM   1934 N NE    . ARG C 3 178 ? 60.684 -1.155  34.124 1.00 68.18 ? 185 ARG A NE    1 
ATOM   1935 C CZ    . ARG C 3 178 ? 60.356 -0.307  35.104 1.00 73.50 ? 185 ARG A CZ    1 
ATOM   1936 N NH1   . ARG C 3 178 ? 59.862 -0.766  36.255 1.00 71.76 ? 185 ARG A NH1   1 
ATOM   1937 N NH2   . ARG C 3 178 ? 60.506 1.004   34.933 1.00 72.55 ? 185 ARG A NH2   1 
ATOM   1938 N N     . ILE C 3 179 ? 56.481 -6.447  34.440 1.00 53.43 ? 186 ILE A N     1 
ATOM   1939 C CA    . ILE C 3 179 ? 55.789 -7.620  34.977 1.00 51.12 ? 186 ILE A CA    1 
ATOM   1940 C C     . ILE C 3 179 ? 55.208 -8.511  33.899 1.00 48.02 ? 186 ILE A C     1 
ATOM   1941 O O     . ILE C 3 179 ? 55.230 -9.720  34.026 1.00 47.07 ? 186 ILE A O     1 
ATOM   1942 C CB    . ILE C 3 179 ? 54.667 -7.212  35.980 1.00 51.13 ? 186 ILE A CB    1 
ATOM   1943 C CG1   . ILE C 3 179 ? 55.301 -6.567  37.216 1.00 47.03 ? 186 ILE A CG1   1 
ATOM   1944 C CG2   . ILE C 3 179 ? 53.842 -8.435  36.394 1.00 50.05 ? 186 ILE A CG2   1 
ATOM   1945 C CD1   . ILE C 3 179 ? 54.383 -6.389  38.357 1.00 37.52 ? 186 ILE A CD1   1 
ATOM   1946 N N     . LEU C 3 180 ? 54.690 -7.924  32.833 1.00 46.71 ? 187 LEU A N     1 
ATOM   1947 C CA    . LEU C 3 180 ? 54.144 -8.723  31.743 1.00 44.67 ? 187 LEU A CA    1 
ATOM   1948 C C     . LEU C 3 180 ? 55.271 -9.553  31.153 1.00 44.63 ? 187 LEU A C     1 
ATOM   1949 O O     . LEU C 3 180 ? 55.089 -10.711 30.807 1.00 48.65 ? 187 LEU A O     1 
ATOM   1950 C CB    . LEU C 3 180 ? 53.525 -7.813  30.675 1.00 41.48 ? 187 LEU A CB    1 
ATOM   1951 C CG    . LEU C 3 180 ? 52.017 -7.976  30.363 1.00 42.63 ? 187 LEU A CG    1 
ATOM   1952 C CD1   . LEU C 3 180 ? 51.247 -8.525  31.565 1.00 38.48 ? 187 LEU A CD1   1 
ATOM   1953 C CD2   . LEU C 3 180 ? 51.451 -6.648  29.912 1.00 29.60 ? 187 LEU A CD2   1 
ATOM   1954 N N     . LYS C 3 181 ? 56.456 -8.970  31.063 1.00 46.61 ? 188 LYS A N     1 
ATOM   1955 C CA    . LYS C 3 181 ? 57.589 -9.700  30.521 1.00 46.07 ? 188 LYS A CA    1 
ATOM   1956 C C     . LYS C 3 181 ? 58.002 -10.817 31.480 1.00 44.07 ? 188 LYS A C     1 
ATOM   1957 O O     . LYS C 3 181 ? 58.409 -11.888 31.051 1.00 41.72 ? 188 LYS A O     1 
ATOM   1958 C CB    . LYS C 3 181 ? 58.757 -8.742  30.236 1.00 49.18 ? 188 LYS A CB    1 
ATOM   1959 C CG    . LYS C 3 181 ? 60.079 -9.420  29.825 1.00 60.82 ? 188 LYS A CG    1 
ATOM   1960 C CD    . LYS C 3 181 ? 59.875 -10.451 28.712 1.00 70.19 ? 188 LYS A CD    1 
ATOM   1961 C CE    . LYS C 3 181 ? 61.095 -11.340 28.521 1.00 73.24 ? 188 LYS A CE    1 
ATOM   1962 N NZ    . LYS C 3 181 ? 60.753 -12.520 27.682 1.00 77.00 ? 188 LYS A NZ    1 
ATOM   1963 N N     . MET C 3 182 ? 57.882 -10.582 32.779 1.00 44.55 ? 189 MET A N     1 
ATOM   1964 C CA    . MET C 3 182 ? 58.248 -11.608 33.741 1.00 49.59 ? 189 MET A CA    1 
ATOM   1965 C C     . MET C 3 182 ? 57.228 -12.752 33.700 1.00 53.48 ? 189 MET A C     1 
ATOM   1966 O O     . MET C 3 182 ? 57.579 -13.937 33.844 1.00 51.99 ? 189 MET A O     1 
ATOM   1967 C CB    . MET C 3 182 ? 58.280 -11.026 35.143 1.00 53.34 ? 189 MET A CB    1 
ATOM   1968 C CG    . MET C 3 182 ? 59.097 -9.759  35.273 1.00 59.98 ? 189 MET A CG    1 
ATOM   1969 S SD    . MET C 3 182 ? 59.411 -9.359  36.990 1.00 63.58 ? 189 MET A SD    1 
ATOM   1970 C CE    . MET C 3 182 ? 59.805 -11.018 37.600 1.00 52.59 ? 189 MET A CE    1 
ATOM   1971 N N     . LEU C 3 183 ? 55.960 -12.402 33.508 1.00 50.24 ? 190 LEU A N     1 
ATOM   1972 C CA    . LEU C 3 183 ? 54.941 -13.420 33.461 1.00 49.08 ? 190 LEU A CA    1 
ATOM   1973 C C     . LEU C 3 183 ? 55.152 -14.301 32.235 1.00 48.62 ? 190 LEU A C     1 
ATOM   1974 O O     . LEU C 3 183 ? 54.861 -15.504 32.269 1.00 44.80 ? 190 LEU A O     1 
ATOM   1975 C CB    . LEU C 3 183 ? 53.549 -12.776 33.496 1.00 50.53 ? 190 LEU A CB    1 
ATOM   1976 C CG    . LEU C 3 183 ? 53.170 -12.285 34.910 1.00 51.42 ? 190 LEU A CG    1 
ATOM   1977 C CD1   . LEU C 3 183 ? 51.836 -11.552 34.886 1.00 47.43 ? 190 LEU A CD1   1 
ATOM   1978 C CD2   . LEU C 3 183 ? 53.130 -13.478 35.883 1.00 47.64 ? 190 LEU A CD2   1 
ATOM   1979 N N     . GLU C 3 184 ? 55.678 -13.709 31.160 1.00 46.27 ? 191 GLU A N     1 
ATOM   1980 C CA    . GLU C 3 184 ? 55.972 -14.483 29.959 1.00 43.08 ? 191 GLU A CA    1 
ATOM   1981 C C     . GLU C 3 184 ? 57.185 -15.363 30.249 1.00 44.46 ? 191 GLU A C     1 
ATOM   1982 O O     . GLU C 3 184 ? 57.164 -16.550 29.939 1.00 44.40 ? 191 GLU A O     1 
ATOM   1983 C CB    . GLU C 3 184 ? 56.267 -13.590 28.758 1.00 38.24 ? 191 GLU A CB    1 
ATOM   1984 C CG    . GLU C 3 184 ? 55.942 -14.293 27.458 1.00 39.06 ? 191 GLU A CG    1 
ATOM   1985 C CD    . GLU C 3 184 ? 56.263 -13.494 26.228 1.00 44.12 ? 191 GLU A CD    1 
ATOM   1986 O OE1   . GLU C 3 184 ? 57.282 -13.797 25.584 1.00 46.47 ? 191 GLU A OE1   1 
ATOM   1987 O OE2   . GLU C 3 184 ? 55.500 -12.566 25.889 1.00 48.83 ? 191 GLU A OE2   1 
ATOM   1988 N N     . ASP C 3 185 ? 58.232 -14.790 30.850 1.00 43.35 ? 192 ASP A N     1 
ATOM   1989 C CA    . ASP C 3 185 ? 59.415 -15.561 31.197 1.00 43.33 ? 192 ASP A CA    1 
ATOM   1990 C C     . ASP C 3 185 ? 58.998 -16.723 32.073 1.00 43.91 ? 192 ASP A C     1 
