data_1O3T
# 
_entry.id   1O3T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O3T         
NDB   PD0401       
RCSB  RCSB001769   
WWPDB D_1000001769 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2003-04-08 
_pdbx_database_PDB_obs_spr.pdb_id           1O3T 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1DBC 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1O3Q . unspecified 
PDB 1O3R . unspecified 
PDB 1O3S . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O3T 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, S.'         1 
'Vojtechovsky, J.' 2 
'Parkinson, G.N.'  3 
'Ebright, R.H.'    4 
'Berman, H.M.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex:  
DNA Binding Specificity Based on Energetics of DNA Kinking
;
J.Mol.Biol. 314 63 74 2001 JMOBAK UK 0022-2836 0070 ? 11724532 10.1006/jmbi.2001.5089 
1       
;Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex:  
Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
;
J.Mol.Biol. 314 75 82 2001 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.2001.5090 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, S.'         1  
primary 'Vojtechovsky, J.' 2  
primary 'Parkinson, G.N.'  3  
primary 'Ebright, R.H.'    4  
primary 'Berman, H.M.'     5  
1       'Chen, S.'         6  
1       'Gunasekera, A.'   7  
1       'Zhang, X.'        8  
1       'Kunkel, T.A.'     9  
1       'Ebright, R.H.'    10 
1       'Berman, H.M.'     11 
# 
_cell.entry_id           1O3T 
_cell.length_a           136.990 
_cell.length_b           152.800 
_cell.length_c           76.060 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1O3T 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'"          4337.855  2  ? ? ? ? 
2 polymer     syn "5'-D(*CP*TP*AP*GP*AP*TP*CP*GP*CP*AP*TP*TP*TP*TP*TP*CP*G)-3'" 5168.357  2  ? ? ? ? 
3 polymer     man 'CATABOLITE GENE ACTIVATOR PROTEIN'                           22558.072 2  ? ? ? ? 
4 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                        329.206   2  ? ? ? ? 
5 water       nat water                                                         18.015    56 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'CAP, CAMP RECEPTOR PROTEIN, CAMP-REGULATORY PROTEIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DA)(DA)(DA)(DA)(DA)(DT)(DG)(DC)(DG)(DA)(DT)' GCGAAAAATGCGAT C,F ? 
2 polydeoxyribonucleotide no no '(DC)(DT)(DA)(DG)(DA)(DT)(DC)(DG)(DC)(DA)(DT)(DT)(DT)(DT)(DT)(DC)(DG)' CTAGATCGCATTTTTCG D,E ? 
3 'polypeptide(L)'        no no 
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DA  n 
1 8   DA  n 
1 9   DT  n 
1 10  DG  n 
1 11  DC  n 
1 12  DG  n 
1 13  DA  n 
1 14  DT  n 
2 1   DC  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DC  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
3 1   ASP n 
3 2   PRO n 
3 3   THR n 
3 4   LEU n 
3 5   GLU n 
3 6   TRP n 
3 7   PHE n 
3 8   LEU n 
3 9   SER n 
3 10  HIS n 
3 11  CYS n 
3 12  HIS n 
3 13  ILE n 
3 14  HIS n 
3 15  LYS n 
3 16  TYR n 
3 17  PRO n 
3 18  SER n 
3 19  LYS n 
3 20  SER n 
3 21  THR n 
3 22  LEU n 
3 23  ILE n 
3 24  HIS n 
3 25  GLN n 
3 26  GLY n 
3 27  GLU n 
3 28  LYS n 
3 29  ALA n 
3 30  GLU n 
3 31  THR n 
3 32  LEU n 
3 33  TYR n 
3 34  TYR n 
3 35  ILE n 
3 36  VAL n 
3 37  LYS n 
3 38  GLY n 
3 39  SER n 
3 40  VAL n 
3 41  ALA n 
3 42  VAL n 
3 43  LEU n 
3 44  ILE n 
3 45  LYS n 
3 46  ASP n 
3 47  GLU n 
3 48  GLU n 
3 49  GLY n 
3 50  LYS n 
3 51  GLU n 
3 52  MET n 
3 53  ILE n 
3 54  LEU n 
3 55  SER n 
3 56  TYR n 
3 57  LEU n 
3 58  ASN n 
3 59  GLN n 
3 60  GLY n 
3 61  ASP n 
3 62  PHE n 
3 63  ILE n 
3 64  GLY n 
3 65  GLU n 
3 66  LEU n 
3 67  GLY n 
3 68  LEU n 
3 69  PHE n 
3 70  GLU n 
3 71  GLU n 
3 72  GLY n 
3 73  GLN n 
3 74  GLU n 
3 75  ARG n 
3 76  SER n 
3 77  ALA n 
3 78  TRP n 
3 79  VAL n 
3 80  ARG n 
3 81  ALA n 
3 82  LYS n 
3 83  THR n 
3 84  ALA n 
3 85  CYS n 
3 86  GLU n 
3 87  VAL n 
3 88  ALA n 
3 89  GLU n 
3 90  ILE n 
3 91  SER n 
3 92  TYR n 
3 93  LYS n 
3 94  LYS n 
3 95  PHE n 
3 96  ARG n 
3 97  GLN n 
3 98  LEU n 
3 99  ILE n 
3 100 GLN n 
3 101 VAL n 
3 102 ASN n 
3 103 PRO n 
3 104 ASP n 
3 105 ILE n 
3 106 LEU n 
3 107 MET n 
3 108 ARG n 
3 109 LEU n 
3 110 SER n 
3 111 ALA n 
3 112 GLN n 
3 113 MET n 
3 114 ALA n 
3 115 ARG n 
3 116 ARG n 
3 117 LEU n 
3 118 GLN n 
3 119 VAL n 
3 120 THR n 
3 121 SER n 
3 122 GLU n 
3 123 LYS n 
3 124 VAL n 
3 125 GLY n 
3 126 ASN n 
3 127 LEU n 
3 128 ALA n 
3 129 PHE n 
3 130 LEU n 
3 131 ASP n 
3 132 VAL n 
3 133 THR n 
3 134 GLY n 
3 135 ARG n 
3 136 ILE n 
3 137 ALA n 
3 138 GLN n 
3 139 THR n 
3 140 LEU n 
3 141 LEU n 
3 142 ASN n 
3 143 LEU n 
3 144 ALA n 
3 145 LYS n 
3 146 GLN n 
3 147 PRO n 
3 148 ASP n 
3 149 ALA n 
3 150 MET n 
3 151 THR n 
3 152 HIS n 
3 153 PRO n 
3 154 ASP n 
3 155 GLY n 
3 156 MET n 
3 157 GLN n 
3 158 ILE n 
3 159 LYS n 
3 160 ILE n 
3 161 THR n 
3 162 ARG n 
3 163 GLN n 
3 164 GLU n 
3 165 ILE n 
3 166 GLY n 
3 167 GLN n 
3 168 ILE n 
3 169 VAL n 
3 170 GLY n 
3 171 CYS n 
3 172 SER n 
3 173 ARG n 
3 174 GLU n 
3 175 THR n 
3 176 VAL n 
3 177 GLY n 
3 178 ARG n 
3 179 ILE n 
3 180 LEU n 
3 181 LYS n 
3 182 MET n 
3 183 LEU n 
3 184 GLU n 
3 185 ASP n 
3 186 GLN n 
3 187 ASN n 
3 188 LEU n 
3 189 ILE n 
3 190 SER n 
3 191 ALA n 
3 192 HIS n 
3 193 GLY n 
3 194 LYS n 
3 195 THR n 
3 196 ILE n 
3 197 VAL n 
3 198 VAL n 
3 199 TYR n 
3 200 GLY n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP CRP_ECOLI P0ACJ8 9 
;DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVR
AKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKI
TRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
;
? 
2 1 PDB 1O3T      1O3T   ? ? ? 
3 2 PDB 1O3T      1O3T   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O3T A 1 ? 200 ? P0ACJ8 9  ? 208 ? 8  207 
2 1 1O3T B 1 ? 200 ? P0ACJ8 9  ? 208 ? 8  207 
3 2 1O3T C 1 ? 14  ? 1O3T   -5 ? 9   ? -5 9   
4 3 1O3T D 1 ? 17  ? 1O3T   13 ? -4  ? 13 -4  
5 3 1O3T E 1 ? 17  ? 1O3T   10 ? 26  ? 10 26  
6 2 1O3T F 1 ? 14  ? 1O3T   27 ? 14  ? 27 14  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                  'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ?                  'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1O3T 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   4 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.density_percent_sol   60.84 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
;PEG 3350, MES, NACL, MGCL2, CACL2, CAMP, NAN3, DITHIOTHREITOL, SPERMINE, 
N-OCTYL-B-D-GLUCOPYRANOSIDE, pH 5.5, VAPOR DIFFUSION, HANGING DROP 
at 293K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 N-OCTYL-B-D-GLUCOPYRANOSIDE ? ? ? 
1 2  1 MES                         ? ? ? 
1 3  1 NACL                        ? ? ? 
1 4  1 MGCL2                       ? ? ? 
1 5  1 CAMP                        ? ? ? 
1 6  1 CACL2                       ? ? ? 
1 7  1 NAN3                        ? ? ? 
1 8  1 DITHIOTHREITOL              ? ? ? 
1 9  1 SPERMINE                    ? ? ? 
1 10 1 'PEG 3350'                  ? ? ? 
1 11 2 'PEG 3350'                  ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           258.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   FUJI 
_diffrn_detector.pdbx_collection_date   1993-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.908 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1O3T 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   14452 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1O3T 
_refine.ls_number_reflns_obs                     14452 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               1827714.04 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    72.2 
_refine.ls_R_factor_obs                          0.2301 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23 
_refine.ls_R_factor_R_free                       0.303 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  747 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.0 
_refine.aniso_B[1][1]                            18.78 
_refine.aniso_B[2][2]                            -11.72 
_refine.aniso_B[3][3]                            -7.06 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.299 
_refine.solvent_model_param_bsol                 55.06 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1O3T 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.49 
_refine_analyze.Luzzati_sigma_a_free            0.54 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3129 
_refine_hist.pdbx_number_atoms_nucleic_acid   1262 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             56 
_refine_hist.number_atoms_total               4491 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.010 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.60  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.40 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.07  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.330 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.250 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.250 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.280 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.97 
_refine_ls_shell.number_reflns_R_work             1752 
_refine_ls_shell.R_factor_R_work                  0.269 
_refine_ls_shell.percent_reflns_obs               56.10 
_refine_ls_shell.R_factor_R_free                  0.374 
_refine_ls_shell.R_factor_R_free_error            0.041 
_refine_ls_shell.percent_reflns_R_free            4.60 
_refine_ls_shell.number_reflns_R_free             85 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 CMP.PARAM         CMP.TOP     'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1O3T 
_struct.title                     'PROTEIN-DNA RECOGNITION AND DNA DEFORMATION REVEALED IN CRYSTAL STRUCTURES OF CAP-DNA COMPLEXES' 
_struct.pdbx_descriptor           'CATABOLITE GENE ACTIVATOR PROTEIN/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O3T 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            
'PROTEIN-DNA COMPLEX, CAP, CAP-DNA, CATABOLITE GENE ACTIVATOR PROTEIN, CAMP RECEPTOR PROTEIN, CRP, GENE REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 1 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU E 4   ? HIS E 10  ? LEU A 11  HIS A 17  1 ? 7  
HELX_P HELX_P2  2  SER E 91  ? VAL E 101 ? SER A 98  VAL A 108 1 ? 11 
HELX_P HELX_P3  3  ASP E 104 ? LEU E 130 ? ASP A 111 LEU A 137 1 ? 27 
HELX_P HELX_P4  4  THR E 133 ? LYS E 145 ? THR A 140 LYS A 152 1 ? 13 
HELX_P HELX_P5  5  THR E 161 ? GLY E 170 ? THR A 168 GLY A 177 1 ? 10 
HELX_P HELX_P6  6  SER E 172 ? GLN E 186 ? SER A 179 GLN A 193 1 ? 15 
HELX_P HELX_P7  7  THR F 3   ? SER F 9   ? THR B 10  SER B 16  1 ? 7  
HELX_P HELX_P8  8  SER F 91  ? ASN F 102 ? SER B 98  ASN B 109 1 ? 12 
HELX_P HELX_P9  9  ILE F 105 ? PHE F 129 ? ILE B 112 PHE B 136 1 ? 25 
HELX_P HELX_P10 10 ASP F 131 ? LYS F 145 ? ASP B 138 LYS B 152 1 ? 15 
HELX_P HELX_P11 11 THR F 161 ? GLY F 170 ? THR B 168 GLY B 177 1 ? 10 
HELX_P HELX_P12 12 SER F 172 ? ASN F 187 ? SER B 179 ASN B 194 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 17 N1 ? ? C DC -4 D DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 17 O6 ? ? C DC -4 D DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 17 N2 ? ? C DC -4 D DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 16 N3 ? ? C DG -3 D DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 16 O2 ? ? C DG -3 D DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 16 N4 ? ? C DG -3 D DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 15 N3 ? ? C DA -2 D DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 15 O4 ? ? C DA -2 D DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 14 N3 ? ? C DA -1 D DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 14 O4 ? ? C DA -1 D DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT 13 N3 ? ? C DA 1  D DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT 13 O4 ? ? C DA 1  D DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 11 O4 ? ? C DA 2  D DT 3  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog14 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 12 N3 ? ? C DA 2  D DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 12 O4 ? ? C DA 2  D DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 11 N3 ? ? C DA 3  D DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 11 O4 ? ? C DA 3  D DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 10 N1 ? ? C DT 4  D DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 10 N6 ? ? C DT 4  D DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 9  N3 ? ? C DG 5  D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 9  O2 ? ? C DG 5  D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 9  N4 ? ? C DG 5  D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG 8  N1 ? ? C DC 6  D DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG 8  O6 ? ? C DC 6  D DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG 8  N2 ? ? C DC 6  D DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 7  N3 ? ? C DG 7  D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 7  O2 ? ? C DG 7  D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 7  N4 ? ? C DG 7  D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 6  N3 ? ? C DA 8  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 6  O4 ? ? C DA 8  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 5  N1 ? ? C DT 9  D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 5  N6 ? ? C DT 9  D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33 hydrog ? ? B DC 1  N3 ? ? ? 1_555 C DG 4  N1 ? ? D DC 13 E DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34 hydrog ? ? B DC 1  N4 ? ? ? 1_555 C DG 4  O6 ? ? D DC 13 E DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35 hydrog ? ? B DC 1  O2 ? ? ? 1_555 C DG 4  N2 ? ? D DC 13 E DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36 hydrog ? ? B DT 2  N3 ? ? ? 1_555 C DA 3  N1 ? ? D DT 12 E DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37 hydrog ? ? B DT 2  O4 ? ? ? 1_555 C DA 3  N6 ? ? D DT 12 E DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38 hydrog ? ? B DA 3  N1 ? ? ? 1_555 C DT 2  N3 ? ? D DA 11 E DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? B DA 3  N6 ? ? ? 1_555 C DT 2  O4 ? ? D DA 11 E DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40 hydrog ? ? B DG 4  N1 ? ? ? 1_555 C DC 1  N3 ? ? D DG 10 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41 hydrog ? ? B DG 4  N2 ? ? ? 1_555 C DC 1  O2 ? ? D DG 10 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42 hydrog ? ? B DG 4  O6 ? ? ? 1_555 C DC 1  N4 ? ? D DG 10 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43 hydrog ? ? B DG 4  N2 ? ? ? 1_555 C DT 2  O2 ? ? D DG 10 E DT 11 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? 
hydrog44 hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 14 N3 ? ? E DA 14 F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45 hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 14 O4 ? ? E DA 14 F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46 hydrog ? ? C DT 6  N3 ? ? ? 1_555 D DA 13 N1 ? ? E DT 15 F DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47 hydrog ? ? C DT 6  O4 ? ? ? 1_555 D DA 13 N6 ? ? E DT 15 F DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48 hydrog ? ? C DC 7  N3 ? ? ? 1_555 D DG 12 N1 ? ? E DC 16 F DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49 hydrog ? ? C DC 7  N4 ? ? ? 1_555 D DG 12 O6 ? ? E DC 16 F DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50 hydrog ? ? C DC 7  O2 ? ? ? 1_555 D DG 12 N2 ? ? E DC 16 F DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51 hydrog ? ? C DG 8  N1 ? ? ? 1_555 D DC 11 N3 ? ? E DG 17 F DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52 hydrog ? ? C DG 8  N2 ? ? ? 1_555 D DC 11 O2 ? ? E DG 17 F DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53 hydrog ? ? C DG 8  O6 ? ? ? 1_555 D DC 11 N4 ? ? E DG 17 F DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54 hydrog ? ? C DC 9  N3 ? ? ? 1_555 D DG 10 N1 ? ? E DC 18 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55 hydrog ? ? C DC 9  N4 ? ? ? 1_555 D DG 10 O6 ? ? E DC 18 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56 hydrog ? ? C DC 9  O2 ? ? ? 1_555 D DG 10 N2 ? ? E DC 18 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 9  N3 ? ? E DA 19 F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 9  O4 ? ? E DA 19 F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 8  N1 ? ? E DT 20 F DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA 8  N6 ? ? E DT 20 F DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 7  N1 ? ? E DT 21 F DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 7  N6 ? ? E DT 21 F DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63 hydrog ? ? C DT 13 N3 ? ? ? 1_555 D DA 6  N1 ? ? E DT 22 F DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64 hydrog ? ? C DT 13 O4 ? ? ? 1_555 D DA 6  N6 ? ? E DT 22 F DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65 hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 5  N1 ? ? E DT 23 F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66 hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA 5  N6 ? ? E DT 23 F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67 hydrog ? ? C DT 15 N3 ? ? ? 1_555 D DA 4  N1 ? ? E DT 24 F DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68 hydrog ? ? C DT 15 O4 ? ? ? 1_555 D DA 4  N6 ? ? E DT 24 F DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69 hydrog ? ? C DC 16 N3 ? ? ? 1_555 D DG 3  N1 ? ? E DC 25 F DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70 hydrog ? ? C DC 16 N4 ? ? ? 1_555 D DG 3  O6 ? ? E DC 25 F DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71 hydrog ? ? C DC 16 O2 ? ? ? 1_555 D DG 3  N2 ? ? E DC 25 F DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72 hydrog ? ? C DG 17 N1 ? ? ? 1_555 D DC 2  N3 ? ? E DG 26 F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73 hydrog ? ? C DG 17 N2 ? ? ? 1_555 D DC 2  O2 ? ? E DG 26 F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74 hydrog ? ? C DG 17 O6 ? ? ? 1_555 D DC 2  N4 ? ? E DG 26 F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 13  ? TYR E 16  ? ILE A 20  TYR A 23  
A 2 CYS E 85  ? GLU E 89  ? CYS A 92  GLU A 96  
A 3 TYR E 33  ? LYS E 37  ? TYR A 40  LYS A 44  
A 4 PHE E 62  ? ILE E 63  ? PHE A 69  ILE A 70  
B 1 THR E 21  ? ILE E 23  ? THR A 28  ILE A 30  
B 2 TRP E 78  ? ARG E 80  ? TRP A 85  ARG A 87  
B 3 VAL E 40  ? LYS E 45  ? VAL A 47  LYS A 52  
B 4 GLU E 51  ? LEU E 57  ? GLU A 58  LEU A 64  
C 1 MET E 150 ? THR E 151 ? MET A 157 THR A 158 
C 2 MET E 156 ? ILE E 158 ? MET A 163 ILE A 165 
C 3 THR E 195 ? VAL E 197 ? THR A 202 VAL A 204 
D 1 PHE F 62  ? ILE F 63  ? PHE B 69  ILE B 70  
D 2 TYR F 33  ? LYS F 37  ? TYR B 40  LYS B 44  
D 3 GLU F 86  ? VAL F 87  ? GLU B 93  VAL B 94  
E 1 GLU F 51  ? TYR F 56  ? GLU B 58  TYR B 63  
E 2 VAL F 40  ? LYS F 45  ? VAL B 47  LYS B 52  
E 3 TRP F 78  ? ALA F 81  ? TRP B 85  ALA B 88  
F 1 THR F 151 ? HIS F 152 ? THR B 158 HIS B 159 
F 2 GLY F 155 ? MET F 156 ? GLY B 162 MET B 163 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS E 14  ? N HIS A 21  O VAL E 87  ? O VAL A 94  
A 2 3 O ALA E 88  ? O ALA A 95  N TYR E 34  ? N TYR A 41  
A 3 4 N TYR E 33  ? N TYR A 40  O ILE E 63  ? O ILE A 70  
B 1 2 N ILE E 23  ? N ILE A 30  O VAL E 79  ? O VAL A 86  
B 2 3 O TRP E 78  ? O TRP A 85  N LEU E 43  ? N LEU A 50  
B 3 4 N VAL E 42  ? N VAL A 49  O SER E 55  ? O SER A 62  
C 1 2 N MET E 150 ? N MET A 157 O GLN E 157 ? O GLN A 164 
C 2 3 N MET E 156 ? N MET A 163 O VAL E 197 ? O VAL A 204 
D 1 2 O ILE F 63  ? O ILE B 70  N TYR F 33  ? N TYR B 40  
D 2 3 N LYS F 37  ? N LYS B 44  O GLU F 86  ? O GLU B 93  
E 1 2 O SER F 55  ? O SER B 62  N VAL F 42  ? N VAL B 49  
E 2 3 N LEU F 43  ? N LEU B 50  O TRP F 78  ? O TRP B 85  
F 1 2 N HIS F 152 ? N HIS B 159 O GLY F 155 ? O GLY B 162 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CMP B 761' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CMP A 762' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 LEU E 117 ? LEU A 124 . ? 1_555 ? 
2  AC1 13 SER E 121 ? SER A 128 . ? 1_555 ? 
3  AC1 13 ILE F 23  ? ILE B 30  . ? 1_555 ? 
4  AC1 13 VAL F 42  ? VAL B 49  . ? 1_555 ? 
5  AC1 13 SER F 55  ? SER B 62  . ? 1_555 ? 
6  AC1 13 GLY F 64  ? GLY B 71  . ? 1_555 ? 
7  AC1 13 GLU F 65  ? GLU B 72  . ? 1_555 ? 
8  AC1 13 LEU F 66  ? LEU B 73  . ? 1_555 ? 
9  AC1 13 ARG F 75  ? ARG B 82  . ? 1_555 ? 
10 AC1 13 SER F 76  ? SER B 83  . ? 1_555 ? 
11 AC1 13 ALA F 77  ? ALA B 84  . ? 1_555 ? 
12 AC1 13 ARG F 116 ? ARG B 123 . ? 1_555 ? 
13 AC1 13 THR F 120 ? THR B 127 . ? 1_555 ? 
14 AC2 12 VAL E 42  ? VAL A 49  . ? 1_555 ? 
15 AC2 12 LEU E 54  ? LEU A 61  . ? 1_555 ? 
16 AC2 12 ILE E 63  ? ILE A 70  . ? 1_555 ? 
17 AC2 12 GLY E 64  ? GLY A 71  . ? 1_555 ? 
18 AC2 12 GLU E 65  ? GLU A 72  . ? 1_555 ? 
19 AC2 12 LEU E 66  ? LEU A 73  . ? 1_555 ? 
20 AC2 12 ARG E 75  ? ARG A 82  . ? 1_555 ? 
21 AC2 12 SER E 76  ? SER A 83  . ? 1_555 ? 
22 AC2 12 ALA E 77  ? ALA A 84  . ? 1_555 ? 
23 AC2 12 THR E 120 ? THR A 127 . ? 1_555 ? 
24 AC2 12 LEU F 117 ? LEU B 124 . ? 1_555 ? 
25 AC2 12 SER F 121 ? SER B 128 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1O3T 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O3T 
_atom_sites.fract_transf_matrix[1][1]   0.007300 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006545 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013148 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? 74.557 25.310 -20.675 1.00 57.69 ? -5  DG  C "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? 75.888 25.814 -20.858 1.00 59.26 ? -5  DG  C "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? 76.223 27.012 -19.998 1.00 58.72 ? -5  DG  C "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? 75.238 28.052 -20.213 1.00 58.87 ? -5  DG  C "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? 76.164 26.722 -18.501 1.00 58.16 ? -5  DG  C "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? 77.011 27.646 -17.825 1.00 58.33 ? -5  DG  C "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? 74.715 27.003 -18.160 1.00 58.65 ? -5  DG  C "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? 74.395 28.180 -19.070 1.00 59.65 ? -5  DG  C "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? 73.013 28.203 -19.535 1.00 61.36 ? -5  DG  C N9    1 
ATOM   10   C C8    . DG  A 1 1   ? 72.245 27.114 -19.872 1.00 62.80 ? -5  DG  C C8    1 
ATOM   11   N N7    . DG  A 1 1   ? 71.040 27.436 -20.253 1.00 62.51 ? -5  DG  C N7    1 
ATOM   12   C C5    . DG  A 1 1   ? 71.009 28.818 -20.162 1.00 60.33 ? -5  DG  C C5    1 
ATOM   13   C C6    . DG  A 1 1   ? 69.970 29.716 -20.440 1.00 59.02 ? -5  DG  C C6    1 
ATOM   14   O O6    . DG  A 1 1   ? 68.829 29.464 -20.843 1.00 60.63 ? -5  DG  C O6    1 
ATOM   15   N N1    . DG  A 1 1   ? 70.356 31.030 -20.209 1.00 57.53 ? -5  DG  C N1    1 
ATOM   16   C C2    . DG  A 1 1   ? 71.596 31.424 -19.769 1.00 58.48 ? -5  DG  C C2    1 
ATOM   17   N N2    . DG  A 1 1   ? 71.785 32.748 -19.607 1.00 55.05 ? -5  DG  C N2    1 
ATOM   18   N N3    . DG  A 1 1   ? 72.581 30.586 -19.507 1.00 59.49 ? -5  DG  C N3    1 
ATOM   19   C C4    . DG  A 1 1   ? 72.220 29.308 -19.721 1.00 60.33 ? -5  DG  C C4    1 
ATOM   20   P P     . DC  A 1 2   ? 77.178 27.554 -16.240 1.00 59.06 ? -4  DC  C P     1 
ATOM   21   O OP1   . DC  A 1 2   ? 78.521 26.955 -16.010 1.00 60.49 ? -4  DC  C OP1   1 
ATOM   22   O OP2   . DC  A 1 2   ? 75.975 26.890 -15.690 1.00 56.99 ? -4  DC  C OP2   1 
ATOM   23   O "O5'" . DC  A 1 2   ? 77.205 29.080 -15.763 1.00 59.17 ? -4  DC  C "O5'" 1 
ATOM   24   C "C5'" . DC  A 1 2   ? 78.222 29.977 -16.237 1.00 60.61 ? -4  DC  C "C5'" 1 
ATOM   25   C "C4'" . DC  A 1 2   ? 78.175 31.314 -15.520 1.00 60.71 ? -4  DC  C "C4'" 1 
ATOM   26   O "O4'" . DC  A 1 2   ? 77.014 32.077 -15.945 1.00 59.45 ? -4  DC  C "O4'" 1 
ATOM   27   C "C3'" . DC  A 1 2   ? 78.054 31.219 -14.002 1.00 59.98 ? -4  DC  C "C3'" 1 
ATOM   28   O "O3'" . DC  A 1 2   ? 78.716 32.323 -13.366 1.00 59.94 ? -4  DC  C "O3'" 1 
ATOM   29   C "C2'" . DC  A 1 2   ? 76.549 31.214 -13.789 1.00 60.29 ? -4  DC  C "C2'" 1 
ATOM   30   C "C1'" . DC  A 1 2   ? 76.047 32.139 -14.898 1.00 58.46 ? -4  DC  C "C1'" 1 
ATOM   31   N N1    . DC  A 1 2   ? 74.743 31.771 -15.474 1.00 58.02 ? -4  DC  C N1    1 
ATOM   32   C C2    . DC  A 1 2   ? 73.662 32.664 -15.358 1.00 58.60 ? -4  DC  C C2    1 
ATOM   33   O O2    . DC  A 1 2   ? 73.820 33.729 -14.748 1.00 61.57 ? -4  DC  C O2    1 
ATOM   34   N N3    . DC  A 1 2   ? 72.472 32.340 -15.914 1.00 58.20 ? -4  DC  C N3    1 
ATOM   35   C C4    . DC  A 1 2   ? 72.333 31.174 -16.556 1.00 58.56 ? -4  DC  C C4    1 
ATOM   36   N N4    . DC  A 1 2   ? 71.139 30.887 -17.085 1.00 57.98 ? -4  DC  C N4    1 
ATOM   37   C C5    . DC  A 1 2   ? 73.411 30.245 -16.682 1.00 57.21 ? -4  DC  C C5    1 
ATOM   38   C C6    . DC  A 1 2   ? 74.585 30.581 -16.130 1.00 58.03 ? -4  DC  C C6    1 
ATOM   39   P P     . DG  A 1 3   ? 79.219 32.183 -11.839 1.00 61.88 ? -3  DG  C P     1 
ATOM   40   O OP1   . DG  A 1 3   ? 80.641 32.607 -11.750 1.00 61.94 ? -3  DG  C OP1   1 
ATOM   41   O OP2   . DG  A 1 3   ? 78.822 30.831 -11.355 1.00 61.74 ? -3  DG  C OP2   1 
ATOM   42   O "O5'" . DG  A 1 3   ? 78.353 33.279 -11.079 1.00 60.27 ? -3  DG  C "O5'" 1 
ATOM   43   C "C5'" . DG  A 1 3   ? 77.019 33.503 -11.493 1.00 58.57 ? -3  DG  C "C5'" 1 
ATOM   44   C "C4'" . DG  A 1 3   ? 76.609 34.940 -11.295 1.00 56.99 ? -3  DG  C "C4'" 1 
ATOM   45   O "O4'" . DG  A 1 3   ? 75.419 35.126 -12.083 1.00 56.26 ? -3  DG  C "O4'" 1 
ATOM   46   C "C3'" . DG  A 1 3   ? 76.229 35.344 -9.880  1.00 58.04 ? -3  DG  C "C3'" 1 
ATOM   47   O "O3'" . DG  A 1 3   ? 76.430 36.747 -9.682  1.00 59.02 ? -3  DG  C "O3'" 1 
ATOM   48   C "C2'" . DG  A 1 3   ? 74.768 34.950 -9.814  1.00 58.10 ? -3  DG  C "C2'" 1 
ATOM   49   C "C1'" . DG  A 1 3   ? 74.266 35.112 -11.250 1.00 57.81 ? -3  DG  C "C1'" 1 
ATOM   50   N N9    . DG  A 1 3   ? 73.512 33.926 -11.643 1.00 57.23 ? -3  DG  C N9    1 
ATOM   51   C C8    . DG  A 1 3   ? 73.967 32.636 -11.544 1.00 56.83 ? -3  DG  C C8    1 
ATOM   52   N N7    . DG  A 1 3   ? 73.113 31.752 -11.975 1.00 58.40 ? -3  DG  C N7    1 
