data_1O3R
# 
_entry.id   1O3R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O3R         
NDB   PD0399       
RCSB  RCSB001767   
WWPDB D_1000001767 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2003-04-08 
_pdbx_database_PDB_obs_spr.pdb_id           1O3R 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1DB8 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1O3Q . unspecified 
PDB 1O3S . unspecified 
PDB 1O3T . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O3R 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, S.'         1 
'Vojtechovsky, J.' 2 
'Parkinson, G.N.'  3 
'Ebright, R.H.'    4 
'Berman, H.M.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
;
J.Mol.Biol. 314 63 74 2001 JMOBAK UK 0022-2836 0070 ? 11724532 10.1006/jmbi.2001.5089 
1       
;Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
;
J.Mol.Biol. 314 75 82 2001 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.2001.5090 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, S.'         1  
primary 'Vojtechovsky, J.' 2  
primary 'Parkinson, G.N.'  3  
primary 'Ebright, R.H.'    4  
primary 'Berman, H.M.'     5  
1       'Chen, S.'         6  
1       'Gunasekera, A.'   7  
1       'Zhang, X.'        8  
1       'Kunkel, T.A.'     9  
1       'Ebright, R.H.'    10 
1       'Berman, H.M.'     11 
# 
_cell.entry_id           1O3R 
_cell.length_a           76.900 
_cell.length_b           76.900 
_cell.length_c           143.640 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1O3R 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.cell_setting                     trigonal 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'"             3390.262  1  ? ? ? ? 
2 polymer     syn "5'-D(*CP*TP*AP*GP*AP*TP*CP*GP*CP*AP*TP*TP*TP*TP*T)-3'" 4549.969  1  ? ? ? ? 
3 polymer     man 'CATABOLITE GENE ACTIVATOR PROTEIN'                     22558.072 1  ? ? ? ? 
4 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                  329.206   2  ? ? ? ? 
5 water       nat water                                                   18.015    54 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'CAP, CAMP RECEPTOR PROTEIN, CAMP-REGULATORY PROTEIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DA)(DA)(DT)(DG)(DC)(DG)(DA)(DT)' AAAAATGCGAT B ? 
2 polydeoxyribonucleotide no no '(DC)(DT)(DA)(DG)(DA)(DT)(DC)(DG)(DC)(DA)(DT)(DT)(DT)(DT)(DT)' CTAGATCGCATTTTT C ? 
3 'polypeptide(L)'        no no 
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DG  n 
1 8   DC  n 
1 9   DG  n 
1 10  DA  n 
1 11  DT  n 
2 1   DC  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DC  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
3 1   ASP n 
3 2   PRO n 
3 3   THR n 
3 4   LEU n 
3 5   GLU n 
3 6   TRP n 
3 7   PHE n 
3 8   LEU n 
3 9   SER n 
3 10  HIS n 
3 11  CYS n 
3 12  HIS n 
3 13  ILE n 
3 14  HIS n 
3 15  LYS n 
3 16  TYR n 
3 17  PRO n 
3 18  SER n 
3 19  LYS n 
3 20  SER n 
3 21  THR n 
3 22  LEU n 
3 23  ILE n 
3 24  HIS n 
3 25  GLN n 
3 26  GLY n 
3 27  GLU n 
3 28  LYS n 
3 29  ALA n 
3 30  GLU n 
3 31  THR n 
3 32  LEU n 
3 33  TYR n 
3 34  TYR n 
3 35  ILE n 
3 36  VAL n 
3 37  LYS n 
3 38  GLY n 
3 39  SER n 
3 40  VAL n 
3 41  ALA n 
3 42  VAL n 
3 43  LEU n 
3 44  ILE n 
3 45  LYS n 
3 46  ASP n 
3 47  GLU n 
3 48  GLU n 
3 49  GLY n 
3 50  LYS n 
3 51  GLU n 
3 52  MET n 
3 53  ILE n 
3 54  LEU n 
3 55  SER n 
3 56  TYR n 
3 57  LEU n 
3 58  ASN n 
3 59  GLN n 
3 60  GLY n 
3 61  ASP n 
3 62  PHE n 
3 63  ILE n 
3 64  GLY n 
3 65  GLU n 
3 66  LEU n 
3 67  GLY n 
3 68  LEU n 
3 69  PHE n 
3 70  GLU n 
3 71  GLU n 
3 72  GLY n 
3 73  GLN n 
3 74  GLU n 
3 75  ARG n 
3 76  SER n 
3 77  ALA n 
3 78  TRP n 
3 79  VAL n 
3 80  ARG n 
3 81  ALA n 
3 82  LYS n 
3 83  THR n 
3 84  ALA n 
3 85  CYS n 
3 86  GLU n 
3 87  VAL n 
3 88  ALA n 
3 89  GLU n 
3 90  ILE n 
3 91  SER n 
3 92  TYR n 
3 93  LYS n 
3 94  LYS n 
3 95  PHE n 
3 96  ARG n 
3 97  GLN n 
3 98  LEU n 
3 99  ILE n 
3 100 GLN n 
3 101 VAL n 
3 102 ASN n 
3 103 PRO n 
3 104 ASP n 
3 105 ILE n 
3 106 LEU n 
3 107 MET n 
3 108 ARG n 
3 109 LEU n 
3 110 SER n 
3 111 ALA n 
3 112 GLN n 
3 113 MET n 
3 114 ALA n 
3 115 ARG n 
3 116 ARG n 
3 117 LEU n 
3 118 GLN n 
3 119 VAL n 
3 120 THR n 
3 121 SER n 
3 122 GLU n 
3 123 LYS n 
3 124 VAL n 
3 125 GLY n 
3 126 ASN n 
3 127 LEU n 
3 128 ALA n 
3 129 PHE n 
3 130 LEU n 
3 131 ASP n 
3 132 VAL n 
3 133 THR n 
3 134 GLY n 
3 135 ARG n 
3 136 ILE n 
3 137 ALA n 
3 138 GLN n 
3 139 THR n 
3 140 LEU n 
3 141 LEU n 
3 142 ASN n 
3 143 LEU n 
3 144 ALA n 
3 145 LYS n 
3 146 GLN n 
3 147 PRO n 
3 148 ASP n 
3 149 ALA n 
3 150 MET n 
3 151 THR n 
3 152 HIS n 
3 153 PRO n 
3 154 ASP n 
3 155 GLY n 
3 156 MET n 
3 157 GLN n 
3 158 ILE n 
3 159 LYS n 
3 160 ILE n 
3 161 THR n 
3 162 ARG n 
3 163 GLN n 
3 164 GLU n 
3 165 ILE n 
3 166 GLY n 
3 167 GLN n 
3 168 ILE n 
3 169 VAL n 
3 170 GLY n 
3 171 CYS n 
3 172 SER n 
3 173 ARG n 
3 174 GLU n 
3 175 THR n 
3 176 VAL n 
3 177 GLY n 
3 178 ARG n 
3 179 ILE n 
3 180 LEU n 
3 181 LYS n 
3 182 MET n 
3 183 LEU n 
3 184 GLU n 
3 185 ASP n 
3 186 GLN n 
3 187 ASN n 
3 188 LEU n 
3 189 ILE n 
3 190 SER n 
3 191 ALA n 
3 192 HIS n 
3 193 GLY n 
3 194 LYS n 
3 195 THR n 
3 196 ILE n 
3 197 VAL n 
3 198 VAL n 
3 199 TYR n 
3 200 GLY n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP CRP_ECOLI P0ACJ8 9 
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
? 
2 1 PDB 1O3R      1O3R   ? ? ? 
3 2 PDB 1O3R      1O3R   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O3R A 1 ? 200 ? P0ACJ8 9  ? 208 ? 8  207 
2 2 1O3R B 1 ? 11  ? 1O3R   -2 ? 9   ? -2 9   
3 3 1O3R C 1 ? 15  ? 1O3R   13 ? -2  ? 13 -2  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                  'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ?                  'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1O3R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.97 
_exptl_crystal.density_percent_sol   68.8 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.23 
_exptl_crystal_grow.pdbx_details    
;PEG 8000, 1,4-DIOXANE, MES, NACL, MGCL2, CAMP, pH 6.23, 
VAPOR DIFFUSION, HANGING DROP at 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 1,4-DIOXANE ? ? ? 
1 2 1 MES         ? ? ? 
1 3 1 NACL        ? ? ? 
1 4 1 MGCL2       ? ? ? 
1 5 1 CAMP        ? ? ? 
1 6 1 'PEG 8000'  ? ? ? 
1 7 2 'PEG 8000'  ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           108.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   1997-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.100 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1O3R 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   9519 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.5 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.8000 
_reflns.B_iso_Wilson_estimate        32.75 
_reflns.pdbx_redundancy              5.300 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           0.306 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        5.30 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1O3R 
_refine.ls_number_reflns_obs                     9519 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               2839655.76 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    92.5 
_refine.ls_R_factor_obs                          0.2331 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.283 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  953 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               54.70 
_refine.aniso_B[1][1]                            9.92 
_refine.aniso_B[2][2]                            9.92 
_refine.aniso_B[3][3]                            -19.84 
_refine.aniso_B[1][2]                            17.17 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.399 
_refine.solvent_model_param_bsol                 70.85 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1O3R 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.13 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.45 
_refine_analyze.Luzzati_sigma_a_free            0.32 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1581 
_refine_hist.pdbx_number_atoms_nucleic_acid   527 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             54 
_refine_hist.number_atoms_total               2206 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.50  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.20 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.06  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.750 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.310 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             4.090 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            5.930 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             1480 
_refine_ls_shell.R_factor_R_work                  0.247 
_refine_ls_shell.percent_reflns_obs               96.40 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            0.030 
_refine_ls_shell.percent_reflns_R_free            8.90 
_refine_ls_shell.number_reflns_R_free             144 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 CMP.PARAM         CMP.TOP     'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1O3R 
_struct.title                     'PROTEIN-DNA RECOGNITION AND DNA DEFORMATION REVEALED IN CRYSTAL STRUCTURES OF CAP-DNA COMPLEXES' 
_struct.pdbx_descriptor           'CATABOLITE GENE ACTIVATOR PROTEIN/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O3R 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            
'PROTEIN-DNA COMPLEX, CAP, CAP-DNA, CATABOLITE GENE ACTIVATOR PROTEIN, CAMP RECEPTOR PROTEIN, CRP, GENE REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP C 1   ? SER C 9   ? ASP A 8   SER A 16  1 ? 9  
HELX_P HELX_P2 2 GLU C 65  ? PHE C 69  ? GLU A 72  PHE A 76  5 ? 5  
HELX_P HELX_P3 3 TYR C 92  ? ASN C 102 ? TYR A 99  ASN A 109 1 ? 11 
HELX_P HELX_P4 4 ASN C 102 ? LEU C 130 ? ASN A 109 LEU A 137 1 ? 29 
HELX_P HELX_P5 5 ASP C 131 ? GLN C 146 ? ASP A 138 GLN A 153 1 ? 16 
HELX_P HELX_P6 6 THR C 161 ? GLY C 170 ? THR A 168 GLY A 177 1 ? 10 
HELX_P HELX_P7 7 SER C 172 ? GLN C 186 ? SER A 179 GLN A 193 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 1  N1 ? ? ? 1_555 B DT 15 N3 ? ? B DA -2 C DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 15 O4 ? ? B DA -2 C DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 14 N3 ? ? B DA -1 C DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 14 O4 ? ? B DA -1 C DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 13 N3 ? ? B DA 1  C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 13 O4 ? ? B DA 1  C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 12 N3 ? ? B DA 2  C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 12 O4 ? ? B DA 2  C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 11 N3 ? ? B DA 3  C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 11 O4 ? ? B DA 3  C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 10 N1 ? ? B DT 4  C DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 10 N6 ? ? B DT 4  C DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC 9  N3 ? ? B DG 5  C DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC 9  O2 ? ? B DG 5  C DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC 9  N4 ? ? B DG 5  C DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG 8  N1 ? ? B DC 6  C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG 8  O6 ? ? B DC 6  C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG 8  N2 ? ? B DC 6  C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 7  N3 ? ? B DG 7  C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 7  O2 ? ? B DG 7  C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 7  N4 ? ? B DG 7  C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 6  N3 ? ? B DA 8  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 6  O4 ? ? B DA 8  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 5  N1 ? ? B DT 9  C DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 5  N6 ? ? B DT 9  C DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS C 12  ? TYR C 16  ? HIS A 19  TYR A 23  
A 2 CYS C 85  ? SER C 91  ? CYS A 92  SER A 98  
A 3 THR C 31  ? LYS C 37  ? THR A 38  LYS A 44  
A 4 PHE C 62  ? ILE C 63  ? PHE A 69  ILE A 70  
B 1 THR C 21  ? ILE C 23  ? THR A 28  ILE A 30  
B 2 TRP C 78  ? ALA C 81  ? TRP A 85  ALA A 88  
B 3 VAL C 40  ? LYS C 45  ? VAL A 47  LYS A 52  
B 4 GLU C 51  ? LEU C 57  ? GLU A 58  LEU A 64  
C 1 MET C 150 ? HIS C 152 ? MET A 157 HIS A 159 
C 2 GLY C 155 ? LYS C 159 ? GLY A 162 LYS A 166 
C 3 THR C 195 ? TYR C 199 ? THR A 202 TYR A 206 
C 4 ILE C 189 ? HIS C 192 ? ILE A 196 HIS A 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS C 14  ? N HIS A 21  O VAL C 87  ? O VAL A 94  
A 2 3 O ILE C 90  ? O ILE A 97  N LEU C 32  ? N LEU A 39  
A 3 4 N TYR C 33  ? N TYR A 40  O ILE C 63  ? O ILE A 70  
B 1 2 N ILE C 23  ? N ILE A 30  O VAL C 79  ? O VAL A 86  
B 2 3 O ARG C 80  ? O ARG A 87  N ALA C 41  ? N ALA A 48  
B 3 4 N VAL C 42  ? N VAL A 49  O LEU C 54  ? O LEU A 61  
C 1 2 N MET C 150 ? N MET A 157 O GLN C 157 ? O GLN A 164 
C 2 3 N MET C 156 ? N MET A 163 O VAL C 198 ? O VAL A 205 
C 3 4 O THR C 195 ? O THR A 202 N HIS C 192 ? N HIS A 199 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CMP A 1' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CMP A 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 SER C 55  ? SER A 62  . ? 1_555 ? 
2  AC1 11 ILE C 63  ? ILE A 70  . ? 1_555 ? 
3  AC1 11 GLY C 64  ? GLY A 71  . ? 1_555 ? 
4  AC1 11 GLU C 65  ? GLU A 72  . ? 1_555 ? 
5  AC1 11 LEU C 66  ? LEU A 73  . ? 1_555 ? 
6  AC1 11 ARG C 75  ? ARG A 82  . ? 1_555 ? 
7  AC1 11 SER C 76  ? SER A 83  . ? 1_555 ? 
8  AC1 11 VAL C 79  ? VAL A 86  . ? 1_555 ? 
9  AC1 11 THR C 120 ? THR A 127 . ? 1_555 ? 
10 AC1 11 SER C 121 ? SER A 128 . ? 5_555 ? 
11 AC1 11 HOH H .   ? HOH A 213 . ? 1_555 ? 
12 AC2 14 LYS C 50  ? LYS A 57  . ? 1_555 ? 
13 AC2 14 GLU C 51  ? GLU A 58  . ? 1_555 ? 
14 AC2 14 ALA C 128 ? ALA A 135 . ? 5_555 ? 
15 AC2 14 PHE C 129 ? PHE A 136 . ? 5_555 ? 
16 AC2 14 GLN C 163 ? GLN A 170 . ? 1_555 ? 
17 AC2 14 GLY C 166 ? GLY A 173 . ? 1_555 ? 
18 AC2 14 GLN C 167 ? GLN A 174 . ? 1_555 ? 
19 AC2 14 GLY C 170 ? GLY A 177 . ? 1_555 ? 
20 AC2 14 CYS C 171 ? CYS A 178 . ? 1_555 ? 
21 AC2 14 SER C 172 ? SER A 179 . ? 1_555 ? 
22 AC2 14 ARG C 173 ? ARG A 180 . ? 1_555 ? 
23 AC2 14 HOH H .   ? HOH A 219 . ? 1_555 ? 
24 AC2 14 HOH H .   ? HOH A 249 . ? 1_555 ? 
25 AC2 14 DA  B 5   ? DA  C 9   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1O3R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O3R 
_atom_sites.fract_transf_matrix[1][1]   0.013004 
_atom_sites.fract_transf_matrix[1][2]   0.007508 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015016 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006962 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 52.206 8.777   5.983  1.00 85.22 ? -2  DA  B "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 51.277 9.507   5.165  1.00 84.66 ? -2  DA  B "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 50.035 9.984   5.888  1.00 85.22 ? -2  DA  B "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 49.262 8.856   6.380  1.00 85.22 ? -2  DA  B "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 50.349 10.810  7.134  1.00 85.22 ? -2  DA  B "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 49.265 11.739  7.347  1.00 85.22 ? -2  DA  B "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 50.444 9.751   8.228  1.00 84.57 ? -2  DA  B "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 49.357 8.770   7.810  1.00 85.22 ? -2  DA  B "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 49.560 7.363   8.185  1.00 85.22 ? -2  DA  B N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 50.521 6.483   7.726  1.00 85.22 ? -2  DA  B C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 50.407 5.266   8.221  1.00 85.22 ? -2  DA  B N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 49.310 5.350   9.071  1.00 85.22 ? -2  DA  B C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 48.668 4.392   9.900  1.00 85.22 ? -2  DA  B C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 49.052 3.119   10.007 1.00 85.22 ? -2  DA  B N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 47.600 4.798   10.624 1.00 85.22 ? -2  DA  B N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 47.209 6.087   10.518 1.00 85.22 ? -2  DA  B C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 47.728 7.077   9.778  1.00 85.22 ? -2  DA  B N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 48.784 6.639   9.068  1.00 85.22 ? -2  DA  B C4    1 
ATOM   19   P P     . DA  A 1 2   ? 49.340 12.819  8.548  1.00 85.22 ? -1  DA  B P     1 
ATOM   20   O OP1   . DA  A 1 2   ? 47.916 13.132  8.913  1.00 85.22 ? -1  DA  B OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? 50.275 13.933  8.171  1.00 85.22 ? -1  DA  B OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? 50.009 11.993  9.738  1.00 85.22 ? -1  DA  B "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? 50.104 12.532  11.050 1.00 85.22 ? -1  DA  B "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? 48.831 12.250  11.815 1.00 85.22 ? -1  DA  B "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? 48.483 10.850  11.663 1.00 85.22 ? -1  DA  B "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? 49.001 12.461  13.312 1.00 85.22 ? -1  DA  B "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? 47.787 12.894  13.920 1.00 85.22 ? -1  DA  B "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? 49.468 11.102  13.796 1.00 85.22 ? -1  DA  B "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? 48.745 10.133  12.869 1.00 85.22 ? -1  DA  B "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? 49.563 8.959   12.535 1.00 85.22 ? -1  DA  B N9    1 
ATOM   31   C C8    . DA  A 1 2   ? 50.753 8.935   11.845 1.00 85.22 ? -1  DA  B C8    1 
ATOM   32   N N7    . DA  A 1 2   ? 51.284 7.739   11.743 1.00 85.22 ? -1  DA  B N7    1 
ATOM   33   C C5    . DA  A 1 2   ? 50.378 6.916   12.399 1.00 84.68 ? -1  DA  B C5    1 
ATOM   34   C C6    . DA  A 1 2   ? 50.365 5.527   12.651 1.00 82.75 ? -1  DA  B C6    1 
ATOM   35   N N6    . DA  A 1 2   ? 51.318 4.693   12.254 1.00 78.80 ? -1  DA  B N6    1 
ATOM   36   N N1    . DA  A 1 2   ? 49.319 5.022   13.340 1.00 85.22 ? -1  DA  B N1    1 
ATOM   37   C C2    . DA  A 1 2   ? 48.353 5.859   13.746 1.00 85.22 ? -1  DA  B C2    1 
ATOM   38   N N3    . DA  A 1 2   ? 48.252 7.180   13.573 1.00 85.22 ? -1  DA  B N3    1 
ATOM   39   C C4    . DA  A 1 2   ? 49.308 7.652   12.884 1.00 85.22 ? -1  DA  B C4    1 
ATOM   40   P P     . DA  A 1 3   ? 47.818 13.464  15.423 1.00 85.22 ? 1   DA  B P     1 
ATOM   41   O OP1   . DA  A 1 3   ? 46.777 14.537  15.523 1.00 85.22 ? 1   DA  B OP1   1 
ATOM   42   O OP2   . DA  A 1 3   ? 49.238 13.768  15.792 1.00 85.22 ? 1   DA  B OP2   1 
ATOM   43   O "O5'" . DA  A 1 3   ? 47.321 12.212  16.280 1.00 85.22 ? 1   DA  B "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 3   ? 46.133 11.519  15.904 1.00 85.22 ? 1   DA  B "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 3   ? 45.839 10.382  16.857 1.00 85.22 ? 1   DA  B "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 3   ? 46.734 9.261   16.603 1.00 85.22 ? 1   DA  B "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 3   ? 46.089 10.764  18.317 1.00 85.16 ? 1   DA  B "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 3   ? 45.159 10.069  19.159 1.00 83.10 ? 1   DA  B "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 3   ? 47.542 10.361  18.533 1.00 84.61 ? 1   DA  B "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 3   ? 47.629 9.092   17.698 1.00 85.16 ? 1   DA  B "C1'" 1 
ATOM   51   N N9    . DA  A 1 3   ? 48.938 8.668   17.184 1.00 85.22 ? 1   DA  B N9    1 
ATOM   52   C C8    . DA  A 1 3   ? 49.998 9.443   16.774 1.00 85.22 ? 1   DA  B C8    1 
ATOM   53   N N7    . DA  A 1 3   ? 51.038 8.746   16.363 1.00 85.22 ? 1   DA  B N7    1 
ATOM   54   C C5    . DA  A 1 3   ? 50.638 7.421   16.510 1.00 85.22 ? 1   DA  B C5    1 
ATOM   55   C C6    . DA  A 1 3   ? 51.287 6.189   16.243 1.00 85.08 ? 1   DA  B C6    1 
ATOM   56   N N6    . DA  A 1 3   ? 52.521 6.091   15.756 1.00 85.22 ? 1   DA  B N6    1 
ATOM   57   N N1    . DA  A 1 3   ? 50.613 5.049   16.505 1.00 85.07 ? 1   DA  B N1    1 
ATOM   58   C C2    . DA  A 1 3   ? 49.371 5.144   17.001 1.00 84.11 ? 1   DA  B C2    1 
ATOM   59   N N3    . DA  A 1 3   ? 48.652 6.233   17.294 1.00 84.52 ? 1   DA  B N3    1 
ATOM   60   C C4    . DA  A 1 3   ? 49.348 7.356   17.020 1.00 85.22 ? 1   DA  B C4    1 
ATOM   61   P P     . DA  A 1 4   ? 45.258 10.209  20.759 1.00 83.41 ? 2   DA  B P     1 
ATOM   62   O OP1   . DA  A 1 4   ? 43.978 10.745  21.286 1.00 82.01 ? 2   DA  B OP1   1 
ATOM   63   O OP2   . DA  A 1 4   ? 46.547 10.870  21.117 1.00 77.39 ? 2   DA  B OP2   1 
ATOM   64   O "O5'" . DA  A 1 4   ? 45.344 8.690   21.210 1.00 85.10 ? 2   DA  B "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 4   ? 46.235 7.823   20.539 1.00 84.75 ? 2   DA  B "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 4   ? 46.387 6.531   21.294 1.00 82.21 ? 2   DA  B "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 4   ? 47.512 5.856   20.696 1.00 85.22 ? 2   DA  B "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 4   ? 46.757 6.692   22.763 1.00 82.12 ? 2   DA  B "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 4   ? 46.257 5.555   23.480 1.00 82.33 ? 2   DA  B "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 4   ? 48.272 6.788   22.720 1.00 82.76 ? 2   DA  B "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 4   ? 48.645 5.886   21.555 1.00 83.28 ? 2   DA  B "C1'" 1 
ATOM   72   N N9    . DA  A 1 4   ? 49.783 6.362   20.763 1.00 85.22 ? 2   DA  B N9    1 
ATOM   73   C C8    . DA  A 1 4   ? 50.075 7.664   20.441 1.00 85.22 ? 2   DA  B C8    1 
ATOM   74   N N7    . DA  A 1 4   ? 51.163 7.802   19.720 1.00 85.22 ? 2   DA  B N7    1 
ATOM   75   C C5    . DA  A 1 4   ? 51.622 6.502   19.550 1.00 85.22 ? 2   DA  B C5    1 
ATOM   76   C C6    . DA  A 1 4   ? 52.745 5.972   18.877 1.00 83.41 ? 2   DA  B C6    1 
ATOM   77   N N6    . DA  A 1 4   ? 53.640 6.714   18.226 1.00 83.20 ? 2   DA  B N6    1 
ATOM   78   N N1    . DA  A 1 4   ? 52.914 4.634   18.894 1.00 83.75 ? 2   DA  B N1    1 
ATOM   79   C C2    . DA  A 1 4   ? 52.011 3.885   19.546 1.00 84.36 ? 2   DA  B C2    1 
ATOM   80   N N3    . DA  A 1 4   ? 50.918 4.262   20.217 1.00 84.92 ? 2   DA  B N3    1 
ATOM   81   C C4    . DA  A 1 4   ? 50.779 5.600   20.183 1.00 85.22 ? 2   DA  B C4    1 
ATOM   82   P P     . DA  A 1 5   ? 46.969 5.064   24.837 1.00 83.07 ? 3   DA  B P     1 
ATOM   83   O OP1   . DA  A 1 5   ? 45.984 4.158   25.467 1.00 84.76 ? 3   DA  B OP1   1 
ATOM   84   O OP2   . DA  A 1 5   ? 47.554 6.181   25.620 1.00 75.46 ? 3   DA  B OP2   1 
ATOM   85   O "O5'" . DA  A 1 5   ? 48.179 4.167   24.334 1.00 79.60 ? 3   DA  B "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 5   ? 47.938 3.033   23.528 1.00 72.08 ? 3   DA  B "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 5   ? 49.132 2.109   23.533 1.00 69.99 ? 3   DA  B "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 5   ? 50.239 2.731   22.833 1.00 69.59 ? 3   DA  B "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 5   ? 49.665 1.829   24.939 1.00 67.47 ? 3   DA  B "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 5   ? 50.256 0.516   24.937 1.00 65.68 ? 3   DA  B "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 5   ? 50.688 2.940   25.134 1.00 66.66 ? 3   DA  B "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 5   ? 51.281 3.026   23.745 1.00 66.87 ? 3   DA  B "C1'" 1 
ATOM   93   N N9    . DA  A 1 5   ? 51.972 4.242   23.310 1.00 71.48 ? 3   DA  B N9    1 
ATOM   94   C C8    . DA  A 1 5   ? 51.608 5.561   23.393 1.00 74.25 ? 3   DA  B C8    1 
ATOM   95   N N7    . DA  A 1 5   ? 52.492 6.389   22.881 1.00 73.32 ? 3   DA  B N7    1 
ATOM   96   C C5    . DA  A 1 5   ? 53.509 5.556   22.436 1.00 75.88 ? 3   DA  B C5    1 
ATOM   97   C C6    . DA  A 1 5   ? 54.737 5.808   21.796 1.00 75.79 ? 3   DA  B C6    1 
ATOM   98   N N6    . DA  A 1 5   ? 55.182 7.020   21.484 1.00 74.31 ? 3   DA  B N6    1 
ATOM   99   N N1    . DA  A 1 5   ? 55.507 4.748   21.479 1.00 76.81 ? 3   DA  B N1    1 
ATOM   100  C C2    . DA  A 1 5   ? 55.070 3.527   21.784 1.00 78.45 ? 3   DA  B C2    1 
ATOM   101  N N3    . DA  A 1 5   ? 53.947 3.160   22.388 1.00 79.44 ? 3   DA  B N3    1 
ATOM   102  C C4    . DA  A 1 5   ? 53.200 4.234   22.691 1.00 76.24 ? 3   DA  B C4    1 
ATOM   103  P P     . DT  A 1 6   ? 50.834 -0.128  26.294 1.00 61.80 ? 4   DT  B P     1 
ATOM   104  O OP1   . DT  A 1 6   ? 50.146 -1.412  26.506 1.00 68.85 ? 4   DT  B OP1   1 
ATOM   105  O OP2   . DT  A 1 6   ? 50.910 0.863   27.393 1.00 64.63 ? 4   DT  B OP2   1 
ATOM   106  O "O5'" . DT  A 1 6   ? 52.315 -0.501  25.890 1.00 57.70 ? 4   DT  B "O5'" 1 
ATOM   107  C "C5'" . DT  A 1 6   ? 53.055 0.378   25.075 1.00 59.64 ? 4   DT  B "C5'" 1 
ATOM   108  C "C4'" . DT  A 1 6   ? 54.420 -0.192  24.810 1.00 58.84 ? 4   DT  B "C4'" 1 
ATOM   109  O "O4'" . DT  A 1 6   ? 55.173 0.886   24.212 1.00 62.73 ? 4   DT  B "O4'" 1 
ATOM   110  C "C3'" . DT  A 1 6   ? 55.167 -0.547  26.088 1.00 59.00 ? 4   DT  B "C3'" 1 
ATOM   111  O "O3'" . DT  A 1 6   ? 56.008 -1.671  25.904 1.00 56.88 ? 4   DT  B "O3'" 1 
ATOM   112  C "C2'" . DT  A 1 6   ? 55.875 0.744   26.459 1.00 62.15 ? 4   DT  B "C2'" 1 
ATOM   113  C "C1'" . DT  A 1 6   ? 56.144 1.398   25.117 1.00 65.28 ? 4   DT  B "C1'" 1 
ATOM   114  N N1    . DT  A 1 6   ? 56.029 2.872   25.099 1.00 68.08 ? 4   DT  B N1    1 
ATOM   115  C C2    . DT  A 1 6   ? 56.771 3.563   24.158 1.00 73.77 ? 4   DT  B C2    1 
ATOM   116  O O2    . DT  A 1 6   ? 57.520 3.016   23.369 1.00 78.62 ? 4   DT  B O2    1 
ATOM   117  N N3    . DT  A 1 6   ? 56.598 4.923   24.169 1.00 71.87 ? 4   DT  B N3    1 
ATOM   118  C C4    . DT  A 1 6   ? 55.786 5.646   25.007 1.00 71.84 ? 4   DT  B C4    1 
ATOM   119  O O4    . DT  A 1 6   ? 55.721 6.858   24.890 1.00 74.12 ? 4   DT  B O4    1 
ATOM   120  C C5    . DT  A 1 6   ? 55.053 4.870   25.984 1.00 72.59 ? 4   DT  B C5    1 
ATOM   121  C C7    . DT  A 1 6   ? 54.164 5.585   26.951 1.00 68.82 ? 4   DT  B C7    1 
ATOM   122  C C6    . DT  A 1 6   ? 55.207 3.534   25.979 1.00 68.37 ? 4   DT  B C6    1 
ATOM   123  P P     . DG  A 1 7   ? 56.786 -2.303  27.161 1.00 63.72 ? 5   DG  B P     1 
ATOM   124  O OP1   . DG  A 1 7   ? 56.884 -3.776  26.962 1.00 60.10 ? 5   DG  B OP1   1 
ATOM   125  O OP2   . DG  A 1 7   ? 56.269 -1.774  28.447 1.00 61.15 ? 5   DG  B OP2   1 
ATOM   126  O "O5'" . DG  A 1 7   ? 58.226 -1.698  26.933 1.00 65.17 ? 5   DG  B "O5'" 1 
ATOM   127  C "C5'" . DG  A 1 7   ? 58.738 -1.630  25.616 1.00 63.70 ? 5   DG  B "C5'" 1 
ATOM   128  C "C4'" . DG  A 1 7   ? 60.135 -1.078  25.632 1.00 56.74 ? 5   DG  B "C4'" 1 
ATOM   129  O "O4'" . DG  A 1 7   ? 60.097 0.360   25.684 1.00 56.96 ? 5   DG  B "O4'" 1 
ATOM   130  C "C3'" . DG  A 1 7   ? 60.901 -1.495  26.872 1.00 60.75 ? 5   DG  B "C3'" 1 
ATOM   131  O "O3'" . DG  A 1 7   ? 62.252 -1.550  26.474 1.00 69.76 ? 5   DG  B "O3'" 1 
ATOM   132  C "C2'" . DG  A 1 7   ? 60.595 -0.379  27.861 1.00 52.00 ? 5   DG  B "C2'" 1 
ATOM   133  C "C1'" . DG  A 1 7   ? 60.523 0.832   26.951 1.00 57.79 ? 5   DG  B "C1'" 1 
ATOM   134  N N9    . DG  A 1 7   ? 59.621 1.918   27.319 1.00 66.00 ? 5   DG  B N9    1 
ATOM   135  C C8    . DG  A 1 7   ? 58.448 1.859   28.042 1.00 65.41 ? 5   DG  B C8    1 
ATOM   136  N N7    . DG  A 1 7   ? 57.844 3.015   28.128 1.00 63.82 ? 5   DG  B N7    1 
ATOM   137  C C5    . DG  A 1 7   ? 58.677 3.888   27.435 1.00 69.43 ? 5   DG  B C5    1 
ATOM   138  C C6    . DG  A 1 7   ? 58.556 5.288   27.173 1.00 70.38 ? 5   DG  B C6    1 
ATOM   139  O O6    . DG  A 1 7   ? 57.663 6.064   27.508 1.00 74.64 ? 5   DG  B O6    1 
ATOM   140  N N1    . DG  A 1 7   ? 59.626 5.763   26.434 1.00 71.37 ? 5   DG  B N1    1 
ATOM   141  C C2    . DG  A 1 7   ? 60.681 5.006   25.998 1.00 74.86 ? 5   DG  B C2    1 
ATOM   142  N N2    . DG  A 1 7   ? 61.624 5.652   25.295 1.00 72.98 ? 5   DG  B N2    1 
ATOM   143  N N3    . DG  A 1 7   ? 60.810 3.709   26.232 1.00 72.61 ? 5   DG  B N3    1 
ATOM   144  C C4    . DG  A 1 7   ? 59.780 3.222   26.946 1.00 67.96 ? 5   DG  B C4    1 
ATOM   145  P P     . DC  A 1 8   ? 63.331 -2.334  27.351 1.00 76.87 ? 6   DC  B P     1 
ATOM   146  O OP1   . DC  A 1 8   ? 63.578 -3.601  26.616 1.00 77.16 ? 6   DC  B OP1   1 