ATOM   1991 O O     . ASP C 3 185 ? 59.698 -17.715 32.163 1.00 50.13 ? 192 ASP A O     1 
ATOM   1992 C CB    . ASP C 3 185 ? 60.460 -14.701 31.910 1.00 48.66 ? 192 ASP A CB    1 
ATOM   1993 C CG    . ASP C 3 185 ? 61.290 -13.835 30.938 1.00 57.40 ? 192 ASP A CG    1 
ATOM   1994 O OD1   . ASP C 3 185 ? 61.741 -12.738 31.340 1.00 58.12 ? 192 ASP A OD1   1 
ATOM   1995 O OD2   . ASP C 3 185 ? 61.508 -14.243 29.773 1.00 60.38 ? 192 ASP A OD2   1 
ATOM   1996 N N     . GLN C 3 186 ? 57.854 -16.622 32.727 1.00 42.74 ? 193 GLN A N     1 
ATOM   1997 C CA    . GLN C 3 186 ? 57.389 -17.748 33.520 1.00 41.49 ? 193 GLN A CA    1 
ATOM   1998 C C     . GLN C 3 186 ? 56.417 -18.599 32.683 1.00 40.97 ? 193 GLN A C     1 
ATOM   1999 O O     . GLN C 3 186 ? 55.720 -19.448 33.205 1.00 40.10 ? 193 GLN A O     1 
ATOM   2000 C CB    . GLN C 3 186 ? 56.665 -17.263 34.762 1.00 47.88 ? 193 GLN A CB    1 
ATOM   2001 C CG    . GLN C 3 186 ? 57.400 -16.237 35.590 1.00 55.69 ? 193 GLN A CG    1 
ATOM   2002 C CD    . GLN C 3 186 ? 56.669 -15.923 36.895 1.00 61.22 ? 193 GLN A CD    1 
ATOM   2003 O OE1   . GLN C 3 186 ? 56.731 -14.797 37.395 1.00 63.21 ? 193 GLN A OE1   1 
ATOM   2004 N NE2   . GLN C 3 186 ? 55.976 -16.928 37.456 1.00 60.58 ? 193 GLN A NE2   1 
ATOM   2005 N N     . ASN C 3 187 ? 56.358 -18.356 31.382 1.00 41.67 ? 194 ASN A N     1 
ATOM   2006 C CA    . ASN C 3 187 ? 55.460 -19.096 30.496 1.00 45.41 ? 194 ASN A CA    1 
ATOM   2007 C C     . ASN C 3 187 ? 53.994 -19.076 30.911 1.00 43.85 ? 194 ASN A C     1 
ATOM   2008 O O     . ASN C 3 187 ? 53.260 -20.003 30.612 1.00 45.24 ? 194 ASN A O     1 
ATOM   2009 C CB    . ASN C 3 187 ? 55.873 -20.569 30.366 1.00 51.29 ? 194 ASN A CB    1 
ATOM   2010 C CG    . ASN C 3 187 ? 57.057 -20.771 29.477 1.00 53.43 ? 194 ASN A CG    1 
ATOM   2011 O OD1   . ASN C 3 187 ? 57.309 -19.983 28.576 1.00 62.57 ? 194 ASN A OD1   1 
ATOM   2012 N ND2   . ASN C 3 187 ? 57.788 -21.841 29.714 1.00 56.91 ? 194 ASN A ND2   1 
ATOM   2013 N N     . LEU C 3 188 ? 53.552 -18.032 31.581 1.00 44.89 ? 195 LEU A N     1 
ATOM   2014 C CA    . LEU C 3 188 ? 52.163 -17.979 31.983 1.00 45.35 ? 195 LEU A CA    1 
ATOM   2015 C C     . LEU C 3 188 ? 51.330 -17.288 30.924 1.00 44.61 ? 195 LEU A C     1 
ATOM   2016 O O     . LEU C 3 188 ? 50.140 -17.543 30.778 1.00 46.74 ? 195 LEU A O     1 
ATOM   2017 C CB    . LEU C 3 188 ? 52.058 -17.254 33.312 1.00 50.63 ? 195 LEU A CB    1 
ATOM   2018 C CG    . LEU C 3 188 ? 52.785 -18.032 34.415 1.00 50.86 ? 195 LEU A CG    1 
ATOM   2019 C CD1   . LEU C 3 188 ? 53.038 -17.124 35.599 1.00 48.01 ? 195 LEU A CD1   1 
ATOM   2020 C CD2   . LEU C 3 188 ? 51.977 -19.265 34.790 1.00 46.58 ? 195 LEU A CD2   1 
ATOM   2021 N N     . ILE C 3 189 ? 51.970 -16.413 30.170 1.00 43.55 ? 196 ILE A N     1 
ATOM   2022 C CA    . ILE C 3 189 ? 51.284 -15.694 29.117 1.00 43.13 ? 196 ILE A CA    1 
ATOM   2023 C C     . ILE C 3 189 ? 52.234 -15.440 27.958 1.00 48.09 ? 196 ILE A C     1 
ATOM   2024 O O     . ILE C 3 189 ? 53.425 -15.685 28.058 1.00 50.85 ? 196 ILE A O     1 
ATOM   2025 C CB    . ILE C 3 189 ? 50.772 -14.324 29.611 1.00 39.33 ? 196 ILE A CB    1 
ATOM   2026 C CG1   . ILE C 3 189 ? 51.944 -13.469 30.092 1.00 30.68 ? 196 ILE A CG1   1 
ATOM   2027 C CG2   . ILE C 3 189 ? 49.754 -14.517 30.680 1.00 31.41 ? 196 ILE A CG2   1 
ATOM   2028 C CD1   . ILE C 3 189 ? 51.666 -11.997 30.103 1.00 26.57 ? 196 ILE A CD1   1 
ATOM   2029 N N     . SER C 3 190 ? 51.690 -14.970 26.845 1.00 51.29 ? 197 SER A N     1 
ATOM   2030 C CA    . SER C 3 190 ? 52.498 -14.617 25.694 1.00 53.71 ? 197 SER A CA    1 
ATOM   2031 C C     . SER C 3 190 ? 51.946 -13.259 25.283 1.00 57.01 ? 197 SER A C     1 
ATOM   2032 O O     . SER C 3 190 ? 50.750 -13.137 25.003 1.00 60.79 ? 197 SER A O     1 
ATOM   2033 C CB    . SER C 3 190 ? 52.323 -15.622 24.568 1.00 50.89 ? 197 SER A CB    1 
ATOM   2034 O OG    . SER C 3 190 ? 53.236 -15.330 23.529 1.00 53.92 ? 197 SER A OG    1 
ATOM   2035 N N     . ALA C 3 191 ? 52.802 -12.242 25.236 1.00 54.90 ? 198 ALA A N     1 
ATOM   2036 C CA    . ALA C 3 191 ? 52.320 -10.911 24.920 1.00 51.15 ? 198 ALA A CA    1 
ATOM   2037 C C     . ALA C 3 191 ? 52.942 -10.171 23.765 1.00 49.20 ? 198 ALA A C     1 
ATOM   2038 O O     . ALA C 3 191 ? 54.102 -9.806  23.815 1.00 53.26 ? 198 ALA A O     1 
ATOM   2039 C CB    . ALA C 3 191 ? 52.415 -10.053 26.162 1.00 53.17 ? 198 ALA A CB    1 
ATOM   2040 N N     . HIS C 3 192 ? 52.150 -9.925  22.732 1.00 45.62 ? 199 HIS A N     1 
ATOM   2041 C CA    . HIS C 3 192 ? 52.617 -9.171  21.579 1.00 43.58 ? 199 HIS A CA    1 
ATOM   2042 C C     . HIS C 3 192 ? 51.735 -7.941  21.441 1.00 46.41 ? 199 HIS A C     1 
ATOM   2043 O O     . HIS C 3 192 ? 50.538 -8.045  21.135 1.00 45.34 ? 199 HIS A O     1 
ATOM   2044 C CB    . HIS C 3 192 ? 52.545 -10.009 20.303 1.00 40.05 ? 199 HIS A CB    1 
ATOM   2045 C CG    . HIS C 3 192 ? 53.450 -11.188 20.323 1.00 43.92 ? 199 HIS A CG    1 
ATOM   2046 N ND1   . HIS C 3 192 ? 53.196 -12.303 21.091 1.00 49.29 ? 199 HIS A ND1   1 