ATOM   53   C C5    . DG  A 1 3   ? 72.020 32.502 -12.383 1.00 57.39 ? -3  DG  C C5    1 
ATOM   54   C C6    . DG  A 1 3   ? 70.785 32.083 -12.943 1.00 57.52 ? -3  DG  C C6    1 
ATOM   55   O O6    . DG  A 1 3   ? 70.401 30.925 -13.195 1.00 55.19 ? -3  DG  C O6    1 
ATOM   56   N N1    . DG  A 1 3   ? 69.959 33.168 -13.215 1.00 57.06 ? -3  DG  C N1    1 
ATOM   57   C C2    . DG  A 1 3   ? 70.283 34.482 -12.980 1.00 57.06 ? -3  DG  C C2    1 
ATOM   58   N N2    . DG  A 1 3   ? 69.350 35.376 -13.315 1.00 56.96 ? -3  DG  C N2    1 
ATOM   59   N N3    . DG  A 1 3   ? 71.431 34.887 -12.456 1.00 55.64 ? -3  DG  C N3    1 
ATOM   60   C C4    . DG  A 1 3   ? 72.247 33.850 -12.184 1.00 56.66 ? -3  DG  C C4    1 
ATOM   61   P P     . DA  A 1 4   ? 76.158 37.397 -8.233  1.00 60.90 ? -2  DA  C P     1 
ATOM   62   O OP1   . DA  A 1 4   ? 77.098 38.539 -8.057  1.00 60.32 ? -2  DA  C OP1   1 
ATOM   63   O OP2   . DA  A 1 4   ? 76.105 36.320 -7.203  1.00 57.81 ? -2  DA  C OP2   1 
ATOM   64   O "O5'" . DA  A 1 4   ? 74.698 38.004 -8.368  1.00 57.78 ? -2  DA  C "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 4   ? 74.390 38.938 -9.394  1.00 55.90 ? -2  DA  C "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 4   ? 73.018 39.522 -9.159  1.00 55.20 ? -2  DA  C "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 4   ? 72.019 38.484 -9.329  1.00 52.42 ? -2  DA  C "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 4   ? 72.831 40.017 -7.726  1.00 55.20 ? -2  DA  C "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 4   ? 71.896 41.102 -7.739  1.00 58.15 ? -2  DA  C "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 4   ? 72.321 38.783 -7.000  1.00 52.01 ? -2  DA  C "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 4   ? 71.456 38.128 -8.068  1.00 49.97 ? -2  DA  C "C1'" 1 
ATOM   72   N N9    . DA  A 1 4   ? 71.341 36.670 -8.015  1.00 46.95 ? -2  DA  C N9    1 
ATOM   73   C C8    . DA  A 1 4   ? 72.124 35.756 -7.344  1.00 44.35 ? -2  DA  C C8    1 
ATOM   74   N N7    . DA  A 1 4   ? 71.749 34.511 -7.522  1.00 43.61 ? -2  DA  C N7    1 
ATOM   75   C C5    . DA  A 1 4   ? 70.641 34.611 -8.362  1.00 45.30 ? -2  DA  C C5    1 
ATOM   76   C C6    . DA  A 1 4   ? 69.778 33.642 -8.928  1.00 44.71 ? -2  DA  C C6    1 
ATOM   77   N N6    . DA  A 1 4   ? 69.902 32.328 -8.727  1.00 43.85 ? -2  DA  C N6    1 
ATOM   78   N N1    . DA  A 1 4   ? 68.768 34.079 -9.718  1.00 43.99 ? -2  DA  C N1    1 
ATOM   79   C C2    . DA  A 1 4   ? 68.643 35.396 -9.924  1.00 43.16 ? -2  DA  C C2    1 
ATOM   80   N N3    . DA  A 1 4   ? 69.386 36.400 -9.452  1.00 44.81 ? -2  DA  C N3    1 
ATOM   81   C C4    . DA  A 1 4   ? 70.379 35.934 -8.668  1.00 45.87 ? -2  DA  C C4    1 
ATOM   82   P P     . DA  A 1 5   ? 70.924 41.344 -6.486  1.00 60.02 ? -1  DA  C P     1 
ATOM   83   O OP1   . DA  A 1 5   ? 70.440 42.759 -6.594  1.00 57.06 ? -1  DA  C OP1   1 
ATOM   84   O OP2   . DA  A 1 5   ? 71.631 40.890 -5.252  1.00 59.02 ? -1  DA  C OP2   1 
ATOM   85   O "O5'" . DA  A 1 5   ? 69.698 40.366 -6.783  1.00 61.32 ? -1  DA  C "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 5   ? 69.049 40.392 -8.062  1.00 62.32 ? -1  DA  C "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 5   ? 67.582 40.036 -7.940  1.00 62.35 ? -1  DA  C "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 5   ? 67.441 38.600 -7.792  1.00 62.78 ? -1  DA  C "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 5   ? 66.920 40.633 -6.696  1.00 62.82 ? -1  DA  C "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 5   ? 65.530 40.892 -6.946  1.00 63.70 ? -1  DA  C "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 5   ? 67.147 39.558 -5.645  1.00 61.86 ? -1  DA  C "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 5   ? 67.005 38.289 -6.470  1.00 62.67 ? -1  DA  C "C1'" 1 
ATOM   93   N N9    . DA  A 1 5   ? 67.738 37.114 -5.991  1.00 63.31 ? -1  DA  C N9    1 
ATOM   94   C C8    . DA  A 1 5   ? 68.818 37.046 -5.141  1.00 62.13 ? -1  DA  C C8    1 
ATOM   95   N N7    . DA  A 1 5   ? 69.212 35.819 -4.885  1.00 62.97 ? -1  DA  C N7    1 
ATOM   96   C C5    . DA  A 1 5   ? 68.338 35.026 -5.623  1.00 63.52 ? -1  DA  C C5    1 
ATOM   97   C C6    . DA  A 1 5   ? 68.221 33.626 -5.786  1.00 64.18 ? -1  DA  C C6    1 
ATOM   98   N N6    . DA  A 1 5   ? 69.015 32.732 -5.185  1.00 64.78 ? -1  DA  C N6    1 
ATOM   99   N N1    . DA  A 1 5   ? 67.242 33.169 -6.598  1.00 65.21 ? -1  DA  C N1    1 
ATOM   100  C C2    . DA  A 1 5   ? 66.439 34.058 -7.200  1.00 65.03 ? -1  DA  C C2    1 
ATOM   101  N N3    . DA  A 1 5   ? 66.445 35.386 -7.125  1.00 64.83 ? -1  DA  C N3    1 
ATOM   102  C C4    . DA  A 1 5   ? 67.431 35.812 -6.312  1.00 63.94 ? -1  DA  C C4    1 
ATOM   103  P P     . DA  A 1 6   ? 64.467 40.869 -5.730  1.00 66.05 ? 1   DA  C P     1 
ATOM   104  O OP1   . DA  A 1 6   ? 63.499 41.974 -5.975  1.00 63.94 ? 1   DA  C OP1   1 
ATOM   105  O OP2   . DA  A 1 6   ? 65.175 40.793 -4.420  1.00 63.47 ? 1   DA  C OP2   1 
ATOM   106  O "O5'" . DA  A 1 6   ? 63.691 39.498 -5.968  1.00 61.86 ? 1   DA  C "O5'" 1 
ATOM   107  C "C5'" . DA  A 1 6   ? 63.364 39.090 -7.294  1.00 55.91 ? 1   DA  C "C5'" 1 
ATOM   108  C "C4'" . DA  A 1 6   ? 62.409 37.920 -7.279  1.00 51.16 ? 1   DA  C "C4'" 1 
ATOM   109  O "O4'" . DA  A 1 6   ? 63.101 36.725 -6.837  1.00 49.09 ? 1   DA  C "O4'" 1 
ATOM   110  C "C3'" . DA  A 1 6   ? 61.268 38.112 -6.285  1.00 48.60 ? 1   DA  C "C3'" 1 
ATOM   111  O "O3'" . DA  A 1 6   ? 60.102 37.433 -6.758  1.00 46.31 ? 1   DA  C "O3'" 1 
ATOM   112  C "C2'" . DA  A 1 6   ? 61.833 37.516 -5.006  1.00 46.91 ? 1   DA  C "C2'" 1 
ATOM   113  C "C1'" . DA  A 1 6   ? 62.652 36.349 -5.543  1.00 46.15 ? 1   DA  C "C1'" 1 
ATOM   114  N N9    . DA  A 1 6   ? 63.814 35.947 -4.750  1.00 45.23 ? 1   DA  C N9    1 
ATOM   115  C C8    . DA  A 1 6   ? 64.614 36.721 -3.947  1.00 44.82 ? 1   DA  C C8    1 
ATOM   116  N N7    . DA  A 1 6   ? 65.569 36.048 -3.346  1.00 45.38 ? 1   DA  C N7    1 
ATOM   117  C C5    . DA  A 1 6   ? 65.391 34.745 -3.788  1.00 45.87 ? 1   DA  C C5    1 
ATOM   118  C C6    . DA  A 1 6   ? 66.085 33.543 -3.517  1.00 48.11 ? 1   DA  C C6    1 
ATOM   119  N N6    . DA  A 1 6   ? 67.146 33.461 -2.702  1.00 48.25 ? 1   DA  C N6    1 
ATOM   120  N N1    . DA  A 1 6   ? 65.646 32.412 -4.122  1.00 47.61 ? 1   DA  C N1    1 
ATOM   121  C C2    . DA  A 1 6   ? 64.584 32.495 -4.941  1.00 44.93 ? 1   DA  C C2    1 
ATOM   122  N N3    . DA  A 1 6   ? 63.854 33.560 -5.273  1.00 44.94 ? 1   DA  C N3    1 
ATOM   123  C C4    . DA  A 1 6   ? 64.315 34.667 -4.657  1.00 45.77 ? 1   DA  C C4    1 
ATOM   124  P P     . DA  A 1 7   ? 58.770 37.436 -5.869  1.00 43.49 ? 2   DA  C P     1 
ATOM   125  O OP1   . DA  A 1 7   ? 57.637 37.901 -6.717  1.00 41.34 ? 2   DA  C OP1   1 
ATOM   126  O OP2   . DA  A 1 7   ? 59.102 38.153 -4.611  1.00 42.88 ? 2   DA  C OP2   1 
ATOM   127  O "O5'" . DA  A 1 7   ? 58.579 35.899 -5.497  1.00 44.23 ? 2   DA  C "O5'" 1 
ATOM   128  C "C5'" . DA  A 1 7   ? 59.669 35.161 -4.946  1.00 43.36 ? 2   DA  C "C5'" 1 
ATOM   129  C "C4'" . DA  A 1 7   ? 59.404 33.673 -4.997  1.00 42.89 ? 2   DA  C "C4'" 1 
ATOM   130  O "O4'" . DA  A 1 7   ? 60.645 33.019 -4.645  1.00 44.96 ? 2   DA  C "O4'" 1 
ATOM   131  C "C3'" . DA  A 1 7   ? 58.384 33.187 -3.965  1.00 41.67 ? 2   DA  C "C3'" 1 
ATOM   132  O "O3'" . DA  A 1 7   ? 57.701 31.999 -4.406  1.00 37.00 ? 2   DA  C "O3'" 1 
ATOM   133  C "C2'" . DA  A 1 7   ? 59.243 32.935 -2.742  1.00 41.91 ? 2   DA  C "C2'" 1 
ATOM   134  C "C1'" . DA  A 1 7   ? 60.556 32.452 -3.342  1.00 43.78 ? 2   DA  C "C1'" 1 
ATOM   135  N N9    . DA  A 1 7   ? 61.742 32.861 -2.586  1.00 42.97 ? 2   DA  C N9    1 
ATOM   136  C C8    . DA  A 1 7   ? 62.099 34.129 -2.206  1.00 43.10 ? 2   DA  C C8    1 
ATOM   137  N N7    . DA  A 1 7   ? 63.219 34.180 -1.519  1.00 43.62 ? 2   DA  C N7    1 
ATOM   138  C C5    . DA  A 1 7   ? 63.625 32.858 -1.443  1.00 42.41 ? 2   DA  C C5    1 
ATOM   139  C C6    . DA  A 1 7   ? 64.731 32.244 -0.838  1.00 41.42 ? 2   DA  C C6    1 
ATOM   140  N N6    . DA  A 1 7   ? 65.673 32.910 -0.174  1.00 39.95 ? 2   DA  C N6    1 
ATOM   141  N N1    . DA  A 1 7   ? 64.836 30.903 -0.939  1.00 43.32 ? 2   DA  C N1    1 
ATOM   142  C C2    . DA  A 1 7   ? 63.888 30.232 -1.604  1.00 43.62 ? 2   DA  C C2    1 
ATOM   143  N N3    . DA  A 1 7   ? 62.803 30.696 -2.218  1.00 44.25 ? 2   DA  C N3    1 
ATOM   144  C C4    . DA  A 1 7   ? 62.728 32.033 -2.099  1.00 43.00 ? 2   DA  C C4    1 
ATOM   145  P P     . DA  A 1 8   ? 56.783 31.167 -3.370  1.00 35.69 ? 3   DA  C P     1 
ATOM   146  O OP1   . DA  A 1 8   ? 55.818 30.351 -4.157  1.00 32.69 ? 3   DA  C OP1   1 
ATOM   147  O OP2   . DA  A 1 8   ? 56.273 32.082 -2.306  1.00 35.32 ? 3   DA  C OP2   1 
ATOM   148  O "O5'" . DA  A 1 8   ? 57.806 30.140 -2.718  1.00 32.23 ? 3   DA  C "O5'" 1 
ATOM   149  C "C5'" . DA  A 1 8   ? 58.430 29.178 -3.552  1.00 37.97 ? 3   DA  C "C5'" 1 
ATOM   150  C "C4'" . DA  A 1 8   ? 59.065 28.075 -2.741  1.00 38.86 ? 3   DA  C "C4'" 1 
ATOM   151  O "O4'" . DA  A 1 8   ? 60.223 28.597 -2.050  1.00 41.37 ? 3   DA  C "O4'" 1 
ATOM   152  C "C3'" . DA  A 1 8   ? 58.156 27.528 -1.644  1.00 37.57 ? 3   DA  C "C3'" 1 
ATOM   153  O "O3'" . DA  A 1 8   ? 58.490 26.159 -1.414  1.00 33.39 ? 3   DA  C "O3'" 1 
ATOM   154  C "C2'" . DA  A 1 8   ? 58.490 28.420 -0.460  1.00 38.81 ? 3   DA  C "C2'" 1 
ATOM   155  C "C1'" . DA  A 1 8   ? 59.982 28.640 -0.651  1.00 40.02 ? 3   DA  C "C1'" 1 
ATOM   156  N N9    . DA  A 1 8   ? 60.551 29.879 -0.118  1.00 38.09 ? 3   DA  C N9    1 
ATOM   157  C C8    . DA  A 1 8   ? 60.148 31.159 -0.377  1.00 40.06 ? 3   DA  C C8    1 
ATOM   158  N N7    . DA  A 1 8   ? 60.833 32.073 0.267   1.00 40.52 ? 3   DA  C N7    1 
ATOM   159  C C5    . DA  A 1 8   ? 61.755 31.340 1.002   1.00 36.89 ? 3   DA  C C5    1 
ATOM   160  C C6    . DA  A 1 8   ? 62.751 31.724 1.908   1.00 34.49 ? 3   DA  C C6    1 
ATOM   161  N N6    . DA  A 1 8   ? 62.997 32.993 2.225   1.00 33.34 ? 3   DA  C N6    1 
ATOM   162  N N1    . DA  A 1 8   ? 63.488 30.752 2.485   1.00 31.18 ? 3   DA  C N1    1 
ATOM   163  C C2    . DA  A 1 8   ? 63.235 29.485 2.158   1.00 32.42 ? 3   DA  C C2    1 
ATOM   164  N N3    . DA  A 1 8   ? 62.327 28.998 1.319   1.00 35.07 ? 3   DA  C N3    1 
ATOM   165  C C4    . DA  A 1 8   ? 61.604 29.990 0.768   1.00 36.81 ? 3   DA  C C4    1 
ATOM   166  P P     . DT  A 1 9   ? 57.497 25.211 -0.591  1.00 31.68 ? 4   DT  C P     1 
ATOM   167  O OP1   . DT  A 1 9   ? 57.250 24.000 -1.404  1.00 32.41 ? 4   DT  C OP1   1 
ATOM   168  O OP2   . DT  A 1 9   ? 56.356 25.991 -0.080  1.00 32.14 ? 4   DT  C OP2   1 
ATOM   169  O "O5'" . DT  A 1 9   ? 58.408 24.808 0.639   1.00 36.05 ? 4   DT  C "O5'" 1 
ATOM   170  C "C5'" . DT  A 1 9   ? 59.369 25.737 1.135   1.00 33.84 ? 4   DT  C "C5'" 1 
ATOM   171  C "C4'" . DT  A 1 9   ? 60.513 25.009 1.795   1.00 33.69 ? 4   DT  C "C4'" 1 
ATOM   172  O "O4'" . DT  A 1 9   ? 61.443 26.010 2.261   1.00 34.57 ? 4   DT  C "O4'" 1 
ATOM   173  C "C3'" . DT  A 1 9   ? 60.087 24.241 3.038   1.00 33.56 ? 4   DT  C "C3'" 1 
ATOM   174  O "O3'" . DT  A 1 9   ? 60.938 23.118 3.237   1.00 34.49 ? 4   DT  C "O3'" 1 
ATOM   175  C "C2'" . DT  A 1 9   ? 60.212 25.282 4.132   1.00 34.13 ? 4   DT  C "C2'" 1 
ATOM   176  C "C1'" . DT  A 1 9   ? 61.395 26.130 3.674   1.00 34.15 ? 4   DT  C "C1'" 1 
ATOM   177  N N1    . DT  A 1 9   ? 61.241 27.569 4.000   1.00 32.92 ? 4   DT  C N1    1 
ATOM   178  C C2    . DT  A 1 9   ? 62.001 28.124 5.018   1.00 32.19 ? 4   DT  C C2    1 
ATOM   179  O O2    . DT  A 1 9   ? 62.831 27.498 5.668   1.00 28.93 ? 4   DT  C O2    1 
ATOM   180  N N3    . DT  A 1 9   ? 61.742 29.453 5.255   1.00 30.53 ? 4   DT  C N3    1 
ATOM   181  C C4    . DT  A 1 9   ? 60.826 30.259 4.601   1.00 28.05 ? 4   DT  C C4    1 
ATOM   182  O O4    . DT  A 1 9   ? 60.684 31.430 4.935   1.00 28.11 ? 4   DT  C O4    1 
ATOM   183  C C5    . DT  A 1 9   ? 60.089 29.624 3.553   1.00 27.83 ? 4   DT  C C5    1 
ATOM   184  C C7    . DT  A 1 9   ? 59.087 30.432 2.791   1.00 24.13 ? 4   DT  C C7    1 
ATOM   185  C C6    . DT  A 1 9   ? 60.331 28.330 3.303   1.00 29.82 ? 4   DT  C C6    1 
ATOM   186  P P     . DG  A 1 10  ? 60.574 22.019 4.350   1.00 35.01 ? 5   DG  C P     1 
ATOM   187  O OP1   . DG  A 1 10  ? 60.525 20.696 3.669   1.00 32.06 ? 5   DG  C OP1   1 
ATOM   188  O OP2   . DG  A 1 10  ? 59.394 22.498 5.108   1.00 32.45 ? 5   DG  C OP2   1 
ATOM   189  O "O5'" . DG  A 1 10  ? 61.833 22.100 5.319   1.00 33.39 ? 5   DG  C "O5'" 1 
ATOM   190  C "C5'" . DG  A 1 10  ? 62.331 23.378 5.677   1.00 36.73 ? 5   DG  C "C5'" 1 
ATOM   191  C "C4'" . DG  A 1 10  ? 63.296 23.301 6.837   1.00 38.52 ? 5   DG  C "C4'" 1 
ATOM   192  O "O4'" . DG  A 1 10  ? 63.460 24.671 7.275   1.00 39.64 ? 5   DG  C "O4'" 1 
ATOM   193  C "C3'" . DG  A 1 10  ? 62.862 22.532 8.083   1.00 37.67 ? 5   DG  C "C3'" 1 
ATOM   194  O "O3'" . DG  A 1 10  ? 64.045 22.079 8.782   1.00 38.77 ? 5   DG  C "O3'" 1 
ATOM   195  C "C2'" . DG  A 1 10  ? 62.074 23.587 8.848   1.00 38.76 ? 5   DG  C "C2'" 1 
ATOM   196  C "C1'" . DG  A 1 10  ? 62.764 24.909 8.493   1.00 39.83 ? 5   DG  C "C1'" 1 
ATOM   197  N N9    . DG  A 1 10  ? 61.832 26.009 8.232   1.00 41.11 ? 5   DG  C N9    1 
ATOM   198  C C8    . DG  A 1 10  ? 60.587 25.885 7.668   1.00 41.15 ? 5   DG  C C8    1 
ATOM   199  N N7    . DG  A 1 10  ? 59.972 27.026 7.513   1.00 42.39 ? 5   DG  C N7    1 
ATOM   200  C C5    . DG  A 1 10  ? 60.858 27.971 8.009   1.00 42.11 ? 5   DG  C C5    1 
ATOM   201  C C6    . DG  A 1 10  ? 60.735 29.384 8.092   1.00 43.33 ? 5   DG  C C6    1 
ATOM   202  O O6    . DG  A 1 10  ? 59.781 30.106 7.742   1.00 44.81 ? 5   DG  C O6    1 
ATOM   203  N N1    . DG  A 1 10  ? 61.870 29.963 8.650   1.00 43.19 ? 5   DG  C N1    1 
ATOM   204  C C2    . DG  A 1 10  ? 62.976 29.278 9.078   1.00 40.81 ? 5   DG  C C2    1 
ATOM   205  N N2    . DG  A 1 10  ? 63.962 30.039 9.586   1.00 40.23 ? 5   DG  C N2    1 
ATOM   206  N N3    . DG  A 1 10  ? 63.105 27.955 9.012   1.00 40.39 ? 5   DG  C N3    1 
ATOM   207  C C4    . DG  A 1 10  ? 62.014 27.368 8.466   1.00 41.39 ? 5   DG  C C4    1 
ATOM   208  P P     . DC  A 1 11  ? 63.994 20.784 9.758   1.00 42.95 ? 6   DC  C P     1 
ATOM   209  O OP1   . DC  A 1 11  ? 65.345 20.171 9.783   1.00 44.83 ? 6   DC  C OP1   1 
ATOM   210  O OP2   . DC  A 1 11  ? 62.829 19.944 9.380   1.00 41.17 ? 6   DC  C OP2   1 
ATOM   211  O "O5'" . DC  A 1 11  ? 63.781 21.401 11.216  1.00 41.53 ? 6   DC  C "O5'" 1 
ATOM   212  C "C5'" . DC  A 1 11  ? 63.406 22.770 11.366  1.00 41.64 ? 6   DC  C "C5'" 1 
ATOM   213  C "C4'" . DC  A 1 11  ? 64.281 23.463 12.381  1.00 41.90 ? 6   DC  C "C4'" 1 
ATOM   214  O "O4'" . DC  A 1 11  ? 64.183 24.891 12.139  1.00 41.47 ? 6   DC  C "O4'" 1 
ATOM   215  C "C3'" . DC  A 1 11  ? 63.838 23.269 13.825  1.00 43.52 ? 6   DC  C "C3'" 1 
ATOM   216  O "O3'" . DC  A 1 11  ? 64.943 23.204 14.739  1.00 46.19 ? 6   DC  C "O3'" 1 
ATOM   217  C "C2'" . DC  A 1 11  ? 62.873 24.422 14.046  1.00 42.32 ? 6   DC  C "C2'" 1 
ATOM   218  C "C1'" . DC  A 1 11  ? 63.399 25.536 13.137  1.00 41.33 ? 6   DC  C "C1'" 1 
ATOM   219  N N1    . DC  A 1 11  ? 62.297 26.236 12.437  1.00 42.42 ? 6   DC  C N1    1 
ATOM   220  C C2    . DC  A 1 11  ? 62.313 27.641 12.309  1.00 42.19 ? 6   DC  C C2    1 
ATOM   221  O O2    . DC  A 1 11  ? 63.278 28.289 12.762  1.00 42.25 ? 6   DC  C O2    1 
ATOM   222  N N3    . DC  A 1 11  ? 61.268 28.253 11.689  1.00 41.40 ? 6   DC  C N3    1 
ATOM   223  C C4    . DC  A 1 11  ? 60.251 27.527 11.211  1.00 39.03 ? 6   DC  C C4    1 
ATOM   224  N N4    . DC  A 1 11  ? 59.240 28.164 10.619  1.00 36.72 ? 6   DC  C N4    1 
ATOM   225  C C5    . DC  A 1 11  ? 60.223 26.114 11.317  1.00 39.64 ? 6   DC  C C5    1 
ATOM   226  C C6    . DC  A 1 11  ? 61.254 25.515 11.926  1.00 40.41 ? 6   DC  C C6    1 
ATOM   227  P P     . DG  A 1 12  ? 65.148 21.884 15.654  1.00 48.85 ? 7   DG  C P     1 
ATOM   228  O OP1   . DG  A 1 12  ? 66.584 21.874 16.012  1.00 52.04 ? 7   DG  C OP1   1 
ATOM   229  O OP2   . DG  A 1 12  ? 64.557 20.680 15.005  1.00 45.70 ? 7   DG  C OP2   1 
ATOM   230  O "O5'" . DG  A 1 12  ? 64.294 22.213 16.960  1.00 47.53 ? 7   DG  C "O5'" 1 
ATOM   231  C "C5'" . DG  A 1 12  ? 63.199 23.125 16.885  1.00 48.94 ? 7   DG  C "C5'" 1 
ATOM   232  C "C4'" . DG  A 1 12  ? 62.722 23.523 18.263  1.00 50.31 ? 7   DG  C "C4'" 1 
ATOM   233  O "O4'" . DG  A 1 12  ? 61.699 24.531 18.099  1.00 49.54 ? 7   DG  C "O4'" 1 
ATOM   234  C "C3'" . DG  A 1 12  ? 62.057 22.414 19.064  1.00 52.35 ? 7   DG  C "C3'" 1 
ATOM   235  O "O3'" . DG  A 1 12  ? 62.187 22.687 20.458  1.00 55.90 ? 7   DG  C "O3'" 1 
ATOM   236  C "C2'" . DG  A 1 12  ? 60.611 22.497 18.614  1.00 49.46 ? 7   DG  C "C2'" 1 
ATOM   237  C "C1'" . DG  A 1 12  ? 60.407 23.987 18.345  1.00 48.57 ? 7   DG  C "C1'" 1 
ATOM   238  N N9    . DG  A 1 12  ? 59.627 24.203 17.132  1.00 45.98 ? 7   DG  C N9    1 
ATOM   239  C C8    . DG  A 1 12  ? 59.388 23.270 16.159  1.00 45.82 ? 7   DG  C C8    1 
ATOM   240  N N7    . DG  A 1 12  ? 58.699 23.737 15.159  1.00 46.03 ? 7   DG  C N7    1 
ATOM   241  C C5    . DG  A 1 12  ? 58.455 25.057 15.495  1.00 43.01 ? 7   DG  C C5    1 
ATOM   242  C C6    . DG  A 1 12  ? 57.747 26.055 14.791  1.00 42.82 ? 7   DG  C C6    1 
ATOM   243  O O6    . DG  A 1 12  ? 57.172 25.963 13.689  1.00 38.18 ? 7   DG  C O6    1 
ATOM   244  N N1    . DG  A 1 12  ? 57.739 27.262 15.489  1.00 43.04 ? 7   DG  C N1    1 
ATOM   245  C C2    . DG  A 1 12  ? 58.334 27.472 16.709  1.00 43.36 ? 7   DG  C C2    1 
ATOM   246  N N2    . DG  A 1 12  ? 58.222 28.706 17.215  1.00 41.08 ? 7   DG  C N2    1 
ATOM   247  N N3    . DG  A 1 12  ? 58.993 26.537 17.381  1.00 45.02 ? 7   DG  C N3    1 
ATOM   248  C C4    . DG  A 1 12  ? 59.015 25.362 16.717  1.00 44.39 ? 7   DG  C C4    1 
ATOM   249  P P     . DA  A 1 13  ? 61.952 21.510 21.523  1.00 59.36 ? 8   DA  C P     1 
ATOM   250  O OP1   . DA  A 1 13  ? 63.263 20.830 21.716  1.00 56.73 ? 8   DA  C OP1   1 
ATOM   251  O OP2   . DA  A 1 13  ? 60.772 20.712 21.109  1.00 58.73 ? 8   DA  C OP2   1 
ATOM   252  O "O5'" . DA  A 1 13  ? 61.560 22.306 22.847  1.00 58.54 ? 8   DA  C "O5'" 1 
ATOM   253  C "C5'" . DA  A 1 13  ? 62.255 23.499 23.216  1.00 56.52 ? 8   DA  C "C5'" 1 
ATOM   254  C "C4'" . DA  A 1 13  ? 61.278 24.558 23.674  1.00 56.91 ? 8   DA  C "C4'" 1 
ATOM   255  O "O4'" . DA  A 1 13  ? 60.379 24.852 22.579  1.00 56.97 ? 8   DA  C "O4'" 1 
ATOM   256  C "C3'" . DA  A 1 13  ? 60.374 24.080 24.811  1.00 57.52 ? 8   DA  C "C3'" 1 
ATOM   257  O "O3'" . DA  A 1 13  ? 59.919 25.198 25.597  1.00 59.60 ? 8   DA  C "O3'" 1 
ATOM   258  C "C2'" . DA  A 1 13  ? 59.217 23.438 24.069  1.00 57.98 ? 8   DA  C "C2'" 1 
ATOM   259  C "C1'" . DA  A 1 13  ? 59.077 24.355 22.869  1.00 56.54 ? 8   DA  C "C1'" 1 
ATOM   260  N N9    . DA  A 1 13  ? 58.526 23.741 21.659  1.00 56.10 ? 8   DA  C N9    1 
ATOM   261  C C8    . DA  A 1 13  ? 58.572 22.422 21.266  1.00 54.35 ? 8   DA  C C8    1 
ATOM   262  N N7    . DA  A 1 13  ? 57.950 22.187 20.133  1.00 53.98 ? 8   DA  C N7    1 
ATOM   263  C C5    . DA  A 1 13  ? 57.467 23.434 19.750  1.00 52.69 ? 8   DA  C C5    1 
ATOM   264  C C6    . DA  A 1 13  ? 56.727 23.863 18.635  1.00 50.27 ? 8   DA  C C6    1 
ATOM   265  N N6    . DA  A 1 13  ? 56.321 23.052 17.662  1.00 46.22 ? 8   DA  C N6    1 
ATOM   266  N N1    . DA  A 1 13  ? 56.417 25.176 18.553  1.00 50.53 ? 8   DA  C N1    1 
ATOM   267  C C2    . DA  A 1 13  ? 56.828 25.993 19.530  1.00 51.26 ? 8   DA  C C2    1 
ATOM   268  N N3    . DA  A 1 13  ? 57.526 25.712 20.627  1.00 52.03 ? 8   DA  C N3    1 
ATOM   269  C C4    . DA  A 1 13  ? 57.819 24.401 20.678  1.00 53.61 ? 8   DA  C C4    1 
ATOM   270  P P     . DT  A 1 14  ? 59.150 24.937 26.994  1.00 62.53 ? 9   DT  C P     1 
ATOM   271  O OP1   . DT  A 1 14  ? 58.683 26.252 27.532  1.00 58.33 ? 9   DT  C OP1   1 
ATOM   272  O OP2   . DT  A 1 14  ? 60.035 24.072 27.834  1.00 62.04 ? 9   DT  C OP2   1 
ATOM   273  O "O5'" . DT  A 1 14  ? 57.876 24.074 26.558  1.00 61.50 ? 9   DT  C "O5'" 1 
ATOM   274  C "C5'" . DT  A 1 14  ? 56.546 24.533 26.807  1.00 61.49 ? 9   DT  C "C5'" 1 
ATOM   275  C "C4'" . DT  A 1 14  ? 56.280 25.810 26.043  1.00 59.92 ? 9   DT  C "C4'" 1 
ATOM   276  O "O4'" . DT  A 1 14  ? 56.309 25.531 24.617  1.00 59.65 ? 9   DT  C "O4'" 1 
ATOM   277  C "C3'" . DT  A 1 14  ? 54.873 26.330 26.314  1.00 59.00 ? 9   DT  C "C3'" 1 
ATOM   278  O "O3'" . DT  A 1 14  ? 54.826 27.748 26.175  1.00 60.26 ? 9   DT  C "O3'" 1 
ATOM   279  C "C2'" . DT  A 1 14  ? 54.051 25.639 25.245  1.00 59.64 ? 9   DT  C "C2'" 1 
ATOM   280  C "C1'" . DT  A 1 14  ? 55.001 25.627 24.072  1.00 57.43 ? 9   DT  C "C1'" 1 
ATOM   281  N N1    . DT  A 1 14  ? 54.791 24.525 23.106  1.00 56.90 ? 9   DT  C N1    1 
ATOM   282  C C2    . DT  A 1 14  ? 53.924 24.765 22.061  1.00 55.71 ? 9   DT  C C2    1 
ATOM   283  O O2    . DT  A 1 14  ? 53.329 25.819 21.919  1.00 56.74 ? 9   DT  C O2    1 
ATOM   284  N N3    . DT  A 1 14  ? 53.769 23.718 21.189  1.00 55.22 ? 9   DT  C N3    1 
ATOM   285  C C4    . DT  A 1 14  ? 54.366 22.477 21.262  1.00 57.40 ? 9   DT  C C4    1 
ATOM   286  O O4    . DT  A 1 14  ? 54.115 21.629 20.411  1.00 52.97 ? 9   DT  C O4    1 
ATOM   287  C C5    . DT  A 1 14  ? 55.258 22.287 22.383  1.00 58.82 ? 9   DT  C C5    1 
ATOM   288  C C7    . DT  A 1 14  ? 55.949 20.969 22.539  1.00 60.69 ? 9   DT  C C7    1 
ATOM   289  C C6    . DT  A 1 14  ? 55.427 23.310 23.239  1.00 57.58 ? 9   DT  C C6    1 
ATOM   290  O "O5'" . DC  B 2 1   ? 46.664 12.606 28.588  1.00 51.50 ? 13  DC  D "O5'" 1 
ATOM   291  C "C5'" . DC  B 2 1   ? 46.253 11.265 28.321  1.00 49.42 ? 13  DC  D "C5'" 1 
ATOM   292  C "C4'" . DC  B 2 1   ? 46.021 11.068 26.841  1.00 48.04 ? 13  DC  D "C4'" 1 
ATOM   293  O "O4'" . DC  B 2 1   ? 44.967 11.972 26.420  1.00 46.68 ? 13  DC  D "O4'" 1 
ATOM   294  C "C3'" . DC  B 2 1   ? 47.244 11.454 26.013  1.00 45.86 ? 13  DC  D "C3'" 1 
ATOM   295  O "O3'" . DC  B 2 1   ? 47.328 10.724 24.788  1.00 45.17 ? 13  DC  D "O3'" 1 
ATOM   296  C "C2'" . DC  B 2 1   ? 47.026 12.926 25.754  1.00 46.75 ? 13  DC  D "C2'" 1 
ATOM   297  C "C1'" . DC  B 2 1   ? 45.513 13.020 25.627  1.00 46.39 ? 13  DC  D "C1'" 1 
ATOM   298  N N1    . DC  B 2 1   ? 44.990 14.307 26.120  1.00 45.87 ? 13  DC  D N1    1 
ATOM   299  C C2    . DC  B 2 1   ? 44.035 14.976 25.361  1.00 44.48 ? 13  DC  D C2    1 
ATOM   300  O O2    . DC  B 2 1   ? 43.599 14.435 24.335  1.00 47.41 ? 13  DC  D O2    1 
ATOM   301  N N3    . DC  B 2 1   ? 43.608 16.192 25.761  1.00 41.16 ? 13  DC  D N3    1 
ATOM   302  C C4    . DC  B 2 1   ? 44.082 16.730 26.876  1.00 39.16 ? 13  DC  D C4    1 
ATOM   303  N N4    . DC  B 2 1   ? 43.631 17.922 27.220  1.00 40.23 ? 13  DC  D N4    1 
ATOM   304  C C5    . DC  B 2 1   ? 45.037 16.062 27.689  1.00 41.08 ? 13  DC  D C5    1 
ATOM   305  C C6    . DC  B 2 1   ? 45.459 14.859 27.281  1.00 44.14 ? 13  DC  D C6    1 
ATOM   306  P P     . DT  B 2 2   ? 48.533 11.036 23.762  1.00 49.16 ? 12  DT  D P     1 
ATOM   307  O OP1   . DT  B 2 2   ? 49.095 9.751  23.260  1.00 44.36 ? 12  DT  D OP1   1 
ATOM   308  O OP2   . DT  B 2 2   ? 49.442 12.046 24.379  1.00 47.23 ? 12  DT  D OP2   1 
ATOM   309  O "O5'" . DT  B 2 2   ? 47.801 11.758 22.549  1.00 46.82 ? 12  DT  D "O5'" 1 
ATOM   310  C "C5'" . DT  B 2 2   ? 46.689 11.152 21.892  1.00 46.32 ? 12  DT  D "C5'" 1 
ATOM   311  C "C4'" . DT  B 2 2   ? 46.382 11.910 20.626  1.00 44.22 ? 12  DT  D "C4'" 1 
ATOM   312  O "O4'" . DT  B 2 2   ? 45.769 13.182 20.968  1.00 45.31 ? 12  DT  D "O4'" 1 
ATOM   313  C "C3'" . DT  B 2 2   ? 47.682 12.270 19.912  1.00 44.93 ? 12  DT  D "C3'" 1 
ATOM   314  O "O3'" . DT  B 2 2   ? 47.490 12.325 18.501  1.00 45.28 ? 12  DT  D "O3'" 1 
ATOM   315  C "C2'" . DT  B 2 2   ? 48.047 13.617 20.511  1.00 44.87 ? 12  DT  D "C2'" 1 
ATOM   316  C "C1'" . DT  B 2 2   ? 46.681 14.249 20.716  1.00 43.94 ? 12  DT  D "C1'" 1 
ATOM   317  N N1    . DT  B 2 2   ? 46.571 15.251 21.811  1.00 42.23 ? 12  DT  D N1    1 
ATOM   318  C C2    . DT  B 2 2   ? 45.681 16.273 21.608  1.00 44.36 ? 12  DT  D C2    1 
ATOM   319  O O2    . DT  B 2 2   ? 44.991 16.356 20.615  1.00 50.71 ? 12  DT  D O2    1 
ATOM   320  N N3    . DT  B 2 2   ? 45.624 17.202 22.611  1.00 45.14 ? 12  DT  D N3    1 
ATOM   321  C C4    . DT  B 2 2   ? 46.347 17.208 23.781  1.00 42.90 ? 12  DT  D C4    1 
ATOM   322  O O4    . DT  B 2 2   ? 46.183 18.115 24.591  1.00 45.41 ? 12  DT  D O4    1 
ATOM   323  C C5    . DT  B 2 2   ? 47.258 16.102 23.946  1.00 39.82 ? 12  DT  D C5    1 
ATOM   324  C C7    . DT  B 2 2   ? 48.077 16.032 25.195  1.00 38.21 ? 12  DT  D C7    1 
ATOM   325  C C6    . DT  B 2 2   ? 47.326 15.184 22.966  1.00 39.06 ? 12  DT  D C6    1 
ATOM   326  P P     . DA  B 2 3   ? 48.744 12.593 17.531  1.00 44.48 ? 11  DA  D P     1 
ATOM   327  O OP1   . DA  B 2 3   ? 49.053 11.314 16.838  1.00 44.43 ? 11  DA  D OP1   1 
ATOM   328  O OP2   . DA  B 2 3   ? 49.819 13.298 18.292  1.00 44.12 ? 11  DA  D OP2   1 
ATOM   329  O "O5'" . DA  B 2 3   ? 48.098 13.575 16.459  1.00 43.87 ? 11  DA  D "O5'" 1 
ATOM   330  C "C5'" . DA  B 2 3   ? 46.759 13.351 16.014  1.00 38.57 ? 11  DA  D "C5'" 1 
ATOM   331  C "C4'" . DA  B 2 3   ? 46.146 14.629 15.492  1.00 37.13 ? 11  DA  D "C4'" 1 
ATOM   332  O "O4'" . DA  B 2 3   ? 46.065 15.598 16.567  1.00 38.52 ? 11  DA  D "O4'" 1 
ATOM   333  C "C3'" . DA  B 2 3   ? 46.993 15.302 14.417  1.00 38.50 ? 11  DA  D "C3'" 1 
ATOM   334  O "O3'" . DA  B 2 3   ? 46.149 16.008 13.493  1.00 39.41 ? 11  DA  D "O3'" 1 
ATOM   335  C "C2'" . DA  B 2 3   ? 47.902 16.211 15.227  1.00 37.72 ? 11  DA  D "C2'" 1 
ATOM   336  C "C1'" . DA  B 2 3   ? 46.990 16.661 16.360  1.00 38.68 ? 11  DA  D "C1'" 1 
ATOM   337  N N9    . DA  B 2 3   ? 47.622 16.972 17.650  1.00 41.21 ? 11  DA  D N9    1 
ATOM   338  C C8    . DA  B 2 3   ? 48.625 16.275 18.277  1.00 44.18 ? 11  DA  D C8    1 
ATOM   339  N N7    . DA  B 2 3   ? 48.943 16.752 19.461  1.00 44.31 ? 11  DA  D N7    1 
ATOM   340  C C5    . DA  B 2 3   ? 48.105 17.847 19.619  1.00 40.44 ? 11  DA  D C5    1 
ATOM   341  C C6    . DA  B 2 3   ? 47.945 18.780 20.674  1.00 39.48 ? 11  DA  D C6    1 
ATOM   342  N N6    . DA  B 2 3   ? 48.637 18.750 21.810  1.00 37.28 ? 11  DA  D N6    1 