ATOM   147  O OP2   . DC  A 1 8   ? 62.957 -2.375  28.793 1.00 75.13 ? 6   DC  B OP2   1 
ATOM   148  O "O5'" . DC  A 1 8   ? 64.530 -1.305  27.198 1.00 80.10 ? 6   DC  B "O5'" 1 
ATOM   149  C "C5'" . DC  A 1 8   ? 64.191 0.046   26.887 1.00 84.15 ? 6   DC  B "C5'" 1 
ATOM   150  C "C4'" . DC  A 1 8   ? 65.384 0.957   27.003 1.00 84.83 ? 6   DC  B "C4'" 1 
ATOM   151  O "O4'" . DC  A 1 8   ? 64.866 2.299   27.155 1.00 85.11 ? 6   DC  B "O4'" 1 
ATOM   152  C "C3'" . DC  A 1 8   ? 66.227 0.712   28.238 1.00 85.22 ? 6   DC  B "C3'" 1 
ATOM   153  O "O3'" . DC  A 1 8   ? 67.565 1.093   27.953 1.00 85.22 ? 6   DC  B "O3'" 1 
ATOM   154  C "C2'" . DC  A 1 8   ? 65.553 1.568   29.294 1.00 85.22 ? 6   DC  B "C2'" 1 
ATOM   155  C "C1'" . DC  A 1 8   ? 65.014 2.749   28.494 1.00 84.99 ? 6   DC  B "C1'" 1 
ATOM   156  N N1    . DC  A 1 8   ? 63.690 3.205   28.947 1.00 83.99 ? 6   DC  B N1    1 
ATOM   157  C C2    . DC  A 1 8   ? 63.170 4.384   28.427 1.00 84.81 ? 6   DC  B C2    1 
ATOM   158  O O2    . DC  A 1 8   ? 63.827 5.005   27.594 1.00 85.10 ? 6   DC  B O2    1 
ATOM   159  N N3    . DC  A 1 8   ? 61.962 4.819   28.842 1.00 85.22 ? 6   DC  B N3    1 
ATOM   160  C C4    . DC  A 1 8   ? 61.276 4.117   29.739 1.00 84.90 ? 6   DC  B C4    1 
ATOM   161  N N4    . DC  A 1 8   ? 60.090 4.590   30.119 1.00 85.22 ? 6   DC  B N4    1 
ATOM   162  C C5    . DC  A 1 8   ? 61.775 2.902   30.284 1.00 85.22 ? 6   DC  B C5    1 
ATOM   163  C C6    . DC  A 1 8   ? 62.977 2.486   29.865 1.00 84.72 ? 6   DC  B C6    1 
ATOM   164  P P     . DG  A 1 9   ? 68.754 0.059   28.234 1.00 85.22 ? 7   DG  B P     1 
ATOM   165  O OP1   . DG  A 1 9   ? 69.612 0.037   27.014 1.00 85.22 ? 7   DG  B OP1   1 
ATOM   166  O OP2   . DG  A 1 9   ? 68.142 -1.207  28.721 1.00 85.22 ? 7   DG  B OP2   1 
ATOM   167  O "O5'" . DG  A 1 9   ? 69.512 0.764   29.445 1.00 84.17 ? 7   DG  B "O5'" 1 
ATOM   168  C "C5'" . DG  A 1 9   ? 68.841 1.755   30.219 1.00 82.70 ? 7   DG  B "C5'" 1 
ATOM   169  C "C4'" . DG  A 1 9   ? 69.230 1.637   31.674 1.00 85.22 ? 7   DG  B "C4'" 1 
ATOM   170  O "O4'" . DG  A 1 9   ? 68.196 2.286   32.460 1.00 85.22 ? 7   DG  B "O4'" 1 
ATOM   171  C "C3'" . DG  A 1 9   ? 69.239 0.176   32.138 1.00 85.22 ? 7   DG  B "C3'" 1 
ATOM   172  O "O3'" . DG  A 1 9   ? 70.078 0.013   33.285 1.00 85.22 ? 7   DG  B "O3'" 1 
ATOM   173  C "C2'" . DG  A 1 9   ? 67.804 -0.052  32.562 1.00 85.22 ? 7   DG  B "C2'" 1 
ATOM   174  C "C1'" . DG  A 1 9   ? 67.441 1.300   33.161 1.00 85.22 ? 7   DG  B "C1'" 1 
ATOM   175  N N9    . DG  A 1 9   ? 66.022 1.608   33.048 1.00 85.22 ? 7   DG  B N9    1 
ATOM   176  C C8    . DG  A 1 9   ? 65.039 0.696   32.754 1.00 85.22 ? 7   DG  B C8    1 
ATOM   177  N N7    . DG  A 1 9   ? 63.839 1.204   32.779 1.00 85.22 ? 7   DG  B N7    1 
ATOM   178  C C5    . DG  A 1 9   ? 64.036 2.542   33.096 1.00 85.22 ? 7   DG  B C5    1 
ATOM   179  C C6    . DG  A 1 9   ? 63.094 3.573   33.265 1.00 85.22 ? 7   DG  B C6    1 
ATOM   180  O O6    . DG  A 1 9   ? 61.868 3.499   33.171 1.00 85.22 ? 7   DG  B O6    1 
ATOM   181  N N1    . DG  A 1 9   ? 63.704 4.787   33.573 1.00 85.22 ? 7   DG  B N1    1 
ATOM   182  C C2    . DG  A 1 9   ? 65.056 4.980   33.706 1.00 85.22 ? 7   DG  B C2    1 
ATOM   183  N N2    . DG  A 1 9   ? 65.434 6.239   34.012 1.00 84.11 ? 7   DG  B N2    1 
ATOM   184  N N3    . DG  A 1 9   ? 65.964 4.011   33.554 1.00 85.22 ? 7   DG  B N3    1 
ATOM   185  C C4    . DG  A 1 9   ? 65.381 2.821   33.250 1.00 85.22 ? 7   DG  B C4    1 
ATOM   186  P P     . DA  A 1 10  ? 71.663 0.265   33.164 1.00 85.22 ? 8   DA  B P     1 
ATOM   187  O OP1   . DA  A 1 10  ? 71.955 0.602   31.737 1.00 85.22 ? 8   DA  B OP1   1 
ATOM   188  O OP2   . DA  A 1 10  ? 72.391 -0.870  33.831 1.00 85.22 ? 8   DA  B OP2   1 
ATOM   189  O "O5'" . DA  A 1 10  ? 71.889 1.583   34.032 1.00 85.22 ? 8   DA  B "O5'" 1 
ATOM   190  C "C5'" . DA  A 1 10  ? 72.000 2.855   33.404 1.00 84.86 ? 8   DA  B "C5'" 1 
ATOM   191  C "C4'" . DA  A 1 10  ? 71.642 3.952   34.378 1.00 85.22 ? 8   DA  B "C4'" 1 
ATOM   192  O "O4'" . DA  A 1 10  ? 70.218 3.902   34.663 1.00 85.22 ? 8   DA  B "O4'" 1 
ATOM   193  C "C3'" . DA  A 1 10  ? 72.325 3.763   35.741 1.00 85.22 ? 8   DA  B "C3'" 1 
ATOM   194  O "O3'" . DA  A 1 10  ? 72.501 5.063   36.347 1.00 85.22 ? 8   DA  B "O3'" 1 
ATOM   195  C "C2'" . DA  A 1 10  ? 71.327 2.903   36.512 1.00 84.20 ? 8   DA  B "C2'" 1 
ATOM   196  C "C1'" . DA  A 1 10  ? 70.015 3.496   36.021 1.00 85.22 ? 8   DA  B "C1'" 1 
ATOM   197  N N9    . DA  A 1 10  ? 68.776 2.712   36.116 1.00 85.22 ? 8   DA  B N9    1 
ATOM   198  C C8    . DA  A 1 10  ? 68.571 1.359   36.003 1.00 85.22 ? 8   DA  B C8    1 
ATOM   199  N N7    . DA  A 1 10  ? 67.312 1.002   36.148 1.00 85.22 ? 8   DA  B N7    1 
ATOM   200  C C5    . DA  A 1 10  ? 66.644 2.201   36.375 1.00 85.22 ? 8   DA  B C5    1 
ATOM   201  C C6    . DA  A 1 10  ? 65.283 2.511   36.611 1.00 85.22 ? 8   DA  B C6    1 
ATOM   202  N N6    . DA  A 1 10  ? 64.308 1.603   36.661 1.00 85.22 ? 8   DA  B N6    1 
ATOM   203  N N1    . DA  A 1 10  ? 64.958 3.811   36.798 1.00 85.22 ? 8   DA  B N1    1 
ATOM   204  C C2    . DA  A 1 10  ? 65.930 4.730   36.757 1.00 84.19 ? 8   DA  B C2    1 
ATOM   205  N N3    . DA  A 1 10  ? 67.235 4.567   36.546 1.00 84.66 ? 8   DA  B N3    1 
ATOM   206  C C4    . DA  A 1 10  ? 67.532 3.263   36.359 1.00 85.22 ? 8   DA  B C4    1 
ATOM   207  P P     . DT  A 1 11  ? 73.350 5.225   37.716 1.00 85.22 ? 9   DT  B P     1 
ATOM   208  O OP1   . DT  A 1 11  ? 74.506 6.149   37.453 1.00 85.22 ? 9   DT  B OP1   1 
ATOM   209  O OP2   . DT  A 1 11  ? 73.587 3.860   38.306 1.00 85.22 ? 9   DT  B OP2   1 
ATOM   210  O "O5'" . DT  A 1 11  ? 72.324 5.977   38.667 1.00 85.22 ? 9   DT  B "O5'" 1 
ATOM   211  C "C5'" . DT  A 1 11  ? 70.951 5.667   38.575 1.00 85.22 ? 9   DT  B "C5'" 1 
ATOM   212  C "C4'" . DT  A 1 11  ? 70.118 6.861   38.957 1.00 85.22 ? 9   DT  B "C4'" 1 
ATOM   213  O "O4'" . DT  A 1 11  ? 68.742 6.456   38.800 1.00 85.22 ? 9   DT  B "O4'" 1 
ATOM   214  C "C3'" . DT  A 1 11  ? 70.271 7.278   40.417 1.00 85.22 ? 9   DT  B "C3'" 1 
ATOM   215  O "O3'" . DT  A 1 11  ? 69.762 8.614   40.581 1.00 83.35 ? 9   DT  B "O3'" 1 
ATOM   216  C "C2'" . DT  A 1 11  ? 69.283 6.358   41.106 1.00 85.22 ? 9   DT  B "C2'" 1 
ATOM   217  C "C1'" . DT  A 1 11  ? 68.162 6.238   40.073 1.00 85.22 ? 9   DT  B "C1'" 1 
ATOM   218  N N1    . DT  A 1 11  ? 67.521 4.921   40.038 1.00 85.22 ? 9   DT  B N1    1 
ATOM   219  C C2    . DT  A 1 11  ? 66.185 4.891   40.302 1.00 84.61 ? 9   DT  B C2    1 
ATOM   220  O O2    . DT  A 1 11  ? 65.542 5.904   40.529 1.00 85.22 ? 9   DT  B O2    1 
ATOM   221  N N3    . DT  A 1 11  ? 65.623 3.636   40.293 1.00 85.01 ? 9   DT  B N3    1 
ATOM   222  C C4    . DT  A 1 11  ? 66.262 2.435   40.044 1.00 85.22 ? 9   DT  B C4    1 
ATOM   223  O O4    . DT  A 1 11  ? 65.620 1.378   40.085 1.00 85.22 ? 9   DT  B O4    1 
ATOM   224  C C5    . DT  A 1 11  ? 67.683 2.546   39.753 1.00 85.22 ? 9   DT  B C5    1 
ATOM   225  C C7    . DT  A 1 11  ? 68.467 1.304   39.459 1.00 84.04 ? 9   DT  B C7    1 
ATOM   226  C C6    . DT  A 1 11  ? 68.231 3.771   39.764 1.00 85.22 ? 9   DT  B C6    1 
ATOM   227  O "O5'" . DC  B 2 1   ? 70.196 -5.810  50.423 1.00 80.84 ? 13  DC  C "O5'" 1 
ATOM   228  C "C5'" . DC  B 2 1   ? 69.864 -6.914  51.278 1.00 82.58 ? 13  DC  C "C5'" 1 
ATOM   229  C "C4'" . DC  B 2 1   ? 68.478 -7.522  51.163 1.00 85.22 ? 13  DC  C "C4'" 1 
ATOM   230  O "O4'" . DC  B 2 1   ? 67.493 -6.636  51.764 1.00 85.22 ? 13  DC  C "O4'" 1 
ATOM   231  C "C3'" . DC  B 2 1   ? 67.984 -7.749  49.731 1.00 85.22 ? 13  DC  C "C3'" 1 
ATOM   232  O "O3'" . DC  B 2 1   ? 67.095 -8.883  49.676 1.00 85.22 ? 13  DC  C "O3'" 1 
ATOM   233  C "C2'" . DC  B 2 1   ? 67.285 -6.442  49.403 1.00 84.60 ? 13  DC  C "C2'" 1 
ATOM   234  C "C1'" . DC  B 2 1   ? 66.681 -6.025  50.754 1.00 85.22 ? 13  DC  C "C1'" 1 
ATOM   235  N N1    . DC  B 2 1   ? 66.679 -4.563  51.003 1.00 85.22 ? 13  DC  C N1    1 
ATOM   236  C C2    . DC  B 2 1   ? 65.822 -4.023  51.995 1.00 85.22 ? 13  DC  C C2    1 
ATOM   237  O O2    . DC  B 2 1   ? 65.057 -4.782  52.615 1.00 83.52 ? 13  DC  C O2    1 
ATOM   238  N N3    . DC  B 2 1   ? 65.862 -2.683  52.239 1.00 85.22 ? 13  DC  C N3    1 
ATOM   239  C C4    . DC  B 2 1   ? 66.701 -1.897  51.539 1.00 85.22 ? 13  DC  C C4    1 
ATOM   240  N N4    . DC  B 2 1   ? 66.733 -0.592  51.816 1.00 85.22 ? 13  DC  C N4    1 
ATOM   241  C C5    . DC  B 2 1   ? 67.554 -2.417  50.523 1.00 85.22 ? 13  DC  C C5    1 
ATOM   242  C C6    . DC  B 2 1   ? 67.511 -3.738  50.292 1.00 85.22 ? 13  DC  C C6    1 
ATOM   243  P P     . DT  B 2 2   ? 66.422 -9.308  48.268 1.00 85.22 ? 12  DT  C P     1 
ATOM   244  O OP1   . DT  B 2 2   ? 66.194 -10.789 48.295 1.00 83.55 ? 12  DT  C OP1   1 
ATOM   245  O OP2   . DT  B 2 2   ? 67.226 -8.687  47.165 1.00 85.22 ? 12  DT  C OP2   1 
ATOM   246  O "O5'" . DT  B 2 2   ? 64.993 -8.597  48.301 1.00 85.22 ? 12  DT  C "O5'" 1 
ATOM   247  C "C5'" . DT  B 2 2   ? 64.023 -8.954  49.294 1.00 85.22 ? 12  DT  C "C5'" 1 
ATOM   248  C "C4'" . DT  B 2 2   ? 62.671 -8.373  48.948 1.00 85.22 ? 12  DT  C "C4'" 1 
ATOM   249  O "O4'" . DT  B 2 2   ? 62.682 -6.937  49.180 1.00 85.22 ? 12  DT  C "O4'" 1 
ATOM   250  C "C3'" . DT  B 2 2   ? 62.384 -8.537  47.455 1.00 85.22 ? 12  DT  C "C3'" 1 
ATOM   251  O "O3'" . DT  B 2 2   ? 60.979 -8.637  47.210 1.00 85.22 ? 12  DT  C "O3'" 1 
ATOM   252  C "C2'" . DT  B 2 2   ? 62.963 -7.269  46.854 1.00 85.22 ? 12  DT  C "C2'" 1 
ATOM   253  C "C1'" . DT  B 2 2   ? 62.623 -6.252  47.930 1.00 85.22 ? 12  DT  C "C1'" 1 
ATOM   254  N N1    . DT  B 2 2   ? 63.486 -5.056  47.994 1.00 85.22 ? 12  DT  C N1    1 
ATOM   255  C C2    . DT  B 2 2   ? 62.901 -3.865  48.380 1.00 85.22 ? 12  DT  C C2    1 
ATOM   256  O O2    . DT  B 2 2   ? 61.718 -3.762  48.663 1.00 84.74 ? 12  DT  C O2    1 
ATOM   257  N N3    . DT  B 2 2   ? 63.755 -2.797  48.420 1.00 85.22 ? 12  DT  C N3    1 
ATOM   258  C C4    . DT  B 2 2   ? 65.100 -2.793  48.124 1.00 85.22 ? 12  DT  C C4    1 
ATOM   259  O O4    . DT  B 2 2   ? 65.741 -1.749  48.221 1.00 85.22 ? 12  DT  C O4    1 
ATOM   260  C C5    . DT  B 2 2   ? 65.645 -4.071  47.707 1.00 85.22 ? 12  DT  C C5    1 
ATOM   261  C C7    . DT  B 2 2   ? 67.089 -4.156  47.327 1.00 85.22 ? 12  DT  C C7    1 
ATOM   262  C C6    . DT  B 2 2   ? 64.823 -5.127  47.671 1.00 85.22 ? 12  DT  C C6    1 
ATOM   263  P P     . DA  B 2 3   ? 60.427 -8.507  45.699 1.00 85.22 ? 11  DA  C P     1 
ATOM   264  O OP1   . DA  B 2 3   ? 59.429 -9.595  45.463 1.00 83.23 ? 11  DA  C OP1   1 
ATOM   265  O OP2   . DA  B 2 3   ? 61.587 -8.344  44.769 1.00 85.22 ? 11  DA  C OP2   1 
ATOM   266  O "O5'" . DA  B 2 3   ? 59.657 -7.116  45.712 1.00 85.22 ? 11  DA  C "O5'" 1 
ATOM   267  C "C5'" . DA  B 2 3   ? 58.651 -6.875  46.682 1.00 83.51 ? 11  DA  C "C5'" 1 
ATOM   268  C "C4'" . DA  B 2 3   ? 57.960 -5.569  46.392 1.00 79.04 ? 11  DA  C "C4'" 1 
ATOM   269  O "O4'" . DA  B 2 3   ? 58.923 -4.497  46.490 1.00 81.77 ? 11  DA  C "O4'" 1 
ATOM   270  C "C3'" . DA  B 2 3   ? 57.424 -5.479  44.973 1.00 73.74 ? 11  DA  C "C3'" 1 
ATOM   271  O "O3'" . DA  B 2 3   ? 56.342 -4.569  45.005 1.00 70.19 ? 11  DA  C "O3'" 1 
ATOM   272  C "C2'" . DA  B 2 3   ? 58.598 -4.915  44.195 1.00 75.40 ? 11  DA  C "C2'" 1 
ATOM   273  C "C1'" . DA  B 2 3   ? 59.210 -3.962  45.206 1.00 80.75 ? 11  DA  C "C1'" 1 
ATOM   274  N N9    . DA  B 2 3   ? 60.653 -3.776  45.139 1.00 82.97 ? 11  DA  C N9    1 
ATOM   275  C C8    . DA  B 2 3   ? 61.611 -4.699  44.810 1.00 84.14 ? 11  DA  C C8    1 
ATOM   276  N N7    . DA  B 2 3   ? 62.838 -4.244  44.912 1.00 85.22 ? 11  DA  C N7    1 
ATOM   277  C C5    . DA  B 2 3   ? 62.671 -2.927  45.322 1.00 85.22 ? 11  DA  C C5    1 
ATOM   278  C C6    . DA  B 2 3   ? 63.588 -1.903  45.616 1.00 85.22 ? 11  DA  C C6    1 
ATOM   279  N N6    . DA  B 2 3   ? 64.915 -2.054  45.538 1.00 85.22 ? 11  DA  C N6    1 
ATOM   280  N N1    . DA  B 2 3   ? 63.094 -0.705  45.999 1.00 85.22 ? 11  DA  C N1    1 
ATOM   281  C C2    . DA  B 2 3   ? 61.772 -0.555  46.074 1.00 85.22 ? 11  DA  C C2    1 
ATOM   282  N N3    . DA  B 2 3   ? 60.809 -1.441  45.826 1.00 85.22 ? 11  DA  C N3    1 
ATOM   283  C C4    . DA  B 2 3   ? 61.332 -2.622  45.451 1.00 85.22 ? 11  DA  C C4    1 
ATOM   284  P P     . DG  B 2 4   ? 55.193 -4.656  43.911 1.00 69.15 ? 10  DG  C P     1 
ATOM   285  O OP1   . DG  B 2 4   ? 53.921 -4.945  44.636 1.00 72.93 ? 10  DG  C OP1   1 
ATOM   286  O OP2   . DG  B 2 4   ? 55.666 -5.557  42.829 1.00 74.14 ? 10  DG  C OP2   1 
ATOM   287  O "O5'" . DG  B 2 4   ? 55.167 -3.184  43.344 1.00 63.36 ? 10  DG  C "O5'" 1 
ATOM   288  C "C5'" . DG  B 2 4   ? 56.377 -2.488  43.274 1.00 60.78 ? 10  DG  C "C5'" 1 
ATOM   289  C "C4'" . DG  B 2 4   ? 56.141 -1.005  43.291 1.00 56.74 ? 10  DG  C "C4'" 1 
ATOM   290  O "O4'" . DG  B 2 4   ? 57.411 -0.441  43.657 1.00 65.88 ? 10  DG  C "O4'" 1 
ATOM   291  C "C3'" . DG  B 2 4   ? 55.779 -0.390  41.943 1.00 56.78 ? 10  DG  C "C3'" 1 
ATOM   292  O "O3'" . DG  B 2 4   ? 55.036 0.810   42.153 1.00 53.78 ? 10  DG  C "O3'" 1 
ATOM   293  C "C2'" . DG  B 2 4   ? 57.140 -0.138  41.324 1.00 62.59 ? 10  DG  C "C2'" 1 
ATOM   294  C "C1'" . DG  B 2 4   ? 58.035 0.156   42.527 1.00 69.64 ? 10  DG  C "C1'" 1 
ATOM   295  N N9    . DG  B 2 4   ? 59.355 -0.454  42.406 1.00 74.81 ? 10  DG  C N9    1 
ATOM   296  C C8    . DG  B 2 4   ? 59.619 -1.766  42.100 1.00 76.61 ? 10  DG  C C8    1 
ATOM   297  N N7    . DG  B 2 4   ? 60.894 -2.030  42.028 1.00 81.80 ? 10  DG  C N7    1 
ATOM   298  C C5    . DG  B 2 4   ? 61.513 -0.818  42.311 1.00 82.94 ? 10  DG  C C5    1 
ATOM   299  C C6    . DG  B 2 4   ? 62.896 -0.480  42.372 1.00 85.22 ? 10  DG  C C6    1 
ATOM   300  O O6    . DG  B 2 4   ? 63.885 -1.212  42.165 1.00 85.22 ? 10  DG  C O6    1 
ATOM   301  N N1    . DG  B 2 4   ? 63.078 0.863   42.708 1.00 85.22 ? 10  DG  C N1    1 
ATOM   302  C C2    . DG  B 2 4   ? 62.066 1.764   42.946 1.00 84.90 ? 10  DG  C C2    1 
ATOM   303  N N2    . DG  B 2 4   ? 62.442 3.022   43.256 1.00 85.22 ? 10  DG  C N2    1 
ATOM   304  N N3    . DG  B 2 4   ? 60.781 1.460   42.883 1.00 83.73 ? 10  DG  C N3    1 
ATOM   305  C C4    . DG  B 2 4   ? 60.577 0.163   42.561 1.00 79.83 ? 10  DG  C C4    1 
ATOM   306  P P     . DA  B 2 5   ? 54.556 1.708   40.912 1.00 51.95 ? 9   DA  C P     1 
ATOM   307  O OP1   . DA  B 2 5   ? 53.207 2.227   41.269 1.00 58.91 ? 9   DA  C OP1   1 
ATOM   308  O OP2   . DA  B 2 5   ? 54.722 0.969   39.652 1.00 58.11 ? 9   DA  C OP2   1 
ATOM   309  O "O5'" . DA  B 2 5   ? 55.563 2.940   40.968 1.00 54.74 ? 9   DA  C "O5'" 1 
ATOM   310  C "C5'" . DA  B 2 5   ? 55.656 3.719   42.163 1.00 60.44 ? 9   DA  C "C5'" 1 
ATOM   311  C "C4'" . DA  B 2 5   ? 56.216 5.097   41.892 1.00 61.99 ? 9   DA  C "C4'" 1 
ATOM   312  O "O4'" . DA  B 2 5   ? 57.645 5.014   41.751 1.00 64.37 ? 9   DA  C "O4'" 1 
ATOM   313  C "C3'" . DA  B 2 5   ? 55.731 5.761   40.612 1.00 68.23 ? 9   DA  C "C3'" 1 
ATOM   314  O "O3'" . DA  B 2 5   ? 55.769 7.181   40.773 1.00 75.60 ? 9   DA  C "O3'" 1 
ATOM   315  C "C2'" . DA  B 2 5   ? 56.738 5.278   39.589 1.00 69.03 ? 9   DA  C "C2'" 1 
ATOM   316  C "C1'" . DA  B 2 5   ? 58.023 5.219   40.399 1.00 69.48 ? 9   DA  C "C1'" 1 
ATOM   317  N N9    . DA  B 2 5   ? 58.929 4.132   40.041 1.00 74.88 ? 9   DA  C N9    1 
ATOM   318  C C8    . DA  B 2 5   ? 58.606 2.839   39.725 1.00 75.59 ? 9   DA  C C8    1 
ATOM   319  N N7    . DA  B 2 5   ? 59.641 2.078   39.488 1.00 80.15 ? 9   DA  C N7    1 
ATOM   320  C C5    . DA  B 2 5   ? 60.723 2.929   39.649 1.00 81.81 ? 9   DA  C C5    1 
ATOM   321  C C6    . DA  B 2 5   ? 62.106 2.729   39.529 1.00 84.79 ? 9   DA  C C6    1 
ATOM   322  N N6    . DA  B 2 5   ? 62.662 1.552   39.199 1.00 85.22 ? 9   DA  C N6    1 
ATOM   323  N N1    . DA  B 2 5   ? 62.913 3.790   39.756 1.00 85.22 ? 9   DA  C N1    1 
ATOM   324  C C2    . DA  B 2 5   ? 62.355 4.967   40.075 1.00 84.22 ? 9   DA  C C2    1 
ATOM   325  N N3    . DA  B 2 5   ? 61.073 5.280   40.212 1.00 84.25 ? 9   DA  C N3    1 
ATOM   326  C C4    . DA  B 2 5   ? 60.299 4.201   39.983 1.00 80.34 ? 9   DA  C C4    1 
ATOM   327  P P     . DT  B 2 6   ? 55.407 8.138   39.534 1.00 82.76 ? 8   DT  C P     1 
ATOM   328  O OP1   . DT  B 2 6   ? 54.455 9.174   40.005 1.00 82.27 ? 8   DT  C OP1   1 
ATOM   329  O OP2   . DT  B 2 6   ? 55.060 7.294   38.354 1.00 80.86 ? 8   DT  C OP2   1 
ATOM   330  O "O5'" . DT  B 2 6   ? 56.790 8.850   39.228 1.00 83.47 ? 8   DT  C "O5'" 1 
ATOM   331  C "C5'" . DT  B 2 6   ? 57.991 8.099   39.243 1.00 85.22 ? 8   DT  C "C5'" 1 
ATOM   332  C "C4'" . DT  B 2 6   ? 59.172 9.011   39.041 1.00 84.44 ? 8   DT  C "C4'" 1 
ATOM   333  O "O4'" . DT  B 2 6   ? 60.347 8.178   38.899 1.00 85.22 ? 8   DT  C "O4'" 1 
ATOM   334  C "C3'" . DT  B 2 6   ? 59.084 9.815   37.750 1.00 84.66 ? 8   DT  C "C3'" 1 
ATOM   335  O "O3'" . DT  B 2 6   ? 59.764 11.060  37.916 1.00 85.22 ? 8   DT  C "O3'" 1 
ATOM   336  C "C2'" . DT  B 2 6   ? 59.726 8.893   36.725 1.00 83.26 ? 8   DT  C "C2'" 1 
ATOM   337  C "C1'" . DT  B 2 6   ? 60.788 8.155   37.539 1.00 83.07 ? 8   DT  C "C1'" 1 
ATOM   338  N N1    . DT  B 2 6   ? 60.970 6.733   37.170 1.00 79.97 ? 8   DT  C N1    1 
ATOM   339  C C2    . DT  B 2 6   ? 62.252 6.231   37.098 1.00 80.36 ? 8   DT  C C2    1 
ATOM   340  O O2    . DT  B 2 6   ? 63.249 6.909   37.281 1.00 82.28 ? 8   DT  C O2    1 
ATOM   341  N N3    . DT  B 2 6   ? 62.326 4.890   36.804 1.00 79.54 ? 8   DT  C N3    1 
ATOM   342  C C4    . DT  B 2 6   ? 61.274 4.025   36.573 1.00 78.30 ? 8   DT  C C4    1 
ATOM   343  O O4    . DT  B 2 6   ? 61.499 2.835   36.334 1.00 75.49 ? 8   DT  C O4    1 
ATOM   344  C C5    . DT  B 2 6   ? 59.959 4.625   36.644 1.00 75.46 ? 8   DT  C C5    1 
ATOM   345  C C7    . DT  B 2 6   ? 58.760 3.770   36.399 1.00 75.01 ? 8   DT  C C7    1 
ATOM   346  C C6    . DT  B 2 6   ? 59.874 5.930   36.931 1.00 76.31 ? 8   DT  C C6    1 
ATOM   347  P P     . DC  B 2 7   ? 59.269 12.363  37.107 1.00 85.22 ? 7   DC  C P     1 
ATOM   348  O OP1   . DC  B 2 7   ? 58.945 13.427  38.101 1.00 85.22 ? 7   DC  C OP1   1 
ATOM   349  O OP2   . DC  B 2 7   ? 58.252 11.960  36.101 1.00 85.22 ? 7   DC  C OP2   1 
ATOM   350  O "O5'" . DC  B 2 7   ? 60.584 12.782  36.314 1.00 85.22 ? 7   DC  C "O5'" 1 
ATOM   351  C "C5'" . DC  B 2 7   ? 61.541 11.789  35.952 1.00 85.22 ? 7   DC  C "C5'" 1 
ATOM   352  C "C4'" . DC  B 2 7   ? 62.257 12.201  34.691 1.00 85.22 ? 7   DC  C "C4'" 1 
ATOM   353  O "O4'" . DC  B 2 7   ? 62.756 10.988  34.071 1.00 82.65 ? 7   DC  C "O4'" 1 
ATOM   354  C "C3'" . DC  B 2 7   ? 61.305 12.817  33.676 1.00 84.96 ? 7   DC  C "C3'" 1 
ATOM   355  O "O3'" . DC  B 2 7   ? 61.948 13.777  32.846 1.00 85.22 ? 7   DC  C "O3'" 1 
ATOM   356  C "C2'" . DC  B 2 7   ? 60.799 11.619  32.905 1.00 85.22 ? 7   DC  C "C2'" 1 
ATOM   357  C "C1'" . DC  B 2 7   ? 61.980 10.649  32.926 1.00 85.21 ? 7   DC  C "C1'" 1 
ATOM   358  N N1    . DC  B 2 7   ? 61.492 9.264   33.098 1.00 85.22 ? 7   DC  C N1    1 
ATOM   359  C C2    . DC  B 2 7   ? 62.352 8.248   33.605 1.00 85.22 ? 7   DC  C C2    1 
ATOM   360  O O2    . DC  B 2 7   ? 63.529 8.525   33.898 1.00 84.86 ? 7   DC  C O2    1 
ATOM   361  N N3    . DC  B 2 7   ? 61.860 6.991   33.753 1.00 83.93 ? 7   DC  C N3    1 
ATOM   362  C C4    . DC  B 2 7   ? 60.589 6.726   33.419 1.00 84.11 ? 7   DC  C C4    1 
ATOM   363  N N4    . DC  B 2 7   ? 60.144 5.484   33.574 1.00 85.22 ? 7   DC  C N4    1 
ATOM   364  C C5    . DC  B 2 7   ? 59.713 7.728   32.908 1.00 83.87 ? 7   DC  C C5    1 
ATOM   365  C C6    . DC  B 2 7   ? 60.196 8.963   32.767 1.00 83.79 ? 7   DC  C C6    1 
ATOM   366  P P     . DG  B 2 8   ? 61.051 14.814  32.012 1.00 85.22 ? 6   DG  C P     1 
ATOM   367  O OP1   . DG  B 2 8   ? 61.273 16.190  32.531 1.00 85.22 ? 6   DG  C OP1   1 
ATOM   368  O OP2   . DG  B 2 8   ? 59.673 14.260  31.953 1.00 85.22 ? 6   DG  C OP2   1 
ATOM   369  O "O5'" . DG  B 2 8   ? 61.680 14.734  30.562 1.00 85.02 ? 6   DG  C "O5'" 1 
ATOM   370  C "C5'" . DG  B 2 8   ? 63.087 14.635  30.405 1.00 85.22 ? 6   DG  C "C5'" 1 
ATOM   371  C "C4'" . DG  B 2 8   ? 63.415 14.230  28.989 1.00 85.22 ? 6   DG  C "C4'" 1 
ATOM   372  O "O4'" . DG  B 2 8   ? 63.064 12.837  28.795 1.00 85.22 ? 6   DG  C "O4'" 1 
ATOM   373  C "C3'" . DG  B 2 8   ? 62.576 15.002  27.973 1.00 85.22 ? 6   DG  C "C3'" 1 
ATOM   374  O "O3'" . DG  B 2 8   ? 63.349 15.164  26.779 1.00 85.22 ? 6   DG  C "O3'" 1 
ATOM   375  C "C2'" . DG  B 2 8   ? 61.332 14.133  27.825 1.00 84.19 ? 6   DG  C "C2'" 1 
ATOM   376  C "C1'" . DG  B 2 8   ? 61.912 12.729  27.960 1.00 85.22 ? 6   DG  C "C1'" 1 
ATOM   377  N N9    . DG  B 2 8   ? 61.043 11.678  28.499 1.00 85.22 ? 6   DG  C N9    1 
ATOM   378  C C8    . DG  B 2 8   ? 59.764 11.799  28.996 1.00 85.22 ? 6   DG  C C8    1 
ATOM   379  N N7    . DG  B 2 8   ? 59.247 10.654  29.366 1.00 85.22 ? 6   DG  C N7    1 
ATOM   380  C C5    . DG  B 2 8   ? 60.247 9.722   29.106 1.00 85.22 ? 6   DG  C C5    1 
ATOM   381  C C6    . DG  B 2 8   ? 60.276 8.301   29.295 1.00 85.22 ? 6   DG  C C6    1 
ATOM   382  O O6    . DG  B 2 8   ? 59.394 7.557   29.733 1.00 85.22 ? 6   DG  C O6    1 
ATOM   383  N N1    . DG  B 2 8   ? 61.495 7.757   28.903 1.00 85.22 ? 6   DG  C N1    1 
ATOM   384  C C2    . DG  B 2 8   ? 62.547 8.472   28.389 1.00 85.22 ? 6   DG  C C2    1 
ATOM   385  N N2    . DG  B 2 8   ? 63.644 7.771   28.074 1.00 84.98 ? 6   DG  C N2    1 
ATOM   386  N N3    . DG  B 2 8   ? 62.532 9.781   28.199 1.00 85.22 ? 6   DG  C N3    1 
ATOM   387  C C4    . DG  B 2 8   ? 61.362 10.338  28.578 1.00 85.22 ? 6   DG  C C4    1 
ATOM   388  P P     . DC  B 2 9   ? 62.715 15.891  25.487 1.00 85.22 ? 5   DC  C P     1 
ATOM   389  O OP1   . DC  B 2 9   ? 63.647 17.001  25.121 1.00 85.22 ? 5   DC  C OP1   1 
ATOM   390  O OP2   . DC  B 2 9   ? 61.249 16.174  25.655 1.00 85.22 ? 5   DC  C OP2   1 
ATOM   391  O "O5'" . DC  B 2 9   ? 62.850 14.723  24.422 1.00 85.22 ? 5   DC  C "O5'" 1 
ATOM   392  C "C5'" . DC  B 2 9   ? 62.632 13.395  24.852 1.00 85.22 ? 5   DC  C "C5'" 1 
ATOM   393  C "C4'" . DC  B 2 9   ? 63.142 12.413  23.832 1.00 85.22 ? 5   DC  C "C4'" 1 
ATOM   394  O "O4'" . DC  B 2 9   ? 62.741 11.100  24.286 1.00 85.22 ? 5   DC  C "O4'" 1 
ATOM   395  C "C3'" . DC  B 2 9   ? 62.542 12.565  22.439 1.00 85.22 ? 5   DC  C "C3'" 1 
ATOM   396  O "O3'" . DC  B 2 9   ? 63.492 12.017  21.513 1.00 85.22 ? 5   DC  C "O3'" 1 
ATOM   397  C "C2'" . DC  B 2 9   ? 61.262 11.749  22.538 1.00 83.62 ? 5   DC  C "C2'" 1 
ATOM   398  C "C1'" . DC  B 2 9   ? 61.646 10.622  23.502 1.00 85.22 ? 5   DC  C "C1'" 1 
ATOM   399  N N1    . DC  B 2 9   ? 60.591 10.220  24.454 1.00 85.22 ? 5   DC  C N1    1 
ATOM   400  C C2    . DC  B 2 9   ? 60.746 9.013   25.116 1.00 85.22 ? 5   DC  C C2    1 
ATOM   401  O O2    . DC  B 2 9   ? 61.736 8.320   24.850 1.00 85.22 ? 5   DC  C O2    1 
ATOM   402  N N3    . DC  B 2 9   ? 59.822 8.628   26.024 1.00 85.22 ? 5   DC  C N3    1 
ATOM   403  C C4    . DC  B 2 9   ? 58.766 9.404   26.274 1.00 85.22 ? 5   DC  C C4    1 
ATOM   404  N N4    . DC  B 2 9   ? 57.882 8.977   27.190 1.00 84.99 ? 5   DC  C N4    1 
ATOM   405  C C5    . DC  B 2 9   ? 58.571 10.646  25.598 1.00 85.22 ? 5   DC  C C5    1 
ATOM   406  C C6    . DC  B 2 9   ? 59.499 11.011  24.702 1.00 85.12 ? 5   DC  C C6    1 
ATOM   407  P P     . DA  B 2 10  ? 63.317 12.234  19.928 1.00 85.22 ? 4   DA  C P     1 
ATOM   408  O OP1   . DA  B 2 10  ? 64.298 13.293  19.540 1.00 85.22 ? 4   DA  C OP1   1 
ATOM   409  O OP2   . DA  B 2 10  ? 61.876 12.402  19.567 1.00 82.39 ? 4   DA  C OP2   1 
ATOM   410  O "O5'" . DA  B 2 10  ? 63.852 10.840  19.370 1.00 82.94 ? 4   DA  C "O5'" 1 
ATOM   411  C "C5'" . DA  B 2 10  ? 64.895 10.155  20.061 1.00 80.32 ? 4   DA  C "C5'" 1 
ATOM   412  C "C4'" . DA  B 2 10  ? 64.748 8.655   19.921 1.00 85.22 ? 4   DA  C "C4'" 1 
ATOM   413  O "O4'" . DA  B 2 10  ? 63.636 8.168   20.724 1.00 85.22 ? 4   DA  C "O4'" 1 
ATOM   414  C "C3'" . DA  B 2 10  ? 64.424 8.215   18.492 1.00 83.56 ? 4   DA  C "C3'" 1 
ATOM   415  O "O3'" . DA  B 2 10  ? 64.978 6.915   18.261 1.00 85.22 ? 4   DA  C "O3'" 1 
ATOM   416  C "C2'" . DA  B 2 10  ? 62.905 8.214   18.469 1.00 82.45 ? 4   DA  C "C2'" 1 
ATOM   417  C "C1'" . DA  B 2 10  ? 62.576 7.719   19.875 1.00 85.21 ? 4   DA  C "C1'" 1 
ATOM   418  N N9    . DA  B 2 10  ? 61.289 8.153   20.440 1.00 85.22 ? 4   DA  C N9    1 
ATOM   419  C C8    . DA  B 2 10  ? 60.545 9.254   20.086 1.00 85.22 ? 4   DA  C C8    1 
ATOM   420  N N7    . DA  B 2 10  ? 59.414 9.367   20.744 1.00 85.22 ? 4   DA  C N7    1 
ATOM   421  C C5    . DA  B 2 10  ? 59.412 8.271   21.599 1.00 85.22 ? 4   DA  C C5    1 
ATOM   422  C C6    . DA  B 2 10  ? 58.486 7.821   22.574 1.00 85.22 ? 4   DA  C C6    1 
ATOM   423  N N6    . DA  B 2 10  ? 57.337 8.447   22.859 1.00 83.87 ? 4   DA  C N6    1 
ATOM   424  N N1    . DA  B 2 10  ? 58.791 6.692   23.255 1.00 85.22 ? 4   DA  C N1    1 
ATOM   425  C C2    . DA  B 2 10  ? 59.938 6.066   22.975 1.00 85.22 ? 4   DA  C C2    1 
ATOM   426  N N3    . DA  B 2 10  ? 60.885 6.387   22.090 1.00 85.22 ? 4   DA  C N3    1 
ATOM   427  C C4    . DA  B 2 10  ? 60.561 7.515   21.427 1.00 85.22 ? 4   DA  C C4    1 
ATOM   428  P P     . DT  B 2 11  ? 64.602 6.102   16.922 1.00 85.22 ? 3   DT  C P     1 
ATOM   429  O OP1   . DT  B 2 11  ? 65.864 5.434   16.505 1.00 84.86 ? 3   DT  C OP1   1 
ATOM   430  O OP2   . DT  B 2 11  ? 63.857 6.978   15.959 1.00 84.91 ? 3   DT  C OP2   1 
ATOM   431  O "O5'" . DT  B 2 11  ? 63.626 4.955   17.446 1.00 85.22 ? 3   DT  C "O5'" 1 
ATOM   432  C "C5'" . DT  B 2 11  ? 64.016 4.156   18.560 1.00 85.22 ? 3   DT  C "C5'" 1 
ATOM   433  C "C4'" . DT  B 2 11  ? 63.140 2.935   18.689 1.00 84.57 ? 3   DT  C "C4'" 1 
ATOM   434  O "O4'" . DT  B 2 11  ? 61.861 3.296   19.275 1.00 85.22 ? 3   DT  C "O4'" 1 
ATOM   435  C "C3'" . DT  B 2 11  ? 62.803 2.353   17.320 1.00 83.06 ? 3   DT  C "C3'" 1 
ATOM   436  O "O3'" . DT  B 2 11  ? 62.664 0.936   17.439 1.00 83.55 ? 3   DT  C "O3'" 1 
ATOM   437  C "C2'" . DT  B 2 11  ? 61.510 3.068   16.949 1.00 82.16 ? 3   DT  C "C2'" 1 
ATOM   438  C "C1'" . DT  B 2 11  ? 60.824 3.153   18.305 1.00 85.22 ? 3   DT  C "C1'" 1 
ATOM   439  N N1    . DT  B 2 11  ? 59.793 4.202   18.530 1.00 85.10 ? 3   DT  C N1    1 
ATOM   440  C C2    . DT  B 2 11  ? 58.690 3.876   19.312 1.00 85.22 ? 3   DT  C C2    1 
ATOM   441  O O2    . DT  B 2 11  ? 58.524 2.782   19.822 1.00 80.82 ? 3   DT  C O2    1 
ATOM   442  N N3    . DT  B 2 11  ? 57.779 4.890   19.472 1.00 85.22 ? 3   DT  C N3    1 
ATOM   443  C C4    . DT  B 2 11  ? 57.849 6.161   18.950 1.00 84.21 ? 3   DT  C C4    1 
ATOM   444  O O4    . DT  B 2 11  ? 56.960 6.965   19.186 1.00 83.63 ? 3   DT  C O4    1 
ATOM   445  C C5    . DT  B 2 11  ? 59.014 6.434   18.144 1.00 85.16 ? 3   DT  C C5    1 
ATOM   446  C C7    . DT  B 2 11  ? 59.157 7.789   17.530 1.00 85.22 ? 3   DT  C C7    1 
ATOM   447  C C6    . DT  B 2 11  ? 59.920 5.456   17.978 1.00 84.93 ? 3   DT  C C6    1 
ATOM   448  P P     . DT  B 2 12  ? 61.863 0.118   16.315 1.00 85.22 ? 2   DT  C P     1 
ATOM   449  O OP1   . DT  B 2 12  ? 62.555 -1.183  16.113 1.00 82.90 ? 2   DT  C OP1   1 
ATOM   450  O OP2   . DT  B 2 12  ? 61.622 1.015   15.149 1.00 85.22 ? 2   DT  C OP2   1 
ATOM   451  O "O5'" . DT  B 2 12  ? 60.458 -0.149  17.015 1.00 85.22 ? 2   DT  C "O5'" 1 
ATOM   452  C "C5'" . DT  B 2 12  ? 60.393 -0.562  18.379 1.00 83.18 ? 2   DT  C "C5'" 1 
ATOM   453  C "C4'" . DT  B 2 12  ? 58.986 -0.981  18.739 1.00 80.95 ? 2   DT  C "C4'" 1 
ATOM   454  O "O4'" . DT  B 2 12  ? 58.148 0.197   18.875 1.00 82.75 ? 2   DT  C "O4'" 1 
ATOM   455  C "C3'" . DT  B 2 12  ? 58.335 -1.792  17.611 1.00 81.59 ? 2   DT  C "C3'" 1 
ATOM   456  O "O3'" . DT  B 2 12  ? 57.391 -2.718  18.167 1.00 81.20 ? 2   DT  C "O3'" 1 
ATOM   457  C "C2'" . DT  B 2 12  ? 57.660 -0.724  16.763 1.00 78.59 ? 2   DT  C "C2'" 1 
ATOM   458  C "C1'" . DT  B 2 12  ? 57.176 0.215   17.837 1.00 78.79 ? 2   DT  C "C1'" 1 
ATOM   459  N N1    . DT  B 2 12  ? 56.863 1.603   17.475 1.00 79.09 ? 2   DT  C N1    1 
ATOM   460  C C2    . DT  B 2 12  ? 55.784 2.181   18.107 1.00 79.65 ? 2   DT  C C2    1 
ATOM   461  O O2    . DT  B 2 12  ? 55.128 1.606   18.954 1.00 79.58 ? 2   DT  C O2    1 
ATOM   462  N N3    . DT  B 2 12  ? 55.494 3.462   17.706 1.00 83.02 ? 2   DT  C N3    1 
ATOM   463  C C4    . DT  B 2 12  ? 56.161 4.210   16.757 1.00 83.16 ? 2   DT  C C4    1 