ATOM   2047 C CD2   . HIS C 3 192 ? 54.660 -11.390 19.754 1.00 49.35 ? 199 HIS A CD2   1 
ATOM   2048 C CE1   . HIS C 3 192 ? 54.215 -13.139 21.000 1.00 49.82 ? 199 HIS A CE1   1 
ATOM   2049 N NE2   . HIS C 3 192 ? 55.117 -12.608 20.194 1.00 50.66 ? 199 HIS A NE2   1 
ATOM   2050 N N     . GLY C 3 193 ? 52.329 -6.774  21.665 1.00 45.94 ? 200 GLY A N     1 
ATOM   2051 C CA    . GLY C 3 193 ? 51.560 -5.550  21.586 1.00 47.66 ? 200 GLY A CA    1 
ATOM   2052 C C     . GLY C 3 193 ? 50.427 -5.583  22.609 1.00 49.93 ? 200 GLY A C     1 
ATOM   2053 O O     . GLY C 3 193 ? 50.591 -6.088  23.730 1.00 46.55 ? 200 GLY A O     1 
ATOM   2054 N N     . LYS C 3 194 ? 49.279 -5.041  22.220 1.00 45.81 ? 201 LYS A N     1 
ATOM   2055 C CA    . LYS C 3 194 ? 48.134 -5.013  23.091 1.00 44.71 ? 201 LYS A CA    1 
ATOM   2056 C C     . LYS C 3 194 ? 47.584 -6.428  23.225 1.00 44.20 ? 201 LYS A C     1 
ATOM   2057 O O     . LYS C 3 194 ? 46.755 -6.699  24.087 1.00 42.51 ? 201 LYS A O     1 
ATOM   2058 C CB    . LYS C 3 194 ? 47.049 -4.104  22.523 1.00 48.86 ? 201 LYS A CB    1 
ATOM   2059 C CG    . LYS C 3 194 ? 47.532 -2.870  21.808 1.00 53.58 ? 201 LYS A CG    1 
ATOM   2060 C CD    . LYS C 3 194 ? 48.077 -1.814  22.743 1.00 60.31 ? 201 LYS A CD    1 
ATOM   2061 C CE    . LYS C 3 194 ? 48.299 -0.469  22.013 1.00 63.67 ? 201 LYS A CE    1 
ATOM   2062 N NZ    . LYS C 3 194 ? 49.392 -0.467  20.972 1.00 59.93 ? 201 LYS A NZ    1 
ATOM   2063 N N     . THR C 3 195 ? 48.032 -7.348  22.386 1.00 43.37 ? 202 THR A N     1 
ATOM   2064 C CA    . THR C 3 195 ? 47.498 -8.690  22.513 1.00 45.98 ? 202 THR A CA    1 
ATOM   2065 C C     . THR C 3 195 ? 48.276 -9.527  23.512 1.00 47.62 ? 202 THR A C     1 
ATOM   2066 O O     . THR C 3 195 ? 49.500 -9.493  23.554 1.00 51.37 ? 202 THR A O     1 
ATOM   2067 C CB    . THR C 3 195 ? 47.416 -9.418  21.165 1.00 45.25 ? 202 THR A CB    1 
ATOM   2068 O OG1   . THR C 3 195 ? 46.508 -8.719  20.308 1.00 46.80 ? 202 THR A OG1   1 
ATOM   2069 C CG2   . THR C 3 195 ? 46.882 -10.821 21.362 1.00 41.73 ? 202 THR A CG2   1 
ATOM   2070 N N     . ILE C 3 196 ? 47.531 -10.258 24.335 1.00 44.34 ? 203 ILE A N     1 
ATOM   2071 C CA    . ILE C 3 196 ? 48.098 -11.105 25.359 1.00 43.08 ? 203 ILE A CA    1 
ATOM   2072 C C     . ILE C 3 196 ? 47.328 -12.388 25.378 1.00 43.13 ? 203 ILE A C     1 
ATOM   2073 O O     . ILE C 3 196 ? 46.106 -12.379 25.382 1.00 46.42 ? 203 ILE A O     1 
ATOM   2074 C CB    . ILE C 3 196 ? 47.927 -10.531 26.779 1.00 45.86 ? 203 ILE A CB    1 
ATOM   2075 C CG1   . ILE C 3 196 ? 48.603 -9.169  26.898 1.00 45.70 ? 203 ILE A CG1   1 
ATOM   2076 C CG2   . ILE C 3 196 ? 48.459 -11.549 27.814 1.00 42.11 ? 203 ILE A CG2   1 
ATOM   2077 C CD1   . ILE C 3 196 ? 48.281 -8.466  28.201 1.00 48.36 ? 203 ILE A CD1   1 
ATOM   2078 N N     . VAL C 3 197 ? 48.049 -13.494 25.419 1.00 41.72 ? 204 VAL A N     1 
ATOM   2079 C CA    . VAL C 3 197 ? 47.399 -14.775 25.491 1.00 40.78 ? 204 VAL A CA    1 
ATOM   2080 C C     . VAL C 3 197 ? 47.694 -15.329 26.872 1.00 43.89 ? 204 VAL A C     1 
ATOM   2081 O O     . VAL C 3 197 ? 48.862 -15.502 27.239 1.00 45.58 ? 204 VAL A O     1 
ATOM   2082 C CB    . VAL C 3 197 ? 47.947 -15.761 24.453 1.00 40.68 ? 204 VAL A CB    1 
ATOM   2083 C CG1   . VAL C 3 197 ? 47.262 -17.124 24.633 1.00 34.53 ? 204 VAL A CG1   1 
ATOM   2084 C CG2   . VAL C 3 197 ? 47.758 -15.211 23.051 1.00 32.24 ? 204 VAL A CG2   1 
ATOM   2085 N N     . VAL C 3 198 ? 46.632 -15.579 27.636 1.00 42.83 ? 205 VAL A N     1 
ATOM   2086 C CA    . VAL C 3 198 ? 46.747 -16.159 28.966 1.00 37.01 ? 205 VAL A CA    1 
ATOM   2087 C C     . VAL C 3 198 ? 46.588 -17.625 28.670 1.00 37.57 ? 205 VAL A C     1 
ATOM   2088 O O     . VAL C 3 198 ? 45.564 -18.048 28.156 1.00 34.85 ? 205 VAL A O     1 
ATOM   2089 C CB    . VAL C 3 198 ? 45.619 -15.697 29.918 1.00 34.73 ? 205 VAL A CB    1 
ATOM   2090 C CG1   . VAL C 3 198 ? 45.848 -16.253 31.292 1.00 35.09 ? 205 VAL A CG1   1 
ATOM   2091 C CG2   . VAL C 3 198 ? 45.570 -14.169 29.987 1.00 35.86 ? 205 VAL A CG2   1 
ATOM   2092 N N     . TYR C 3 199 ? 47.634 -18.385 28.968 1.00 41.52 ? 206 TYR A N     1 
ATOM   2093 C CA    . TYR C 3 199 ? 47.672 -19.811 28.708 1.00 43.72 ? 206 TYR A CA    1 
ATOM   2094 C C     . TYR C 3 199 ? 46.698 -20.679 29.477 1.00 51.00 ? 206 TYR A C     1 
ATOM   2095 O O     . TYR C 3 199 ? 46.319 -20.357 30.601 1.00 56.97 ? 206 TYR A O     1 
ATOM   2096 C CB    . TYR C 3 199 ? 49.085 -20.309 28.932 1.00 36.71 ? 206 TYR A CB    1 
ATOM   2097 C CG    . TYR C 3 199 ? 49.999 -19.879 27.839 1.00 38.29 ? 206 TYR A CG    1 
ATOM   2098 C CD1   . TYR C 3 199 ? 49.573 -19.924 26.516 1.00 38.46 ? 206 TYR A CD1   1 
ATOM   2099 C CD2   . TYR C 3 199 ? 51.282 -19.426 28.103 1.00 38.26 ? 206 TYR A CD2   1 
ATOM   2100 C CE1   . TYR C 3 199 ? 50.392 -19.526 25.493 1.00 40.98 ? 206 TYR A CE1   1 
ATOM   2101 C CE2   . TYR C 3 199 ? 52.116 -19.028 27.077 1.00 42.19 ? 206 TYR A CE2   1 
ATOM   2102 C CZ    . TYR C 3 199 ? 51.660 -19.077 25.771 1.00 40.91 ? 206 TYR A CZ    1 
ATOM   2103 O OH    . TYR C 3 199 ? 52.447 -18.658 24.719 1.00 43.83 ? 206 TYR A OH    1 