ATOM   343  N N1    . DA  B 2 3   ? 47.029 19.755 20.516  1.00 40.10 ? 11  DA  D N1    1 
ATOM   344  C C2    . DA  B 2 3   ? 46.323 19.782 19.378  1.00 40.83 ? 11  DA  D C2    1 
ATOM   345  N N3    . DA  B 2 3   ? 46.379 18.962 18.321  1.00 41.03 ? 11  DA  D N3    1 
ATOM   346  C C4    . DA  B 2 3   ? 47.298 18.005 18.506  1.00 39.81 ? 11  DA  D C4    1 
ATOM   347  P P     . DG  B 2 4   ? 46.347 15.811 11.903  1.00 39.88 ? 10  DG  D P     1 
ATOM   348  O OP1   . DG  B 2 4   ? 44.998 15.863 11.299  1.00 41.11 ? 10  DG  D OP1   1 
ATOM   349  O OP2   . DG  B 2 4   ? 47.240 14.654 11.618  1.00 37.80 ? 10  DG  D OP2   1 
ATOM   350  O "O5'" . DG  B 2 4   ? 47.118 17.133 11.485  1.00 38.35 ? 10  DG  D "O5'" 1 
ATOM   351  C "C5'" . DG  B 2 4   ? 47.877 17.825 12.461  1.00 36.24 ? 10  DG  D "C5'" 1 
ATOM   352  C "C4'" . DG  B 2 4   ? 47.306 19.201 12.686  1.00 35.65 ? 10  DG  D "C4'" 1 
ATOM   353  O "O4'" . DG  B 2 4   ? 47.231 19.433 14.114  1.00 36.02 ? 10  DG  D "O4'" 1 
ATOM   354  C "C3'" . DG  B 2 4   ? 48.255 20.262 12.148  1.00 36.06 ? 10  DG  D "C3'" 1 
ATOM   355  O "O3'" . DG  B 2 4   ? 47.572 21.434 11.736  1.00 37.15 ? 10  DG  D "O3'" 1 
ATOM   356  C "C2'" . DG  B 2 4   ? 49.163 20.542 13.326  1.00 36.31 ? 10  DG  D "C2'" 1 
ATOM   357  C "C1'" . DG  B 2 4   ? 48.225 20.376 14.512  1.00 35.21 ? 10  DG  D "C1'" 1 
ATOM   358  N N9    . DG  B 2 4   ? 48.922 19.866 15.691  1.00 33.05 ? 10  DG  D N9    1 
ATOM   359  C C8    . DG  B 2 4   ? 49.571 18.662 15.826  1.00 30.84 ? 10  DG  D C8    1 
ATOM   360  N N7    . DG  B 2 4   ? 50.202 18.544 16.961  1.00 29.04 ? 10  DG  D N7    1 
ATOM   361  C C5    . DG  B 2 4   ? 49.934 19.734 17.620  1.00 31.00 ? 10  DG  D C5    1 
ATOM   362  C C6    . DG  B 2 4   ? 50.361 20.192 18.877  1.00 31.22 ? 10  DG  D C6    1 
ATOM   363  O O6    . DG  B 2 4   ? 51.080 19.627 19.684  1.00 32.38 ? 10  DG  D O6    1 
ATOM   364  N N1    . DG  B 2 4   ? 49.861 21.455 19.162  1.00 32.51 ? 10  DG  D N1    1 
ATOM   365  C C2    . DG  B 2 4   ? 49.048 22.183 18.336  1.00 33.54 ? 10  DG  D C2    1 
ATOM   366  N N2    . DG  B 2 4   ? 48.666 23.398 18.782  1.00 35.85 ? 10  DG  D N2    1 
ATOM   367  N N3    . DG  B 2 4   ? 48.639 21.760 17.154  1.00 31.22 ? 10  DG  D N3    1 
ATOM   368  C C4    . DG  B 2 4   ? 49.120 20.542 16.861  1.00 31.01 ? 10  DG  D C4    1 
ATOM   369  P P     . DA  B 2 5   ? 48.425 22.737 11.395  1.00 38.83 ? 9   DA  D P     1 
ATOM   370  O OP1   . DA  B 2 5   ? 47.864 23.406 10.199  1.00 38.33 ? 9   DA  D OP1   1 
ATOM   371  O OP2   . DA  B 2 5   ? 49.834 22.325 11.394  1.00 42.39 ? 9   DA  D OP2   1 
ATOM   372  O "O5'" . DA  B 2 5   ? 48.193 23.641 12.677  1.00 36.49 ? 9   DA  D "O5'" 1 
ATOM   373  C "C5'" . DA  B 2 5   ? 46.891 24.106 13.011  1.00 35.12 ? 9   DA  D "C5'" 1 
ATOM   374  C "C4'" . DA  B 2 5   ? 47.006 25.464 13.651  1.00 34.05 ? 9   DA  D "C4'" 1 
ATOM   375  O "O4'" . DA  B 2 5   ? 47.705 25.285 14.901  1.00 34.34 ? 9   DA  D "O4'" 1 
ATOM   376  C "C3'" . DA  B 2 5   ? 47.886 26.385 12.819  1.00 32.95 ? 9   DA  D "C3'" 1 
ATOM   377  O "O3'" . DA  B 2 5   ? 47.519 27.750 12.966  1.00 31.60 ? 9   DA  D "O3'" 1 
ATOM   378  C "C2'" . DA  B 2 5   ? 49.280 26.086 13.328  1.00 35.38 ? 9   DA  D "C2'" 1 
ATOM   379  C "C1'" . DA  B 2 5   ? 49.046 25.764 14.799  1.00 37.07 ? 9   DA  D "C1'" 1 
ATOM   380  N N9    . DA  B 2 5   ? 49.927 24.704 15.302  1.00 37.17 ? 9   DA  D N9    1 
ATOM   381  C C8    . DA  B 2 5   ? 50.203 23.490 14.712  1.00 37.91 ? 9   DA  D C8    1 
ATOM   382  N N7    . DA  B 2 5   ? 51.024 22.737 15.407  1.00 37.91 ? 9   DA  D N7    1 
ATOM   383  C C5    . DA  B 2 5   ? 51.309 23.505 16.527  1.00 34.19 ? 9   DA  D C5    1 
ATOM   384  C C6    . DA  B 2 5   ? 52.118 23.271 17.644  1.00 34.34 ? 9   DA  D C6    1 
ATOM   385  N N6    . DA  B 2 5   ? 52.811 22.151 17.839  1.00 32.02 ? 9   DA  D N6    1 
ATOM   386  N N1    . DA  B 2 5   ? 52.194 24.242 18.575  1.00 35.49 ? 9   DA  D N1    1 
ATOM   387  C C2    . DA  B 2 5   ? 51.486 25.368 18.388  1.00 35.34 ? 9   DA  D C2    1 
ATOM   388  N N3    . DA  B 2 5   ? 50.688 25.703 17.384  1.00 34.53 ? 9   DA  D N3    1 
ATOM   389  C C4    . DA  B 2 5   ? 50.642 24.718 16.475  1.00 35.46 ? 9   DA  D C4    1 
ATOM   390  P P     . DT  B 2 6   ? 48.229 28.843 12.052  1.00 34.58 ? 8   DT  D P     1 
ATOM   391  O OP1   . DT  B 2 6   ? 47.224 29.735 11.446  1.00 36.19 ? 8   DT  D OP1   1 
ATOM   392  O OP2   . DT  B 2 6   ? 49.169 28.092 11.184  1.00 34.67 ? 8   DT  D OP2   1 
ATOM   393  O "O5'" . DT  B 2 6   ? 49.057 29.699 13.099  1.00 38.56 ? 8   DT  D "O5'" 1 
ATOM   394  C "C5'" . DT  B 2 6   ? 49.757 29.048 14.150  1.00 40.01 ? 8   DT  D "C5'" 1 
ATOM   395  C "C4'" . DT  B 2 6   ? 50.501 30.057 14.984  1.00 40.06 ? 8   DT  D "C4'" 1 
ATOM   396  O "O4'" . DT  B 2 6   ? 51.343 29.328 15.907  1.00 43.18 ? 8   DT  D "O4'" 1 
ATOM   397  C "C3'" . DT  B 2 6   ? 51.454 30.913 14.166  1.00 40.99 ? 8   DT  D "C3'" 1 
ATOM   398  O "O3'" . DT  B 2 6   ? 51.600 32.178 14.805  1.00 43.54 ? 8   DT  D "O3'" 1 
ATOM   399  C "C2'" . DT  B 2 6   ? 52.734 30.094 14.166  1.00 41.84 ? 8   DT  D "C2'" 1 
ATOM   400  C "C1'" . DT  B 2 6   ? 52.715 29.417 15.534  1.00 42.24 ? 8   DT  D "C1'" 1 
ATOM   401  N N1    . DT  B 2 6   ? 53.264 28.039 15.554  1.00 41.49 ? 8   DT  D N1    1 
ATOM   402  C C2    . DT  B 2 6   ? 53.915 27.581 16.690  1.00 41.76 ? 8   DT  D C2    1 
ATOM   403  O O2    . DT  B 2 6   ? 54.098 28.262 17.687  1.00 40.27 ? 8   DT  D O2    1 
ATOM   404  N N3    . DT  B 2 6   ? 54.343 26.277 16.614  1.00 40.69 ? 8   DT  D N3    1 
ATOM   405  C C4    . DT  B 2 6   ? 54.184 25.410 15.547  1.00 40.46 ? 8   DT  D C4    1 
ATOM   406  O O4    . DT  B 2 6   ? 54.596 24.256 15.622  1.00 42.85 ? 8   DT  D O4    1 
ATOM   407  C C5    . DT  B 2 6   ? 53.516 25.958 14.400  1.00 39.30 ? 8   DT  D C5    1 
ATOM   408  C C7    . DT  B 2 6   ? 53.313 25.085 13.203  1.00 39.84 ? 8   DT  D C7    1 
ATOM   409  C C6    . DT  B 2 6   ? 53.101 27.226 14.456  1.00 39.25 ? 8   DT  D C6    1 
ATOM   410  P P     . DC  B 2 7   ? 51.796 33.505 13.924  1.00 45.96 ? 7   DC  D P     1 
ATOM   411  O OP1   . DC  B 2 7   ? 50.763 34.466 14.408  1.00 44.21 ? 7   DC  D OP1   1 
ATOM   412  O OP2   . DC  B 2 7   ? 51.839 33.145 12.486  1.00 44.86 ? 7   DC  D OP2   1 
ATOM   413  O "O5'" . DC  B 2 7   ? 53.250 33.999 14.371  1.00 44.68 ? 7   DC  D "O5'" 1 
ATOM   414  C "C5'" . DC  B 2 7   ? 53.528 34.250 15.752  1.00 45.00 ? 7   DC  D "C5'" 1 
ATOM   415  C "C4'" . DC  B 2 7   ? 55.002 34.495 15.981  1.00 45.80 ? 7   DC  D "C4'" 1 
ATOM   416  O "O4'" . DC  B 2 7   ? 55.725 33.245 15.896  1.00 44.63 ? 7   DC  D "O4'" 1 
ATOM   417  C "C3'" . DC  B 2 7   ? 55.619 35.388 14.905  1.00 49.63 ? 7   DC  D "C3'" 1 
ATOM   418  O "O3'" . DC  B 2 7   ? 56.728 36.143 15.401  1.00 54.62 ? 7   DC  D "O3'" 1 
ATOM   419  C "C2'" . DC  B 2 7   ? 56.079 34.397 13.859  1.00 47.72 ? 7   DC  D "C2'" 1 
ATOM   420  C "C1'" . DC  B 2 7   ? 56.528 33.228 14.718  1.00 45.83 ? 7   DC  D "C1'" 1 
ATOM   421  N N1    . DC  B 2 7   ? 56.383 31.919 14.069  1.00 44.58 ? 7   DC  D N1    1 
ATOM   422  C C2    . DC  B 2 7   ? 56.429 30.766 14.848  1.00 43.25 ? 7   DC  D C2    1 
ATOM   423  O O2    . DC  B 2 7   ? 56.563 30.874 16.079  1.00 41.43 ? 7   DC  D O2    1 
ATOM   424  N N3    . DC  B 2 7   ? 56.327 29.563 14.241  1.00 43.28 ? 7   DC  D N3    1 
ATOM   425  C C4    . DC  B 2 7   ? 56.179 29.493 12.914  1.00 43.14 ? 7   DC  D C4    1 
ATOM   426  N N4    . DC  B 2 7   ? 56.093 28.292 12.356  1.00 46.42 ? 7   DC  D N4    1 
ATOM   427  C C5    . DC  B 2 7   ? 56.115 30.651 12.103  1.00 42.17 ? 7   DC  D C5    1 
ATOM   428  C C6    . DC  B 2 7   ? 56.220 31.832 12.713  1.00 43.75 ? 7   DC  D C6    1 
ATOM   429  P P     . DG  B 2 8   ? 57.228 37.435 14.588  1.00 57.47 ? 6   DG  D P     1 
ATOM   430  O OP1   . DG  B 2 8   ? 56.965 38.640 15.411  1.00 56.71 ? 6   DG  D OP1   1 
ATOM   431  O OP2   . DG  B 2 8   ? 56.695 37.364 13.198  1.00 60.07 ? 6   DG  D OP2   1 
ATOM   432  O "O5'" . DG  B 2 8   ? 58.796 37.219 14.480  1.00 57.80 ? 6   DG  D "O5'" 1 
ATOM   433  C "C5'" . DG  B 2 8   ? 59.640 37.423 15.604  1.00 59.07 ? 6   DG  D "C5'" 1 
ATOM   434  C "C4'" . DG  B 2 8   ? 61.075 37.254 15.181  1.00 58.73 ? 6   DG  D "C4'" 1 
ATOM   435  O "O4'" . DG  B 2 8   ? 61.208 35.891 14.710  1.00 60.06 ? 6   DG  D "O4'" 1 
ATOM   436  C "C3'" . DG  B 2 8   ? 61.416 38.131 13.979  1.00 57.82 ? 6   DG  D "C3'" 1 
ATOM   437  O "O3'" . DG  B 2 8   ? 62.796 38.478 13.960  1.00 58.21 ? 6   DG  D "O3'" 1 
ATOM   438  C "C2'" . DG  B 2 8   ? 61.035 37.262 12.800  1.00 57.54 ? 6   DG  D "C2'" 1 
ATOM   439  C "C1'" . DG  B 2 8   ? 61.354 35.864 13.301  1.00 58.69 ? 6   DG  D "C1'" 1 
ATOM   440  N N9    . DG  B 2 8   ? 60.461 34.839 12.767  1.00 60.36 ? 6   DG  D N9    1 
ATOM   441  C C8    . DG  B 2 8   ? 59.350 35.055 11.982  1.00 61.46 ? 6   DG  D C8    1 
ATOM   442  N N7    . DG  B 2 8   ? 58.803 33.950 11.552  1.00 60.67 ? 6   DG  D N7    1 
ATOM   443  C C5    . DG  B 2 8   ? 59.581 32.942 12.105  1.00 59.21 ? 6   DG  D C5    1 
ATOM   444  C C6    . DG  B 2 8   ? 59.478 31.539 11.977  1.00 58.25 ? 6   DG  D C6    1 
ATOM   445  O O6    . DG  B 2 8   ? 58.665 30.889 11.315  1.00 56.42 ? 6   DG  D O6    1 
ATOM   446  N N1    . DG  B 2 8   ? 60.461 30.881 12.714  1.00 58.41 ? 6   DG  D N1    1 
ATOM   447  C C2    . DG  B 2 8   ? 61.425 31.495 13.473  1.00 58.63 ? 6   DG  D C2    1 
ATOM   448  N N2    . DG  B 2 8   ? 62.281 30.675 14.117  1.00 56.43 ? 6   DG  D N2    1 
ATOM   449  N N3    . DG  B 2 8   ? 61.541 32.813 13.593  1.00 58.47 ? 6   DG  D N3    1 
ATOM   450  C C4    . DG  B 2 8   ? 60.593 33.470 12.884  1.00 59.48 ? 6   DG  D C4    1 
ATOM   451  P P     . DC  B 2 9   ? 63.374 39.363 12.749  1.00 61.04 ? 5   DC  D P     1 
ATOM   452  O OP1   . DC  B 2 9   ? 64.389 40.271 13.335  1.00 62.54 ? 5   DC  D OP1   1 
ATOM   453  O OP2   . DC  B 2 9   ? 62.258 39.939 11.955  1.00 59.00 ? 5   DC  D OP2   1 
ATOM   454  O "O5'" . DC  B 2 9   ? 64.124 38.282 11.853  1.00 60.06 ? 5   DC  D "O5'" 1 
ATOM   455  C "C5'" . DC  B 2 9   ? 65.083 37.409 12.444  1.00 61.32 ? 5   DC  D "C5'" 1 
ATOM   456  C "C4'" . DC  B 2 9   ? 65.714 36.518 11.400  1.00 62.34 ? 5   DC  D "C4'" 1 
ATOM   457  O "O4'" . DC  B 2 9   ? 64.822 35.439 11.033  1.00 64.09 ? 5   DC  D "O4'" 1 
ATOM   458  C "C3'" . DC  B 2 9   ? 65.974 37.277 10.099  1.00 62.35 ? 5   DC  D "C3'" 1 
ATOM   459  O "O3'" . DC  B 2 9   ? 67.024 36.600 9.399   1.00 63.43 ? 5   DC  D "O3'" 1 
ATOM   460  C "C2'" . DC  B 2 9   ? 64.671 37.079 9.338   1.00 62.36 ? 5   DC  D "C2'" 1 
ATOM   461  C "C1'" . DC  B 2 9   ? 64.393 35.631 9.696   1.00 63.14 ? 5   DC  D "C1'" 1 
ATOM   462  N N1    . DC  B 2 9   ? 63.061 35.030 9.516   1.00 63.51 ? 5   DC  D N1    1 
ATOM   463  C C2    . DC  B 2 9   ? 62.971 33.623 9.526   1.00 64.24 ? 5   DC  D C2    1 
ATOM   464  O O2    . DC  B 2 9   ? 64.002 32.952 9.717   1.00 63.48 ? 5   DC  D O2    1 
ATOM   465  N N3    . DC  B 2 9   ? 61.773 33.034 9.323   1.00 64.14 ? 5   DC  D N3    1 
ATOM   466  C C4    . DC  B 2 9   ? 60.690 33.783 9.115   1.00 63.10 ? 5   DC  D C4    1 
ATOM   467  N N4    . DC  B 2 9   ? 59.530 33.144 8.900   1.00 64.55 ? 5   DC  D N4    1 
ATOM   468  C C5    . DC  B 2 9   ? 60.748 35.215 9.112   1.00 61.94 ? 5   DC  D C5    1 
ATOM   469  C C6    . DC  B 2 9   ? 61.942 35.791 9.320   1.00 62.44 ? 5   DC  D C6    1 
ATOM   470  P P     . DA  B 2 10  ? 68.537 36.682 9.938   1.00 64.99 ? 4   DA  D P     1 
ATOM   471  O OP1   . DA  B 2 10  ? 68.493 36.928 11.404  1.00 65.53 ? 4   DA  D OP1   1 
ATOM   472  O OP2   . DA  B 2 10  ? 69.291 37.613 9.054   1.00 63.75 ? 4   DA  D OP2   1 
ATOM   473  O "O5'" . DA  B 2 10  ? 69.113 35.217 9.711   1.00 58.99 ? 4   DA  D "O5'" 1 
ATOM   474  C "C5'" . DA  B 2 10  ? 69.329 34.341 10.808  1.00 56.32 ? 4   DA  D "C5'" 1 
ATOM   475  C "C4'" . DA  B 2 10  ? 69.522 32.929 10.306  1.00 55.88 ? 4   DA  D "C4'" 1 
ATOM   476  O "O4'" . DA  B 2 10  ? 68.267 32.446 9.764   1.00 56.02 ? 4   DA  D "O4'" 1 
ATOM   477  C "C3'" . DA  B 2 10  ? 70.508 32.871 9.140   1.00 55.28 ? 4   DA  D "C3'" 1 
ATOM   478  O "O3'" . DA  B 2 10  ? 71.157 31.596 9.098   1.00 52.70 ? 4   DA  D "O3'" 1 
ATOM   479  C "C2'" . DA  B 2 10  ? 69.616 33.083 7.929   1.00 56.37 ? 4   DA  D "C2'" 1 
ATOM   480  C "C1'" . DA  B 2 10  ? 68.351 32.341 8.344   1.00 56.26 ? 4   DA  D "C1'" 1 
ATOM   481  N N9    . DA  B 2 10  ? 67.086 32.809 7.765   1.00 54.79 ? 4   DA  D N9    1 
ATOM   482  C C8    . DA  B 2 10  ? 66.509 34.046 7.885   1.00 55.88 ? 4   DA  D C8    1 
ATOM   483  N N7    . DA  B 2 10  ? 65.357 34.158 7.266   1.00 56.13 ? 4   DA  D N7    1 
ATOM   484  C C5    . DA  B 2 10  ? 65.165 32.912 6.691   1.00 55.08 ? 4   DA  D C5    1 
ATOM   485  C C6    . DA  B 2 10  ? 64.129 32.389 5.902   1.00 53.92 ? 4   DA  D C6    1 
ATOM   486  N N6    . DA  B 2 10  ? 63.053 33.082 5.549   1.00 54.19 ? 4   DA  D N6    1 
ATOM   487  N N1    . DA  B 2 10  ? 64.238 31.108 5.484   1.00 53.80 ? 4   DA  D N1    1 
ATOM   488  C C2    . DA  B 2 10  ? 65.321 30.410 5.847   1.00 53.62 ? 4   DA  D C2    1 
ATOM   489  N N3    . DA  B 2 10  ? 66.363 30.791 6.589   1.00 55.12 ? 4   DA  D N3    1 
ATOM   490  C C4    . DA  B 2 10  ? 66.222 32.070 6.985   1.00 55.29 ? 4   DA  D C4    1 
ATOM   491  P P     . DT  B 2 11  ? 72.306 31.328 8.013   1.00 51.92 ? 3   DT  D P     1 
ATOM   492  O OP1   . DT  B 2 11  ? 73.509 30.829 8.731   1.00 53.45 ? 3   DT  D OP1   1 
ATOM   493  O OP2   . DT  B 2 11  ? 72.409 32.531 7.143   1.00 47.88 ? 3   DT  D OP2   1 
ATOM   494  O "O5'" . DT  B 2 11  ? 71.736 30.120 7.148   1.00 51.57 ? 3   DT  D "O5'" 1 
ATOM   495  C "C5'" . DT  B 2 11  ? 70.474 30.236 6.511   1.00 49.03 ? 3   DT  D "C5'" 1 
ATOM   496  C "C4'" . DT  B 2 11  ? 69.946 28.878 6.112   1.00 48.55 ? 3   DT  D "C4'" 1 
ATOM   497  O "O4'" . DT  B 2 11  ? 68.572 29.054 5.709   1.00 47.25 ? 3   DT  D "O4'" 1 
ATOM   498  C "C3'" . DT  B 2 11  ? 70.638 28.254 4.908   1.00 48.28 ? 3   DT  D "C3'" 1 
ATOM   499  O "O3'" . DT  B 2 11  ? 70.505 26.835 4.923   1.00 50.96 ? 3   DT  D "O3'" 1 
ATOM   500  C "C2'" . DT  B 2 11  ? 69.864 28.835 3.746   1.00 45.32 ? 3   DT  D "C2'" 1 
ATOM   501  C "C1'" . DT  B 2 11  ? 68.449 28.960 4.296   1.00 45.22 ? 3   DT  D "C1'" 1 
ATOM   502  N N1    . DT  B 2 11  ? 67.762 30.184 3.841   1.00 40.56 ? 3   DT  D N1    1 
ATOM   503  C C2    . DT  B 2 11  ? 66.765 30.069 2.904   1.00 37.29 ? 3   DT  D C2    1 
ATOM   504  O O2    . DT  B 2 11  ? 66.406 28.997 2.446   1.00 34.52 ? 3   DT  D O2    1 
ATOM   505  N N3    . DT  B 2 11  ? 66.201 31.268 2.519   1.00 36.37 ? 3   DT  D N3    1 
ATOM   506  C C4    . DT  B 2 11  ? 66.524 32.530 2.985   1.00 35.74 ? 3   DT  D C4    1 
ATOM   507  O O4    . DT  B 2 11  ? 65.935 33.510 2.560   1.00 30.61 ? 3   DT  D O4    1 
ATOM   508  C C5    . DT  B 2 11  ? 67.566 32.570 3.972   1.00 36.70 ? 3   DT  D C5    1 
ATOM   509  C C7    . DT  B 2 11  ? 67.970 33.895 4.535   1.00 37.96 ? 3   DT  D C7    1 
ATOM   510  C C6    . DT  B 2 11  ? 68.130 31.414 4.346   1.00 38.54 ? 3   DT  D C6    1 
ATOM   511  P P     . DT  B 2 12  ? 71.678 25.930 4.307   1.00 54.71 ? 2   DT  D P     1 
ATOM   512  O OP1   . DT  B 2 12  ? 72.336 25.252 5.459   1.00 53.60 ? 2   DT  D OP1   1 
ATOM   513  O OP2   . DT  B 2 12  ? 72.476 26.772 3.372   1.00 55.76 ? 2   DT  D OP2   1 
ATOM   514  O "O5'" . DT  B 2 12  ? 70.937 24.833 3.433   1.00 53.65 ? 2   DT  D "O5'" 1 
ATOM   515  C "C5'" . DT  B 2 12  ? 70.743 25.017 2.035   1.00 52.64 ? 2   DT  D "C5'" 1 
ATOM   516  C "C4'" . DT  B 2 12  ? 69.348 24.578 1.656   1.00 53.13 ? 2   DT  D "C4'" 1 
ATOM   517  O "O4'" . DT  B 2 12  ? 68.461 25.723 1.755   1.00 53.92 ? 2   DT  D "O4'" 1 
ATOM   518  C "C3'" . DT  B 2 12  ? 69.259 24.140 0.199   1.00 52.40 ? 2   DT  D "C3'" 1 
ATOM   519  O "O3'" . DT  B 2 12  ? 68.252 23.150 0.030   1.00 50.79 ? 2   DT  D "O3'" 1 
ATOM   520  C "C2'" . DT  B 2 12  ? 68.931 25.422 -0.536  1.00 53.48 ? 2   DT  D "C2'" 1 
ATOM   521  C "C1'" . DT  B 2 12  ? 68.038 26.134 0.458   1.00 54.38 ? 2   DT  D "C1'" 1 
ATOM   522  N N1    . DT  B 2 12  ? 68.097 27.605 0.388   1.00 55.77 ? 2   DT  D N1    1 
ATOM   523  C C2    . DT  B 2 12  ? 66.995 28.269 -0.098  1.00 55.43 ? 2   DT  D C2    1 
ATOM   524  O O2    . DT  B 2 12  ? 65.985 27.696 -0.472  1.00 55.90 ? 2   DT  D O2    1 
ATOM   525  N N3    . DT  B 2 12  ? 67.121 29.634 -0.135  1.00 55.00 ? 2   DT  D N3    1 
ATOM   526  C C4    . DT  B 2 12  ? 68.214 30.383 0.252   1.00 54.00 ? 2   DT  D C4    1 
ATOM   527  O O4    . DT  B 2 12  ? 68.177 31.599 0.169   1.00 52.29 ? 2   DT  D O4    1 
ATOM   528  C C5    . DT  B 2 12  ? 69.337 29.623 0.745   1.00 55.46 ? 2   DT  D C5    1 
ATOM   529  C C7    . DT  B 2 12  ? 70.571 30.349 1.180   1.00 56.82 ? 2   DT  D C7    1 
ATOM   530  C C6    . DT  B 2 12  ? 69.223 28.288 0.791   1.00 56.28 ? 2   DT  D C6    1 
ATOM   531  P P     . DT  B 2 13  ? 67.994 22.534 -1.424  1.00 52.19 ? 1   DT  D P     1 
ATOM   532  O OP1   . DT  B 2 13  ? 67.204 21.286 -1.243  1.00 53.09 ? 1   DT  D OP1   1 
ATOM   533  O OP2   . DT  B 2 13  ? 69.275 22.493 -2.181  1.00 53.15 ? 1   DT  D OP2   1 
ATOM   534  O "O5'" . DT  B 2 13  ? 67.059 23.629 -2.091  1.00 50.45 ? 1   DT  D "O5'" 1 
ATOM   535  C "C5'" . DT  B 2 13  ? 65.787 23.921 -1.527  1.00 46.34 ? 1   DT  D "C5'" 1 
ATOM   536  C "C4'" . DT  B 2 13  ? 64.876 24.463 -2.596  1.00 41.24 ? 1   DT  D "C4'" 1 
ATOM   537  O "O4'" . DT  B 2 13  ? 64.975 25.906 -2.606  1.00 38.83 ? 1   DT  D "O4'" 1 
ATOM   538  C "C3'" . DT  B 2 13  ? 65.367 24.008 -3.968  1.00 39.91 ? 1   DT  D "C3'" 1 
ATOM   539  O "O3'" . DT  B 2 13  ? 64.271 23.877 -4.874  1.00 39.59 ? 1   DT  D "O3'" 1 
ATOM   540  C "C2'" . DT  B 2 13  ? 66.332 25.110 -4.359  1.00 38.74 ? 1   DT  D "C2'" 1 
ATOM   541  C "C1'" . DT  B 2 13  ? 65.640 26.332 -3.783  1.00 40.91 ? 1   DT  D "C1'" 1 
ATOM   542  N N1    . DT  B 2 13  ? 66.488 27.518 -3.468  1.00 42.80 ? 1   DT  D N1    1 
ATOM   543  C C2    . DT  B 2 13  ? 65.910 28.766 -3.623  1.00 44.90 ? 1   DT  D C2    1 
ATOM   544  O O2    . DT  B 2 13  ? 64.738 28.923 -3.960  1.00 46.94 ? 1   DT  D O2    1 
ATOM   545  N N3    . DT  B 2 13  ? 66.757 29.826 -3.373  1.00 42.42 ? 1   DT  D N3    1 
ATOM   546  C C4    . DT  B 2 13  ? 68.082 29.763 -2.993  1.00 39.22 ? 1   DT  D C4    1 
ATOM   547  O O4    . DT  B 2 13  ? 68.718 30.802 -2.820  1.00 36.06 ? 1   DT  D O4    1 
ATOM   548  C C5    . DT  B 2 13  ? 68.610 28.426 -2.833  1.00 38.48 ? 1   DT  D C5    1 
ATOM   549  C C7    . DT  B 2 13  ? 70.035 28.253 -2.413  1.00 41.06 ? 1   DT  D C7    1 
ATOM   550  C C6    . DT  B 2 13  ? 67.798 27.389 -3.070  1.00 38.55 ? 1   DT  D C6    1 
ATOM   551  P P     . DT  B 2 14  ? 64.527 23.916 -6.457  1.00 41.65 ? -1  DT  D P     1 
ATOM   552  O OP1   . DT  B 2 14  ? 63.689 22.863 -7.073  1.00 41.25 ? -1  DT  D OP1   1 
ATOM   553  O OP2   . DT  B 2 14  ? 65.982 23.954 -6.754  1.00 42.18 ? -1  DT  D OP2   1 
ATOM   554  O "O5'" . DT  B 2 14  ? 63.905 25.319 -6.852  1.00 40.19 ? -1  DT  D "O5'" 1 
ATOM   555  C "C5'" . DT  B 2 14  ? 62.701 25.735 -6.237  1.00 41.16 ? -1  DT  D "C5'" 1 
ATOM   556  C "C4'" . DT  B 2 14  ? 62.097 26.890 -6.992  1.00 42.31 ? -1  DT  D "C4'" 1 
ATOM   557  O "O4'" . DT  B 2 14  ? 62.879 28.076 -6.722  1.00 42.30 ? -1  DT  D "O4'" 1 
ATOM   558  C "C3'" . DT  B 2 14  ? 62.139 26.714 -8.506  1.00 42.11 ? -1  DT  D "C3'" 1 
ATOM   559  O "O3'" . DT  B 2 14  ? 61.013 27.396 -9.076  1.00 44.92 ? -1  DT  D "O3'" 1 
ATOM   560  C "C2'" . DT  B 2 14  ? 63.487 27.316 -8.873  1.00 42.02 ? -1  DT  D "C2'" 1 
ATOM   561  C "C1'" . DT  B 2 14  ? 63.620 28.458 -7.873  1.00 41.60 ? -1  DT  D "C1'" 1 
ATOM   562  N N1    . DT  B 2 14  ? 64.980 28.808 -7.420  1.00 41.02 ? -1  DT  D N1    1 
ATOM   563  C C2    . DT  B 2 14  ? 65.290 30.143 -7.302  1.00 41.54 ? -1  DT  D C2    1 
ATOM   564  O O2    . DT  B 2 14  ? 64.525 31.034 -7.622  1.00 43.57 ? -1  DT  D O2    1 
ATOM   565  N N3    . DT  B 2 14  ? 66.535 30.401 -6.799  1.00 41.28 ? -1  DT  D N3    1 
ATOM   566  C C4    . DT  B 2 14  ? 67.491 29.480 -6.430  1.00 43.16 ? -1  DT  D C4    1 
ATOM   567  O O4    . DT  B 2 14  ? 68.570 29.867 -5.984  1.00 45.17 ? -1  DT  D O4    1 
ATOM   568  C C5    . DT  B 2 14  ? 67.111 28.093 -6.610  1.00 42.00 ? -1  DT  D C5    1 
ATOM   569  C C7    . DT  B 2 14  ? 68.084 27.019 -6.249  1.00 39.81 ? -1  DT  D C7    1 
ATOM   570  C C6    . DT  B 2 14  ? 65.891 27.832 -7.093  1.00 41.59 ? -1  DT  D C6    1 
ATOM   571  P P     . DT  B 2 15  ? 60.878 27.553 -10.668 1.00 48.41 ? -2  DT  D P     1 
ATOM   572  O OP1   . DT  B 2 15  ? 59.429 27.447 -11.021 1.00 42.75 ? -2  DT  D OP1   1 
ATOM   573  O OP2   . DT  B 2 15  ? 61.861 26.632 -11.312 1.00 46.05 ? -2  DT  D OP2   1 
ATOM   574  O "O5'" . DT  B 2 15  ? 61.332 29.065 -10.894 1.00 44.37 ? -2  DT  D "O5'" 1 
ATOM   575  C "C5'" . DT  B 2 15  ? 60.901 30.077 -9.990  1.00 42.10 ? -2  DT  D "C5'" 1 
ATOM   576  C "C4'" . DT  B 2 15  ? 60.985 31.445 -10.630 1.00 44.62 ? -2  DT  D "C4'" 1 
ATOM   577  O "O4'" . DT  B 2 15  ? 62.281 32.034 -10.342 1.00 43.51 ? -2  DT  D "O4'" 1 
ATOM   578  C "C3'" . DT  B 2 15  ? 60.872 31.422 -12.156 1.00 44.01 ? -2  DT  D "C3'" 1 
ATOM   579  O "O3'" . DT  B 2 15  ? 60.238 32.619 -12.651 1.00 43.59 ? -2  DT  D "O3'" 1 
ATOM   580  C "C2'" . DT  B 2 15  ? 62.323 31.273 -12.588 1.00 45.82 ? -2  DT  D "C2'" 1 
ATOM   581  C "C1'" . DT  B 2 15  ? 63.072 32.079 -11.523 1.00 43.97 ? -2  DT  D "C1'" 1 
ATOM   582  N N1    . DT  B 2 15  ? 64.446 31.633 -11.177 1.00 43.07 ? -2  DT  D N1    1 
ATOM   583  C C2    . DT  B 2 15  ? 65.183 32.460 -10.374 1.00 43.73 ? -2  DT  D C2    1 
ATOM   584  O O2    . DT  B 2 15  ? 64.750 33.506 -9.939  1.00 48.34 ? -2  DT  D O2    1 
ATOM   585  N N3    . DT  B 2 15  ? 66.449 32.019 -10.094 1.00 43.55 ? -2  DT  D N3    1 
ATOM   586  C C4    . DT  B 2 15  ? 67.033 30.849 -10.522 1.00 42.03 ? -2  DT  D C4    1 
ATOM   587  O O4    . DT  B 2 15  ? 68.172 30.578 -10.179 1.00 40.22 ? -2  DT  D O4    1 
ATOM   588  C C5    . DT  B 2 15  ? 66.205 30.021 -11.362 1.00 42.13 ? -2  DT  D C5    1 
ATOM   589  C C7    . DT  B 2 15  ? 66.759 28.729 -11.875 1.00 42.01 ? -2  DT  D C7    1 
ATOM   590  C C6    . DT  B 2 15  ? 64.967 30.449 -11.646 1.00 42.05 ? -2  DT  D C6    1 
ATOM   591  P P     . DC  B 2 16  ? 60.035 32.830 -14.238 1.00 43.91 ? -3  DC  D P     1 
ATOM   592  O OP1   . DC  B 2 16  ? 58.802 33.635 -14.463 1.00 42.82 ? -3  DC  D OP1   1 
ATOM   593  O OP2   . DC  B 2 16  ? 60.197 31.520 -14.930 1.00 44.00 ? -3  DC  D OP2   1 
ATOM   594  O "O5'" . DC  B 2 16  ? 61.261 33.759 -14.649 1.00 42.08 ? -3  DC  D "O5'" 1 
ATOM   595  C "C5'" . DC  B 2 16  ? 61.483 34.983 -13.968 1.00 43.52 ? -3  DC  D "C5'" 1 
ATOM   596  C "C4'" . DC  B 2 16  ? 62.691 35.701 -14.523 1.00 44.49 ? -3  DC  D "C4'" 1 
ATOM   597  O "O4'" . DC  B 2 16  ? 63.911 35.003 -14.183 1.00 45.16 ? -3  DC  D "O4'" 1 
ATOM   598  C "C3'" . DC  B 2 16  ? 62.681 35.757 -16.051 1.00 42.84 ? -3  DC  D "C3'" 1 
ATOM   599  O "O3'" . DC  B 2 16  ? 63.514 36.846 -16.424 1.00 44.22 ? -3  DC  D "O3'" 1 
ATOM   600  C "C2'" . DC  B 2 16  ? 63.396 34.480 -16.439 1.00 43.96 ? -3  DC  D "C2'" 1 
ATOM   601  C "C1'" . DC  B 2 16  ? 64.478 34.480 -15.375 1.00 45.26 ? -3  DC  D "C1'" 1 
ATOM   602  N N1    . DC  B 2 16  ? 65.253 33.267 -15.066 1.00 43.54 ? -3  DC  D N1    1 
ATOM   603  C C2    . DC  B 2 16  ? 66.569 33.451 -14.658 1.00 45.64 ? -3  DC  D C2    1 
ATOM   604  O O2    . DC  B 2 16  ? 66.994 34.618 -14.559 1.00 47.66 ? -3  DC  D O2    1 
ATOM   605  N N3    . DC  B 2 16  ? 67.342 32.374 -14.383 1.00 44.73 ? -3  DC  D N3    1 
ATOM   606  C C4    . DC  B 2 16  ? 66.834 31.146 -14.508 1.00 43.67 ? -3  DC  D C4    1 
ATOM   607  N N4    . DC  B 2 16  ? 67.633 30.112 -14.239 1.00 44.37 ? -3  DC  D N4    1 
ATOM   608  C C5    . DC  B 2 16  ? 65.481 30.926 -14.916 1.00 44.08 ? -3  DC  D C5    1 
ATOM   609  C C6    . DC  B 2 16  ? 64.732 32.007 -15.180 1.00 42.77 ? -3  DC  D C6    1 
ATOM   610  P P     . DG  B 2 17  ? 62.937 38.015 -17.348 1.00 51.78 ? -4  DG  D P     1 
ATOM   611  O OP1   . DG  B 2 17  ? 61.677 38.518 -16.721 1.00 49.74 ? -4  DG  D OP1   1 
ATOM   612  O OP2   . DG  B 2 17  ? 62.897 37.499 -18.746 1.00 51.30 ? -4  DG  D OP2   1 
ATOM   613  O "O5'" . DG  B 2 17  ? 64.080 39.124 -17.241 1.00 48.98 ? -4  DG  D "O5'" 1 
ATOM   614  C "C5'" . DG  B 2 17  ? 64.574 39.542 -15.966 1.00 49.41 ? -4  DG  D "C5'" 1 
ATOM   615  C "C4'" . DG  B 2 17  ? 65.979 40.099 -16.080 1.00 50.32 ? -4  DG  D "C4'" 1 
ATOM   616  O "O4'" . DG  B 2 17  ? 66.964 39.042 -15.907 1.00 49.46 ? -4  DG  D "O4'" 1 
ATOM   617  C "C3'" . DG  B 2 17  ? 66.282 40.708 -17.450 1.00 49.98 ? -4  DG  D "C3'" 1 
ATOM   618  O "O3'" . DG  B 2 17  ? 67.363 41.642 -17.391 1.00 50.00 ? -4  DG  D "O3'" 1 
ATOM   619  C "C2'" . DG  B 2 17  ? 66.824 39.515 -18.222 1.00 49.99 ? -4  DG  D "C2'" 1 
ATOM   620  C "C1'" . DG  B 2 17  ? 67.624 38.780 -17.146 1.00 49.50 ? -4  DG  D "C1'" 1 
ATOM   621  N N9    . DG  B 2 17  ? 67.737 37.332 -17.324 1.00 50.56 ? -4  DG  D N9    1 
ATOM   622  C C8    . DG  B 2 17  ? 66.786 36.505 -17.870 1.00 49.89 ? -4  DG  D C8    1 
ATOM   623  N N7    . DG  B 2 17  ? 67.156 35.252 -17.918 1.00 49.33 ? -4  DG  D N7    1 
ATOM   624  C C5    . DG  B 2 17  ? 68.432 35.240 -17.368 1.00 49.01 ? -4  DG  D C5    1 
ATOM   625  C C6    . DG  B 2 17  ? 69.331 34.155 -17.161 1.00 46.61 ? -4  DG  D C6    1 
ATOM   626  O O6    . DG  B 2 17  ? 69.170 32.968 -17.431 1.00 46.25 ? -4  DG  D O6    1 
ATOM   627  N N1    . DG  B 2 17  ? 70.520 34.573 -16.578 1.00 46.51 ? -4  DG  D N1    1 
ATOM   628  C C2    . DG  B 2 17  ? 70.818 35.869 -16.238 1.00 48.66 ? -4  DG  D C2    1 
ATOM   629  N N2    . DG  B 2 17  ? 72.028 36.050 -15.679 1.00 49.90 ? -4  DG  D N2    1 
ATOM   630  N N3    . DG  B 2 17  ? 69.993 36.903 -16.430 1.00 49.64 ? -4  DG  D N3    1 
ATOM   631  C C4    . DG  B 2 17  ? 68.818 36.514 -16.994 1.00 50.82 ? -4  DG  D C4    1 
ATOM   632  O "O5'" . DC  C 2 1   ? 51.381 26.630 27.967  1.00 67.59 ? 10  DC  E "O5'" 1 
ATOM   633  C "C5'" . DC  C 2 1   ? 51.587 26.132 26.640  1.00 63.19 ? 10  DC  E "C5'" 1 
ATOM   634  C "C4'" . DC  C 2 1   ? 50.857 26.996 25.635  1.00 61.33 ? 10  DC  E "C4'" 1 