ATOM   464  O O4    . DT  B 2 12  ? 55.769 5.346   16.494 1.00 81.44 ? 2   DT  C O4    1 
ATOM   465  C C5    . DT  B 2 12  ? 57.301 3.547   16.139 1.00 85.18 ? 2   DT  C C5    1 
ATOM   466  C C7    . DT  B 2 12  ? 58.097 4.273   15.100 1.00 81.49 ? 2   DT  C C7    1 
ATOM   467  C C6    . DT  B 2 12  ? 57.591 2.292   16.532 1.00 85.22 ? 2   DT  C C6    1 
ATOM   468  P P     . DT  B 2 13  ? 56.348 -3.492  17.215 1.00 80.13 ? 1   DT  C P     1 
ATOM   469  O OP1   . DT  B 2 13  ? 56.448 -4.912  17.610 1.00 77.65 ? 1   DT  C OP1   1 
ATOM   470  O OP2   . DT  B 2 13  ? 56.496 -3.114  15.789 1.00 80.89 ? 1   DT  C OP2   1 
ATOM   471  O "O5'" . DT  B 2 13  ? 54.938 -2.939  17.704 1.00 80.32 ? 1   DT  C "O5'" 1 
ATOM   472  C "C5'" . DT  B 2 13  ? 54.652 -2.852  19.091 1.00 71.49 ? 1   DT  C "C5'" 1 
ATOM   473  C "C4'" . DT  B 2 13  ? 53.208 -2.481  19.327 1.00 67.35 ? 1   DT  C "C4'" 1 
ATOM   474  O "O4'" . DT  B 2 13  ? 52.996 -1.093  18.962 1.00 72.67 ? 1   DT  C "O4'" 1 
ATOM   475  C "C3'" . DT  B 2 13  ? 52.231 -3.273  18.452 1.00 65.50 ? 1   DT  C "C3'" 1 
ATOM   476  O "O3'" . DT  B 2 13  ? 50.992 -3.422  19.165 1.00 65.60 ? 1   DT  C "O3'" 1 
ATOM   477  C "C2'" . DT  B 2 13  ? 52.095 -2.401  17.214 1.00 67.20 ? 1   DT  C "C2'" 1 
ATOM   478  C "C1'" . DT  B 2 13  ? 52.137 -1.016  17.834 1.00 71.59 ? 1   DT  C "C1'" 1 
ATOM   479  N N1    . DT  B 2 13  ? 52.518 0.144   17.010 1.00 74.02 ? 1   DT  C N1    1 
ATOM   480  C C2    . DT  B 2 13  ? 51.697 1.263   17.060 1.00 78.18 ? 1   DT  C C2    1 
ATOM   481  O O2    . DT  B 2 13  ? 50.701 1.327   17.762 1.00 82.77 ? 1   DT  C O2    1 
ATOM   482  N N3    . DT  B 2 13  ? 52.087 2.310   16.257 1.00 80.25 ? 1   DT  C N3    1 
ATOM   483  C C4    . DT  B 2 13  ? 53.199 2.350   15.431 1.00 85.22 ? 1   DT  C C4    1 
ATOM   484  O O4    . DT  B 2 13  ? 53.431 3.363   14.765 1.00 85.22 ? 1   DT  C O4    1 
ATOM   485  C C5    . DT  B 2 13  ? 54.021 1.142   15.436 1.00 85.22 ? 1   DT  C C5    1 
ATOM   486  C C7    . DT  B 2 13  ? 55.248 1.092   14.580 1.00 84.03 ? 1   DT  C C7    1 
ATOM   487  C C6    . DT  B 2 13  ? 53.640 0.116   16.217 1.00 80.95 ? 1   DT  C C6    1 
ATOM   488  P P     . DT  B 2 14  ? 49.766 -4.231  18.511 1.00 64.35 ? -1  DT  C P     1 
ATOM   489  O OP1   . DT  B 2 14  ? 49.322 -5.324  19.425 1.00 63.80 ? -1  DT  C OP1   1 
ATOM   490  O OP2   . DT  B 2 14  ? 50.076 -4.530  17.094 1.00 60.03 ? -1  DT  C OP2   1 
ATOM   491  O "O5'" . DT  B 2 14  ? 48.616 -3.149  18.553 1.00 64.69 ? -1  DT  C "O5'" 1 
ATOM   492  C "C5'" . DT  B 2 14  ? 48.922 -1.814  18.254 1.00 63.62 ? -1  DT  C "C5'" 1 
ATOM   493  C "C4'" . DT  B 2 14  ? 47.762 -0.924  18.597 1.00 62.93 ? -1  DT  C "C4'" 1 
ATOM   494  O "O4'" . DT  B 2 14  ? 48.041 0.345   17.983 1.00 65.85 ? -1  DT  C "O4'" 1 
ATOM   495  C "C3'" . DT  B 2 14  ? 46.421 -1.359  18.034 1.00 63.33 ? -1  DT  C "C3'" 1 
ATOM   496  O "O3'" . DT  B 2 14  ? 45.411 -0.842  18.903 1.00 66.29 ? -1  DT  C "O3'" 1 
ATOM   497  C "C2'" . DT  B 2 14  ? 46.432 -0.744  16.645 1.00 66.13 ? -1  DT  C "C2'" 1 
ATOM   498  C "C1'" . DT  B 2 14  ? 47.236 0.536   16.826 1.00 68.03 ? -1  DT  C "C1'" 1 
ATOM   499  N N1    . DT  B 2 14  ? 48.175 0.847   15.731 1.00 71.79 ? -1  DT  C N1    1 
ATOM   500  C C2    . DT  B 2 14  ? 48.214 2.132   15.230 1.00 74.46 ? -1  DT  C C2    1 
ATOM   501  O O2    . DT  B 2 14  ? 47.442 3.007   15.571 1.00 75.40 ? -1  DT  C O2    1 
ATOM   502  N N3    . DT  B 2 14  ? 49.202 2.356   14.306 1.00 78.14 ? -1  DT  C N3    1 
ATOM   503  C C4    . DT  B 2 14  ? 50.126 1.444   13.834 1.00 80.20 ? -1  DT  C C4    1 
ATOM   504  O O4    . DT  B 2 14  ? 50.975 1.800   13.027 1.00 84.19 ? -1  DT  C O4    1 
ATOM   505  C C5    . DT  B 2 14  ? 50.002 0.105   14.367 1.00 78.24 ? -1  DT  C C5    1 
ATOM   506  C C7    . DT  B 2 14  ? 50.953 -0.950  13.901 1.00 76.27 ? -1  DT  C C7    1 
ATOM   507  C C6    . DT  B 2 14  ? 49.037 -0.126  15.268 1.00 74.94 ? -1  DT  C C6    1 
ATOM   508  P P     . DT  B 2 15  ? 43.857 -1.088  18.590 1.00 69.48 ? -2  DT  C P     1 
ATOM   509  O OP1   . DT  B 2 15  ? 43.235 -1.510  19.867 1.00 66.31 ? -2  DT  C OP1   1 
ATOM   510  O OP2   . DT  B 2 15  ? 43.664 -1.915  17.371 1.00 66.62 ? -2  DT  C OP2   1 
ATOM   511  O "O5'" . DT  B 2 15  ? 43.354 0.388   18.283 1.00 73.14 ? -2  DT  C "O5'" 1 
ATOM   512  C "C5'" . DT  B 2 15  ? 42.444 0.662   17.226 1.00 76.20 ? -2  DT  C "C5'" 1 
ATOM   513  C "C4'" . DT  B 2 15  ? 42.348 2.155   17.027 1.00 76.02 ? -2  DT  C "C4'" 1 
ATOM   514  O "O4'" . DT  B 2 15  ? 43.595 2.585   16.414 1.00 76.91 ? -2  DT  C "O4'" 1 
ATOM   515  C "C3'" . DT  B 2 15  ? 41.247 2.544   16.035 1.00 77.81 ? -2  DT  C "C3'" 1 
ATOM   516  O "O3'" . DT  B 2 15  ? 40.566 3.789   16.348 1.00 65.13 ? -2  DT  C "O3'" 1 
ATOM   517  C "C2'" . DT  B 2 15  ? 41.968 2.496   14.694 1.00 78.96 ? -2  DT  C "C2'" 1 
ATOM   518  C "C1'" . DT  B 2 15  ? 43.368 2.975   15.059 1.00 80.01 ? -2  DT  C "C1'" 1 
ATOM   519  N N1    . DT  B 2 15  ? 44.481 2.468   14.222 1.00 80.36 ? -2  DT  C N1    1 
ATOM   520  C C2    . DT  B 2 15  ? 45.240 3.394   13.502 1.00 85.22 ? -2  DT  C C2    1 
ATOM   521  O O2    . DT  B 2 15  ? 45.042 4.608   13.529 1.00 85.22 ? -2  DT  C O2    1 
ATOM   522  N N3    . DT  B 2 15  ? 46.252 2.846   12.742 1.00 85.22 ? -2  DT  C N3    1 
ATOM   523  C C4    . DT  B 2 15  ? 46.580 1.508   12.634 1.00 84.28 ? -2  DT  C C4    1 
ATOM   524  O O4    . DT  B 2 15  ? 47.528 1.175   11.918 1.00 85.22 ? -2  DT  C O4    1 
ATOM   525  C C5    . DT  B 2 15  ? 45.744 0.598   13.413 1.00 80.59 ? -2  DT  C C5    1 
ATOM   526  C C7    . DT  B 2 15  ? 46.017 -0.871  13.355 1.00 76.77 ? -2  DT  C C7    1 
ATOM   527  C C6    . DT  B 2 15  ? 44.754 1.120   14.156 1.00 80.24 ? -2  DT  C C6    1 
ATOM   528  N N     . ASP C 3 1   ? 12.494 -9.524  31.826 1.00 85.22 ? 8   ASP A N     1 
ATOM   529  C CA    . ASP C 3 1   ? 11.409 -9.511  32.846 1.00 85.22 ? 8   ASP A CA    1 
ATOM   530  C C     . ASP C 3 1   ? 10.382 -8.443  32.504 1.00 85.12 ? 8   ASP A C     1 
ATOM   531  O O     . ASP C 3 1   ? 10.670 -7.485  31.784 1.00 81.40 ? 8   ASP A O     1 
ATOM   532  C CB    . ASP C 3 1   ? 11.981 -9.209  34.221 1.00 85.22 ? 8   ASP A CB    1 
ATOM   533  C CG    . ASP C 3 1   ? 12.406 -7.766  34.355 1.00 85.22 ? 8   ASP A CG    1 
ATOM   534  O OD1   . ASP C 3 1   ? 11.513 -6.887  34.447 1.00 85.22 ? 8   ASP A OD1   1 
ATOM   535  O OD2   . ASP C 3 1   ? 13.633 -7.515  34.353 1.00 85.22 ? 8   ASP A OD2   1 
ATOM   536  N N     . PRO C 3 2   ? 9.166  -8.586  33.045 1.00 85.22 ? 9   PRO A N     1 
ATOM   537  C CA    . PRO C 3 2   ? 8.087  -7.626  32.790 1.00 85.22 ? 9   PRO A CA    1 
ATOM   538  C C     . PRO C 3 2   ? 8.373  -6.187  33.234 1.00 84.02 ? 9   PRO A C     1 
ATOM   539  O O     . PRO C 3 2   ? 8.288  -5.266  32.427 1.00 83.73 ? 9   PRO A O     1 
ATOM   540  C CB    . PRO C 3 2   ? 6.890  -8.255  33.512 1.00 84.74 ? 9   PRO A CB    1 
ATOM   541  C CG    . PRO C 3 2   ? 7.534  -9.039  34.633 1.00 85.22 ? 9   PRO A CG    1 
ATOM   542  C CD    . PRO C 3 2   ? 8.722  -9.664  33.953 1.00 85.22 ? 9   PRO A CD    1 
ATOM   543  N N     . THR C 3 3   ? 8.721  -5.991  34.501 1.00 83.50 ? 10  THR A N     1 
ATOM   544  C CA    . THR C 3 3   ? 8.990  -4.639  34.993 1.00 85.15 ? 10  THR A CA    1 
ATOM   545  C C     . THR C 3 3   ? 10.127 -3.924  34.262 1.00 85.21 ? 10  THR A C     1 
ATOM   546  O O     . THR C 3 3   ? 10.420 -2.767  34.555 1.00 82.87 ? 10  THR A O     1 
ATOM   547  C CB    . THR C 3 3   ? 9.332  -4.620  36.502 1.00 85.22 ? 10  THR A CB    1 
ATOM   548  O OG1   . THR C 3 3   ? 10.475 -5.453  36.734 1.00 78.90 ? 10  THR A OG1   1 
ATOM   549  C CG2   . THR C 3 3   ? 8.156  -5.104  37.334 1.00 85.22 ? 10  THR A CG2   1 
ATOM   550  N N     . LEU C 3 4   ? 10.776 -4.598  33.321 1.00 84.70 ? 11  LEU A N     1 
ATOM   551  C CA    . LEU C 3 4   ? 11.853 -3.945  32.600 1.00 82.43 ? 11  LEU A CA    1 
ATOM   552  C C     . LEU C 3 4   ? 11.277 -3.071  31.493 1.00 84.08 ? 11  LEU A C     1 
ATOM   553  O O     . LEU C 3 4   ? 11.450 -1.844  31.526 1.00 85.22 ? 11  LEU A O     1 
ATOM   554  C CB    . LEU C 3 4   ? 12.825 -4.964  32.009 1.00 80.46 ? 11  LEU A CB    1 
ATOM   555  C CG    . LEU C 3 4   ? 14.190 -4.373  31.640 1.00 77.90 ? 11  LEU A CG    1 
ATOM   556  C CD1   . LEU C 3 4   ? 14.892 -3.850  32.896 1.00 78.65 ? 11  LEU A CD1   1 
ATOM   557  C CD2   . LEU C 3 4   ? 15.031 -5.430  30.964 1.00 74.64 ? 11  LEU A CD2   1 
ATOM   558  N N     . GLU C 3 5   ? 10.595 -3.681  30.519 1.00 80.65 ? 12  GLU A N     1 
ATOM   559  C CA    . GLU C 3 5   ? 10.004 -2.895  29.431 1.00 80.48 ? 12  GLU A CA    1 
ATOM   560  C C     . GLU C 3 5   ? 9.244  -1.702  30.008 1.00 78.10 ? 12  GLU A C     1 
ATOM   561  O O     . GLU C 3 5   ? 9.152  -0.640  29.388 1.00 77.52 ? 12  GLU A O     1 
ATOM   562  C CB    . GLU C 3 5   ? 9.030  -3.727  28.592 1.00 82.29 ? 12  GLU A CB    1 
ATOM   563  C CG    . GLU C 3 5   ? 9.674  -4.606  27.529 1.00 85.20 ? 12  GLU A CG    1 
ATOM   564  C CD    . GLU C 3 5   ? 10.103 -5.960  28.066 1.00 85.22 ? 12  GLU A CD    1 
ATOM   565  O OE1   . GLU C 3 5   ? 9.227  -6.737  28.525 1.00 85.22 ? 12  GLU A OE1   1 
ATOM   566  O OE2   . GLU C 3 5   ? 11.321 -6.248  28.026 1.00 85.22 ? 12  GLU A OE2   1 
ATOM   567  N N     . TRP C 3 6   ? 8.701  -1.883  31.204 1.00 74.26 ? 13  TRP A N     1 
ATOM   568  C CA    . TRP C 3 6   ? 7.956  -0.817  31.834 1.00 71.30 ? 13  TRP A CA    1 
ATOM   569  C C     . TRP C 3 6   ? 8.896  0.328   32.168 1.00 70.66 ? 13  TRP A C     1 
ATOM   570  O O     . TRP C 3 6   ? 8.693  1.457   31.723 1.00 66.09 ? 13  TRP A O     1 
ATOM   571  C CB    . TRP C 3 6   ? 7.268  -1.306  33.111 1.00 65.40 ? 13  TRP A CB    1 
ATOM   572  C CG    . TRP C 3 6   ? 6.581  -0.176  33.853 1.00 64.43 ? 13  TRP A CG    1 
ATOM   573  C CD1   . TRP C 3 6   ? 5.529  0.585   33.408 1.00 61.16 ? 13  TRP A CD1   1 
ATOM   574  C CD2   . TRP C 3 6   ? 6.914  0.329   35.153 1.00 61.57 ? 13  TRP A CD2   1 
ATOM   575  N NE1   . TRP C 3 6   ? 5.191  1.524   34.350 1.00 61.17 ? 13  TRP A NE1   1 
ATOM   576  C CE2   . TRP C 3 6   ? 6.025  1.391   35.430 1.00 60.47 ? 13  TRP A CE2   1 
ATOM   577  C CE3   . TRP C 3 6   ? 7.874  -0.011  36.107 1.00 60.90 ? 13  TRP A CE3   1 
ATOM   578  C CZ2   . TRP C 3 6   ? 6.070  2.114   36.623 1.00 62.07 ? 13  TRP A CZ2   1 
ATOM   579  C CZ3   . TRP C 3 6   ? 7.918  0.708   37.296 1.00 65.96 ? 13  TRP A CZ3   1 
ATOM   580  C CH2   . TRP C 3 6   ? 7.022  1.759   37.543 1.00 62.42 ? 13  TRP A CH2   1 
ATOM   581  N N     . PHE C 3 7   ? 9.909  0.025   32.977 1.00 72.21 ? 14  PHE A N     1 
ATOM   582  C CA    . PHE C 3 7   ? 10.903 1.008   33.397 1.00 69.13 ? 14  PHE A CA    1 
ATOM   583  C C     . PHE C 3 7   ? 11.519 1.630   32.158 1.00 66.82 ? 14  PHE A C     1 
ATOM   584  O O     . PHE C 3 7   ? 11.586 2.850   32.043 1.00 62.84 ? 14  PHE A O     1 
ATOM   585  C CB    . PHE C 3 7   ? 11.996 0.328   34.226 1.00 71.61 ? 14  PHE A CB    1 
ATOM   586  C CG    . PHE C 3 7   ? 13.180 1.210   34.524 1.00 71.00 ? 14  PHE A CG    1 
ATOM   587  C CD1   . PHE C 3 7   ? 13.119 2.167   35.538 1.00 69.85 ? 14  PHE A CD1   1 
ATOM   588  C CD2   . PHE C 3 7   ? 14.360 1.082   33.792 1.00 66.47 ? 14  PHE A CD2   1 
ATOM   589  C CE1   . PHE C 3 7   ? 14.213 2.980   35.822 1.00 63.39 ? 14  PHE A CE1   1 
ATOM   590  C CE2   . PHE C 3 7   ? 15.455 1.888   34.068 1.00 61.34 ? 14  PHE A CE2   1 
ATOM   591  C CZ    . PHE C 3 7   ? 15.382 2.840   35.085 1.00 62.75 ? 14  PHE A CZ    1 
ATOM   592  N N     . LEU C 3 8   ? 11.961 0.777   31.235 1.00 65.37 ? 15  LEU A N     1 
ATOM   593  C CA    . LEU C 3 8   ? 12.574 1.247   29.999 1.00 67.50 ? 15  LEU A CA    1 
ATOM   594  C C     . LEU C 3 8   ? 11.669 2.201   29.244 1.00 65.21 ? 15  LEU A C     1 
ATOM   595  O O     . LEU C 3 8   ? 12.108 3.223   28.731 1.00 65.22 ? 15  LEU A O     1 
ATOM   596  C CB    . LEU C 3 8   ? 12.942 0.068   29.095 1.00 67.08 ? 15  LEU A CB    1 
ATOM   597  C CG    . LEU C 3 8   ? 14.256 -0.634  29.456 1.00 67.77 ? 15  LEU A CG    1 
ATOM   598  C CD1   . LEU C 3 8   ? 14.773 -1.399  28.245 1.00 62.22 ? 15  LEU A CD1   1 
ATOM   599  C CD2   . LEU C 3 8   ? 15.298 0.406   29.872 1.00 64.29 ? 15  LEU A CD2   1 
ATOM   600  N N     . SER C 3 9   ? 10.394 1.850   29.193 1.00 65.37 ? 16  SER A N     1 
ATOM   601  C CA    . SER C 3 9   ? 9.382  2.641   28.513 1.00 61.04 ? 16  SER A CA    1 
ATOM   602  C C     . SER C 3 9   ? 9.308  4.084   28.989 1.00 56.70 ? 16  SER A C     1 
ATOM   603  O O     . SER C 3 9   ? 8.734  4.908   28.296 1.00 54.71 ? 16  SER A O     1 
ATOM   604  C CB    . SER C 3 9   ? 8.018  2.014   28.733 1.00 62.47 ? 16  SER A CB    1 
ATOM   605  O OG    . SER C 3 9   ? 7.552  2.346   30.033 1.00 65.73 ? 16  SER A OG    1 
ATOM   606  N N     . HIS C 3 10  ? 9.860  4.377   30.169 1.00 58.37 ? 17  HIS A N     1 
ATOM   607  C CA    . HIS C 3 10  ? 9.838  5.733   30.754 1.00 61.36 ? 17  HIS A CA    1 
ATOM   608  C C     . HIS C 3 10  ? 11.190 6.413   30.767 1.00 59.50 ? 17  HIS A C     1 
ATOM   609  O O     . HIS C 3 10  ? 11.416 7.341   31.548 1.00 58.76 ? 17  HIS A O     1 
ATOM   610  C CB    . HIS C 3 10  ? 9.361  5.715   32.203 1.00 64.87 ? 17  HIS A CB    1 
ATOM   611  C CG    . HIS C 3 10  ? 7.926  5.343   32.365 1.00 74.25 ? 17  HIS A CG    1 
ATOM   612  N ND1   . HIS C 3 10  ? 7.423  4.127   31.952 1.00 77.02 ? 17  HIS A ND1   1 
ATOM   613  C CD2   . HIS C 3 10  ? 6.899  6.000   32.950 1.00 75.11 ? 17  HIS A CD2   1 
ATOM   614  C CE1   . HIS C 3 10  ? 6.147  4.050   32.283 1.00 80.69 ? 17  HIS A CE1   1 
ATOM   615  N NE2   . HIS C 3 10  ? 5.805  5.174   32.891 1.00 79.20 ? 17  HIS A NE2   1 
ATOM   616  N N     . CYS C 3 11  ? 12.079 5.954   29.902 1.00 54.89 ? 18  CYS A N     1 
ATOM   617  C CA    . CYS C 3 11  ? 13.415 6.491   29.842 1.00 55.22 ? 18  CYS A CA    1 
ATOM   618  C C     . CYS C 3 11  ? 13.756 7.099   28.504 1.00 55.19 ? 18  CYS A C     1 
ATOM   619  O O     . CYS C 3 11  ? 13.157 6.767   27.492 1.00 57.72 ? 18  CYS A O     1 
ATOM   620  C CB    . CYS C 3 11  ? 14.417 5.373   30.126 1.00 57.14 ? 18  CYS A CB    1 
ATOM   621  S SG    . CYS C 3 11  ? 14.346 4.700   31.783 1.00 62.69 ? 18  CYS A SG    1 
ATOM   622  N N     . HIS C 3 12  ? 14.737 7.990   28.512 1.00 54.78 ? 19  HIS A N     1 
ATOM   623  C CA    . HIS C 3 12  ? 15.234 8.601   27.290 1.00 53.23 ? 19  HIS A CA    1 
ATOM   624  C C     . HIS C 3 12  ? 16.362 7.650   26.891 1.00 50.34 ? 19  HIS A C     1 
ATOM   625  O O     . HIS C 3 12  ? 17.225 7.350   27.702 1.00 53.36 ? 19  HIS A O     1 
ATOM   626  C CB    . HIS C 3 12  ? 15.849 9.989   27.569 1.00 56.56 ? 19  HIS A CB    1 
ATOM   627  C CG    . HIS C 3 12  ? 14.851 11.096  27.756 1.00 60.70 ? 19  HIS A CG    1 
ATOM   628  N ND1   . HIS C 3 12  ? 14.166 11.670  26.706 1.00 62.38 ? 19  HIS A ND1   1 
ATOM   629  C CD2   . HIS C 3 12  ? 14.473 11.777  28.865 1.00 64.05 ? 19  HIS A CD2   1 
ATOM   630  C CE1   . HIS C 3 12  ? 13.414 12.659  27.158 1.00 62.19 ? 19  HIS A CE1   1 
ATOM   631  N NE2   . HIS C 3 12  ? 13.583 12.745  28.466 1.00 65.02 ? 19  HIS A NE2   1 
ATOM   632  N N     . ILE C 3 13  ? 16.357 7.141   25.674 1.00 45.61 ? 20  ILE A N     1 
ATOM   633  C CA    . ILE C 3 13  ? 17.455 6.286   25.275 1.00 44.23 ? 20  ILE A CA    1 
ATOM   634  C C     . ILE C 3 13  ? 18.487 7.170   24.582 1.00 47.30 ? 20  ILE A C     1 
ATOM   635  O O     . ILE C 3 13  ? 18.159 7.940   23.679 1.00 47.46 ? 20  ILE A O     1 
ATOM   636  C CB    . ILE C 3 13  ? 17.024 5.201   24.290 1.00 44.14 ? 20  ILE A CB    1 
ATOM   637  C CG1   . ILE C 3 13  ? 15.948 4.317   24.919 1.00 43.79 ? 20  ILE A CG1   1 
ATOM   638  C CG2   . ILE C 3 13  ? 18.229 4.411   23.850 1.00 41.11 ? 20  ILE A CG2   1 
ATOM   639  C CD1   . ILE C 3 13  ? 16.259 3.784   26.299 1.00 50.60 ? 20  ILE A CD1   1 
ATOM   640  N N     . HIS C 3 14  ? 19.737 7.064   25.016 1.00 48.51 ? 21  HIS A N     1 
ATOM   641  C CA    . HIS C 3 14  ? 20.820 7.845   24.436 1.00 43.90 ? 21  HIS A CA    1 
ATOM   642  C C     . HIS C 3 14  ? 21.932 6.935   23.966 1.00 43.37 ? 21  HIS A C     1 
ATOM   643  O O     . HIS C 3 14  ? 22.077 5.822   24.440 1.00 44.80 ? 21  HIS A O     1 
ATOM   644  C CB    . HIS C 3 14  ? 21.404 8.794   25.468 1.00 40.41 ? 21  HIS A CB    1 
ATOM   645  C CG    . HIS C 3 14  ? 20.529 9.952   25.788 1.00 40.93 ? 21  HIS A CG    1 
ATOM   646  N ND1   . HIS C 3 14  ? 20.633 11.160  25.135 1.00 44.10 ? 21  HIS A ND1   1 
ATOM   647  C CD2   . HIS C 3 14  ? 19.546 10.100  26.703 1.00 43.09 ? 21  HIS A CD2   1 
ATOM   648  C CE1   . HIS C 3 14  ? 19.753 12.004  25.638 1.00 42.63 ? 21  HIS A CE1   1 
ATOM   649  N NE2   . HIS C 3 14  ? 19.081 11.386  26.593 1.00 46.31 ? 21  HIS A NE2   1 
ATOM   650  N N     . LYS C 3 15  ? 22.731 7.431   23.041 1.00 41.18 ? 22  LYS A N     1 
ATOM   651  C CA    . LYS C 3 15  ? 23.843 6.674   22.544 1.00 39.71 ? 22  LYS A CA    1 
ATOM   652  C C     . LYS C 3 15  ? 25.098 7.464   22.845 1.00 40.45 ? 22  LYS A C     1 
ATOM   653  O O     . LYS C 3 15  ? 25.081 8.697   22.864 1.00 43.69 ? 22  LYS A O     1 
ATOM   654  C CB    . LYS C 3 15  ? 23.716 6.478   21.048 1.00 41.61 ? 22  LYS A CB    1 
ATOM   655  C CG    . LYS C 3 15  ? 22.425 5.864   20.631 1.00 37.49 ? 22  LYS A CG    1 
ATOM   656  C CD    . LYS C 3 15  ? 22.470 4.388   20.677 1.00 49.28 ? 22  LYS A CD    1 
ATOM   657  C CE    . LYS C 3 15  ? 21.438 3.816   19.707 1.00 56.32 ? 22  LYS A CE    1 
ATOM   658  N NZ    . LYS C 3 15  ? 21.894 3.905   18.271 1.00 61.62 ? 22  LYS A NZ    1 
ATOM   659  N N     . TYR C 3 16  ? 26.180 6.737   23.096 1.00 40.00 ? 23  TYR A N     1 
ATOM   660  C CA    . TYR C 3 16  ? 27.476 7.320   23.386 1.00 38.42 ? 23  TYR A CA    1 
ATOM   661  C C     . TYR C 3 16  ? 28.548 6.531   22.654 1.00 39.93 ? 23  TYR A C     1 
ATOM   662  O O     . TYR C 3 16  ? 28.704 5.339   22.858 1.00 42.87 ? 23  TYR A O     1 
ATOM   663  C CB    . TYR C 3 16  ? 27.747 7.268   24.878 1.00 34.05 ? 23  TYR A CB    1 
ATOM   664  C CG    . TYR C 3 16  ? 26.784 8.073   25.709 1.00 33.08 ? 23  TYR A CG    1 
ATOM   665  C CD1   . TYR C 3 16  ? 25.600 7.520   26.184 1.00 28.73 ? 23  TYR A CD1   1 
ATOM   666  C CD2   . TYR C 3 16  ? 27.081 9.386   26.052 1.00 31.07 ? 23  TYR A CD2   1 
ATOM   667  C CE1   . TYR C 3 16  ? 24.746 8.262   26.988 1.00 30.67 ? 23  TYR A CE1   1 
ATOM   668  C CE2   . TYR C 3 16  ? 26.243 10.123  26.842 1.00 29.90 ? 23  TYR A CE2   1 
ATOM   669  C CZ    . TYR C 3 16  ? 25.077 9.568   27.313 1.00 31.58 ? 23  TYR A CZ    1 
ATOM   670  O OH    . TYR C 3 16  ? 24.253 10.344  28.113 1.00 34.10 ? 23  TYR A OH    1 
ATOM   671  N N     . PRO C 3 17  ? 29.317 7.189   21.796 1.00 41.40 ? 24  PRO A N     1 
ATOM   672  C CA    . PRO C 3 17  ? 30.342 6.432   21.093 1.00 41.07 ? 24  PRO A CA    1 
ATOM   673  C C     . PRO C 3 17  ? 31.454 6.038   22.057 1.00 43.06 ? 24  PRO A C     1 
ATOM   674  O O     . PRO C 3 17  ? 31.645 6.654   23.104 1.00 41.80 ? 24  PRO A O     1 
ATOM   675  C CB    . PRO C 3 17  ? 30.817 7.424   20.045 1.00 40.61 ? 24  PRO A CB    1 
ATOM   676  C CG    . PRO C 3 17  ? 30.848 8.684   20.839 1.00 43.71 ? 24  PRO A CG    1 
ATOM   677  C CD    . PRO C 3 17  ? 29.512 8.636   21.596 1.00 45.14 ? 24  PRO A CD    1 
ATOM   678  N N     . SER C 3 18  ? 32.202 5.009   21.696 1.00 47.24 ? 25  SER A N     1 
ATOM   679  C CA    . SER C 3 18  ? 33.297 4.578   22.535 1.00 45.21 ? 25  SER A CA    1 
ATOM   680  C C     . SER C 3 18  ? 34.160 5.771   22.916 1.00 44.60 ? 25  SER A C     1 
ATOM   681  O O     . SER C 3 18  ? 34.096 6.821   22.293 1.00 41.80 ? 25  SER A O     1 
ATOM   682  C CB    . SER C 3 18  ? 34.148 3.572   21.805 1.00 41.64 ? 25  SER A CB    1 
ATOM   683  O OG    . SER C 3 18  ? 35.477 3.751   22.233 1.00 44.86 ? 25  SER A OG    1 
ATOM   684  N N     . LYS C 3 19  ? 34.974 5.594   23.948 1.00 45.62 ? 26  LYS A N     1 
ATOM   685  C CA    . LYS C 3 19  ? 35.859 6.645   24.441 1.00 43.36 ? 26  LYS A CA    1 
ATOM   686  C C     . LYS C 3 19  ? 35.194 7.925   24.924 1.00 40.09 ? 26  LYS A C     1 
ATOM   687  O O     . LYS C 3 19  ? 35.901 8.834   25.324 1.00 40.87 ? 26  LYS A O     1 
ATOM   688  C CB    . LYS C 3 19  ? 36.933 7.001   23.402 1.00 44.53 ? 26  LYS A CB    1 
ATOM   689  C CG    . LYS C 3 19  ? 37.887 5.836   23.075 1.00 53.55 ? 26  LYS A CG    1 
ATOM   690  C CD    . LYS C 3 19  ? 39.205 6.263   22.402 1.00 55.94 ? 26  LYS A CD    1 
ATOM   691  C CE    . LYS C 3 19  ? 39.031 6.798   20.978 1.00 64.26 ? 26  LYS A CE    1 
ATOM   692  N NZ    . LYS C 3 19  ? 40.349 7.081   20.308 1.00 67.09 ? 26  LYS A NZ    1 
ATOM   693  N N     . SER C 3 20  ? 33.862 8.006   24.931 1.00 36.11 ? 27  SER A N     1 
ATOM   694  C CA    . SER C 3 20  ? 33.206 9.233   25.395 1.00 37.74 ? 27  SER A CA    1 
ATOM   695  C C     . SER C 3 20  ? 32.775 9.297   26.891 1.00 41.84 ? 27  SER A C     1 
ATOM   696  O O     . SER C 3 20  ? 32.839 8.305   27.618 1.00 48.23 ? 27  SER A O     1 
ATOM   697  C CB    . SER C 3 20  ? 32.035 9.563   24.476 1.00 31.73 ? 27  SER A CB    1 
ATOM   698  O OG    . SER C 3 20  ? 30.995 8.643   24.612 1.00 30.41 ? 27  SER A OG    1 
ATOM   699  N N     . THR C 3 21  ? 32.341 10.466  27.353 1.00 40.10 ? 28  THR A N     1 
ATOM   700  C CA    . THR C 3 21  ? 31.974 10.622  28.756 1.00 39.78 ? 28  THR A CA    1 
ATOM   701  C C     . THR C 3 21  ? 30.494 10.755  29.035 1.00 41.70 ? 28  THR A C     1 
ATOM   702  O O     . THR C 3 21  ? 29.847 11.722  28.619 1.00 46.81 ? 28  THR A O     1 
ATOM   703  C CB    . THR C 3 21  ? 32.648 11.871  29.398 1.00 42.70 ? 28  THR A CB    1 
ATOM   704  O OG1   . THR C 3 21  ? 34.071 11.813  29.226 1.00 49.21 ? 28  THR A OG1   1 
ATOM   705  C CG2   . THR C 3 21  ? 32.336 11.934  30.892 1.00 37.82 ? 28  THR A CG2   1 
ATOM   706  N N     . LEU C 3 22  ? 29.966 9.805   29.786 1.00 39.55 ? 29  LEU A N     1 
ATOM   707  C CA    . LEU C 3 22  ? 28.567 9.831   30.156 1.00 37.80 ? 29  LEU A CA    1 
ATOM   708  C C     . LEU C 3 22  ? 28.375 10.624  31.440 1.00 37.98 ? 29  LEU A C     1 
ATOM   709  O O     . LEU C 3 22  ? 27.425 11.387  31.568 1.00 38.71 ? 29  LEU A O     1 
ATOM   710  C CB    . LEU C 3 22  ? 28.053 8.416   30.365 1.00 38.31 ? 29  LEU A CB    1 
ATOM   711  C CG    . LEU C 3 22  ? 27.895 7.573   29.111 1.00 40.76 ? 29  LEU A CG    1 
ATOM   712  C CD1   . LEU C 3 22  ? 29.181 6.831   28.717 1.00 36.66 ? 29  LEU A CD1   1 
ATOM   713  C CD2   . LEU C 3 22  ? 26.793 6.600   29.413 1.00 44.55 ? 29  LEU A CD2   1 
ATOM   714  N N     . ILE C 3 23  ? 29.271 10.438  32.402 1.00 37.20 ? 30  ILE A N     1 
ATOM   715  C CA    . ILE C 3 23  ? 29.160 11.152  33.659 1.00 36.24 ? 30  ILE A CA    1 
ATOM   716  C C     . ILE C 3 23  ? 30.466 11.817  34.033 1.00 39.38 ? 30  ILE A C     1 
ATOM   717  O O     . ILE C 3 23  ? 31.519 11.265  33.814 1.00 43.97 ? 30  ILE A O     1 
ATOM   718  C CB    . ILE C 3 23  ? 28.707 10.204  34.754 1.00 33.52 ? 30  ILE A CB    1 
ATOM   719  C CG1   . ILE C 3 23  ? 27.370 9.580   34.327 1.00 34.32 ? 30  ILE A CG1   1 
ATOM   720  C CG2   . ILE C 3 23  ? 28.517 10.952  36.054 1.00 29.97 ? 30  ILE A CG2   1 
ATOM   721  C CD1   . ILE C 3 23  ? 26.859 8.477   35.199 1.00 32.39 ? 30  ILE A CD1   1 
ATOM   722  N N     . HIS C 3 24  ? 30.384 13.033  34.557 1.00 42.44 ? 31  HIS A N     1 
ATOM   723  C CA    . HIS C 3 24  ? 31.558 13.801  34.957 1.00 42.51 ? 31  HIS A CA    1 
ATOM   724  C C     . HIS C 3 24  ? 31.601 13.894  36.467 1.00 43.15 ? 31  HIS A C     1 
ATOM   725  O O     . HIS C 3 24  ? 30.589 14.144  37.132 1.00 42.13 ? 31  HIS A O     1 
ATOM   726  C CB    . HIS C 3 24  ? 31.490 15.220  34.395 1.00 47.50 ? 31  HIS A CB    1 
ATOM   727  C CG    . HIS C 3 24  ? 31.265 15.282  32.917 1.00 51.23 ? 31  HIS A CG    1 
ATOM   728  N ND1   . HIS C 3 24  ? 32.291 15.463  32.013 1.00 52.14 ? 31  HIS A ND1   1 
ATOM   729  C CD2   . HIS C 3 24  ? 30.135 15.152  32.183 1.00 50.74 ? 31  HIS A CD2   1 
ATOM   730  C CE1   . HIS C 3 24  ? 31.803 15.439  30.787 1.00 47.42 ? 31  HIS A CE1   1 
ATOM   731  N NE2   . HIS C 3 24  ? 30.499 15.250  30.861 1.00 50.76 ? 31  HIS A NE2   1 
ATOM   732  N N     . GLN C 3 25  ? 32.788 13.706  37.008 1.00 44.24 ? 32  GLN A N     1 
ATOM   733  C CA    . GLN C 3 25  ? 32.981 13.760  38.442 1.00 47.27 ? 32  GLN A CA    1 
ATOM   734  C C     . GLN C 3 25  ? 32.635 15.154  38.971 1.00 47.59 ? 32  GLN A C     1 
ATOM   735  O O     . GLN C 3 25  ? 32.870 16.149  38.298 1.00 49.65 ? 32  GLN A O     1 
ATOM   736  C CB    . GLN C 3 25  ? 34.436 13.443  38.741 1.00 49.57 ? 32  GLN A CB    1 
ATOM   737  C CG    . GLN C 3 25  ? 34.659 12.283  39.628 1.00 54.59 ? 32  GLN A CG    1 
ATOM   738  C CD    . GLN C 3 25  ? 35.241 12.697  40.949 1.00 61.05 ? 32  GLN A CD    1 
ATOM   739  O OE1   . GLN C 3 25  ? 34.672 13.546  41.641 1.00 64.02 ? 32  GLN A OE1   1 
ATOM   740  N NE2   . GLN C 3 25  ? 36.381 12.102  41.319 1.00 59.65 ? 32  GLN A NE2   1 
ATOM   741  N N     . GLY C 3 26  ? 32.063 15.229  40.164 1.00 46.85 ? 33  GLY A N     1 
ATOM   742  C CA    . GLY C 3 26  ? 31.761 16.526  40.741 1.00 52.61 ? 33  GLY A CA    1 
ATOM   743  C C     . GLY C 3 26  ? 30.552 17.331  40.293 1.00 57.12 ? 33  GLY A C     1 
ATOM   744  O O     . GLY C 3 26  ? 30.213 18.342  40.915 1.00 55.68 ? 33  GLY A O     1 
ATOM   745  N N     . GLU C 3 27  ? 29.889 16.914  39.225 1.00 58.32 ? 34  GLU A N     1 
ATOM   746  C CA    . GLU C 3 27  ? 28.736 17.660  38.783 1.00 56.55 ? 34  GLU A CA    1 
ATOM   747  C C     . GLU C 3 27  ? 27.474 17.257  39.530 1.00 54.98 ? 34  GLU A C     1 
ATOM   748  O O     . GLU C 3 27  ? 27.398 16.188  40.130 1.00 53.91 ? 34  GLU A O     1 
ATOM   749  C CB    . GLU C 3 27  ? 28.540 17.478  37.289 1.00 63.40 ? 34  GLU A CB    1 
ATOM   750  C CG    . GLU C 3 27  ? 29.752 17.824  36.477 1.00 71.21 ? 34  GLU A CG    1 
ATOM   751  C CD    . GLU C 3 27  ? 29.405 18.168  35.043 1.00 79.30 ? 34  GLU A CD    1 
ATOM   752  O OE1   . GLU C 3 27  ? 28.574 17.451  34.427 1.00 80.15 ? 34  GLU A OE1   1 
ATOM   753  O OE2   . GLU C 3 27  ? 29.981 19.158  34.535 1.00 81.84 ? 34  GLU A OE2   1 
ATOM   754  N N     . LYS C 3 28  ? 26.482 18.134  39.485 1.00 55.81 ? 35  LYS A N     1 
ATOM   755  C CA    . LYS C 3 28  ? 25.218 17.902  40.151 1.00 55.97 ? 35  LYS A CA    1 
ATOM   756  C C     . LYS C 3 28  ? 24.593 16.671  39.526 1.00 55.62 ? 35  LYS A C     1 
ATOM   757  O O     . LYS C 3 28  ? 24.456 16.580  38.310 1.00 54.81 ? 35  LYS A O     1 
ATOM   758  C CB    . LYS C 3 28  ? 24.307 19.120  39.963 1.00 59.32 ? 35  LYS A CB    1 
ATOM   759  C CG    . LYS C 3 28  ? 23.158 19.253  40.960 1.00 68.51 ? 35  LYS A CG    1 
ATOM   760  C CD    . LYS C 3 28  ? 22.196 20.378  40.533 1.00 75.49 ? 35  LYS A CD    1 
ATOM   761  C CE    . LYS C 3 28  ? 21.099 20.670  41.570 1.00 77.90 ? 35  LYS A CE    1 
ATOM   762  N NZ    . LYS C 3 28  ? 20.226 21.823  41.151 1.00 78.41 ? 35  LYS A NZ    1 
ATOM   763  N N     . ALA C 3 29  ? 24.228 15.711  40.364 1.00 56.23 ? 36  ALA A N     1 
ATOM   764  C CA    . ALA C 3 29  ? 23.604 14.489  39.880 1.00 53.60 ? 36  ALA A CA    1 
ATOM   765  C C     . ALA C 3 29  ? 22.074 14.594  39.971 1.00 51.23 ? 36  ALA A C     1 
ATOM   766  O O     . ALA C 3 29  ? 21.531 14.896  41.031 1.00 49.55 ? 36  ALA A O     1 
ATOM   767  C CB    . ALA C 3 29  ? 24.111 13.317  40.697 1.00 51.02 ? 36  ALA A CB    1 
ATOM   768  N N     . GLU C 3 30  ? 21.384 14.354  38.860 1.00 51.45 ? 37  GLU A N     1 
ATOM   769  C CA    . GLU C 3 30  ? 19.921 14.432  38.829 1.00 50.06 ? 37  GLU A CA    1 
ATOM   770  C C     . GLU C 3 30  ? 19.360 13.380  37.897 1.00 47.49 ? 37  GLU A C     1 
ATOM   771  O O     . GLU C 3 30  ? 18.153 13.269  37.725 1.00 46.14 ? 37  GLU A O     1 
ATOM   772  C CB    . GLU C 3 30  ? 19.473 15.795  38.314 1.00 54.93 ? 37  GLU A CB    1 
ATOM   773  C CG    . GLU C 3 30  ? 20.138 16.983  38.989 1.00 69.92 ? 37  GLU A CG    1 
ATOM   774  C CD    . GLU C 3 30  ? 20.030 18.263  38.163 1.00 76.43 ? 37  GLU A CD    1 
ATOM   775  O OE1   . GLU C 3 30  ? 18.898 18.763  38.001 1.00 81.26 ? 37  GLU A OE1   1 
ATOM   776  O OE2   . GLU C 3 30  ? 21.071 18.767  37.671 1.00 76.71 ? 37  GLU A OE2   1 
ATOM   777  N N     . THR C 3 31  ? 20.245 12.598  37.295 1.00 45.62 ? 38  THR A N     1 
ATOM   778  C CA    . THR C 3 31  ? 19.832 11.582  36.341 1.00 44.05 ? 38  THR A CA    1 
ATOM   779  C C     . THR C 3 31  ? 20.282 10.175  36.695 1.00 43.59 ? 38  THR A C     1 
ATOM   780  O O     . THR C 3 31  ? 21.293 9.992   37.340 1.00 50.60 ? 38  THR A O     1 
ATOM   781  C CB    . THR C 3 31  ? 20.395 11.936  34.976 1.00 43.30 ? 38  THR A CB    1 