ATOM   2104 N N     . GLY C 3 200 ? 46.314 -21.792 28.860 1.00 53.61 ? 207 GLY A N     1 
ATOM   2105 C CA    . GLY C 3 200 ? 45.391 -22.727 29.475 1.00 58.96 ? 207 GLY A CA    1 
ATOM   2106 C C     . GLY C 3 200 ? 45.284 -24.030 28.690 1.00 65.56 ? 207 GLY A C     1 
ATOM   2107 O O     . GLY C 3 200 ? 44.856 -24.028 27.503 1.00 66.57 ? 207 GLY A O     1 
ATOM   2108 O OXT   . GLY C 3 200 ? 45.637 -25.081 29.264 1.00 61.13 ? 207 GLY A OXT   1 
HETATM 2109 P P     . CMP D 4 .   ? 27.221 8.838   40.588 1.00 50.55 ? 1   CMP A P     1 
HETATM 2110 O O1P   . CMP D 4 .   ? 27.649 9.141   41.956 1.00 49.71 ? 1   CMP A O1P   1 
HETATM 2111 O O2P   . CMP D 4 .   ? 26.012 9.468   40.055 1.00 53.16 ? 1   CMP A O2P   1 
HETATM 2112 O "O5'" . CMP D 4 .   ? 28.424 9.175   39.591 1.00 52.81 ? 1   CMP A "O5'" 1 
HETATM 2113 C "C5'" . CMP D 4 .   ? 29.463 8.233   39.320 1.00 51.83 ? 1   CMP A "C5'" 1 
HETATM 2114 C "C4'" . CMP D 4 .   ? 28.839 6.910   39.068 1.00 52.43 ? 1   CMP A "C4'" 1 
HETATM 2115 O "O4'" . CMP D 4 .   ? 29.791 5.855   38.801 1.00 54.41 ? 1   CMP A "O4'" 1 
HETATM 2116 C "C3'" . CMP D 4 .   ? 28.152 6.433   40.312 1.00 49.46 ? 1   CMP A "C3'" 1 
HETATM 2117 O "O3'" . CMP D 4 .   ? 27.018 7.250   40.473 1.00 53.88 ? 1   CMP A "O3'" 1 
HETATM 2118 C "C2'" . CMP D 4 .   ? 27.930 4.979   39.956 1.00 45.99 ? 1   CMP A "C2'" 1 
HETATM 2119 O "O2'" . CMP D 4 .   ? 26.922 4.815   38.981 1.00 61.13 ? 1   CMP A "O2'" 1 
HETATM 2120 C "C1'" . CMP D 4 .   ? 29.300 4.640   39.356 1.00 51.63 ? 1   CMP A "C1'" 1 
HETATM 2121 N N9    . CMP D 4 .   ? 30.240 4.222   40.394 1.00 45.49 ? 1   CMP A N9    1 
HETATM 2122 C C8    . CMP D 4 .   ? 30.866 5.046   41.287 1.00 45.00 ? 1   CMP A C8    1 
HETATM 2123 N N7    . CMP D 4 .   ? 31.653 4.423   42.119 1.00 47.80 ? 1   CMP A N7    1 
HETATM 2124 C C5    . CMP D 4 .   ? 31.546 3.094   41.745 1.00 46.65 ? 1   CMP A C5    1 
HETATM 2125 C C6    . CMP D 4 .   ? 32.169 1.929   42.222 1.00 46.16 ? 1   CMP A C6    1 
HETATM 2126 N N6    . CMP D 4 .   ? 33.071 1.926   43.203 1.00 38.46 ? 1   CMP A N6    1 
HETATM 2127 N N1    . CMP D 4 .   ? 31.841 0.759   41.633 1.00 46.56 ? 1   CMP A N1    1 
HETATM 2128 C C2    . CMP D 4 .   ? 30.965 0.778   40.622 1.00 45.42 ? 1   CMP A C2    1 
HETATM 2129 N N3    . CMP D 4 .   ? 30.331 1.810   40.074 1.00 43.52 ? 1   CMP A N3    1 
HETATM 2130 C C4    . CMP D 4 .   ? 30.670 2.954   40.688 1.00 44.76 ? 1   CMP A C4    1 
HETATM 2131 P P     . CMP E 4 .   ? 50.177 5.250   33.390 1.00 84.54 ? 2   CMP A P     1 
HETATM 2132 O O1P   . CMP E 4 .   ? 51.582 5.282   33.938 1.00 84.54 ? 2   CMP A O1P   1 
HETATM 2133 O O2P   . CMP E 4 .   ? 49.911 5.723   31.985 1.00 84.54 ? 2   CMP A O2P   1 
HETATM 2134 O "O5'" . CMP E 4 .   ? 49.650 3.734   33.505 1.00 84.54 ? 2   CMP A "O5'" 1 
HETATM 2135 C "C5'" . CMP E 4 .   ? 49.075 3.238   34.720 1.00 84.54 ? 2   CMP A "C5'" 1 
HETATM 2136 C "C4'" . CMP E 4 .   ? 48.138 4.276   35.254 1.00 84.54 ? 2   CMP A "C4'" 1 
HETATM 2137 O "O4'" . CMP E 4 .   ? 47.432 3.908   36.464 1.00 84.54 ? 2   CMP A "O4'" 1 
HETATM 2138 C "C3'" . CMP E 4 .   ? 48.870 5.533   35.644 1.00 84.54 ? 2   CMP A "C3'" 1 
HETATM 2139 O "O3'" . CMP E 4 .   ? 49.257 6.117   34.414 1.00 84.54 ? 2   CMP A "O3'" 1 
HETATM 2140 C "C2'" . CMP E 4 .   ? 47.784 6.273   36.415 1.00 84.54 ? 2   CMP A "C2'" 1 
HETATM 2141 O "O2'" . CMP E 4 .   ? 46.909 6.950   35.509 1.00 61.13 ? 2   CMP A "O2'" 1 
HETATM 2142 C "C1'" . CMP E 4 .   ? 47.078 5.103   37.144 1.00 84.54 ? 2   CMP A "C1'" 1 
HETATM 2143 N N9    . CMP E 4 .   ? 47.401 4.934   38.564 1.00 81.65 ? 2   CMP A N9    1 
HETATM 2144 C C8    . CMP E 4 .   ? 46.562 4.577   39.589 1.00 80.05 ? 2   CMP A C8    1 
HETATM 2145 N N7    . CMP E 4 .   ? 47.142 4.558   40.764 1.00 80.66 ? 2   CMP A N7    1 
HETATM 2146 C C5    . CMP E 4 .   ? 48.452 4.917   40.493 1.00 82.49 ? 2   CMP A C5    1 
HETATM 2147 C C6    . CMP E 4 .   ? 49.582 5.089   41.316 1.00 84.54 ? 2   CMP A C6    1 
HETATM 2148 N N6    . CMP E 4 .   ? 49.568 4.963   42.644 1.00 84.54 ? 2   CMP A N6    1 
HETATM 2149 N N1    . CMP E 4 .   ? 50.749 5.414   40.720 1.00 84.54 ? 2   CMP A N1    1 
HETATM 2150 C C2    . CMP E 4 .   ? 50.767 5.578   39.390 1.00 84.54 ? 2   CMP A C2    1 
HETATM 2151 N N3    . CMP E 4 .   ? 49.771 5.467   38.516 1.00 84.54 ? 2   CMP A N3    1 
HETATM 2152 C C4    . CMP E 4 .   ? 48.629 5.130   39.140 1.00 82.16 ? 2   CMP A C4    1 
HETATM 2153 O O     . HOH F 5 .   ? 47.590 13.301  15.289 1.00 71.28 ? 106 HOH B O     1 
HETATM 2154 O O     . HOH F 5 .   ? 71.220 -4.285  26.999 1.00 64.04 ? 133 HOH B O     1 
HETATM 2155 O O     . HOH F 5 .   ? 72.511 8.629   36.293 1.00 46.38 ? 136 HOH B O     1 
HETATM 2156 O O     . HOH F 5 .   ? 54.228 18.928  13.091 1.00 69.26 ? 138 HOH B O     1 
HETATM 2157 O O     . HOH G 5 .   ? 44.153 0.127   18.847 1.00 49.31 ? 109 HOH C O     1 
HETATM 2158 O O     . HOH G 5 .   ? 57.716 1.539   46.618 1.00 68.85 ? 110 HOH C O     1 
HETATM 2159 O O     . HOH G 5 .   ? 53.546 -2.703  20.074 1.00 68.41 ? 114 HOH C O     1 