ATOM   635  O "O4'" . DC  C 2 1   ? 51.160 26.528 24.287  1.00 58.63 ? 10  DC  E "O4'" 1 
ATOM   636  C "C3'" . DC  C 2 1   ? 49.348 26.858 25.769  1.00 58.86 ? 10  DC  E "C3'" 1 
ATOM   637  O "O3'" . DC  C 2 1   ? 48.646 28.062 25.500  1.00 58.01 ? 10  DC  E "O3'" 1 
ATOM   638  C "C2'" . DC  C 2 1   ? 49.006 25.718 24.830  1.00 57.52 ? 10  DC  E "C2'" 1 
ATOM   639  C "C1'" . DC  C 2 1   ? 50.034 25.854 23.708  1.00 53.90 ? 10  DC  E "C1'" 1 
ATOM   640  N N1    . DC  C 2 1   ? 50.496 24.531 23.236  1.00 48.28 ? 10  DC  E N1    1 
ATOM   641  C C2    . DC  C 2 1   ? 50.110 24.062 21.972  1.00 45.04 ? 10  DC  E C2    1 
ATOM   642  O O2    . DC  C 2 1   ? 49.419 24.776 21.245  1.00 43.18 ? 10  DC  E O2    1 
ATOM   643  N N3    . DC  C 2 1   ? 50.502 22.832 21.578  1.00 41.63 ? 10  DC  E N3    1 
ATOM   644  C C4    . DC  C 2 1   ? 51.253 22.085 22.377  1.00 43.74 ? 10  DC  E C4    1 
ATOM   645  N N4    . DC  C 2 1   ? 51.616 20.886 21.946  1.00 45.87 ? 10  DC  E N4    1 
ATOM   646  C C5    . DC  C 2 1   ? 51.671 22.536 23.658  1.00 46.23 ? 10  DC  E C5    1 
ATOM   647  C C6    . DC  C 2 1   ? 51.277 23.755 24.042  1.00 48.12 ? 10  DC  E C6    1 
ATOM   648  P P     . DT  C 2 2   ? 47.107 28.163 25.930  1.00 59.91 ? 11  DT  E P     1 
ATOM   649  O OP1   . DT  C 2 2   ? 46.726 29.590 26.044  1.00 59.18 ? 11  DT  E OP1   1 
ATOM   650  O OP2   . DT  C 2 2   ? 46.889 27.246 27.083  1.00 58.66 ? 11  DT  E OP2   1 
ATOM   651  O "O5'" . DT  C 2 2   ? 46.354 27.555 24.668  1.00 60.29 ? 11  DT  E "O5'" 1 
ATOM   652  C "C5'" . DT  C 2 2   ? 46.452 28.183 23.391  1.00 58.12 ? 11  DT  E "C5'" 1 
ATOM   653  C "C4'" . DT  C 2 2   ? 45.589 27.457 22.389  1.00 54.49 ? 11  DT  E "C4'" 1 
ATOM   654  O "O4'" . DT  C 2 2   ? 46.176 26.159 22.121  1.00 52.71 ? 11  DT  E "O4'" 1 
ATOM   655  C "C3'" . DT  C 2 2   ? 44.206 27.159 22.979  1.00 53.11 ? 11  DT  E "C3'" 1 
ATOM   656  O "O3'" . DT  C 2 2   ? 43.236 27.069 21.926  1.00 51.46 ? 11  DT  E "O3'" 1 
ATOM   657  C "C2'" . DT  C 2 2   ? 44.409 25.810 23.653  1.00 51.20 ? 11  DT  E "C2'" 1 
ATOM   658  C "C1'" . DT  C 2 2   ? 45.343 25.145 22.664  1.00 49.15 ? 11  DT  E "C1'" 1 
ATOM   659  N N1    . DT  C 2 2   ? 46.177 24.000 23.072  1.00 45.07 ? 11  DT  E N1    1 
ATOM   660  C C2    . DT  C 2 2   ? 46.616 23.222 22.040  1.00 44.94 ? 11  DT  E C2    1 
ATOM   661  O O2    . DT  C 2 2   ? 46.343 23.475 20.880  1.00 47.51 ? 11  DT  E O2    1 
ATOM   662  N N3    . DT  C 2 2   ? 47.379 22.139 22.403  1.00 44.10 ? 11  DT  E N3    1 
ATOM   663  C C4    . DT  C 2 2   ? 47.741 21.772 23.681  1.00 46.08 ? 11  DT  E C4    1 
ATOM   664  O O4    . DT  C 2 2   ? 48.440 20.775 23.858  1.00 45.14 ? 11  DT  E O4    1 
ATOM   665  C C5    . DT  C 2 2   ? 47.240 22.638 24.733  1.00 46.74 ? 11  DT  E C5    1 
ATOM   666  C C7    . DT  C 2 2   ? 47.574 22.311 26.157  1.00 46.43 ? 11  DT  E C7    1 
ATOM   667  C C6    . DT  C 2 2   ? 46.493 23.702 24.377  1.00 45.44 ? 11  DT  E C6    1 
ATOM   668  P P     . DA  C 2 3   ? 41.682 27.344 22.240  1.00 51.27 ? 12  DA  E P     1 
ATOM   669  O OP1   . DA  C 2 3   ? 41.403 28.711 21.725  1.00 47.95 ? 12  DA  E OP1   1 
ATOM   670  O OP2   . DA  C 2 3   ? 41.387 27.005 23.668  1.00 46.93 ? 12  DA  E OP2   1 
ATOM   671  O "O5'" . DA  C 2 3   ? 40.911 26.314 21.300  1.00 47.95 ? 12  DA  E "O5'" 1 
ATOM   672  C "C5'" . DA  C 2 3   ? 40.857 26.533 19.900  1.00 44.61 ? 12  DA  E "C5'" 1 
ATOM   673  C "C4'" . DA  C 2 3   ? 40.529 25.253 19.168  1.00 41.98 ? 12  DA  E "C4'" 1 
ATOM   674  O "O4'" . DA  C 2 3   ? 41.454 24.221 19.593  1.00 41.62 ? 12  DA  E "O4'" 1 
ATOM   675  C "C3'" . DA  C 2 3   ? 39.143 24.694 19.485  1.00 38.79 ? 12  DA  E "C3'" 1 
ATOM   676  O "O3'" . DA  C 2 3   ? 38.670 23.965 18.345  1.00 34.38 ? 12  DA  E "O3'" 1 
ATOM   677  C "C2'" . DA  C 2 3   ? 39.408 23.803 20.684  1.00 40.42 ? 12  DA  E "C2'" 1 
ATOM   678  C "C1'" . DA  C 2 3   ? 40.784 23.241 20.365  1.00 42.89 ? 12  DA  E "C1'" 1 
ATOM   679  N N9    . DA  C 2 3   ? 41.640 22.868 21.497  1.00 47.18 ? 12  DA  E N9    1 
ATOM   680  C C8    . DA  C 2 3   ? 41.864 23.533 22.678  1.00 48.20 ? 12  DA  E C8    1 
ATOM   681  N N7    . DA  C 2 3   ? 42.668 22.895 23.500  1.00 48.59 ? 12  DA  E N7    1 
ATOM   682  C C5    . DA  C 2 3   ? 43.003 21.739 22.811  1.00 49.91 ? 12  DA  E C5    1 
ATOM   683  C C6    . DA  C 2 3   ? 43.821 20.635 23.139  1.00 52.71 ? 12  DA  E C6    1 
ATOM   684  N N6    . DA  C 2 3   ? 44.481 20.517 24.287  1.00 52.55 ? 12  DA  E N6    1 
ATOM   685  N N1    . DA  C 2 3   ? 43.937 19.640 22.229  1.00 55.48 ? 12  DA  E N1    1 
ATOM   686  C C2    . DA  C 2 3   ? 43.279 19.756 21.070  1.00 56.16 ? 12  DA  E C2    1 
ATOM   687  N N3    . DA  C 2 3   ? 42.485 20.743 20.645  1.00 54.98 ? 12  DA  E N3    1 
ATOM   688  C C4    . DA  C 2 3   ? 42.385 21.712 21.574  1.00 50.11 ? 12  DA  E C4    1 
ATOM   689  P P     . DG  C 2 4   ? 37.105 23.611 18.192  1.00 32.54 ? 13  DG  E P     1 
ATOM   690  O OP1   . DG  C 2 4   ? 36.744 23.937 16.807  1.00 31.89 ? 13  DG  E OP1   1 
ATOM   691  O OP2   . DG  C 2 4   ? 36.313 24.169 19.318  1.00 30.60 ? 13  DG  E OP2   1 
ATOM   692  O "O5'" . DG  C 2 4   ? 37.083 22.027 18.295  1.00 30.67 ? 13  DG  E "O5'" 1 
ATOM   693  C "C5'" . DG  C 2 4   ? 38.160 21.343 18.924  1.00 27.53 ? 13  DG  E "C5'" 1 
ATOM   694  C "C4'" . DG  C 2 4   ? 38.033 19.860 18.696  1.00 25.14 ? 13  DG  E "C4'" 1 
ATOM   695  O "O4'" . DG  C 2 4   ? 38.947 19.208 19.608  1.00 27.33 ? 13  DG  E "O4'" 1 
ATOM   696  C "C3'" . DG  C 2 4   ? 36.656 19.334 19.071  1.00 23.56 ? 13  DG  E "C3'" 1 
ATOM   697  O "O3'" . DG  C 2 4   ? 36.331 18.184 18.299  1.00 21.93 ? 13  DG  E "O3'" 1 
ATOM   698  C "C2'" . DG  C 2 4   ? 36.793 19.031 20.548  1.00 25.15 ? 13  DG  E "C2'" 1 
ATOM   699  C "C1'" . DG  C 2 4   ? 38.238 18.587 20.674  1.00 29.28 ? 13  DG  E "C1'" 1 
ATOM   700  N N9    . DG  C 2 4   ? 38.859 19.007 21.930  1.00 34.66 ? 13  DG  E N9    1 
ATOM   701  C C8    . DG  C 2 4   ? 38.409 19.973 22.802  1.00 36.72 ? 13  DG  E C8    1 
ATOM   702  N N7    . DG  C 2 4   ? 39.176 20.120 23.851  1.00 38.97 ? 13  DG  E N7    1 
ATOM   703  C C5    . DG  C 2 4   ? 40.197 19.198 23.660  1.00 39.16 ? 13  DG  E C5    1 
ATOM   704  C C6    . DG  C 2 4   ? 41.333 18.889 24.465  1.00 38.87 ? 13  DG  E C6    1 
ATOM   705  O O6    . DG  C 2 4   ? 41.684 19.394 25.544  1.00 34.42 ? 13  DG  E O6    1 
ATOM   706  N N1    . DG  C 2 4   ? 42.099 17.880 23.891  1.00 38.71 ? 13  DG  E N1    1 
ATOM   707  C C2    . DG  C 2 4   ? 41.818 17.251 22.700  1.00 37.75 ? 13  DG  E C2    1 
ATOM   708  N N2    . DG  C 2 4   ? 42.667 16.301 22.309  1.00 40.11 ? 13  DG  E N2    1 
ATOM   709  N N3    . DG  C 2 4   ? 40.780 17.531 21.945  1.00 37.80 ? 13  DG  E N3    1 
ATOM   710  C C4    . DG  C 2 4   ? 40.014 18.504 22.478  1.00 37.97 ? 13  DG  E C4    1 
ATOM   711  P P     . DA  C 2 5   ? 35.420 17.038 18.944  1.00 17.96 ? 14  DA  E P     1 
ATOM   712  O OP1   . DA  C 2 5   ? 34.706 16.320 17.875  1.00 18.63 ? 14  DA  E OP1   1 
ATOM   713  O OP2   . DA  C 2 5   ? 34.659 17.659 20.048  1.00 20.82 ? 14  DA  E OP2   1 
ATOM   714  O "O5'" . DA  C 2 5   ? 36.492 16.034 19.546  1.00 23.21 ? 14  DA  E "O5'" 1 
ATOM   715  C "C5'" . DA  C 2 5   ? 37.607 15.594 18.759  1.00 23.33 ? 14  DA  E "C5'" 1 
ATOM   716  C "C4'" . DA  C 2 5   ? 38.008 14.197 19.167  1.00 22.07 ? 14  DA  E "C4'" 1 
ATOM   717  O "O4'" . DA  C 2 5   ? 38.593 14.247 20.490  1.00 23.17 ? 14  DA  E "O4'" 1 
ATOM   718  C "C3'" . DA  C 2 5   ? 36.801 13.293 19.307  1.00 24.76 ? 14  DA  E "C3'" 1 
ATOM   719  O "O3'" . DA  C 2 5   ? 37.096 11.946 18.999  1.00 22.44 ? 14  DA  E "O3'" 1 
ATOM   720  C "C2'" . DA  C 2 5   ? 36.379 13.493 20.750  1.00 26.13 ? 14  DA  E "C2'" 1 
ATOM   721  C "C1'" . DA  C 2 5   ? 37.702 13.719 21.462  1.00 25.87 ? 14  DA  E "C1'" 1 
ATOM   722  N N9    . DA  C 2 5   ? 37.628 14.693 22.551  1.00 26.49 ? 14  DA  E N9    1 
ATOM   723  C C8    . DA  C 2 5   ? 36.656 15.636 22.795  1.00 26.77 ? 14  DA  E C8    1 
ATOM   724  N N7    . DA  C 2 5   ? 36.898 16.386 23.843  1.00 28.32 ? 14  DA  E N7    1 
ATOM   725  C C5    . DA  C 2 5   ? 38.107 15.897 24.329  1.00 31.48 ? 14  DA  E C5    1 
ATOM   726  C C6    . DA  C 2 5   ? 38.909 16.256 25.431  1.00 32.52 ? 14  DA  E C6    1 
ATOM   727  N N6    . DA  C 2 5   ? 38.602 17.227 26.295  1.00 35.32 ? 14  DA  E N6    1 
ATOM   728  N N1    . DA  C 2 5   ? 40.053 15.568 25.624  1.00 33.95 ? 14  DA  E N1    1 
ATOM   729  C C2    . DA  C 2 5   ? 40.360 14.589 24.778  1.00 33.76 ? 14  DA  E C2    1 
ATOM   730  N N3    . DA  C 2 5   ? 39.693 14.149 23.720  1.00 34.72 ? 14  DA  E N3    1 
ATOM   731  C C4    . DA  C 2 5   ? 38.562 14.854 23.544  1.00 30.78 ? 14  DA  E C4    1 
ATOM   732  P P     . DT  C 2 6   ? 35.891 10.896 18.936  1.00 30.48 ? 15  DT  E P     1 
ATOM   733  O OP1   . DT  C 2 6   ? 35.920 10.152 17.655  1.00 27.35 ? 15  DT  E OP1   1 
ATOM   734  O OP2   . DT  C 2 6   ? 34.645 11.599 19.347  1.00 24.02 ? 15  DT  E OP2   1 
ATOM   735  O "O5'" . DT  C 2 6   ? 36.283 9.880  20.091  1.00 33.28 ? 15  DT  E "O5'" 1 
ATOM   736  C "C5'" . DT  C 2 6   ? 37.038 10.310 21.213  1.00 32.06 ? 15  DT  E "C5'" 1 
ATOM   737  C "C4'" . DT  C 2 6   ? 37.372 9.127  22.085  1.00 33.39 ? 15  DT  E "C4'" 1 
ATOM   738  O "O4'" . DT  C 2 6   ? 37.834 9.655  23.341  1.00 35.45 ? 15  DT  E "O4'" 1 
ATOM   739  C "C3'" . DT  C 2 6   ? 36.169 8.259  22.439  1.00 35.08 ? 15  DT  E "C3'" 1 
ATOM   740  O "O3'" . DT  C 2 6   ? 36.576 6.919  22.702  1.00 39.15 ? 15  DT  E "O3'" 1 
ATOM   741  C "C2'" . DT  C 2 6   ? 35.616 8.933  23.676  1.00 35.35 ? 15  DT  E "C2'" 1 
ATOM   742  C "C1'" . DT  C 2 6   ? 36.855 9.488  24.355  1.00 33.43 ? 15  DT  E "C1'" 1 
ATOM   743  N N1    . DT  C 2 6   ? 36.632 10.815 24.960  1.00 35.18 ? 15  DT  E N1    1 
ATOM   744  C C2    . DT  C 2 6   ? 37.353 11.152 26.086  1.00 35.69 ? 15  DT  E C2    1 
ATOM   745  O O2    . DT  C 2 6   ? 38.163 10.407 26.605  1.00 33.92 ? 15  DT  E O2    1 
ATOM   746  N N3    . DT  C 2 6   ? 37.087 12.409 26.581  1.00 36.81 ? 15  DT  E N3    1 
ATOM   747  C C4    . DT  C 2 6   ? 36.193 13.331 26.076  1.00 35.29 ? 15  DT  E C4    1 
ATOM   748  O O4    . DT  C 2 6   ? 36.057 14.413 26.629  1.00 37.50 ? 15  DT  E O4    1 
ATOM   749  C C5    . DT  C 2 6   ? 35.474 12.912 24.898  1.00 34.64 ? 15  DT  E C5    1 
ATOM   750  C C7    . DT  C 2 6   ? 34.485 13.851 24.285  1.00 33.19 ? 15  DT  E C7    1 
ATOM   751  C C6    . DT  C 2 6   ? 35.724 11.693 24.404  1.00 33.87 ? 15  DT  E C6    1 
ATOM   752  P P     . DC  C 2 7   ? 35.577 5.706  22.385  1.00 41.86 ? 16  DC  E P     1 
ATOM   753  O OP1   . DC  C 2 7   ? 36.192 4.840  21.356  1.00 39.41 ? 16  DC  E OP1   1 
ATOM   754  O OP2   . DC  C 2 7   ? 34.222 6.256  22.162  1.00 38.81 ? 16  DC  E OP2   1 
ATOM   755  O "O5'" . DC  C 2 7   ? 35.569 4.909  23.759  1.00 41.10 ? 16  DC  E "O5'" 1 
ATOM   756  C "C5'" . DC  C 2 7   ? 36.550 5.183  24.761  1.00 39.13 ? 16  DC  E "C5'" 1 
ATOM   757  C "C4'" . DC  C 2 7   ? 36.055 4.741  26.118  1.00 38.88 ? 16  DC  E "C4'" 1 
ATOM   758  O "O4'" . DC  C 2 7   ? 35.753 5.922  26.902  1.00 35.55 ? 16  DC  E "O4'" 1 
ATOM   759  C "C3'" . DC  C 2 7   ? 34.744 3.959  26.026  1.00 39.94 ? 16  DC  E "C3'" 1 
ATOM   760  O "O3'" . DC  C 2 7   ? 34.595 3.023  27.091  1.00 44.66 ? 16  DC  E "O3'" 1 
ATOM   761  C "C2'" . DC  C 2 7   ? 33.697 5.046  26.122  1.00 37.57 ? 16  DC  E "C2'" 1 
ATOM   762  C "C1'" . DC  C 2 7   ? 34.344 6.048  27.077  1.00 38.00 ? 16  DC  E "C1'" 1 
ATOM   763  N N1    . DC  C 2 7   ? 33.964 7.444  26.797  1.00 37.04 ? 16  DC  E N1    1 
ATOM   764  C C2    . DC  C 2 7   ? 34.594 8.486  27.470  1.00 35.08 ? 16  DC  E C2    1 
ATOM   765  O O2    . DC  C 2 7   ? 35.454 8.233  28.326  1.00 36.21 ? 16  DC  E O2    1 
ATOM   766  N N3    . DC  C 2 7   ? 34.251 9.750  27.172  1.00 35.77 ? 16  DC  E N3    1 
ATOM   767  C C4    . DC  C 2 7   ? 33.320 9.996  26.254  1.00 35.98 ? 16  DC  E C4    1 
ATOM   768  N N4    . DC  C 2 7   ? 33.034 11.254 25.985  1.00 38.16 ? 16  DC  E N4    1 
ATOM   769  C C5    . DC  C 2 7   ? 32.650 8.962  25.571  1.00 35.31 ? 16  DC  E C5    1 
ATOM   770  C C6    . DC  C 2 7   ? 32.996 7.713  25.868  1.00 38.50 ? 16  DC  E C6    1 
ATOM   771  P P     . DG  C 2 8   ? 33.678 1.716  26.881  1.00 47.26 ? 17  DG  E P     1 
ATOM   772  O OP1   . DG  C 2 8   ? 34.599 0.548  26.846  1.00 48.95 ? 17  DG  E OP1   1 
ATOM   773  O OP2   . DG  C 2 8   ? 32.759 1.955  25.739  1.00 47.16 ? 17  DG  E OP2   1 
ATOM   774  O "O5'" . DG  C 2 8   ? 32.828 1.644  28.227  1.00 46.36 ? 17  DG  E "O5'" 1 
ATOM   775  C "C5'" . DG  C 2 8   ? 33.482 1.590  29.495  1.00 43.80 ? 17  DG  E "C5'" 1 
ATOM   776  C "C4'" . DG  C 2 8   ? 32.496 1.829  30.616  1.00 41.58 ? 17  DG  E "C4'" 1 
ATOM   777  O "O4'" . DG  C 2 8   ? 32.059 3.208  30.609  1.00 36.57 ? 17  DG  E "O4'" 1 
ATOM   778  C "C3'" . DG  C 2 8   ? 31.219 1.013  30.481  1.00 41.96 ? 17  DG  E "C3'" 1 
ATOM   779  O "O3'" . DG  C 2 8   ? 30.693 0.776  31.796  1.00 48.53 ? 17  DG  E "O3'" 1 
ATOM   780  C "C2'" . DG  C 2 8   ? 30.333 1.925  29.650  1.00 39.05 ? 17  DG  E "C2'" 1 
ATOM   781  C "C1'" . DG  C 2 8   ? 30.711 3.303  30.175  1.00 35.88 ? 17  DG  E "C1'" 1 
ATOM   782  N N9    . DG  C 2 8   ? 30.597 4.415  29.223  1.00 35.62 ? 17  DG  E N9    1 
ATOM   783  C C8    . DG  C 2 8   ? 30.763 4.355  27.861  1.00 32.48 ? 17  DG  E C8    1 
ATOM   784  N N7    . DG  C 2 8   ? 30.576 5.504  27.270  1.00 33.92 ? 17  DG  E N7    1 
ATOM   785  C C5    . DG  C 2 8   ? 30.277 6.385  28.298  1.00 35.29 ? 17  DG  E C5    1 
ATOM   786  C C6    . DG  C 2 8   ? 29.973 7.781  28.262  1.00 37.38 ? 17  DG  E C6    1 
ATOM   787  O O6    . DG  C 2 8   ? 29.913 8.538  27.286  1.00 38.72 ? 17  DG  E O6    1 
ATOM   788  N N1    . DG  C 2 8   ? 29.719 8.281  29.533  1.00 37.74 ? 17  DG  E N1    1 
ATOM   789  C C2    . DG  C 2 8   ? 29.750 7.549  30.690  1.00 36.67 ? 17  DG  E C2    1 
ATOM   790  N N2    . DG  C 2 8   ? 29.477 8.235  31.817  1.00 35.98 ? 17  DG  E N2    1 
ATOM   791  N N3    . DG  C 2 8   ? 30.030 6.250  30.741  1.00 33.93 ? 17  DG  E N3    1 
ATOM   792  C C4    . DG  C 2 8   ? 30.283 5.737  29.515  1.00 34.93 ? 17  DG  E C4    1 
ATOM   793  P P     . DC  C 2 9   ? 29.197 0.197  31.980  1.00 49.96 ? 18  DC  E P     1 
ATOM   794  O OP1   . DC  C 2 9   ? 29.225 -0.584 33.247  1.00 49.25 ? 18  DC  E OP1   1 
ATOM   795  O OP2   . DC  C 2 9   ? 28.755 -0.465 30.717  1.00 48.17 ? 18  DC  E OP2   1 
ATOM   796  O "O5'" . DC  C 2 9   ? 28.311 1.502  32.247  1.00 47.51 ? 18  DC  E "O5'" 1 
ATOM   797  C "C5'" . DC  C 2 9   ? 28.445 2.217  33.477  1.00 45.32 ? 18  DC  E "C5'" 1 
ATOM   798  C "C4'" . DC  C 2 9   ? 27.226 3.068  33.752  1.00 45.87 ? 18  DC  E "C4'" 1 
ATOM   799  O "O4'" . DC  C 2 9   ? 27.222 4.226  32.890  1.00 45.83 ? 18  DC  E "O4'" 1 
ATOM   800  C "C3'" . DC  C 2 9   ? 25.903 2.352  33.463  1.00 45.35 ? 18  DC  E "C3'" 1 
ATOM   801  O "O3'" . DC  C 2 9   ? 24.877 3.029  34.192  1.00 47.46 ? 18  DC  E "O3'" 1 
ATOM   802  C "C2'" . DC  C 2 9   ? 25.675 2.672  31.997  1.00 44.57 ? 18  DC  E "C2'" 1 
ATOM   803  C "C1'" . DC  C 2 9   ? 26.149 4.116  31.972  1.00 44.60 ? 18  DC  E "C1'" 1 
ATOM   804  N N1    . DC  C 2 9   ? 26.535 4.766  30.712  1.00 43.95 ? 18  DC  E N1    1 
ATOM   805  C C2    . DC  C 2 9   ? 26.612 6.140  30.714  1.00 44.19 ? 18  DC  E C2    1 
ATOM   806  O O2    . DC  C 2 9   ? 26.368 6.738  31.770  1.00 45.62 ? 18  DC  E O2    1 
ATOM   807  N N3    . DC  C 2 9   ? 26.942 6.793  29.582  1.00 45.55 ? 18  DC  E N3    1 
ATOM   808  C C4    . DC  C 2 9   ? 27.185 6.106  28.468  1.00 44.81 ? 18  DC  E C4    1 
ATOM   809  N N4    . DC  C 2 9   ? 27.493 6.794  27.363  1.00 44.01 ? 18  DC  E N4    1 
ATOM   810  C C5    . DC  C 2 9   ? 27.122 4.688  28.436  1.00 44.06 ? 18  DC  E C5    1 
ATOM   811  C C6    . DC  C 2 9   ? 26.798 4.061  29.574  1.00 44.25 ? 18  DC  E C6    1 
ATOM   812  P P     . DA  C 2 10  ? 24.126 2.310  35.414  1.00 50.88 ? 19  DA  E P     1 
ATOM   813  O OP1   . DA  C 2 10  ? 25.210 1.840  36.327  1.00 46.82 ? 19  DA  E OP1   1 
ATOM   814  O OP2   . DA  C 2 10  ? 23.134 1.334  34.878  1.00 45.68 ? 19  DA  E OP2   1 
ATOM   815  O "O5'" . DA  C 2 10  ? 23.336 3.516  36.107  1.00 46.43 ? 19  DA  E "O5'" 1 
ATOM   816  C "C5'" . DA  C 2 10  ? 23.990 4.346  37.072  1.00 46.73 ? 19  DA  E "C5'" 1 
ATOM   817  C "C4'" . DA  C 2 10  ? 23.525 5.789  36.989  1.00 45.12 ? 19  DA  E "C4'" 1 
ATOM   818  O "O4'" . DA  C 2 10  ? 23.817 6.365  35.689  1.00 44.99 ? 19  DA  E "O4'" 1 
ATOM   819  C "C3'" . DA  C 2 10  ? 22.024 5.982  37.158  1.00 43.20 ? 19  DA  E "C3'" 1 
ATOM   820  O "O3'" . DA  C 2 10  ? 21.797 7.279  37.715  1.00 39.98 ? 19  DA  E "O3'" 1 
ATOM   821  C "C2'" . DA  C 2 10  ? 21.514 5.882  35.729  1.00 42.17 ? 19  DA  E "C2'" 1 
ATOM   822  C "C1'" . DA  C 2 10  ? 22.616 6.584  34.963  1.00 40.23 ? 19  DA  E "C1'" 1 
ATOM   823  N N9    . DA  C 2 10  ? 22.845 6.179  33.575  1.00 39.10 ? 19  DA  E N9    1 
ATOM   824  C C8    . DA  C 2 10  ? 23.132 4.933  33.075  1.00 37.16 ? 19  DA  E C8    1 
ATOM   825  N N7    . DA  C 2 10  ? 23.350 4.919  31.777  1.00 35.08 ? 19  DA  E N7    1 
ATOM   826  C C5    . DA  C 2 10  ? 23.178 6.243  31.397  1.00 35.92 ? 19  DA  E C5    1 
ATOM   827  C C6    . DA  C 2 10  ? 23.278 6.893  30.155  1.00 35.90 ? 19  DA  E C6    1 
ATOM   828  N N6    . DA  C 2 10  ? 23.593 6.278  29.017  1.00 36.53 ? 19  DA  E N6    1 
ATOM   829  N N1    . DA  C 2 10  ? 23.041 8.223  30.123  1.00 37.77 ? 19  DA  E N1    1 
ATOM   830  C C2    . DA  C 2 10  ? 22.729 8.848  31.264  1.00 35.43 ? 19  DA  E C2    1 
ATOM   831  N N3    . DA  C 2 10  ? 22.608 8.352  32.489  1.00 37.43 ? 19  DA  E N3    1 
ATOM   832  C C4    . DA  C 2 10  ? 22.851 7.027  32.490  1.00 37.48 ? 19  DA  E C4    1 
ATOM   833  P P     . DT  C 2 11  ? 20.473 7.558  38.585  1.00 41.41 ? 20  DT  E P     1 
ATOM   834  O OP1   . DT  C 2 11  ? 20.835 8.526  39.660  1.00 38.15 ? 20  DT  E OP1   1 
ATOM   835  O OP2   . DT  C 2 11  ? 19.830 6.260  38.929  1.00 36.58 ? 20  DT  E OP2   1 
ATOM   836  O "O5'" . DT  C 2 11  ? 19.512 8.326  37.583  1.00 39.74 ? 20  DT  E "O5'" 1 
ATOM   837  C "C5'" . DT  C 2 11  ? 19.804 8.350  36.204  1.00 42.54 ? 20  DT  E "C5'" 1 
ATOM   838  C "C4'" . DT  C 2 11  ? 19.688 9.754  35.675  1.00 43.08 ? 20  DT  E "C4'" 1 
ATOM   839  O "O4'" . DT  C 2 11  ? 20.136 9.713  34.308  1.00 45.33 ? 20  DT  E "O4'" 1 
ATOM   840  C "C3'" . DT  C 2 11  ? 18.251 10.256 35.631  1.00 43.14 ? 20  DT  E "C3'" 1 
ATOM   841  O "O3'" . DT  C 2 11  ? 18.197 11.691 35.762  1.00 40.45 ? 20  DT  E "O3'" 1 
ATOM   842  C "C2'" . DT  C 2 11  ? 17.773 9.745  34.285  1.00 46.03 ? 20  DT  E "C2'" 1 
ATOM   843  C "C1'" . DT  C 2 11  ? 19.030 9.821  33.427  1.00 46.54 ? 20  DT  E "C1'" 1 
ATOM   844  N N1    . DT  C 2 11  ? 19.153 8.737  32.442  1.00 49.58 ? 20  DT  E N1    1 
ATOM   845  C C2    . DT  C 2 11  ? 19.162 9.062  31.111  1.00 49.72 ? 20  DT  E C2    1 
ATOM   846  O O2    . DT  C 2 11  ? 19.056 10.203 30.704  1.00 52.31 ? 20  DT  E O2    1 
ATOM   847  N N3    . DT  C 2 11  ? 19.300 7.998  30.269  1.00 51.43 ? 20  DT  E N3    1 
ATOM   848  C C4    . DT  C 2 11  ? 19.429 6.673  30.618  1.00 54.97 ? 20  DT  E C4    1 
ATOM   849  O O4    . DT  C 2 11  ? 19.548 5.821  29.750  1.00 57.55 ? 20  DT  E O4    1 
ATOM   850  C C5    . DT  C 2 11  ? 19.410 6.406  32.024  1.00 56.21 ? 20  DT  E C5    1 
ATOM   851  C C7    . DT  C 2 11  ? 19.552 4.994  32.488  1.00 60.11 ? 20  DT  E C7    1 
ATOM   852  C C6    . DT  C 2 11  ? 19.269 7.437  32.858  1.00 53.20 ? 20  DT  E C6    1 
ATOM   853  P P     . DT  C 2 12  ? 16.774 12.433 35.994  1.00 39.63 ? 21  DT  E P     1 
ATOM   854  O OP1   . DT  C 2 12  ? 16.945 13.511 36.998  1.00 36.92 ? 21  DT  E OP1   1 
ATOM   855  O OP2   . DT  C 2 12  ? 15.705 11.422 36.167  1.00 35.64 ? 21  DT  E OP2   1 
ATOM   856  O "O5'" . DT  C 2 12  ? 16.542 13.142 34.601  1.00 39.29 ? 21  DT  E "O5'" 1 
ATOM   857  C "C5'" . DT  C 2 12  ? 17.107 12.547 33.459  1.00 38.14 ? 21  DT  E "C5'" 1 
ATOM   858  C "C4'" . DT  C 2 12  ? 17.011 13.459 32.272  1.00 34.18 ? 21  DT  E "C4'" 1 
ATOM   859  O "O4'" . DT  C 2 12  ? 17.336 12.633 31.145  1.00 34.63 ? 21  DT  E "O4'" 1 
ATOM   860  C "C3'" . DT  C 2 12  ? 15.609 13.975 32.005  1.00 35.13 ? 21  DT  E "C3'" 1 
ATOM   861  O "O3'" . DT  C 2 12  ? 15.734 15.212 31.300  1.00 32.45 ? 21  DT  E "O3'" 1 
ATOM   862  C "C2'" . DT  C 2 12  ? 14.989 12.857 31.184  1.00 34.85 ? 21  DT  E "C2'" 1 
ATOM   863  C "C1'" . DT  C 2 12  ? 16.171 12.316 30.397  1.00 35.31 ? 21  DT  E "C1'" 1 
ATOM   864  N N1    . DT  C 2 12  ? 16.172 10.856 30.203  1.00 34.19 ? 21  DT  E N1    1 
ATOM   865  C C2    . DT  C 2 12  ? 16.325 10.369 28.926  1.00 34.64 ? 21  DT  E C2    1 
ATOM   866  O O2    . DT  C 2 12  ? 16.426 11.091 27.950  1.00 35.28 ? 21  DT  E O2    1 
ATOM   867  N N3    . DT  C 2 12  ? 16.354 9.000  28.832  1.00 34.78 ? 21  DT  E N3    1 
ATOM   868  C C4    . DT  C 2 12  ? 16.244 8.090  29.866  1.00 38.17 ? 21  DT  E C4    1 
ATOM   869  O O4    . DT  C 2 12  ? 16.293 6.877  29.632  1.00 35.53 ? 21  DT  E O4    1 
ATOM   870  C C5    . DT  C 2 12  ? 16.077 8.676  31.182  1.00 38.72 ? 21  DT  E C5    1 
ATOM   871  C C7    . DT  C 2 12  ? 15.960 7.773  32.367  1.00 42.25 ? 21  DT  E C7    1 
ATOM   872  C C6    . DT  C 2 12  ? 16.043 10.011 31.281  1.00 36.76 ? 21  DT  E C6    1 
ATOM   873  P P     . DT  C 2 13  ? 14.443 15.898 30.652  1.00 31.43 ? 22  DT  E P     1 
ATOM   874  O OP1   . DT  C 2 13  ? 14.395 17.284 31.183  1.00 26.89 ? 22  DT  E OP1   1 
ATOM   875  O OP2   . DT  C 2 13  ? 13.276 14.991 30.840  1.00 31.44 ? 22  DT  E OP2   1 
ATOM   876  O "O5'" . DT  C 2 13  ? 14.792 15.862 29.100  1.00 26.70 ? 22  DT  E "O5'" 1 
ATOM   877  C "C5'" . DT  C 2 13  ? 15.032 14.609 28.488  1.00 24.49 ? 22  DT  E "C5'" 1 
ATOM   878  C "C4'" . DT  C 2 13  ? 14.775 14.666 27.004  1.00 27.92 ? 22  DT  E "C4'" 1 
ATOM   879  O "O4'" . DT  C 2 13  ? 14.856 13.303 26.526  1.00 31.35 ? 22  DT  E "O4'" 1 
ATOM   880  C "C3'" . DT  C 2 13  ? 13.395 15.152 26.579  1.00 27.59 ? 22  DT  E "C3'" 1 
ATOM   881  O "O3'" . DT  C 2 13  ? 13.500 15.749 25.279  1.00 25.66 ? 22  DT  E "O3'" 1 
ATOM   882  C "C2'" . DT  C 2 13  ? 12.557 13.883 26.615  1.00 27.06 ? 22  DT  E "C2'" 1 
ATOM   883  C "C1'" . DT  C 2 13  ? 13.554 12.792 26.223  1.00 32.48 ? 22  DT  E "C1'" 1 
ATOM   884  N N1    . DT  C 2 13  ? 13.397 11.504 26.961  1.00 31.92 ? 22  DT  E N1    1 
ATOM   885  C C2    . DT  C 2 13  ? 13.469 10.315 26.260  1.00 32.41 ? 22  DT  E C2    1 
ATOM   886  O O2    . DT  C 2 13  ? 13.645 10.260 25.054  1.00 33.74 ? 22  DT  E O2    1 
ATOM   887  N N3    . DT  C 2 13  ? 13.335 9.184  27.032  1.00 30.47 ? 22  DT  E N3    1 
ATOM   888  C C4    . DT  C 2 13  ? 13.145 9.125  28.403  1.00 30.90 ? 22  DT  E C4    1 
ATOM   889  O O4    . DT  C 2 13  ? 13.054 8.033  28.967  1.00 28.90 ? 22  DT  E O4    1 
ATOM   890  C C5    . DT  C 2 13  ? 13.070 10.406 29.067  1.00 30.86 ? 22  DT  E C5    1 
ATOM   891  C C7    . DT  C 2 13  ? 12.858 10.445 30.544  1.00 33.18 ? 22  DT  E C7    1 
ATOM   892  C C6    . DT  C 2 13  ? 13.196 11.513 28.325  1.00 32.52 ? 22  DT  E C6    1 
ATOM   893  P P     . DT  C 2 14  ? 12.194 15.900 24.356  1.00 27.80 ? 23  DT  E P     1 
ATOM   894  O OP1   . DT  C 2 14  ? 12.496 16.933 23.335  1.00 24.80 ? 23  DT  E OP1   1 
ATOM   895  O OP2   . DT  C 2 14  ? 11.016 16.066 25.240  1.00 26.94 ? 23  DT  E OP2   1 
ATOM   896  O "O5'" . DT  C 2 14  ? 12.156 14.505 23.590  1.00 24.26 ? 23  DT  E "O5'" 1 
ATOM   897  C "C5'" . DT  C 2 14  ? 13.323 14.099 22.891  1.00 23.88 ? 23  DT  E "C5'" 1 
ATOM   898  C "C4'" . DT  C 2 14  ? 13.026 13.046 21.852  1.00 22.02 ? 23  DT  E "C4'" 1 
ATOM   899  O "O4'" . DT  C 2 14  ? 12.792 11.780 22.505  1.00 23.03 ? 23  DT  E "O4'" 1 
ATOM   900  C "C3'" . DT  C 2 14  ? 11.779 13.299 21.007  1.00 20.77 ? 23  DT  E "C3'" 1 
ATOM   901  O "O3'" . DT  C 2 14  ? 12.021 12.748 19.703  1.00 19.16 ? 23  DT  E "O3'" 1 
ATOM   902  C "C2'" . DT  C 2 14  ? 10.690 12.609 21.811  1.00 18.53 ? 23  DT  E "C2'" 1 
ATOM   903  C "C1'" . DT  C 2 14  ? 11.432 11.400 22.358  1.00 22.24 ? 23  DT  E "C1'" 1 
ATOM   904  N N1    . DT  C 2 14  ? 10.971 10.793 23.628  1.00 23.25 ? 23  DT  E N1    1 
ATOM   905  C C2    . DT  C 2 14  ? 10.847 9.431  23.662  1.00 26.56 ? 23  DT  E C2    1 
ATOM   906  O O2    . DT  C 2 14  ? 11.113 8.715  22.716  1.00 30.00 ? 23  DT  E O2    1 
ATOM   907  N N3    . DT  C 2 14  ? 10.398 8.926  24.850  1.00 28.81 ? 23  DT  E N3    1 
ATOM   908  C C4    . DT  C 2 14  ? 10.069 9.627  25.982  1.00 26.77 ? 23  DT  E C4    1 
ATOM   909  O O4    . DT  C 2 14  ? 9.674  9.033  26.975  1.00 25.99 ? 23  DT  E O4    1 
ATOM   910  C C5    . DT  C 2 14  ? 10.227 11.045 25.886  1.00 27.71 ? 23  DT  E C5    1 
ATOM   911  C C7    . DT  C 2 14  ? 9.890  11.887 27.079  1.00 30.84 ? 23  DT  E C7    1 
ATOM   912  C C6    . DT  C 2 14  ? 10.670 11.556 24.726  1.00 26.23 ? 23  DT  E C6    1 
ATOM   913  P P     . DT  C 2 15  ? 10.813 12.501 18.673  1.00 17.75 ? 24  DT  E P     1 
ATOM   914  O OP1   . DT  C 2 15  ? 11.413 12.642 17.332  1.00 18.50 ? 24  DT  E OP1   1 
ATOM   915  O OP2   . DT  C 2 15  ? 9.641  13.305 19.032  1.00 14.68 ? 24  DT  E OP2   1 
ATOM   916  O "O5'" . DT  C 2 15  ? 10.512 10.947 18.833  1.00 20.14 ? 24  DT  E "O5'" 1 
ATOM   917  C "C5'" . DT  C 2 15  ? 11.610 10.034 18.813  1.00 25.22 ? 24  DT  E "C5'" 1 
ATOM   918  C "C4'" . DT  C 2 15  ? 11.174 8.607  18.558  1.00 28.14 ? 24  DT  E "C4'" 1 
ATOM   919  O "O4'" . DT  C 2 15  ? 10.590 8.010  19.746  1.00 27.23 ? 24  DT  E "O4'" 1 
ATOM   920  C "C3'" . DT  C 2 15  ? 10.120 8.432  17.471  1.00 28.98 ? 24  DT  E "C3'" 1 
ATOM   921  O "O3'" . DT  C 2 15  ? 10.339 7.151  16.869  1.00 32.70 ? 24  DT  E "O3'" 1 
ATOM   922  C "C2'" . DT  C 2 15  ? 8.818  8.509  18.259  1.00 30.62 ? 24  DT  E "C2'" 1 
ATOM   923  C "C1'" . DT  C 2 15  ? 9.201  7.787  19.550  1.00 29.32 ? 24  DT  E "C1'" 1 
ATOM   924  N N1    . DT  C 2 15  ? 8.503  8.096  20.819  1.00 27.01 ? 24  DT  E N1    1 
ATOM   925  C C2    . DT  C 2 15  ? 8.217  7.032  21.651  1.00 28.04 ? 24  DT  E C2    1 
ATOM   926  O O2    . DT  C 2 15  ? 8.412  5.875  21.343  1.00 28.47 ? 24  DT  E O2    1 