ATOM   782  O OG1   . THR C 3 31  ? 19.834 13.177  34.553 1.00 43.94 ? 38  THR A OG1   1 
ATOM   783  C CG2   . THR C 3 31  ? 20.098 10.853  33.959 1.00 43.31 ? 38  THR A CG2   1 
ATOM   784  N N     . LEU C 3 32  ? 19.532 9.177   36.262 1.00 37.33 ? 39  LEU A N     1 
ATOM   785  C CA    . LEU C 3 32  ? 19.914 7.802   36.524 1.00 38.88 ? 39  LEU A CA    1 
ATOM   786  C C     . LEU C 3 32  ? 20.183 7.123   35.179 1.00 40.68 ? 39  LEU A C     1 
ATOM   787  O O     . LEU C 3 32  ? 19.525 7.415   34.192 1.00 44.50 ? 39  LEU A O     1 
ATOM   788  C CB    . LEU C 3 32  ? 18.791 7.083   37.259 1.00 38.62 ? 39  LEU A CB    1 
ATOM   789  C CG    . LEU C 3 32  ? 19.032 5.613   37.577 1.00 38.82 ? 39  LEU A CG    1 
ATOM   790  C CD1   . LEU C 3 32  ? 20.053 5.473   38.683 1.00 40.20 ? 39  LEU A CD1   1 
ATOM   791  C CD2   . LEU C 3 32  ? 17.734 4.990   37.983 1.00 37.26 ? 39  LEU A CD2   1 
ATOM   792  N N     . TYR C 3 33  ? 21.148 6.223   35.113 1.00 38.95 ? 40  TYR A N     1 
ATOM   793  C CA    . TYR C 3 33  ? 21.407 5.582   33.836 1.00 41.90 ? 40  TYR A CA    1 
ATOM   794  C C     . TYR C 3 33  ? 21.259 4.087   33.949 1.00 44.16 ? 40  TYR A C     1 
ATOM   795  O O     . TYR C 3 33  ? 21.403 3.518   35.014 1.00 47.34 ? 40  TYR A O     1 
ATOM   796  C CB    . TYR C 3 33  ? 22.815 5.895   33.326 1.00 38.94 ? 40  TYR A CB    1 
ATOM   797  C CG    . TYR C 3 33  ? 23.071 7.353   33.096 1.00 39.82 ? 40  TYR A CG    1 
ATOM   798  C CD1   . TYR C 3 33  ? 23.160 8.231   34.166 1.00 42.96 ? 40  TYR A CD1   1 
ATOM   799  C CD2   . TYR C 3 33  ? 23.291 7.848   31.816 1.00 38.82 ? 40  TYR A CD2   1 
ATOM   800  C CE1   . TYR C 3 33  ? 23.466 9.557   33.974 1.00 45.20 ? 40  TYR A CE1   1 
ATOM   801  C CE2   . TYR C 3 33  ? 23.607 9.170   31.612 1.00 37.94 ? 40  TYR A CE2   1 
ATOM   802  C CZ    . TYR C 3 33  ? 23.693 10.025  32.690 1.00 46.03 ? 40  TYR A CZ    1 
ATOM   803  O OH    . TYR C 3 33  ? 23.995 11.364  32.510 1.00 52.62 ? 40  TYR A OH    1 
ATOM   804  N N     . TYR C 3 34  ? 20.978 3.454   32.825 1.00 44.42 ? 41  TYR A N     1 
ATOM   805  C CA    . TYR C 3 34  ? 20.821 2.020   32.781 1.00 44.13 ? 41  TYR A CA    1 
ATOM   806  C C     . TYR C 3 34  ? 21.437 1.604   31.465 1.00 43.25 ? 41  TYR A C     1 
ATOM   807  O O     . TYR C 3 34  ? 20.999 2.029   30.407 1.00 45.26 ? 41  TYR A O     1 
ATOM   808  C CB    . TYR C 3 34  ? 19.339 1.645   32.841 1.00 45.76 ? 41  TYR A CB    1 
ATOM   809  C CG    . TYR C 3 34  ? 19.127 0.163   32.773 1.00 52.13 ? 41  TYR A CG    1 
ATOM   810  C CD1   . TYR C 3 34  ? 19.126 -0.503  31.550 1.00 53.90 ? 41  TYR A CD1   1 
ATOM   811  C CD2   . TYR C 3 34  ? 19.013 -0.596  33.935 1.00 55.14 ? 41  TYR A CD2   1 
ATOM   812  C CE1   . TYR C 3 34  ? 19.022 -1.877  31.488 1.00 52.97 ? 41  TYR A CE1   1 
ATOM   813  C CE2   . TYR C 3 34  ? 18.915 -1.977  33.876 1.00 51.16 ? 41  TYR A CE2   1 
ATOM   814  C CZ    . TYR C 3 34  ? 18.922 -2.598  32.650 1.00 49.51 ? 41  TYR A CZ    1 
ATOM   815  O OH    . TYR C 3 34  ? 18.843 -3.951  32.584 1.00 57.06 ? 41  TYR A OH    1 
ATOM   816  N N     . ILE C 3 35  ? 22.478 0.794   31.524 1.00 41.96 ? 42  ILE A N     1 
ATOM   817  C CA    . ILE C 3 35  ? 23.129 0.393   30.306 1.00 41.66 ? 42  ILE A CA    1 
ATOM   818  C C     . ILE C 3 35  ? 22.303 -0.658  29.604 1.00 44.94 ? 42  ILE A C     1 
ATOM   819  O O     . ILE C 3 35  ? 22.180 -1.778  30.076 1.00 46.72 ? 42  ILE A O     1 
ATOM   820  C CB    . ILE C 3 35  ? 24.518 -0.181  30.552 1.00 39.34 ? 42  ILE A CB    1 
ATOM   821  C CG1   . ILE C 3 35  ? 25.377 0.819   31.327 1.00 35.43 ? 42  ILE A CG1   1 
ATOM   822  C CG2   . ILE C 3 35  ? 25.150 -0.527  29.203 1.00 40.92 ? 42  ILE A CG2   1 
ATOM   823  C CD1   . ILE C 3 35  ? 26.862 0.444   31.412 1.00 26.20 ? 42  ILE A CD1   1 
ATOM   824  N N     . VAL C 3 36  ? 21.741 -0.272  28.468 1.00 46.41 ? 43  VAL A N     1 
ATOM   825  C CA    . VAL C 3 36  ? 20.922 -1.143  27.644 1.00 44.06 ? 43  VAL A CA    1 
ATOM   826  C C     . VAL C 3 36  ? 21.818 -2.008  26.773 1.00 47.19 ? 43  VAL A C     1 
ATOM   827  O O     . VAL C 3 36  ? 21.484 -3.155  26.481 1.00 48.46 ? 43  VAL A O     1 
ATOM   828  C CB    . VAL C 3 36  ? 19.987 -0.312  26.746 1.00 39.63 ? 43  VAL A CB    1 
ATOM   829  C CG1   . VAL C 3 36  ? 19.283 -1.197  25.744 1.00 28.78 ? 43  VAL A CG1   1 
ATOM   830  C CG2   . VAL C 3 36  ? 18.996 0.427   27.616 1.00 38.90 ? 43  VAL A CG2   1 
ATOM   831  N N     . LYS C 3 37  ? 22.955 -1.454  26.362 1.00 46.38 ? 44  LYS A N     1 
ATOM   832  C CA    . LYS C 3 37  ? 23.895 -2.179  25.524 1.00 46.24 ? 44  LYS A CA    1 
ATOM   833  C C     . LYS C 3 37  ? 25.227 -1.440  25.548 1.00 47.34 ? 44  LYS A C     1 
ATOM   834  O O     . LYS C 3 37  ? 25.236 -0.211  25.537 1.00 47.19 ? 44  LYS A O     1 
ATOM   835  C CB    . LYS C 3 37  ? 23.371 -2.261  24.095 1.00 44.64 ? 44  LYS A CB    1 
ATOM   836  C CG    . LYS C 3 37  ? 24.385 -2.820  23.163 1.00 50.06 ? 44  LYS A CG    1 
ATOM   837  C CD    . LYS C 3 37  ? 24.073 -2.541  21.721 1.00 56.65 ? 44  LYS A CD    1 
ATOM   838  C CE    . LYS C 3 37  ? 25.097 -3.252  20.819 1.00 63.53 ? 44  LYS A CE    1 
ATOM   839  N NZ    . LYS C 3 37  ? 26.513 -2.857  21.138 1.00 70.10 ? 44  LYS A NZ    1 
ATOM   840  N N     . GLY C 3 38  ? 26.334 -2.194  25.590 1.00 46.41 ? 45  GLY A N     1 
ATOM   841  C CA    . GLY C 3 38  ? 27.673 -1.619  25.638 1.00 39.40 ? 45  GLY A CA    1 
ATOM   842  C C     . GLY C 3 38  ? 28.362 -1.725  27.000 1.00 42.54 ? 45  GLY A C     1 
ATOM   843  O O     . GLY C 3 38  ? 27.777 -2.147  27.997 1.00 44.93 ? 45  GLY A O     1 
ATOM   844  N N     . SER C 3 39  ? 29.628 -1.325  27.044 1.00 46.14 ? 46  SER A N     1 
ATOM   845  C CA    . SER C 3 39  ? 30.431 -1.357  28.267 1.00 45.51 ? 46  SER A CA    1 
ATOM   846  C C     . SER C 3 39  ? 31.040 -0.006  28.590 1.00 45.62 ? 46  SER A C     1 
ATOM   847  O O     . SER C 3 39  ? 31.486 0.712   27.693 1.00 49.96 ? 46  SER A O     1 
ATOM   848  C CB    . SER C 3 39  ? 31.564 -2.366  28.123 1.00 47.01 ? 46  SER A CB    1 
ATOM   849  O OG    . SER C 3 39  ? 31.044 -3.680  28.148 1.00 60.45 ? 46  SER A OG    1 
ATOM   850  N N     . VAL C 3 40  ? 31.060 0.340   29.872 1.00 43.26 ? 47  VAL A N     1 
ATOM   851  C CA    . VAL C 3 40  ? 31.647 1.595   30.302 1.00 42.60 ? 47  VAL A CA    1 
ATOM   852  C C     . VAL C 3 40  ? 32.687 1.324   31.382 1.00 45.10 ? 47  VAL A C     1 
ATOM   853  O O     . VAL C 3 40  ? 32.835 0.205   31.863 1.00 44.27 ? 47  VAL A O     1 
ATOM   854  C CB    . VAL C 3 40  ? 30.603 2.571   30.882 1.00 39.95 ? 47  VAL A CB    1 
ATOM   855  C CG1   . VAL C 3 40  ? 29.358 2.585   30.021 1.00 38.55 ? 47  VAL A CG1   1 
ATOM   856  C CG2   . VAL C 3 40  ? 30.278 2.196   32.306 1.00 37.23 ? 47  VAL A CG2   1 
ATOM   857  N N     . ALA C 3 41  ? 33.413 2.370   31.750 1.00 45.46 ? 48  ALA A N     1 
ATOM   858  C CA    . ALA C 3 41  ? 34.427 2.277   32.776 1.00 40.67 ? 48  ALA A CA    1 
ATOM   859  C C     . ALA C 3 41  ? 34.165 3.401   33.767 1.00 41.97 ? 48  ALA A C     1 
ATOM   860  O O     . ALA C 3 41  ? 33.843 4.531   33.384 1.00 44.53 ? 48  ALA A O     1 
ATOM   861  C CB    . ALA C 3 41  ? 35.796 2.433   32.167 1.00 34.98 ? 48  ALA A CB    1 
ATOM   862  N N     . VAL C 3 42  ? 34.280 3.065   35.044 1.00 37.38 ? 49  VAL A N     1 
ATOM   863  C CA    . VAL C 3 42  ? 34.112 4.006   36.133 1.00 31.10 ? 49  VAL A CA    1 
ATOM   864  C C     . VAL C 3 42  ? 35.507 4.355   36.609 1.00 35.24 ? 49  VAL A C     1 
ATOM   865  O O     . VAL C 3 42  ? 36.230 3.477   37.068 1.00 35.92 ? 49  VAL A O     1 
ATOM   866  C CB    . VAL C 3 42  ? 33.379 3.353   37.316 1.00 32.19 ? 49  VAL A CB    1 
ATOM   867  C CG1   . VAL C 3 42  ? 33.455 4.242   38.533 1.00 27.54 ? 49  VAL A CG1   1 
ATOM   868  C CG2   . VAL C 3 42  ? 31.927 3.062   36.950 1.00 32.57 ? 49  VAL A CG2   1 
ATOM   869  N N     . LEU C 3 43  ? 35.910 5.615   36.505 1.00 36.92 ? 50  LEU A N     1 
ATOM   870  C CA    . LEU C 3 43  ? 37.238 5.965   36.988 1.00 39.82 ? 50  LEU A CA    1 
ATOM   871  C C     . LEU C 3 43  ? 37.312 7.199   37.896 1.00 41.20 ? 50  LEU A C     1 
ATOM   872  O O     . LEU C 3 43  ? 36.453 8.076   37.845 1.00 43.04 ? 50  LEU A O     1 
ATOM   873  C CB    . LEU C 3 43  ? 38.188 6.120   35.800 1.00 45.22 ? 50  LEU A CB    1 
ATOM   874  C CG    . LEU C 3 43  ? 37.713 6.997   34.644 1.00 50.27 ? 50  LEU A CG    1 
ATOM   875  C CD1   . LEU C 3 43  ? 38.666 8.181   34.481 1.00 52.99 ? 50  LEU A CD1   1 
ATOM   876  C CD2   . LEU C 3 43  ? 37.646 6.177   33.360 1.00 50.62 ? 50  LEU A CD2   1 
ATOM   877  N N     . ILE C 3 44  ? 38.329 7.236   38.755 1.00 39.90 ? 51  ILE A N     1 
ATOM   878  C CA    . ILE C 3 44  ? 38.571 8.366   39.651 1.00 38.98 ? 51  ILE A CA    1 
ATOM   879  C C     . ILE C 3 44  ? 39.960 8.896   39.309 1.00 39.06 ? 51  ILE A C     1 
ATOM   880  O O     . ILE C 3 44  ? 40.706 8.215   38.624 1.00 38.87 ? 51  ILE A O     1 
ATOM   881  C CB    . ILE C 3 44  ? 38.540 7.955   41.116 1.00 37.15 ? 51  ILE A CB    1 
ATOM   882  C CG1   . ILE C 3 44  ? 39.629 6.912   41.370 1.00 37.52 ? 51  ILE A CG1   1 
ATOM   883  C CG2   . ILE C 3 44  ? 37.144 7.498   41.476 1.00 36.57 ? 51  ILE A CG2   1 
ATOM   884  C CD1   . ILE C 3 44  ? 39.713 6.412   42.786 1.00 38.60 ? 51  ILE A CD1   1 
ATOM   885  N N     . LYS C 3 45  ? 40.310 10.100  39.763 1.00 41.33 ? 52  LYS A N     1 
ATOM   886  C CA    . LYS C 3 45  ? 41.621 10.661  39.418 1.00 49.53 ? 52  LYS A CA    1 
ATOM   887  C C     . LYS C 3 45  ? 42.409 11.289  40.560 1.00 55.56 ? 52  LYS A C     1 
ATOM   888  O O     . LYS C 3 45  ? 41.862 11.605  41.606 1.00 60.17 ? 52  LYS A O     1 
ATOM   889  C CB    . LYS C 3 45  ? 41.486 11.725  38.311 1.00 42.33 ? 52  LYS A CB    1 
ATOM   890  C CG    . LYS C 3 45  ? 41.259 11.194  36.922 1.00 40.61 ? 52  LYS A CG    1 
ATOM   891  C CD    . LYS C 3 45  ? 40.733 12.277  35.988 1.00 41.78 ? 52  LYS A CD    1 
ATOM   892  C CE    . LYS C 3 45  ? 40.105 11.621  34.770 1.00 48.96 ? 52  LYS A CE    1 
ATOM   893  N NZ    . LYS C 3 45  ? 39.541 12.548  33.770 1.00 52.76 ? 52  LYS A NZ    1 
ATOM   894  N N     . ASP C 3 46  ? 43.707 11.454  40.342 1.00 57.82 ? 53  ASP A N     1 
ATOM   895  C CA    . ASP C 3 46  ? 44.553 12.095  41.322 1.00 62.26 ? 53  ASP A CA    1 
ATOM   896  C C     . ASP C 3 46  ? 44.693 13.498  40.754 1.00 64.91 ? 53  ASP A C     1 
ATOM   897  O O     . ASP C 3 46  ? 44.251 13.752  39.627 1.00 64.18 ? 53  ASP A O     1 
ATOM   898  C CB    . ASP C 3 46  ? 45.917 11.381  41.444 1.00 66.73 ? 53  ASP A CB    1 
ATOM   899  C CG    . ASP C 3 46  ? 46.829 11.625  40.258 1.00 68.55 ? 53  ASP A CG    1 
ATOM   900  O OD1   . ASP C 3 46  ? 46.321 11.806  39.136 1.00 70.75 ? 53  ASP A OD1   1 
ATOM   901  O OD2   . ASP C 3 46  ? 48.061 11.616  40.445 1.00 66.51 ? 53  ASP A OD2   1 
ATOM   902  N N     . GLU C 3 47  ? 45.277 14.403  41.533 1.00 68.09 ? 54  GLU A N     1 
ATOM   903  C CA    . GLU C 3 47  ? 45.451 15.791  41.120 1.00 70.14 ? 54  GLU A CA    1 
ATOM   904  C C     . GLU C 3 47  ? 46.202 15.910  39.787 1.00 69.83 ? 54  GLU A C     1 
ATOM   905  O O     . GLU C 3 47  ? 45.927 16.794  38.970 1.00 69.92 ? 54  GLU A O     1 
ATOM   906  C CB    . GLU C 3 47  ? 46.194 16.555  42.216 1.00 72.51 ? 54  GLU A CB    1 
ATOM   907  C CG    . GLU C 3 47  ? 47.671 16.189  42.353 1.00 81.86 ? 54  GLU A CG    1 
ATOM   908  C CD    . GLU C 3 47  ? 47.916 14.773  42.877 1.00 85.22 ? 54  GLU A CD    1 
ATOM   909  O OE1   . GLU C 3 47  ? 49.100 14.336  42.886 1.00 84.49 ? 54  GLU A OE1   1 
ATOM   910  O OE2   . GLU C 3 47  ? 46.933 14.109  43.285 1.00 85.22 ? 54  GLU A OE2   1 
ATOM   911  N N     . GLU C 3 48  ? 47.139 15.000  39.565 1.00 68.36 ? 55  GLU A N     1 
ATOM   912  C CA    . GLU C 3 48  ? 47.927 15.000  38.350 1.00 66.52 ? 55  GLU A CA    1 
ATOM   913  C C     . GLU C 3 48  ? 47.137 14.580  37.121 1.00 64.56 ? 55  GLU A C     1 
ATOM   914  O O     . GLU C 3 48  ? 47.368 15.092  36.037 1.00 67.58 ? 55  GLU A O     1 
ATOM   915  C CB    . GLU C 3 48  ? 49.107 14.066  38.519 1.00 69.69 ? 55  GLU A CB    1 
ATOM   916  C CG    . GLU C 3 48  ? 49.848 14.241  39.820 1.00 75.60 ? 55  GLU A CG    1 
ATOM   917  C CD    . GLU C 3 48  ? 51.093 13.378  39.882 1.00 82.32 ? 55  GLU A CD    1 
ATOM   918  O OE1   . GLU C 3 48  ? 51.991 13.574  39.026 1.00 82.88 ? 55  GLU A OE1   1 
ATOM   919  O OE2   . GLU C 3 48  ? 51.172 12.505  40.782 1.00 85.22 ? 55  GLU A OE2   1 
ATOM   920  N N     . GLY C 3 49  ? 46.211 13.644  37.281 1.00 63.46 ? 56  GLY A N     1 
ATOM   921  C CA    . GLY C 3 49  ? 45.436 13.176  36.141 1.00 59.72 ? 56  GLY A CA    1 
ATOM   922  C C     . GLY C 3 49  ? 45.518 11.661  35.969 1.00 56.67 ? 56  GLY A C     1 
ATOM   923  O O     . GLY C 3 49  ? 44.869 11.067  35.100 1.00 50.39 ? 56  GLY A O     1 
ATOM   924  N N     . LYS C 3 50  ? 46.349 11.026  36.780 1.00 52.75 ? 57  LYS A N     1 
ATOM   925  C CA    . LYS C 3 50  ? 46.446 9.589   36.728 1.00 55.29 ? 57  LYS A CA    1 
ATOM   926  C C     . LYS C 3 50  ? 45.063 9.013   37.088 1.00 55.91 ? 57  LYS A C     1 
ATOM   927  O O     . LYS C 3 50  ? 44.450 9.397   38.096 1.00 55.49 ? 57  LYS A O     1 
ATOM   928  C CB    . LYS C 3 50  ? 47.537 9.115   37.691 1.00 56.38 ? 57  LYS A CB    1 
ATOM   929  C CG    . LYS C 3 50  ? 48.926 9.379   37.134 1.00 61.65 ? 57  LYS A CG    1 
ATOM   930  C CD    . LYS C 3 50  ? 50.032 8.727   37.939 1.00 64.85 ? 57  LYS A CD    1 
ATOM   931  C CE    . LYS C 3 50  ? 50.325 9.490   39.226 1.00 70.20 ? 57  LYS A CE    1 
ATOM   932  N NZ    . LYS C 3 50  ? 51.436 8.872   40.021 1.00 71.97 ? 57  LYS A NZ    1 
ATOM   933  N N     . GLU C 3 51  ? 44.565 8.101   36.255 1.00 53.95 ? 58  GLU A N     1 
ATOM   934  C CA    . GLU C 3 51  ? 43.246 7.525   36.478 1.00 51.26 ? 58  GLU A CA    1 
ATOM   935  C C     . GLU C 3 51  ? 43.280 6.194   37.153 1.00 47.61 ? 58  GLU A C     1 
ATOM   936  O O     . GLU C 3 51  ? 44.258 5.486   37.040 1.00 48.05 ? 58  GLU A O     1 
ATOM   937  C CB    . GLU C 3 51  ? 42.516 7.380   35.167 1.00 52.35 ? 58  GLU A CB    1 
ATOM   938  C CG    . GLU C 3 51  ? 42.473 8.646   34.414 1.00 51.12 ? 58  GLU A CG    1 
ATOM   939  C CD    . GLU C 3 51  ? 41.890 8.426   33.081 1.00 52.02 ? 58  GLU A CD    1 
ATOM   940  O OE1   . GLU C 3 51  ? 41.954 7.264   32.616 1.00 54.73 ? 58  GLU A OE1   1 
ATOM   941  O OE2   . GLU C 3 51  ? 41.383 9.407   32.506 1.00 49.25 ? 58  GLU A OE2   1 
ATOM   942  N N     . MET C 3 52  ? 42.194 5.865   37.845 1.00 45.94 ? 59  MET A N     1 
ATOM   943  C CA    . MET C 3 52  ? 42.078 4.615   38.572 1.00 49.31 ? 59  MET A CA    1 
ATOM   944  C C     . MET C 3 52  ? 40.713 4.000   38.328 1.00 49.18 ? 59  MET A C     1 
ATOM   945  O O     . MET C 3 52  ? 39.718 4.463   38.867 1.00 52.73 ? 59  MET A O     1 
ATOM   946  C CB    . MET C 3 52  ? 42.263 4.864   40.070 1.00 51.79 ? 59  MET A CB    1 
ATOM   947  C CG    . MET C 3 52  ? 42.037 3.635   40.947 1.00 56.46 ? 59  MET A CG    1 
ATOM   948  S SD    . MET C 3 52  ? 43.165 2.294   40.522 1.00 60.94 ? 59  MET A SD    1 
ATOM   949  C CE    . MET C 3 52  ? 43.043 1.254   41.969 1.00 59.20 ? 59  MET A CE    1 
ATOM   950  N N     . ILE C 3 53  ? 40.660 2.948   37.526 1.00 47.07 ? 60  ILE A N     1 
ATOM   951  C CA    . ILE C 3 53  ? 39.381 2.306   37.241 1.00 44.46 ? 60  ILE A CA    1 
ATOM   952  C C     . ILE C 3 53  ? 38.892 1.576   38.485 1.00 43.94 ? 60  ILE A C     1 
ATOM   953  O O     . ILE C 3 53  ? 39.641 0.831   39.095 1.00 48.52 ? 60  ILE A O     1 
ATOM   954  C CB    . ILE C 3 53  ? 39.522 1.343   36.042 1.00 39.19 ? 60  ILE A CB    1 
ATOM   955  C CG1   . ILE C 3 53  ? 40.149 2.115   34.879 1.00 33.79 ? 60  ILE A CG1   1 
ATOM   956  C CG2   . ILE C 3 53  ? 38.164 0.796   35.634 1.00 37.78 ? 60  ILE A CG2   1 
ATOM   957  C CD1   . ILE C 3 53  ? 40.320 1.363   33.633 1.00 32.78 ? 60  ILE A CD1   1 
ATOM   958  N N     . LEU C 3 54  ? 37.641 1.819   38.861 1.00 40.10 ? 61  LEU A N     1 
ATOM   959  C CA    . LEU C 3 54  ? 37.036 1.226   40.047 1.00 34.81 ? 61  LEU A CA    1 
ATOM   960  C C     . LEU C 3 54  ? 36.152 0.096   39.642 1.00 35.20 ? 61  LEU A C     1 
ATOM   961  O O     . LEU C 3 54  ? 35.795 -0.766  40.452 1.00 33.01 ? 61  LEU A O     1 
ATOM   962  C CB    . LEU C 3 54  ? 36.152 2.239   40.756 1.00 34.93 ? 61  LEU A CB    1 
ATOM   963  C CG    . LEU C 3 54  ? 36.719 3.485   41.409 1.00 33.20 ? 61  LEU A CG    1 
ATOM   964  C CD1   . LEU C 3 54  ? 35.557 4.380   41.714 1.00 35.66 ? 61  LEU A CD1   1 
ATOM   965  C CD2   . LEU C 3 54  ? 37.484 3.148   42.672 1.00 32.01 ? 61  LEU A CD2   1 
ATOM   966  N N     . SER C 3 55  ? 35.755 0.133   38.381 1.00 34.66 ? 62  SER A N     1 
ATOM   967  C CA    . SER C 3 55  ? 34.880 -0.882  37.862 1.00 34.08 ? 62  SER A CA    1 
ATOM   968  C C     . SER C 3 55  ? 34.619 -0.672  36.402 1.00 35.11 ? 62  SER A C     1 
ATOM   969  O O     . SER C 3 55  ? 34.918 0.372   35.837 1.00 36.36 ? 62  SER A O     1 
ATOM   970  C CB    . SER C 3 55  ? 33.548 -0.842  38.613 1.00 36.71 ? 62  SER A CB    1 
ATOM   971  O OG    . SER C 3 55  ? 32.599 -1.729  38.042 1.00 38.91 ? 62  SER A OG    1 
ATOM   972  N N     . TYR C 3 56  ? 34.084 -1.720  35.792 1.00 36.44 ? 63  TYR A N     1 
ATOM   973  C CA    . TYR C 3 56  ? 33.655 -1.706  34.405 1.00 34.34 ? 63  TYR A CA    1 
ATOM   974  C C     . TYR C 3 56  ? 32.153 -1.977  34.623 1.00 36.98 ? 63  TYR A C     1 
ATOM   975  O O     . TYR C 3 56  ? 31.778 -2.514  35.679 1.00 34.28 ? 63  TYR A O     1 
ATOM   976  C CB    . TYR C 3 56  ? 34.277 -2.861  33.624 1.00 31.21 ? 63  TYR A CB    1 
ATOM   977  C CG    . TYR C 3 56  ? 35.672 -2.652  33.142 1.00 35.27 ? 63  TYR A CG    1 
ATOM   978  C CD1   . TYR C 3 56  ? 36.029 -1.503  32.440 1.00 40.93 ? 63  TYR A CD1   1 
ATOM   979  C CD2   . TYR C 3 56  ? 36.655 -3.595  33.395 1.00 40.26 ? 63  TYR A CD2   1 
ATOM   980  C CE1   . TYR C 3 56  ? 37.363 -1.292  32.004 1.00 41.35 ? 63  TYR A CE1   1 
ATOM   981  C CE2   . TYR C 3 56  ? 37.980 -3.399  32.967 1.00 43.49 ? 63  TYR A CE2   1 
ATOM   982  C CZ    . TYR C 3 56  ? 38.323 -2.245  32.280 1.00 42.96 ? 63  TYR A CZ    1 
ATOM   983  O OH    . TYR C 3 56  ? 39.627 -2.045  31.920 1.00 39.01 ? 63  TYR A OH    1 
ATOM   984  N N     . LEU C 3 57  ? 31.294 -1.586  33.683 1.00 35.99 ? 64  LEU A N     1 
ATOM   985  C CA    . LEU C 3 57  ? 29.866 -1.861  33.833 1.00 39.99 ? 64  LEU A CA    1 
ATOM   986  C C     . LEU C 3 57  ? 29.294 -2.235  32.488 1.00 41.72 ? 64  LEU A C     1 
ATOM   987  O O     . LEU C 3 57  ? 29.753 -1.749  31.459 1.00 46.28 ? 64  LEU A O     1 
ATOM   988  C CB    . LEU C 3 57  ? 29.128 -0.682  34.475 1.00 38.05 ? 64  LEU A CB    1 
ATOM   989  C CG    . LEU C 3 57  ? 29.643 -0.446  35.909 1.00 44.61 ? 64  LEU A CG    1 
ATOM   990  C CD1   . LEU C 3 57  ? 29.152 0.896   36.460 1.00 44.68 ? 64  LEU A CD1   1 
ATOM   991  C CD2   . LEU C 3 57  ? 29.211 -1.609  36.808 1.00 38.30 ? 64  LEU A CD2   1 
ATOM   992  N N     . ASN C 3 58  ? 28.295 -3.116  32.500 1.00 44.18 ? 65  ASN A N     1 
ATOM   993  C CA    . ASN C 3 58  ? 27.714 -3.636  31.272 1.00 41.97 ? 65  ASN A CA    1 
ATOM   994  C C     . ASN C 3 58  ? 26.209 -3.607  31.168 1.00 44.22 ? 65  ASN A C     1 
ATOM   995  O O     . ASN C 3 58  ? 25.496 -3.024  32.001 1.00 41.39 ? 65  ASN A O     1 
ATOM   996  C CB    . ASN C 3 58  ? 28.192 -5.067  31.106 1.00 46.24 ? 65  ASN A CB    1 
ATOM   997  C CG    . ASN C 3 58  ? 29.678 -5.196  31.345 1.00 53.28 ? 65  ASN A CG    1 
ATOM   998  O OD1   . ASN C 3 58  ? 30.482 -4.837  30.478 1.00 57.77 ? 65  ASN A OD1   1 
ATOM   999  N ND2   . ASN C 3 58  ? 30.063 -5.672  32.538 1.00 51.89 ? 65  ASN A ND2   1 
ATOM   1000 N N     . GLN C 3 59  ? 25.722 -4.249  30.118 1.00 46.22 ? 66  GLN A N     1 
ATOM   1001 C CA    . GLN C 3 59  ? 24.306 -4.302  29.917 1.00 51.59 ? 66  GLN A CA    1 
ATOM   1002 C C     . GLN C 3 59  ? 23.716 -4.659  31.242 1.00 51.99 ? 66  GLN A C     1 
ATOM   1003 O O     . GLN C 3 59  ? 24.347 -5.310  32.067 1.00 56.72 ? 66  GLN A O     1 
ATOM   1004 C CB    . GLN C 3 59  ? 23.973 -5.345  28.879 1.00 60.67 ? 66  GLN A CB    1 
ATOM   1005 C CG    . GLN C 3 59  ? 24.449 -4.919  27.501 1.00 75.56 ? 66  GLN A CG    1 
ATOM   1006 C CD    . GLN C 3 59  ? 24.354 -6.021  26.477 1.00 78.64 ? 66  GLN A CD    1 
ATOM   1007 O OE1   . GLN C 3 59  ? 23.409 -6.825  26.498 1.00 79.75 ? 66  GLN A OE1   1 
ATOM   1008 N NE2   . GLN C 3 59  ? 25.327 -6.062  25.561 1.00 75.69 ? 66  GLN A NE2   1 
ATOM   1009 N N     . GLY C 3 60  ? 22.515 -4.185  31.480 1.00 52.47 ? 67  GLY A N     1 
ATOM   1010 C CA    . GLY C 3 60  ? 21.877 -4.505  32.727 1.00 50.45 ? 67  GLY A CA    1 
ATOM   1011 C C     . GLY C 3 60  ? 22.387 -3.753  33.922 1.00 50.84 ? 67  GLY A C     1 
ATOM   1012 O O     . GLY C 3 60  ? 21.909 -4.005  35.012 1.00 54.53 ? 67  GLY A O     1 
ATOM   1013 N N     . ASP C 3 61  ? 23.337 -2.838  33.768 1.00 49.78 ? 68  ASP A N     1 
ATOM   1014 C CA    . ASP C 3 61  ? 23.801 -2.112  34.954 1.00 45.73 ? 68  ASP A CA    1 
ATOM   1015 C C     . ASP C 3 61  ? 23.267 -0.696  35.066 1.00 42.53 ? 68  ASP A C     1 
ATOM   1016 O O     . ASP C 3 61  ? 23.113 -0.016  34.069 1.00 50.66 ? 68  ASP A O     1 
ATOM   1017 C CB    . ASP C 3 61  ? 25.328 -2.042  34.993 1.00 47.01 ? 68  ASP A CB    1 
ATOM   1018 C CG    . ASP C 3 61  ? 25.968 -3.366  35.297 1.00 49.80 ? 68  ASP A CG    1 
ATOM   1019 O OD1   . ASP C 3 61  ? 25.452 -4.100  36.170 1.00 56.19 ? 68  ASP A OD1   1 
ATOM   1020 O OD2   . ASP C 3 61  ? 27.006 -3.663  34.678 1.00 50.57 ? 68  ASP A OD2   1 
ATOM   1021 N N     . PHE C 3 62  ? 22.974 -0.246  36.274 1.00 39.31 ? 69  PHE A N     1 
ATOM   1022 C CA    . PHE C 3 62  ? 22.538 1.133   36.459 1.00 40.76 ? 69  PHE A CA    1 
ATOM   1023 C C     . PHE C 3 62  ? 23.810 1.956   36.680 1.00 42.56 ? 69  PHE A C     1 
ATOM   1024 O O     . PHE C 3 62  ? 24.817 1.428   37.162 1.00 43.52 ? 69  PHE A O     1 
ATOM   1025 C CB    . PHE C 3 62  ? 21.671 1.303   37.707 1.00 42.18 ? 69  PHE A CB    1 
ATOM   1026 C CG    . PHE C 3 62  ? 20.282 0.726   37.594 1.00 47.93 ? 69  PHE A CG    1 
ATOM   1027 C CD1   . PHE C 3 62  ? 20.002 -0.553  38.075 1.00 50.63 ? 69  PHE A CD1   1 
ATOM   1028 C CD2   . PHE C 3 62  ? 19.241 1.484   37.057 1.00 48.99 ? 69  PHE A CD2   1 
ATOM   1029 C CE1   . PHE C 3 62  ? 18.717 -1.060  38.029 1.00 54.51 ? 69  PHE A CE1   1 
ATOM   1030 C CE2   . PHE C 3 62  ? 17.954 0.993   37.001 1.00 47.75 ? 69  PHE A CE2   1 
ATOM   1031 C CZ    . PHE C 3 62  ? 17.686 -0.280  37.487 1.00 56.56 ? 69  PHE A CZ    1 
ATOM   1032 N N     . ILE C 3 63  ? 23.781 3.237   36.322 1.00 43.79 ? 70  ILE A N     1 
ATOM   1033 C CA    . ILE C 3 63  ? 24.934 4.121   36.544 1.00 43.68 ? 70  ILE A CA    1 
ATOM   1034 C C     . ILE C 3 63  ? 24.357 5.400   37.095 1.00 40.11 ? 70  ILE A C     1 
ATOM   1035 O O     . ILE C 3 63  ? 23.212 5.710   36.810 1.00 39.88 ? 70  ILE A O     1 
ATOM   1036 C CB    . ILE C 3 63  ? 25.715 4.486   35.247 1.00 46.70 ? 70  ILE A CB    1 
ATOM   1037 C CG1   . ILE C 3 63  ? 25.564 3.395   34.175 1.00 47.57 ? 70  ILE A CG1   1 
ATOM   1038 C CG2   . ILE C 3 63  ? 27.206 4.637   35.583 1.00 39.67 ? 70  ILE A CG2   1 
ATOM   1039 C CD1   . ILE C 3 63  ? 26.258 3.754   32.877 1.00 42.25 ? 70  ILE A CD1   1 
ATOM   1040 N N     . GLY C 3 64  ? 25.139 6.130   37.884 1.00 39.35 ? 71  GLY A N     1 
ATOM   1041 C CA    . GLY C 3 64  ? 24.667 7.374   38.466 1.00 38.94 ? 71  GLY A CA    1 
ATOM   1042 C C     . GLY C 3 64  ? 23.571 7.202   39.510 1.00 42.01 ? 71  GLY A C     1 
ATOM   1043 O O     . GLY C 3 64  ? 22.732 8.069   39.679 1.00 44.14 ? 71  GLY A O     1 
ATOM   1044 N N     . GLU C 3 65  ? 23.580 6.085   40.220 1.00 41.74 ? 72  GLU A N     1 
ATOM   1045 C CA    . GLU C 3 65  ? 22.579 5.803   41.238 1.00 42.08 ? 72  GLU A CA    1 
ATOM   1046 C C     . GLU C 3 65  ? 22.960 6.364   42.594 1.00 46.80 ? 72  GLU A C     1 
ATOM   1047 O O     . GLU C 3 65  ? 22.102 6.538   43.466 1.00 49.04 ? 72  GLU A O     1 
ATOM   1048 C CB    . GLU C 3 65  ? 22.403 4.291   41.407 1.00 39.98 ? 72  GLU A CB    1 
ATOM   1049 C CG    . GLU C 3 65  ? 23.590 3.578   42.079 1.00 40.55 ? 72  GLU A CG    1 
ATOM   1050 C CD    . GLU C 3 65  ? 24.804 3.413   41.153 1.00 49.01 ? 72  GLU A CD    1 
ATOM   1051 O OE1   . GLU C 3 65  ? 25.892 3.003   41.616 1.00 49.56 ? 72  GLU A OE1   1 
ATOM   1052 O OE2   . GLU C 3 65  ? 24.671 3.690   39.943 1.00 55.07 ? 72  GLU A OE2   1 
ATOM   1053 N N     . LEU C 3 66  ? 24.243 6.647   42.780 1.00 46.80 ? 73  LEU A N     1 
ATOM   1054 C CA    . LEU C 3 66  ? 24.709 7.093   44.079 1.00 48.83 ? 73  LEU A CA    1 
ATOM   1055 C C     . LEU C 3 66  ? 24.183 8.425   44.535 1.00 53.45 ? 73  LEU A C     1 
ATOM   1056 O O     . LEU C 3 66  ? 24.010 8.641   45.736 1.00 57.91 ? 73  LEU A O     1 
ATOM   1057 C CB    . LEU C 3 66  ? 26.238 7.091   44.120 1.00 46.28 ? 73  LEU A CB    1 
ATOM   1058 C CG    . LEU C 3 66  ? 26.895 5.734   43.873 1.00 42.63 ? 73  LEU A CG    1 
ATOM   1059 C CD1   . LEU C 3 66  ? 28.389 5.863   43.954 1.00 39.84 ? 73  LEU A CD1   1 
ATOM   1060 C CD2   . LEU C 3 66  ? 26.401 4.746   44.900 1.00 43.54 ? 73  LEU A CD2   1 
ATOM   1061 N N     . GLY C 3 67  ? 23.922 9.317   43.582 1.00 57.60 ? 74  GLY A N     1 
ATOM   1062 C CA    . GLY C 3 67  ? 23.430 10.644  43.923 1.00 59.88 ? 74  GLY A CA    1 
ATOM   1063 C C     . GLY C 3 67  ? 21.920 10.720  44.006 1.00 60.46 ? 74  GLY A C     1 
ATOM   1064 O O     . GLY C 3 67  ? 21.347 11.800  44.071 1.00 61.14 ? 74  GLY A O     1 
ATOM   1065 N N     . LEU C 3 68  ? 21.289 9.554   44.032 1.00 59.35 ? 75  LEU A N     1 
ATOM   1066 C CA    . LEU C 3 68  ? 19.848 9.440   44.076 1.00 55.08 ? 75  LEU A CA    1 
ATOM   1067 C C     . LEU C 3 68  ? 19.242 9.448   45.461 1.00 55.69 ? 75  LEU A C     1 
ATOM   1068 O O     . LEU C 3 68  ? 18.027 9.493   45.588 1.00 52.04 ? 75  LEU A O     1 
ATOM   1069 C CB    . LEU C 3 68  ? 19.435 8.142   43.389 1.00 49.44 ? 75  LEU A CB    1 
ATOM   1070 C CG    . LEU C 3 68  ? 17.969 7.773   43.587 1.00 50.57 ? 75  LEU A CG    1 
ATOM   1071 C CD1   . LEU C 3 68  ? 17.117 8.746   42.784 1.00 53.51 ? 75  LEU A CD1   1 
ATOM   1072 C CD2   . LEU C 3 68  ? 17.695 6.354   43.145 1.00 49.13 ? 75  LEU A CD2   1 
ATOM   1073 N N     . PHE C 3 69  ? 20.051 9.429   46.512 1.00 58.60 ? 76  PHE A N     1 
ATOM   1074 C CA    . PHE C 3 69  ? 19.434 9.322   47.834 1.00 62.84 ? 76  PHE A CA    1 
ATOM   1075 C C     . PHE C 3 69  ? 19.479 10.517  48.746 1.00 66.96 ? 76  PHE A C     1 
ATOM   1076 O O     . PHE C 3 69  ? 18.647 10.638  49.641 1.00 66.83 ? 76  PHE A O     1 
ATOM   1077 C CB    . PHE C 3 69  ? 19.982 8.079   48.562 1.00 55.10 ? 76  PHE A CB    1 
ATOM   1078 C CG    . PHE C 3 69  ? 19.822 6.817   47.769 1.00 55.54 ? 76  PHE A CG    1 
ATOM   1079 C CD1   . PHE C 3 69  ? 20.745 6.478   46.783 1.00 56.57 ? 76  PHE A CD1   1 
ATOM   1080 C CD2   . PHE C 3 69  ? 18.687 6.027   47.919 1.00 53.98 ? 76  PHE A CD2   1 
ATOM   1081 C CE1   . PHE C 3 69  ? 20.530 5.368   45.947 1.00 59.22 ? 76  PHE A CE1   1 
ATOM   1082 C CE2   . PHE C 3 69  ? 18.460 4.920   47.096 1.00 54.93 ? 76  PHE A CE2   1 
ATOM   1083 C CZ    . PHE C 3 69  ? 19.382 4.589   46.104 1.00 57.32 ? 76  PHE A CZ    1 
ATOM   1084 N N     . GLU C 3 70  ? 20.436 11.405  48.516 1.00 72.88 ? 77  GLU A N     1 
ATOM   1085 C CA    . GLU C 3 70  ? 20.572 12.586  49.349 1.00 76.21 ? 77  GLU A CA    1 
ATOM   1086 C C     . GLU C 3 70  ? 20.590 13.817  48.456 1.00 76.27 ? 77  GLU A C     1 
ATOM   1087 O O     . GLU C 3 70  ? 21.342 13.887  47.481 1.00 75.18 ? 77  GLU A O     1 
ATOM   1088 C CB    . GLU C 3 70  ? 21.856 12.482  50.182 1.00 78.89 ? 77  GLU A CB    1 
ATOM   1089 C CG    . GLU C 3 70  ? 21.996 13.516  51.296 1.00 84.43 ? 77  GLU A CG    1 
ATOM   1090 C CD    . GLU C 3 70  ? 23.256 13.296  52.151 1.00 85.22 ? 77  GLU A CD    1 
ATOM   1091 O OE1   . GLU C 3 70  ? 24.382 13.354  51.595 1.00 85.22 ? 77  GLU A OE1   1 
ATOM   1092 O OE2   . GLU C 3 70  ? 23.120 13.063  53.382 1.00 85.22 ? 77  GLU A OE2   1 
ATOM   1093 N N     . GLU C 3 71  ? 19.736 14.774  48.796 1.00 78.90 ? 78  GLU A N     1 
ATOM   1094 C CA    . GLU C 3 71  ? 19.603 16.024  48.049 1.00 81.21 ? 78  GLU A CA    1 
ATOM   1095 C C     . GLU C 3 71  ? 20.941 16.676  47.706 1.00 80.78 ? 78  GLU A C     1 
ATOM   1096 O O     . GLU C 3 71  ? 21.905 16.593  48.477 1.00 82.02 ? 78  GLU A O     1 
ATOM   1097 C CB    . GLU C 3 71  ? 18.751 17.030  48.845 1.00 82.87 ? 78  GLU A CB    1 
ATOM   1098 C CG    . GLU C 3 71  ? 17.258 16.705  48.951 1.00 84.28 ? 78  GLU A CG    1 