HETATM 2160 O O     . HOH G 5 .   ? 57.995 -4.990  40.612 1.00 53.18 ? 126 HOH C O     1 
HETATM 2161 O O     . HOH G 5 .   ? 59.628 -7.057  51.257 1.00 76.19 ? 128 HOH C O     1 
HETATM 2162 O O     . HOH H 5 .   ? 47.856 -15.886 35.322 1.00 26.79 ? 208 HOH A O     1 
HETATM 2163 O O     . HOH H 5 .   ? 37.299 12.511  31.149 1.00 38.82 ? 209 HOH A O     1 
HETATM 2164 O O     . HOH H 5 .   ? 35.499 -5.837  29.942 1.00 44.95 ? 210 HOH A O     1 
HETATM 2165 O O     . HOH H 5 .   ? 40.209 -3.842  28.373 1.00 53.58 ? 211 HOH A O     1 
HETATM 2166 O O     . HOH H 5 .   ? 38.544 3.505   29.911 1.00 47.23 ? 212 HOH A O     1 
HETATM 2167 O O     . HOH H 5 .   ? 27.941 15.020  28.271 1.00 46.19 ? 213 HOH A O     1 
HETATM 2168 O O     . HOH H 5 .   ? 19.959 3.229   14.635 1.00 55.90 ? 214 HOH A O     1 
HETATM 2169 O O     . HOH H 5 .   ? 15.595 -2.059  35.148 1.00 62.58 ? 215 HOH A O     1 
HETATM 2170 O O     . HOH H 5 .   ? 29.794 20.035  30.986 1.00 78.33 ? 216 HOH A O     1 
HETATM 2171 O O     . HOH H 5 .   ? 27.360 -4.490  38.994 1.00 50.93 ? 217 HOH A O     1 
HETATM 2172 O O     . HOH H 5 .   ? 59.390 -21.105 33.355 1.00 59.69 ? 218 HOH A O     1 
HETATM 2173 O O     . HOH H 5 .   ? 39.017 -8.326  24.227 1.00 59.07 ? 219 HOH A O     1 
HETATM 2174 O O     . HOH H 5 .   ? 37.522 -6.450  42.514 1.00 53.30 ? 220 HOH A O     1 
HETATM 2175 O O     . HOH H 5 .   ? 4.665  7.678   36.410 1.00 62.39 ? 221 HOH A O     1 
HETATM 2176 O O     . HOH H 5 .   ? 51.498 -10.680 47.621 1.00 59.25 ? 222 HOH A O     1 
HETATM 2177 O O     . HOH H 5 .   ? 40.251 1.640   24.845 1.00 65.66 ? 223 HOH A O     1 
HETATM 2178 O O     . HOH H 5 .   ? 12.536 11.554  32.054 1.00 44.53 ? 224 HOH A O     1 
HETATM 2179 O O     . HOH H 5 .   ? 28.789 13.575  47.116 1.00 64.72 ? 225 HOH A O     1 
HETATM 2180 O O     . HOH H 5 .   ? 51.724 -6.513  50.371 1.00 66.92 ? 226 HOH A O     1 
HETATM 2181 O O     . HOH H 5 .   ? 35.699 -8.243  38.664 1.00 52.28 ? 227 HOH A O     1 
HETATM 2182 O O     . HOH H 5 .   ? 28.721 -2.676  21.092 1.00 45.21 ? 228 HOH A O     1 
HETATM 2183 O O     . HOH H 5 .   ? 27.588 14.581  34.454 1.00 58.27 ? 229 HOH A O     1 
HETATM 2184 O O     . HOH H 5 .   ? 50.664 -4.477  48.836 1.00 42.83 ? 230 HOH A O     1 
HETATM 2185 O O     . HOH H 5 .   ? 21.880 14.686  36.537 1.00 59.61 ? 231 HOH A O     1 
HETATM 2186 O O     . HOH H 5 .   ? 32.104 -2.324  41.328 1.00 65.61 ? 232 HOH A O     1 
HETATM 2187 O O     . HOH H 5 .   ? 49.069 10.251  43.294 1.00 55.27 ? 233 HOH A O     1 
HETATM 2188 O O     . HOH H 5 .   ? 5.614  -3.436  36.034 1.00 71.42 ? 234 HOH A O     1 
HETATM 2189 O O     . HOH H 5 .   ? 16.260 -0.336  23.393 1.00 56.12 ? 235 HOH A O     1 
HETATM 2190 O O     . HOH H 5 .   ? 25.718 -6.830  38.422 1.00 73.41 ? 236 HOH A O     1 
HETATM 2191 O O     . HOH H 5 .   ? 28.739 -5.428  35.286 1.00 49.32 ? 237 HOH A O     1 
HETATM 2192 O O     . HOH H 5 .   ? 39.849 -2.964  23.978 1.00 64.88 ? 238 HOH A O     1 
HETATM 2193 O O     . HOH H 5 .   ? 28.963 21.835  35.856 1.00 60.11 ? 239 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   -2  -2  DA  A   B . n 
A 1 2   DA  2   -1  -1  DA  A   B . n 
A 1 3   DA  3   1   1   DA  A   B . n 
A 1 4   DA  4   2   2   DA  A   B . n 
A 1 5   DA  5   3   3   DA  A   B . n 
A 1 6   DT  6   4   4   DT  T   B . n 
A 1 7   DG  7   5   5   DG  G   B . n 
A 1 8   DT  8   6   6   DT  T   B . n 
A 1 9   DG  9   7   7   DG  G   B . n 
A 1 10  DA  10  8   8   DA  A   B . n 
A 1 11  DT  11  9   9   DT  T   B . n 
B 2 1   DC  1   13  13  DC  C   C . n 
B 2 2   DT  2   12  12  DT  T   C . n 
B 2 3   DA  3   11  11  DA  A   C . n 
B 2 4   DG  4   10  10  DG  G   C . n 
B 2 5   DA  5   9   9   DA  A   C . n 
B 2 6   DT  6   8   8   DT  T   C . n 
B 2 7   DC  7   7   7   DC  C   C . n 
B 2 8   DA  8   6   6   DA  A   C . n 
B 2 9   DC  9   5   5   DC  C   C . n 
B 2 10  DA  10  4   4   DA  A   C . n 
B 2 11  DT  11  3   3   DT  T   C . n 
B 2 12  DT  12  2   2   DT  T   C . n 
B 2 13  DT  13  1   1   DT  T   C . n 
B 2 14  DT  14  -1  -1  DT  T   C . n 
B 2 15  DT  15  -2  -2  DT  T   C . n 
C 3 1   ASP 1   8   8   ASP ASP A . n 
C 3 2   PRO 2   9   9   PRO PRO A . n 
C 3 3   THR 3   10  10  THR THR A . n 
C 3 4   LEU 4   11  11  LEU LEU A . n 
C 3 5   GLU 5   12  12  GLU GLU A . n 
C 3 6   TRP 6   13  13  TRP TRP A . n 
C 3 7   PHE 7   14  14  PHE PHE A . n 
C 3 8   LEU 8   15  15  LEU LEU A . n 
C 3 9   SER 9   16  16  SER SER A . n 
C 3 10  HIS 10  17  17  HIS HIS A . n 
C 3 11  CYS 11  18  18  CYS CYS A . n 
C 3 12  HIS 12  19  19  HIS HIS A . n 
C 3 13  ILE 13  20  20  ILE ILE A . n 
C 3 14  HIS 14  21  21  HIS HIS A . n 
C 3 15  LYS 15  22  22  LYS LYS A . n 
C 3 16  TYR 16  23  23  TYR TYR A . n 
C 3 17  PRO 17  24  24  PRO PRO A . n 
C 3 18  SER 18  25  25  SER SER A . n 
C 3 19  LYS 19  26  26  LYS LYS A . n 
C 3 20  SER 20  27  27  SER SER A . n 
C 3 21  THR 21  28  28  THR THR A . n 
C 3 22  LEU 22  29  29  LEU LEU A . n 
C 3 23  ILE 23  30  30  ILE ILE A . n 
C 3 24  HIS 24  31  31  HIS HIS A . n 
C 3 25  GLN 25  32  32  GLN GLN A . n 
C 3 26  GLY 26  33  33  GLY GLY A . n 