ATOM   927  N N3    . DT  C 2 15  ? 7.694  7.378  22.865  1.00 29.47 ? 24  DT  E N3    1 
ATOM   928  C C4    . DT  C 2 15  ? 7.425  8.654  23.314  1.00 28.01 ? 24  DT  E C4    1 
ATOM   929  O O4    . DT  C 2 15  ? 7.009  8.827  24.449  1.00 36.41 ? 24  DT  E O4    1 
ATOM   930  C C5    . DT  C 2 15  ? 7.686  9.706  22.381  1.00 22.57 ? 24  DT  E C5    1 
ATOM   931  C C7    . DT  C 2 15  ? 7.387  11.107 22.792  1.00 17.52 ? 24  DT  E C7    1 
ATOM   932  C C6    . DT  C 2 15  ? 8.198  9.383  21.186  1.00 24.51 ? 24  DT  E C6    1 
ATOM   933  P P     . DC  C 2 16  ? 9.444  6.673  15.626  1.00 38.12 ? 25  DC  E P     1 
ATOM   934  O OP1   . DC  C 2 16  ? 10.350 5.928  14.722  1.00 38.43 ? 25  DC  E OP1   1 
ATOM   935  O OP2   . DC  C 2 16  ? 8.640  7.808  15.102  1.00 38.93 ? 25  DC  E OP2   1 
ATOM   936  O "O5'" . DC  C 2 16  ? 8.479  5.599  16.289  1.00 38.89 ? 25  DC  E "O5'" 1 
ATOM   937  C "C5'" . DC  C 2 16  ? 9.048  4.532  17.047  1.00 41.34 ? 25  DC  E "C5'" 1 
ATOM   938  C "C4'" . DC  C 2 16  ? 8.005  3.506  17.415  1.00 38.36 ? 25  DC  E "C4'" 1 
ATOM   939  O "O4'" . DC  C 2 16  ? 7.238  3.996  18.541  1.00 34.42 ? 25  DC  E "O4'" 1 
ATOM   940  C "C3'" . DC  C 2 16  ? 6.999  3.300  16.283  1.00 38.89 ? 25  DC  E "C3'" 1 
ATOM   941  O "O3'" . DC  C 2 16  ? 6.513  1.950  16.282  1.00 40.29 ? 25  DC  E "O3'" 1 
ATOM   942  C "C2'" . DC  C 2 16  ? 5.929  4.332  16.596  1.00 38.04 ? 25  DC  E "C2'" 1 
ATOM   943  C "C1'" . DC  C 2 16  ? 5.915  4.306  18.115  1.00 37.00 ? 25  DC  E "C1'" 1 
ATOM   944  N N1    . DC  C 2 16  ? 5.465  5.526  18.810  1.00 35.70 ? 25  DC  E N1    1 
ATOM   945  C C2    . DC  C 2 16  ? 4.849  5.373  20.032  1.00 30.81 ? 25  DC  E C2    1 
ATOM   946  O O2    . DC  C 2 16  ? 4.700  4.230  20.467  1.00 31.33 ? 25  DC  E O2    1 
ATOM   947  N N3    . DC  C 2 16  ? 4.430  6.459  20.708  1.00 27.71 ? 25  DC  E N3    1 
ATOM   948  C C4    . DC  C 2 16  ? 4.602  7.671  20.191  1.00 28.80 ? 25  DC  E C4    1 
ATOM   949  N N4    . DC  C 2 16  ? 4.175  8.713  20.898  1.00 31.06 ? 25  DC  E N4    1 
ATOM   950  C C5    . DC  C 2 16  ? 5.219  7.867  18.930  1.00 30.91 ? 25  DC  E C5    1 
ATOM   951  C C6    . DC  C 2 16  ? 5.639  6.774  18.276  1.00 36.32 ? 25  DC  E C6    1 
ATOM   952  P P     . DG  C 2 17  ? 5.219  1.556  15.407  1.00 40.62 ? 26  DG  E P     1 
ATOM   953  O OP1   . DG  C 2 17  ? 5.600  0.508  14.429  1.00 41.69 ? 26  DG  E OP1   1 
ATOM   954  O OP2   . DG  C 2 17  ? 4.598  2.812  14.917  1.00 38.44 ? 26  DG  E OP2   1 
ATOM   955  O "O5'" . DG  C 2 17  ? 4.306  0.827  16.490  1.00 36.77 ? 26  DG  E "O5'" 1 
ATOM   956  C "C5'" . DG  C 2 17  ? 4.921  -0.028 17.451  1.00 31.24 ? 26  DG  E "C5'" 1 
ATOM   957  C "C4'" . DG  C 2 17  ? 3.906  -0.578 18.425  1.00 29.97 ? 26  DG  E "C4'" 1 
ATOM   958  O "O4'" . DG  C 2 17  ? 3.387  0.496  19.235  1.00 26.93 ? 26  DG  E "O4'" 1 
ATOM   959  C "C3'" . DG  C 2 17  ? 2.684  -1.200 17.745  1.00 29.58 ? 26  DG  E "C3'" 1 
ATOM   960  O "O3'" . DG  C 2 17  ? 2.029  -2.119 18.667  1.00 24.85 ? 26  DG  E "O3'" 1 
ATOM   961  C "C2'" . DG  C 2 17  ? 1.765  -0.005 17.575  1.00 28.31 ? 26  DG  E "C2'" 1 
ATOM   962  C "C1'" . DG  C 2 17  ? 2.027  0.738  18.875  1.00 29.19 ? 26  DG  E "C1'" 1 
ATOM   963  N N9    . DG  C 2 17  ? 1.794  2.177  18.899  1.00 28.28 ? 26  DG  E N9    1 
ATOM   964  C C8    . DG  C 2 17  ? 1.835  3.056  17.843  1.00 26.60 ? 26  DG  E C8    1 
ATOM   965  N N7    . DG  C 2 17  ? 1.640  4.295  18.207  1.00 26.75 ? 26  DG  E N7    1 
ATOM   966  C C5    . DG  C 2 17  ? 1.449  4.227  19.585  1.00 26.04 ? 26  DG  E C5    1 
ATOM   967  C C6    . DG  C 2 17  ? 1.213  5.256  20.540  1.00 26.41 ? 26  DG  E C6    1 
ATOM   968  O O6    . DG  C 2 17  ? 1.139  6.473  20.360  1.00 28.42 ? 26  DG  E O6    1 
ATOM   969  N N1    . DG  C 2 17  ? 1.071  4.743  21.823  1.00 27.48 ? 26  DG  E N1    1 
ATOM   970  C C2    . DG  C 2 17  ? 1.156  3.418  22.161  1.00 28.02 ? 26  DG  E C2    1 
ATOM   971  N N2    . DG  C 2 17  ? 0.998  3.140  23.471  1.00 29.19 ? 26  DG  E N2    1 
ATOM   972  N N3    . DG  C 2 17  ? 1.382  2.449  21.287  1.00 25.55 ? 26  DG  E N3    1 
ATOM   973  C C4    . DG  C 2 17  ? 1.520  2.926  20.024  1.00 26.76 ? 26  DG  E C4    1 
ATOM   974  O "O5'" . DG  D 1 1   ? -5.152 8.443  23.156  1.00 43.62 ? 27  DG  F "O5'" 1 
ATOM   975  C "C5'" . DG  D 1 1   ? -5.202 9.734  23.770  1.00 46.65 ? 27  DG  F "C5'" 1 
ATOM   976  C "C4'" . DG  D 1 1   ? -3.886 10.092 24.421  1.00 47.07 ? 27  DG  F "C4'" 1 
ATOM   977  O "O4'" . DG  D 1 1   ? -2.834 9.952  23.440  1.00 45.50 ? 27  DG  F "O4'" 1 
ATOM   978  C "C3'" . DG  D 1 1   ? -3.809 11.547 24.889  1.00 47.72 ? 27  DG  F "C3'" 1 
ATOM   979  O "O3'" . DG  D 1 1   ? -2.841 11.679 25.941  1.00 49.88 ? 27  DG  F "O3'" 1 
ATOM   980  C "C2'" . DG  D 1 1   ? -3.309 12.262 23.650  1.00 47.18 ? 27  DG  F "C2'" 1 
ATOM   981  C "C1'" . DG  D 1 1   ? -2.360 11.234 23.056  1.00 43.04 ? 27  DG  F "C1'" 1 
ATOM   982  N N9    . DG  D 1 1   ? -2.287 11.246 21.607  1.00 39.06 ? 27  DG  F N9    1 
ATOM   983  C C8    . DG  D 1 1   ? -2.392 12.326 20.776  1.00 39.24 ? 27  DG  F C8    1 
ATOM   984  N N7    . DG  D 1 1   ? -2.219 12.020 19.520  1.00 41.56 ? 27  DG  F N7    1 
ATOM   985  C C5    . DG  D 1 1   ? -2.001 10.652 19.529  1.00 38.05 ? 27  DG  F C5    1 
ATOM   986  C C6    . DG  D 1 1   ? -1.747 9.762  18.466  1.00 37.75 ? 27  DG  F C6    1 
ATOM   987  O O6    . DG  D 1 1   ? -1.652 10.011 17.256  1.00 33.29 ? 27  DG  F O6    1 
ATOM   988  N N1    . DG  D 1 1   ? -1.597 8.460  18.924  1.00 37.56 ? 27  DG  F N1    1 
ATOM   989  C C2    . DG  D 1 1   ? -1.681 8.069  20.238  1.00 35.44 ? 27  DG  F C2    1 
ATOM   990  N N2    . DG  D 1 1   ? -1.510 6.770  20.483  1.00 34.71 ? 27  DG  F N2    1 
ATOM   991  N N3    . DG  D 1 1   ? -1.915 8.893  21.235  1.00 35.78 ? 27  DG  F N3    1 
ATOM   992  C C4    . DG  D 1 1   ? -2.061 10.160 20.811  1.00 37.73 ? 27  DG  F C4    1 
ATOM   993  P P     . DC  D 1 2   ? -3.335 11.830 27.460  1.00 51.23 ? 26  DC  F P     1 
ATOM   994  O OP1   . DC  D 1 2   ? -4.755 12.267 27.388  1.00 50.96 ? 26  DC  F OP1   1 
ATOM   995  O OP2   . DC  D 1 2   ? -2.347 12.638 28.238  1.00 49.14 ? 26  DC  F OP2   1 
ATOM   996  O "O5'" . DC  D 1 2   ? -3.340 10.334 28.002  1.00 49.11 ? 26  DC  F "O5'" 1 
ATOM   997  C "C5'" . DC  D 1 2   ? -2.223 9.797  28.686  1.00 45.83 ? 26  DC  F "C5'" 1 
ATOM   998  C "C4'" . DC  D 1 2   ? -2.402 8.310  28.862  1.00 44.27 ? 26  DC  F "C4'" 1 
ATOM   999  O "O4'" . DC  D 1 2   ? -2.380 7.679  27.559  1.00 41.57 ? 26  DC  F "O4'" 1 
ATOM   1000 C "C3'" . DC  D 1 2   ? -1.251 7.683  29.629  1.00 47.43 ? 26  DC  F "C3'" 1 
ATOM   1001 O "O3'" . DC  D 1 2   ? -1.716 6.532  30.343  1.00 50.07 ? 26  DC  F "O3'" 1 
ATOM   1002 C "C2'" . DC  D 1 2   ? -0.264 7.348  28.527  1.00 47.07 ? 26  DC  F "C2'" 1 
ATOM   1003 C "C1'" . DC  D 1 2   ? -1.164 6.962  27.366  1.00 45.07 ? 26  DC  F "C1'" 1 
ATOM   1004 N N1    . DC  D 1 2   ? -0.610 7.350  26.052  1.00 47.89 ? 26  DC  F N1    1 
ATOM   1005 C C2    . DC  D 1 2   ? 0.085  6.394  25.275  1.00 48.39 ? 26  DC  F C2    1 
ATOM   1006 O O2    . DC  D 1 2   ? 0.215  5.229  25.700  1.00 51.14 ? 26  DC  F O2    1 
ATOM   1007 N N3    . DC  D 1 2   ? 0.596  6.767  24.080  1.00 47.24 ? 26  DC  F N3    1 
ATOM   1008 C C4    . DC  D 1 2   ? 0.444  8.019  23.650  1.00 46.84 ? 26  DC  F C4    1 
ATOM   1009 N N4    . DC  D 1 2   ? 0.970  8.337  22.470  1.00 47.36 ? 26  DC  F N4    1 
ATOM   1010 C C5    . DC  D 1 2   ? -0.252 9.001  24.409  1.00 46.74 ? 26  DC  F C5    1 
ATOM   1011 C C6    . DC  D 1 2   ? -0.758 8.629  25.592  1.00 47.91 ? 26  DC  F C6    1 
ATOM   1012 P P     . DG  D 1 3   ? -1.114 6.191  31.797  1.00 51.56 ? 25  DG  F P     1 
ATOM   1013 O OP1   . DG  D 1 3   ? -2.167 5.415  32.497  1.00 53.13 ? 25  DG  F OP1   1 
ATOM   1014 O OP2   . DG  D 1 3   ? -0.591 7.438  32.413  1.00 50.41 ? 25  DG  F OP2   1 
ATOM   1015 O "O5'" . DG  D 1 3   ? 0.108  5.209  31.482  1.00 51.83 ? 25  DG  F "O5'" 1 
ATOM   1016 C "C5'" . DG  D 1 3   ? 0.841  5.353  30.267  1.00 48.80 ? 25  DG  F "C5'" 1 
ATOM   1017 C "C4'" . DG  D 1 3   ? 1.489  4.054  29.844  1.00 47.97 ? 25  DG  F "C4'" 1 
ATOM   1018 O "O4'" . DG  D 1 3   ? 1.769  4.138  28.428  1.00 48.07 ? 25  DG  F "O4'" 1 
ATOM   1019 C "C3'" . DG  D 1 3   ? 2.835  3.758  30.500  1.00 46.78 ? 25  DG  F "C3'" 1 
ATOM   1020 O "O3'" . DG  D 1 3   ? 3.084  2.353  30.435  1.00 45.91 ? 25  DG  F "O3'" 1 
ATOM   1021 C "C2'" . DG  D 1 3   ? 3.806  4.488  29.590  1.00 45.15 ? 25  DG  F "C2'" 1 
ATOM   1022 C "C1'" . DG  D 1 3   ? 3.169  4.333  28.213  1.00 42.98 ? 25  DG  F "C1'" 1 
ATOM   1023 N N9    . DG  D 1 3   ? 3.311  5.514  27.362  1.00 36.48 ? 25  DG  F N9    1 
ATOM   1024 C C8    . DG  D 1 3   ? 3.268  6.833  27.749  1.00 34.51 ? 25  DG  F C8    1 
ATOM   1025 N N7    . DG  D 1 3   ? 3.404  7.661  26.752  1.00 32.34 ? 25  DG  F N7    1 
ATOM   1026 C C5    . DG  D 1 3   ? 3.554  6.839  25.646  1.00 30.52 ? 25  DG  F C5    1 
ATOM   1027 C C6    . DG  D 1 3   ? 3.748  7.164  24.280  1.00 30.94 ? 25  DG  F C6    1 
ATOM   1028 O O6    . DG  D 1 3   ? 3.839  8.287  23.757  1.00 28.97 ? 25  DG  F O6    1 
ATOM   1029 N N1    . DG  D 1 3   ? 3.842  6.018  23.495  1.00 28.96 ? 25  DG  F N1    1 
ATOM   1030 C C2    . DG  D 1 3   ? 3.761  4.730  23.970  1.00 28.50 ? 25  DG  F C2    1 
ATOM   1031 N N2    . DG  D 1 3   ? 3.864  3.752  23.073  1.00 25.43 ? 25  DG  F N2    1 
ATOM   1032 N N3    . DG  D 1 3   ? 3.590  4.422  25.238  1.00 29.46 ? 25  DG  F N3    1 
ATOM   1033 C C4    . DG  D 1 3   ? 3.496  5.513  26.012  1.00 30.84 ? 25  DG  F C4    1 
ATOM   1034 P P     . DA  D 1 4   ? 3.846  1.617  31.636  1.00 48.13 ? 24  DA  F P     1 
ATOM   1035 O OP1   . DA  D 1 4   ? 2.889  1.463  32.769  1.00 47.32 ? 24  DA  F OP1   1 
ATOM   1036 O OP2   . DA  D 1 4   ? 5.159  2.283  31.868  1.00 45.69 ? 24  DA  F OP2   1 
ATOM   1037 O "O5'" . DA  D 1 4   ? 4.129  0.179  31.025  1.00 43.94 ? 24  DA  F "O5'" 1 
ATOM   1038 C "C5'" . DA  D 1 4   ? 5.457  -0.237 30.769  1.00 45.95 ? 24  DA  F "C5'" 1 
ATOM   1039 C "C4'" . DA  D 1 4   ? 5.617  -0.623 29.318  1.00 44.72 ? 24  DA  F "C4'" 1 
ATOM   1040 O "O4'" . DA  D 1 4   ? 5.433  0.555  28.486  1.00 42.79 ? 24  DA  F "O4'" 1 
ATOM   1041 C "C3'" . DA  D 1 4   ? 7.051  -1.068 29.063  1.00 45.04 ? 24  DA  F "C3'" 1 
ATOM   1042 O "O3'" . DA  D 1 4   ? 7.115  -2.062 28.040  1.00 46.75 ? 24  DA  F "O3'" 1 
ATOM   1043 C "C2'" . DA  D 1 4   ? 7.759  0.223  28.688  1.00 44.97 ? 24  DA  F "C2'" 1 
ATOM   1044 C "C1'" . DA  D 1 4   ? 6.681  0.956  27.915  1.00 43.82 ? 24  DA  F "C1'" 1 
ATOM   1045 N N9    . DA  D 1 4   ? 6.760  2.426  27.913  1.00 44.57 ? 24  DA  F N9    1 
ATOM   1046 C C8    . DA  D 1 4   ? 6.796  3.293  28.982  1.00 42.17 ? 24  DA  F C8    1 
ATOM   1047 N N7    . DA  D 1 4   ? 6.809  4.561  28.635  1.00 40.24 ? 24  DA  F N7    1 
ATOM   1048 C C5    . DA  D 1 4   ? 6.793  4.531  27.243  1.00 40.84 ? 24  DA  F C5    1 
ATOM   1049 C C6    . DA  D 1 4   ? 6.786  5.556  26.263  1.00 40.10 ? 24  DA  F C6    1 
ATOM   1050 N N6    . DA  D 1 4   ? 6.770  6.857  26.550  1.00 39.75 ? 24  DA  F N6    1 
ATOM   1051 N N1    . DA  D 1 4   ? 6.790  5.190  24.963  1.00 39.63 ? 24  DA  F N1    1 
ATOM   1052 C C2    . DA  D 1 4   ? 6.785  3.882  24.669  1.00 42.28 ? 24  DA  F C2    1 
ATOM   1053 N N3    . DA  D 1 4   ? 6.776  2.828  25.492  1.00 43.97 ? 24  DA  F N3    1 
ATOM   1054 C C4    . DA  D 1 4   ? 6.782  3.225  26.783  1.00 43.59 ? 24  DA  F C4    1 
ATOM   1055 P P     . DA  D 1 5   ? 8.521  -2.773 27.722  1.00 47.69 ? 23  DA  F P     1 
ATOM   1056 O OP1   . DA  D 1 5   ? 8.408  -4.240 27.925  1.00 47.61 ? 23  DA  F OP1   1 
ATOM   1057 O OP2   . DA  D 1 5   ? 9.541  -2.008 28.490  1.00 48.39 ? 23  DA  F OP2   1 
ATOM   1058 O "O5'" . DA  D 1 5   ? 8.699  -2.490 26.167  1.00 45.86 ? 23  DA  F "O5'" 1 
ATOM   1059 C "C5'" . DA  D 1 5   ? 8.350  -1.210 25.648  1.00 44.84 ? 23  DA  F "C5'" 1 
ATOM   1060 C "C4'" . DA  D 1 5   ? 9.063  -0.939 24.343  1.00 43.07 ? 23  DA  F "C4'" 1 
ATOM   1061 O "O4'" . DA  D 1 5   ? 9.111  0.497  24.180  1.00 43.29 ? 23  DA  F "O4'" 1 
ATOM   1062 C "C3'" . DA  D 1 5   ? 10.518 -1.390 24.285  1.00 39.77 ? 23  DA  F "C3'" 1 
ATOM   1063 O "O3'" . DA  D 1 5   ? 10.864 -1.610 22.920  1.00 34.70 ? 23  DA  F "O3'" 1 
ATOM   1064 C "C2'" . DA  D 1 5   ? 11.261 -0.211 24.879  1.00 40.82 ? 23  DA  F "C2'" 1 
ATOM   1065 C "C1'" . DA  D 1 5   ? 10.430 0.981  24.421  1.00 41.55 ? 23  DA  F "C1'" 1 
ATOM   1066 N N9    . DA  D 1 5   ? 10.328 2.053  25.417  1.00 40.08 ? 23  DA  F N9    1 
ATOM   1067 C C8    . DA  D 1 5   ? 10.370 1.949  26.784  1.00 37.61 ? 23  DA  F C8    1 
ATOM   1068 N N7    . DA  D 1 5   ? 10.221 3.093  27.405  1.00 36.90 ? 23  DA  F N7    1 
ATOM   1069 C C5    . DA  D 1 5   ? 10.075 4.014  26.379  1.00 36.20 ? 23  DA  F C5    1 
ATOM   1070 C C6    . DA  D 1 5   ? 9.881  5.409  26.374  1.00 36.23 ? 23  DA  F C6    1 
ATOM   1071 N N6    . DA  D 1 5   ? 9.804  6.159  27.479  1.00 30.11 ? 23  DA  F N6    1 
ATOM   1072 N N1    . DA  D 1 5   ? 9.774  6.021  25.172  1.00 38.68 ? 23  DA  F N1    1 
ATOM   1073 C C2    . DA  D 1 5   ? 9.864  5.278  24.062  1.00 39.21 ? 23  DA  F C2    1 
ATOM   1074 N N3    . DA  D 1 5   ? 10.051 3.969  23.940  1.00 38.49 ? 23  DA  F N3    1 
ATOM   1075 C C4    . DA  D 1 5   ? 10.146 3.389  25.149  1.00 38.28 ? 23  DA  F C4    1 
ATOM   1076 P P     . DA  D 1 6   ? 12.396 -1.798 22.507  1.00 34.29 ? 22  DA  F P     1 
ATOM   1077 O OP1   . DA  D 1 6   ? 12.439 -2.752 21.370  1.00 32.83 ? 22  DA  F OP1   1 
ATOM   1078 O OP2   . DA  D 1 6   ? 13.178 -2.072 23.732  1.00 35.17 ? 22  DA  F OP2   1 
ATOM   1079 O "O5'" . DA  D 1 6   ? 12.811 -0.364 21.946  1.00 37.48 ? 22  DA  F "O5'" 1 
ATOM   1080 C "C5'" . DA  D 1 6   ? 12.137 0.182  20.813  1.00 36.86 ? 22  DA  F "C5'" 1 
ATOM   1081 C "C4'" . DA  D 1 6   ? 12.742 1.499  20.376  1.00 34.32 ? 22  DA  F "C4'" 1 
ATOM   1082 O "O4'" . DA  D 1 6   ? 12.489 2.528  21.370  1.00 36.50 ? 22  DA  F "O4'" 1 
ATOM   1083 C "C3'" . DA  D 1 6   ? 14.263 1.466  20.223  1.00 32.30 ? 22  DA  F "C3'" 1 
ATOM   1084 O "O3'" . DA  D 1 6   ? 14.645 2.401  19.206  1.00 30.58 ? 22  DA  F "O3'" 1 
ATOM   1085 C "C2'" . DA  D 1 6   ? 14.753 1.881  21.603  1.00 33.00 ? 22  DA  F "C2'" 1 
ATOM   1086 C "C1'" . DA  D 1 6   ? 13.710 2.917  21.993  1.00 34.72 ? 22  DA  F "C1'" 1 
ATOM   1087 N N9    . DA  D 1 6   ? 13.467 3.172  23.419  1.00 33.10 ? 22  DA  F N9    1 
ATOM   1088 C C8    . DA  D 1 6   ? 13.326 2.278  24.444  1.00 33.33 ? 22  DA  F C8    1 
ATOM   1089 N N7    . DA  D 1 6   ? 13.133 2.840  25.613  1.00 32.80 ? 22  DA  F N7    1 
ATOM   1090 C C5    . DA  D 1 6   ? 13.149 4.201  25.342  1.00 31.58 ? 22  DA  F C5    1 
ATOM   1091 C C6    . DA  D 1 6   ? 13.012 5.351  26.169  1.00 31.18 ? 22  DA  F C6    1 
ATOM   1092 N N6    . DA  D 1 6   ? 12.833 5.310  27.492  1.00 28.15 ? 22  DA  F N6    1 
ATOM   1093 N N1    . DA  D 1 6   ? 13.072 6.564  25.575  1.00 32.55 ? 22  DA  F N1    1 
ATOM   1094 C C2    . DA  D 1 6   ? 13.268 6.615  24.249  1.00 33.87 ? 22  DA  F C2    1 
ATOM   1095 N N3    . DA  D 1 6   ? 13.424 5.615  23.375  1.00 34.21 ? 22  DA  F N3    1 
ATOM   1096 C C4    . DA  D 1 6   ? 13.349 4.420  23.992  1.00 32.99 ? 22  DA  F C4    1 
ATOM   1097 P P     . DA  D 1 7   ? 16.143 2.401  18.630  1.00 28.21 ? 21  DA  F P     1 
ATOM   1098 O OP1   . DA  D 1 7   ? 16.146 1.838  17.260  1.00 29.60 ? 21  DA  F OP1   1 
ATOM   1099 O OP2   . DA  D 1 7   ? 17.009 1.799  19.672  1.00 31.23 ? 21  DA  F OP2   1 
ATOM   1100 O "O5'" . DA  D 1 7   ? 16.468 3.959  18.512  1.00 31.14 ? 21  DA  F "O5'" 1 
ATOM   1101 C "C5'" . DA  D 1 7   ? 16.061 4.817  19.561  1.00 29.05 ? 21  DA  F "C5'" 1 
ATOM   1102 C "C4'" . DA  D 1 7   ? 16.437 6.258  19.310  1.00 26.20 ? 21  DA  F "C4'" 1 
ATOM   1103 O "O4'" . DA  D 1 7   ? 15.998 6.970  20.476  1.00 26.98 ? 21  DA  F "O4'" 1 
ATOM   1104 C "C3'" . DA  D 1 7   ? 17.905 6.628  19.164  1.00 27.39 ? 21  DA  F "C3'" 1 
ATOM   1105 O "O3'" . DA  D 1 7   ? 17.930 7.904  18.498  1.00 27.35 ? 21  DA  F "O3'" 1 
ATOM   1106 C "C2'" . DA  D 1 7   ? 18.345 6.754  20.608  1.00 25.72 ? 21  DA  F "C2'" 1 
ATOM   1107 C "C1'" . DA  D 1 7   ? 17.106 7.298  21.296  1.00 27.26 ? 21  DA  F "C1'" 1 
ATOM   1108 N N9    . DA  D 1 7   ? 16.846 6.681  22.591  1.00 29.31 ? 21  DA  F N9    1 
ATOM   1109 C C8    . DA  D 1 7   ? 16.588 5.359  22.834  1.00 32.43 ? 21  DA  F C8    1 
ATOM   1110 N N7    . DA  D 1 7   ? 16.331 5.093  24.089  1.00 33.35 ? 21  DA  F N7    1 
ATOM   1111 C C5    . DA  D 1 7   ? 16.442 6.324  24.715  1.00 30.52 ? 21  DA  F C5    1 
ATOM   1112 C C6    . DA  D 1 7   ? 16.292 6.713  26.042  1.00 32.70 ? 21  DA  F C6    1 
ATOM   1113 N N6    . DA  D 1 7   ? 15.979 5.869  27.028  1.00 33.90 ? 21  DA  F N6    1 
ATOM   1114 N N1    . DA  D 1 7   ? 16.476 8.017  26.336  1.00 34.47 ? 21  DA  F N1    1 
ATOM   1115 C C2    . DA  D 1 7   ? 16.788 8.860  25.350  1.00 32.00 ? 21  DA  F C2    1 
ATOM   1116 N N3    . DA  D 1 7   ? 16.958 8.612  24.062  1.00 30.36 ? 21  DA  F N3    1 
ATOM   1117 C C4    . DA  D 1 7   ? 16.768 7.308  23.807  1.00 30.57 ? 21  DA  F C4    1 
ATOM   1118 P P     . DA  D 1 8   ? 19.229 8.860  18.573  1.00 31.67 ? 20  DA  F P     1 
ATOM   1119 O OP1   . DA  D 1 8   ? 19.092 9.826  17.440  1.00 25.75 ? 20  DA  F OP1   1 
ATOM   1120 O OP2   . DA  D 1 8   ? 20.463 8.028  18.675  1.00 30.87 ? 20  DA  F OP2   1 
ATOM   1121 O "O5'" . DA  D 1 8   ? 19.054 9.678  19.935  1.00 24.78 ? 20  DA  F "O5'" 1 
ATOM   1122 C "C5'" . DA  D 1 8   ? 17.981 10.588 20.078  1.00 25.26 ? 20  DA  F "C5'" 1 
ATOM   1123 C "C4'" . DA  D 1 8   ? 18.266 11.652 21.118  1.00 26.38 ? 20  DA  F "C4'" 1 
ATOM   1124 O "O4'" . DA  D 1 8   ? 18.318 11.086 22.447  1.00 29.14 ? 20  DA  F "O4'" 1 
ATOM   1125 C "C3'" . DA  D 1 8   ? 19.600 12.373 20.973  1.00 28.24 ? 20  DA  F "C3'" 1 
ATOM   1126 O "O3'" . DA  D 1 8   ? 19.443 13.692 21.487  1.00 27.20 ? 20  DA  F "O3'" 1 
ATOM   1127 C "C2'" . DA  D 1 8   ? 20.539 11.541 21.832  1.00 27.78 ? 20  DA  F "C2'" 1 
ATOM   1128 C "C1'" . DA  D 1 8   ? 19.633 11.161 22.978  1.00 29.17 ? 20  DA  F "C1'" 1 
ATOM   1129 N N9    . DA  D 1 8   ? 19.916 9.913  23.692  1.00 33.86 ? 20  DA  F N9    1 
ATOM   1130 C C8    . DA  D 1 8   ? 20.311 8.706  23.177  1.00 34.61 ? 20  DA  F C8    1 
ATOM   1131 N N7    . DA  D 1 8   ? 20.475 7.775  24.081  1.00 35.49 ? 20  DA  F N7    1 
ATOM   1132 C C5    . DA  D 1 8   ? 20.170 8.408  25.276  1.00 35.94 ? 20  DA  F C5    1 
ATOM   1133 C C6    . DA  D 1 8   ? 20.161 7.958  26.608  1.00 36.81 ? 20  DA  F C6    1 
ATOM   1134 N N6    . DA  D 1 8   ? 20.465 6.716  26.968  1.00 39.53 ? 20  DA  F N6    1 
ATOM   1135 N N1    . DA  D 1 8   ? 19.823 8.837  27.568  1.00 36.52 ? 20  DA  F N1    1 
ATOM   1136 C C2    . DA  D 1 8   ? 19.512 10.086 27.205  1.00 38.19 ? 20  DA  F C2    1 
ATOM   1137 N N3    . DA  D 1 8   ? 19.480 10.631 25.989  1.00 37.26 ? 20  DA  F N3    1 
ATOM   1138 C C4    . DA  D 1 8   ? 19.827 9.725  25.055  1.00 35.19 ? 20  DA  F C4    1 
ATOM   1139 P P     . DT  D 1 9   ? 20.716 14.646 21.642  1.00 26.34 ? 19  DT  F P     1 
ATOM   1140 O OP1   . DT  D 1 9   ? 20.459 15.803 20.774  1.00 28.42 ? 19  DT  F OP1   1 
ATOM   1141 O OP2   . DT  D 1 9   ? 21.971 13.865 21.496  1.00 25.89 ? 19  DT  F OP2   1 
ATOM   1142 O "O5'" . DT  D 1 9   ? 20.656 15.056 23.166  1.00 23.13 ? 19  DT  F "O5'" 1 
ATOM   1143 C "C5'" . DT  D 1 9   ? 20.745 14.025 24.119  1.00 20.53 ? 19  DT  F "C5'" 1 
ATOM   1144 C "C4'" . DT  D 1 9   ? 20.905 14.580 25.504  1.00 17.93 ? 19  DT  F "C4'" 1 
ATOM   1145 O "O4'" . DT  D 1 9   ? 21.034 13.418 26.347  1.00 19.07 ? 19  DT  F "O4'" 1 
ATOM   1146 C "C3'" . DT  D 1 9   ? 22.194 15.369 25.686  1.00 19.71 ? 19  DT  F "C3'" 1 
ATOM   1147 O "O3'" . DT  D 1 9   ? 22.038 16.375 26.700  1.00 22.61 ? 19  DT  F "O3'" 1 
ATOM   1148 C "C2'" . DT  D 1 9   ? 23.196 14.291 26.045  1.00 22.18 ? 19  DT  F "C2'" 1 
ATOM   1149 C "C1'" . DT  D 1 9   ? 22.352 13.302 26.829  1.00 22.63 ? 19  DT  F "C1'" 1 
ATOM   1150 N N1    . DT  D 1 9   ? 22.746 11.888 26.727  1.00 24.65 ? 19  DT  F N1    1 
ATOM   1151 C C2    . DT  D 1 9   ? 22.859 11.191 27.904  1.00 28.05 ? 19  DT  F C2    1 
ATOM   1152 O O2    . DT  D 1 9   ? 22.631 11.691 28.989  1.00 30.23 ? 19  DT  F O2    1 
ATOM   1153 N N3    . DT  D 1 9   ? 23.246 9.878  27.767  1.00 29.99 ? 19  DT  F N3    1 
ATOM   1154 C C4    . DT  D 1 9   ? 23.514 9.207  26.590  1.00 31.97 ? 19  DT  F C4    1 
ATOM   1155 O O4    . DT  D 1 9   ? 23.853 8.030  26.620  1.00 34.48 ? 19  DT  F O4    1 
ATOM   1156 C C5    . DT  D 1 9   ? 23.364 9.993  25.383  1.00 32.20 ? 19  DT  F C5    1 
ATOM   1157 C C7    . DT  D 1 9   ? 23.621 9.337  24.061  1.00 30.18 ? 19  DT  F C7    1 
ATOM   1158 C C6    . DT  D 1 9   ? 22.996 11.285 25.510  1.00 28.50 ? 19  DT  F C6    1 
ATOM   1159 P P     . DG  D 1 10  ? 23.285 17.327 27.096  1.00 24.72 ? 18  DG  F P     1 
ATOM   1160 O OP1   . DG  D 1 10  ? 22.759 18.614 27.578  1.00 14.75 ? 18  DG  F OP1   1 
ATOM   1161 O OP2   . DG  D 1 10  ? 24.300 17.306 25.996  1.00 21.63 ? 18  DG  F OP2   1 
ATOM   1162 O "O5'" . DG  D 1 10  ? 23.866 16.599 28.381  1.00 26.17 ? 18  DG  F "O5'" 1 
ATOM   1163 C "C5'" . DG  D 1 10  ? 23.040 16.444 29.528  1.00 30.79 ? 18  DG  F "C5'" 1 
ATOM   1164 C "C4'" . DG  D 1 10  ? 23.883 16.190 30.748  1.00 30.47 ? 18  DG  F "C4'" 1 
ATOM   1165 O "O4'" . DG  D 1 10  ? 24.344 14.818 30.697  1.00 28.53 ? 18  DG  F "O4'" 1 
ATOM   1166 C "C3'" . DG  D 1 10  ? 25.141 17.047 30.733  1.00 32.33 ? 18  DG  F "C3'" 1 
ATOM   1167 O "O3'" . DG  D 1 10  ? 25.537 17.389 32.063  1.00 39.10 ? 18  DG  F "O3'" 1 
ATOM   1168 C "C2'" . DG  D 1 10  ? 26.134 16.168 29.992  1.00 31.45 ? 18  DG  F "C2'" 1 
ATOM   1169 C "C1'" . DG  D 1 10  ? 25.734 14.766 30.425  1.00 30.41 ? 18  DG  F "C1'" 1 
ATOM   1170 N N9    . DG  D 1 10  ? 25.970 13.714 29.437  1.00 33.37 ? 18  DG  F N9    1 
ATOM   1171 C C8    . DG  D 1 10  ? 26.208 13.891 28.094  1.00 33.25 ? 18  DG  F C8    1 
ATOM   1172 N N7    . DG  D 1 10  ? 26.441 12.772 27.457  1.00 34.14 ? 18  DG  F N7    1 
ATOM   1173 C C5    . DG  D 1 10  ? 26.340 11.790 28.433  1.00 35.21 ? 18  DG  F C5    1 
ATOM   1174 C C6    . DG  D 1 10  ? 26.504 10.378 28.337  1.00 36.70 ? 18  DG  F C6    1 
ATOM   1175 O O6    . DG  D 1 10  ? 26.795 9.692  27.340  1.00 38.76 ? 18  DG  F O6    1 
ATOM   1176 N N1    . DG  D 1 10  ? 26.304 9.759  29.562  1.00 35.88 ? 18  DG  F N1    1 
ATOM   1177 C C2    . DG  D 1 10  ? 25.993 10.403 30.730  1.00 35.87 ? 18  DG  F C2    1 
ATOM   1178 N N2    . DG  D 1 10  ? 25.828 9.609  31.797  1.00 36.42 ? 18  DG  F N2    1 
ATOM   1179 N N3    . DG  D 1 10  ? 25.850 11.720 30.842  1.00 34.68 ? 18  DG  F N3    1 
ATOM   1180 C C4    . DG  D 1 10  ? 26.035 12.348 29.662  1.00 34.47 ? 18  DG  F C4    1 
ATOM   1181 P P     . DC  D 1 11  ? 26.821 18.333 32.302  1.00 43.31 ? 17  DC  F P     1 
ATOM   1182 O OP1   . DC  D 1 11  ? 26.425 19.485 33.158  1.00 44.49 ? 17  DC  F OP1   1 
ATOM   1183 O OP2   . DC  D 1 11  ? 27.465 18.597 30.987  1.00 43.10 ? 17  DC  F OP2   1 
ATOM   1184 O "O5'" . DC  D 1 11  ? 27.781 17.392 33.150  1.00 37.56 ? 17  DC  F "O5'" 1 
ATOM   1185 C "C5'" . DC  D 1 11  ? 27.806 15.998 32.906  1.00 30.71 ? 17  DC  F "C5'" 1 
ATOM   1186 C "C4'" . DC  D 1 11  ? 28.778 15.331 33.842  1.00 31.38 ? 17  DC  F "C4'" 1 
ATOM   1187 O "O4'" . DC  D 1 11  ? 28.946 13.976 33.359  1.00 31.22 ? 17  DC  F "O4'" 1 
ATOM   1188 C "C3'" . DC  D 1 11  ? 30.166 15.959 33.799  1.00 34.29 ? 17  DC  F "C3'" 1 
ATOM   1189 O "O3'" . DC  D 1 11  ? 30.832 15.893 35.077  1.00 38.34 ? 17  DC  F "O3'" 1 
ATOM   1190 C "C2'" . DC  D 1 11  ? 30.845 15.200 32.671  1.00 33.28 ? 17  DC  F "C2'" 1 
ATOM   1191 C "C1'" . DC  D 1 11  ? 30.211 13.809 32.731  1.00 32.33 ? 17  DC  F "C1'" 1 
ATOM   1192 N N1    . DC  D 1 11  ? 29.969 13.192 31.403  1.00 31.04 ? 17  DC  F N1    1 
ATOM   1193 C C2    . DC  D 1 11  ? 29.998 11.797 31.282  1.00 33.68 ? 17  DC  F C2    1 
ATOM   1194 O O2    . DC  D 1 11  ? 30.235 11.100 32.282  1.00 37.96 ? 17  DC  F O2    1 
ATOM   1195 N N3    . DC  D 1 11  ? 29.772 11.234 30.075  1.00 32.81 ? 17  DC  F N3    1 
ATOM   1196 C C4    . DC  D 1 11  ? 29.534 11.994 29.017  1.00 28.99 ? 17  DC  F C4    1 
ATOM   1197 N N4    . DC  D 1 11  ? 29.333 11.374 27.856  1.00 30.12 ? 17  DC  F N4    1 
ATOM   1198 C C5    . DC  D 1 11  ? 29.497 13.413 29.102  1.00 27.73 ? 17  DC  F C5    1 
ATOM   1199 C C6    . DC  D 1 11  ? 29.718 13.966 30.304  1.00 30.36 ? 17  DC  F C6    1 
ATOM   1200 P P     . DG  D 1 12  ? 31.459 17.240 35.741  1.00 41.82 ? 16  DG  F P     1 
ATOM   1201 O OP1   . DG  D 1 12  ? 30.930 17.353 37.120  1.00 40.29 ? 16  DG  F OP1   1 
ATOM   1202 O OP2   . DG  D 1 12  ? 31.371 18.413 34.825  1.00 35.11 ? 16  DG  F OP2   1 
ATOM   1203 O "O5'" . DG  D 1 12  ? 33.000 16.887 35.892  1.00 42.62 ? 16  DG  F "O5'" 1 
ATOM   1204 C "C5'" . DG  D 1 12  ? 33.916 17.213 34.869  1.00 40.67 ? 16  DG  F "C5'" 1 
ATOM   1205 C "C4'" . DG  D 1 12  ? 35.009 16.177 34.826  1.00 42.33 ? 16  DG  F "C4'" 1 
ATOM   1206 O "O4'" . DG  D 1 12  ? 34.649 15.101 33.914  1.00 41.08 ? 16  DG  F "O4'" 1 
ATOM   1207 C "C3'" . DG  D 1 12  ? 36.268 16.795 34.233  1.00 43.99 ? 16  DG  F "C3'" 1 
ATOM   1208 O "O3'" . DG  D 1 12  ? 37.402 16.111 34.751  1.00 42.74 ? 16  DG  F "O3'" 1 
ATOM   1209 C "C2'" . DG  D 1 12  ? 36.111 16.538 32.748  1.00 43.96 ? 16  DG  F "C2'" 1 
ATOM   1210 C "C1'" . DG  D 1 12  ? 35.472 15.163 32.744  1.00 41.53 ? 16  DG  F "C1'" 1 
ATOM   1211 N N9    . DG  D 1 12  ? 34.645 14.889 31.575  1.00 40.96 ? 16  DG  F N9    1 
ATOM   1212 C C8    . DG  D 1 12  ? 33.557 15.610 31.155  1.00 41.90 ? 16  DG  F C8    1 
ATOM   1213 N N7    . DG  D 1 12  ? 32.972 15.095 30.107  1.00 42.13 ? 16  DG  F N7    1 
ATOM   1214 C C5    . DG  D 1 12  ? 33.729 13.972 29.806  1.00 41.59 ? 16  DG  F C5    1 
ATOM   1215 C C6    . DG  D 1 12  ? 33.568 13.008 28.777  1.00 40.86 ? 16  DG  F C6    1 
ATOM   1216 O O6    . DG  D 1 12  ? 32.688 12.947 27.917  1.00 32.02 ? 16  DG  F O6    1 
ATOM   1217 N N1    . DG  D 1 12  ? 34.566 12.038 28.822  1.00 42.63 ? 16  DG  F N1    1 
ATOM   1218 C C2    . DG  D 1 12  ? 35.585 11.989 29.742  1.00 42.66 ? 16  DG  F C2    1 
ATOM   1219 N N2    . DG  D 1 12  ? 36.441 10.953 29.618  1.00 39.28 ? 16  DG  F N2    1 