ATOM   1099 C CD    . GLU C 3 71  ? 16.465 17.093  47.699 1.00 85.22 ? 78  GLU A CD    1 
ATOM   1100 O OE1   . GLU C 3 71  ? 16.756 16.551  46.600 1.00 85.22 ? 78  GLU A OE1   1 
ATOM   1101 O OE2   . GLU C 3 71  ? 15.546 17.945  47.819 1.00 85.22 ? 78  GLU A OE2   1 
ATOM   1102 N N     . GLY C 3 72  ? 20.987 17.328  46.546 1.00 78.02 ? 79  GLY A N     1 
ATOM   1103 C CA    . GLY C 3 72  ? 22.197 18.015  46.128 1.00 74.92 ? 79  GLY A CA    1 
ATOM   1104 C C     . GLY C 3 72  ? 23.461 17.205  46.301 1.00 69.49 ? 79  GLY A C     1 
ATOM   1105 O O     . GLY C 3 72  ? 24.326 17.519  47.112 1.00 66.39 ? 79  GLY A O     1 
ATOM   1106 N N     . GLN C 3 73  ? 23.556 16.146  45.518 1.00 66.98 ? 80  GLN A N     1 
ATOM   1107 C CA    . GLN C 3 73  ? 24.704 15.278  45.576 1.00 63.94 ? 80  GLN A CA    1 
ATOM   1108 C C     . GLN C 3 73  ? 25.490 15.428  44.273 1.00 61.23 ? 80  GLN A C     1 
ATOM   1109 O O     . GLN C 3 73  ? 24.928 15.796  43.226 1.00 60.43 ? 80  GLN A O     1 
ATOM   1110 C CB    . GLN C 3 73  ? 24.216 13.849  45.757 1.00 67.45 ? 80  GLN A CB    1 
ATOM   1111 C CG    . GLN C 3 73  ? 25.222 12.914  46.407 1.00 74.48 ? 80  GLN A CG    1 
ATOM   1112 C CD    . GLN C 3 73  ? 24.834 12.549  47.825 1.00 74.96 ? 80  GLN A CD    1 
ATOM   1113 O OE1   . GLN C 3 73  ? 25.302 13.159  48.788 1.00 71.85 ? 80  GLN A OE1   1 
ATOM   1114 N NE2   . GLN C 3 73  ? 23.958 11.552  47.958 1.00 76.09 ? 80  GLN A NE2   1 
ATOM   1115 N N     . GLU C 3 74  ? 26.789 15.156  44.326 1.00 55.79 ? 81  GLU A N     1 
ATOM   1116 C CA    . GLU C 3 74  ? 27.620 15.271  43.122 1.00 53.53 ? 81  GLU A CA    1 
ATOM   1117 C C     . GLU C 3 74  ? 28.111 13.911  42.626 1.00 48.73 ? 81  GLU A C     1 
ATOM   1118 O O     . GLU C 3 74  ? 28.249 12.954  43.400 1.00 41.33 ? 81  GLU A O     1 
ATOM   1119 C CB    . GLU C 3 74  ? 28.814 16.181  43.387 1.00 54.68 ? 81  GLU A CB    1 
ATOM   1120 C CG    . GLU C 3 74  ? 28.483 17.291  44.367 1.00 61.56 ? 81  GLU A CG    1 
ATOM   1121 C CD    . GLU C 3 74  ? 29.429 18.467  44.270 1.00 67.34 ? 81  GLU A CD    1 
ATOM   1122 O OE1   . GLU C 3 74  ? 30.657 18.265  44.475 1.00 67.51 ? 81  GLU A OE1   1 
ATOM   1123 O OE2   . GLU C 3 74  ? 28.935 19.589  43.982 1.00 64.13 ? 81  GLU A OE2   1 
ATOM   1124 N N     . ARG C 3 75  ? 28.332 13.821  41.319 1.00 44.06 ? 82  ARG A N     1 
ATOM   1125 C CA    . ARG C 3 75  ? 28.814 12.590  40.734 1.00 40.02 ? 82  ARG A CA    1 
ATOM   1126 C C     . ARG C 3 75  ? 30.134 12.249  41.447 1.00 40.11 ? 82  ARG A C     1 
ATOM   1127 O O     . ARG C 3 75  ? 30.980 13.117  41.691 1.00 45.85 ? 82  ARG A O     1 
ATOM   1128 C CB    . ARG C 3 75  ? 29.009 12.786  39.245 1.00 36.34 ? 82  ARG A CB    1 
ATOM   1129 C CG    . ARG C 3 75  ? 27.743 13.148  38.528 1.00 38.31 ? 82  ARG A CG    1 
ATOM   1130 C CD    . ARG C 3 75  ? 26.674 12.063  38.637 1.00 39.82 ? 82  ARG A CD    1 
ATOM   1131 N NE    . ARG C 3 75  ? 25.588 12.264  37.676 1.00 38.54 ? 82  ARG A NE    1 
ATOM   1132 C CZ    . ARG C 3 75  ? 24.419 11.631  37.707 1.00 37.66 ? 82  ARG A CZ    1 
ATOM   1133 N NH1   . ARG C 3 75  ? 24.169 10.750  38.652 1.00 40.20 ? 82  ARG A NH1   1 
ATOM   1134 N NH2   . ARG C 3 75  ? 23.496 11.877  36.790 1.00 38.73 ? 82  ARG A NH2   1 
ATOM   1135 N N     . SER C 3 76  ? 30.305 10.986  41.787 1.00 30.74 ? 83  SER A N     1 
ATOM   1136 C CA    . SER C 3 76  ? 31.464 10.555  42.522 1.00 25.12 ? 83  SER A CA    1 
ATOM   1137 C C     . SER C 3 76  ? 32.619 10.113  41.668 1.00 26.74 ? 83  SER A C     1 
ATOM   1138 O O     . SER C 3 76  ? 33.692 9.834   42.169 1.00 29.79 ? 83  SER A O     1 
ATOM   1139 C CB    . SER C 3 76  ? 31.056 9.400   43.412 1.00 23.92 ? 83  SER A CB    1 
ATOM   1140 O OG    . SER C 3 76  ? 30.707 8.273   42.618 1.00 33.65 ? 83  SER A OG    1 
ATOM   1141 N N     . ALA C 3 77  ? 32.412 10.035  40.369 1.00 29.41 ? 84  ALA A N     1 
ATOM   1142 C CA    . ALA C 3 77  ? 33.472 9.555   39.507 1.00 31.40 ? 84  ALA A CA    1 
ATOM   1143 C C     . ALA C 3 77  ? 33.179 9.841   38.060 1.00 31.93 ? 84  ALA A C     1 
ATOM   1144 O O     . ALA C 3 77  ? 32.083 10.232  37.707 1.00 35.43 ? 84  ALA A O     1 
ATOM   1145 C CB    . ALA C 3 77  ? 33.635 8.059   39.703 1.00 25.35 ? 84  ALA A CB    1 
ATOM   1146 N N     . TRP C 3 78  ? 34.175 9.656   37.219 1.00 31.37 ? 85  TRP A N     1 
ATOM   1147 C CA    . TRP C 3 78  ? 33.954 9.837   35.810 1.00 36.82 ? 85  TRP A CA    1 
ATOM   1148 C C     . TRP C 3 78  ? 33.448 8.461   35.315 1.00 40.63 ? 85  TRP A C     1 
ATOM   1149 O O     . TRP C 3 78  ? 33.795 7.416   35.872 1.00 45.29 ? 85  TRP A O     1 
ATOM   1150 C CB    . TRP C 3 78  ? 35.264 10.213  35.108 1.00 39.06 ? 85  TRP A CB    1 
ATOM   1151 C CG    . TRP C 3 78  ? 35.923 11.476  35.637 1.00 49.95 ? 85  TRP A CG    1 
ATOM   1152 C CD1   . TRP C 3 78  ? 36.777 11.611  36.736 1.00 50.26 ? 85  TRP A CD1   1 
ATOM   1153 C CD2   . TRP C 3 78  ? 35.728 12.780  35.127 1.00 46.06 ? 85  TRP A CD2   1 
ATOM   1154 N NE1   . TRP C 3 78  ? 37.102 12.934  36.918 1.00 44.14 ? 85  TRP A NE1   1 
ATOM   1155 C CE2   . TRP C 3 78  ? 36.468 13.671  35.947 1.00 47.09 ? 85  TRP A CE2   1 
ATOM   1156 C CE3   . TRP C 3 78  ? 34.990 13.290  34.054 1.00 46.69 ? 85  TRP A CE3   1 
ATOM   1157 C CZ2   . TRP C 3 78  ? 36.482 15.043  35.721 1.00 54.08 ? 85  TRP A CZ2   1 
ATOM   1158 C CZ3   . TRP C 3 78  ? 35.002 14.650  33.821 1.00 56.20 ? 85  TRP A CZ3   1 
ATOM   1159 C CH2   . TRP C 3 78  ? 35.744 15.520  34.654 1.00 61.91 ? 85  TRP A CH2   1 
ATOM   1160 N N     . VAL C 3 79  ? 32.594 8.455   34.305 1.00 36.99 ? 86  VAL A N     1 
ATOM   1161 C CA    . VAL C 3 79  ? 32.120 7.215   33.730 1.00 35.66 ? 86  VAL A CA    1 
ATOM   1162 C C     . VAL C 3 79  ? 32.364 7.459   32.242 1.00 37.14 ? 86  VAL A C     1 
ATOM   1163 O O     . VAL C 3 79  ? 31.856 8.430   31.674 1.00 38.90 ? 86  VAL A O     1 
ATOM   1164 C CB    . VAL C 3 79  ? 30.620 6.984   34.023 1.00 38.85 ? 86  VAL A CB    1 
ATOM   1165 C CG1   . VAL C 3 79  ? 30.108 5.837   33.191 1.00 36.70 ? 86  VAL A CG1   1 
ATOM   1166 C CG2   . VAL C 3 79  ? 30.419 6.688   35.503 1.00 35.73 ? 86  VAL A CG2   1 
ATOM   1167 N N     . ARG C 3 80  ? 33.161 6.591   31.627 1.00 35.95 ? 87  ARG A N     1 
ATOM   1168 C CA    . ARG C 3 80  ? 33.533 6.724   30.221 1.00 36.48 ? 87  ARG A CA    1 
ATOM   1169 C C     . ARG C 3 80  ? 33.176 5.446   29.487 1.00 37.88 ? 87  ARG A C     1 
ATOM   1170 O O     . ARG C 3 80  ? 33.191 4.365   30.075 1.00 37.25 ? 87  ARG A O     1 
ATOM   1171 C CB    . ARG C 3 80  ? 35.043 7.008   30.150 1.00 41.97 ? 87  ARG A CB    1 
ATOM   1172 C CG    . ARG C 3 80  ? 35.691 7.016   28.774 1.00 47.22 ? 87  ARG A CG    1 
ATOM   1173 C CD    . ARG C 3 80  ? 37.214 7.093   28.905 1.00 49.53 ? 87  ARG A CD    1 
ATOM   1174 N NE    . ARG C 3 80  ? 37.629 8.285   29.649 1.00 55.84 ? 87  ARG A NE    1 
ATOM   1175 C CZ    . ARG C 3 80  ? 38.683 8.347   30.461 1.00 55.50 ? 87  ARG A CZ    1 
ATOM   1176 N NH1   . ARG C 3 80  ? 39.450 7.282   30.648 1.00 56.80 ? 87  ARG A NH1   1 
ATOM   1177 N NH2   . ARG C 3 80  ? 38.960 9.476   31.102 1.00 53.98 ? 87  ARG A NH2   1 
ATOM   1178 N N     . ALA C 3 81  ? 32.860 5.568   28.199 1.00 40.89 ? 88  ALA A N     1 
ATOM   1179 C CA    . ALA C 3 81  ? 32.458 4.414   27.388 1.00 41.86 ? 88  ALA A CA    1 
ATOM   1180 C C     . ALA C 3 81  ? 33.614 3.630   26.820 1.00 44.05 ? 88  ALA A C     1 
ATOM   1181 O O     . ALA C 3 81  ? 34.525 4.205   26.199 1.00 44.14 ? 88  ALA A O     1 
ATOM   1182 C CB    . ALA C 3 81  ? 31.553 4.864   26.263 1.00 40.88 ? 88  ALA A CB    1 
ATOM   1183 N N     . LYS C 3 82  ? 33.566 2.314   27.042 1.00 46.27 ? 89  LYS A N     1 
ATOM   1184 C CA    . LYS C 3 82  ? 34.595 1.389   26.562 1.00 46.39 ? 89  LYS A CA    1 
ATOM   1185 C C     . LYS C 3 82  ? 34.276 1.075   25.132 1.00 45.41 ? 89  LYS A C     1 
ATOM   1186 O O     . LYS C 3 82  ? 35.149 0.970   24.285 1.00 47.95 ? 89  LYS A O     1 
ATOM   1187 C CB    . LYS C 3 82  ? 34.594 0.085   27.354 1.00 47.51 ? 89  LYS A CB    1 
ATOM   1188 C CG    . LYS C 3 82  ? 35.360 0.140   28.656 1.00 57.86 ? 89  LYS A CG    1 
ATOM   1189 C CD    . LYS C 3 82  ? 36.866 0.280   28.437 1.00 67.97 ? 89  LYS A CD    1 
ATOM   1190 C CE    . LYS C 3 82  ? 37.452 -0.905  27.659 1.00 71.69 ? 89  LYS A CE    1 
ATOM   1191 N NZ    . LYS C 3 82  ? 37.162 -2.224  28.299 1.00 74.68 ? 89  LYS A NZ    1 
ATOM   1192 N N     . THR C 3 83  ? 32.998 0.930   24.863 1.00 43.95 ? 90  THR A N     1 
ATOM   1193 C CA    . THR C 3 83  ? 32.577 0.626   23.523 1.00 42.76 ? 90  THR A CA    1 
ATOM   1194 C C     . THR C 3 83  ? 31.487 1.605   23.192 1.00 45.00 ? 90  THR A C     1 
ATOM   1195 O O     . THR C 3 83  ? 31.302 2.589   23.880 1.00 49.00 ? 90  THR A O     1 
ATOM   1196 C CB    . THR C 3 83  ? 32.009 -0.771  23.473 1.00 38.57 ? 90  THR A CB    1 
ATOM   1197 O OG1   . THR C 3 83  ? 30.871 -0.844  24.332 1.00 31.09 ? 90  THR A OG1   1 
ATOM   1198 C CG2   . THR C 3 83  ? 33.026 -1.746  23.936 1.00 32.28 ? 90  THR A CG2   1 
ATOM   1199 N N     . ALA C 3 84  ? 30.767 1.340   22.122 1.00 44.86 ? 91  ALA A N     1 
ATOM   1200 C CA    . ALA C 3 84  ? 29.664 2.197   21.765 1.00 42.92 ? 91  ALA A CA    1 
ATOM   1201 C C     . ALA C 3 84  ? 28.603 1.826   22.798 1.00 43.24 ? 91  ALA A C     1 
ATOM   1202 O O     . ALA C 3 84  ? 28.582 0.701   23.269 1.00 45.67 ? 91  ALA A O     1 
ATOM   1203 C CB    . ALA C 3 84  ? 29.193 1.875   20.355 1.00 36.16 ? 91  ALA A CB    1 
ATOM   1204 N N     . CYS C 3 85  ? 27.739 2.763   23.164 1.00 44.29 ? 92  CYS A N     1 
ATOM   1205 C CA    . CYS C 3 85  ? 26.713 2.468   24.148 1.00 47.41 ? 92  CYS A CA    1 
ATOM   1206 C C     . CYS C 3 85  ? 25.297 2.925   23.837 1.00 46.96 ? 92  CYS A C     1 
ATOM   1207 O O     . CYS C 3 85  ? 25.075 3.815   23.037 1.00 49.91 ? 92  CYS A O     1 
ATOM   1208 C CB    . CYS C 3 85  ? 27.117 3.029   25.508 1.00 47.91 ? 92  CYS A CB    1 
ATOM   1209 S SG    . CYS C 3 85  ? 28.348 2.041   26.346 1.00 50.52 ? 92  CYS A SG    1 
ATOM   1210 N N     . GLU C 3 86  ? 24.348 2.273   24.484 1.00 43.99 ? 93  GLU A N     1 
ATOM   1211 C CA    . GLU C 3 86  ? 22.953 2.594   24.358 1.00 46.19 ? 93  GLU A CA    1 
ATOM   1212 C C     . GLU C 3 86  ? 22.502 2.572   25.815 1.00 47.23 ? 93  GLU A C     1 
ATOM   1213 O O     . GLU C 3 86  ? 22.310 1.527   26.410 1.00 45.42 ? 93  GLU A O     1 
ATOM   1214 C CB    . GLU C 3 86  ? 22.240 1.540   23.533 1.00 50.60 ? 93  GLU A CB    1 
ATOM   1215 C CG    . GLU C 3 86  ? 20.748 1.809   23.365 1.00 61.72 ? 93  GLU A CG    1 
ATOM   1216 C CD    . GLU C 3 86  ? 20.086 0.806   22.448 1.00 63.90 ? 93  GLU A CD    1 
ATOM   1217 O OE1   . GLU C 3 86  ? 20.797 0.313   21.543 1.00 65.04 ? 93  GLU A OE1   1 
ATOM   1218 O OE2   . GLU C 3 86  ? 18.877 0.525   22.619 1.00 71.56 ? 93  GLU A OE2   1 
ATOM   1219 N N     . VAL C 3 87  ? 22.385 3.757   26.385 1.00 47.31 ? 94  VAL A N     1 
ATOM   1220 C CA    . VAL C 3 87  ? 22.032 3.915   27.769 1.00 45.97 ? 94  VAL A CA    1 
ATOM   1221 C C     . VAL C 3 87  ? 20.643 4.497   27.861 1.00 50.58 ? 94  VAL A C     1 
ATOM   1222 O O     . VAL C 3 87  ? 20.268 5.389   27.101 1.00 50.22 ? 94  VAL A O     1 
ATOM   1223 C CB    . VAL C 3 87  ? 23.028 4.878   28.472 1.00 44.29 ? 94  VAL A CB    1 
ATOM   1224 C CG1   . VAL C 3 87  ? 22.800 4.911   29.970 1.00 42.24 ? 94  VAL A CG1   1 
ATOM   1225 C CG2   . VAL C 3 87  ? 24.422 4.455   28.177 1.00 41.34 ? 94  VAL A CG2   1 
ATOM   1226 N N     . ALA C 3 88  ? 19.875 3.953   28.795 1.00 51.12 ? 95  ALA A N     1 
ATOM   1227 C CA    . ALA C 3 88  ? 18.537 4.423   29.062 1.00 46.32 ? 95  ALA A CA    1 
ATOM   1228 C C     . ALA C 3 88  ? 18.821 5.444   30.142 1.00 47.50 ? 95  ALA A C     1 
ATOM   1229 O O     . ALA C 3 88  ? 19.631 5.201   31.040 1.00 50.00 ? 95  ALA A O     1 
ATOM   1230 C CB    . ALA C 3 88  ? 17.691 3.309   29.603 1.00 42.77 ? 95  ALA A CB    1 
ATOM   1231 N N     . GLU C 3 89  ? 18.182 6.599   30.047 1.00 44.50 ? 96  GLU A N     1 
ATOM   1232 C CA    . GLU C 3 89  ? 18.405 7.637   31.027 1.00 41.20 ? 96  GLU A CA    1 
ATOM   1233 C C     . GLU C 3 89  ? 17.062 8.087   31.543 1.00 38.64 ? 96  GLU A C     1 
ATOM   1234 O O     . GLU C 3 89  ? 16.081 8.039   30.827 1.00 35.02 ? 96  GLU A O     1 
ATOM   1235 C CB    . GLU C 3 89  ? 19.197 8.776   30.385 1.00 41.98 ? 96  GLU A CB    1 
ATOM   1236 C CG    . GLU C 3 89  ? 20.608 8.346   29.959 1.00 42.93 ? 96  GLU A CG    1 
ATOM   1237 C CD    . GLU C 3 89  ? 21.372 9.442   29.236 1.00 44.74 ? 96  GLU A CD    1 
ATOM   1238 O OE1   . GLU C 3 89  ? 21.158 10.643  29.548 1.00 45.34 ? 96  GLU A OE1   1 
ATOM   1239 O OE2   . GLU C 3 89  ? 22.196 9.100   28.365 1.00 37.57 ? 96  GLU A OE2   1 
ATOM   1240 N N     . ILE C 3 90  ? 17.024 8.523   32.794 1.00 40.77 ? 97  ILE A N     1 
ATOM   1241 C CA    . ILE C 3 90  ? 15.778 8.927   33.428 1.00 45.11 ? 97  ILE A CA    1 
ATOM   1242 C C     . ILE C 3 90  ? 16.065 9.903   34.542 1.00 46.33 ? 97  ILE A C     1 
ATOM   1243 O O     . ILE C 3 90  ? 17.114 9.844   35.169 1.00 48.93 ? 97  ILE A O     1 
ATOM   1244 C CB    . ILE C 3 90  ? 15.083 7.685   34.026 1.00 47.95 ? 97  ILE A CB    1 
ATOM   1245 C CG1   . ILE C 3 90  ? 13.737 8.051   34.644 1.00 47.79 ? 97  ILE A CG1   1 
ATOM   1246 C CG2   . ILE C 3 90  ? 15.995 7.059   35.068 1.00 46.03 ? 97  ILE A CG2   1 
ATOM   1247 C CD1   . ILE C 3 90  ? 12.801 6.879   34.659 1.00 41.97 ? 97  ILE A CD1   1 
ATOM   1248 N N     . SER C 3 91  ? 15.120 10.795  34.796 1.00 52.00 ? 98  SER A N     1 
ATOM   1249 C CA    . SER C 3 91  ? 15.280 11.804  35.849 1.00 55.97 ? 98  SER A CA    1 
ATOM   1250 C C     . SER C 3 91  ? 15.061 11.222  37.240 1.00 57.00 ? 98  SER A C     1 
ATOM   1251 O O     . SER C 3 91  ? 14.106 10.479  37.464 1.00 58.73 ? 98  SER A O     1 
ATOM   1252 C CB    . SER C 3 91  ? 14.290 12.949  35.618 1.00 52.50 ? 98  SER A CB    1 
ATOM   1253 O OG    . SER C 3 91  ? 13.262 12.541  34.726 1.00 55.74 ? 98  SER A OG    1 
ATOM   1254 N N     . TYR C 3 92  ? 15.948 11.549  38.172 1.00 55.09 ? 99  TYR A N     1 
ATOM   1255 C CA    . TYR C 3 92  ? 15.796 11.049  39.532 1.00 55.79 ? 99  TYR A CA    1 
ATOM   1256 C C     . TYR C 3 92  ? 14.353 11.281  39.975 1.00 57.50 ? 99  TYR A C     1 
ATOM   1257 O O     . TYR C 3 92  ? 13.679 10.367  40.452 1.00 52.39 ? 99  TYR A O     1 
ATOM   1258 C CB    . TYR C 3 92  ? 16.738 11.787  40.478 1.00 53.51 ? 99  TYR A CB    1 
ATOM   1259 C CG    . TYR C 3 92  ? 18.174 11.302  40.499 1.00 49.29 ? 99  TYR A CG    1 
ATOM   1260 C CD1   . TYR C 3 92  ? 18.581 10.167  39.781 1.00 46.66 ? 99  TYR A CD1   1 
ATOM   1261 C CD2   . TYR C 3 92  ? 19.115 11.957  41.284 1.00 45.87 ? 99  TYR A CD2   1 
ATOM   1262 C CE1   . TYR C 3 92  ? 19.891 9.706   39.864 1.00 45.66 ? 99  TYR A CE1   1 
ATOM   1263 C CE2   . TYR C 3 92  ? 20.412 11.511  41.376 1.00 45.01 ? 99  TYR A CE2   1 
ATOM   1264 C CZ    . TYR C 3 92  ? 20.802 10.389  40.678 1.00 48.02 ? 99  TYR A CZ    1 
ATOM   1265 O OH    . TYR C 3 92  ? 22.085 9.932   40.869 1.00 45.80 ? 99  TYR A OH    1 
ATOM   1266 N N     . LYS C 3 93  ? 13.905 12.526  39.793 1.00 64.22 ? 100 LYS A N     1 
ATOM   1267 C CA    . LYS C 3 93  ? 12.547 12.976  40.128 1.00 63.57 ? 100 LYS A CA    1 
ATOM   1268 C C     . LYS C 3 93  ? 11.560 11.979  39.568 1.00 60.24 ? 100 LYS A C     1 
ATOM   1269 O O     . LYS C 3 93  ? 10.642 11.547  40.253 1.00 55.76 ? 100 LYS A O     1 
ATOM   1270 C CB    . LYS C 3 93  ? 12.302 14.366  39.525 1.00 65.76 ? 100 LYS A CB    1 
ATOM   1271 C CG    . LYS C 3 93  ? 10.844 14.817  39.495 1.00 71.02 ? 100 LYS A CG    1 
ATOM   1272 C CD    . LYS C 3 93  ? 10.050 14.219  38.313 1.00 76.40 ? 100 LYS A CD    1 
ATOM   1273 C CE    . LYS C 3 93  ? 8.559  14.607  38.371 1.00 78.90 ? 100 LYS A CE    1 
ATOM   1274 N NZ    . LYS C 3 93  ? 7.712  13.957  37.313 1.00 78.16 ? 100 LYS A NZ    1 
ATOM   1275 N N     . LYS C 3 94  ? 11.769 11.624  38.310 1.00 59.81 ? 101 LYS A N     1 
ATOM   1276 C CA    . LYS C 3 94  ? 10.926 10.650  37.648 1.00 63.22 ? 101 LYS A CA    1 
ATOM   1277 C C     . LYS C 3 94  ? 11.083 9.307   38.371 1.00 62.10 ? 101 LYS A C     1 
ATOM   1278 O O     . LYS C 3 94  ? 10.146 8.812   38.983 1.00 60.97 ? 101 LYS A O     1 
ATOM   1279 C CB    . LYS C 3 94  ? 11.355 10.512  36.179 1.00 66.20 ? 101 LYS A CB    1 
ATOM   1280 C CG    . LYS C 3 94  ? 10.468 9.616   35.312 1.00 69.29 ? 101 LYS A CG    1 
ATOM   1281 C CD    . LYS C 3 94  ? 9.131  10.291  34.958 1.00 71.68 ? 101 LYS A CD    1 
ATOM   1282 C CE    . LYS C 3 94  ? 8.290  9.467   33.957 1.00 68.45 ? 101 LYS A CE    1 
ATOM   1283 N NZ    . LYS C 3 94  ? 8.937  9.213   32.624 1.00 64.52 ? 101 LYS A NZ    1 
ATOM   1284 N N     . PHE C 3 95  ? 12.285 8.737   38.304 1.00 63.60 ? 102 PHE A N     1 
ATOM   1285 C CA    . PHE C 3 95  ? 12.593 7.441   38.919 1.00 61.54 ? 102 PHE A CA    1 
ATOM   1286 C C     . PHE C 3 95  ? 11.934 7.274   40.275 1.00 61.51 ? 102 PHE A C     1 
ATOM   1287 O O     . PHE C 3 95  ? 11.265 6.266   40.511 1.00 60.88 ? 102 PHE A O     1 
ATOM   1288 C CB    . PHE C 3 95  ? 14.123 7.253   39.053 1.00 59.61 ? 102 PHE A CB    1 
ATOM   1289 C CG    . PHE C 3 95  ? 14.550 5.866   39.516 1.00 52.05 ? 102 PHE A CG    1 
ATOM   1290 C CD1   . PHE C 3 95  ? 14.334 4.752   38.725 1.00 49.06 ? 102 PHE A CD1   1 
ATOM   1291 C CD2   . PHE C 3 95  ? 15.164 5.687   40.753 1.00 54.48 ? 102 PHE A CD2   1 
ATOM   1292 C CE1   . PHE C 3 95  ? 14.714 3.492   39.154 1.00 50.09 ? 102 PHE A CE1   1 
ATOM   1293 C CE2   . PHE C 3 95  ? 15.550 4.422   41.194 1.00 51.56 ? 102 PHE A CE2   1 
ATOM   1294 C CZ    . PHE C 3 95  ? 15.324 3.327   40.396 1.00 50.96 ? 102 PHE A CZ    1 
ATOM   1295 N N     . ARG C 3 96  ? 12.117 8.258   41.156 1.00 61.29 ? 103 ARG A N     1 
ATOM   1296 C CA    . ARG C 3 96  ? 11.538 8.198   42.498 1.00 65.87 ? 103 ARG A CA    1 
ATOM   1297 C C     . ARG C 3 96  ? 10.061 7.803   42.402 1.00 69.63 ? 103 ARG A C     1 
ATOM   1298 O O     . ARG C 3 96  ? 9.548  6.990   43.194 1.00 68.78 ? 103 ARG A O     1 
ATOM   1299 C CB    . ARG C 3 96  ? 11.664 9.556   43.204 1.00 67.10 ? 103 ARG A CB    1 
ATOM   1300 C CG    . ARG C 3 96  ? 13.084 9.987   43.560 1.00 69.08 ? 103 ARG A CG    1 
ATOM   1301 C CD    . ARG C 3 96  ? 13.104 11.445  44.019 1.00 77.74 ? 103 ARG A CD    1 
ATOM   1302 N NE    . ARG C 3 96  ? 14.418 12.087  43.896 1.00 83.89 ? 103 ARG A NE    1 
ATOM   1303 C CZ    . ARG C 3 96  ? 15.416 11.942  44.765 1.00 85.22 ? 103 ARG A CZ    1 
ATOM   1304 N NH1   . ARG C 3 96  ? 15.253 11.171  45.838 1.00 85.22 ? 103 ARG A NH1   1 
ATOM   1305 N NH2   . ARG C 3 96  ? 16.573 12.571  44.565 1.00 84.98 ? 103 ARG A NH2   1 
ATOM   1306 N N     . GLN C 3 97  ? 9.392  8.377   41.407 1.00 70.30 ? 104 GLN A N     1 
ATOM   1307 C CA    . GLN C 3 97  ? 7.986  8.117   41.170 1.00 70.08 ? 104 GLN A CA    1 
ATOM   1308 C C     . GLN C 3 97  ? 7.734  6.673   40.714 1.00 68.82 ? 104 GLN A C     1 
ATOM   1309 O O     . GLN C 3 97  ? 6.785  6.047   41.172 1.00 67.09 ? 104 GLN A O     1 
ATOM   1310 C CB    . GLN C 3 97  ? 7.474  9.114   40.138 1.00 72.77 ? 104 GLN A CB    1 
ATOM   1311 C CG    . GLN C 3 97  ? 5.975  9.292   40.096 1.00 80.44 ? 104 GLN A CG    1 
ATOM   1312 C CD    . GLN C 3 97  ? 5.568  10.597  39.408 1.00 85.22 ? 104 GLN A CD    1 
ATOM   1313 O OE1   . GLN C 3 97  ? 4.372  10.906  39.288 1.00 85.22 ? 104 GLN A OE1   1 
ATOM   1314 N NE2   . GLN C 3 97  ? 6.562  11.374  38.961 1.00 85.22 ? 104 GLN A NE2   1 
ATOM   1315 N N     . LEU C 3 98  ? 8.577  6.136   39.834 1.00 65.99 ? 105 LEU A N     1 
ATOM   1316 C CA    . LEU C 3 98  ? 8.379  4.760   39.369 1.00 70.13 ? 105 LEU A CA    1 
ATOM   1317 C C     . LEU C 3 98  ? 8.475  3.716   40.481 1.00 72.80 ? 105 LEU A C     1 
ATOM   1318 O O     . LEU C 3 98  ? 7.785  2.692   40.445 1.00 67.74 ? 105 LEU A O     1 
ATOM   1319 C CB    . LEU C 3 98  ? 9.416  4.359   38.322 1.00 70.50 ? 105 LEU A CB    1 
ATOM   1320 C CG    . LEU C 3 98  ? 9.574  4.989   36.952 1.00 69.59 ? 105 LEU A CG    1 
ATOM   1321 C CD1   . LEU C 3 98  ? 10.517 4.104   36.170 1.00 67.43 ? 105 LEU A CD1   1 
ATOM   1322 C CD2   . LEU C 3 98  ? 8.260  5.090   36.229 1.00 71.02 ? 105 LEU A CD2   1 
ATOM   1323 N N     . ILE C 3 99  ? 9.362  3.958   41.448 1.00 75.76 ? 106 ILE A N     1 
ATOM   1324 C CA    . ILE C 3 99  ? 9.566  3.001   42.533 1.00 77.98 ? 106 ILE A CA    1 
ATOM   1325 C C     . ILE C 3 99  ? 8.473  3.072   43.602 1.00 78.83 ? 106 ILE A C     1 
ATOM   1326 O O     . ILE C 3 99  ? 8.451  2.265   44.540 1.00 77.85 ? 106 ILE A O     1 
ATOM   1327 C CB    . ILE C 3 99  ? 11.015 3.132   43.172 1.00 77.24 ? 106 ILE A CB    1 
ATOM   1328 C CG1   . ILE C 3 99  ? 11.191 4.461   43.909 1.00 75.36 ? 106 ILE A CG1   1 
ATOM   1329 C CG2   . ILE C 3 99  ? 12.073 3.034   42.074 1.00 75.98 ? 106 ILE A CG2   1 
ATOM   1330 C CD1   . ILE C 3 99  ? 12.565 4.631   44.520 1.00 70.68 ? 106 ILE A CD1   1 
ATOM   1331 N N     . GLN C 3 100 ? 7.575  4.048   43.472 1.00 78.32 ? 107 GLN A N     1 
ATOM   1332 C CA    . GLN C 3 100 ? 6.455  4.141   44.398 1.00 76.59 ? 107 GLN A CA    1 
ATOM   1333 C C     . GLN C 3 100 ? 5.453  3.205   43.758 1.00 74.91 ? 107 GLN A C     1 
ATOM   1334 O O     . GLN C 3 100 ? 4.948  2.292   44.396 1.00 77.68 ? 107 GLN A O     1 
ATOM   1335 C CB    . GLN C 3 100 ? 5.890  5.555   44.469 1.00 75.66 ? 107 GLN A CB    1 
ATOM   1336 C CG    . GLN C 3 100 ? 6.590  6.442   45.479 1.00 80.97 ? 107 GLN A CG    1 
ATOM   1337 C CD    . GLN C 3 100 ? 6.314  7.916   45.237 1.00 85.22 ? 107 GLN A CD    1 
ATOM   1338 O OE1   . GLN C 3 100 ? 5.164  8.320   45.076 1.00 85.22 ? 107 GLN A OE1   1 
ATOM   1339 N NE2   . GLN C 3 100 ? 7.371  8.727   45.207 1.00 85.22 ? 107 GLN A NE2   1 
ATOM   1340 N N     . VAL C 3 101 ? 5.183  3.403   42.478 1.00 73.51 ? 108 VAL A N     1 
ATOM   1341 C CA    . VAL C 3 101 ? 4.250  2.511   41.821 1.00 73.46 ? 108 VAL A CA    1 
ATOM   1342 C C     . VAL C 3 101 ? 4.805  1.106   41.972 1.00 75.66 ? 108 VAL A C     1 
ATOM   1343 O O     . VAL C 3 101 ? 4.053  0.151   42.120 1.00 79.61 ? 108 VAL A O     1 
ATOM   1344 C CB    . VAL C 3 101 ? 4.037  2.855   40.296 1.00 69.53 ? 108 VAL A CB    1 
ATOM   1345 C CG1   . VAL C 3 101 ? 5.092  3.834   39.809 1.00 68.72 ? 108 VAL A CG1   1 
ATOM   1346 C CG2   . VAL C 3 101 ? 4.048  1.574   39.453 1.00 59.35 ? 108 VAL A CG2   1 
ATOM   1347 N N     . ASN C 3 102 ? 6.126  0.981   41.964 1.00 76.96 ? 109 ASN A N     1 
ATOM   1348 C CA    . ASN C 3 102 ? 6.745  -0.337  42.090 1.00 76.34 ? 109 ASN A CA    1 
ATOM   1349 C C     . ASN C 3 102 ? 8.124  -0.280  42.726 1.00 77.32 ? 109 ASN A C     1 
ATOM   1350 O O     . ASN C 3 102 ? 9.119  -0.092  42.029 1.00 76.45 ? 109 ASN A O     1 
ATOM   1351 C CB    . ASN C 3 102 ? 6.854  -1.003  40.718 1.00 70.98 ? 109 ASN A CB    1 
ATOM   1352 C CG    . ASN C 3 102 ? 7.437  -2.378  40.803 1.00 67.40 ? 109 ASN A CG    1 
ATOM   1353 O OD1   . ASN C 3 102 ? 7.488  -3.107  39.826 1.00 68.46 ? 109 ASN A OD1   1 
ATOM   1354 N ND2   . ASN C 3 102 ? 7.886  -2.744  41.983 1.00 70.13 ? 109 ASN A ND2   1 
ATOM   1355 N N     . PRO C 3 103 ? 8.202  -0.462  44.058 1.00 78.46 ? 110 PRO A N     1 
ATOM   1356 C CA    . PRO C 3 103 ? 9.474  -0.428  44.793 1.00 78.06 ? 110 PRO A CA    1 
ATOM   1357 C C     . PRO C 3 103 ? 10.365 -1.597  44.428 1.00 74.43 ? 110 PRO A C     1 
ATOM   1358 O O     . PRO C 3 103 ? 11.546 -1.630  44.766 1.00 72.67 ? 110 PRO A O     1 
ATOM   1359 C CB    . PRO C 3 103 ? 9.034  -0.471  46.254 1.00 78.33 ? 110 PRO A CB    1 
ATOM   1360 C CG    . PRO C 3 103 ? 7.679  0.171   46.214 1.00 78.89 ? 110 PRO A CG    1 
ATOM   1361 C CD    . PRO C 3 103 ? 7.073  -0.497  44.998 1.00 77.90 ? 110 PRO A CD    1 
ATOM   1362 N N     . ASP C 3 104 ? 9.790  -2.548  43.710 1.00 72.57 ? 111 ASP A N     1 
ATOM   1363 C CA    . ASP C 3 104 ? 10.528 -3.718  43.309 1.00 70.57 ? 111 ASP A CA    1 
ATOM   1364 C C     . ASP C 3 104 ? 11.693 -3.357  42.408 1.00 69.78 ? 111 ASP A C     1 
ATOM   1365 O O     . ASP C 3 104 ? 12.709 -4.054  42.385 1.00 68.42 ? 111 ASP A O     1 
ATOM   1366 C CB    . ASP C 3 104 ? 9.614  -4.689  42.603 1.00 72.04 ? 111 ASP A CB    1 
ATOM   1367 C CG    . ASP C 3 104 ? 10.209 -6.041  42.510 1.00 77.09 ? 111 ASP A CG    1 
ATOM   1368 O OD1   . ASP C 3 104 ? 9.607  -6.904  41.844 1.00 85.22 ? 111 ASP A OD1   1 
ATOM   1369 O OD2   . ASP C 3 104 ? 11.285 -6.242  43.114 1.00 79.98 ? 111 ASP A OD2   1 
ATOM   1370 N N     . ILE C 3 105 ? 11.557 -2.275  41.649 1.00 69.31 ? 112 ILE A N     1 
ATOM   1371 C CA    . ILE C 3 105 ? 12.664 -1.883  40.792 1.00 67.66 ? 112 ILE A CA    1 
ATOM   1372 C C     . ILE C 3 105 ? 13.731 -1.288  41.708 1.00 63.76 ? 112 ILE A C     1 
ATOM   1373 O O     . ILE C 3 105 ? 14.925 -1.463  41.451 1.00 67.29 ? 112 ILE A O     1 
ATOM   1374 C CB    . ILE C 3 105 ? 12.240 -0.861  39.674 1.00 68.87 ? 112 ILE A CB    1 
ATOM   1375 C CG1   . ILE C 3 105 ? 13.408 -0.603  38.690 1.00 70.50 ? 112 ILE A CG1   1 
ATOM   1376 C CG2   . ILE C 3 105 ? 11.813 0.451   40.300 1.00 70.99 ? 112 ILE A CG2   1 
ATOM   1377 C CD1   . ILE C 3 105 ? 13.780 -1.762  37.723 1.00 67.89 ? 112 ILE A CD1   1 
ATOM   1378 N N     . LEU C 3 106 ? 13.317 -0.622  42.788 1.00 55.64 ? 113 LEU A N     1 
ATOM   1379 C CA    . LEU C 3 106 ? 14.297 -0.044  43.697 1.00 55.76 ? 113 LEU A CA    1 
ATOM   1380 C C     . LEU C 3 106 ? 15.152 -1.162  44.263 1.00 62.83 ? 113 LEU A C     1 
ATOM   1381 O O     . LEU C 3 106 ? 16.353 -0.974  44.519 1.00 64.62 ? 113 LEU A O     1 
ATOM   1382 C CB    . LEU C 3 106 ? 13.640 0.720   44.849 1.00 49.41 ? 113 LEU A CB    1 
ATOM   1383 C CG    . LEU C 3 106 ? 14.606 1.077   46.003 1.00 46.03 ? 113 LEU A CG    1 
ATOM   1384 C CD1   . LEU C 3 106 ? 15.874 1.667   45.438 1.00 43.78 ? 113 LEU A CD1   1 
ATOM   1385 C CD2   . LEU C 3 106 ? 13.965 2.055   47.009 1.00 43.43 ? 113 LEU A CD2   1 
ATOM   1386 N N     . MET C 3 107 ? 14.519 -2.322  44.458 1.00 64.76 ? 114 MET A N     1 
ATOM   1387 C CA    . MET C 3 107 ? 15.185 -3.509  44.981 1.00 61.70 ? 114 MET A CA    1 
ATOM   1388 C C     . MET C 3 107 ? 16.295 -3.899  44.025 1.00 60.42 ? 114 MET A C     1 
ATOM   1389 O O     . MET C 3 107 ? 17.440 -4.058  44.419 1.00 62.38 ? 114 MET A O     1 
ATOM   1390 C CB    . MET C 3 107 ? 14.194 -4.666  45.095 1.00 64.10 ? 114 MET A CB    1 
ATOM   1391 C CG    . MET C 3 107 ? 13.427 -4.737  46.402 1.00 68.24 ? 114 MET A CG    1 
ATOM   1392 S SD    . MET C 3 107 ? 14.451 -5.339  47.778 1.00 73.63 ? 114 MET A SD    1 
ATOM   1393 C CE    . MET C 3 107 ? 14.944 -6.944  47.155 1.00 58.09 ? 114 MET A CE    1 
ATOM   1394 N N     . ARG C 3 108 ? 15.937 -4.048  42.759 1.00 58.36 ? 115 ARG A N     1 
ATOM   1395 C CA    . ARG C 3 108 ? 16.875 -4.424  41.711 1.00 56.93 ? 115 ARG A CA    1 
ATOM   1396 C C     . ARG C 3 108 ? 18.149 -3.558  41.729 1.00 54.97 ? 115 ARG A C     1 
ATOM   1397 O O     . ARG C 3 108 ? 19.263 -4.027  41.433 1.00 48.58 ? 115 ARG A O     1 
ATOM   1398 C CB    . ARG C 3 108 ? 16.188 -4.263  40.361 1.00 60.52 ? 115 ARG A CB    1 
ATOM   1399 C CG    . ARG C 3 108 ? 16.816 -5.066  39.270 1.00 69.63 ? 115 ARG A CG    1 
ATOM   1400 C CD    . ARG C 3 108 ? 16.220 -6.431  39.328 1.00 74.60 ? 115 ARG A CD    1 
ATOM   1401 N NE    . ARG C 3 108 ? 14.803 -6.402  38.983 1.00 74.96 ? 115 ARG A NE    1 
ATOM   1402 C CZ    . ARG C 3 108 ? 14.347 -6.306  37.736 1.00 80.59 ? 115 ARG A CZ    1 
ATOM   1403 N NH1   . ARG C 3 108 ? 15.201 -6.225  36.727 1.00 78.39 ? 115 ARG A NH1   1 
ATOM   1404 N NH2   . ARG C 3 108 ? 13.042 -6.317  37.492 1.00 83.92 ? 115 ARG A NH2   1 
ATOM   1405 N N     . LEU C 3 109 ? 17.963 -2.285  42.061 1.00 49.74 ? 116 LEU A N     1 
ATOM   1406 C CA    . LEU C 3 109 ? 19.058 -1.336  42.101 1.00 46.66 ? 116 LEU A CA    1 
ATOM   1407 C C     . LEU C 3 109 ? 19.928 -1.634  43.295 1.00 47.45 ? 116 LEU A C     1 
ATOM   1408 O O     . LEU C 3 109 ? 21.119 -1.887  43.160 1.00 48.17 ? 116 LEU A O     1 
ATOM   1409 C CB    . LEU C 3 109 ? 18.508 0.079   42.231 1.00 46.18 ? 116 LEU A CB    1 
ATOM   1410 C CG    . LEU C 3 109 ? 19.505 1.221   42.113 1.00 41.09 ? 116 LEU A CG    1 
ATOM   1411 C CD1   . LEU C 3 109 ? 19.737 1.451   40.668 1.00 42.02 ? 116 LEU A CD1   1 
ATOM   1412 C CD2   . LEU C 3 109 ? 18.980 2.489   42.755 1.00 41.70 ? 116 LEU A CD2   1 
ATOM   1413 N N     . SER C 3 110 ? 19.305 -1.587  44.468 1.00 49.90 ? 117 SER A N     1 
ATOM   1414 C CA    . SER C 3 110 ? 19.958 -1.841  45.754 1.00 47.99 ? 117 SER A CA    1 
ATOM   1415 C C     . SER C 3 110 ? 20.797 -3.117  45.728 1.00 46.75 ? 117 SER A C     1 
ATOM   1416 O O     . SER C 3 110 ? 21.855 -3.188  46.357 1.00 47.00 ? 117 SER A O     1 