C 3 27  GLU 27  34  34  GLU GLU A . n 
C 3 28  LYS 28  35  35  LYS LYS A . n 
C 3 29  ALA 29  36  36  ALA ALA A . n 
C 3 30  GLU 30  37  37  GLU GLU A . n 
C 3 31  THR 31  38  38  THR THR A . n 
C 3 32  LEU 32  39  39  LEU LEU A . n 
C 3 33  TYR 33  40  40  TYR TYR A . n 
C 3 34  TYR 34  41  41  TYR TYR A . n 
C 3 35  ILE 35  42  42  ILE ILE A . n 
C 3 36  VAL 36  43  43  VAL VAL A . n 
C 3 37  LYS 37  44  44  LYS LYS A . n 
C 3 38  GLY 38  45  45  GLY GLY A . n 
C 3 39  SER 39  46  46  SER SER A . n 
C 3 40  VAL 40  47  47  VAL VAL A . n 
C 3 41  ALA 41  48  48  ALA ALA A . n 
C 3 42  VAL 42  49  49  VAL VAL A . n 
C 3 43  LEU 43  50  50  LEU LEU A . n 
C 3 44  ILE 44  51  51  ILE ILE A . n 
C 3 45  LYS 45  52  52  LYS LYS A . n 
C 3 46  ASP 46  53  53  ASP ASP A . n 
C 3 47  GLU 47  54  54  GLU GLU A . n 
C 3 48  GLU 48  55  55  GLU GLU A . n 
C 3 49  GLY 49  56  56  GLY GLY A . n 
C 3 50  LYS 50  57  57  LYS LYS A . n 
C 3 51  GLU 51  58  58  GLU GLU A . n 
C 3 52  MET 52  59  59  MET MET A . n 
C 3 53  ILE 53  60  60  ILE ILE A . n 
C 3 54  LEU 54  61  61  LEU LEU A . n 
C 3 55  SER 55  62  62  SER SER A . n 
C 3 56  TYR 56  63  63  TYR TYR A . n 
C 3 57  LEU 57  64  64  LEU LEU A . n 
C 3 58  ASN 58  65  65  ASN ASN A . n 
C 3 59  GLN 59  66  66  GLN GLN A . n 
C 3 60  GLY 60  67  67  GLY GLY A . n 
C 3 61  ASP 61  68  68  ASP ASP A . n 
C 3 62  PHE 62  69  69  PHE PHE A . n 
C 3 63  ILE 63  70  70  ILE ILE A . n 
C 3 64  GLY 64  71  71  GLY GLY A . n 
C 3 65  GLU 65  72  72  GLU GLU A . n 
C 3 66  LEU 66  73  73  LEU LEU A . n 
C 3 67  GLY 67  74  74  GLY GLY A . n 
C 3 68  LEU 68  75  75  LEU LEU A . n 
C 3 69  PHE 69  76  76  PHE PHE A . n 
C 3 70  GLU 70  77  77  GLU GLU A . n 
C 3 71  GLU 71  78  78  GLU GLU A . n 
C 3 72  GLY 72  79  79  GLY GLY A . n 
C 3 73  GLN 73  80  80  GLN GLN A . n 
C 3 74  GLU 74  81  81  GLU GLU A . n 
C 3 75  ARG 75  82  82  ARG ARG A . n 
C 3 76  SER 76  83  83  SER SER A . n 
C 3 77  ALA 77  84  84  ALA ALA A . n 
C 3 78  TRP 78  85  85  TRP TRP A . n 
C 3 79  VAL 79  86  86  VAL VAL A . n 
C 3 80  ARG 80  87  87  ARG ARG A . n 
C 3 81  ALA 81  88  88  ALA ALA A . n 
C 3 82  LYS 82  89  89  LYS LYS A . n 
C 3 83  THR 83  90  90  THR THR A . n 
C 3 84  ALA 84  91  91  ALA ALA A . n 
C 3 85  CYS 85  92  92  CYS CYS A . n 
C 3 86  GLU 86  93  93  GLU GLU A . n 
C 3 87  VAL 87  94  94  VAL VAL A . n 
C 3 88  ALA 88  95  95  ALA ALA A . n 
C 3 89  GLU 89  96  96  GLU GLU A . n 
C 3 90  ILE 90  97  97  ILE ILE A . n 
C 3 91  SER 91  98  98  SER SER A . n 
C 3 92  TYR 92  99  99  TYR TYR A . n 
C 3 93  LYS 93  100 100 LYS LYS A . n 
C 3 94  LYS 94  101 101 LYS LYS A . n 
C 3 95  PHE 95  102 102 PHE PHE A . n 
C 3 96  ARG 96  103 103 ARG ARG A . n 
C 3 97  GLN 97  104 104 GLN GLN A . n 
C 3 98  LEU 98  105 105 LEU LEU A . n 
C 3 99  ILE 99  106 106 ILE ILE A . n 
C 3 100 GLN 100 107 107 GLN GLN A . n 
C 3 101 VAL 101 108 108 VAL VAL A . n 
C 3 102 ASN 102 109 109 ASN ASN A . n 
C 3 103 PRO 103 110 110 PRO PRO A . n 
C 3 104 ASP 104 111 111 ASP ASP A . n 
C 3 105 ILE 105 112 112 ILE ILE A . n 
C 3 106 LEU 106 113 113 LEU LEU A . n 
C 3 107 MET 107 114 114 MET MET A . n 
C 3 108 ARG 108 115 115 ARG ARG A . n 
C 3 109 LEU 109 116 116 LEU LEU A . n 
C 3 110 SER 110 117 117 SER SER A . n 
C 3 111 ALA 111 118 118 ALA ALA A . n 
C 3 112 GLN 112 119 119 GLN GLN A . n 
C 3 113 MET 113 120 120 MET MET A . n 
C 3 114 ALA 114 121 121 ALA ALA A . n 
C 3 115 ARG 115 122 122 ARG ARG A . n 
C 3 116 ARG 116 123 123 ARG ARG A . n 
C 3 117 LEU 117 124 124 LEU LEU A . n 
C 3 118 GLN 118 125 125 GLN GLN A . n 
C 3 119 VAL 119 126 126 VAL VAL A . n 
C 3 120 THR 120 127 127 THR THR A . n 
C 3 121 SER 121 128 128 SER SER A . n 
C 3 122 GLU 122 129 129 GLU GLU A . n 
C 3 123 LYS 123 130 130 LYS LYS A . n 
C 3 124 VAL 124 131 131 VAL VAL A . n 
C 3 125 GLY 125 132 132 GLY GLY A . n 
C 3 126 ASN 126 133 133 ASN ASN A . n 
C 3 127 LEU 127 134 134 LEU LEU A . n 
C 3 128 ALA 128 135 135 ALA ALA A . n 
C 3 129 PHE 129 136 136 PHE PHE A . n 
C 3 130 LEU 130 137 137 LEU LEU A . n 
C 3 131 ASP 131 138 138 ASP ASP A . n 
C 3 132 VAL 132 139 139 VAL VAL A . n 
C 3 133 THR 133 140 140 THR THR A . n 
C 3 134 GLY 134 141 141 GLY GLY A . n 
C 3 135 ARG 135 142 142 ARG ARG A . n 
C 3 136 ILE 136 143 143 ILE ILE A . n 
C 3 137 ALA 137 144 144 ALA ALA A . n 
C 3 138 GLN 138 145 145 GLN GLN A . n 
C 3 139 THR 139 146 146 THR THR A . n 
C 3 140 LEU 140 147 147 LEU LEU A . n 
C 3 141 LEU 141 148 148 LEU LEU A . n 
C 3 142 ASN 142 149 149 ASN ASN A . n 
C 3 143 LEU 143 150 150 LEU LEU A . n 
C 3 144 ALA 144 151 151 ALA ALA A . n 
C 3 145 LYS 145 152 152 LYS LYS A . n 
C 3 146 GLN 146 153 153 GLN GLN A . n 
C 3 147 PRO 147 154 154 PRO PRO A . n 
C 3 148 ASP 148 155 155 ASP ASP A . n 
C 3 149 ALA 149 156 156 ALA ALA A . n 
C 3 150 MET 150 157 157 MET MET A . n 
C 3 151 THR 151 158 158 THR THR A . n 
C 3 152 HIS 152 159 159 HIS HIS A . n 
C 3 153 PRO 153 160 160 PRO PRO A . n 
C 3 154 ASP 154 161 161 ASP ASP A . n 
C 3 155 GLY 155 162 162 GLY GLY A . n 
C 3 156 MET 156 163 163 MET MET A . n 
C 3 157 GLN 157 164 164 GLN GLN A . n 