ATOM   1220 N N3    . DG  D 1 12  ? 35.746 12.885 30.713  1.00 43.44 ? 16  DG  F N3    1 
ATOM   1221 C C4    . DG  D 1 12  ? 34.782 13.840 30.687  1.00 42.36 ? 16  DG  F C4    1 
ATOM   1222 P P     . DA  D 1 13  ? 37.965 16.487 36.199  1.00 40.88 ? 15  DA  F P     1 
ATOM   1223 O OP1   . DA  D 1 13  ? 36.955 16.050 37.194  1.00 38.56 ? 15  DA  F OP1   1 
ATOM   1224 O OP2   . DA  D 1 13  ? 38.432 17.896 36.181  1.00 36.89 ? 15  DA  F OP2   1 
ATOM   1225 O "O5'" . DA  D 1 13  ? 39.184 15.480 36.336  1.00 45.23 ? 15  DA  F "O5'" 1 
ATOM   1226 C "C5'" . DA  D 1 13  ? 38.926 14.105 36.615  1.00 48.73 ? 15  DA  F "C5'" 1 
ATOM   1227 C "C4'" . DA  D 1 13  ? 39.818 13.205 35.791  1.00 49.59 ? 15  DA  F "C4'" 1 
ATOM   1228 O "O4'" . DA  D 1 13  ? 39.417 13.228 34.400  1.00 49.56 ? 15  DA  F "O4'" 1 
ATOM   1229 C "C3'" . DA  D 1 13  ? 41.271 13.677 35.784  1.00 50.46 ? 15  DA  F "C3'" 1 
ATOM   1230 O "O3'" . DA  D 1 13  ? 42.122 12.535 35.608  1.00 50.99 ? 15  DA  F "O3'" 1 
ATOM   1231 C "C2'" . DA  D 1 13  ? 41.316 14.612 34.587  1.00 47.82 ? 15  DA  F "C2'" 1 
ATOM   1232 C "C1'" . DA  D 1 13  ? 40.419 13.866 33.622  1.00 47.72 ? 15  DA  F "C1'" 1 
ATOM   1233 N N9    . DA  D 1 13  ? 39.777 14.600 32.533  1.00 47.03 ? 15  DA  F N9    1 
ATOM   1234 C C8    . DA  D 1 13  ? 39.366 15.906 32.478  1.00 47.83 ? 15  DA  F C8    1 
ATOM   1235 N N7    . DA  D 1 13  ? 38.815 16.238 31.331  1.00 47.21 ? 15  DA  F N7    1 
ATOM   1236 C C5    . DA  D 1 13  ? 38.867 15.070 30.582  1.00 44.33 ? 15  DA  F C5    1 
ATOM   1237 C C6    . DA  D 1 13  ? 38.448 14.758 29.275  1.00 42.53 ? 15  DA  F C6    1 
ATOM   1238 N N6    . DA  D 1 13  ? 37.870 15.622 28.454  1.00 40.68 ? 15  DA  F N6    1 
ATOM   1239 N N1    . DA  D 1 13  ? 38.653 13.504 28.835  1.00 45.33 ? 15  DA  F N1    1 
ATOM   1240 C C2    . DA  D 1 13  ? 39.240 12.624 29.655  1.00 47.33 ? 15  DA  F C2    1 
ATOM   1241 N N3    . DA  D 1 13  ? 39.679 12.794 30.900  1.00 47.52 ? 15  DA  F N3    1 
ATOM   1242 C C4    . DA  D 1 13  ? 39.460 14.056 31.309  1.00 46.13 ? 15  DA  F C4    1 
ATOM   1243 P P     . DT  D 1 14  ? 43.695 12.666 35.864  1.00 51.46 ? 14  DT  F P     1 
ATOM   1244 O OP1   . DT  D 1 14  ? 44.112 11.531 36.720  1.00 51.42 ? 14  DT  F OP1   1 
ATOM   1245 O OP2   . DT  D 1 14  ? 43.964 14.063 36.305  1.00 50.83 ? 14  DT  F OP2   1 
ATOM   1246 O "O5'" . DT  D 1 14  ? 44.302 12.466 34.408  1.00 52.76 ? 14  DT  F "O5'" 1 
ATOM   1247 C "C5'" . DT  D 1 14  ? 43.659 13.071 33.297  1.00 55.11 ? 14  DT  F "C5'" 1 
ATOM   1248 C "C4'" . DT  D 1 14  ? 43.604 12.112 32.136  1.00 56.04 ? 14  DT  F "C4'" 1 
ATOM   1249 O "O4'" . DT  D 1 14  ? 42.612 12.596 31.202  1.00 55.93 ? 14  DT  F "O4'" 1 
ATOM   1250 C "C3'" . DT  D 1 14  ? 44.917 12.084 31.362  1.00 57.22 ? 14  DT  F "C3'" 1 
ATOM   1251 O "O3'" . DT  D 1 14  ? 45.081 10.819 30.712  1.00 59.30 ? 14  DT  F "O3'" 1 
ATOM   1252 C "C2'" . DT  D 1 14  ? 44.731 13.209 30.362  1.00 56.12 ? 14  DT  F "C2'" 1 
ATOM   1253 C "C1'" . DT  D 1 14  ? 43.250 13.100 30.042  1.00 54.60 ? 14  DT  F "C1'" 1 
ATOM   1254 N N1    . DT  D 1 14  ? 42.596 14.357 29.669  1.00 55.14 ? 14  DT  F N1    1 
ATOM   1255 C C2    . DT  D 1 14  ? 42.177 14.456 28.370  1.00 54.71 ? 14  DT  F C2    1 
ATOM   1256 O O2    . DT  D 1 14  ? 42.320 13.553 27.563  1.00 57.05 ? 14  DT  F O2    1 
ATOM   1257 N N3    . DT  D 1 14  ? 41.587 15.652 28.045  1.00 56.41 ? 14  DT  F N3    1 
ATOM   1258 C C4    . DT  D 1 14  ? 41.379 16.737 28.880  1.00 59.72 ? 14  DT  F C4    1 
ATOM   1259 O O4    . DT  D 1 14  ? 40.834 17.758 28.441  1.00 57.16 ? 14  DT  F O4    1 
ATOM   1260 C C5    . DT  D 1 14  ? 41.841 16.558 30.241  1.00 60.95 ? 14  DT  F C5    1 
ATOM   1261 C C7    . DT  D 1 14  ? 41.657 17.677 31.216  1.00 64.39 ? 14  DT  F C7    1 
ATOM   1262 C C6    . DT  D 1 14  ? 42.416 15.389 30.565  1.00 57.58 ? 14  DT  F C6    1 
ATOM   1263 N N     . PRO E 3 2   ? 32.564 21.603 -33.428 1.00 31.38 ? 9   PRO A N     1 
ATOM   1264 C CA    . PRO E 3 2   ? 31.278 21.315 -34.118 1.00 32.11 ? 9   PRO A CA    1 
ATOM   1265 C C     . PRO E 3 2   ? 30.107 22.127 -33.532 1.00 33.10 ? 9   PRO A C     1 
ATOM   1266 O O     . PRO E 3 2   ? 29.872 23.275 -33.927 1.00 32.03 ? 9   PRO A O     1 
ATOM   1267 C CB    . PRO E 3 2   ? 31.046 19.821 -33.967 1.00 31.63 ? 9   PRO A CB    1 
ATOM   1268 C CG    . PRO E 3 2   ? 31.827 19.522 -32.689 1.00 31.12 ? 9   PRO A CG    1 
ATOM   1269 C CD    . PRO E 3 2   ? 33.082 20.376 -32.802 1.00 30.38 ? 9   PRO A CD    1 
ATOM   1270 N N     . THR E 3 3   ? 29.370 21.523 -32.602 1.00 34.39 ? 10  THR A N     1 
ATOM   1271 C CA    . THR E 3 3   ? 28.257 22.207 -31.946 1.00 36.03 ? 10  THR A CA    1 
ATOM   1272 C C     . THR E 3 3   ? 28.855 23.287 -31.023 1.00 37.04 ? 10  THR A C     1 
ATOM   1273 O O     . THR E 3 3   ? 28.146 23.935 -30.248 1.00 37.58 ? 10  THR A O     1 
ATOM   1274 C CB    . THR E 3 3   ? 27.362 21.185 -31.140 1.00 36.35 ? 10  THR A CB    1 
ATOM   1275 O OG1   . THR E 3 3   ? 26.565 21.870 -30.166 1.00 35.59 ? 10  THR A OG1   1 
ATOM   1276 C CG2   . THR E 3 3   ? 28.213 20.146 -30.452 1.00 37.79 ? 10  THR A CG2   1 
ATOM   1277 N N     . LEU E 3 4   ? 30.169 23.482 -31.135 1.00 37.09 ? 11  LEU A N     1 
ATOM   1278 C CA    . LEU E 3 4   ? 30.880 24.471 -30.336 1.00 36.49 ? 11  LEU A CA    1 
ATOM   1279 C C     . LEU E 3 4   ? 31.538 25.582 -31.167 1.00 36.87 ? 11  LEU A C     1 
ATOM   1280 O O     . LEU E 3 4   ? 31.653 26.732 -30.704 1.00 37.22 ? 11  LEU A O     1 
ATOM   1281 C CB    . LEU E 3 4   ? 31.910 23.778 -29.435 1.00 36.33 ? 11  LEU A CB    1 
ATOM   1282 C CG    . LEU E 3 4   ? 32.672 22.573 -29.974 1.00 37.33 ? 11  LEU A CG    1 
ATOM   1283 C CD1   . LEU E 3 4   ? 33.662 23.028 -31.023 1.00 37.43 ? 11  LEU A CD1   1 
ATOM   1284 C CD2   . LEU E 3 4   ? 33.380 21.867 -28.817 1.00 37.13 ? 11  LEU A CD2   1 
ATOM   1285 N N     . GLU E 3 5   ? 31.982 25.264 -32.382 1.00 35.12 ? 12  GLU A N     1 
ATOM   1286 C CA    . GLU E 3 5   ? 32.560 26.314 -33.215 1.00 33.80 ? 12  GLU A CA    1 
ATOM   1287 C C     . GLU E 3 5   ? 31.428 27.347 -33.321 1.00 33.00 ? 12  GLU A C     1 
ATOM   1288 O O     . GLU E 3 5   ? 31.653 28.559 -33.407 1.00 31.15 ? 12  GLU A O     1 
ATOM   1289 C CB    . GLU E 3 5   ? 32.899 25.796 -34.608 1.00 32.92 ? 12  GLU A CB    1 
ATOM   1290 C CG    . GLU E 3 5   ? 33.271 24.347 -34.685 1.00 32.76 ? 12  GLU A CG    1 
ATOM   1291 C CD    . GLU E 3 5   ? 34.023 24.056 -35.953 1.00 33.38 ? 12  GLU A CD    1 
ATOM   1292 O OE1   . GLU E 3 5   ? 33.940 22.924 -36.465 1.00 32.64 ? 12  GLU A OE1   1 
ATOM   1293 O OE2   . GLU E 3 5   ? 34.715 24.976 -36.435 1.00 34.82 ? 12  GLU A OE2   1 
ATOM   1294 N N     . TRP E 3 6   ? 30.206 26.816 -33.333 1.00 32.32 ? 13  TRP A N     1 
ATOM   1295 C CA    . TRP E 3 6   ? 29.001 27.614 -33.381 1.00 31.92 ? 13  TRP A CA    1 
ATOM   1296 C C     . TRP E 3 6   ? 28.992 28.326 -32.048 1.00 32.40 ? 13  TRP A C     1 
ATOM   1297 O O     . TRP E 3 6   ? 28.820 29.542 -31.988 1.00 33.91 ? 13  TRP A O     1 
ATOM   1298 C CB    . TRP E 3 6   ? 27.764 26.719 -33.476 1.00 32.18 ? 13  TRP A CB    1 
ATOM   1299 C CG    . TRP E 3 6   ? 26.480 27.443 -33.196 1.00 29.89 ? 13  TRP A CG    1 
ATOM   1300 C CD1   . TRP E 3 6   ? 25.865 28.365 -33.992 1.00 28.78 ? 13  TRP A CD1   1 
ATOM   1301 C CD2   . TRP E 3 6   ? 25.697 27.352 -32.006 1.00 30.04 ? 13  TRP A CD2   1 
ATOM   1302 N NE1   . TRP E 3 6   ? 24.747 28.860 -33.366 1.00 29.09 ? 13  TRP A NE1   1 
ATOM   1303 C CE2   . TRP E 3 6   ? 24.619 28.257 -32.145 1.00 29.38 ? 13  TRP A CE2   1 
ATOM   1304 C CE3   . TRP E 3 6   ? 25.801 26.594 -30.831 1.00 29.39 ? 13  TRP A CE3   1 
ATOM   1305 C CZ2   . TRP E 3 6   ? 23.653 28.429 -31.152 1.00 29.30 ? 13  TRP A CZ2   1 
ATOM   1306 C CZ3   . TRP E 3 6   ? 24.836 26.762 -29.839 1.00 30.76 ? 13  TRP A CZ3   1 
ATOM   1307 C CH2   . TRP E 3 6   ? 23.775 27.677 -30.007 1.00 30.53 ? 13  TRP A CH2   1 
ATOM   1308 N N     . PHE E 3 7   ? 29.181 27.575 -30.967 1.00 31.04 ? 14  PHE A N     1 
ATOM   1309 C CA    . PHE E 3 7   ? 29.207 28.210 -29.661 1.00 29.65 ? 14  PHE A CA    1 
ATOM   1310 C C     . PHE E 3 7   ? 30.275 29.315 -29.549 1.00 30.58 ? 14  PHE A C     1 
ATOM   1311 O O     . PHE E 3 7   ? 30.046 30.332 -28.892 1.00 31.57 ? 14  PHE A O     1 
ATOM   1312 C CB    . PHE E 3 7   ? 29.432 27.193 -28.549 1.00 26.09 ? 14  PHE A CB    1 
ATOM   1313 C CG    . PHE E 3 7   ? 29.852 27.821 -27.254 1.00 24.30 ? 14  PHE A CG    1 
ATOM   1314 C CD1   . PHE E 3 7   ? 29.038 28.773 -26.633 1.00 22.14 ? 14  PHE A CD1   1 
ATOM   1315 C CD2   . PHE E 3 7   ? 31.091 27.515 -26.685 1.00 23.08 ? 14  PHE A CD2   1 
ATOM   1316 C CE1   . PHE E 3 7   ? 29.451 29.417 -25.467 1.00 22.54 ? 14  PHE A CE1   1 
ATOM   1317 C CE2   . PHE E 3 7   ? 31.514 28.152 -25.515 1.00 22.88 ? 14  PHE A CE2   1 
ATOM   1318 C CZ    . PHE E 3 7   ? 30.691 29.110 -24.902 1.00 22.52 ? 14  PHE A CZ    1 
ATOM   1319 N N     . LEU E 3 8   ? 31.441 29.135 -30.166 1.00 29.99 ? 15  LEU A N     1 
ATOM   1320 C CA    . LEU E 3 8   ? 32.452 30.176 -30.061 1.00 29.13 ? 15  LEU A CA    1 
ATOM   1321 C C     . LEU E 3 8   ? 32.133 31.318 -31.027 1.00 29.36 ? 15  LEU A C     1 
ATOM   1322 O O     . LEU E 3 8   ? 32.577 32.454 -30.828 1.00 30.10 ? 15  LEU A O     1 
ATOM   1323 C CB    . LEU E 3 8   ? 33.848 29.602 -30.327 1.00 28.84 ? 15  LEU A CB    1 
ATOM   1324 C CG    . LEU E 3 8   ? 34.829 29.915 -29.188 1.00 28.02 ? 15  LEU A CG    1 
ATOM   1325 C CD1   . LEU E 3 8   ? 34.477 29.074 -27.971 1.00 27.94 ? 15  LEU A CD1   1 
ATOM   1326 C CD2   . LEU E 3 8   ? 36.253 29.644 -29.616 1.00 27.90 ? 15  LEU A CD2   1 
ATOM   1327 N N     . SER E 3 9   ? 31.351 31.000 -32.062 1.00 28.51 ? 16  SER A N     1 
ATOM   1328 C CA    . SER E 3 9   ? 30.918 31.961 -33.084 1.00 26.98 ? 16  SER A CA    1 
ATOM   1329 C C     . SER E 3 9   ? 30.664 33.339 -32.493 1.00 27.33 ? 16  SER A C     1 
ATOM   1330 O O     . SER E 3 9   ? 31.172 34.337 -32.991 1.00 27.46 ? 16  SER A O     1 
ATOM   1331 C CB    . SER E 3 9   ? 29.639 31.470 -33.757 1.00 25.28 ? 16  SER A CB    1 
ATOM   1332 O OG    . SER E 3 9   ? 28.898 32.545 -34.293 1.00 23.53 ? 16  SER A OG    1 
ATOM   1333 N N     . HIS E 3 10  ? 29.852 33.383 -31.441 1.00 27.41 ? 17  HIS A N     1 
ATOM   1334 C CA    . HIS E 3 10  ? 29.538 34.620 -30.737 1.00 25.51 ? 17  HIS A CA    1 
ATOM   1335 C C     . HIS E 3 10  ? 30.213 34.466 -29.387 1.00 24.84 ? 17  HIS A C     1 
ATOM   1336 O O     . HIS E 3 10  ? 29.609 33.928 -28.447 1.00 24.26 ? 17  HIS A O     1 
ATOM   1337 C CB    . HIS E 3 10  ? 28.038 34.749 -30.534 1.00 25.83 ? 17  HIS A CB    1 
ATOM   1338 C CG    . HIS E 3 10  ? 27.234 33.830 -31.396 1.00 25.60 ? 17  HIS A CG    1 
ATOM   1339 N ND1   . HIS E 3 10  ? 27.297 32.459 -31.279 1.00 24.17 ? 17  HIS A ND1   1 
ATOM   1340 C CD2   . HIS E 3 10  ? 26.345 34.085 -32.383 1.00 24.64 ? 17  HIS A CD2   1 
ATOM   1341 C CE1   . HIS E 3 10  ? 26.478 31.910 -32.154 1.00 23.40 ? 17  HIS A CE1   1 
ATOM   1342 N NE2   . HIS E 3 10  ? 25.890 32.874 -32.836 1.00 23.74 ? 17  HIS A NE2   1 
ATOM   1343 N N     . CYS E 3 11  ? 31.458 34.930 -29.285 1.00 23.95 ? 18  CYS A N     1 
ATOM   1344 C CA    . CYS E 3 11  ? 32.182 34.775 -28.037 1.00 23.71 ? 18  CYS A CA    1 
ATOM   1345 C C     . CYS E 3 11  ? 33.510 35.514 -27.944 1.00 23.54 ? 18  CYS A C     1 
ATOM   1346 O O     . CYS E 3 11  ? 34.566 34.884 -27.997 1.00 24.13 ? 18  CYS A O     1 
ATOM   1347 C CB    . CYS E 3 11  ? 32.432 33.284 -27.809 1.00 23.55 ? 18  CYS A CB    1 
ATOM   1348 S SG    . CYS E 3 11  ? 32.220 32.739 -26.131 1.00 19.37 ? 18  CYS A SG    1 
ATOM   1349 N N     . HIS E 3 12  ? 33.460 36.835 -27.798 1.00 22.26 ? 19  HIS A N     1 
ATOM   1350 C CA    . HIS E 3 12  ? 34.665 37.643 -27.659 1.00 20.64 ? 19  HIS A CA    1 
ATOM   1351 C C     . HIS E 3 12  ? 35.668 36.801 -26.867 1.00 22.36 ? 19  HIS A C     1 
ATOM   1352 O O     . HIS E 3 12  ? 35.284 36.169 -25.883 1.00 23.39 ? 19  HIS A O     1 
ATOM   1353 C CB    . HIS E 3 12  ? 34.332 38.895 -26.881 1.00 18.26 ? 19  HIS A CB    1 
ATOM   1354 C CG    . HIS E 3 12  ? 33.139 39.635 -27.394 1.00 17.30 ? 19  HIS A CG    1 
ATOM   1355 N ND1   . HIS E 3 12  ? 33.171 40.395 -28.540 1.00 17.68 ? 19  HIS A ND1   1 
ATOM   1356 C CD2   . HIS E 3 12  ? 31.896 39.787 -26.879 1.00 17.50 ? 19  HIS A CD2   1 
ATOM   1357 C CE1   . HIS E 3 12  ? 32.004 40.992 -28.705 1.00 18.39 ? 19  HIS A CE1   1 
ATOM   1358 N NE2   . HIS E 3 12  ? 31.213 40.640 -27.709 1.00 17.39 ? 19  HIS A NE2   1 
ATOM   1359 N N     . ILE E 3 13  ? 36.938 36.781 -27.280 1.00 22.37 ? 20  ILE A N     1 
ATOM   1360 C CA    . ILE E 3 13  ? 37.934 35.951 -26.602 1.00 22.11 ? 20  ILE A CA    1 
ATOM   1361 C C     . ILE E 3 13  ? 39.166 36.739 -26.174 1.00 24.48 ? 20  ILE A C     1 
ATOM   1362 O O     . ILE E 3 13  ? 39.698 37.515 -26.960 1.00 26.87 ? 20  ILE A O     1 
ATOM   1363 C CB    . ILE E 3 13  ? 38.382 34.773 -27.507 1.00 19.90 ? 20  ILE A CB    1 
ATOM   1364 C CG1   . ILE E 3 13  ? 39.677 35.115 -28.237 1.00 21.07 ? 20  ILE A CG1   1 
ATOM   1365 C CG2   . ILE E 3 13  ? 37.323 34.450 -28.512 1.00 16.23 ? 20  ILE A CG2   1 
ATOM   1366 C CD1   . ILE E 3 13  ? 40.952 34.843 -27.413 1.00 20.27 ? 20  ILE A CD1   1 
ATOM   1367 N N     . HIS E 3 14  ? 39.645 36.510 -24.948 1.00 24.89 ? 21  HIS A N     1 
ATOM   1368 C CA    . HIS E 3 14  ? 40.801 37.238 -24.413 1.00 24.10 ? 21  HIS A CA    1 
ATOM   1369 C C     . HIS E 3 14  ? 41.990 36.370 -23.977 1.00 23.42 ? 21  HIS A C     1 
ATOM   1370 O O     . HIS E 3 14  ? 41.814 35.203 -23.618 1.00 24.06 ? 21  HIS A O     1 
ATOM   1371 C CB    . HIS E 3 14  ? 40.327 38.088 -23.231 1.00 25.56 ? 21  HIS A CB    1 
ATOM   1372 C CG    . HIS E 3 14  ? 39.364 39.166 -23.621 1.00 26.71 ? 21  HIS A CG    1 
ATOM   1373 N ND1   . HIS E 3 14  ? 39.729 40.492 -23.713 1.00 26.72 ? 21  HIS A ND1   1 
ATOM   1374 C CD2   . HIS E 3 14  ? 38.069 39.104 -24.016 1.00 27.25 ? 21  HIS A CD2   1 
ATOM   1375 C CE1   . HIS E 3 14  ? 38.704 41.200 -24.151 1.00 26.83 ? 21  HIS A CE1   1 
ATOM   1376 N NE2   . HIS E 3 14  ? 37.684 40.382 -24.344 1.00 27.09 ? 21  HIS A NE2   1 
ATOM   1377 N N     . LYS E 3 15  ? 43.196 36.944 -24.013 1.00 21.76 ? 22  LYS A N     1 
ATOM   1378 C CA    . LYS E 3 15  ? 44.422 36.240 -23.593 1.00 20.53 ? 22  LYS A CA    1 
ATOM   1379 C C     . LYS E 3 15  ? 44.859 36.749 -22.213 1.00 19.39 ? 22  LYS A C     1 
ATOM   1380 O O     . LYS E 3 15  ? 45.330 37.867 -22.108 1.00 21.20 ? 22  LYS A O     1 
ATOM   1381 C CB    . LYS E 3 15  ? 45.568 36.507 -24.573 1.00 21.01 ? 22  LYS A CB    1 
ATOM   1382 C CG    . LYS E 3 15  ? 45.210 36.359 -26.050 1.00 24.47 ? 22  LYS A CG    1 
ATOM   1383 C CD    . LYS E 3 15  ? 45.043 34.900 -26.485 1.00 25.63 ? 22  LYS A CD    1 
ATOM   1384 C CE    . LYS E 3 15  ? 44.535 34.789 -27.915 1.00 23.91 ? 22  LYS A CE    1 
ATOM   1385 N NZ    . LYS E 3 15  ? 45.356 35.610 -28.850 1.00 26.11 ? 22  LYS A NZ    1 
ATOM   1386 N N     . TYR E 3 16  ? 44.712 35.972 -21.151 1.00 15.55 ? 23  TYR A N     1 
ATOM   1387 C CA    . TYR E 3 16  ? 45.145 36.492 -19.869 1.00 13.76 ? 23  TYR A CA    1 
ATOM   1388 C C     . TYR E 3 16  ? 46.492 35.917 -19.481 1.00 12.56 ? 23  TYR A C     1 
ATOM   1389 O O     . TYR E 3 16  ? 46.769 34.741 -19.694 1.00 11.52 ? 23  TYR A O     1 
ATOM   1390 C CB    . TYR E 3 16  ? 44.169 36.165 -18.739 1.00 14.98 ? 23  TYR A CB    1 
ATOM   1391 C CG    . TYR E 3 16  ? 42.777 36.733 -18.854 1.00 16.66 ? 23  TYR A CG    1 
ATOM   1392 C CD1   . TYR E 3 16  ? 41.887 36.259 -19.815 1.00 18.26 ? 23  TYR A CD1   1 
ATOM   1393 C CD2   . TYR E 3 16  ? 42.314 37.679 -17.955 1.00 13.95 ? 23  TYR A CD2   1 
ATOM   1394 C CE1   . TYR E 3 16  ? 40.575 36.700 -19.866 1.00 15.46 ? 23  TYR A CE1   1 
ATOM   1395 C CE2   . TYR E 3 16  ? 41.007 38.126 -18.013 1.00 14.07 ? 23  TYR A CE2   1 
ATOM   1396 C CZ    . TYR E 3 16  ? 40.143 37.623 -18.969 1.00 14.02 ? 23  TYR A CZ    1 
ATOM   1397 O OH    . TYR E 3 16  ? 38.826 38.012 -19.009 1.00 14.59 ? 23  TYR A OH    1 
ATOM   1398 N N     . PRO E 3 17  ? 47.340 36.749 -18.876 1.00 10.54 ? 24  PRO A N     1 
ATOM   1399 C CA    . PRO E 3 17  ? 48.677 36.437 -18.408 1.00 10.40 ? 24  PRO A CA    1 
ATOM   1400 C C     . PRO E 3 17  ? 48.715 35.756 -17.063 1.00 10.34 ? 24  PRO A C     1 
ATOM   1401 O O     . PRO E 3 17  ? 47.959 36.083 -16.167 1.00 12.91 ? 24  PRO A O     1 
ATOM   1402 C CB    . PRO E 3 17  ? 49.315 37.802 -18.315 1.00 11.91 ? 24  PRO A CB    1 
ATOM   1403 C CG    . PRO E 3 17  ? 48.195 38.606 -17.812 1.00 11.05 ? 24  PRO A CG    1 
ATOM   1404 C CD    . PRO E 3 17  ? 47.101 38.190 -18.755 1.00 10.97 ? 24  PRO A CD    1 
ATOM   1405 N N     . SER E 3 18  ? 49.630 34.818 -16.940 1.00 9.82  ? 25  SER A N     1 
ATOM   1406 C CA    . SER E 3 18  ? 49.887 34.074 -15.731 1.00 9.83  ? 25  SER A CA    1 
ATOM   1407 C C     . SER E 3 18  ? 49.670 34.940 -14.467 1.00 11.49 ? 25  SER A C     1 
ATOM   1408 O O     . SER E 3 18  ? 50.102 36.101 -14.408 1.00 13.55 ? 25  SER A O     1 
ATOM   1409 C CB    . SER E 3 18  ? 51.335 33.596 -15.811 1.00 7.94  ? 25  SER A CB    1 
ATOM   1410 O OG    . SER E 3 18  ? 51.522 32.381 -15.142 1.00 10.51 ? 25  SER A OG    1 
ATOM   1411 N N     . LYS E 3 19  ? 49.001 34.375 -13.465 1.00 11.66 ? 26  LYS A N     1 
ATOM   1412 C CA    . LYS E 3 19  ? 48.724 35.053 -12.192 1.00 11.55 ? 26  LYS A CA    1 
ATOM   1413 C C     . LYS E 3 19  ? 47.658 36.134 -12.183 1.00 10.58 ? 26  LYS A C     1 
ATOM   1414 O O     . LYS E 3 19  ? 47.418 36.733 -11.150 1.00 9.21  ? 26  LYS A O     1 
ATOM   1415 C CB    . LYS E 3 19  ? 50.006 35.640 -11.599 1.00 12.05 ? 26  LYS A CB    1 
ATOM   1416 C CG    . LYS E 3 19  ? 50.958 34.597 -11.076 1.00 15.35 ? 26  LYS A CG    1 
ATOM   1417 C CD    . LYS E 3 19  ? 52.089 35.209 -10.279 1.00 17.14 ? 26  LYS A CD    1 
ATOM   1418 C CE    . LYS E 3 19  ? 53.200 34.191 -10.072 1.00 20.42 ? 26  LYS A CE    1 
ATOM   1419 N NZ    . LYS E 3 19  ? 53.757 33.658 -11.355 1.00 18.25 ? 26  LYS A NZ    1 
ATOM   1420 N N     . SER E 3 20  ? 47.013 36.385 -13.313 1.00 11.15 ? 27  SER A N     1 
ATOM   1421 C CA    . SER E 3 20  ? 45.965 37.410 -13.354 1.00 12.86 ? 27  SER A CA    1 
ATOM   1422 C C     . SER E 3 20  ? 44.580 36.992 -12.792 1.00 13.04 ? 27  SER A C     1 
ATOM   1423 O O     . SER E 3 20  ? 44.085 35.878 -13.002 1.00 11.68 ? 27  SER A O     1 
ATOM   1424 C CB    . SER E 3 20  ? 45.804 37.937 -14.782 1.00 12.82 ? 27  SER A CB    1 
ATOM   1425 O OG    . SER E 3 20  ? 45.775 36.876 -15.724 1.00 13.67 ? 27  SER A OG    1 
ATOM   1426 N N     . THR E 3 21  ? 43.962 37.907 -12.065 1.00 12.62 ? 28  THR A N     1 
ATOM   1427 C CA    . THR E 3 21  ? 42.665 37.634 -11.502 1.00 11.92 ? 28  THR A CA    1 
ATOM   1428 C C     . THR E 3 21  ? 41.626 37.672 -12.605 1.00 11.49 ? 28  THR A C     1 
ATOM   1429 O O     . THR E 3 21  ? 41.335 38.737 -13.125 1.00 11.73 ? 28  THR A O     1 
ATOM   1430 C CB    . THR E 3 21  ? 42.280 38.702 -10.484 1.00 13.55 ? 28  THR A CB    1 
ATOM   1431 O OG1   . THR E 3 21  ? 43.313 38.829 -9.492  1.00 13.69 ? 28  THR A OG1   1 
ATOM   1432 C CG2   . THR E 3 21  ? 40.939 38.350 -9.835  1.00 12.88 ? 28  THR A CG2   1 
ATOM   1433 N N     . LEU E 3 22  ? 41.081 36.525 -12.986 1.00 11.63 ? 29  LEU A N     1 
ATOM   1434 C CA    . LEU E 3 22  ? 40.035 36.511 -14.001 1.00 12.34 ? 29  LEU A CA    1 
ATOM   1435 C C     . LEU E 3 22  ? 38.768 36.934 -13.305 1.00 13.85 ? 29  LEU A C     1 
ATOM   1436 O O     . LEU E 3 22  ? 37.998 37.705 -13.855 1.00 16.11 ? 29  LEU A O     1 
ATOM   1437 C CB    . LEU E 3 22  ? 39.798 35.118 -14.589 1.00 12.87 ? 29  LEU A CB    1 
ATOM   1438 C CG    . LEU E 3 22  ? 40.729 34.563 -15.670 1.00 15.30 ? 29  LEU A CG    1 
ATOM   1439 C CD1   . LEU E 3 22  ? 42.156 34.521 -15.164 1.00 16.78 ? 29  LEU A CD1   1 
ATOM   1440 C CD2   . LEU E 3 22  ? 40.277 33.182 -16.060 1.00 13.83 ? 29  LEU A CD2   1 
ATOM   1441 N N     . ILE E 3 23  ? 38.557 36.453 -12.076 1.00 14.94 ? 30  ILE A N     1 
ATOM   1442 C CA    . ILE E 3 23  ? 37.328 36.779 -11.346 1.00 13.61 ? 30  ILE A CA    1 
ATOM   1443 C C     . ILE E 3 23  ? 37.448 37.062 -9.860  1.00 14.40 ? 30  ILE A C     1 
ATOM   1444 O O     . ILE E 3 23  ? 38.148 36.361 -9.161  1.00 15.42 ? 30  ILE A O     1 
ATOM   1445 C CB    . ILE E 3 23  ? 36.321 35.655 -11.527 1.00 10.99 ? 30  ILE A CB    1 
ATOM   1446 C CG1   . ILE E 3 23  ? 36.116 35.407 -13.020 1.00 9.68  ? 30  ILE A CG1   1 
ATOM   1447 C CG2   . ILE E 3 23  ? 35.026 36.022 -10.880 1.00 8.94  ? 30  ILE A CG2   1 
ATOM   1448 C CD1   . ILE E 3 23  ? 35.590 34.047 -13.332 1.00 13.17 ? 30  ILE A CD1   1 
ATOM   1449 N N     . HIS E 3 24  ? 36.743 38.086 -9.387  1.00 15.26 ? 31  HIS A N     1 
ATOM   1450 C CA    . HIS E 3 24  ? 36.728 38.460 -7.970  1.00 16.83 ? 31  HIS A CA    1 
ATOM   1451 C C     . HIS E 3 24  ? 35.572 37.790 -7.204  1.00 17.36 ? 31  HIS A C     1 
ATOM   1452 O O     . HIS E 3 24  ? 34.418 37.864 -7.624  1.00 16.39 ? 31  HIS A O     1 
ATOM   1453 C CB    . HIS E 3 24  ? 36.495 39.959 -7.816  1.00 21.15 ? 31  HIS A CB    1 
ATOM   1454 C CG    . HIS E 3 24  ? 37.730 40.802 -7.828  1.00 24.33 ? 31  HIS A CG    1 
ATOM   1455 N ND1   . HIS E 3 24  ? 38.785 40.594 -6.968  1.00 26.06 ? 31  HIS A ND1   1 
ATOM   1456 C CD2   . HIS E 3 24  ? 38.028 41.926 -8.527  1.00 25.47 ? 31  HIS A CD2   1 
ATOM   1457 C CE1   . HIS E 3 24  ? 39.677 41.556 -7.133  1.00 27.24 ? 31  HIS A CE1   1 
ATOM   1458 N NE2   . HIS E 3 24  ? 39.240 42.377 -8.073  1.00 26.36 ? 31  HIS A NE2   1 
ATOM   1459 N N     . GLN E 3 25  ? 35.857 37.157 -6.074  1.00 18.83 ? 32  GLN A N     1 
ATOM   1460 C CA    . GLN E 3 25  ? 34.775 36.566 -5.281  1.00 20.24 ? 32  GLN A CA    1 
ATOM   1461 C C     . GLN E 3 25  ? 34.017 37.715 -4.663  1.00 19.45 ? 32  GLN A C     1 
ATOM   1462 O O     . GLN E 3 25  ? 34.562 38.454 -3.857  1.00 18.57 ? 32  GLN A O     1 
ATOM   1463 C CB    . GLN E 3 25  ? 35.282 35.694 -4.126  1.00 20.58 ? 32  GLN A CB    1 
ATOM   1464 C CG    . GLN E 3 25  ? 34.130 35.109 -3.338  1.00 23.21 ? 32  GLN A CG    1 
ATOM   1465 C CD    . GLN E 3 25  ? 34.471 34.721 -1.906  1.00 26.42 ? 32  GLN A CD    1 
ATOM   1466 O OE1   . GLN E 3 25  ? 35.327 33.859 -1.662  1.00 28.33 ? 32  GLN A OE1   1 
ATOM   1467 N NE2   . GLN E 3 25  ? 33.780 35.346 -0.943  1.00 26.58 ? 32  GLN A NE2   1 
ATOM   1468 N N     . GLY E 3 26  ? 32.758 37.864 -5.018  1.00 20.48 ? 33  GLY A N     1 
ATOM   1469 C CA    . GLY E 3 26  ? 32.003 38.956 -4.452  1.00 23.47 ? 33  GLY A CA    1 
ATOM   1470 C C     . GLY E 3 26  ? 31.346 39.741 -5.554  1.00 25.88 ? 33  GLY A C     1 
ATOM   1471 O O     . GLY E 3 26  ? 30.126 39.848 -5.591  1.00 27.49 ? 33  GLY A O     1 
ATOM   1472 N N     . GLU E 3 27  ? 32.164 40.280 -6.456  1.00 27.47 ? 34  GLU A N     1 
ATOM   1473 C CA    . GLU E 3 27  ? 31.701 41.062 -7.605  1.00 28.79 ? 34  GLU A CA    1 
ATOM   1474 C C     . GLU E 3 27  ? 30.404 40.533 -8.223  1.00 28.98 ? 34  GLU A C     1 
ATOM   1475 O O     . GLU E 3 27  ? 30.111 39.341 -8.172  1.00 29.36 ? 34  GLU A O     1 
ATOM   1476 C CB    . GLU E 3 27  ? 32.805 41.104 -8.674  1.00 30.33 ? 34  GLU A CB    1 
ATOM   1477 C CG    . GLU E 3 27  ? 32.317 41.334 -10.107 1.00 33.44 ? 34  GLU A CG    1 
ATOM   1478 C CD    . GLU E 3 27  ? 32.321 42.789 -10.527 1.00 34.52 ? 34  GLU A CD    1 
ATOM   1479 O OE1   . GLU E 3 27  ? 31.889 43.641 -9.719  1.00 34.57 ? 34  GLU A OE1   1 
ATOM   1480 O OE2   . GLU E 3 27  ? 32.743 43.066 -11.675 1.00 33.51 ? 34  GLU A OE2   1 
ATOM   1481 N N     . LYS E 3 28  ? 29.637 41.446 -8.805  1.00 29.36 ? 35  LYS A N     1 
ATOM   1482 C CA    . LYS E 3 28  ? 28.381 41.124 -9.454  1.00 29.03 ? 35  LYS A CA    1 
ATOM   1483 C C     . LYS E 3 28  ? 28.634 40.238 -10.683 1.00 28.46 ? 35  LYS A C     1 
ATOM   1484 O O     . LYS E 3 28  ? 29.476 40.561 -11.524 1.00 28.74 ? 35  LYS A O     1 
ATOM   1485 C CB    . LYS E 3 28  ? 27.699 42.429 -9.871  1.00 31.53 ? 35  LYS A CB    1 
ATOM   1486 C CG    . LYS E 3 28  ? 26.282 42.664 -9.295  1.00 33.23 ? 35  LYS A CG    1 
ATOM   1487 C CD    . LYS E 3 28  ? 26.251 42.789 -7.765  1.00 31.02 ? 35  LYS A CD    1 
ATOM   1488 C CE    . LYS E 3 28  ? 24.830 43.071 -7.270  1.00 31.48 ? 35  LYS A CE    1 
ATOM   1489 N NZ    . LYS E 3 28  ? 23.793 42.104 -7.760  1.00 28.71 ? 35  LYS A NZ    1 
ATOM   1490 N N     . ALA E 3 29  ? 27.906 39.126 -10.782 1.00 27.08 ? 36  ALA A N     1 
ATOM   1491 C CA    . ALA E 3 29  ? 28.061 38.202 -11.895 1.00 26.80 ? 36  ALA A CA    1 
ATOM   1492 C C     . ALA E 3 29  ? 27.025 38.376 -12.994 1.00 28.29 ? 36  ALA A C     1 
ATOM   1493 O O     . ALA E 3 29  ? 25.831 38.484 -12.724 1.00 29.13 ? 36  ALA A O     1 
ATOM   1494 C CB    . ALA E 3 29  ? 28.011 36.799 -11.394 1.00 25.43 ? 36  ALA A CB    1 
ATOM   1495 N N     . GLU E 3 30  ? 27.496 38.356 -14.241 1.00 30.41 ? 37  GLU A N     1 
ATOM   1496 C CA    . GLU E 3 30  ? 26.646 38.517 -15.418 1.00 30.08 ? 37  GLU A CA    1 
ATOM   1497 C C     . GLU E 3 30  ? 27.282 37.993 -16.717 1.00 30.01 ? 37  GLU A C     1 
ATOM   1498 O O     . GLU E 3 30  ? 26.698 38.151 -17.794 1.00 30.99 ? 37  GLU A O     1 
ATOM   1499 C CB    . GLU E 3 30  ? 26.296 39.996 -15.606 1.00 30.79 ? 37  GLU A CB    1 
ATOM   1500 C CG    . GLU E 3 30  ? 27.522 40.878 -15.688 1.00 34.08 ? 37  GLU A CG    1 
ATOM   1501 C CD    . GLU E 3 30  ? 27.208 42.285 -16.114 1.00 35.47 ? 37  GLU A CD    1 
ATOM   1502 O OE1   . GLU E 3 30  ? 26.469 42.418 -17.110 1.00 35.96 ? 37  GLU A OE1   1 
ATOM   1503 O OE2   . GLU E 3 30  ? 27.707 43.245 -15.467 1.00 36.32 ? 37  GLU A OE2   1 
ATOM   1504 N N     . THR E 3 31  ? 28.473 37.400 -16.645 1.00 27.67 ? 38  THR A N     1 
ATOM   1505 C CA    . THR E 3 31  ? 29.085 36.877 -17.867 1.00 26.46 ? 38  THR A CA    1 
ATOM   1506 C C     . THR E 3 31  ? 29.666 35.471 -17.769 1.00 24.58 ? 38  THR A C     1 
ATOM   1507 O O     . THR E 3 31  ? 30.299 35.101 -16.783 1.00 25.46 ? 38  THR A O     1 
ATOM   1508 C CB    . THR E 3 31  ? 30.201 37.788 -18.391 1.00 27.63 ? 38  THR A CB    1 
ATOM   1509 O OG1   . THR E 3 31  ? 30.868 37.119 -19.466 1.00 30.74 ? 38  THR A OG1   1 
ATOM   1510 C CG2   . THR E 3 31  ? 31.238 38.084 -17.301 1.00 30.02 ? 38  THR A CG2   1 
ATOM   1511 N N     . LEU E 3 32  ? 29.451 34.674 -18.796 1.00 22.25 ? 39  LEU A N     1 