ATOM   1417 C CB    . SER C 3 110 ? 18.901 -1.926  46.858 1.00 47.92 ? 117 SER A CB    1 
ATOM   1418 O OG    . SER C 3 110 ? 18.208 -0.697  46.993 1.00 46.68 ? 117 SER A OG    1 
ATOM   1419 N N     . ALA C 3 111 ? 20.322 -4.122  45.005 1.00 43.14 ? 118 ALA A N     1 
ATOM   1420 C CA    . ALA C 3 111 ? 21.067 -5.355  44.878 1.00 43.34 ? 118 ALA A CA    1 
ATOM   1421 C C     . ALA C 3 111 ? 22.406 -5.021  44.233 1.00 42.45 ? 118 ALA A C     1 
ATOM   1422 O O     . ALA C 3 111 ? 23.468 -5.345  44.764 1.00 42.58 ? 118 ALA A O     1 
ATOM   1423 C CB    . ALA C 3 111 ? 20.314 -6.329  44.018 1.00 40.48 ? 118 ALA A CB    1 
ATOM   1424 N N     . GLN C 3 112 ? 22.339 -4.370  43.078 1.00 44.06 ? 119 GLN A N     1 
ATOM   1425 C CA    . GLN C 3 112 ? 23.526 -3.968  42.339 1.00 42.60 ? 119 GLN A CA    1 
ATOM   1426 C C     . GLN C 3 112 ? 24.504 -3.214  43.222 1.00 41.74 ? 119 GLN A C     1 
ATOM   1427 O O     . GLN C 3 112 ? 25.722 -3.461  43.200 1.00 36.19 ? 119 GLN A O     1 
ATOM   1428 C CB    . GLN C 3 112 ? 23.115 -3.107  41.163 1.00 37.70 ? 119 GLN A CB    1 
ATOM   1429 C CG    . GLN C 3 112 ? 22.589 -3.939  40.044 1.00 43.76 ? 119 GLN A CG    1 
ATOM   1430 C CD    . GLN C 3 112 ? 22.329 -3.140  38.792 1.00 45.66 ? 119 GLN A CD    1 
ATOM   1431 O OE1   . GLN C 3 112 ? 23.127 -2.290  38.417 1.00 56.55 ? 119 GLN A OE1   1 
ATOM   1432 N NE2   . GLN C 3 112 ? 21.221 -3.419  38.129 1.00 41.04 ? 119 GLN A NE2   1 
ATOM   1433 N N     . MET C 3 113 ? 23.963 -2.290  44.002 1.00 41.02 ? 120 MET A N     1 
ATOM   1434 C CA    . MET C 3 113 ? 24.804 -1.517  44.893 1.00 43.79 ? 120 MET A CA    1 
ATOM   1435 C C     . MET C 3 113 ? 25.495 -2.486  45.847 1.00 41.50 ? 120 MET A C     1 
ATOM   1436 O O     . MET C 3 113 ? 26.679 -2.356  46.128 1.00 36.79 ? 120 MET A O     1 
ATOM   1437 C CB    . MET C 3 113 ? 23.978 -0.491  45.675 1.00 45.90 ? 120 MET A CB    1 
ATOM   1438 C CG    . MET C 3 113 ? 23.332 0.623   44.844 1.00 43.57 ? 120 MET A CG    1 
ATOM   1439 S SD    . MET C 3 113 ? 22.421 1.805   45.922 1.00 53.09 ? 120 MET A SD    1 
ATOM   1440 C CE    . MET C 3 113 ? 23.651 3.064   46.150 1.00 44.33 ? 120 MET A CE    1 
ATOM   1441 N N     . ALA C 3 114 ? 24.744 -3.466  46.335 1.00 42.50 ? 121 ALA A N     1 
ATOM   1442 C CA    . ALA C 3 114 ? 25.298 -4.456  47.248 1.00 40.04 ? 121 ALA A CA    1 
ATOM   1443 C C     . ALA C 3 114 ? 26.439 -5.171  46.557 1.00 38.78 ? 121 ALA A C     1 
ATOM   1444 O O     . ALA C 3 114 ? 27.537 -5.225  47.077 1.00 40.62 ? 121 ALA A O     1 
ATOM   1445 C CB    . ALA C 3 114 ? 24.233 -5.438  47.667 1.00 37.96 ? 121 ALA A CB    1 
ATOM   1446 N N     . ARG C 3 115 ? 26.201 -5.708  45.375 1.00 36.73 ? 122 ARG A N     1 
ATOM   1447 C CA    . ARG C 3 115 ? 27.277 -6.395  44.686 1.00 41.60 ? 122 ARG A CA    1 
ATOM   1448 C C     . ARG C 3 115 ? 28.467 -5.451  44.511 1.00 45.07 ? 122 ARG A C     1 
ATOM   1449 O O     . ARG C 3 115 ? 29.608 -5.822  44.793 1.00 46.43 ? 122 ARG A O     1 
ATOM   1450 C CB    . ARG C 3 115 ? 26.798 -6.901  43.326 1.00 43.09 ? 122 ARG A CB    1 
ATOM   1451 C CG    . ARG C 3 115 ? 27.758 -7.827  42.610 1.00 48.36 ? 122 ARG A CG    1 
ATOM   1452 C CD    . ARG C 3 115 ? 26.991 -8.988  41.986 1.00 65.70 ? 122 ARG A CD    1 
ATOM   1453 N NE    . ARG C 3 115 ? 25.724 -8.550  41.383 1.00 81.16 ? 122 ARG A NE    1 
ATOM   1454 C CZ    . ARG C 3 115 ? 24.795 -9.364  40.872 1.00 85.22 ? 122 ARG A CZ    1 
ATOM   1455 N NH1   . ARG C 3 115 ? 24.981 -10.686 40.880 1.00 85.22 ? 122 ARG A NH1   1 
ATOM   1456 N NH2   . ARG C 3 115 ? 23.673 -8.853  40.361 1.00 85.22 ? 122 ARG A NH2   1 
ATOM   1457 N N     . ARG C 3 116 ? 28.196 -4.227  44.056 1.00 43.03 ? 123 ARG A N     1 
ATOM   1458 C CA    . ARG C 3 116 ? 29.255 -3.246  43.846 1.00 39.21 ? 123 ARG A CA    1 
ATOM   1459 C C     . ARG C 3 116 ? 30.104 -3.024  45.078 1.00 36.85 ? 123 ARG A C     1 
ATOM   1460 O O     . ARG C 3 116 ? 31.319 -2.968  44.986 1.00 35.83 ? 123 ARG A O     1 
ATOM   1461 C CB    . ARG C 3 116 ? 28.666 -1.915  43.380 1.00 38.88 ? 123 ARG A CB    1 
ATOM   1462 C CG    . ARG C 3 116 ? 28.492 -1.882  41.905 1.00 38.14 ? 123 ARG A CG    1 
ATOM   1463 C CD    . ARG C 3 116 ? 27.554 -0.804  41.457 1.00 36.16 ? 123 ARG A CD    1 
ATOM   1464 N NE    . ARG C 3 116 ? 26.919 -1.219  40.208 1.00 39.72 ? 123 ARG A NE    1 
ATOM   1465 C CZ    . ARG C 3 116 ? 26.265 -0.407  39.392 1.00 36.68 ? 123 ARG A CZ    1 
ATOM   1466 N NH1   . ARG C 3 116 ? 26.162 0.877   39.690 1.00 33.76 ? 123 ARG A NH1   1 
ATOM   1467 N NH2   . ARG C 3 116 ? 25.715 -0.885  38.291 1.00 30.11 ? 123 ARG A NH2   1 
ATOM   1468 N N     . LEU C 3 117 ? 29.452 -2.902  46.227 1.00 35.37 ? 124 LEU A N     1 
ATOM   1469 C CA    . LEU C 3 117 ? 30.142 -2.680  47.481 1.00 34.61 ? 124 LEU A CA    1 
ATOM   1470 C C     . LEU C 3 117 ? 30.985 -3.878  47.804 1.00 33.20 ? 124 LEU A C     1 
ATOM   1471 O O     . LEU C 3 117 ? 32.080 -3.734  48.327 1.00 33.76 ? 124 LEU A O     1 
ATOM   1472 C CB    . LEU C 3 117 ? 29.151 -2.433  48.622 1.00 34.90 ? 124 LEU A CB    1 
ATOM   1473 C CG    . LEU C 3 117 ? 29.817 -2.003  49.930 1.00 38.07 ? 124 LEU A CG    1 
ATOM   1474 C CD1   . LEU C 3 117 ? 30.580 -0.714  49.674 1.00 42.62 ? 124 LEU A CD1   1 
ATOM   1475 C CD2   . LEU C 3 117 ? 28.783 -1.794  51.027 1.00 38.87 ? 124 LEU A CD2   1 
ATOM   1476 N N     . GLN C 3 118 ? 30.479 -5.066  47.488 1.00 34.82 ? 125 GLN A N     1 
ATOM   1477 C CA    . GLN C 3 118 ? 31.225 -6.289  47.766 1.00 38.29 ? 125 GLN A CA    1 
ATOM   1478 C C     . GLN C 3 118 ? 32.543 -6.245  47.027 1.00 37.41 ? 125 GLN A C     1 
ATOM   1479 O O     . GLN C 3 118 ? 33.601 -6.302  47.624 1.00 39.94 ? 125 GLN A O     1 
ATOM   1480 C CB    . GLN C 3 118 ? 30.444 -7.542  47.335 1.00 43.28 ? 125 GLN A CB    1 
ATOM   1481 C CG    . GLN C 3 118 ? 29.129 -7.761  48.094 1.00 59.96 ? 125 GLN A CG    1 
ATOM   1482 C CD    . GLN C 3 118 ? 28.310 -8.992  47.633 1.00 66.66 ? 125 GLN A CD    1 
ATOM   1483 O OE1   . GLN C 3 118 ? 28.264 -9.336  46.439 1.00 67.83 ? 125 GLN A OE1   1 
ATOM   1484 N NE2   . GLN C 3 118 ? 27.636 -9.634  48.588 1.00 68.91 ? 125 GLN A NE2   1 
ATOM   1485 N N     . VAL C 3 119 ? 32.478 -6.116  45.716 1.00 34.41 ? 126 VAL A N     1 
ATOM   1486 C CA    . VAL C 3 119 ? 33.680 -6.103  44.924 1.00 32.15 ? 126 VAL A CA    1 
ATOM   1487 C C     . VAL C 3 119 ? 34.635 -4.947  45.222 1.00 31.04 ? 126 VAL A C     1 
ATOM   1488 O O     . VAL C 3 119 ? 35.834 -5.122  45.159 1.00 32.97 ? 126 VAL A O     1 
ATOM   1489 C CB    . VAL C 3 119 ? 33.310 -6.178  43.395 1.00 32.34 ? 126 VAL A CB    1 
ATOM   1490 C CG1   . VAL C 3 119 ? 31.857 -6.485  43.234 1.00 25.54 ? 126 VAL A CG1   1 
ATOM   1491 C CG2   . VAL C 3 119 ? 33.644 -4.910  42.687 1.00 34.89 ? 126 VAL A CG2   1 
ATOM   1492 N N     . THR C 3 120 ? 34.130 -3.766  45.551 1.00 34.36 ? 127 THR A N     1 
ATOM   1493 C CA    . THR C 3 120 ? 35.032 -2.648  45.819 1.00 34.12 ? 127 THR A CA    1 
ATOM   1494 C C     . THR C 3 120 ? 35.821 -2.999  47.035 1.00 32.61 ? 127 THR A C     1 
ATOM   1495 O O     . THR C 3 120 ? 37.020 -2.791  47.084 1.00 36.88 ? 127 THR A O     1 
ATOM   1496 C CB    . THR C 3 120 ? 34.295 -1.319  46.081 1.00 34.00 ? 127 THR A CB    1 
ATOM   1497 O OG1   . THR C 3 120 ? 33.437 -1.026  44.980 1.00 40.33 ? 127 THR A OG1   1 
ATOM   1498 C CG2   . THR C 3 120 ? 35.288 -0.182  46.199 1.00 33.28 ? 127 THR A CG2   1 
ATOM   1499 N N     . SER C 3 121 ? 35.129 -3.535  48.026 1.00 30.64 ? 128 SER A N     1 
ATOM   1500 C CA    . SER C 3 121 ? 35.759 -3.963  49.257 1.00 26.83 ? 128 SER A CA    1 
ATOM   1501 C C     . SER C 3 121 ? 36.779 -5.026  48.896 1.00 24.65 ? 128 SER A C     1 
ATOM   1502 O O     . SER C 3 121 ? 37.915 -4.996  49.335 1.00 24.30 ? 128 SER A O     1 
ATOM   1503 C CB    . SER C 3 121 ? 34.706 -4.540  50.172 1.00 27.14 ? 128 SER A CB    1 
ATOM   1504 O OG    . SER C 3 121 ? 33.544 -3.750  50.114 1.00 36.48 ? 128 SER A OG    1 
ATOM   1505 N N     . GLU C 3 122 ? 36.370 -5.972  48.075 1.00 29.32 ? 129 GLU A N     1 
ATOM   1506 C CA    . GLU C 3 122 ? 37.281 -7.006  47.663 1.00 36.84 ? 129 GLU A CA    1 
ATOM   1507 C C     . GLU C 3 122 ? 38.492 -6.337  47.038 1.00 40.42 ? 129 GLU A C     1 
ATOM   1508 O O     . GLU C 3 122 ? 39.621 -6.774  47.218 1.00 44.61 ? 129 GLU A O     1 
ATOM   1509 C CB    . GLU C 3 122 ? 36.630 -7.931  46.645 1.00 44.08 ? 129 GLU A CB    1 
ATOM   1510 C CG    . GLU C 3 122 ? 37.561 -9.063  46.240 1.00 60.76 ? 129 GLU A CG    1 
ATOM   1511 C CD    . GLU C 3 122 ? 37.058 -9.879  45.065 1.00 69.37 ? 129 GLU A CD    1 
ATOM   1512 O OE1   . GLU C 3 122 ? 37.850 -10.724 44.580 1.00 73.12 ? 129 GLU A OE1   1 
ATOM   1513 O OE2   . GLU C 3 122 ? 35.891 -9.681  44.634 1.00 72.28 ? 129 GLU A OE2   1 
ATOM   1514 N N     . LYS C 3 123 ? 38.237 -5.266  46.300 1.00 41.35 ? 130 LYS A N     1 
ATOM   1515 C CA    . LYS C 3 123 ? 39.289 -4.519  45.645 1.00 40.05 ? 130 LYS A CA    1 
ATOM   1516 C C     . LYS C 3 123 ? 40.177 -3.787  46.666 1.00 38.65 ? 130 LYS A C     1 
ATOM   1517 O O     . LYS C 3 123 ? 41.357 -3.539  46.399 1.00 33.29 ? 130 LYS A O     1 
ATOM   1518 C CB    . LYS C 3 123 ? 38.680 -3.524  44.661 1.00 40.93 ? 130 LYS A CB    1 
ATOM   1519 C CG    . LYS C 3 123 ? 39.695 -2.957  43.683 1.00 45.91 ? 130 LYS A CG    1 
ATOM   1520 C CD    . LYS C 3 123 ? 39.042 -1.962  42.751 1.00 46.16 ? 130 LYS A CD    1 
ATOM   1521 C CE    . LYS C 3 123 ? 37.891 -2.596  41.959 1.00 49.20 ? 130 LYS A CE    1 
ATOM   1522 N NZ    . LYS C 3 123 ? 38.313 -3.573  40.925 1.00 46.97 ? 130 LYS A NZ    1 
ATOM   1523 N N     . VAL C 3 124 ? 39.617 -3.448  47.831 1.00 37.37 ? 131 VAL A N     1 
ATOM   1524 C CA    . VAL C 3 124 ? 40.401 -2.768  48.855 1.00 35.44 ? 131 VAL A CA    1 
ATOM   1525 C C     . VAL C 3 124 ? 41.400 -3.718  49.471 1.00 35.24 ? 131 VAL A C     1 
ATOM   1526 O O     . VAL C 3 124 ? 42.551 -3.360  49.651 1.00 34.73 ? 131 VAL A O     1 
ATOM   1527 C CB    . VAL C 3 124 ? 39.567 -2.219  49.980 1.00 32.99 ? 131 VAL A CB    1 
ATOM   1528 C CG1   . VAL C 3 124 ? 40.473 -1.418  50.904 1.00 34.09 ? 131 VAL A CG1   1 
ATOM   1529 C CG2   . VAL C 3 124 ? 38.463 -1.363  49.434 1.00 30.44 ? 131 VAL A CG2   1 
ATOM   1530 N N     . GLY C 3 125 ? 40.954 -4.926  49.804 1.00 32.32 ? 132 GLY A N     1 
ATOM   1531 C CA    . GLY C 3 125 ? 41.866 -5.908  50.357 1.00 31.98 ? 132 GLY A CA    1 
ATOM   1532 C C     . GLY C 3 125 ? 42.980 -6.232  49.375 1.00 29.97 ? 132 GLY A C     1 
ATOM   1533 O O     . GLY C 3 125 ? 44.099 -6.460  49.757 1.00 30.23 ? 132 GLY A O     1 
ATOM   1534 N N     . ASN C 3 126 ? 42.655 -6.253  48.098 1.00 30.47 ? 133 ASN A N     1 
ATOM   1535 C CA    . ASN C 3 126 ? 43.606 -6.530  47.043 1.00 32.12 ? 133 ASN A CA    1 
ATOM   1536 C C     . ASN C 3 126 ? 44.774 -5.556  47.029 1.00 32.54 ? 133 ASN A C     1 
ATOM   1537 O O     . ASN C 3 126 ? 45.916 -5.935  46.927 1.00 28.94 ? 133 ASN A O     1 
ATOM   1538 C CB    . ASN C 3 126 ? 42.885 -6.448  45.711 1.00 33.11 ? 133 ASN A CB    1 
ATOM   1539 C CG    . ASN C 3 126 ? 42.126 -7.706  45.379 1.00 37.07 ? 133 ASN A CG    1 
ATOM   1540 O OD1   . ASN C 3 126 ? 41.303 -7.718  44.462 1.00 40.40 ? 133 ASN A OD1   1 
ATOM   1541 N ND2   . ASN C 3 126 ? 42.413 -8.786  46.106 1.00 41.31 ? 133 ASN A ND2   1 
ATOM   1542 N N     . LEU C 3 127 ? 44.458 -4.280  47.094 1.00 39.39 ? 134 LEU A N     1 
ATOM   1543 C CA    . LEU C 3 127 ? 45.467 -3.232  47.107 1.00 42.47 ? 134 LEU A CA    1 
ATOM   1544 C C     . LEU C 3 127 ? 46.247 -3.290  48.427 1.00 42.71 ? 134 LEU A C     1 
ATOM   1545 O O     . LEU C 3 127 ? 47.409 -2.900  48.504 1.00 44.36 ? 134 LEU A O     1 
ATOM   1546 C CB    . LEU C 3 127 ? 44.788 -1.853  46.971 1.00 38.67 ? 134 LEU A CB    1 
ATOM   1547 C CG    . LEU C 3 127 ? 44.017 -1.628  45.668 1.00 48.20 ? 134 LEU A CG    1 
ATOM   1548 C CD1   . LEU C 3 127 ? 43.152 -0.391  45.762 1.00 44.34 ? 134 LEU A CD1   1 
ATOM   1549 C CD2   . LEU C 3 127 ? 45.000 -1.529  44.490 1.00 51.78 ? 134 LEU A CD2   1 
ATOM   1550 N N     . ALA C 3 128 ? 45.603 -3.795  49.461 1.00 37.99 ? 135 ALA A N     1 
ATOM   1551 C CA    . ALA C 3 128 ? 46.229 -3.838  50.751 1.00 37.75 ? 135 ALA A CA    1 
ATOM   1552 C C     . ALA C 3 128 ? 47.029 -5.102  50.953 1.00 41.37 ? 135 ALA A C     1 
ATOM   1553 O O     . ALA C 3 128 ? 48.105 -5.086  51.545 1.00 43.32 ? 135 ALA A O     1 
ATOM   1554 C CB    . ALA C 3 128 ? 45.164 -3.709  51.844 1.00 28.42 ? 135 ALA A CB    1 
ATOM   1555 N N     . PHE C 3 129 ? 46.515 -6.203  50.439 1.00 41.67 ? 136 PHE A N     1 
ATOM   1556 C CA    . PHE C 3 129 ? 47.171 -7.462  50.658 1.00 40.29 ? 136 PHE A CA    1 
ATOM   1557 C C     . PHE C 3 129 ? 48.027 -8.034  49.545 1.00 43.84 ? 136 PHE A C     1 
ATOM   1558 O O     . PHE C 3 129 ? 48.944 -8.801  49.837 1.00 50.32 ? 136 PHE A O     1 
ATOM   1559 C CB    . PHE C 3 129 ? 46.140 -8.511  51.062 1.00 38.05 ? 136 PHE A CB    1 
ATOM   1560 C CG    . PHE C 3 129 ? 45.343 -8.162  52.275 1.00 36.97 ? 136 PHE A CG    1 
ATOM   1561 C CD1   . PHE C 3 129 ? 45.969 -7.721  53.438 1.00 36.22 ? 136 PHE A CD1   1 
ATOM   1562 C CD2   . PHE C 3 129 ? 43.957 -8.336  52.273 1.00 39.77 ? 136 PHE A CD2   1 
ATOM   1563 C CE1   . PHE C 3 129 ? 45.242 -7.460  54.574 1.00 35.86 ? 136 PHE A CE1   1 
ATOM   1564 C CE2   . PHE C 3 129 ? 43.210 -8.081  53.407 1.00 41.27 ? 136 PHE A CE2   1 
ATOM   1565 C CZ    . PHE C 3 129 ? 43.857 -7.639  54.569 1.00 42.54 ? 136 PHE A CZ    1 
ATOM   1566 N N     . LEU C 3 130 ? 47.750 -7.704  48.287 1.00 43.09 ? 137 LEU A N     1 
ATOM   1567 C CA    . LEU C 3 130 ? 48.549 -8.270  47.206 1.00 42.43 ? 137 LEU A CA    1 
ATOM   1568 C C     . LEU C 3 130 ? 49.534 -7.293  46.634 1.00 42.17 ? 137 LEU A C     1 
ATOM   1569 O O     . LEU C 3 130 ? 49.316 -6.095  46.699 1.00 43.03 ? 137 LEU A O     1 
ATOM   1570 C CB    . LEU C 3 130 ? 47.668 -8.759  46.065 1.00 46.20 ? 137 LEU A CB    1 
ATOM   1571 C CG    . LEU C 3 130 ? 46.578 -9.791  46.341 1.00 45.77 ? 137 LEU A CG    1 
ATOM   1572 C CD1   . LEU C 3 130 ? 45.799 -10.044 45.047 1.00 39.18 ? 137 LEU A CD1   1 
ATOM   1573 C CD2   . LEU C 3 130 ? 47.186 -11.065 46.871 1.00 37.26 ? 137 LEU A CD2   1 
ATOM   1574 N N     . ASP C 3 131 ? 50.629 -7.829  46.092 1.00 44.99 ? 138 ASP A N     1 
ATOM   1575 C CA    . ASP C 3 131 ? 51.676 -7.043  45.438 1.00 41.91 ? 138 ASP A CA    1 
ATOM   1576 C C     . ASP C 3 131 ? 51.256 -6.924  43.967 1.00 40.67 ? 138 ASP A C     1 
ATOM   1577 O O     . ASP C 3 131 ? 50.435 -7.705  43.490 1.00 42.02 ? 138 ASP A O     1 
ATOM   1578 C CB    . ASP C 3 131 ? 53.035 -7.748  45.560 1.00 49.53 ? 138 ASP A CB    1 
ATOM   1579 C CG    . ASP C 3 131 ? 52.983 -9.253  45.213 1.00 58.00 ? 138 ASP A CG    1 
ATOM   1580 O OD1   . ASP C 3 131 ? 54.058 -9.837  44.960 1.00 62.12 ? 138 ASP A OD1   1 
ATOM   1581 O OD2   . ASP C 3 131 ? 51.895 -9.869  45.208 1.00 62.05 ? 138 ASP A OD2   1 
ATOM   1582 N N     . VAL C 3 132 ? 51.793 -5.958  43.240 1.00 37.63 ? 139 VAL A N     1 
ATOM   1583 C CA    . VAL C 3 132 ? 51.405 -5.784  41.844 1.00 34.85 ? 139 VAL A CA    1 
ATOM   1584 C C     . VAL C 3 132 ? 51.283 -7.071  41.027 1.00 38.05 ? 139 VAL A C     1 
ATOM   1585 O O     . VAL C 3 132 ? 50.283 -7.299  40.352 1.00 37.40 ? 139 VAL A O     1 
ATOM   1586 C CB    . VAL C 3 132 ? 52.372 -4.905  41.117 1.00 31.83 ? 139 VAL A CB    1 
ATOM   1587 C CG1   . VAL C 3 132 ? 51.873 -4.678  39.696 1.00 40.66 ? 139 VAL A CG1   1 
ATOM   1588 C CG2   . VAL C 3 132 ? 52.524 -3.634  41.834 1.00 31.58 ? 139 VAL A CG2   1 
ATOM   1589 N N     . THR C 3 133 ? 52.325 -7.892  41.062 1.00 40.20 ? 140 THR A N     1 
ATOM   1590 C CA    . THR C 3 133 ? 52.332 -9.148  40.337 1.00 35.98 ? 140 THR A CA    1 
ATOM   1591 C C     . THR C 3 133 ? 51.008 -9.857  40.573 1.00 35.59 ? 140 THR A C     1 
ATOM   1592 O O     . THR C 3 133 ? 50.291 -10.142 39.622 1.00 32.72 ? 140 THR A O     1 
ATOM   1593 C CB    . THR C 3 133 ? 53.501 -10.077 40.812 1.00 35.47 ? 140 THR A CB    1 
ATOM   1594 O OG1   . THR C 3 133 ? 54.760 -9.413  40.639 1.00 43.82 ? 140 THR A OG1   1 
ATOM   1595 C CG2   . THR C 3 133 ? 53.541 -11.337 40.010 1.00 29.43 ? 140 THR A CG2   1 
ATOM   1596 N N     . GLY C 3 134 ? 50.691 -10.121 41.844 1.00 38.26 ? 141 GLY A N     1 
ATOM   1597 C CA    . GLY C 3 134 ? 49.458 -10.819 42.213 1.00 35.54 ? 141 GLY A CA    1 
ATOM   1598 C C     . GLY C 3 134 ? 48.180 -10.186 41.707 1.00 34.43 ? 141 GLY A C     1 
ATOM   1599 O O     . GLY C 3 134 ? 47.236 -10.867 41.306 1.00 32.97 ? 141 GLY A O     1 
ATOM   1600 N N     . ARG C 3 135 ? 48.168 -8.861  41.721 1.00 34.88 ? 142 ARG A N     1 
ATOM   1601 C CA    . ARG C 3 135 ? 47.038 -8.079  41.258 1.00 34.86 ? 142 ARG A CA    1 
ATOM   1602 C C     . ARG C 3 135 ? 46.932 -8.203  39.768 1.00 31.55 ? 142 ARG A C     1 
ATOM   1603 O O     . ARG C 3 135 ? 45.866 -8.438  39.255 1.00 33.08 ? 142 ARG A O     1 
ATOM   1604 C CB    . ARG C 3 135 ? 47.205 -6.619  41.700 1.00 37.80 ? 142 ARG A CB    1 
ATOM   1605 C CG    . ARG C 3 135 ? 47.511 -6.529  43.205 1.00 39.50 ? 142 ARG A CG    1 
ATOM   1606 C CD    . ARG C 3 135 ? 46.628 -5.542  43.903 1.00 41.20 ? 142 ARG A CD    1 
ATOM   1607 N NE    . ARG C 3 135 ? 47.026 -4.200  43.523 1.00 41.07 ? 142 ARG A NE    1 
ATOM   1608 C CZ    . ARG C 3 135 ? 48.179 -3.665  43.871 1.00 28.21 ? 142 ARG A CZ    1 
ATOM   1609 N NH1   . ARG C 3 135 ? 49.008 -4.360  44.594 1.00 30.40 ? 142 ARG A NH1   1 
ATOM   1610 N NH2   . ARG C 3 135 ? 48.495 -2.450  43.495 1.00 29.73 ? 142 ARG A NH2   1 
ATOM   1611 N N     . ILE C 3 136 ? 48.039 -8.049  39.064 1.00 33.72 ? 143 ILE A N     1 
ATOM   1612 C CA    . ILE C 3 136 ? 48.012 -8.220  37.623 1.00 35.86 ? 143 ILE A CA    1 
ATOM   1613 C C     . ILE C 3 136 ? 47.563 -9.656  37.331 1.00 38.63 ? 143 ILE A C     1 
ATOM   1614 O O     . ILE C 3 136 ? 46.649 -9.872  36.546 1.00 43.07 ? 143 ILE A O     1 
ATOM   1615 C CB    . ILE C 3 136 ? 49.396 -7.944  37.003 1.00 32.92 ? 143 ILE A CB    1 
ATOM   1616 C CG1   . ILE C 3 136 ? 49.664 -6.437  37.039 1.00 32.16 ? 143 ILE A CG1   1 
ATOM   1617 C CG2   . ILE C 3 136 ? 49.458 -8.457  35.588 1.00 26.15 ? 143 ILE A CG2   1 
ATOM   1618 C CD1   . ILE C 3 136 ? 51.099 -6.058  36.828 1.00 37.79 ? 143 ILE A CD1   1 
ATOM   1619 N N     . ALA C 3 137 ? 48.178 -10.638 37.982 1.00 38.88 ? 144 ALA A N     1 
ATOM   1620 C CA    . ALA C 3 137 ? 47.793 -12.034 37.771 1.00 40.73 ? 144 ALA A CA    1 
ATOM   1621 C C     . ALA C 3 137 ? 46.303 -12.266 37.922 1.00 40.61 ? 144 ALA A C     1 
ATOM   1622 O O     . ALA C 3 137 ? 45.681 -12.863 37.054 1.00 43.31 ? 144 ALA A O     1 
ATOM   1623 C CB    . ALA C 3 137 ? 48.526 -12.934 38.712 1.00 33.76 ? 144 ALA A CB    1 
ATOM   1624 N N     . GLN C 3 138 ? 45.731 -11.802 39.025 1.00 42.67 ? 145 GLN A N     1 
ATOM   1625 C CA    . GLN C 3 138 ? 44.298 -11.973 39.270 1.00 45.88 ? 145 GLN A CA    1 
ATOM   1626 C C     . GLN C 3 138 ? 43.448 -11.285 38.203 1.00 44.54 ? 145 GLN A C     1 
ATOM   1627 O O     . GLN C 3 138 ? 42.330 -11.703 37.933 1.00 48.70 ? 145 GLN A O     1 
ATOM   1628 C CB    . GLN C 3 138 ? 43.914 -11.417 40.642 1.00 51.77 ? 145 GLN A CB    1 
ATOM   1629 C CG    . GLN C 3 138 ? 42.465 -11.721 40.998 1.00 68.13 ? 145 GLN A CG    1 
ATOM   1630 C CD    . GLN C 3 138 ? 42.057 -11.225 42.379 1.00 76.32 ? 145 GLN A CD    1 
ATOM   1631 O OE1   . GLN C 3 138 ? 42.645 -11.614 43.392 1.00 80.69 ? 145 GLN A OE1   1 
ATOM   1632 N NE2   . GLN C 3 138 ? 41.032 -10.367 42.424 1.00 78.58 ? 145 GLN A NE2   1 
ATOM   1633 N N     . THR C 3 139 ? 43.992 -10.231 37.605 1.00 36.01 ? 146 THR A N     1 
ATOM   1634 C CA    . THR C 3 139 ? 43.322 -9.463  36.577 1.00 31.27 ? 146 THR A CA    1 
ATOM   1635 C C     . THR C 3 139 ? 43.287 -10.120 35.192 1.00 35.19 ? 146 THR A C     1 
ATOM   1636 O O     . THR C 3 139 ? 42.257 -10.077 34.505 1.00 33.66 ? 146 THR A O     1 
ATOM   1637 C CB    . THR C 3 139 ? 43.989 -8.113  36.437 1.00 29.76 ? 146 THR A CB    1 
ATOM   1638 O OG1   . THR C 3 139 ? 43.952 -7.452  37.697 1.00 30.47 ? 146 THR A OG1   1 
ATOM   1639 C CG2   . THR C 3 139 ? 43.285 -7.273  35.392 1.00 23.72 ? 146 THR A CG2   1 
ATOM   1640 N N     . LEU C 3 140 ? 44.415 -10.695 34.768 1.00 33.81 ? 147 LEU A N     1 
ATOM   1641 C CA    . LEU C 3 140 ? 44.483 -11.368 33.480 1.00 31.32 ? 147 LEU A CA    1 
ATOM   1642 C C     . LEU C 3 140 ? 43.549 -12.570 33.573 1.00 35.31 ? 147 LEU A C     1 
ATOM   1643 O O     . LEU C 3 140 ? 42.842 -12.919 32.624 1.00 30.63 ? 147 LEU A O     1 
ATOM   1644 C CB    . LEU C 3 140 ? 45.915 -11.792 33.199 1.00 27.72 ? 147 LEU A CB    1 
ATOM   1645 C CG    . LEU C 3 140 ? 46.895 -10.612 33.052 1.00 27.41 ? 147 LEU A CG    1 
ATOM   1646 C CD1   . LEU C 3 140 ? 48.297 -11.133 32.836 1.00 21.66 ? 147 LEU A CD1   1 
ATOM   1647 C CD2   . LEU C 3 140 ? 46.487 -9.721  31.894 1.00 22.10 ? 147 LEU A CD2   1 
ATOM   1648 N N     . LEU C 3 141 ? 43.527 -13.173 34.758 1.00 39.56 ? 148 LEU A N     1 
ATOM   1649 C CA    . LEU C 3 141 ? 42.662 -14.307 35.051 1.00 44.02 ? 148 LEU A CA    1 
ATOM   1650 C C     . LEU C 3 141 ? 41.191 -13.923 34.885 1.00 47.36 ? 148 LEU A C     1 
ATOM   1651 O O     . LEU C 3 141 ? 40.441 -14.620 34.207 1.00 45.51 ? 148 LEU A O     1 
ATOM   1652 C CB    . LEU C 3 141 ? 42.897 -14.782 36.482 1.00 49.81 ? 148 LEU A CB    1 
ATOM   1653 C CG    . LEU C 3 141 ? 43.450 -16.200 36.596 1.00 55.44 ? 148 LEU A CG    1 
ATOM   1654 C CD1   . LEU C 3 141 ? 42.530 -17.134 35.820 1.00 55.78 ? 148 LEU A CD1   1 
ATOM   1655 C CD2   . LEU C 3 141 ? 44.891 -16.254 36.041 1.00 59.51 ? 148 LEU A CD2   1 
ATOM   1656 N N     . ASN C 3 142 ? 40.784 -12.825 35.529 1.00 50.08 ? 149 ASN A N     1 
ATOM   1657 C CA    . ASN C 3 142 ? 39.415 -12.335 35.439 1.00 49.95 ? 149 ASN A CA    1 
ATOM   1658 C C     . ASN C 3 142 ? 39.129 -11.947 34.007 1.00 48.74 ? 149 ASN A C     1 
ATOM   1659 O O     . ASN C 3 142 ? 38.124 -12.353 33.428 1.00 48.39 ? 149 ASN A O     1 
ATOM   1660 C CB    . ASN C 3 142 ? 39.207 -11.127 36.347 1.00 57.03 ? 149 ASN A CB    1 
ATOM   1661 C CG    . ASN C 3 142 ? 39.052 -11.521 37.808 1.00 69.25 ? 149 ASN A CG    1 
ATOM   1662 O OD1   . ASN C 3 142 ? 38.344 -12.490 38.119 1.00 74.62 ? 149 ASN A OD1   1 
ATOM   1663 N ND2   . ASN C 3 142 ? 39.705 -10.770 38.718 1.00 68.97 ? 149 ASN A ND2   1 
ATOM   1664 N N     . LEU C 3 143 ? 40.021 -11.163 33.428 1.00 44.42 ? 150 LEU A N     1 
ATOM   1665 C CA    . LEU C 3 143 ? 39.849 -10.752 32.053 1.00 43.67 ? 150 LEU A CA    1 
ATOM   1666 C C     . LEU C 3 143 ? 39.623 -11.936 31.115 1.00 45.25 ? 150 LEU A C     1 
ATOM   1667 O O     . LEU C 3 143 ? 38.776 -11.896 30.240 1.00 42.99 ? 150 LEU A O     1 
ATOM   1668 C CB    . LEU C 3 143 ? 41.066 -9.955  31.614 1.00 40.96 ? 150 LEU A CB    1 
ATOM   1669 C CG    . LEU C 3 143 ? 41.133 -8.585  32.305 1.00 42.58 ? 150 LEU A CG    1 
ATOM   1670 C CD1   . LEU C 3 143 ? 42.395 -7.815  31.897 1.00 38.26 ? 150 LEU A CD1   1 
ATOM   1671 C CD2   . LEU C 3 143 ? 39.885 -7.798  31.949 1.00 34.42 ? 150 LEU A CD2   1 
ATOM   1672 N N     . ALA C 3 144 ? 40.372 -13.006 31.314 1.00 48.55 ? 151 ALA A N     1 
ATOM   1673 C CA    . ALA C 3 144 ? 40.249 -14.167 30.453 1.00 49.21 ? 151 ALA A CA    1 
ATOM   1674 C C     . ALA C 3 144 ? 38.946 -14.918 30.635 1.00 52.25 ? 151 ALA A C     1 
ATOM   1675 O O     . ALA C 3 144 ? 38.479 -15.574 29.706 1.00 54.70 ? 151 ALA A O     1 
ATOM   1676 C CB    . ALA C 3 144 ? 41.412 -15.104 30.691 1.00 47.03 ? 151 ALA A CB    1 
ATOM   1677 N N     . LYS C 3 145 ? 38.363 -14.850 31.828 1.00 53.14 ? 152 LYS A N     1 
ATOM   1678 C CA    . LYS C 3 145 ? 37.110 -15.553 32.078 1.00 53.35 ? 152 LYS A CA    1 
ATOM   1679 C C     . LYS C 3 145 ? 35.951 -14.726 31.530 1.00 57.02 ? 152 LYS A C     1 
ATOM   1680 O O     . LYS C 3 145 ? 34.808 -15.172 31.550 1.00 58.61 ? 152 LYS A O     1 
ATOM   1681 C CB    . LYS C 3 145 ? 36.880 -15.774 33.572 1.00 50.46 ? 152 LYS A CB    1 
ATOM   1682 C CG    . LYS C 3 145 ? 37.930 -16.586 34.322 1.00 55.14 ? 152 LYS A CG    1 
ATOM   1683 C CD    . LYS C 3 145 ? 37.600 -16.609 35.832 1.00 53.78 ? 152 LYS A CD    1 
ATOM   1684 C CE    . LYS C 3 145 ? 38.733 -17.177 36.685 1.00 56.67 ? 152 LYS A CE    1 
ATOM   1685 N NZ    . LYS C 3 145 ? 38.897 -18.647 36.565 1.00 52.95 ? 152 LYS A NZ    1 
ATOM   1686 N N     . GLN C 3 146 ? 36.235 -13.515 31.057 1.00 59.11 ? 153 GLN A N     1 
ATOM   1687 C CA    . GLN C 3 146 ? 35.181 -12.668 30.522 1.00 61.19 ? 153 GLN A CA    1 
ATOM   1688 C C     . GLN C 3 146 ? 34.693 -13.202 29.193 1.00 63.72 ? 153 GLN A C     1 
ATOM   1689 O O     . GLN C 3 146 ? 35.443 -13.824 28.448 1.00 65.36 ? 153 GLN A O     1 
ATOM   1690 C CB    . GLN C 3 146 ? 35.656 -11.228 30.344 1.00 63.37 ? 153 GLN A CB    1 
ATOM   1691 C CG    . GLN C 3 146 ? 35.360 -10.321 31.520 1.00 70.71 ? 153 GLN A CG    1 
ATOM   1692 C CD    . GLN C 3 146 ? 35.580 -8.844  31.178 1.00 81.68 ? 153 GLN A CD    1 
ATOM   1693 O OE1   . GLN C 3 146 ? 36.588 -8.482  30.565 1.00 85.22 ? 153 GLN A OE1   1 
ATOM   1694 N NE2   . GLN C 3 146 ? 34.637 -7.985  31.579 1.00 85.22 ? 153 GLN A NE2   1 
ATOM   1695 N N     . PRO C 3 147 ? 33.414 -12.968 28.884 1.00 64.86 ? 154 PRO A N     1 
ATOM   1696 C CA    . PRO C 3 147 ? 32.761 -13.404 27.653 1.00 63.12 ? 154 PRO A CA    1 
ATOM   1697 C C     . PRO C 3 147 ? 33.348 -12.792 26.387 1.00 63.61 ? 154 PRO A C     1 
ATOM   1698 O O     . PRO C 3 147 ? 33.265 -13.386 25.311 1.00 66.27 ? 154 PRO A O     1 
ATOM   1699 C CB    . PRO C 3 147 ? 31.318 -12.976 27.877 1.00 62.61 ? 154 PRO A CB    1 
ATOM   1700 C CG    . PRO C 3 147 ? 31.167 -13.121 29.352 1.00 62.66 ? 154 PRO A CG    1 
ATOM   1701 C CD    . PRO C 3 147 ? 32.412 -12.453 29.833 1.00 66.58 ? 154 PRO A CD    1 
ATOM   1702 N N     . ASP C 3 148 ? 33.932 -11.605 26.507 1.00 60.93 ? 155 ASP A N     1 
ATOM   1703 C CA    . ASP C 3 148 ? 34.496 -10.947 25.345 1.00 58.92 ? 155 ASP A CA    1 
ATOM   1704 C C     . ASP C 3 148 ? 35.902 -11.465 25.069 1.00 57.40 ? 155 ASP A C     1 
ATOM   1705 O O     . ASP C 3 148 ? 36.554 -11.055 24.106 1.00 53.66 ? 155 ASP A O     1 
ATOM   1706 C CB    . ASP C 3 148 ? 34.506 -9.436  25.557 1.00 63.58 ? 155 ASP A CB    1 
ATOM   1707 C CG    . ASP C 3 148 ? 35.619 -8.978  26.484 1.00 69.03 ? 155 ASP A CG    1 
ATOM   1708 O OD1   . ASP C 3 148 ? 35.780 -9.554  27.583 1.00 73.22 ? 155 ASP A OD1   1 
ATOM   1709 O OD2   . ASP C 3 148 ? 36.334 -8.026  26.109 1.00 68.72 ? 155 ASP A OD2   1 
ATOM   1710 N N     . ALA C 3 149 ? 36.368 -12.374 25.921 1.00 56.51 ? 156 ALA A N     1 
ATOM   1711 C CA    . ALA C 3 149 ? 37.690 -12.959 25.738 1.00 56.98 ? 156 ALA A CA    1 
ATOM   1712 C C     . ALA C 3 149 ? 37.662 -13.903 24.541 1.00 56.23 ? 156 ALA A C     1 
ATOM   1713 O O     . ALA C 3 149 ? 36.693 -14.636 24.339 1.00 54.62 ? 156 ALA A O     1 
ATOM   1714 C CB    . ALA C 3 149 ? 38.122 -13.713 26.982 1.00 55.96 ? 156 ALA A CB    1 
ATOM   1715 N N     . MET C 3 150 ? 38.737 -13.863 23.756 1.00 58.05 ? 157 MET A N     1 
ATOM   1716 C CA    . MET C 3 150 ? 38.906 -14.684 22.563 1.00 57.66 ? 157 MET A CA    1 
ATOM   1717 C C     . MET C 3 150 ? 39.421 -16.061 22.935 1.00 55.58 ? 157 MET A C     1 
ATOM   1718 O O     . MET C 3 150 ? 40.295 -16.212 23.793 1.00 55.47 ? 157 MET A O     1 
ATOM   1719 C CB    . MET C 3 150 ? 39.903 -14.019 21.607 1.00 67.25 ? 157 MET A CB    1 
ATOM   1720 C CG    . MET C 3 150 ? 39.456 -12.679 21.041 1.00 74.86 ? 157 MET A CG    1 
ATOM   1721 S SD    . MET C 3 150 ? 37.867 -12.844 20.144 1.00 85.22 ? 157 MET A SD    1 
ATOM   1722 C CE    . MET C 3 150 ? 38.355 -13.853 18.730 1.00 85.22 ? 157 MET A CE    1 
ATOM   1723 N N     . THR C 3 151 ? 38.875 -17.073 22.286 1.00 54.53 ? 158 THR A N     1 
ATOM   1724 C CA    . THR C 3 151 ? 39.296 -18.441 22.552 1.00 58.40 ? 158 THR A CA    1 
ATOM   1725 C C     . THR C 3 151 ? 40.533 -18.750 21.685 1.00 54.20 ? 158 THR A C     1 
ATOM   1726 O O     . THR C 3 151 ? 40.546 -18.516 20.483 1.00 54.14 ? 158 THR A O     1 
ATOM   1727 C CB    . THR C 3 151 ? 38.098 -19.442 22.291 1.00 62.17 ? 158 THR A CB    1 
ATOM   1728 O OG1   . THR C 3 151 ? 38.579 -20.791 22.263 1.00 65.73 ? 158 THR A OG1   1 
ATOM   1729 C CG2   . THR C 3 151 ? 37.381 -19.123 20.974 1.00 63.47 ? 158 THR A CG2   1 
ATOM   1730 N N     . HIS C 3 152 ? 41.579 -19.267 22.306 1.00 51.08 ? 159 HIS A N     1 
ATOM   1731 C CA    . HIS C 3 152 ? 42.818 -19.548 21.593 1.00 50.08 ? 159 HIS A CA    1 
ATOM   1732 C C     . HIS C 3 152 ? 43.320 -20.968 21.895 1.00 47.99 ? 159 HIS A C     1 
ATOM   1733 O O     . HIS C 3 152 ? 43.038 -21.522 22.944 1.00 47.50 ? 159 HIS A O     1 