C 3 158 ILE 158 165 165 ILE ILE A . n 
C 3 159 LYS 159 166 166 LYS LYS A . n 
C 3 160 ILE 160 167 167 ILE ILE A . n 
C 3 161 THR 161 168 168 THR THR A . n 
C 3 162 ARG 162 169 169 ARG ARG A . n 
C 3 163 GLN 163 170 170 GLN GLN A . n 
C 3 164 GLU 164 171 171 GLU GLU A . n 
C 3 165 ILE 165 172 172 ILE ILE A . n 
C 3 166 GLY 166 173 173 GLY GLY A . n 
C 3 167 GLN 167 174 174 GLN GLN A . n 
C 3 168 ILE 168 175 175 ILE ILE A . n 
C 3 169 VAL 169 176 176 VAL VAL A . n 
C 3 170 GLY 170 177 177 GLY GLY A . n 
C 3 171 CYS 171 178 178 CYS CYS A . n 
C 3 172 SER 172 179 179 SER SER A . n 
C 3 173 ARG 173 180 180 ARG ARG A . n 
C 3 174 GLU 174 181 181 GLU GLU A . n 
C 3 175 THR 175 182 182 THR THR A . n 
C 3 176 VAL 176 183 183 VAL VAL A . n 
C 3 177 GLY 177 184 184 GLY GLY A . n 
C 3 178 ARG 178 185 185 ARG ARG A . n 
C 3 179 ILE 179 186 186 ILE ILE A . n 
C 3 180 LEU 180 187 187 LEU LEU A . n 
C 3 181 LYS 181 188 188 LYS LYS A . n 
C 3 182 MET 182 189 189 MET MET A . n 
C 3 183 LEU 183 190 190 LEU LEU A . n 
C 3 184 GLU 184 191 191 GLU GLU A . n 
C 3 185 ASP 185 192 192 ASP ASP A . n 
C 3 186 GLN 186 193 193 GLN GLN A . n 
C 3 187 ASN 187 194 194 ASN ASN A . n 
C 3 188 LEU 188 195 195 LEU LEU A . n 
C 3 189 ILE 189 196 196 ILE ILE A . n 
C 3 190 SER 190 197 197 SER SER A . n 
C 3 191 ALA 191 198 198 ALA ALA A . n 
C 3 192 HIS 192 199 199 HIS HIS A . n 
C 3 193 GLY 193 200 200 GLY GLY A . n 
C 3 194 LYS 194 201 201 LYS LYS A . n 
C 3 195 THR 195 202 202 THR THR A . n 
C 3 196 ILE 196 203 203 ILE ILE A . n 
C 3 197 VAL 197 204 204 VAL VAL A . n 
C 3 198 VAL 198 205 205 VAL VAL A . n 
C 3 199 TYR 199 206 206 TYR TYR A . n 
C 3 200 GLY 200 207 207 GLY GLY A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 95.4666666667 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-08 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO 'data reduction' .         ? 1 
SCALA 'data scaling'   .         ? 2 
AMoRE phasing          .         ? 3 
CNS   refinement       0.5       ? 4 
CCP4  'data scaling'   '(SCALA)' ? 5 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ALA 
_pdbx_validate_symm_contact.auth_seq_id_1     135 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    N6 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    CMP 
_pdbx_validate_symm_contact.auth_seq_id_2     2 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_555 
_pdbx_validate_symm_contact.dist              2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_1              12 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_2              12 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_3              12 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.10 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            1.80 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 9  ? ? -54.42  -89.69 
2 1 THR A 10 ? ? -19.25  -41.36 
3 1 SER A 16 ? ? -47.57  -6.57  
4 1 LYS A 26 ? ? 80.20   -12.84 
5 1 GLU A 37 ? ? -145.75 -4.89  
6 1 LYS A 44 ? ? -174.97 145.17 
7 1 SER A 62 ? ? 170.84  167.55 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1O3Q 'double helix'        
1O3Q 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 1  1_555 B DT 15 1_555 0.204  -0.198 -1.207 -21.380 4.403   -9.389  1  B_DA-2:DT-2_C B -2 ? C -2 ? 20 1 
1 A DA 2  1_555 B DT 14 1_555 0.009  -0.173 -0.398 15.480  16.712  0.119   2  B_DA-1:DT-1_C B -1 ? C -1 ? 20 1 
1 A DA 3  1_555 B DT 13 1_555 -0.163 -0.094 0.006  22.398  -22.112 11.359  3  B_DA1:DT1_C   B 1  ? C 1  ? 20 1 
1 A DA 4  1_555 B DT 12 1_555 -0.075 -0.165 0.130  -3.870  -13.272 2.795   4  B_DA2:DT2_C   B 2  ? C 2  ? 20 1 
1 A DA 5  1_555 B DT 11 1_555 0.068  -0.084 0.556  -2.381  -13.709 -2.015  5  B_DA3:DT3_C   B 3  ? C 3  ? 20 1 
1 A DT 6  1_555 B DA 10 1_555 0.058  0.008  -0.112 -8.104  -9.587  -1.901  6  B_DT4:DA4_C   B 4  ? C 4  ? 20 1 
1 A DG 7  1_555 B DC 9  1_555 -0.009 -0.118 -1.679 -34.804 -17.123 -1.401  7  B_DG5:DC5_C   B 5  ? C 5  ? 19 1 
1 A DT 8  1_555 B DA 8  1_555 -0.391 -0.124 0.442  -17.627 -17.018 -3.539  8  B_DT6:DA6_C   B 6  ? C 6  ? 20 1 
1 A DG 9  1_555 B DC 7  1_555 -0.404 -0.030 -1.013 -35.287 -20.553 5.417   9  B_DG7:DC7_C   B 7  ? C 7  ? 19 1 
1 A DA 10 1_555 B DT 6  1_555 0.038  -0.084 0.305  -5.402  -7.769  0.985   10 B_DA8:DT8_C   B 8  ? C 8  ? 20 1 
1 A DT 11 1_555 B DA 5  1_555 -0.149 0.006  -0.441 14.092  9.764   -1.761  11 B_DT9:DA9_C   B 9  ? C 9  ? 20 1 
1 B DC 1  1_555 B DG 4  5_555 -0.553 0.234  0.764  -10.849 25.625  7.532   12 C_DC13:DG10_C C 13 ? C 10 ? 19 1 
1 B DT 2  1_555 B DA 3  5_555 0.186  -0.297 0.171  16.351  -6.068  -13.273 13 C_DT12:DA11_C C 12 ? C 11 ? 20 1 
1 B DA 3  1_555 B DT 2  5_555 -0.186 -0.297 0.171  -16.351 -6.068  -13.273 14 C_DA11:DT12_C C 11 ? C 12 ? 20 1 
1 B DG 4  1_555 B DC 1  5_555 0.553  0.234  0.764  10.849  25.625  7.532   15 C_DG10:DC13_C C 10 ? C 13 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1  1_555 B DT 15 1_555 A DA 2  1_555 B DT 14 1_555 0.666  -0.053 2.271 -7.860  3.833   37.069 -0.410 -1.694 2.076 5.928   
12.157  38.051 1  BB_DA-2DA-1:DT-1DT-2_CC B -2 ? C -2 ? B -1 ? C -1 ? 