ATOM   1512 C CA    . LEU E 3 32  ? 29.996 33.329 -18.782 1.00 20.75 ? 39  LEU A CA    1 
ATOM   1513 C C     . LEU E 3 32  ? 31.390 33.361 -19.410 1.00 21.58 ? 39  LEU A C     1 
ATOM   1514 O O     . LEU E 3 32  ? 31.760 34.342 -20.053 1.00 20.70 ? 39  LEU A O     1 
ATOM   1515 C CB    . LEU E 3 32  ? 29.111 32.404 -19.593 1.00 18.28 ? 39  LEU A CB    1 
ATOM   1516 C CG    . LEU E 3 32  ? 29.237 30.939 -19.256 1.00 17.29 ? 39  LEU A CG    1 
ATOM   1517 C CD1   . LEU E 3 32  ? 28.488 30.709 -17.971 1.00 18.65 ? 39  LEU A CD1   1 
ATOM   1518 C CD2   . LEU E 3 32  ? 28.651 30.085 -20.355 1.00 17.42 ? 39  LEU A CD2   1 
ATOM   1519 N N     . TYR E 3 33  ? 32.153 32.289 -19.208 1.00 22.10 ? 40  TYR A N     1 
ATOM   1520 C CA    . TYR E 3 33  ? 33.501 32.141 -19.761 1.00 23.23 ? 40  TYR A CA    1 
ATOM   1521 C C     . TYR E 3 33  ? 33.709 30.693 -20.196 1.00 24.25 ? 40  TYR A C     1 
ATOM   1522 O O     . TYR E 3 33  ? 33.031 29.785 -19.718 1.00 23.82 ? 40  TYR A O     1 
ATOM   1523 C CB    . TYR E 3 33  ? 34.597 32.454 -18.741 1.00 22.97 ? 40  TYR A CB    1 
ATOM   1524 C CG    . TYR E 3 33  ? 34.747 33.885 -18.321 1.00 20.97 ? 40  TYR A CG    1 
ATOM   1525 C CD1   . TYR E 3 33  ? 33.926 34.430 -17.335 1.00 20.90 ? 40  TYR A CD1   1 
ATOM   1526 C CD2   . TYR E 3 33  ? 35.743 34.685 -18.865 1.00 20.11 ? 40  TYR A CD2   1 
ATOM   1527 C CE1   . TYR E 3 33  ? 34.090 35.746 -16.895 1.00 20.41 ? 40  TYR A CE1   1 
ATOM   1528 C CE2   . TYR E 3 33  ? 35.919 36.003 -18.434 1.00 20.39 ? 40  TYR A CE2   1 
ATOM   1529 C CZ    . TYR E 3 33  ? 35.084 36.528 -17.451 1.00 19.33 ? 40  TYR A CZ    1 
ATOM   1530 O OH    . TYR E 3 33  ? 35.205 37.837 -17.056 1.00 18.32 ? 40  TYR A OH    1 
ATOM   1531 N N     . TYR E 3 34  ? 34.658 30.488 -21.100 1.00 24.68 ? 41  TYR A N     1 
ATOM   1532 C CA    . TYR E 3 34  ? 34.979 29.160 -21.593 1.00 25.97 ? 41  TYR A CA    1 
ATOM   1533 C C     . TYR E 3 34  ? 36.456 29.214 -21.913 1.00 25.90 ? 41  TYR A C     1 
ATOM   1534 O O     . TYR E 3 34  ? 36.876 30.043 -22.710 1.00 27.37 ? 41  TYR A O     1 
ATOM   1535 C CB    . TYR E 3 34  ? 34.159 28.848 -22.847 1.00 27.80 ? 41  TYR A CB    1 
ATOM   1536 C CG    . TYR E 3 34  ? 34.419 27.472 -23.431 1.00 29.79 ? 41  TYR A CG    1 
ATOM   1537 C CD1   . TYR E 3 34  ? 35.448 27.267 -24.345 1.00 30.06 ? 41  TYR A CD1   1 
ATOM   1538 C CD2   . TYR E 3 34  ? 33.653 26.375 -23.044 1.00 30.22 ? 41  TYR A CD2   1 
ATOM   1539 C CE1   . TYR E 3 34  ? 35.712 26.007 -24.858 1.00 31.72 ? 41  TYR A CE1   1 
ATOM   1540 C CE2   . TYR E 3 34  ? 33.906 25.108 -23.547 1.00 31.55 ? 41  TYR A CE2   1 
ATOM   1541 C CZ    . TYR E 3 34  ? 34.941 24.928 -24.454 1.00 32.92 ? 41  TYR A CZ    1 
ATOM   1542 O OH    . TYR E 3 34  ? 35.220 23.672 -24.946 1.00 32.50 ? 41  TYR A OH    1 
ATOM   1543 N N     . ILE E 3 35  ? 37.240 28.348 -21.281 1.00 23.55 ? 42  ILE A N     1 
ATOM   1544 C CA    . ILE E 3 35  ? 38.674 28.343 -21.473 1.00 22.66 ? 42  ILE A CA    1 
ATOM   1545 C C     . ILE E 3 35  ? 39.109 27.481 -22.631 1.00 23.41 ? 42  ILE A C     1 
ATOM   1546 O O     . ILE E 3 35  ? 39.043 26.262 -22.549 1.00 25.96 ? 42  ILE A O     1 
ATOM   1547 C CB    . ILE E 3 35  ? 39.380 27.829 -20.233 1.00 22.99 ? 42  ILE A CB    1 
ATOM   1548 C CG1   . ILE E 3 35  ? 38.792 28.511 -19.001 1.00 22.65 ? 42  ILE A CG1   1 
ATOM   1549 C CG2   . ILE E 3 35  ? 40.902 28.086 -20.347 1.00 20.83 ? 42  ILE A CG2   1 
ATOM   1550 C CD1   . ILE E 3 35  ? 39.667 28.396 -17.770 1.00 25.05 ? 42  ILE A CD1   1 
ATOM   1551 N N     . VAL E 3 36  ? 39.593 28.108 -23.695 1.00 22.67 ? 43  VAL A N     1 
ATOM   1552 C CA    . VAL E 3 36  ? 40.033 27.385 -24.872 1.00 21.32 ? 43  VAL A CA    1 
ATOM   1553 C C     . VAL E 3 36  ? 41.531 27.076 -24.867 1.00 21.62 ? 43  VAL A C     1 
ATOM   1554 O O     . VAL E 3 36  ? 42.057 26.530 -25.829 1.00 23.23 ? 43  VAL A O     1 
ATOM   1555 C CB    . VAL E 3 36  ? 39.707 28.174 -26.138 1.00 21.69 ? 43  VAL A CB    1 
ATOM   1556 C CG1   . VAL E 3 36  ? 38.397 28.955 -25.955 1.00 18.51 ? 43  VAL A CG1   1 
ATOM   1557 C CG2   . VAL E 3 36  ? 40.867 29.086 -26.486 1.00 20.67 ? 43  VAL A CG2   1 
ATOM   1558 N N     . LYS E 3 37  ? 42.215 27.420 -23.786 1.00 21.39 ? 44  LYS A N     1 
ATOM   1559 C CA    . LYS E 3 37  ? 43.648 27.161 -23.676 1.00 21.19 ? 44  LYS A CA    1 
ATOM   1560 C C     . LYS E 3 37  ? 44.228 27.574 -22.307 1.00 20.70 ? 44  LYS A C     1 
ATOM   1561 O O     . LYS E 3 37  ? 43.852 28.611 -21.741 1.00 20.25 ? 44  LYS A O     1 
ATOM   1562 C CB    . LYS E 3 37  ? 44.383 27.889 -24.805 1.00 21.00 ? 44  LYS A CB    1 
ATOM   1563 C CG    . LYS E 3 37  ? 45.860 28.088 -24.558 1.00 23.79 ? 44  LYS A CG    1 
ATOM   1564 C CD    . LYS E 3 37  ? 46.276 29.547 -24.806 1.00 27.34 ? 44  LYS A CD    1 
ATOM   1565 C CE    . LYS E 3 37  ? 46.047 29.981 -26.278 1.00 30.20 ? 44  LYS A CE    1 
ATOM   1566 N NZ    . LYS E 3 37  ? 46.401 31.417 -26.586 1.00 31.18 ? 44  LYS A NZ    1 
ATOM   1567 N N     . GLY E 3 38  ? 45.145 26.759 -21.785 1.00 19.46 ? 45  GLY A N     1 
ATOM   1568 C CA    . GLY E 3 38  ? 45.766 27.051 -20.502 1.00 20.03 ? 45  GLY A CA    1 
ATOM   1569 C C     . GLY E 3 38  ? 44.942 26.587 -19.322 1.00 20.08 ? 45  GLY A C     1 
ATOM   1570 O O     . GLY E 3 38  ? 44.040 25.773 -19.477 1.00 19.56 ? 45  GLY A O     1 
ATOM   1571 N N     . SER E 3 39  ? 45.234 27.101 -18.134 1.00 20.44 ? 46  SER A N     1 
ATOM   1572 C CA    . SER E 3 39  ? 44.474 26.688 -16.952 1.00 19.82 ? 46  SER A CA    1 
ATOM   1573 C C     . SER E 3 39  ? 44.538 27.627 -15.740 1.00 19.38 ? 46  SER A C     1 
ATOM   1574 O O     . SER E 3 39  ? 45.555 28.289 -15.475 1.00 19.39 ? 46  SER A O     1 
ATOM   1575 C CB    . SER E 3 39  ? 44.900 25.284 -16.542 1.00 19.22 ? 46  SER A CB    1 
ATOM   1576 O OG    . SER E 3 39  ? 46.305 25.206 -16.482 1.00 18.19 ? 46  SER A OG    1 
ATOM   1577 N N     . VAL E 3 40  ? 43.423 27.652 -15.014 1.00 17.60 ? 47  VAL A N     1 
ATOM   1578 C CA    . VAL E 3 40  ? 43.227 28.482 -13.826 1.00 15.80 ? 47  VAL A CA    1 
ATOM   1579 C C     . VAL E 3 40  ? 43.119 27.696 -12.518 1.00 14.62 ? 47  VAL A C     1 
ATOM   1580 O O     . VAL E 3 40  ? 43.417 26.521 -12.444 1.00 16.57 ? 47  VAL A O     1 
ATOM   1581 C CB    . VAL E 3 40  ? 41.949 29.318 -13.959 1.00 15.68 ? 47  VAL A CB    1 
ATOM   1582 C CG1   . VAL E 3 40  ? 42.065 30.245 -15.145 1.00 16.05 ? 47  VAL A CG1   1 
ATOM   1583 C CG2   . VAL E 3 40  ? 40.733 28.389 -14.129 1.00 15.82 ? 47  VAL A CG2   1 
ATOM   1584 N N     . ALA E 3 41  ? 42.665 28.365 -11.480 1.00 12.78 ? 48  ALA A N     1 
ATOM   1585 C CA    . ALA E 3 41  ? 42.540 27.749 -10.182 1.00 10.21 ? 48  ALA A CA    1 
ATOM   1586 C C     . ALA E 3 41  ? 41.464 28.564 -9.528  1.00 8.63  ? 48  ALA A C     1 
ATOM   1587 O O     . ALA E 3 41  ? 41.491 29.783 -9.607  1.00 7.69  ? 48  ALA A O     1 
ATOM   1588 C CB    . ALA E 3 41  ? 43.851 27.876 -9.414  1.00 11.12 ? 48  ALA A CB    1 
ATOM   1589 N N     . VAL E 3 42  ? 40.524 27.870 -8.899  1.00 6.75  ? 49  VAL A N     1 
ATOM   1590 C CA    . VAL E 3 42  ? 39.366 28.457 -8.236  1.00 4.05  ? 49  VAL A CA    1 
ATOM   1591 C C     . VAL E 3 42  ? 39.698 28.467 -6.761  1.00 3.32  ? 49  VAL A C     1 
ATOM   1592 O O     . VAL E 3 42  ? 39.974 27.415 -6.202  1.00 2.47  ? 49  VAL A O     1 
ATOM   1593 C CB    . VAL E 3 42  ? 38.114 27.530 -8.481  1.00 5.52  ? 49  VAL A CB    1 
ATOM   1594 C CG1   . VAL E 3 42  ? 36.754 28.296 -8.303  1.00 0.76  ? 49  VAL A CG1   1 
ATOM   1595 C CG2   . VAL E 3 42  ? 38.248 26.874 -9.848  1.00 2.84  ? 49  VAL A CG2   1 
ATOM   1596 N N     . LEU E 3 43  ? 39.663 29.623 -6.115  1.00 3.00  ? 50  LEU A N     1 
ATOM   1597 C CA    . LEU E 3 43  ? 39.991 29.634 -4.702  1.00 6.53  ? 50  LEU A CA    1 
ATOM   1598 C C     . LEU E 3 43  ? 39.171 30.573 -3.878  1.00 9.76  ? 50  LEU A C     1 
ATOM   1599 O O     . LEU E 3 43  ? 38.761 31.599 -4.382  1.00 11.46 ? 50  LEU A O     1 
ATOM   1600 C CB    . LEU E 3 43  ? 41.454 29.980 -4.481  1.00 7.41  ? 50  LEU A CB    1 
ATOM   1601 C CG    . LEU E 3 43  ? 41.925 31.405 -4.760  1.00 10.11 ? 50  LEU A CG    1 
ATOM   1602 C CD1   . LEU E 3 43  ? 43.106 31.710 -3.849  1.00 11.89 ? 50  LEU A CD1   1 
ATOM   1603 C CD2   . LEU E 3 43  ? 42.307 31.567 -6.235  1.00 11.26 ? 50  LEU A CD2   1 
ATOM   1604 N N     . ILE E 3 44  ? 38.929 30.206 -2.614  1.00 11.91 ? 51  ILE A N     1 
ATOM   1605 C CA    . ILE E 3 44  ? 38.174 31.031 -1.672  1.00 16.19 ? 51  ILE A CA    1 
ATOM   1606 C C     . ILE E 3 44  ? 39.151 31.468 -0.612  1.00 18.68 ? 51  ILE A C     1 
ATOM   1607 O O     . ILE E 3 44  ? 40.155 30.797 -0.373  1.00 19.15 ? 51  ILE A O     1 
ATOM   1608 C CB    . ILE E 3 44  ? 37.055 30.264 -0.924  1.00 18.18 ? 51  ILE A CB    1 
ATOM   1609 C CG1   . ILE E 3 44  ? 37.559 28.859 -0.579  1.00 18.48 ? 51  ILE A CG1   1 
ATOM   1610 C CG2   . ILE E 3 44  ? 35.746 30.294 -1.715  1.00 17.67 ? 51  ILE A CG2   1 
ATOM   1611 C CD1   . ILE E 3 44  ? 36.703 28.119 0.441   1.00 17.66 ? 51  ILE A CD1   1 
ATOM   1612 N N     . LYS E 3 45  ? 38.840 32.583 0.036   1.00 20.05 ? 52  LYS A N     1 
ATOM   1613 C CA    . LYS E 3 45  ? 39.704 33.114 1.069   1.00 20.38 ? 52  LYS A CA    1 
ATOM   1614 C C     . LYS E 3 45  ? 38.897 33.821 2.148   1.00 20.75 ? 52  LYS A C     1 
ATOM   1615 O O     . LYS E 3 45  ? 38.000 34.605 1.856   1.00 19.73 ? 52  LYS A O     1 
ATOM   1616 C CB    . LYS E 3 45  ? 40.738 34.063 0.444   1.00 20.48 ? 52  LYS A CB    1 
ATOM   1617 C CG    . LYS E 3 45  ? 40.174 35.291 -0.268  1.00 20.41 ? 52  LYS A CG    1 
ATOM   1618 C CD    . LYS E 3 45  ? 41.274 36.111 -0.976  1.00 20.59 ? 52  LYS A CD    1 
ATOM   1619 C CE    . LYS E 3 45  ? 42.355 36.725 -0.021  1.00 22.24 ? 52  LYS A CE    1 
ATOM   1620 N NZ    . LYS E 3 45  ? 43.408 35.810 0.578   1.00 19.06 ? 52  LYS A NZ    1 
ATOM   1621 N N     . ASP E 3 46  ? 39.226 33.523 3.401   1.00 22.02 ? 53  ASP A N     1 
ATOM   1622 C CA    . ASP E 3 46  ? 38.542 34.112 4.546   1.00 22.70 ? 53  ASP A CA    1 
ATOM   1623 C C     . ASP E 3 46  ? 39.270 35.332 5.076   1.00 21.73 ? 53  ASP A C     1 
ATOM   1624 O O     . ASP E 3 46  ? 40.489 35.412 5.029   1.00 22.73 ? 53  ASP A O     1 
ATOM   1625 C CB    . ASP E 3 46  ? 38.391 33.082 5.672   1.00 24.96 ? 53  ASP A CB    1 
ATOM   1626 C CG    . ASP E 3 46  ? 39.118 33.493 6.947   1.00 26.69 ? 53  ASP A CG    1 
ATOM   1627 O OD1   . ASP E 3 46  ? 40.381 33.473 6.964   1.00 24.29 ? 53  ASP A OD1   1 
ATOM   1628 O OD2   . ASP E 3 46  ? 38.404 33.840 7.921   1.00 26.79 ? 53  ASP A OD2   1 
ATOM   1629 N N     . GLU E 3 47  ? 38.491 36.251 5.616   1.00 20.81 ? 54  GLU A N     1 
ATOM   1630 C CA    . GLU E 3 47  ? 38.955 37.507 6.161   1.00 21.43 ? 54  GLU A CA    1 
ATOM   1631 C C     . GLU E 3 47  ? 40.311 37.615 6.907   1.00 21.72 ? 54  GLU A C     1 
ATOM   1632 O O     . GLU E 3 47  ? 41.055 38.561 6.665   1.00 20.54 ? 54  GLU A O     1 
ATOM   1633 C CB    . GLU E 3 47  ? 37.820 38.098 6.996   1.00 20.00 ? 54  GLU A CB    1 
ATOM   1634 C CG    . GLU E 3 47  ? 36.515 38.386 6.183   1.00 21.52 ? 54  GLU A CG    1 
ATOM   1635 C CD    . GLU E 3 47  ? 35.590 37.156 5.967   1.00 20.08 ? 54  GLU A CD    1 
ATOM   1636 O OE1   . GLU E 3 47  ? 35.463 36.317 6.878   1.00 17.70 ? 54  GLU A OE1   1 
ATOM   1637 O OE2   . GLU E 3 47  ? 34.963 37.039 4.892   1.00 18.98 ? 54  GLU A OE2   1 
ATOM   1638 N N     . GLU E 3 48  ? 40.651 36.689 7.804   1.00 23.07 ? 55  GLU A N     1 
ATOM   1639 C CA    . GLU E 3 48  ? 41.947 36.789 8.487   1.00 24.01 ? 55  GLU A CA    1 
ATOM   1640 C C     . GLU E 3 48  ? 43.081 36.605 7.469   1.00 24.51 ? 55  GLU A C     1 
ATOM   1641 O O     . GLU E 3 48  ? 44.255 36.787 7.794   1.00 25.51 ? 55  GLU A O     1 
ATOM   1642 C CB    . GLU E 3 48  ? 42.073 35.743 9.598   1.00 25.99 ? 55  GLU A CB    1 
ATOM   1643 C CG    . GLU E 3 48  ? 42.309 36.293 11.033  1.00 27.46 ? 55  GLU A CG    1 
ATOM   1644 C CD    . GLU E 3 48  ? 41.148 37.143 11.603  1.00 27.95 ? 55  GLU A CD    1 
ATOM   1645 O OE1   . GLU E 3 48  ? 41.069 38.348 11.279  1.00 30.43 ? 55  GLU A OE1   1 
ATOM   1646 O OE2   . GLU E 3 48  ? 40.316 36.616 12.380  1.00 25.25 ? 55  GLU A OE2   1 
ATOM   1647 N N     . GLY E 3 49  ? 42.721 36.241 6.238   1.00 24.04 ? 56  GLY A N     1 
ATOM   1648 C CA    . GLY E 3 49  ? 43.708 36.074 5.186   1.00 21.82 ? 56  GLY A CA    1 
ATOM   1649 C C     . GLY E 3 49  ? 44.016 34.682 4.649   1.00 21.16 ? 56  GLY A C     1 
ATOM   1650 O O     . GLY E 3 49  ? 44.828 34.550 3.732   1.00 21.57 ? 56  GLY A O     1 
ATOM   1651 N N     . LYS E 3 50  ? 43.407 33.638 5.193   1.00 20.81 ? 57  LYS A N     1 
ATOM   1652 C CA    . LYS E 3 50  ? 43.700 32.303 4.689   1.00 19.62 ? 57  LYS A CA    1 
ATOM   1653 C C     . LYS E 3 50  ? 43.010 32.089 3.349   1.00 18.92 ? 57  LYS A C     1 
ATOM   1654 O O     . LYS E 3 50  ? 42.059 32.798 3.003   1.00 19.86 ? 57  LYS A O     1 
ATOM   1655 C CB    . LYS E 3 50  ? 43.263 31.238 5.697   1.00 20.49 ? 57  LYS A CB    1 
ATOM   1656 C CG    . LYS E 3 50  ? 44.343 30.850 6.709   1.00 24.03 ? 57  LYS A CG    1 
ATOM   1657 C CD    . LYS E 3 50  ? 45.443 29.932 6.094   1.00 27.57 ? 57  LYS A CD    1 
ATOM   1658 C CE    . LYS E 3 50  ? 46.216 30.553 4.911   1.00 27.69 ? 57  LYS A CE    1 
ATOM   1659 N NZ    . LYS E 3 50  ? 47.318 29.667 4.389   1.00 27.78 ? 57  LYS A NZ    1 
ATOM   1660 N N     . GLU E 3 51  ? 43.493 31.113 2.593   1.00 15.84 ? 58  GLU A N     1 
ATOM   1661 C CA    . GLU E 3 51  ? 42.942 30.809 1.288   1.00 12.78 ? 58  GLU A CA    1 
ATOM   1662 C C     . GLU E 3 51  ? 42.758 29.307 1.164   1.00 11.32 ? 58  GLU A C     1 
ATOM   1663 O O     . GLU E 3 51  ? 43.246 28.572 1.995   1.00 11.51 ? 58  GLU A O     1 
ATOM   1664 C CB    . GLU E 3 51  ? 43.903 31.305 0.212   1.00 13.90 ? 58  GLU A CB    1 
ATOM   1665 C CG    . GLU E 3 51  ? 44.254 32.785 0.316   1.00 15.69 ? 58  GLU A CG    1 
ATOM   1666 C CD    . GLU E 3 51  ? 44.844 33.317 -0.988  1.00 20.46 ? 58  GLU A CD    1 
ATOM   1667 O OE1   . GLU E 3 51  ? 44.584 34.496 -1.312  1.00 21.89 ? 58  GLU A OE1   1 
ATOM   1668 O OE2   . GLU E 3 51  ? 45.562 32.564 -1.697  1.00 18.63 ? 58  GLU A OE2   1 
ATOM   1669 N N     . MET E 3 52  ? 42.031 28.853 0.149   1.00 9.57  ? 59  MET A N     1 
ATOM   1670 C CA    . MET E 3 52  ? 41.845 27.416 -0.090  1.00 8.55  ? 59  MET A CA    1 
ATOM   1671 C C     . MET E 3 52  ? 41.779 27.279 -1.626  1.00 9.74  ? 59  MET A C     1 
ATOM   1672 O O     . MET E 3 52  ? 41.547 28.254 -2.321  1.00 10.93 ? 59  MET A O     1 
ATOM   1673 C CB    . MET E 3 52  ? 40.554 26.896 0.599   1.00 5.19  ? 59  MET A CB    1 
ATOM   1674 C CG    . MET E 3 52  ? 40.294 25.369 0.502   1.00 2.88  ? 59  MET A CG    1 
ATOM   1675 S SD    . MET E 3 52  ? 40.129 24.479 2.129   1.00 10.02 ? 59  MET A SD    1 
ATOM   1676 C CE    . MET E 3 52  ? 40.363 22.807 1.664   1.00 7.76  ? 59  MET A CE    1 
ATOM   1677 N N     . ILE E 3 53  ? 42.043 26.101 -2.169  1.00 9.90  ? 60  ILE A N     1 
ATOM   1678 C CA    . ILE E 3 53  ? 41.958 25.910 -3.611  1.00 10.39 ? 60  ILE A CA    1 
ATOM   1679 C C     . ILE E 3 53  ? 40.792 24.940 -3.803  1.00 11.03 ? 60  ILE A C     1 
ATOM   1680 O O     . ILE E 3 53  ? 40.945 23.762 -3.525  1.00 13.49 ? 60  ILE A O     1 
ATOM   1681 C CB    . ILE E 3 53  ? 43.257 25.242 -4.193  1.00 11.13 ? 60  ILE A CB    1 
ATOM   1682 C CG1   . ILE E 3 53  ? 44.493 26.118 -3.921  1.00 12.35 ? 60  ILE A CG1   1 
ATOM   1683 C CG2   . ILE E 3 53  ? 43.106 24.989 -5.693  1.00 8.49  ? 60  ILE A CG2   1 
ATOM   1684 C CD1   . ILE E 3 53  ? 44.443 27.535 -4.471  1.00 11.70 ? 60  ILE A CD1   1 
ATOM   1685 N N     . LEU E 3 54  ? 39.622 25.401 -4.226  1.00 9.65  ? 61  LEU A N     1 
ATOM   1686 C CA    . LEU E 3 54  ? 38.539 24.444 -4.422  1.00 8.15  ? 61  LEU A CA    1 
ATOM   1687 C C     . LEU E 3 54  ? 38.889 23.552 -5.621  1.00 9.15  ? 61  LEU A C     1 
ATOM   1688 O O     . LEU E 3 54  ? 38.395 22.422 -5.733  1.00 10.62 ? 61  LEU A O     1 
ATOM   1689 C CB    . LEU E 3 54  ? 37.192 25.153 -4.642  1.00 6.91  ? 61  LEU A CB    1 
ATOM   1690 C CG    . LEU E 3 54  ? 36.567 25.806 -3.405  1.00 5.31  ? 61  LEU A CG    1 
ATOM   1691 C CD1   . LEU E 3 54  ? 35.370 26.584 -3.788  1.00 3.38  ? 61  LEU A CD1   1 
ATOM   1692 C CD2   . LEU E 3 54  ? 36.172 24.760 -2.404  1.00 6.95  ? 61  LEU A CD2   1 
ATOM   1693 N N     . SER E 3 55  ? 39.746 24.059 -6.511  1.00 8.26  ? 62  SER A N     1 
ATOM   1694 C CA    . SER E 3 55  ? 40.204 23.301 -7.676  1.00 7.49  ? 62  SER A CA    1 
ATOM   1695 C C     . SER E 3 55  ? 40.998 24.050 -8.702  1.00 7.90  ? 62  SER A C     1 
ATOM   1696 O O     . SER E 3 55  ? 41.133 25.264 -8.662  1.00 7.70  ? 62  SER A O     1 
ATOM   1697 C CB    . SER E 3 55  ? 39.058 22.640 -8.424  1.00 8.66  ? 62  SER A CB    1 
ATOM   1698 O OG    . SER E 3 55  ? 39.496 22.187 -9.701  1.00 6.39  ? 62  SER A OG    1 
ATOM   1699 N N     . TYR E 3 56  ? 41.523 23.266 -9.628  1.00 9.35  ? 63  TYR A N     1 
ATOM   1700 C CA    . TYR E 3 56  ? 42.306 23.745 -10.738 1.00 11.45 ? 63  TYR A CA    1 
ATOM   1701 C C     . TYR E 3 56  ? 41.451 23.454 -11.938 1.00 12.96 ? 63  TYR A C     1 
ATOM   1702 O O     . TYR E 3 56  ? 40.855 22.380 -12.012 1.00 13.48 ? 63  TYR A O     1 
ATOM   1703 C CB    . TYR E 3 56  ? 43.589 22.950 -10.879 1.00 12.17 ? 63  TYR A CB    1 
ATOM   1704 C CG    . TYR E 3 56  ? 44.590 23.109 -9.763  1.00 13.72 ? 63  TYR A CG    1 
ATOM   1705 C CD1   . TYR E 3 56  ? 45.016 24.374 -9.346  1.00 12.08 ? 63  TYR A CD1   1 
ATOM   1706 C CD2   . TYR E 3 56  ? 45.176 21.982 -9.174  1.00 14.64 ? 63  TYR A CD2   1 
ATOM   1707 C CE1   . TYR E 3 56  ? 45.997 24.504 -8.379  1.00 12.34 ? 63  TYR A CE1   1 
ATOM   1708 C CE2   . TYR E 3 56  ? 46.160 22.107 -8.203  1.00 13.89 ? 63  TYR A CE2   1 
ATOM   1709 C CZ    . TYR E 3 56  ? 46.557 23.366 -7.818  1.00 13.21 ? 63  TYR A CZ    1 
ATOM   1710 O OH    . TYR E 3 56  ? 47.515 23.473 -6.865  1.00 14.86 ? 63  TYR A OH    1 
ATOM   1711 N N     . LEU E 3 57  ? 41.397 24.398 -12.879 1.00 14.70 ? 64  LEU A N     1 
ATOM   1712 C CA    . LEU E 3 57  ? 40.596 24.236 -14.095 1.00 15.24 ? 64  LEU A CA    1 
ATOM   1713 C C     . LEU E 3 57  ? 41.420 24.259 -15.356 1.00 17.08 ? 64  LEU A C     1 
ATOM   1714 O O     . LEU E 3 57  ? 42.226 25.151 -15.553 1.00 19.39 ? 64  LEU A O     1 
ATOM   1715 C CB    . LEU E 3 57  ? 39.526 25.316 -14.160 1.00 12.61 ? 64  LEU A CB    1 
ATOM   1716 C CG    . LEU E 3 57  ? 38.137 24.742 -13.921 1.00 8.45  ? 64  LEU A CG    1 
ATOM   1717 C CD1   . LEU E 3 57  ? 38.241 23.574 -12.987 1.00 5.48  ? 64  LEU A CD1   1 
ATOM   1718 C CD2   . LEU E 3 57  ? 37.218 25.818 -13.372 1.00 8.52  ? 64  LEU A CD2   1 
ATOM   1719 N N     . ASN E 3 58  ? 41.222 23.269 -16.211 1.00 18.70 ? 65  ASN A N     1 
ATOM   1720 C CA    . ASN E 3 58  ? 41.979 23.197 -17.442 1.00 20.81 ? 65  ASN A CA    1 
ATOM   1721 C C     . ASN E 3 58  ? 41.142 23.497 -18.671 1.00 21.73 ? 65  ASN A C     1 
ATOM   1722 O O     . ASN E 3 58  ? 40.016 24.006 -18.589 1.00 21.92 ? 65  ASN A O     1 
ATOM   1723 C CB    . ASN E 3 58  ? 42.593 21.810 -17.613 1.00 23.29 ? 65  ASN A CB    1 
ATOM   1724 C CG    . ASN E 3 58  ? 43.316 21.325 -16.372 1.00 25.90 ? 65  ASN A CG    1 
ATOM   1725 O OD1   . ASN E 3 58  ? 43.225 20.147 -16.021 1.00 28.24 ? 65  ASN A OD1   1 
ATOM   1726 N ND2   . ASN E 3 58  ? 44.045 22.216 -15.710 1.00 26.48 ? 65  ASN A ND2   1 
ATOM   1727 N N     . GLN E 3 59  ? 41.740 23.150 -19.807 1.00 21.87 ? 66  GLN A N     1 
ATOM   1728 C CA    . GLN E 3 59  ? 41.198 23.314 -21.148 1.00 22.55 ? 66  GLN A CA    1 
ATOM   1729 C C     . GLN E 3 59  ? 39.852 22.622 -21.291 1.00 21.68 ? 66  GLN A C     1 
ATOM   1730 O O     . GLN E 3 59  ? 39.662 21.531 -20.786 1.00 23.33 ? 66  GLN A O     1 
ATOM   1731 C CB    . GLN E 3 59  ? 42.190 22.696 -22.119 1.00 25.65 ? 66  GLN A CB    1 
ATOM   1732 C CG    . GLN E 3 59  ? 42.046 23.072 -23.565 1.00 28.56 ? 66  GLN A CG    1 
ATOM   1733 C CD    . GLN E 3 59  ? 43.035 22.303 -24.413 1.00 29.77 ? 66  GLN A CD    1 
ATOM   1734 O OE1   . GLN E 3 59  ? 44.167 22.054 -23.985 1.00 29.40 ? 66  GLN A OE1   1 
ATOM   1735 N NE2   . GLN E 3 59  ? 42.617 21.920 -25.621 1.00 27.99 ? 66  GLN A NE2   1 
ATOM   1736 N N     . GLY E 3 60  ? 38.918 23.247 -21.988 1.00 20.16 ? 67  GLY A N     1 
ATOM   1737 C CA    . GLY E 3 60  ? 37.622 22.625 -22.151 1.00 18.01 ? 67  GLY A CA    1 
ATOM   1738 C C     . GLY E 3 60  ? 36.680 22.958 -21.014 1.00 17.24 ? 67  GLY A C     1 
ATOM   1739 O O     . GLY E 3 60  ? 35.476 22.787 -21.157 1.00 15.66 ? 67  GLY A O     1 
ATOM   1740 N N     . ASP E 3 61  ? 37.226 23.433 -19.890 1.00 16.27 ? 68  ASP A N     1 
ATOM   1741 C CA    . ASP E 3 61  ? 36.422 23.796 -18.718 1.00 14.26 ? 68  ASP A CA    1 
ATOM   1742 C C     . ASP E 3 61  ? 35.672 25.096 -18.916 1.00 12.70 ? 68  ASP A C     1 
ATOM   1743 O O     . ASP E 3 61  ? 36.102 25.969 -19.646 1.00 13.86 ? 68  ASP A O     1 
ATOM   1744 C CB    . ASP E 3 61  ? 37.281 24.018 -17.464 1.00 15.71 ? 68  ASP A CB    1 
ATOM   1745 C CG    . ASP E 3 61  ? 37.897 22.769 -16.928 1.00 17.62 ? 68  ASP A CG    1 
ATOM   1746 O OD1   . ASP E 3 61  ? 37.271 21.690 -16.976 1.00 18.92 ? 68  ASP A OD1   1 
ATOM   1747 O OD2   . ASP E 3 61  ? 39.022 22.881 -16.416 1.00 19.47 ? 68  ASP A OD2   1 
ATOM   1748 N N     . PHE E 3 62  ? 34.564 25.238 -18.216 1.00 12.11 ? 69  PHE A N     1 
ATOM   1749 C CA    . PHE E 3 62  ? 33.784 26.458 -18.266 1.00 12.27 ? 69  PHE A CA    1 
ATOM   1750 C C     . PHE E 3 62  ? 34.100 27.080 -16.926 1.00 10.90 ? 69  PHE A C     1 
ATOM   1751 O O     . PHE E 3 62  ? 34.533 26.366 -16.054 1.00 11.44 ? 69  PHE A O     1 
ATOM   1752 C CB    . PHE E 3 62  ? 32.300 26.124 -18.319 1.00 13.45 ? 69  PHE A CB    1 
ATOM   1753 C CG    . PHE E 3 62  ? 31.745 25.983 -19.706 1.00 14.64 ? 69  PHE A CG    1 
ATOM   1754 C CD1   . PHE E 3 62  ? 30.941 26.981 -20.242 1.00 15.34 ? 69  PHE A CD1   1 
ATOM   1755 C CD2   . PHE E 3 62  ? 31.902 24.808 -20.415 1.00 15.05 ? 69  PHE A CD2   1 
ATOM   1756 C CE1   . PHE E 3 62  ? 30.289 26.804 -21.449 1.00 15.43 ? 69  PHE A CE1   1 
ATOM   1757 C CE2   . PHE E 3 62  ? 31.247 24.625 -21.630 1.00 16.79 ? 69  PHE A CE2   1 
ATOM   1758 C CZ    . PHE E 3 62  ? 30.433 25.626 -22.146 1.00 14.58 ? 69  PHE A CZ    1 
ATOM   1759 N N     . ILE E 3 63  ? 33.923 28.384 -16.760 1.00 11.25 ? 70  ILE A N     1 
ATOM   1760 C CA    . ILE E 3 63  ? 34.170 29.031 -15.470 1.00 13.95 ? 70  ILE A CA    1 
ATOM   1761 C C     . ILE E 3 63  ? 33.131 30.104 -15.190 1.00 16.21 ? 70  ILE A C     1 
ATOM   1762 O O     . ILE E 3 63  ? 32.426 30.532 -16.091 1.00 17.25 ? 70  ILE A O     1 
ATOM   1763 C CB    . ILE E 3 63  ? 35.584 29.694 -15.341 1.00 14.09 ? 70  ILE A CB    1 
ATOM   1764 C CG1   . ILE E 3 63  ? 36.279 29.809 -16.687 1.00 13.42 ? 70  ILE A CG1   1 
ATOM   1765 C CG2   . ILE E 3 63  ? 36.441 28.899 -14.376 1.00 11.67 ? 70  ILE A CG2   1 
ATOM   1766 C CD1   . ILE E 3 63  ? 37.663 30.419 -16.546 1.00 13.04 ? 70  ILE A CD1   1 
ATOM   1767 N N     . GLY E 3 64  ? 33.019 30.531 -13.937 1.00 17.93 ? 71  GLY A N     1 
ATOM   1768 C CA    . GLY E 3 64  ? 32.026 31.546 -13.612 1.00 19.07 ? 71  GLY A CA    1 
ATOM   1769 C C     . GLY E 3 64  ? 30.606 31.313 -14.145 1.00 18.10 ? 71  GLY A C     1 
ATOM   1770 O O     . GLY E 3 64  ? 29.928 32.263 -14.542 1.00 18.23 ? 71  GLY A O     1 
ATOM   1771 N N     . GLU E 3 65  ? 30.148 30.067 -14.130 1.00 16.61 ? 72  GLU A N     1 
ATOM   1772 C CA    . GLU E 3 65  ? 28.809 29.712 -14.604 1.00 18.93 ? 72  GLU A CA    1 
ATOM   1773 C C     . GLU E 3 65  ? 27.765 29.363 -13.516 1.00 19.65 ? 72  GLU A C     1 
ATOM   1774 O O     . GLU E 3 65  ? 26.801 28.654 -13.806 1.00 18.53 ? 72  GLU A O     1 
ATOM   1775 C CB    . GLU E 3 65  ? 28.912 28.517 -15.552 1.00 17.52 ? 72  GLU A CB    1 
ATOM   1776 C CG    . GLU E 3 65  ? 29.945 27.459 -15.097 1.00 18.02 ? 72  GLU A CG    1 
ATOM   1777 C CD    . GLU E 3 65  ? 29.683 26.897 -13.705 1.00 16.17 ? 72  GLU A CD    1 
ATOM   1778 O OE1   . GLU E 3 65  ? 30.422 27.239 -12.765 1.00 16.35 ? 72  GLU A OE1   1 
ATOM   1779 O OE2   . GLU E 3 65  ? 28.740 26.107 -13.544 1.00 13.97 ? 72  GLU A OE2   1 
ATOM   1780 N N     . LEU E 3 66  ? 27.933 29.852 -12.289 1.00 20.47 ? 73  LEU A N     1 
ATOM   1781 C CA    . LEU E 3 66  ? 26.987 29.496 -11.228 1.00 22.12 ? 73  LEU A CA    1 
ATOM   1782 C C     . LEU E 3 66  ? 25.972 30.581 -10.908 1.00 23.02 ? 73  LEU A C     1 
ATOM   1783 O O     . LEU E 3 66  ? 25.122 30.419 -10.009 1.00 22.60 ? 73  LEU A O     1 
ATOM   1784 C CB    . LEU E 3 66  ? 27.731 29.045 -9.955  1.00 21.03 ? 73  LEU A CB    1 
ATOM   1785 C CG    . LEU E 3 66  ? 27.724 27.526 -9.719  1.00 18.53 ? 73  LEU A CG    1 
ATOM   1786 C CD1   . LEU E 3 66  ? 28.150 26.816 -10.960 1.00 18.37 ? 73  LEU A CD1   1 
ATOM   1787 C CD2   . LEU E 3 66  ? 28.652 27.152 -8.574  1.00 19.14 ? 73  LEU A CD2   1 
ATOM   1788 N N     . GLY E 3 67  ? 26.072 31.671 -11.674 1.00 22.46 ? 74  GLY A N     1 
ATOM   1789 C CA    . GLY E 3 67  ? 25.149 32.781 -11.556 1.00 21.16 ? 74  GLY A CA    1 
ATOM   1790 C C     . GLY E 3 67  ? 24.246 32.736 -12.773 1.00 21.43 ? 74  GLY A C     1 
ATOM   1791 O O     . GLY E 3 67  ? 23.287 33.482 -12.874 1.00 22.30 ? 74  GLY A O     1 
ATOM   1792 N N     . LEU E 3 68  ? 24.558 31.820 -13.687 1.00 22.73 ? 75  LEU A N     1 
ATOM   1793 C CA    . LEU E 3 68  ? 23.840 31.612 -14.949 1.00 23.34 ? 75  LEU A CA    1 
ATOM   1794 C C     . LEU E 3 68  ? 22.368 31.195 -14.861 1.00 26.32 ? 75  LEU A C     1 
ATOM   1795 O O     . LEU E 3 68  ? 21.691 31.079 -15.881 1.00 28.10 ? 75  LEU A O     1 
ATOM   1796 C CB    . LEU E 3 68  ? 24.595 30.566 -15.779 1.00 18.92 ? 75  LEU A CB    1 
ATOM   1797 C CG    . LEU E 3 68  ? 24.179 30.249 -17.221 1.00 17.96 ? 75  LEU A CG    1 
ATOM   1798 C CD1   . LEU E 3 68  ? 23.429 28.960 -17.269 1.00 19.31 ? 75  LEU A CD1   1 
ATOM   1799 C CD2   . LEU E 3 68  ? 23.340 31.364 -17.800 1.00 17.25 ? 75  LEU A CD2   1 
ATOM   1800 N N     . PHE E 3 69  ? 21.852 30.983 -13.662 1.00 27.74 ? 76  PHE A N     1 
ATOM   1801 C CA    . PHE E 3 69  ? 20.478 30.536 -13.556 1.00 29.43 ? 76  PHE A CA    1 
ATOM   1802 C C     . PHE E 3 69  ? 19.542 31.468 -12.808 1.00 31.68 ? 76  PHE A C     1 
ATOM   1803 O O     . PHE E 3 69  ? 18.325 31.328 -12.904 1.00 32.68 ? 76  PHE A O     1 