ATOM   1734 C CB    . HIS C 3 152 ? 43.845 -18.466 22.011 1.00 48.38 ? 159 HIS A CB    1 
ATOM   1735 C CG    . HIS C 3 152 ? 45.268 -18.740 21.605 1.00 52.77 ? 159 HIS A CG    1 
ATOM   1736 N ND1   . HIS C 3 152 ? 45.950 -17.946 20.705 1.00 49.92 ? 159 HIS A ND1   1 
ATOM   1737 C CD2   . HIS C 3 152 ? 46.174 -19.638 22.070 1.00 49.68 ? 159 HIS A CD2   1 
ATOM   1738 C CE1   . HIS C 3 152 ? 47.211 -18.335 20.641 1.00 46.71 ? 159 HIS A CE1   1 
ATOM   1739 N NE2   . HIS C 3 152 ? 47.373 -19.360 21.460 1.00 47.37 ? 159 HIS A NE2   1 
ATOM   1740 N N     . PRO C 3 153 ? 44.063 -21.582 20.962 1.00 49.56 ? 160 PRO A N     1 
ATOM   1741 C CA    . PRO C 3 153 ? 44.595 -22.937 21.159 1.00 45.89 ? 160 PRO A CA    1 
ATOM   1742 C C     . PRO C 3 153 ? 45.359 -23.234 22.453 1.00 44.71 ? 160 PRO A C     1 
ATOM   1743 O O     . PRO C 3 153 ? 45.322 -24.355 22.958 1.00 43.37 ? 160 PRO A O     1 
ATOM   1744 C CB    . PRO C 3 153 ? 45.478 -23.141 19.928 1.00 46.15 ? 160 PRO A CB    1 
ATOM   1745 C CG    . PRO C 3 153 ? 45.731 -21.738 19.417 1.00 47.56 ? 160 PRO A CG    1 
ATOM   1746 C CD    . PRO C 3 153 ? 44.410 -21.090 19.619 1.00 46.18 ? 160 PRO A CD    1 
ATOM   1747 N N     . ASP C 3 154 ? 46.047 -22.249 23.009 1.00 44.54 ? 161 ASP A N     1 
ATOM   1748 C CA    . ASP C 3 154 ? 46.812 -22.524 24.207 1.00 45.04 ? 161 ASP A CA    1 
ATOM   1749 C C     . ASP C 3 154 ? 46.166 -21.986 25.479 1.00 44.36 ? 161 ASP A C     1 
ATOM   1750 O O     . ASP C 3 154 ? 46.704 -22.129 26.572 1.00 44.85 ? 161 ASP A O     1 
ATOM   1751 C CB    . ASP C 3 154 ? 48.227 -21.972 24.024 1.00 53.91 ? 161 ASP A CB    1 
ATOM   1752 C CG    . ASP C 3 154 ? 48.859 -22.391 22.679 1.00 60.94 ? 161 ASP A CG    1 
ATOM   1753 O OD1   . ASP C 3 154 ? 48.921 -23.612 22.404 1.00 64.09 ? 161 ASP A OD1   1 
ATOM   1754 O OD2   . ASP C 3 154 ? 49.294 -21.507 21.900 1.00 59.31 ? 161 ASP A OD2   1 
ATOM   1755 N N     . GLY C 3 155 ? 44.992 -21.385 25.339 1.00 43.80 ? 162 GLY A N     1 
ATOM   1756 C CA    . GLY C 3 155 ? 44.302 -20.840 26.497 1.00 44.12 ? 162 GLY A CA    1 
ATOM   1757 C C     . GLY C 3 155 ? 43.307 -19.784 26.054 1.00 47.67 ? 162 GLY A C     1 
ATOM   1758 O O     . GLY C 3 155 ? 42.583 -19.979 25.084 1.00 48.58 ? 162 GLY A O     1 
ATOM   1759 N N     . MET C 3 156 ? 43.262 -18.658 26.758 1.00 49.79 ? 163 MET A N     1 
ATOM   1760 C CA    . MET C 3 156 ? 42.343 -17.577 26.401 1.00 47.88 ? 163 MET A CA    1 
ATOM   1761 C C     . MET C 3 156 ? 43.143 -16.359 25.959 1.00 47.37 ? 163 MET A C     1 
ATOM   1762 O O     . MET C 3 156 ? 44.250 -16.120 26.461 1.00 46.09 ? 163 MET A O     1 
ATOM   1763 C CB    . MET C 3 156 ? 41.431 -17.233 27.586 1.00 47.17 ? 163 MET A CB    1 
ATOM   1764 C CG    . MET C 3 156 ? 40.447 -18.338 27.985 1.00 41.46 ? 163 MET A CG    1 
ATOM   1765 S SD    . MET C 3 156 ? 39.315 -18.887 26.663 1.00 47.50 ? 163 MET A SD    1 
ATOM   1766 C CE    . MET C 3 156 ? 38.621 -17.366 26.098 1.00 40.24 ? 163 MET A CE    1 
ATOM   1767 N N     . GLN C 3 157 ? 42.579 -15.601 25.016 1.00 44.12 ? 164 GLN A N     1 
ATOM   1768 C CA    . GLN C 3 157 ? 43.239 -14.426 24.454 1.00 40.63 ? 164 GLN A CA    1 
ATOM   1769 C C     . GLN C 3 157 ? 42.480 -13.146 24.732 1.00 42.93 ? 164 GLN A C     1 
ATOM   1770 O O     . GLN C 3 157 ? 41.304 -13.037 24.390 1.00 45.21 ? 164 GLN A O     1 
ATOM   1771 C CB    . GLN C 3 157 ? 43.386 -14.616 22.952 1.00 40.72 ? 164 GLN A CB    1 
ATOM   1772 C CG    . GLN C 3 157 ? 43.827 -13.381 22.238 1.00 49.88 ? 164 GLN A CG    1 
ATOM   1773 C CD    . GLN C 3 157 ? 44.077 -13.591 20.753 1.00 51.73 ? 164 GLN A CD    1 
ATOM   1774 O OE1   . GLN C 3 157 ? 45.084 -14.180 20.364 1.00 55.40 ? 164 GLN A OE1   1 
ATOM   1775 N NE2   . GLN C 3 157 ? 43.162 -13.097 19.914 1.00 55.69 ? 164 GLN A NE2   1 
ATOM   1776 N N     . ILE C 3 158 ? 43.154 -12.166 25.335 1.00 43.15 ? 165 ILE A N     1 
ATOM   1777 C CA    . ILE C 3 158 ? 42.534 -10.879 25.684 1.00 39.46 ? 165 ILE A CA    1 
ATOM   1778 C C     . ILE C 3 158 ? 43.271 -9.766  24.975 1.00 40.98 ? 165 ILE A C     1 
ATOM   1779 O O     . ILE C 3 158 ? 44.345 -10.006 24.453 1.00 43.93 ? 165 ILE A O     1 
ATOM   1780 C CB    . ILE C 3 158 ? 42.635 -10.614 27.194 1.00 36.88 ? 165 ILE A CB    1 
ATOM   1781 C CG1   . ILE C 3 158 ? 44.109 -10.651 27.615 1.00 37.60 ? 165 ILE A CG1   1 
ATOM   1782 C CG2   . ILE C 3 158 ? 41.846 -11.671 27.988 1.00 38.69 ? 165 ILE A CG2   1 
ATOM   1783 C CD1   . ILE C 3 158 ? 44.340 -10.502 29.125 1.00 31.96 ? 165 ILE A CD1   1 
ATOM   1784 N N     . LYS C 3 159 ? 42.696 -8.563  24.929 1.00 44.36 ? 166 LYS A N     1 
ATOM   1785 C CA    . LYS C 3 159 ? 43.373 -7.409  24.300 1.00 47.65 ? 166 LYS A CA    1 
ATOM   1786 C C     . LYS C 3 159 ? 43.265 -6.230  25.243 1.00 44.79 ? 166 LYS A C     1 
ATOM   1787 O O     . LYS C 3 159 ? 42.178 -5.891  25.655 1.00 47.57 ? 166 LYS A O     1 
ATOM   1788 C CB    . LYS C 3 159 ? 42.762 -7.042  22.946 1.00 49.75 ? 166 LYS A CB    1 
ATOM   1789 C CG    . LYS C 3 159 ? 42.931 -8.117  21.877 1.00 58.97 ? 166 LYS A CG    1 
ATOM   1790 C CD    . LYS C 3 159 ? 43.309 -7.531  20.515 1.00 65.68 ? 166 LYS A CD    1 
ATOM   1791 C CE    . LYS C 3 159 ? 43.315 -8.601  19.424 1.00 63.50 ? 166 LYS A CE    1 
ATOM   1792 N NZ    . LYS C 3 159 ? 44.168 -9.766  19.799 1.00 67.45 ? 166 LYS A NZ    1 
ATOM   1793 N N     . ILE C 3 160 ? 44.389 -5.606  25.577 1.00 42.34 ? 167 ILE A N     1 
ATOM   1794 C CA    . ILE C 3 160 ? 44.402 -4.503  26.534 1.00 40.75 ? 167 ILE A CA    1 
ATOM   1795 C C     . ILE C 3 160 ? 45.810 -3.953  26.666 1.00 39.75 ? 167 ILE A C     1 
ATOM   1796 O O     . ILE C 3 160 ? 46.779 -4.688  26.537 1.00 39.78 ? 167 ILE A O     1 
ATOM   1797 C CB    . ILE C 3 160 ? 43.940 -5.020  27.931 1.00 42.34 ? 167 ILE A CB    1 
ATOM   1798 C CG1   . ILE C 3 160 ? 43.819 -3.885  28.939 1.00 36.46 ? 167 ILE A CG1   1 
ATOM   1799 C CG2   . ILE C 3 160 ? 44.930 -6.034  28.472 1.00 40.17 ? 167 ILE A CG2   1 
ATOM   1800 C CD1   . ILE C 3 160 ? 42.880 -4.236  30.064 1.00 30.02 ? 167 ILE A CD1   1 
ATOM   1801 N N     . THR C 3 161 ? 45.933 -2.667  26.955 1.00 40.87 ? 168 THR A N     1 
ATOM   1802 C CA    . THR C 3 161 ? 47.258 -2.096  27.101 1.00 40.15 ? 168 THR A CA    1 
ATOM   1803 C C     . THR C 3 161 ? 47.839 -2.191  28.501 1.00 39.30 ? 168 THR A C     1 
ATOM   1804 O O     . THR C 3 161 ? 47.127 -2.297  29.487 1.00 40.12 ? 168 THR A O     1 
ATOM   1805 C CB    . THR C 3 161 ? 47.294 -0.628  26.708 1.00 41.77 ? 168 THR A CB    1 
ATOM   1806 O OG1   . THR C 3 161 ? 46.698 0.151   27.746 1.00 42.41 ? 168 THR A OG1   1 
ATOM   1807 C CG2   . THR C 3 161 ? 46.560 -0.418  25.397 1.00 46.59 ? 168 THR A CG2   1 
ATOM   1808 N N     . ARG C 3 162 ? 49.163 -2.158  28.559 1.00 41.38 ? 169 ARG A N     1 
ATOM   1809 C CA    . ARG C 3 162 ? 49.894 -2.202  29.807 1.00 43.57 ? 169 ARG A CA    1 
ATOM   1810 C C     . ARG C 3 162 ? 49.422 -1.003  30.632 1.00 44.71 ? 169 ARG A C     1 
ATOM   1811 O O     . ARG C 3 162 ? 49.283 -1.079  31.861 1.00 45.87 ? 169 ARG A O     1 
ATOM   1812 C CB    . ARG C 3 162 ? 51.393 -2.113  29.518 1.00 39.01 ? 169 ARG A CB    1 
ATOM   1813 C CG    . ARG C 3 162 ? 52.113 -3.451  29.444 1.00 35.93 ? 169 ARG A CG    1 
ATOM   1814 C CD    . ARG C 3 162 ? 53.135 -3.485  28.312 1.00 29.85 ? 169 ARG A CD    1 
ATOM   1815 N NE    . ARG C 3 162 ? 52.497 -3.843  27.062 1.00 27.69 ? 169 ARG A NE    1 
ATOM   1816 C CZ    . ARG C 3 162 ? 52.735 -4.977  26.411 1.00 36.47 ? 169 ARG A CZ    1 
ATOM   1817 N NH1   . ARG C 3 162 ? 53.622 -5.849  26.891 1.00 35.63 ? 169 ARG A NH1   1 
ATOM   1818 N NH2   . ARG C 3 162 ? 52.030 -5.280  25.321 1.00 27.00 ? 169 ARG A NH2   1 
ATOM   1819 N N     . GLN C 3 163 ? 49.141 0.085   29.924 1.00 40.25 ? 170 GLN A N     1 
ATOM   1820 C CA    . GLN C 3 163 ? 48.680 1.312   30.530 1.00 42.59 ? 170 GLN A CA    1 
ATOM   1821 C C     . GLN C 3 163 ? 47.393 1.098   31.312 1.00 42.22 ? 170 GLN A C     1 
ATOM   1822 O O     . GLN C 3 163 ? 47.297 1.495   32.472 1.00 44.15 ? 170 GLN A O     1 
ATOM   1823 C CB    . GLN C 3 163 ? 48.466 2.350   29.440 1.00 52.10 ? 170 GLN A CB    1 
ATOM   1824 C CG    . GLN C 3 163 ? 48.438 3.805   29.897 1.00 59.96 ? 170 GLN A CG    1 
ATOM   1825 C CD    . GLN C 3 163 ? 48.265 4.756   28.716 1.00 68.66 ? 170 GLN A CD    1 
ATOM   1826 O OE1   . GLN C 3 163 ? 49.190 4.950   27.907 1.00 73.67 ? 170 GLN A OE1   1 
ATOM   1827 N NE2   . GLN C 3 163 ? 47.070 5.340   28.597 1.00 69.12 ? 170 GLN A NE2   1 
ATOM   1828 N N     . GLU C 3 164 ? 46.410 0.449   30.695 1.00 43.07 ? 171 GLU A N     1 
ATOM   1829 C CA    . GLU C 3 164 ? 45.123 0.213   31.365 1.00 42.38 ? 171 GLU A CA    1 
ATOM   1830 C C     . GLU C 3 164 ? 45.147 -0.840  32.467 1.00 39.93 ? 171 GLU A C     1 
ATOM   1831 O O     . GLU C 3 164 ? 44.361 -0.758  33.409 1.00 37.46 ? 171 GLU A O     1 
ATOM   1832 C CB    . GLU C 3 164 ? 44.021 -0.138  30.355 1.00 42.67 ? 171 GLU A CB    1 
ATOM   1833 C CG    . GLU C 3 164 ? 42.660 -0.242  31.027 1.00 48.77 ? 171 GLU A CG    1 
ATOM   1834 C CD    . GLU C 3 164 ? 41.513 -0.298  30.055 1.00 51.14 ? 171 GLU A CD    1 
ATOM   1835 O OE1   . GLU C 3 164 ? 41.426 0.599   29.217 1.00 60.06 ? 171 GLU A OE1   1 
ATOM   1836 O OE2   . GLU C 3 164 ? 40.688 -1.223  30.126 1.00 59.44 ? 171 GLU A OE2   1 
ATOM   1837 N N     . ILE C 3 165 ? 46.026 -1.831  32.351 1.00 37.27 ? 172 ILE A N     1 
ATOM   1838 C CA    . ILE C 3 165 ? 46.115 -2.831  33.394 1.00 38.25 ? 172 ILE A CA    1 
ATOM   1839 C C     . ILE C 3 165 ? 46.653 -2.048  34.572 1.00 39.11 ? 172 ILE A C     1 
ATOM   1840 O O     . ILE C 3 165 ? 46.373 -2.332  35.731 1.00 37.45 ? 172 ILE A O     1 
ATOM   1841 C CB    . ILE C 3 165 ? 47.118 -3.942  33.047 1.00 38.77 ? 172 ILE A CB    1 
ATOM   1842 C CG1   . ILE C 3 165 ? 46.602 -4.756  31.861 1.00 41.93 ? 172 ILE A CG1   1 
ATOM   1843 C CG2   . ILE C 3 165 ? 47.354 -4.832  34.265 1.00 32.05 ? 172 ILE A CG2   1 
ATOM   1844 C CD1   . ILE C 3 165 ? 47.498 -5.902  31.466 1.00 42.24 ? 172 ILE A CD1   1 
ATOM   1845 N N     . GLY C 3 166 ? 47.427 -1.024  34.260 1.00 40.12 ? 173 GLY A N     1 
ATOM   1846 C CA    . GLY C 3 166 ? 48.001 -0.238  35.329 1.00 44.39 ? 173 GLY A CA    1 
ATOM   1847 C C     . GLY C 3 166 ? 46.982 0.571   36.097 1.00 42.75 ? 173 GLY A C     1 
ATOM   1848 O O     . GLY C 3 166 ? 47.153 0.796   37.309 1.00 34.72 ? 173 GLY A O     1 
ATOM   1849 N N     . GLN C 3 167 ? 45.947 1.014   35.374 1.00 40.78 ? 174 GLN A N     1 
ATOM   1850 C CA    . GLN C 3 167 ? 44.876 1.817   35.929 1.00 38.91 ? 174 GLN A CA    1 
ATOM   1851 C C     . GLN C 3 167 ? 43.882 0.905   36.601 1.00 41.84 ? 174 GLN A C     1 
ATOM   1852 O O     . GLN C 3 167 ? 42.913 1.354   37.211 1.00 48.90 ? 174 GLN A O     1 
ATOM   1853 C CB    . GLN C 3 167 ? 44.189 2.604   34.834 1.00 35.65 ? 174 GLN A CB    1 
ATOM   1854 C CG    . GLN C 3 167 ? 45.166 3.273   33.892 1.00 41.16 ? 174 GLN A CG    1 
ATOM   1855 C CD    . GLN C 3 167 ? 44.498 4.001   32.728 1.00 45.25 ? 174 GLN A CD    1 
ATOM   1856 O OE1   . GLN C 3 167 ? 43.554 3.495   32.087 1.00 39.27 ? 174 GLN A OE1   1 
ATOM   1857 N NE2   . GLN C 3 167 ? 45.000 5.193   32.439 1.00 46.85 ? 174 GLN A NE2   1 
ATOM   1858 N N     . ILE C 3 168 ? 44.118 -0.387  36.482 1.00 36.39 ? 175 ILE A N     1 
ATOM   1859 C CA    . ILE C 3 168 ? 43.244 -1.337  37.118 1.00 39.66 ? 175 ILE A CA    1 
ATOM   1860 C C     . ILE C 3 168 ? 43.899 -1.828  38.426 1.00 38.89 ? 175 ILE A C     1 
ATOM   1861 O O     . ILE C 3 168 ? 43.293 -1.802  39.496 1.00 38.33 ? 175 ILE A O     1 
ATOM   1862 C CB    . ILE C 3 168 ? 42.961 -2.529  36.167 1.00 43.29 ? 175 ILE A CB    1 
ATOM   1863 C CG1   . ILE C 3 168 ? 42.061 -2.075  35.026 1.00 39.02 ? 175 ILE A CG1   1 
ATOM   1864 C CG2   . ILE C 3 168 ? 42.330 -3.697  36.932 1.00 37.72 ? 175 ILE A CG2   1 
ATOM   1865 C CD1   . ILE C 3 168 ? 41.688 -3.196  34.111 1.00 40.88 ? 175 ILE A CD1   1 
ATOM   1866 N N     . VAL C 3 169 ? 45.144 -2.268  38.338 1.00 36.39 ? 176 VAL A N     1 
ATOM   1867 C CA    . VAL C 3 169 ? 45.851 -2.760  39.513 1.00 37.20 ? 176 VAL A CA    1 
ATOM   1868 C C     . VAL C 3 169 ? 46.483 -1.629  40.326 1.00 39.71 ? 176 VAL A C     1 
ATOM   1869 O O     . VAL C 3 169 ? 46.994 -1.840  41.425 1.00 37.74 ? 176 VAL A O     1 
ATOM   1870 C CB    . VAL C 3 169 ? 46.932 -3.727  39.094 1.00 31.59 ? 176 VAL A CB    1 
ATOM   1871 C CG1   . VAL C 3 169 ? 46.301 -4.925  38.416 1.00 33.14 ? 176 VAL A CG1   1 
ATOM   1872 C CG2   . VAL C 3 169 ? 47.875 -3.037  38.151 1.00 29.40 ? 176 VAL A CG2   1 
ATOM   1873 N N     . GLY C 3 170 ? 46.435 -0.425  39.771 1.00 41.40 ? 177 GLY A N     1 
ATOM   1874 C CA    . GLY C 3 170 ? 46.997 0.722   40.446 1.00 38.34 ? 177 GLY A CA    1 
ATOM   1875 C C     . GLY C 3 170 ? 48.510 0.765   40.503 1.00 37.11 ? 177 GLY A C     1 
ATOM   1876 O O     . GLY C 3 170 ? 49.069 0.872   41.592 1.00 36.25 ? 177 GLY A O     1 
ATOM   1877 N N     . CYS C 3 171 ? 49.172 0.683   39.346 1.00 36.53 ? 178 CYS A N     1 
ATOM   1878 C CA    . CYS C 3 171 ? 50.639 0.762   39.296 1.00 41.74 ? 178 CYS A CA    1 
ATOM   1879 C C     . CYS C 3 171 ? 51.096 1.518   38.043 1.00 40.11 ? 178 CYS A C     1 
ATOM   1880 O O     . CYS C 3 171 ? 50.270 2.011   37.291 1.00 38.11 ? 178 CYS A O     1 
ATOM   1881 C CB    . CYS C 3 171 ? 51.280 -0.642  39.339 1.00 40.43 ? 178 CYS A CB    1 
ATOM   1882 S SG    . CYS C 3 171 ? 51.068 -1.633  37.872 1.00 45.02 ? 178 CYS A SG    1 
ATOM   1883 N N     . SER C 3 172 ? 52.398 1.631   37.818 1.00 37.03 ? 179 SER A N     1 
ATOM   1884 C CA    . SER C 3 172 ? 52.834 2.329   36.627 1.00 39.90 ? 179 SER A CA    1 
ATOM   1885 C C     . SER C 3 172 ? 52.890 1.362   35.463 1.00 42.28 ? 179 SER A C     1 
ATOM   1886 O O     . SER C 3 172 ? 53.227 0.175   35.622 1.00 40.40 ? 179 SER A O     1 
ATOM   1887 C CB    . SER C 3 172 ? 54.207 2.974   36.823 1.00 43.71 ? 179 SER A CB    1 
ATOM   1888 O OG    . SER C 3 172 ? 55.182 2.013   37.159 1.00 52.75 ? 179 SER A OG    1 
ATOM   1889 N N     . ARG C 3 173 ? 52.557 1.896   34.291 1.00 41.38 ? 180 ARG A N     1 
ATOM   1890 C CA    . ARG C 3 173 ? 52.529 1.150   33.052 1.00 37.69 ? 180 ARG A CA    1 
ATOM   1891 C C     . ARG C 3 173 ? 53.870 0.467   32.861 1.00 40.61 ? 180 ARG A C     1 
ATOM   1892 O O     . ARG C 3 173 ? 53.941 -0.578  32.230 1.00 41.98 ? 180 ARG A O     1 
ATOM   1893 C CB    . ARG C 3 173 ? 52.233 2.098   31.905 1.00 33.17 ? 180 ARG A CB    1 
ATOM   1894 C CG    . ARG C 3 173 ? 53.270 3.203   31.789 1.00 37.51 ? 180 ARG A CG    1 
ATOM   1895 C CD    . ARG C 3 173 ? 52.994 4.133   30.614 1.00 44.82 ? 180 ARG A CD    1 
ATOM   1896 N NE    . ARG C 3 173 ? 54.031 5.160   30.512 1.00 52.15 ? 180 ARG A NE    1 
ATOM   1897 C CZ    . ARG C 3 173 ? 55.156 5.055   29.805 1.00 52.94 ? 180 ARG A CZ    1 
ATOM   1898 N NH1   . ARG C 3 173 ? 55.420 3.970   29.097 1.00 52.75 ? 180 ARG A NH1   1 
ATOM   1899 N NH2   . ARG C 3 173 ? 56.049 6.031   29.847 1.00 57.97 ? 180 ARG A NH2   1 
ATOM   1900 N N     . GLU C 3 174 ? 54.930 1.064   33.402 1.00 45.20 ? 181 GLU A N     1 
ATOM   1901 C CA    . GLU C 3 174 ? 56.272 0.488   33.314 1.00 48.11 ? 181 GLU A CA    1 
ATOM   1902 C C     . GLU C 3 174 ? 56.321 -0.793  34.143 1.00 49.36 ? 181 GLU A C     1 
ATOM   1903 O O     . GLU C 3 174 ? 56.893 -1.810  33.730 1.00 47.79 ? 181 GLU A O     1 
ATOM   1904 C CB    . GLU C 3 174 ? 57.327 1.448   33.860 1.00 52.25 ? 181 GLU A CB    1 
ATOM   1905 C CG    . GLU C 3 174 ? 57.876 2.481   32.882 1.00 62.54 ? 181 GLU A CG    1 
ATOM   1906 C CD    . GLU C 3 174 ? 57.197 3.826   33.019 1.00 71.23 ? 181 GLU A CD    1 
ATOM   1907 O OE1   . GLU C 3 174 ? 57.681 4.813   32.414 1.00 72.35 ? 181 GLU A OE1   1 
ATOM   1908 O OE2   . GLU C 3 174 ? 56.170 3.893   33.736 1.00 79.02 ? 181 GLU A OE2   1 
ATOM   1909 N N     . THR C 3 175 ? 55.714 -0.744  35.323 1.00 46.62 ? 182 THR A N     1 
ATOM   1910 C CA    . THR C 3 175 ? 55.699 -1.902  36.197 1.00 44.83 ? 182 THR A CA    1 
ATOM   1911 C C     . THR C 3 175 ? 54.891 -3.045  35.614 1.00 44.59 ? 182 THR A C     1 
ATOM   1912 O O     . THR C 3 175 ? 55.200 -4.212  35.847 1.00 43.35 ? 182 THR A O     1 
ATOM   1913 C CB    . THR C 3 175 ? 55.156 -1.509  37.534 1.00 40.73 ? 182 THR A CB    1 
ATOM   1914 O OG1   . THR C 3 175 ? 55.999 -0.483  38.038 1.00 44.67 ? 182 THR A OG1   1 
ATOM   1915 C CG2   . THR C 3 175 ? 55.139 -2.695  38.511 1.00 35.83 ? 182 THR A CG2   1 
ATOM   1916 N N     . VAL C 3 176 ? 53.863 -2.700  34.849 1.00 41.26 ? 183 VAL A N     1 
ATOM   1917 C CA    . VAL C 3 176 ? 53.023 -3.705  34.236 1.00 41.30 ? 183 VAL A CA    1 
ATOM   1918 C C     . VAL C 3 176 ? 53.867 -4.427  33.208 1.00 47.79 ? 183 VAL A C     1 
ATOM   1919 O O     . VAL C 3 176 ? 54.057 -5.659  33.292 1.00 51.68 ? 183 VAL A O     1 
ATOM   1920 C CB    . VAL C 3 176 ? 51.803 -3.074  33.551 1.00 37.72 ? 183 VAL A CB    1 
ATOM   1921 C CG1   . VAL C 3 176 ? 51.050 -4.106  32.789 1.00 37.81 ? 183 VAL A CG1   1 
ATOM   1922 C CG2   . VAL C 3 176 ? 50.893 -2.447  34.596 1.00 38.36 ? 183 VAL A CG2   1 
ATOM   1923 N N     . GLY C 3 177 ? 54.392 -3.644  32.258 1.00 48.92 ? 184 GLY A N     1 
ATOM   1924 C CA    . GLY C 3 177 ? 55.229 -4.168  31.188 1.00 43.27 ? 184 GLY A CA    1 
ATOM   1925 C C     . GLY C 3 177 ? 56.296 -5.119  31.671 1.00 41.58 ? 184 GLY A C     1 
ATOM   1926 O O     . GLY C 3 177 ? 56.561 -6.109  31.020 1.00 38.75 ? 184 GLY A O     1 
ATOM   1927 N N     . ARG C 3 178 ? 56.906 -4.819  32.812 1.00 43.61 ? 185 ARG A N     1 
ATOM   1928 C CA    . ARG C 3 178 ? 57.958 -5.662  33.376 1.00 44.06 ? 185 ARG A CA    1 
ATOM   1929 C C     . ARG C 3 178 ? 57.401 -6.927  33.986 1.00 47.19 ? 185 ARG A C     1 
ATOM   1930 O O     . ARG C 3 178 ? 57.977 -7.995  33.801 1.00 47.74 ? 185 ARG A O     1 
ATOM   1931 C CB    . ARG C 3 178 ? 58.750 -4.896  34.442 1.00 44.75 ? 185 ARG A CB    1 
ATOM   1932 C CG    . ARG C 3 178 ? 59.539 -3.757  33.867 1.00 48.41 ? 185 ARG A CG    1 
ATOM   1933 C CD    . ARG C 3 178 ? 59.943 -2.723  34.871 1.00 52.13 ? 185 ARG A CD    1 
ATOM   1934 N NE    . ARG C 3 178 ? 60.485 -1.574  34.156 1.00 64.59 ? 185 ARG A NE    1 
ATOM   1935 C CZ    . ARG C 3 178 ? 60.762 -0.390  34.702 1.00 71.14 ? 185 ARG A CZ    1 
ATOM   1936 N NH1   . ARG C 3 178 ? 60.551 -0.178  36.001 1.00 72.47 ? 185 ARG A NH1   1 
ATOM   1937 N NH2   . ARG C 3 178 ? 61.238 0.595   33.939 1.00 69.04 ? 185 ARG A NH2   1 
ATOM   1938 N N     . ILE C 3 179 ? 56.291 -6.815  34.725 1.00 47.17 ? 186 ILE A N     1 
ATOM   1939 C CA    . ILE C 3 179 ? 55.694 -7.989  35.348 1.00 42.54 ? 186 ILE A CA    1 
ATOM   1940 C C     . ILE C 3 179 ? 55.229 -8.880  34.229 1.00 39.38 ? 186 ILE A C     1 
ATOM   1941 O O     . ILE C 3 179 ? 55.341 -10.105 34.309 1.00 37.19 ? 186 ILE A O     1 
ATOM   1942 C CB    . ILE C 3 179 ? 54.492 -7.635  36.280 1.00 43.87 ? 186 ILE A CB    1 
ATOM   1943 C CG1   . ILE C 3 179 ? 54.997 -7.396  37.713 1.00 37.37 ? 186 ILE A CG1   1 
ATOM   1944 C CG2   . ILE C 3 179 ? 53.442 -8.786  36.293 1.00 42.40 ? 186 ILE A CG2   1 
ATOM   1945 C CD1   . ILE C 3 179 ? 55.677 -6.117  37.908 1.00 25.65 ? 186 ILE A CD1   1 
ATOM   1946 N N     . LEU C 3 180 ? 54.721 -8.252  33.172 1.00 35.50 ? 187 LEU A N     1 
ATOM   1947 C CA    . LEU C 3 180 ? 54.247 -9.004  32.022 1.00 34.57 ? 187 LEU A CA    1 
ATOM   1948 C C     . LEU C 3 180 ? 55.380 -9.870  31.525 1.00 34.04 ? 187 LEU A C     1 
ATOM   1949 O O     . LEU C 3 180 ? 55.262 -11.090 31.521 1.00 36.66 ? 187 LEU A O     1 
ATOM   1950 C CB    . LEU C 3 180 ? 53.748 -8.054  30.944 1.00 31.61 ? 187 LEU A CB    1 
ATOM   1951 C CG    . LEU C 3 180 ? 52.241 -8.160  30.661 1.00 35.92 ? 187 LEU A CG    1 
ATOM   1952 C CD1   . LEU C 3 180 ? 51.437 -8.396  31.949 1.00 28.85 ? 187 LEU A CD1   1 
ATOM   1953 C CD2   . LEU C 3 180 ? 51.799 -6.904  29.933 1.00 27.78 ? 187 LEU A CD2   1 
ATOM   1954 N N     . LYS C 3 181 ? 56.498 -9.245  31.171 1.00 37.98 ? 188 LYS A N     1 
ATOM   1955 C CA    . LYS C 3 181 ? 57.684 -9.968  30.694 1.00 38.21 ? 188 LYS A CA    1 
ATOM   1956 C C     . LYS C 3 181 ? 58.069 -11.121 31.610 1.00 35.34 ? 188 LYS A C     1 
ATOM   1957 O O     . LYS C 3 181 ? 58.446 -12.184 31.132 1.00 35.19 ? 188 LYS A O     1 
ATOM   1958 C CB    . LYS C 3 181 ? 58.871 -9.010  30.496 1.00 39.50 ? 188 LYS A CB    1 
ATOM   1959 C CG    . LYS C 3 181 ? 58.609 -7.954  29.409 1.00 42.91 ? 188 LYS A CG    1 
ATOM   1960 C CD    . LYS C 3 181 ? 59.838 -7.145  29.039 1.00 45.48 ? 188 LYS A CD    1 
ATOM   1961 C CE    . LYS C 3 181 ? 59.502 -6.126  27.946 1.00 49.02 ? 188 LYS A CE    1 
ATOM   1962 N NZ    . LYS C 3 181 ? 60.651 -5.291  27.473 1.00 49.62 ? 188 LYS A NZ    1 
ATOM   1963 N N     . MET C 3 182 ? 57.951 -10.923 32.916 1.00 34.11 ? 189 MET A N     1 
ATOM   1964 C CA    . MET C 3 182 ? 58.252 -11.993 33.866 1.00 40.69 ? 189 MET A CA    1 
ATOM   1965 C C     . MET C 3 182 ? 57.221 -13.128 33.773 1.00 41.37 ? 189 MET A C     1 
ATOM   1966 O O     . MET C 3 182 ? 57.572 -14.312 33.852 1.00 37.85 ? 189 MET A O     1 
ATOM   1967 C CB    . MET C 3 182 ? 58.277 -11.464 35.305 1.00 47.58 ? 189 MET A CB    1 
ATOM   1968 C CG    . MET C 3 182 ? 59.263 -10.337 35.518 1.00 63.33 ? 189 MET A CG    1 
ATOM   1969 S SD    . MET C 3 182 ? 59.577 -9.932  37.253 1.00 74.35 ? 189 MET A SD    1 
ATOM   1970 C CE    . MET C 3 182 ? 60.485 -11.430 37.805 1.00 74.97 ? 189 MET A CE    1 
ATOM   1971 N N     . LEU C 3 183 ? 55.951 -12.777 33.604 1.00 35.77 ? 190 LEU A N     1 
ATOM   1972 C CA    . LEU C 3 183 ? 54.955 -13.812 33.527 1.00 40.29 ? 190 LEU A CA    1 
ATOM   1973 C C     . LEU C 3 183 ? 55.135 -14.626 32.263 1.00 43.65 ? 190 LEU A C     1 
ATOM   1974 O O     . LEU C 3 183 ? 54.776 -15.810 32.199 1.00 41.51 ? 190 LEU A O     1 
ATOM   1975 C CB    . LEU C 3 183 ? 53.568 -13.206 33.618 1.00 45.07 ? 190 LEU A CB    1 
ATOM   1976 C CG    . LEU C 3 183 ? 53.381 -12.622 35.018 1.00 45.60 ? 190 LEU A CG    1 
ATOM   1977 C CD1   . LEU C 3 183 ? 52.012 -12.005 35.155 1.00 46.17 ? 190 LEU A CD1   1 
ATOM   1978 C CD2   . LEU C 3 183 ? 53.597 -13.718 36.036 1.00 41.32 ? 190 LEU A CD2   1 
ATOM   1979 N N     . GLU C 3 184 ? 55.703 -13.995 31.247 1.00 43.85 ? 191 GLU A N     1 
ATOM   1980 C CA    . GLU C 3 184 ? 55.978 -14.726 30.026 1.00 45.65 ? 191 GLU A CA    1 
ATOM   1981 C C     . GLU C 3 184 ? 57.271 -15.499 30.309 1.00 48.12 ? 191 GLU A C     1 
ATOM   1982 O O     . GLU C 3 184 ? 57.362 -16.695 30.029 1.00 46.48 ? 191 GLU A O     1 
ATOM   1983 C CB    . GLU C 3 184 ? 56.156 -13.779 28.849 1.00 40.59 ? 191 GLU A CB    1 
ATOM   1984 C CG    . GLU C 3 184 ? 56.274 -14.514 27.551 1.00 37.51 ? 191 GLU A CG    1 
ATOM   1985 C CD    . GLU C 3 184 ? 56.128 -13.620 26.357 1.00 40.51 ? 191 GLU A CD    1 
ATOM   1986 O OE1   . GLU C 3 184 ? 56.947 -13.737 25.424 1.00 42.53 ? 191 GLU A OE1   1 
ATOM   1987 O OE2   . GLU C 3 184 ? 55.181 -12.813 26.345 1.00 46.27 ? 191 GLU A OE2   1 
ATOM   1988 N N     . ASP C 3 185 ? 58.260 -14.809 30.881 1.00 47.10 ? 192 ASP A N     1 
ATOM   1989 C CA    . ASP C 3 185 ? 59.512 -15.451 31.249 1.00 44.74 ? 192 ASP A CA    1 
ATOM   1990 C C     . ASP C 3 185 ? 59.188 -16.742 31.965 1.00 44.21 ? 192 ASP A C     1 
ATOM   1991 O O     . ASP C 3 185 ? 59.947 -17.694 31.892 1.00 46.77 ? 192 ASP A O     1 
ATOM   1992 C CB    . ASP C 3 185 ? 60.328 -14.594 32.206 1.00 46.67 ? 192 ASP A CB    1 
ATOM   1993 C CG    . ASP C 3 185 ? 61.415 -13.804 31.513 1.00 53.31 ? 192 ASP A CG    1 
ATOM   1994 O OD1   . ASP C 3 185 ? 61.820 -14.183 30.396 1.00 59.33 ? 192 ASP A OD1   1 
ATOM   1995 O OD2   . ASP C 3 185 ? 61.883 -12.803 32.096 1.00 55.55 ? 192 ASP A OD2   1 
ATOM   1996 N N     . GLN C 3 186 ? 58.069 -16.783 32.678 1.00 42.91 ? 193 GLN A N     1 
ATOM   1997 C CA    . GLN C 3 186 ? 57.708 -18.003 33.385 1.00 41.59 ? 193 GLN A CA    1 
ATOM   1998 C C     . GLN C 3 186 ? 56.697 -18.878 32.631 1.00 41.01 ? 193 GLN A C     1 
ATOM   1999 O O     . GLN C 3 186 ? 56.069 -19.750 33.227 1.00 36.98 ? 193 GLN A O     1 
ATOM   2000 C CB    . GLN C 3 186 ? 57.147 -17.652 34.748 1.00 40.23 ? 193 GLN A CB    1 
ATOM   2001 C CG    . GLN C 3 186 ? 57.996 -16.709 35.532 1.00 53.01 ? 193 GLN A CG    1 
ATOM   2002 C CD    . GLN C 3 186 ? 57.337 -16.310 36.833 1.00 64.37 ? 193 GLN A CD    1 
ATOM   2003 O OE1   . GLN C 3 186 ? 57.113 -17.150 37.708 1.00 69.68 ? 193 GLN A OE1   1 
ATOM   2004 N NE2   . GLN C 3 186 ? 57.002 -15.027 36.965 1.00 69.91 ? 193 GLN A NE2   1 
ATOM   2005 N N     . ASN C 3 187 ? 56.547 -18.638 31.330 1.00 39.58 ? 194 ASN A N     1 
ATOM   2006 C CA    . ASN C 3 187 ? 55.612 -19.376 30.474 1.00 41.48 ? 194 ASN A CA    1 
ATOM   2007 C C     . ASN C 3 187 ? 54.161 -19.374 30.952 1.00 42.76 ? 194 ASN A C     1 
ATOM   2008 O O     . ASN C 3 187 ? 53.427 -20.331 30.716 1.00 43.89 ? 194 ASN A O     1 
ATOM   2009 C CB    . ASN C 3 187 ? 56.062 -20.831 30.270 1.00 38.07 ? 194 ASN A CB    1 
ATOM   2010 C CG    . ASN C 3 187 ? 57.403 -20.925 29.620 1.00 43.58 ? 194 ASN A CG    1 
ATOM   2011 O OD1   . ASN C 3 187 ? 57.668 -20.240 28.649 1.00 50.33 ? 194 ASN A OD1   1 
ATOM   2012 N ND2   . ASN C 3 187 ? 58.270 -21.777 30.151 1.00 52.00 ? 194 ASN A ND2   1 
ATOM   2013 N N     . LEU C 3 188 ? 53.736 -18.298 31.603 1.00 43.00 ? 195 LEU A N     1 
ATOM   2014 C CA    . LEU C 3 188 ? 52.367 -18.219 32.087 1.00 42.69 ? 195 LEU A CA    1 
ATOM   2015 C C     . LEU C 3 188 ? 51.486 -17.504 31.078 1.00 40.96 ? 195 LEU A C     1 
ATOM   2016 O O     . LEU C 3 188 ? 50.300 -17.794 30.933 1.00 39.96 ? 195 LEU A O     1 
ATOM   2017 C CB    . LEU C 3 188 ? 52.343 -17.511 33.436 1.00 47.92 ? 195 LEU A CB    1 
ATOM   2018 C CG    . LEU C 3 188 ? 53.129 -18.265 34.516 1.00 45.72 ? 195 LEU A CG    1 
ATOM   2019 C CD1   . LEU C 3 188 ? 52.928 -17.618 35.862 1.00 42.52 ? 195 LEU A CD1   1 
ATOM   2020 C CD2   . LEU C 3 188 ? 52.668 -19.704 34.547 1.00 42.94 ? 195 LEU A CD2   1 
ATOM   2021 N N     . ILE C 3 189 ? 52.078 -16.560 30.374 1.00 39.24 ? 196 ILE A N     1 
ATOM   2022 C CA    . ILE C 3 189 ? 51.350 -15.850 29.356 1.00 41.24 ? 196 ILE A CA    1 
ATOM   2023 C C     . ILE C 3 189 ? 52.274 -15.649 28.185 1.00 43.75 ? 196 ILE A C     1 
ATOM   2024 O O     . ILE C 3 189 ? 53.427 -16.067 28.204 1.00 43.56 ? 196 ILE A O     1 
ATOM   2025 C CB    . ILE C 3 189 ? 50.860 -14.467 29.822 1.00 42.07 ? 196 ILE A CB    1 
ATOM   2026 C CG1   . ILE C 3 189 ? 52.061 -13.592 30.225 1.00 37.07 ? 196 ILE A CG1   1 
ATOM   2027 C CG2   . ILE C 3 189 ? 49.777 -14.646 30.895 1.00 33.45 ? 196 ILE A CG2   1 
ATOM   2028 C CD1   . ILE C 3 189 ? 51.753 -12.092 30.337 1.00 34.17 ? 196 ILE A CD1   1 
ATOM   2029 N N     . SER C 3 190 ? 51.752 -14.997 27.162 1.00 45.23 ? 197 SER A N     1 
ATOM   2030 C CA    . SER C 3 190 ? 52.517 -14.716 25.975 1.00 44.49 ? 197 SER A CA    1 
ATOM   2031 C C     . SER C 3 190 ? 51.971 -13.426 25.384 1.00 48.48 ? 197 SER A C     1 
ATOM   2032 O O     . SER C 3 190 ? 50.946 -13.437 24.703 1.00 56.98 ? 197 SER A O     1 
ATOM   2033 C CB    . SER C 3 190 ? 52.355 -15.859 25.004 1.00 35.65 ? 197 SER A CB    1 
ATOM   2034 O OG    . SER C 3 190 ? 52.830 -15.466 23.745 1.00 39.12 ? 197 SER A OG    1 
ATOM   2035 N N     . ALA C 3 191 ? 52.643 -12.309 25.638 1.00 46.89 ? 198 ALA A N     1 
ATOM   2036 C CA    . ALA C 3 191 ? 52.156 -11.039 25.131 1.00 44.05 ? 198 ALA A CA    1 
ATOM   2037 C C     . ALA C 3 191 ? 52.897 -10.512 23.936 1.00 43.60 ? 198 ALA A C     1 
ATOM   2038 O O     . ALA C 3 191 ? 54.114 -10.568 23.890 1.00 49.43 ? 198 ALA A O     1 
ATOM   2039 C CB    . ALA C 3 191 ? 52.190 -10.000 26.231 1.00 46.09 ? 198 ALA A CB    1 
ATOM   2040 N N     . HIS C 3 192 ? 52.140 -10.015 22.963 1.00 42.33 ? 199 HIS A N     1 
ATOM   2041 C CA    . HIS C 3 192 ? 52.665 -9.381  21.754 1.00 38.11 ? 199 HIS A CA    1 
ATOM   2042 C C     . HIS C 3 192 ? 51.728 -8.213  21.574 1.00 40.34 ? 199 HIS A C     1 
ATOM   2043 O O     . HIS C 3 192 ? 50.575 -8.432  21.198 1.00 41.49 ? 199 HIS A O     1 
ATOM   2044 C CB    . HIS C 3 192 ? 52.522 -10.256 20.511 1.00 37.18 ? 199 HIS A CB    1 
ATOM   2045 C CG    . HIS C 3 192 ? 53.387 -11.469 20.517 1.00 36.70 ? 199 HIS A CG    1 
ATOM   2046 N ND1   . HIS C 3 192 ? 53.070 -12.604 21.228 1.00 39.31 ? 199 HIS A ND1   1 
ATOM   2047 C CD2   . HIS C 3 192 ? 54.579 -11.713 19.929 1.00 38.82 ? 199 HIS A CD2   1 
ATOM   2048 C CE1   . HIS C 3 192 ? 54.030 -13.497 21.077 1.00 38.66 ? 199 HIS A CE1   1 
ATOM   2049 N NE2   . HIS C 3 192 ? 54.958 -12.981 20.294 1.00 39.17 ? 199 HIS A NE2   1 
ATOM   2050 N N     . GLY C 3 193 ? 52.200 -6.996  21.852 1.00 39.65 ? 200 GLY A N     1 
ATOM   2051 C CA    . GLY C 3 193 ? 51.356 -5.822  21.718 1.00 39.59 ? 200 GLY A CA    1 