1 A DA 2  1_555 B DT 14 1_555 A DA 3  1_555 B DT 13 1_555 0.626  0.039  3.696 7.842   -22.489 37.776 2.466  0.013  3.253 -31.238 
-10.892 44.424 2  BB_DA-1DA1:DT1DT-1_CC   B -1 ? C -1 ? B 1  ? C 1  ? 
1 A DA 3  1_555 B DT 13 1_555 A DA 4  1_555 B DT 12 1_555 -0.224 -0.553 3.497 -6.257  16.110  37.456 -2.619 -0.392 3.021 23.610  
9.170   41.121 3  BB_DA1DA2:DT2DT1_CC     B 1  ? C 1  ? B 2  ? C 2  ? 
1 A DA 4  1_555 B DT 12 1_555 A DA 5  1_555 B DT 11 1_555 -0.297 -0.611 2.822 -2.533  -0.548  34.375 -0.958 0.159  2.845 -0.926  
4.279   34.470 4  BB_DA2DA3:DT3DT2_CC     B 2  ? C 2  ? B 3  ? C 3  ? 
1 A DA 5  1_555 B DT 11 1_555 A DT 6  1_555 B DA 10 1_555 -0.214 -1.465 3.284 7.403   2.177   32.815 -2.876 1.554  3.064 3.789   
-12.883 33.686 5  BB_DA3DT4:DA4DT3_CC     B 3  ? C 3  ? B 4  ? C 4  ? 
1 A DT 6  1_555 B DA 10 1_555 A DG 7  1_555 B DC 9  1_555 -0.008 0.458  4.315 2.041   21.542  36.136 -2.437 0.303  3.967 31.500  
-2.985  41.933 6  BB_DT4DG5:DC5DA4_CC     B 4  ? C 4  ? B 5  ? C 5  ? 
1 A DG 7  1_555 B DC 9  1_555 A DT 8  1_555 B DA 8  1_555 -0.754 1.010  2.638 -18.773 1.375   27.902 1.548  -1.434 2.658 2.520   
34.418  33.553 7  BB_DG5DT6:DA6DC5_CC     B 5  ? C 5  ? B 6  ? C 6  ? 
1 A DT 8  1_555 B DA 8  1_555 A DG 9  1_555 B DC 7  1_555 -0.310 2.251  4.309 5.030   24.231  19.682 -3.324 2.121  4.375 50.991  
-10.586 31.524 8  BB_DT6DG7:DC7DA6_CC     B 6  ? C 6  ? B 7  ? C 7  ? 
1 A DG 9  1_555 B DC 7  1_555 A DA 10 1_555 B DT 6  1_555 -0.559 0.628  2.410 -20.827 -2.086  31.484 1.187  -1.268 2.293 -3.412  
34.079  37.660 9  BB_DG7DA8:DT8DC7_CC     B 7  ? C 7  ? B 8  ? C 8  ? 
1 A DA 10 1_555 B DT 6  1_555 A DT 11 1_555 B DA 5  1_555 0.231  -0.636 2.655 3.311   1.244   25.382 -1.720 0.240  2.629 2.815   
-7.489  25.623 10 BB_DA8DT9:DA9DT8_CC     B 8  ? C 8  ? B 9  ? C 9  ? 
1 B DC 1  1_555 B DG 4  5_555 B DT 2  1_555 B DA 3  5_555 -0.186 -0.839 3.005 11.305  -6.851  30.971 -0.399 2.057  2.881 -12.159 
-20.063 33.611 11 CC_DC13DT12:DA11DG10_CC C 13 ? C 10 ? C 12 ? C 11 ? 
1 B DT 2  1_555 B DA 3  5_555 B DA 3  1_555 B DT 2  5_555 0.000  1.074  3.813 0.000   -1.231  49.078 1.400  0.000  3.787 -1.482  
0.000   49.093 12 CC_DT12DA11:DT12DA11_CC C 12 ? C 11 ? C 11 ? C 12 ? 
1 B DA 3  1_555 B DT 2  5_555 B DG 4  1_555 B DC 1  5_555 0.186  -0.839 3.005 -11.305 -6.851  30.971 -0.399 -2.057 2.881 -12.159 
20.063  33.611 13 CC_DA11DG10:DC13DT12_CC C 11 ? C 12 ? C 10 ? C 13 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
5 water                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CMP 1  1   1   CMP CMP A . 
E 4 CMP 1  2   2   CMP CMP A . 
F 5 HOH 1  106 106 HOH HOH B . 
F 5 HOH 2  133 133 HOH HOH B . 
F 5 HOH 3  136 136 HOH HOH B . 
F 5 HOH 4  138 138 HOH HOH B . 
G 5 HOH 1  109 109 HOH HOH C . 
G 5 HOH 2  110 110 HOH HOH C . 
G 5 HOH 3  114 114 HOH HOH C . 
G 5 HOH 4  126 126 HOH HOH C . 
G 5 HOH 5  128 128 HOH HOH C . 
H 5 HOH 1  208 100 HOH HOH A . 
H 5 HOH 2  209 101 HOH HOH A . 
H 5 HOH 3  210 102 HOH HOH A . 
H 5 HOH 4  211 103 HOH HOH A . 
H 5 HOH 5  212 104 HOH HOH A . 
H 5 HOH 6  213 105 HOH HOH A . 
H 5 HOH 7  214 107 HOH HOH A . 
H 5 HOH 8  215 108 HOH HOH A . 
H 5 HOH 9  216 111 HOH HOH A . 
H 5 HOH 10 217 112 HOH HOH A . 
H 5 HOH 11 218 113 HOH HOH A . 
H 5 HOH 12 219 115 HOH HOH A . 
H 5 HOH 13 220 116 HOH HOH A . 
H 5 HOH 14 221 117 HOH HOH A . 
H 5 HOH 15 222 118 HOH HOH A . 
H 5 HOH 16 223 119 HOH HOH A . 
H 5 HOH 17 224 120 HOH HOH A . 
H 5 HOH 18 225 121 HOH HOH A . 
H 5 HOH 19 226 122 HOH HOH A . 
H 5 HOH 20 227 123 HOH HOH A . 
H 5 HOH 21 228 124 HOH HOH A . 
H 5 HOH 22 229 125 HOH HOH A . 
H 5 HOH 23 230 127 HOH HOH A . 
H 5 HOH 24 231 129 HOH HOH A . 
H 5 HOH 25 232 130 HOH HOH A . 
H 5 HOH 26 233 131 HOH HOH A . 
H 5 HOH 27 234 132 HOH HOH A . 
H 5 HOH 28 235 134 HOH HOH A . 
H 5 HOH 29 236 135 HOH HOH A . 
H 5 HOH 30 237 137 HOH HOH A . 
H 5 HOH 31 238 139 HOH HOH A . 
H 5 HOH 32 239 140 HOH HOH A . 
#