ATOM   2052 C C     . GLY C 3 193 ? 50.210 -5.866  22.722 1.00 44.69 ? 200 GLY A C     1 
ATOM   2053 O O     . GLY C 3 193 ? 50.390 -6.371  23.833 1.00 42.62 ? 200 GLY A O     1 
ATOM   2054 N N     . LYS C 3 194 ? 49.036 -5.350  22.342 1.00 43.68 ? 201 LYS A N     1 
ATOM   2055 C CA    . LYS C 3 194 ? 47.881 -5.343  23.235 1.00 44.17 ? 201 LYS A CA    1 
ATOM   2056 C C     . LYS C 3 194 ? 47.379 -6.770  23.452 1.00 43.65 ? 201 LYS A C     1 
ATOM   2057 O O     . LYS C 3 194 ? 46.603 -7.055  24.360 1.00 40.51 ? 201 LYS A O     1 
ATOM   2058 C CB    . LYS C 3 194 ? 46.754 -4.480  22.647 1.00 47.81 ? 201 LYS A CB    1 
ATOM   2059 C CG    . LYS C 3 194 ? 46.991 -2.978  22.685 1.00 61.64 ? 201 LYS A CG    1 
ATOM   2060 C CD    . LYS C 3 194 ? 48.239 -2.559  21.857 1.00 73.41 ? 201 LYS A CD    1 
ATOM   2061 C CE    . LYS C 3 194 ? 48.498 -1.022  21.833 1.00 71.37 ? 201 LYS A CE    1 
ATOM   2062 N NZ    . LYS C 3 194 ? 49.699 -0.605  20.997 1.00 64.65 ? 201 LYS A NZ    1 
ATOM   2063 N N     . THR C 3 195 ? 47.841 -7.682  22.618 1.00 44.09 ? 202 THR A N     1 
ATOM   2064 C CA    . THR C 3 195 ? 47.390 -9.055  22.725 1.00 45.24 ? 202 THR A CA    1 
ATOM   2065 C C     . THR C 3 195 ? 48.160 -9.884  23.746 1.00 46.47 ? 202 THR A C     1 
ATOM   2066 O O     . THR C 3 195 ? 49.389 -9.900  23.773 1.00 52.96 ? 202 THR A O     1 
ATOM   2067 C CB    . THR C 3 195 ? 47.427 -9.703  21.360 1.00 43.01 ? 202 THR A CB    1 
ATOM   2068 O OG1   . THR C 3 195 ? 46.723 -8.846  20.451 1.00 43.79 ? 202 THR A OG1   1 
ATOM   2069 C CG2   . THR C 3 195 ? 46.775 -11.082 21.398 1.00 34.80 ? 202 THR A CG2   1 
ATOM   2070 N N     . ILE C 3 196 ? 47.417 -10.563 24.601 1.00 41.68 ? 203 ILE A N     1 
ATOM   2071 C CA    . ILE C 3 196 ? 48.017 -11.365 25.640 1.00 42.08 ? 203 ILE A CA    1 
ATOM   2072 C C     . ILE C 3 196 ? 47.305 -12.679 25.662 1.00 44.87 ? 203 ILE A C     1 
ATOM   2073 O O     . ILE C 3 196 ? 46.077 -12.725 25.763 1.00 46.15 ? 203 ILE A O     1 
ATOM   2074 C CB    . ILE C 3 196 ? 47.831 -10.747 27.073 1.00 39.24 ? 203 ILE A CB    1 
ATOM   2075 C CG1   . ILE C 3 196 ? 48.572 -9.421  27.192 1.00 38.54 ? 203 ILE A CG1   1 
ATOM   2076 C CG2   . ILE C 3 196 ? 48.337 -11.718 28.150 1.00 30.42 ? 203 ILE A CG2   1 
ATOM   2077 C CD1   . ILE C 3 196 ? 48.120 -8.586  28.394 1.00 37.53 ? 203 ILE A CD1   1 
ATOM   2078 N N     . VAL C 3 197 ? 48.071 -13.750 25.562 1.00 41.18 ? 204 VAL A N     1 
ATOM   2079 C CA    . VAL C 3 197 ? 47.467 -15.045 25.666 1.00 40.54 ? 204 VAL A CA    1 
ATOM   2080 C C     . VAL C 3 197 ? 47.776 -15.501 27.100 1.00 40.77 ? 204 VAL A C     1 
ATOM   2081 O O     . VAL C 3 197 ? 48.930 -15.558 27.517 1.00 40.61 ? 204 VAL A O     1 
ATOM   2082 C CB    . VAL C 3 197 ? 48.043 -16.051 24.616 1.00 42.37 ? 204 VAL A CB    1 
ATOM   2083 C CG1   . VAL C 3 197 ? 47.415 -17.432 24.819 1.00 39.66 ? 204 VAL A CG1   1 
ATOM   2084 C CG2   . VAL C 3 197 ? 47.747 -15.583 23.213 1.00 30.40 ? 204 VAL A CG2   1 
ATOM   2085 N N     . VAL C 3 198 ? 46.724 -15.767 27.866 1.00 42.03 ? 205 VAL A N     1 
ATOM   2086 C CA    . VAL C 3 198 ? 46.872 -16.259 29.231 1.00 41.24 ? 205 VAL A CA    1 
ATOM   2087 C C     . VAL C 3 198 ? 46.758 -17.754 29.003 1.00 42.30 ? 205 VAL A C     1 
ATOM   2088 O O     . VAL C 3 198 ? 45.707 -18.248 28.614 1.00 41.94 ? 205 VAL A O     1 
ATOM   2089 C CB    . VAL C 3 198 ? 45.718 -15.795 30.167 1.00 38.20 ? 205 VAL A CB    1 
ATOM   2090 C CG1   . VAL C 3 198 ? 45.952 -16.323 31.547 1.00 39.41 ? 205 VAL A CG1   1 
ATOM   2091 C CG2   . VAL C 3 198 ? 45.648 -14.260 30.237 1.00 36.94 ? 205 VAL A CG2   1 
ATOM   2092 N N     . TYR C 3 199 ? 47.865 -18.462 29.190 1.00 43.63 ? 206 TYR A N     1 
ATOM   2093 C CA    . TYR C 3 199 ? 47.880 -19.901 28.972 1.00 44.69 ? 206 TYR A CA    1 
ATOM   2094 C C     . TYR C 3 199 ? 47.026 -20.642 29.979 1.00 49.53 ? 206 TYR A C     1 
ATOM   2095 O O     . TYR C 3 199 ? 46.881 -20.204 31.134 1.00 50.74 ? 206 TYR A O     1 
ATOM   2096 C CB    . TYR C 3 199 ? 49.297 -20.428 29.042 1.00 34.88 ? 206 TYR A CB    1 
ATOM   2097 C CG    . TYR C 3 199 ? 50.142 -19.979 27.901 1.00 36.71 ? 206 TYR A CG    1 
ATOM   2098 C CD1   . TYR C 3 199 ? 49.687 -20.127 26.588 1.00 32.17 ? 206 TYR A CD1   1 
ATOM   2099 C CD2   . TYR C 3 199 ? 51.429 -19.455 28.119 1.00 35.57 ? 206 TYR A CD2   1 
ATOM   2100 C CE1   . TYR C 3 199 ? 50.493 -19.777 25.518 1.00 36.21 ? 206 TYR A CE1   1 
ATOM   2101 C CE2   . TYR C 3 199 ? 52.245 -19.100 27.065 1.00 34.53 ? 206 TYR A CE2   1 
ATOM   2102 C CZ    . TYR C 3 199 ? 51.777 -19.271 25.758 1.00 39.77 ? 206 TYR A CZ    1 
ATOM   2103 O OH    . TYR C 3 199 ? 52.603 -19.017 24.678 1.00 46.29 ? 206 TYR A OH    1 
ATOM   2104 N N     . GLY C 3 200 ? 46.463 -21.764 29.536 1.00 51.48 ? 207 GLY A N     1 
ATOM   2105 C CA    . GLY C 3 200 ? 45.617 -22.557 30.404 1.00 55.92 ? 207 GLY A CA    1 
ATOM   2106 C C     . GLY C 3 200 ? 46.312 -23.838 30.803 1.00 62.80 ? 207 GLY A C     1 
ATOM   2107 O O     . GLY C 3 200 ? 46.739 -24.572 29.882 1.00 70.39 ? 207 GLY A O     1 
ATOM   2108 O OXT   . GLY C 3 200 ? 46.429 -24.108 32.016 1.00 58.02 ? 207 GLY A OXT   1 
HETATM 2109 P P     . CMP D 4 .   ? 27.273 8.724   40.619 1.00 43.51 ? 1   CMP A P     1 
HETATM 2110 O O1P   . CMP D 4 .   ? 27.884 9.172   41.903 1.00 39.22 ? 1   CMP A O1P   1 
HETATM 2111 O O2P   . CMP D 4 .   ? 25.974 9.280   40.215 1.00 39.86 ? 1   CMP A O2P   1 
HETATM 2112 O "O5'" . CMP D 4 .   ? 28.310 8.963   39.418 1.00 40.97 ? 1   CMP A "O5'" 1 
HETATM 2113 C "C5'" . CMP D 4 .   ? 29.357 8.024   39.112 1.00 43.75 ? 1   CMP A "C5'" 1 
HETATM 2114 C "C4'" . CMP D 4 .   ? 28.778 6.647   39.081 1.00 48.91 ? 1   CMP A "C4'" 1 
HETATM 2115 O "O4'" . CMP D 4 .   ? 29.761 5.595   38.891 1.00 47.41 ? 1   CMP A "O4'" 1 
HETATM 2116 C "C3'" . CMP D 4 .   ? 28.197 6.287   40.423 1.00 47.90 ? 1   CMP A "C3'" 1 
HETATM 2117 O "O3'" . CMP D 4 .   ? 27.071 7.123   40.647 1.00 49.22 ? 1   CMP A "O3'" 1 
HETATM 2118 C "C2'" . CMP D 4 .   ? 27.979 4.798   40.227 1.00 38.72 ? 1   CMP A "C2'" 1 
HETATM 2119 O "O2'" . CMP D 4 .   ? 26.915 4.509   39.346 1.00 58.02 ? 1   CMP A "O2'" 1 
HETATM 2120 C "C1'" . CMP D 4 .   ? 29.311 4.422   39.567 1.00 46.94 ? 1   CMP A "C1'" 1 
HETATM 2121 N N9    . CMP D 4 .   ? 30.301 4.049   40.580 1.00 44.82 ? 1   CMP A N9    1 
HETATM 2122 C C8    . CMP D 4 .   ? 30.923 4.872   41.489 1.00 43.06 ? 1   CMP A C8    1 
HETATM 2123 N N7    . CMP D 4 .   ? 31.728 4.244   42.305 1.00 41.19 ? 1   CMP A N7    1 
HETATM 2124 C C5    . CMP D 4 .   ? 31.644 2.918   41.903 1.00 40.98 ? 1   CMP A C5    1 
HETATM 2125 C C6    . CMP D 4 .   ? 32.286 1.747   42.358 1.00 40.51 ? 1   CMP A C6    1 
HETATM 2126 N N6    . CMP D 4 .   ? 33.175 1.733   43.348 1.00 40.56 ? 1   CMP A N6    1 
HETATM 2127 N N1    . CMP D 4 .   ? 31.990 0.585   41.736 1.00 37.59 ? 1   CMP A N1    1 
HETATM 2128 C C2    . CMP D 4 .   ? 31.121 0.610   40.713 1.00 40.84 ? 1   CMP A C2    1 
HETATM 2129 N N3    . CMP D 4 .   ? 30.462 1.645   40.185 1.00 40.29 ? 1   CMP A N3    1 
HETATM 2130 C C4    . CMP D 4 .   ? 30.772 2.784   40.836 1.00 42.16 ? 1   CMP A C4    1 
HETATM 2131 P P     . CMP E 4 .   ? 50.648 4.948   33.743 1.00 85.22 ? 2   CMP A P     1 
HETATM 2132 O O1P   . CMP E 4 .   ? 52.002 4.898   34.394 1.00 85.22 ? 2   CMP A O1P   1 
HETATM 2133 O O2P   . CMP E 4 .   ? 50.502 5.493   32.351 1.00 85.22 ? 2   CMP A O2P   1 
HETATM 2134 O "O5'" . CMP E 4 .   ? 49.981 3.479   33.772 1.00 85.22 ? 2   CMP A "O5'" 1 
HETATM 2135 C "C5'" . CMP E 4 .   ? 49.173 3.034   34.873 1.00 85.10 ? 2   CMP A "C5'" 1 
HETATM 2136 C "C4'" . CMP E 4 .   ? 48.307 4.170   35.325 1.00 85.22 ? 2   CMP A "C4'" 1 
HETATM 2137 O "O4'" . CMP E 4 .   ? 47.456 3.874   36.464 1.00 85.22 ? 2   CMP A "O4'" 1 
HETATM 2138 C "C3'" . CMP E 4 .   ? 49.151 5.312   35.833 1.00 85.22 ? 2   CMP A "C3'" 1 
HETATM 2139 O "O3'" . CMP E 4 .   ? 49.728 5.877   34.685 1.00 85.22 ? 2   CMP A "O3'" 1 
HETATM 2140 C "C2'" . CMP E 4 .   ? 48.098 6.173   36.504 1.00 85.22 ? 2   CMP A "C2'" 1 
HETATM 2141 O "O2'" . CMP E 4 .   ? 47.380 6.887   35.498 1.00 58.02 ? 2   CMP A "O2'" 1 
HETATM 2142 C "C1'" . CMP E 4 .   ? 47.231 5.089   37.184 1.00 84.72 ? 2   CMP A "C1'" 1 
HETATM 2143 N N9    . CMP E 4 .   ? 47.521 4.846   38.603 1.00 77.31 ? 2   CMP A N9    1 
HETATM 2144 C C8    . CMP E 4 .   ? 46.645 4.456   39.578 1.00 74.30 ? 2   CMP A C8    1 
HETATM 2145 N N7    . CMP E 4 .   ? 47.195 4.316   40.755 1.00 78.07 ? 2   CMP A N7    1 
HETATM 2146 C C5    . CMP E 4 .   ? 48.528 4.638   40.543 1.00 80.87 ? 2   CMP A C5    1 
HETATM 2147 C C6    . CMP E 4 .   ? 49.659 4.669   41.401 1.00 85.22 ? 2   CMP A C6    1 
HETATM 2148 N N6    . CMP E 4 .   ? 49.616 4.391   42.713 1.00 85.22 ? 2   CMP A N6    1 
HETATM 2149 N N1    . CMP E 4 .   ? 50.856 5.001   40.855 1.00 85.22 ? 2   CMP A N1    1 
HETATM 2150 C C2    . CMP E 4 .   ? 50.902 5.292   39.552 1.00 85.22 ? 2   CMP A C2    1 
HETATM 2151 N N3    . CMP E 4 .   ? 49.913 5.309   38.654 1.00 85.18 ? 2   CMP A N3    1 
HETATM 2152 C C4    . CMP E 4 .   ? 48.741 4.965   39.222 1.00 79.21 ? 2   CMP A C4    1 
HETATM 2153 O O     . HOH F 5 .   ? 55.942 -4.473  23.787 1.00 57.06 ? 115 HOH B O     1 
HETATM 2154 O O     . HOH F 5 .   ? 47.364 2.686   6.982  1.00 55.98 ? 126 HOH B O     1 
HETATM 2155 O O     . HOH F 5 .   ? 50.691 6.978   4.516  1.00 62.26 ? 130 HOH B O     1 
HETATM 2156 O O     . HOH F 5 .   ? 61.616 -4.082  24.488 1.00 77.59 ? 133 HOH B O     1 
HETATM 2157 O O     . HOH F 5 .   ? 42.396 9.234   19.829 1.00 50.79 ? 151 HOH B O     1 
HETATM 2158 O O     . HOH G 5 .   ? 43.307 0.517   10.987 1.00 61.40 ? 118 HOH C O     1 
HETATM 2159 O O     . HOH G 5 .   ? 40.663 5.791   14.559 1.00 66.82 ? 122 HOH C O     1 
HETATM 2160 O O     . HOH G 5 .   ? 64.308 -3.793  40.656 1.00 79.74 ? 135 HOH C O     1 
HETATM 2161 O O     . HOH G 5 .   ? 63.958 15.160  16.863 1.00 62.97 ? 136 HOH C O     1 
HETATM 2162 O O     . HOH G 5 .   ? 58.734 -10.138 42.381 1.00 67.67 ? 141 HOH C O     1 
HETATM 2163 O O     . HOH G 5 .   ? 64.605 8.011   30.377 1.00 56.88 ? 145 HOH C O     1 
HETATM 2164 O O     . HOH G 5 .   ? 45.216 0.101   22.388 1.00 85.22 ? 153 HOH C O     1 
HETATM 2165 O O     . HOH H 5 .   ? 48.197 -15.899 35.475 1.00 31.44 ? 208 HOH A O     1 
HETATM 2166 O O     . HOH H 5 .   ? 43.202 -4.849  41.931 1.00 34.53 ? 209 HOH A O     1 
HETATM 2167 O O     . HOH H 5 .   ? 51.169 -10.826 47.922 1.00 42.87 ? 210 HOH A O     1 
HETATM 2168 O O     . HOH H 5 .   ? 55.756 -5.585  28.594 1.00 32.32 ? 211 HOH A O     1 
HETATM 2169 O O     . HOH H 5 .   ? 27.960 14.546  28.310 1.00 42.06 ? 212 HOH A O     1 
HETATM 2170 O O     . HOH H 5 .   ? 32.266 -2.366  41.271 1.00 42.64 ? 213 HOH A O     1 
HETATM 2171 O O     . HOH H 5 .   ? 12.632 11.642  32.030 1.00 45.41 ? 214 HOH A O     1 
HETATM 2172 O O     . HOH H 5 .   ? 36.914 13.282  31.233 1.00 57.75 ? 215 HOH A O     1 
HETATM 2173 O O     . HOH H 5 .   ? 27.530 -4.682  39.055 1.00 45.35 ? 216 HOH A O     1 
HETATM 2174 O O     . HOH H 5 .   ? 38.893 4.121   29.595 1.00 44.81 ? 217 HOH A O     1 
HETATM 2175 O O     . HOH H 5 .   ? 27.980 14.185  47.269 1.00 45.29 ? 218 HOH A O     1 
HETATM 2176 O O     . HOH H 5 .   ? 45.725 7.461   33.680 1.00 69.33 ? 219 HOH A O     1 
HETATM 2177 O O     . HOH H 5 .   ? 39.344 -8.392  25.510 1.00 61.12 ? 220 HOH A O     1 
HETATM 2178 O O     . HOH H 5 .   ? 23.334 -7.240  35.510 1.00 56.97 ? 221 HOH A O     1 
HETATM 2179 O O     . HOH H 5 .   ? 37.771 -7.246  42.556 1.00 48.83 ? 222 HOH A O     1 
HETATM 2180 O O     . HOH H 5 .   ? 35.190 -4.491  37.338 1.00 47.69 ? 223 HOH A O     1 
HETATM 2181 O O     . HOH H 5 .   ? 31.306 19.599  31.218 1.00 52.13 ? 224 HOH A O     1 
HETATM 2182 O O     . HOH H 5 .   ? 38.873 11.122  42.023 1.00 57.20 ? 225 HOH A O     1 
HETATM 2183 O O     . HOH H 5 .   ? 42.509 -9.928  49.416 1.00 44.77 ? 226 HOH A O     1 
HETATM 2184 O O     . HOH H 5 .   ? 39.749 -4.194  28.601 1.00 49.05 ? 227 HOH A O     1 
HETATM 2185 O O     . HOH H 5 .   ? 60.573 -12.596 28.083 1.00 58.24 ? 228 HOH A O     1 
HETATM 2186 O O     . HOH H 5 .   ? 26.282 -9.154  26.459 1.00 77.85 ? 229 HOH A O     1 
HETATM 2187 O O     . HOH H 5 .   ? 40.540 -1.389  40.144 1.00 35.78 ? 230 HOH A O     1 
HETATM 2188 O O     . HOH H 5 .   ? 36.315 -5.147  29.919 1.00 82.39 ? 231 HOH A O     1 
HETATM 2189 O O     . HOH H 5 .   ? 16.772 -1.156  22.600 1.00 64.48 ? 232 HOH A O     1 
HETATM 2190 O O     . HOH H 5 .   ? 39.849 15.291  33.918 1.00 54.81 ? 233 HOH A O     1 
HETATM 2191 O O     . HOH H 5 .   ? 45.680 -26.528 32.155 1.00 53.15 ? 234 HOH A O     1 
HETATM 2192 O O     . HOH H 5 .   ? 22.059 14.903  35.905 1.00 40.28 ? 235 HOH A O     1 
HETATM 2193 O O     . HOH H 5 .   ? 25.760 -10.057 45.510 1.00 55.07 ? 236 HOH A O     1 
HETATM 2194 O O     . HOH H 5 .   ? 27.774 14.500  33.962 1.00 59.00 ? 237 HOH A O     1 
HETATM 2195 O O     . HOH H 5 .   ? 40.046 -11.597 45.089 1.00 74.99 ? 238 HOH A O     1 
HETATM 2196 O O     . HOH H 5 .   ? 52.505 -22.727 31.000 1.00 49.76 ? 239 HOH A O     1 
HETATM 2197 O O     . HOH H 5 .   ? 55.301 7.916   32.582 1.00 81.28 ? 240 HOH A O     1 
HETATM 2198 O O     . HOH H 5 .   ? 64.949 -15.115 32.788 1.00 63.32 ? 241 HOH A O     1 
HETATM 2199 O O     . HOH H 5 .   ? 26.346 9.522   20.378 1.00 46.50 ? 242 HOH A O     1 
HETATM 2200 O O     . HOH H 5 .   ? 12.833 -7.081  26.007 1.00 70.47 ? 243 HOH A O     1 
HETATM 2201 O O     . HOH H 5 .   ? 62.304 -12.955 35.036 1.00 57.02 ? 244 HOH A O     1 
HETATM 2202 O O     . HOH H 5 .   ? 15.327 0.065   24.329 1.00 57.83 ? 245 HOH A O     1 
HETATM 2203 O O     . HOH H 5 .   ? 50.795 -4.842  48.905 1.00 57.22 ? 246 HOH A O     1 
HETATM 2204 O O     . HOH H 5 .   ? 17.620 21.940  37.837 1.00 56.78 ? 247 HOH A O     1 
HETATM 2205 O O     . HOH H 5 .   ? 40.490 -22.444 18.935 1.00 67.07 ? 248 HOH A O     1 
HETATM 2206 O O     . HOH H 5 .   ? 52.163 6.884   42.016 1.00 61.79 ? 249 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   -2  -2  DA  A   B . n 
A 1 2   DA  2   -1  -1  DA  A   B . n 
A 1 3   DA  3   1   1   DA  A   B . n 
A 1 4   DA  4   2   2   DA  A   B . n 
A 1 5   DA  5   3   3   DA  A   B . n 
A 1 6   DT  6   4   4   DT  T   B . n 
A 1 7   DG  7   5   5   DG  G   B . n 
A 1 8   DC  8   6   6   DC  C   B . n 
A 1 9   DG  9   7   7   DG  G   B . n 
A 1 10  DA  10  8   8   DA  A   B . n 
A 1 11  DT  11  9   9   DT  T   B . n 
B 2 1   DC  1   13  13  DC  C   C . n 
B 2 2   DT  2   12  12  DT  T   C . n 
B 2 3   DA  3   11  11  DA  A   C . n 
B 2 4   DG  4   10  10  DG  G   C . n 
B 2 5   DA  5   9   9   DA  A   C . n 
B 2 6   DT  6   8   8   DT  T   C . n 
B 2 7   DC  7   7   7   DC  C   C . n 
B 2 8   DG  8   6   6   DG  G   C . n 
B 2 9   DC  9   5   5   DC  C   C . n 
B 2 10  DA  10  4   4   DA  A   C . n 
B 2 11  DT  11  3   3   DT  T   C . n 
B 2 12  DT  12  2   2   DT  T   C . n 
B 2 13  DT  13  1   1   DT  T   C . n 
B 2 14  DT  14  -1  -1  DT  T   C . n 
B 2 15  DT  15  -2  -2  DT  T   C . n 
C 3 1   ASP 1   8   8   ASP ASP A . n 
C 3 2   PRO 2   9   9   PRO PRO A . n 
C 3 3   THR 3   10  10  THR THR A . n 
C 3 4   LEU 4   11  11  LEU LEU A . n 
C 3 5   GLU 5   12  12  GLU GLU A . n 
C 3 6   TRP 6   13  13  TRP TRP A . n 
C 3 7   PHE 7   14  14  PHE PHE A . n 
C 3 8   LEU 8   15  15  LEU LEU A . n 
C 3 9   SER 9   16  16  SER SER A . n 
C 3 10  HIS 10  17  17  HIS HIS A . n 
C 3 11  CYS 11  18  18  CYS CYS A . n 
C 3 12  HIS 12  19  19  HIS HIS A . n 
C 3 13  ILE 13  20  20  ILE ILE A . n 
C 3 14  HIS 14  21  21  HIS HIS A . n 
C 3 15  LYS 15  22  22  LYS LYS A . n 
C 3 16  TYR 16  23  23  TYR TYR A . n 
C 3 17  PRO 17  24  24  PRO PRO A . n 
C 3 18  SER 18  25  25  SER SER A . n 
C 3 19  LYS 19  26  26  LYS LYS A . n 
C 3 20  SER 20  27  27  SER SER A . n 
C 3 21  THR 21  28  28  THR THR A . n 
C 3 22  LEU 22  29  29  LEU LEU A . n 
C 3 23  ILE 23  30  30  ILE ILE A . n 
C 3 24  HIS 24  31  31  HIS HIS A . n 
C 3 25  GLN 25  32  32  GLN GLN A . n 
C 3 26  GLY 26  33  33  GLY GLY A . n 
C 3 27  GLU 27  34  34  GLU GLU A . n 
C 3 28  LYS 28  35  35  LYS LYS A . n 
C 3 29  ALA 29  36  36  ALA ALA A . n 
C 3 30  GLU 30  37  37  GLU GLU A . n 
C 3 31  THR 31  38  38  THR THR A . n 
C 3 32  LEU 32  39  39  LEU LEU A . n 
C 3 33  TYR 33  40  40  TYR TYR A . n 
C 3 34  TYR 34  41  41  TYR TYR A . n 
C 3 35  ILE 35  42  42  ILE ILE A . n 
C 3 36  VAL 36  43  43  VAL VAL A . n 
C 3 37  LYS 37  44  44  LYS LYS A . n 
C 3 38  GLY 38  45  45  GLY GLY A . n 
C 3 39  SER 39  46  46  SER SER A . n 
C 3 40  VAL 40  47  47  VAL VAL A . n 
C 3 41  ALA 41  48  48  ALA ALA A . n 
C 3 42  VAL 42  49  49  VAL VAL A . n 
C 3 43  LEU 43  50  50  LEU LEU A . n 
C 3 44  ILE 44  51  51  ILE ILE A . n 
C 3 45  LYS 45  52  52  LYS LYS A . n 
C 3 46  ASP 46  53  53  ASP ASP A . n 
C 3 47  GLU 47  54  54  GLU GLU A . n 
C 3 48  GLU 48  55  55  GLU GLU A . n 
C 3 49  GLY 49  56  56  GLY GLY A . n 
C 3 50  LYS 50  57  57  LYS LYS A . n 
C 3 51  GLU 51  58  58  GLU GLU A . n 
C 3 52  MET 52  59  59  MET MET A . n 
C 3 53  ILE 53  60  60  ILE ILE A . n 
C 3 54  LEU 54  61  61  LEU LEU A . n 
C 3 55  SER 55  62  62  SER SER A . n 
C 3 56  TYR 56  63  63  TYR TYR A . n 
C 3 57  LEU 57  64  64  LEU LEU A . n 
C 3 58  ASN 58  65  65  ASN ASN A . n 
C 3 59  GLN 59  66  66  GLN GLN A . n 
C 3 60  GLY 60  67  67  GLY GLY A . n 
C 3 61  ASP 61  68  68  ASP ASP A . n 
C 3 62  PHE 62  69  69  PHE PHE A . n 
C 3 63  ILE 63  70  70  ILE ILE A . n 
C 3 64  GLY 64  71  71  GLY GLY A . n 
C 3 65  GLU 65  72  72  GLU GLU A . n 
C 3 66  LEU 66  73  73  LEU LEU A . n 
C 3 67  GLY 67  74  74  GLY GLY A . n 
C 3 68  LEU 68  75  75  LEU LEU A . n 
C 3 69  PHE 69  76  76  PHE PHE A . n 
C 3 70  GLU 70  77  77  GLU GLU A . n 
C 3 71  GLU 71  78  78  GLU GLU A . n 
C 3 72  GLY 72  79  79  GLY GLY A . n 
C 3 73  GLN 73  80  80  GLN GLN A . n 
C 3 74  GLU 74  81  81  GLU GLU A . n 
C 3 75  ARG 75  82  82  ARG ARG A . n 
C 3 76  SER 76  83  83  SER SER A . n 
C 3 77  ALA 77  84  84  ALA ALA A . n 
C 3 78  TRP 78  85  85  TRP TRP A . n 
C 3 79  VAL 79  86  86  VAL VAL A . n 
C 3 80  ARG 80  87  87  ARG ARG A . n 
C 3 81  ALA 81  88  88  ALA ALA A . n 
C 3 82  LYS 82  89  89  LYS LYS A . n 
C 3 83  THR 83  90  90  THR THR A . n 
C 3 84  ALA 84  91  91  ALA ALA A . n 
C 3 85  CYS 85  92  92  CYS CYS A . n 
C 3 86  GLU 86  93  93  GLU GLU A . n 
C 3 87  VAL 87  94  94  VAL VAL A . n 
C 3 88  ALA 88  95  95  ALA ALA A . n 
C 3 89  GLU 89  96  96  GLU GLU A . n 
C 3 90  ILE 90  97  97  ILE ILE A . n 
C 3 91  SER 91  98  98  SER SER A . n 
C 3 92  TYR 92  99  99  TYR TYR A . n 
C 3 93  LYS 93  100 100 LYS LYS A . n 
C 3 94  LYS 94  101 101 LYS LYS A . n 
C 3 95  PHE 95  102 102 PHE PHE A . n 
C 3 96  ARG 96  103 103 ARG ARG A . n 
C 3 97  GLN 97  104 104 GLN GLN A . n 
C 3 98  LEU 98  105 105 LEU LEU A . n 
C 3 99  ILE 99  106 106 ILE ILE A . n 
C 3 100 GLN 100 107 107 GLN GLN A . n 
C 3 101 VAL 101 108 108 VAL VAL A . n 
C 3 102 ASN 102 109 109 ASN ASN A . n 
C 3 103 PRO 103 110 110 PRO PRO A . n 
C 3 104 ASP 104 111 111 ASP ASP A . n 
C 3 105 ILE 105 112 112 ILE ILE A . n 
C 3 106 LEU 106 113 113 LEU LEU A . n 
C 3 107 MET 107 114 114 MET MET A . n 
C 3 108 ARG 108 115 115 ARG ARG A . n 
C 3 109 LEU 109 116 116 LEU LEU A . n 
C 3 110 SER 110 117 117 SER SER A . n 
C 3 111 ALA 111 118 118 ALA ALA A . n 
C 3 112 GLN 112 119 119 GLN GLN A . n 
C 3 113 MET 113 120 120 MET MET A . n 
C 3 114 ALA 114 121 121 ALA ALA A . n 
C 3 115 ARG 115 122 122 ARG ARG A . n 
C 3 116 ARG 116 123 123 ARG ARG A . n 
C 3 117 LEU 117 124 124 LEU LEU A . n 
C 3 118 GLN 118 125 125 GLN GLN A . n 
C 3 119 VAL 119 126 126 VAL VAL A . n 
C 3 120 THR 120 127 127 THR THR A . n 
C 3 121 SER 121 128 128 SER SER A . n 
C 3 122 GLU 122 129 129 GLU GLU A . n 
C 3 123 LYS 123 130 130 LYS LYS A . n 
C 3 124 VAL 124 131 131 VAL VAL A . n 
C 3 125 GLY 125 132 132 GLY GLY A . n 
C 3 126 ASN 126 133 133 ASN ASN A . n 
C 3 127 LEU 127 134 134 LEU LEU A . n 
C 3 128 ALA 128 135 135 ALA ALA A . n 
C 3 129 PHE 129 136 136 PHE PHE A . n 
C 3 130 LEU 130 137 137 LEU LEU A . n 
C 3 131 ASP 131 138 138 ASP ASP A . n 
C 3 132 VAL 132 139 139 VAL VAL A . n 
C 3 133 THR 133 140 140 THR THR A . n 
C 3 134 GLY 134 141 141 GLY GLY A . n 
C 3 135 ARG 135 142 142 ARG ARG A . n 
C 3 136 ILE 136 143 143 ILE ILE A . n 
C 3 137 ALA 137 144 144 ALA ALA A . n 
C 3 138 GLN 138 145 145 GLN GLN A . n 
C 3 139 THR 139 146 146 THR THR A . n 
C 3 140 LEU 140 147 147 LEU LEU A . n 
C 3 141 LEU 141 148 148 LEU LEU A . n 
C 3 142 ASN 142 149 149 ASN ASN A . n 
C 3 143 LEU 143 150 150 LEU LEU A . n 
C 3 144 ALA 144 151 151 ALA ALA A . n 
C 3 145 LYS 145 152 152 LYS LYS A . n 
C 3 146 GLN 146 153 153 GLN GLN A . n 
C 3 147 PRO 147 154 154 PRO PRO A . n 
C 3 148 ASP 148 155 155 ASP ASP A . n 
C 3 149 ALA 149 156 156 ALA ALA A . n 
C 3 150 MET 150 157 157 MET MET A . n 
C 3 151 THR 151 158 158 THR THR A . n 
C 3 152 HIS 152 159 159 HIS HIS A . n 
C 3 153 PRO 153 160 160 PRO PRO A . n 
C 3 154 ASP 154 161 161 ASP ASP A . n 
C 3 155 GLY 155 162 162 GLY GLY A . n 
C 3 156 MET 156 163 163 MET MET A . n 
C 3 157 GLN 157 164 164 GLN GLN A . n 
C 3 158 ILE 158 165 165 ILE ILE A . n 
C 3 159 LYS 159 166 166 LYS LYS A . n 
C 3 160 ILE 160 167 167 ILE ILE A . n 
C 3 161 THR 161 168 168 THR THR A . n 
C 3 162 ARG 162 169 169 ARG ARG A . n 
C 3 163 GLN 163 170 170 GLN GLN A . n 
C 3 164 GLU 164 171 171 GLU GLU A . n 
C 3 165 ILE 165 172 172 ILE ILE A . n 
C 3 166 GLY 166 173 173 GLY GLY A . n 
C 3 167 GLN 167 174 174 GLN GLN A . n 
C 3 168 ILE 168 175 175 ILE ILE A . n 
C 3 169 VAL 169 176 176 VAL VAL A . n 
C 3 170 GLY 170 177 177 GLY GLY A . n 
C 3 171 CYS 171 178 178 CYS CYS A . n 
C 3 172 SER 172 179 179 SER SER A . n 
C 3 173 ARG 173 180 180 ARG ARG A . n 
C 3 174 GLU 174 181 181 GLU GLU A . n 
C 3 175 THR 175 182 182 THR THR A . n 
C 3 176 VAL 176 183 183 VAL VAL A . n 
C 3 177 GLY 177 184 184 GLY GLY A . n 
C 3 178 ARG 178 185 185 ARG ARG A . n 
C 3 179 ILE 179 186 186 ILE ILE A . n 
C 3 180 LEU 180 187 187 LEU LEU A . n 
C 3 181 LYS 181 188 188 LYS LYS A . n 
C 3 182 MET 182 189 189 MET MET A . n 
C 3 183 LEU 183 190 190 LEU LEU A . n 
C 3 184 GLU 184 191 191 GLU GLU A . n 
C 3 185 ASP 185 192 192 ASP ASP A . n 
C 3 186 GLN 186 193 193 GLN GLN A . n 
C 3 187 ASN 187 194 194 ASN ASN A . n 
C 3 188 LEU 188 195 195 LEU LEU A . n 
C 3 189 ILE 189 196 196 ILE ILE A . n 
C 3 190 SER 190 197 197 SER SER A . n 
C 3 191 ALA 191 198 198 ALA ALA A . n 
C 3 192 HIS 192 199 199 HIS HIS A . n 
C 3 193 GLY 193 200 200 GLY GLY A . n 
C 3 194 LYS 194 201 201 LYS LYS A . n 
C 3 195 THR 195 202 202 THR THR A . n 
C 3 196 ILE 196 203 203 ILE ILE A . n 
C 3 197 VAL 197 204 204 VAL VAL A . n 
C 3 198 VAL 198 205 205 VAL VAL A . n 
C 3 199 TYR 199 206 206 TYR TYR A . n 
C 3 200 GLY 200 207 207 GLY GLY A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 95.7600000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-08 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO 'data reduction' .         ? 1 
SCALA 'data scaling'   .         ? 2 
AMoRE phasing          .         ? 3 
CNS   refinement       0.5       ? 4 
CCP4  'data scaling'   '(SCALA)' ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 10  ? ? -59.65  -2.72  
2 1 SER A 25  ? ? -49.37  162.77 
3 1 ILE A 167 ? ? -177.45 149.73 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1O3R 'double helix'        
1O3R 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 1  1_555 B DT 15 1_555 -0.022 0.192  -0.474 -4.974  -7.972  -2.498 1  B_DA-2:DT-2_C B -2 ? C -2 ? 20 1 
1 A DA 2  1_555 B DT 14 1_555 0.012  -0.089 0.030  9.087   -8.233  2.493  2  B_DA-1:DT-1_C B -1 ? C -1 ? 20 1 
1 A DA 3  1_555 B DT 13 1_555 0.193  0.154  0.429  15.735  -20.816 -7.766 3  B_DA1:DT1_C   B 1  ? C 1  ? 20 1 
1 A DA 4  1_555 B DT 12 1_555 -0.086 0.074  -0.106 3.423   -17.558 -2.217 4  B_DA2:DT2_C   B 2  ? C 2  ? 20 1 
1 A DA 5  1_555 B DT 11 1_555 0.404  -0.036 0.638  -4.630  -14.097 -9.511 5  B_DA3:DT3_C   B 3  ? C 3  ? 20 1 
1 A DT 6  1_555 B DA 10 1_555 -0.132 -0.209 -0.951 -4.152  -31.257 7.996  6  B_DT4:DA4_C   B 4  ? C 4  ? 20 1 
1 A DG 7  1_555 B DC 9  1_555 -0.128 -0.167 -0.988 -17.221 -0.315  1.350  7  B_DG5:DC5_C   B 5  ? C 5  ? 19 1 
1 A DC 8  1_555 B DG 8  1_555 0.068  -0.031 -0.991 20.397  -13.947 5.682  8  B_DC6:DG6_C   B 6  ? C 6  ? 19 1 
1 A DG 9  1_555 B DC 7  1_555 0.000  -0.161 -0.945 -28.384 1.431   -8.660 9  B_DG7:DC7_C   B 7  ? C 7  ? 19 1 
1 A DA 10 1_555 B DT 6  1_555 0.057  -0.083 0.296  -6.539  -10.627 2.919  10 B_DA8:DT8_C   B 8  ? C 8  ? 20 1 
1 A DT 11 1_555 B DA 5  1_555 -0.021 -0.301 1.119  -9.652  -7.223  3.404  11 B_DT9:DA9_C   B 9  ? C 9  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1  1_555 B DT 15 1_555 A DA 2  1_555 B DT 14 1_555 0.360  0.106  2.900 1.006   -3.744 36.310 0.628  -0.452 2.884 -5.986 
-1.609  36.509 1  BB_DA-2DA-1:DT-1DT-2_CC B -2 ? C -2 ? B -1 ? C -1 ? 
1 A DA 2  1_555 B DT 14 1_555 A DA 3  1_555 B DT 13 1_555 -0.327 -0.375 3.214 0.444   -6.682 39.453 0.212  0.529  3.229 -9.812 
-0.652  39.995 2  BB_DA-1DA1:DT1DT-1_CC   B -1 ? C -1 ? B 1  ? C 1  ? 
1 A DA 3  1_555 B DT 13 1_555 A DA 4  1_555 B DT 12 1_555 0.381  -0.800 3.301 3.259   7.313  36.950 -2.171 -0.171 3.114 11.374 
-5.070  37.778 3  BB_DA1DA2:DT2DT1_CC     B 1  ? C 1  ? B 2  ? C 2  ? 
1 A DA 4  1_555 B DT 12 1_555 A DA 5  1_555 B DT 11 1_555 -0.306 -0.594 3.272 -6.630  -3.826 35.095 -0.406 -0.471 3.318 -6.253 
10.836  35.894 4  BB_DA2DA3:DT3DT2_CC     B 2  ? C 2  ? B 3  ? C 3  ? 
1 A DA 5  1_555 B DT 11 1_555 A DT 6  1_555 B DA 10 1_555 0.630  -0.572 3.275 14.913  3.618  35.336 -1.337 0.967  3.205 5.644  
-23.261 38.427 5  BB_DA3DT4:DA4DT3_CC     B 3  ? C 3  ? B 4  ? C 4  ? 
1 A DT 6  1_555 B DA 10 1_555 A DG 7  1_555 B DC 9  1_555 0.124  1.827  3.689 -4.888  7.544  35.638 1.681  -0.987 3.931 12.091 
7.833   36.718 6  BB_DT4DG5:DC5DA4_CC     B 4  ? C 4  ? B 5  ? C 5  ? 
1 A DG 7  1_555 B DC 9  1_555 A DC 8  1_555 B DG 8  1_555 -0.439 0.587  2.204 -0.385  6.618  28.453 0.164  0.812  2.285 13.238 
0.770   29.199 7  BB_DG5DC6:DG6DC5_CC     B 5  ? C 5  ? B 6  ? C 6  ? 
1 A DC 8  1_555 B DG 8  1_555 A DG 9  1_555 B DC 7  1_555 -0.074 3.091  5.022 -3.607  40.331 9.290  -5.856 -0.810 4.152 77.308 
6.914   41.501 8  BB_DC6DG7:DC7DG6_CC     B 6  ? C 6  ? B 7  ? C 7  ? 
1 A DG 9  1_555 B DC 7  1_555 A DA 10 1_555 B DT 6  1_555 -0.211 2.116  2.694 -16.480 -2.490 31.883 3.728  -1.596 2.354 -4.194 
27.757  35.876 9  BB_DG7DA8:DT8DC7_CC     B 7  ? C 7  ? B 8  ? C 8  ? 
1 A DA 10 1_555 B DT 6  1_555 A DT 11 1_555 B DA 5  1_555 0.019  -1.161 3.344 -4.243  -0.301 32.701 -1.993 -0.772 3.326 -0.532 
7.496   32.969 10 BB_DA8DT9:DA9DT8_CC     B 8  ? C 8  ? B 9  ? C 9  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
5 water                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CMP 1  1   1   CMP CMP A . 
E 4 CMP 1  2   2   CMP CMP A . 
F 5 HOH 1  115 115 HOH HOH B . 
F 5 HOH 2  126 126 HOH HOH B . 
F 5 HOH 3  130 130 HOH HOH B . 
F 5 HOH 4  133 133 HOH HOH B . 
F 5 HOH 5  151 151 HOH HOH B . 
G 5 HOH 1  118 118 HOH HOH C . 
G 5 HOH 2  122 122 HOH HOH C . 
G 5 HOH 3  135 135 HOH HOH C . 
G 5 HOH 4  136 136 HOH HOH C . 
G 5 HOH 5  141 141 HOH HOH C . 
G 5 HOH 6  145 145 HOH HOH C . 
G 5 HOH 7  153 153 HOH HOH C . 
H 5 HOH 1  208 100 HOH HOH A . 
H 5 HOH 2  209 101 HOH HOH A . 
H 5 HOH 3  210 102 HOH HOH A . 
H 5 HOH 4  211 103 HOH HOH A . 
H 5 HOH 5  212 104 HOH HOH A . 
H 5 HOH 6  213 105 HOH HOH A . 
H 5 HOH 7  214 106 HOH HOH A . 
H 5 HOH 8  215 107 HOH HOH A . 
H 5 HOH 9  216 108 HOH HOH A . 
H 5 HOH 10 217 109 HOH HOH A . 
H 5 HOH 11 218 110 HOH HOH A . 
H 5 HOH 12 219 111 HOH HOH A . 
H 5 HOH 13 220 112 HOH HOH A . 
H 5 HOH 14 221 113 HOH HOH A . 
H 5 HOH 15 222 114 HOH HOH A . 
H 5 HOH 16 223 116 HOH HOH A . 
H 5 HOH 17 224 117 HOH HOH A . 
H 5 HOH 18 225 119 HOH HOH A . 
H 5 HOH 19 226 120 HOH HOH A . 
H 5 HOH 20 227 121 HOH HOH A . 
H 5 HOH 21 228 123 HOH HOH A . 
H 5 HOH 22 229 124 HOH HOH A . 
H 5 HOH 23 230 125 HOH HOH A . 
H 5 HOH 24 231 127 HOH HOH A . 
H 5 HOH 25 232 128 HOH HOH A . 
H 5 HOH 26 233 129 HOH HOH A . 
H 5 HOH 27 234 131 HOH HOH A . 
H 5 HOH 28 235 132 HOH HOH A . 
H 5 HOH 29 236 134 HOH HOH A . 
H 5 HOH 30 237 137 HOH HOH A . 
H 5 HOH 31 238 138 HOH HOH A . 
H 5 HOH 32 239 139 HOH HOH A . 
H 5 HOH 33 240 140 HOH HOH A . 
H 5 HOH 34 241 142 HOH HOH A . 
H 5 HOH 35 242 143 HOH HOH A . 
H 5 HOH 36 243 144 HOH HOH A . 
H 5 HOH 37 244 146 HOH HOH A . 
H 5 HOH 38 245 147 HOH HOH A . 
H 5 HOH 39 246 148 HOH HOH A . 
H 5 HOH 40 247 149 HOH HOH A . 
H 5 HOH 41 248 150 HOH HOH A . 
H 5 HOH 42 249 152 HOH HOH A . 
#