ATOM   1804 C CB    . PHE E 3 69  ? 20.477 29.144 -12.926 1.00 28.06 ? 76  PHE A CB    1 
ATOM   1805 C CG    . PHE E 3 69  ? 21.236 28.130 -13.735 1.00 26.37 ? 76  PHE A CG    1 
ATOM   1806 C CD1   . PHE E 3 69  ? 20.583 27.324 -14.659 1.00 26.16 ? 76  PHE A CD1   1 
ATOM   1807 C CD2   . PHE E 3 69  ? 22.614 28.043 -13.637 1.00 23.13 ? 76  PHE A CD2   1 
ATOM   1808 C CE1   . PHE E 3 69  ? 21.308 26.454 -15.473 1.00 25.73 ? 76  PHE A CE1   1 
ATOM   1809 C CE2   . PHE E 3 69  ? 23.326 27.182 -14.440 1.00 21.74 ? 76  PHE A CE2   1 
ATOM   1810 C CZ    . PHE E 3 69  ? 22.679 26.389 -15.357 1.00 21.78 ? 76  PHE A CZ    1 
ATOM   1811 N N     . GLU E 3 70  ? 20.112 32.420 -12.075 1.00 32.66 ? 77  GLU A N     1 
ATOM   1812 C CA    . GLU E 3 70  ? 19.332 33.373 -11.305 1.00 33.59 ? 77  GLU A CA    1 
ATOM   1813 C C     . GLU E 3 70  ? 19.910 34.761 -11.514 1.00 34.65 ? 77  GLU A C     1 
ATOM   1814 O O     . GLU E 3 70  ? 21.117 34.967 -11.436 1.00 35.30 ? 77  GLU A O     1 
ATOM   1815 C CB    . GLU E 3 70  ? 19.366 33.007 -9.822  1.00 34.13 ? 77  GLU A CB    1 
ATOM   1816 C CG    . GLU E 3 70  ? 18.725 31.666 -9.483  1.00 35.23 ? 77  GLU A CG    1 
ATOM   1817 C CD    . GLU E 3 70  ? 18.902 31.305 -8.017  1.00 36.22 ? 77  GLU A CD    1 
ATOM   1818 O OE1   . GLU E 3 70  ? 18.465 32.111 -7.170  1.00 36.92 ? 77  GLU A OE1   1 
ATOM   1819 O OE2   . GLU E 3 70  ? 19.476 30.230 -7.713  1.00 36.09 ? 77  GLU A OE2   1 
ATOM   1820 N N     . GLU E 3 71  ? 19.038 35.722 -11.775 1.00 35.47 ? 78  GLU A N     1 
ATOM   1821 C CA    . GLU E 3 71  ? 19.469 37.086 -12.034 1.00 35.41 ? 78  GLU A CA    1 
ATOM   1822 C C     . GLU E 3 71  ? 19.904 37.827 -10.764 1.00 33.27 ? 78  GLU A C     1 
ATOM   1823 O O     . GLU E 3 71  ? 19.097 38.046 -9.866  1.00 32.54 ? 78  GLU A O     1 
ATOM   1824 C CB    . GLU E 3 71  ? 18.326 37.845 -12.748 1.00 36.83 ? 78  GLU A CB    1 
ATOM   1825 C CG    . GLU E 3 71  ? 18.785 38.882 -13.771 1.00 39.62 ? 78  GLU A CG    1 
ATOM   1826 C CD    . GLU E 3 71  ? 19.671 38.280 -14.862 1.00 42.49 ? 78  GLU A CD    1 
ATOM   1827 O OE1   . GLU E 3 71  ? 20.460 37.359 -14.543 1.00 43.30 ? 78  GLU A OE1   1 
ATOM   1828 O OE2   . GLU E 3 71  ? 19.598 38.733 -16.031 1.00 42.76 ? 78  GLU A OE2   1 
ATOM   1829 N N     . GLY E 3 72  ? 21.183 38.193 -10.678 1.00 30.69 ? 79  GLY A N     1 
ATOM   1830 C CA    . GLY E 3 72  ? 21.634 38.940 -9.515  1.00 27.99 ? 79  GLY A CA    1 
ATOM   1831 C C     . GLY E 3 72  ? 22.564 38.313 -8.493  1.00 26.51 ? 79  GLY A C     1 
ATOM   1832 O O     . GLY E 3 72  ? 22.677 38.816 -7.371  1.00 25.58 ? 79  GLY A O     1 
ATOM   1833 N N     . GLN E 3 73  ? 23.239 37.231 -8.864  1.00 25.41 ? 80  GLN A N     1 
ATOM   1834 C CA    . GLN E 3 73  ? 24.162 36.571 -7.953  1.00 23.63 ? 80  GLN A CA    1 
ATOM   1835 C C     . GLN E 3 73  ? 25.482 37.298 -7.958  1.00 23.92 ? 80  GLN A C     1 
ATOM   1836 O O     . GLN E 3 73  ? 25.703 38.214 -8.746  1.00 24.71 ? 80  GLN A O     1 
ATOM   1837 C CB    . GLN E 3 73  ? 24.433 35.146 -8.393  1.00 23.23 ? 80  GLN A CB    1 
ATOM   1838 C CG    . GLN E 3 73  ? 23.770 34.074 -7.565  1.00 23.64 ? 80  GLN A CG    1 
ATOM   1839 C CD    . GLN E 3 73  ? 22.459 33.626 -8.168  1.00 23.96 ? 80  GLN A CD    1 
ATOM   1840 O OE1   . GLN E 3 73  ? 21.411 34.209 -7.895  1.00 22.54 ? 80  GLN A OE1   1 
ATOM   1841 N NE2   . GLN E 3 73  ? 22.515 32.593 -9.016  1.00 22.60 ? 80  GLN A NE2   1 
ATOM   1842 N N     . GLU E 3 74  ? 26.365 36.869 -7.068  1.00 23.86 ? 81  GLU A N     1 
ATOM   1843 C CA    . GLU E 3 74  ? 27.699 37.429 -6.962  1.00 22.89 ? 81  GLU A CA    1 
ATOM   1844 C C     . GLU E 3 74  ? 28.607 36.296 -7.372  1.00 19.95 ? 81  GLU A C     1 
ATOM   1845 O O     . GLU E 3 74  ? 28.213 35.140 -7.304  1.00 17.97 ? 81  GLU A O     1 
ATOM   1846 C CB    . GLU E 3 74  ? 28.026 37.821 -5.514  1.00 26.72 ? 81  GLU A CB    1 
ATOM   1847 C CG    . GLU E 3 74  ? 26.981 38.702 -4.816  1.00 30.92 ? 81  GLU A CG    1 
ATOM   1848 C CD    . GLU E 3 74  ? 27.585 39.534 -3.681  1.00 34.64 ? 81  GLU A CD    1 
ATOM   1849 O OE1   . GLU E 3 74  ? 28.463 39.002 -2.955  1.00 34.62 ? 81  GLU A OE1   1 
ATOM   1850 O OE2   . GLU E 3 74  ? 27.177 40.715 -3.518  1.00 35.30 ? 81  GLU A OE2   1 
ATOM   1851 N N     . ARG E 3 75  ? 29.814 36.616 -7.812  1.00 18.15 ? 82  ARG A N     1 
ATOM   1852 C CA    . ARG E 3 75  ? 30.752 35.571 -8.190  1.00 16.52 ? 82  ARG A CA    1 
ATOM   1853 C C     . ARG E 3 75  ? 31.177 34.923 -6.874  1.00 14.65 ? 82  ARG A C     1 
ATOM   1854 O O     . ARG E 3 75  ? 31.613 35.608 -5.961  1.00 14.77 ? 82  ARG A O     1 
ATOM   1855 C CB    . ARG E 3 75  ? 31.942 36.182 -8.925  1.00 17.55 ? 82  ARG A CB    1 
ATOM   1856 C CG    . ARG E 3 75  ? 31.560 36.911 -10.222 1.00 16.63 ? 82  ARG A CG    1 
ATOM   1857 C CD    . ARG E 3 75  ? 30.925 35.987 -11.246 1.00 14.25 ? 82  ARG A CD    1 
ATOM   1858 N NE    . ARG E 3 75  ? 31.428 36.258 -12.586 1.00 17.16 ? 82  ARG A NE    1 
ATOM   1859 C CZ    . ARG E 3 75  ? 30.921 35.741 -13.709 1.00 19.58 ? 82  ARG A CZ    1 
ATOM   1860 N NH1   . ARG E 3 75  ? 29.873 34.922 -13.672 1.00 18.36 ? 82  ARG A NH1   1 
ATOM   1861 N NH2   . ARG E 3 75  ? 31.494 36.009 -14.875 1.00 17.86 ? 82  ARG A NH2   1 
ATOM   1862 N N     . SER E 3 76  ? 31.040 33.605 -6.786  1.00 12.53 ? 83  SER A N     1 
ATOM   1863 C CA    . SER E 3 76  ? 31.348 32.875 -5.570  1.00 10.92 ? 83  SER A CA    1 
ATOM   1864 C C     . SER E 3 76  ? 32.801 32.576 -5.186  1.00 14.17 ? 83  SER A C     1 
ATOM   1865 O O     . SER E 3 76  ? 33.038 31.994 -4.127  1.00 15.44 ? 83  SER A O     1 
ATOM   1866 C CB    . SER E 3 76  ? 30.566 31.577 -5.573  1.00 7.37  ? 83  SER A CB    1 
ATOM   1867 O OG    . SER E 3 76  ? 30.869 30.843 -6.724  1.00 6.03  ? 83  SER A OG    1 
ATOM   1868 N N     . ALA E 3 77  ? 33.771 32.939 -6.018  1.00 15.19 ? 84  ALA A N     1 
ATOM   1869 C CA    . ALA E 3 77  ? 35.154 32.689 -5.665  1.00 17.19 ? 84  ALA A CA    1 
ATOM   1870 C C     . ALA E 3 77  ? 36.126 33.265 -6.670  1.00 18.66 ? 84  ALA A C     1 
ATOM   1871 O O     . ALA E 3 77  ? 35.791 33.464 -7.824  1.00 19.24 ? 84  ALA A O     1 
ATOM   1872 C CB    . ALA E 3 77  ? 35.389 31.212 -5.515  1.00 16.47 ? 84  ALA A CB    1 
ATOM   1873 N N     . TRP E 3 78  ? 37.339 33.541 -6.216  1.00 21.37 ? 85  TRP A N     1 
ATOM   1874 C CA    . TRP E 3 78  ? 38.378 34.079 -7.087  1.00 23.15 ? 85  TRP A CA    1 
ATOM   1875 C C     . TRP E 3 78  ? 38.799 33.003 -8.075  1.00 21.98 ? 85  TRP A C     1 
ATOM   1876 O O     . TRP E 3 78  ? 38.693 31.814 -7.789  1.00 24.70 ? 85  TRP A O     1 
ATOM   1877 C CB    . TRP E 3 78  ? 39.584 34.540 -6.259  1.00 26.54 ? 85  TRP A CB    1 
ATOM   1878 C CG    . TRP E 3 78  ? 39.565 36.032 -5.933  1.00 33.03 ? 85  TRP A CG    1 
ATOM   1879 C CD1   . TRP E 3 78  ? 39.951 37.069 -6.762  1.00 34.49 ? 85  TRP A CD1   1 
ATOM   1880 C CD2   . TRP E 3 78  ? 39.130 36.649 -4.708  1.00 33.93 ? 85  TRP A CD2   1 
ATOM   1881 N NE1   . TRP E 3 78  ? 39.781 38.278 -6.123  1.00 35.59 ? 85  TRP A NE1   1 
ATOM   1882 C CE2   . TRP E 3 78  ? 39.283 38.051 -4.864  1.00 34.87 ? 85  TRP A CE2   1 
ATOM   1883 C CE3   . TRP E 3 78  ? 38.628 36.156 -3.500  1.00 34.30 ? 85  TRP A CE3   1 
ATOM   1884 C CZ2   . TRP E 3 78  ? 38.952 38.956 -3.856  1.00 35.14 ? 85  TRP A CZ2   1 
ATOM   1885 C CZ3   . TRP E 3 78  ? 38.297 37.060 -2.497  1.00 35.87 ? 85  TRP A CZ3   1 
ATOM   1886 C CH2   . TRP E 3 78  ? 38.462 38.445 -2.683  1.00 36.14 ? 85  TRP A CH2   1 
ATOM   1887 N N     . VAL E 3 79  ? 39.232 33.427 -9.255  1.00 19.53 ? 86  VAL A N     1 
ATOM   1888 C CA    . VAL E 3 79  ? 39.681 32.522 -10.295 1.00 15.91 ? 86  VAL A CA    1 
ATOM   1889 C C     . VAL E 3 79  ? 40.816 33.275 -10.895 1.00 16.51 ? 86  VAL A C     1 
ATOM   1890 O O     . VAL E 3 79  ? 40.631 34.369 -11.401 1.00 16.75 ? 86  VAL A O     1 
ATOM   1891 C CB    . VAL E 3 79  ? 38.613 32.297 -11.323 1.00 14.10 ? 86  VAL A CB    1 
ATOM   1892 C CG1   . VAL E 3 79  ? 39.136 31.389 -12.441 1.00 11.87 ? 86  VAL A CG1   1 
ATOM   1893 C CG2   . VAL E 3 79  ? 37.419 31.678 -10.635 1.00 13.22 ? 86  VAL A CG2   1 
ATOM   1894 N N     . ARG E 3 80  ? 41.989 32.668 -10.831 1.00 16.93 ? 87  ARG A N     1 
ATOM   1895 C CA    . ARG E 3 80  ? 43.224 33.285 -11.280 1.00 19.44 ? 87  ARG A CA    1 
ATOM   1896 C C     . ARG E 3 80  ? 44.049 32.366 -12.205 1.00 19.47 ? 87  ARG A C     1 
ATOM   1897 O O     . ARG E 3 80  ? 44.456 31.270 -11.820 1.00 20.40 ? 87  ARG A O     1 
ATOM   1898 C CB    . ARG E 3 80  ? 43.993 33.655 -10.002 1.00 20.51 ? 87  ARG A CB    1 
ATOM   1899 C CG    . ARG E 3 80  ? 45.305 34.346 -10.181 1.00 23.29 ? 87  ARG A CG    1 
ATOM   1900 C CD    . ARG E 3 80  ? 45.969 34.470 -8.826  1.00 23.77 ? 87  ARG A CD    1 
ATOM   1901 N NE    . ARG E 3 80  ? 45.979 33.178 -8.143  1.00 25.17 ? 87  ARG A NE    1 
ATOM   1902 C CZ    . ARG E 3 80  ? 46.808 32.855 -7.154  1.00 26.26 ? 87  ARG A CZ    1 
ATOM   1903 N NH1   . ARG E 3 80  ? 47.717 33.736 -6.719  1.00 24.86 ? 87  ARG A NH1   1 
ATOM   1904 N NH2   . ARG E 3 80  ? 46.723 31.647 -6.604  1.00 23.44 ? 87  ARG A NH2   1 
ATOM   1905 N N     . ALA E 3 81  ? 44.307 32.813 -13.425 1.00 20.16 ? 88  ALA A N     1 
ATOM   1906 C CA    . ALA E 3 81  ? 45.049 31.986 -14.373 1.00 21.24 ? 88  ALA A CA    1 
ATOM   1907 C C     . ALA E 3 81  ? 46.347 31.464 -13.773 1.00 22.69 ? 88  ALA A C     1 
ATOM   1908 O O     . ALA E 3 81  ? 47.141 32.235 -13.219 1.00 24.91 ? 88  ALA A O     1 
ATOM   1909 C CB    . ALA E 3 81  ? 45.329 32.767 -15.641 1.00 19.49 ? 88  ALA A CB    1 
ATOM   1910 N N     . LYS E 3 82  ? 46.559 30.152 -13.881 1.00 22.16 ? 89  LYS A N     1 
ATOM   1911 C CA    . LYS E 3 82  ? 47.760 29.518 -13.330 1.00 22.60 ? 89  LYS A CA    1 
ATOM   1912 C C     . LYS E 3 82  ? 48.915 29.611 -14.329 1.00 20.72 ? 89  LYS A C     1 
ATOM   1913 O O     . LYS E 3 82  ? 50.073 29.401 -13.999 1.00 21.12 ? 89  LYS A O     1 
ATOM   1914 C CB    . LYS E 3 82  ? 47.452 28.042 -13.013 1.00 23.57 ? 89  LYS A CB    1 
ATOM   1915 C CG    . LYS E 3 82  ? 48.314 27.429 -11.905 1.00 25.16 ? 89  LYS A CG    1 
ATOM   1916 C CD    . LYS E 3 82  ? 47.955 25.971 -11.642 1.00 25.37 ? 89  LYS A CD    1 
ATOM   1917 C CE    . LYS E 3 82  ? 48.835 25.359 -10.546 1.00 28.62 ? 89  LYS A CE    1 
ATOM   1918 N NZ    . LYS E 3 82  ? 48.499 23.917 -10.232 1.00 30.36 ? 89  LYS A NZ    1 
ATOM   1919 N N     . THR E 3 83  ? 48.552 29.926 -15.562 1.00 19.37 ? 90  THR A N     1 
ATOM   1920 C CA    . THR E 3 83  ? 49.459 30.030 -16.691 1.00 16.69 ? 90  THR A CA    1 
ATOM   1921 C C     . THR E 3 83  ? 48.815 31.107 -17.530 1.00 15.15 ? 90  THR A C     1 
ATOM   1922 O O     . THR E 3 83  ? 48.010 31.878 -17.025 1.00 16.02 ? 90  THR A O     1 
ATOM   1923 C CB    . THR E 3 83  ? 49.445 28.750 -17.537 1.00 16.18 ? 90  THR A CB    1 
ATOM   1924 O OG1   . THR E 3 83  ? 48.126 28.558 -18.048 1.00 17.32 ? 90  THR A OG1   1 
ATOM   1925 C CG2   . THR E 3 83  ? 49.807 27.541 -16.714 1.00 12.56 ? 90  THR A CG2   1 
ATOM   1926 N N     . ALA E 3 84  ? 49.168 31.172 -18.805 1.00 13.99 ? 91  ALA A N     1 
ATOM   1927 C CA    . ALA E 3 84  ? 48.559 32.164 -19.688 1.00 13.53 ? 91  ALA A CA    1 
ATOM   1928 C C     . ALA E 3 84  ? 47.380 31.443 -20.359 1.00 11.70 ? 91  ALA A C     1 
ATOM   1929 O O     . ALA E 3 84  ? 47.543 30.377 -20.916 1.00 9.17  ? 91  ALA A O     1 
ATOM   1930 C CB    . ALA E 3 84  ? 49.569 32.644 -20.705 1.00 11.66 ? 91  ALA A CB    1 
ATOM   1931 N N     . CYS E 3 85  ? 46.187 32.009 -20.278 1.00 12.40 ? 92  CYS A N     1 
ATOM   1932 C CA    . CYS E 3 85  ? 45.009 31.337 -20.842 1.00 16.15 ? 92  CYS A CA    1 
ATOM   1933 C C     . CYS E 3 85  ? 44.410 32.049 -22.014 1.00 14.35 ? 92  CYS A C     1 
ATOM   1934 O O     . CYS E 3 85  ? 44.706 33.194 -22.282 1.00 13.86 ? 92  CYS A O     1 
ATOM   1935 C CB    . CYS E 3 85  ? 43.862 31.211 -19.811 1.00 18.25 ? 92  CYS A CB    1 
ATOM   1936 S SG    . CYS E 3 85  ? 44.293 30.751 -18.125 1.00 23.39 ? 92  CYS A SG    1 
ATOM   1937 N N     . GLU E 3 86  ? 43.540 31.347 -22.703 1.00 14.30 ? 93  GLU A N     1 
ATOM   1938 C CA    . GLU E 3 86  ? 42.830 31.955 -23.794 1.00 15.54 ? 93  GLU A CA    1 
ATOM   1939 C C     . GLU E 3 86  ? 41.431 31.713 -23.254 1.00 16.78 ? 93  GLU A C     1 
ATOM   1940 O O     . GLU E 3 86  ? 41.077 30.579 -22.967 1.00 16.99 ? 93  GLU A O     1 
ATOM   1941 C CB    . GLU E 3 86  ? 43.065 31.201 -25.105 1.00 15.10 ? 93  GLU A CB    1 
ATOM   1942 C CG    . GLU E 3 86  ? 43.212 32.135 -26.327 1.00 17.38 ? 93  GLU A CG    1 
ATOM   1943 C CD    . GLU E 3 86  ? 42.957 31.445 -27.676 1.00 19.65 ? 93  GLU A CD    1 
ATOM   1944 O OE1   . GLU E 3 86  ? 43.774 30.576 -28.074 1.00 17.22 ? 93  GLU A OE1   1 
ATOM   1945 O OE2   . GLU E 3 86  ? 41.929 31.782 -28.328 1.00 18.39 ? 93  GLU A OE2   1 
ATOM   1946 N N     . VAL E 3 87  ? 40.652 32.769 -23.068 1.00 17.05 ? 94  VAL A N     1 
ATOM   1947 C CA    . VAL E 3 87  ? 39.314 32.595 -22.534 1.00 18.78 ? 94  VAL A CA    1 
ATOM   1948 C C     . VAL E 3 87  ? 38.252 33.279 -23.370 1.00 19.54 ? 94  VAL A C     1 
ATOM   1949 O O     . VAL E 3 87  ? 38.393 34.433 -23.738 1.00 20.84 ? 94  VAL A O     1 
ATOM   1950 C CB    . VAL E 3 87  ? 39.236 33.122 -21.112 1.00 18.58 ? 94  VAL A CB    1 
ATOM   1951 C CG1   . VAL E 3 87  ? 37.835 32.941 -20.570 1.00 20.58 ? 94  VAL A CG1   1 
ATOM   1952 C CG2   . VAL E 3 87  ? 40.250 32.398 -20.258 1.00 19.69 ? 94  VAL A CG2   1 
ATOM   1953 N N     . ALA E 3 88  ? 37.183 32.560 -23.668 1.00 19.67 ? 95  ALA A N     1 
ATOM   1954 C CA    . ALA E 3 88  ? 36.119 33.114 -24.471 1.00 21.79 ? 95  ALA A CA    1 
ATOM   1955 C C     . ALA E 3 88  ? 34.942 33.494 -23.565 1.00 25.09 ? 95  ALA A C     1 
ATOM   1956 O O     . ALA E 3 88  ? 34.667 32.807 -22.577 1.00 25.73 ? 95  ALA A O     1 
ATOM   1957 C CB    . ALA E 3 88  ? 35.696 32.097 -25.497 1.00 18.85 ? 95  ALA A CB    1 
ATOM   1958 N N     . GLU E 3 89  ? 34.264 34.596 -23.885 1.00 27.53 ? 96  GLU A N     1 
ATOM   1959 C CA    . GLU E 3 89  ? 33.117 35.027 -23.103 1.00 29.98 ? 96  GLU A CA    1 
ATOM   1960 C C     . GLU E 3 89  ? 31.934 35.373 -23.989 1.00 30.36 ? 96  GLU A C     1 
ATOM   1961 O O     . GLU E 3 89  ? 32.112 35.696 -25.164 1.00 30.48 ? 96  GLU A O     1 
ATOM   1962 C CB    . GLU E 3 89  ? 33.490 36.218 -22.219 1.00 32.83 ? 96  GLU A CB    1 
ATOM   1963 C CG    . GLU E 3 89  ? 34.197 37.351 -22.908 1.00 38.06 ? 96  GLU A CG    1 
ATOM   1964 C CD    . GLU E 3 89  ? 34.741 38.376 -21.906 1.00 41.89 ? 96  GLU A CD    1 
ATOM   1965 O OE1   . GLU E 3 89  ? 35.526 37.973 -21.013 1.00 41.74 ? 96  GLU A OE1   1 
ATOM   1966 O OE2   . GLU E 3 89  ? 34.387 39.578 -22.014 1.00 42.63 ? 96  GLU A OE2   1 
ATOM   1967 N N     . ILE E 3 90  ? 30.723 35.279 -23.444 1.00 30.77 ? 97  ILE A N     1 
ATOM   1968 C CA    . ILE E 3 90  ? 29.545 35.608 -24.237 1.00 32.31 ? 97  ILE A CA    1 
ATOM   1969 C C     . ILE E 3 90  ? 28.699 36.678 -23.598 1.00 32.91 ? 97  ILE A C     1 
ATOM   1970 O O     . ILE E 3 90  ? 28.467 37.726 -24.209 1.00 34.59 ? 97  ILE A O     1 
ATOM   1971 C CB    . ILE E 3 90  ? 28.600 34.417 -24.468 1.00 32.74 ? 97  ILE A CB    1 
ATOM   1972 C CG1   . ILE E 3 90  ? 29.331 33.099 -24.275 1.00 33.24 ? 97  ILE A CG1   1 
ATOM   1973 C CG2   . ILE E 3 90  ? 28.034 34.485 -25.881 1.00 33.82 ? 97  ILE A CG2   1 
ATOM   1974 C CD1   . ILE E 3 90  ? 29.646 32.795 -22.847 1.00 34.78 ? 97  ILE A CD1   1 
ATOM   1975 N N     . SER E 3 91  ? 28.242 36.394 -22.375 1.00 31.84 ? 98  SER A N     1 
ATOM   1976 C CA    . SER E 3 91  ? 27.361 37.268 -21.580 1.00 31.28 ? 98  SER A CA    1 
ATOM   1977 C C     . SER E 3 91  ? 26.119 36.445 -21.280 1.00 31.07 ? 98  SER A C     1 
ATOM   1978 O O     . SER E 3 91  ? 25.525 35.859 -22.185 1.00 32.05 ? 98  SER A O     1 
ATOM   1979 C CB    . SER E 3 91  ? 26.931 38.529 -22.346 1.00 29.99 ? 98  SER A CB    1 
ATOM   1980 O OG    . SER E 3 91  ? 26.052 38.212 -23.410 1.00 30.00 ? 98  SER A OG    1 
ATOM   1981 N N     . TYR E 3 92  ? 25.715 36.395 -20.020 1.00 30.63 ? 99  TYR A N     1 
ATOM   1982 C CA    . TYR E 3 92  ? 24.557 35.588 -19.659 1.00 30.12 ? 99  TYR A CA    1 
ATOM   1983 C C     . TYR E 3 92  ? 23.399 35.678 -20.639 1.00 30.12 ? 99  TYR A C     1 
ATOM   1984 O O     . TYR E 3 92  ? 23.113 34.702 -21.341 1.00 28.68 ? 99  TYR A O     1 
ATOM   1985 C CB    . TYR E 3 92  ? 24.117 35.920 -18.232 1.00 28.84 ? 99  TYR A CB    1 
ATOM   1986 C CG    . TYR E 3 92  ? 24.985 35.221 -17.209 1.00 28.38 ? 99  TYR A CG    1 
ATOM   1987 C CD1   . TYR E 3 92  ? 26.250 34.760 -17.551 1.00 29.04 ? 99  TYR A CD1   1 
ATOM   1988 C CD2   . TYR E 3 92  ? 24.555 35.023 -15.907 1.00 28.44 ? 99  TYR A CD2   1 
ATOM   1989 C CE1   . TYR E 3 92  ? 27.064 34.120 -16.626 1.00 29.04 ? 99  TYR A CE1   1 
ATOM   1990 C CE2   . TYR E 3 92  ? 25.372 34.387 -14.970 1.00 28.47 ? 99  TYR A CE2   1 
ATOM   1991 C CZ    . TYR E 3 92  ? 26.626 33.937 -15.336 1.00 27.81 ? 99  TYR A CZ    1 
ATOM   1992 O OH    . TYR E 3 92  ? 27.453 33.314 -14.426 1.00 26.82 ? 99  TYR A OH    1 
ATOM   1993 N N     . LYS E 3 93  ? 22.750 36.845 -20.693 1.00 30.85 ? 100 LYS A N     1 
ATOM   1994 C CA    . LYS E 3 93  ? 21.615 37.069 -21.595 1.00 30.20 ? 100 LYS A CA    1 
ATOM   1995 C C     . LYS E 3 93  ? 21.877 36.399 -22.920 1.00 28.91 ? 100 LYS A C     1 
ATOM   1996 O O     . LYS E 3 93  ? 21.021 35.705 -23.444 1.00 29.87 ? 100 LYS A O     1 
ATOM   1997 C CB    . LYS E 3 93  ? 21.368 38.567 -21.842 1.00 31.46 ? 100 LYS A CB    1 
ATOM   1998 C CG    . LYS E 3 93  ? 20.550 39.312 -20.771 1.00 31.49 ? 100 LYS A CG    1 
ATOM   1999 C CD    . LYS E 3 93  ? 20.494 40.822 -21.080 1.00 31.87 ? 100 LYS A CD    1 
ATOM   2000 C CE    . LYS E 3 93  ? 19.567 41.587 -20.123 1.00 33.40 ? 100 LYS A CE    1 
ATOM   2001 N NZ    . LYS E 3 93  ? 19.657 43.084 -20.284 1.00 33.87 ? 100 LYS A NZ    1 
ATOM   2002 N N     . LYS E 3 94  ? 23.068 36.593 -23.465 1.00 28.28 ? 101 LYS A N     1 
ATOM   2003 C CA    . LYS E 3 94  ? 23.371 35.979 -24.748 1.00 27.55 ? 101 LYS A CA    1 
ATOM   2004 C C     . LYS E 3 94  ? 23.277 34.467 -24.695 1.00 28.07 ? 101 LYS A C     1 
ATOM   2005 O O     . LYS E 3 94  ? 22.602 33.860 -25.519 1.00 29.21 ? 101 LYS A O     1 
ATOM   2006 C CB    . LYS E 3 94  ? 24.755 36.375 -25.243 1.00 25.97 ? 101 LYS A CB    1 
ATOM   2007 C CG    . LYS E 3 94  ? 24.745 36.701 -26.716 1.00 25.78 ? 101 LYS A CG    1 
ATOM   2008 C CD    . LYS E 3 94  ? 23.945 35.670 -27.482 1.00 23.72 ? 101 LYS A CD    1 
ATOM   2009 C CE    . LYS E 3 94  ? 23.084 36.328 -28.544 1.00 24.05 ? 101 LYS A CE    1 
ATOM   2010 N NZ    . LYS E 3 94  ? 23.880 37.194 -29.455 1.00 23.33 ? 101 LYS A NZ    1 
ATOM   2011 N N     . PHE E 3 95  ? 23.942 33.861 -23.717 1.00 28.32 ? 102 PHE A N     1 
ATOM   2012 C CA    . PHE E 3 95  ? 23.933 32.411 -23.586 1.00 27.86 ? 102 PHE A CA    1 
ATOM   2013 C C     . PHE E 3 95  ? 22.538 31.806 -23.565 1.00 28.82 ? 102 PHE A C     1 
ATOM   2014 O O     . PHE E 3 95  ? 22.272 30.828 -24.261 1.00 28.60 ? 102 PHE A O     1 
ATOM   2015 C CB    . PHE E 3 95  ? 24.661 31.975 -22.323 1.00 24.67 ? 102 PHE A CB    1 
ATOM   2016 C CG    . PHE E 3 95  ? 25.142 30.563 -22.381 1.00 21.95 ? 102 PHE A CG    1 
ATOM   2017 C CD1   . PHE E 3 95  ? 26.119 30.194 -23.296 1.00 20.38 ? 102 PHE A CD1   1 
ATOM   2018 C CD2   . PHE E 3 95  ? 24.642 29.607 -21.519 1.00 21.64 ? 102 PHE A CD2   1 
ATOM   2019 C CE1   . PHE E 3 95  ? 26.599 28.892 -23.351 1.00 19.81 ? 102 PHE A CE1   1 
ATOM   2020 C CE2   . PHE E 3 95  ? 25.119 28.295 -21.568 1.00 21.12 ? 102 PHE A CE2   1 
ATOM   2021 C CZ    . PHE E 3 95  ? 26.102 27.942 -22.488 1.00 20.14 ? 102 PHE A CZ    1 
ATOM   2022 N N     . ARG E 3 96  ? 21.663 32.382 -22.748 1.00 30.11 ? 103 ARG A N     1 
ATOM   2023 C CA    . ARG E 3 96  ? 20.301 31.900 -22.629 1.00 31.73 ? 103 ARG A CA    1 
ATOM   2024 C C     . ARG E 3 96  ? 19.656 31.730 -23.993 1.00 33.77 ? 103 ARG A C     1 
ATOM   2025 O O     . ARG E 3 96  ? 18.816 30.851 -24.179 1.00 34.54 ? 103 ARG A O     1 
ATOM   2026 C CB    . ARG E 3 96  ? 19.476 32.852 -21.769 1.00 30.71 ? 103 ARG A CB    1 
ATOM   2027 C CG    . ARG E 3 96  ? 19.743 32.722 -20.285 1.00 29.07 ? 103 ARG A CG    1 
ATOM   2028 C CD    . ARG E 3 96  ? 19.308 33.971 -19.557 1.00 29.74 ? 103 ARG A CD    1 
ATOM   2029 N NE    . ARG E 3 96  ? 19.919 34.053 -18.231 1.00 31.20 ? 103 ARG A NE    1 
ATOM   2030 C CZ    . ARG E 3 96  ? 20.125 35.185 -17.562 1.00 30.80 ? 103 ARG A CZ    1 
ATOM   2031 N NH1   . ARG E 3 96  ? 19.781 36.356 -18.084 1.00 32.29 ? 103 ARG A NH1   1 
ATOM   2032 N NH2   . ARG E 3 96  ? 20.669 35.147 -16.362 1.00 30.50 ? 103 ARG A NH2   1 
ATOM   2033 N N     . GLN E 3 97  ? 20.052 32.560 -24.952 1.00 35.98 ? 104 GLN A N     1 
ATOM   2034 C CA    . GLN E 3 97  ? 19.506 32.463 -26.302 1.00 37.57 ? 104 GLN A CA    1 
ATOM   2035 C C     . GLN E 3 97  ? 20.169 31.323 -27.061 1.00 38.28 ? 104 GLN A C     1 
ATOM   2036 O O     . GLN E 3 97  ? 19.518 30.594 -27.803 1.00 40.14 ? 104 GLN A O     1 
ATOM   2037 C CB    . GLN E 3 97  ? 19.697 33.779 -27.057 1.00 38.81 ? 104 GLN A CB    1 
ATOM   2038 C CG    . GLN E 3 97  ? 18.445 34.665 -27.089 1.00 40.41 ? 104 GLN A CG    1 
ATOM   2039 C CD    . GLN E 3 97  ? 18.765 36.131 -27.368 1.00 41.53 ? 104 GLN A CD    1 
ATOM   2040 O OE1   . GLN E 3 97  ? 19.133 36.888 -26.464 1.00 41.53 ? 104 GLN A OE1   1 
ATOM   2041 N NE2   . GLN E 3 97  ? 18.641 36.529 -28.625 1.00 41.43 ? 104 GLN A NE2   1 
ATOM   2042 N N     . LEU E 3 98  ? 21.467 31.155 -26.875 1.00 38.42 ? 105 LEU A N     1 
ATOM   2043 C CA    . LEU E 3 98  ? 22.156 30.076 -27.561 1.00 37.83 ? 105 LEU A CA    1 
ATOM   2044 C C     . LEU E 3 98  ? 21.637 28.720 -27.063 1.00 37.50 ? 105 LEU A C     1 
ATOM   2045 O O     . LEU E 3 98  ? 21.985 27.658 -27.604 1.00 37.65 ? 105 LEU A O     1 
ATOM   2046 C CB    . LEU E 3 98  ? 23.660 30.225 -27.348 1.00 36.09 ? 105 LEU A CB    1 
ATOM   2047 C CG    . LEU E 3 98  ? 24.151 31.459 -28.092 1.00 33.18 ? 105 LEU A CG    1 
ATOM   2048 C CD1   . LEU E 3 98  ? 25.547 31.830 -27.668 1.00 35.37 ? 105 LEU A CD1   1 
ATOM   2049 C CD2   . LEU E 3 98  ? 24.108 31.173 -29.556 1.00 33.03 ? 105 LEU A CD2   1 
ATOM   2050 N N     . ILE E 3 99  ? 20.779 28.774 -26.046 1.00 36.05 ? 106 ILE A N     1 
ATOM   2051 C CA    . ILE E 3 99  ? 20.192 27.576 -25.454 1.00 34.74 ? 106 ILE A CA    1 
ATOM   2052 C C     . ILE E 3 99  ? 18.889 27.225 -26.165 1.00 33.71 ? 106 ILE A C     1 
ATOM   2053 O O     . ILE E 3 99  ? 18.791 26.170 -26.795 1.00 32.70 ? 106 ILE A O     1 
ATOM   2054 C CB    . ILE E 3 99  ? 19.934 27.778 -23.929 1.00 34.58 ? 106 ILE A CB    1 
ATOM   2055 C CG1   . ILE E 3 99  ? 21.266 27.738 -23.179 1.00 33.15 ? 106 ILE A CG1   1 
ATOM   2056 C CG2   . ILE E 3 99  ? 18.962 26.721 -23.402 1.00 34.65 ? 106 ILE A CG2   1 
ATOM   2057 C CD1   . ILE E 3 99  ? 21.199 28.234 -21.756 1.00 33.70 ? 106 ILE A CD1   1 
ATOM   2058 N N     . GLN E 3 100 ? 17.900 28.111 -26.069 1.00 31.65 ? 107 GLN A N     1 
ATOM   2059 C CA    . GLN E 3 100 ? 16.619 27.875 -26.717 1.00 31.13 ? 107 GLN A CA    1 
ATOM   2060 C C     . GLN E 3 100 ? 16.866 27.313 -28.110 1.00 30.88 ? 107 GLN A C     1 
ATOM   2061 O O     . GLN E 3 100 ? 16.343 26.267 -28.473 1.00 30.59 ? 107 GLN A O     1 
ATOM   2062 C CB    . GLN E 3 100 ? 15.813 29.171 -26.858 1.00 31.81 ? 107 GLN A CB    1 
ATOM   2063 C CG    . GLN E 3 100 ? 15.703 30.054 -25.615 1.00 31.97 ? 107 GLN A CG    1 
ATOM   2064 C CD    . GLN E 3 100 ? 15.256 29.309 -24.366 1.00 31.58 ? 107 GLN A CD    1 
ATOM   2065 O OE1   . GLN E 3 100 ? 14.465 28.372 -24.436 1.00 31.81 ? 107 GLN A OE1   1 
ATOM   2066 N NE2   . GLN E 3 100 ? 15.752 29.744 -23.211 1.00 31.09 ? 107 GLN A NE2   1 
ATOM   2067 N N     . VAL E 3 101 ? 17.688 28.014 -28.880 1.00 31.94 ? 108 VAL A N     1 
ATOM   2068 C CA    . VAL E 3 101 ? 18.012 27.621 -30.250 1.00 32.73 ? 108 VAL A CA    1 
ATOM   2069 C C     . VAL E 3 101 ? 18.830 26.335 -30.402 1.00 34.48 ? 108 VAL A C     1 
ATOM   2070 O O     . VAL E 3 101 ? 18.784 25.695 -31.453 1.00 34.38 ? 108 VAL A O     1 
ATOM   2071 C CB    . VAL E 3 101 ? 18.716 28.787 -30.971 1.00 31.62 ? 108 VAL A CB    1 
ATOM   2072 C CG1   . VAL E 3 101 ? 19.510 28.281 -32.150 1.00 29.69 ? 108 VAL A CG1   1 
ATOM   2073 C CG2   . VAL E 3 101 ? 17.662 29.813 -31.412 1.00 29.90 ? 108 VAL A CG2   1 
ATOM   2074 N N     . ASN E 3 102 ? 19.567 25.957 -29.360 1.00 36.20 ? 109 ASN A N     1 
ATOM   2075 C CA    . ASN E 3 102 ? 20.371 24.728 -29.379 1.00 38.20 ? 109 ASN A CA    1 
ATOM   2076 C C     . ASN E 3 102 ? 20.731 24.321 -27.958 1.00 39.34 ? 109 ASN A C     1 
ATOM   2077 O O     . ASN E 3 102 ? 21.882 24.466 -27.548 1.00 40.11 ? 109 ASN A O     1 
ATOM   2078 C CB    . ASN E 3 102 ? 21.662 24.916 -30.170 1.00 37.77 ? 109 ASN A CB    1 
ATOM   2079 C CG    . ASN E 3 102 ? 22.529 23.672 -30.159 1.00 38.81 ? 109 ASN A CG    1 
ATOM   2080 O OD1   . ASN E 3 102 ? 23.608 23.651 -30.757 1.00 38.84 ? 109 ASN A OD1   1 
ATOM   2081 N ND2   . ASN E 3 102 ? 22.060 22.623 -29.478 1.00 37.76 ? 109 ASN A ND2   1 
ATOM   2082 N N     . PRO E 3 103 ? 19.755 23.766 -27.210 1.00 39.53 ? 110 PRO A N     1 
ATOM   2083 C CA    . PRO E 3 103 ? 19.842 23.303 -25.816 1.00 38.25 ? 110 PRO A CA    1 
ATOM   2084 C C     . PRO E 3 103 ? 20.934 22.286 -25.498 1.00 36.84 ? 110 PRO A C     1 
ATOM   2085 O O     . PRO E 3 103 ? 21.094 21.882 -24.344 1.00 36.01 ? 110 PRO A O     1 
ATOM   2086 C CB    . PRO E 3 103 ? 18.441 22.750 -25.554 1.00 38.76 ? 110 PRO A CB    1 
ATOM   2087 C CG    . PRO E 3 103 ? 18.087 22.158 -26.873 1.00 39.82 ? 110 PRO A CG    1 
ATOM   2088 C CD    . PRO E 3 103 ? 18.521 23.252 -27.838 1.00 40.16 ? 110 PRO A CD    1 
ATOM   2089 N N     . ASP E 3 104 ? 21.677 21.867 -26.516 1.00 36.12 ? 111 ASP A N     1 
ATOM   2090 C CA    . ASP E 3 104 ? 22.756 20.912 -26.307 1.00 35.64 ? 111 ASP A CA    1 
ATOM   2091 C C     . ASP E 3 104 ? 23.911 21.580 -25.545 1.00 34.49 ? 111 ASP A C     1 
ATOM   2092 O O     . ASP E 3 104 ? 24.363 21.070 -24.526 1.00 34.63 ? 111 ASP A O     1 
ATOM   2093 C CB    . ASP E 3 104 ? 23.232 20.377 -27.652 1.00 37.64 ? 111 ASP A CB    1 
ATOM   2094 C CG    . ASP E 3 104 ? 24.341 19.361 -27.514 1.00 39.95 ? 111 ASP A CG    1 
ATOM   2095 O OD1   . ASP E 3 104 ? 24.253 18.510 -26.599 1.00 39.66 ? 111 ASP A OD1   1 
ATOM   2096 O OD2   . ASP E 3 104 ? 25.292 19.411 -28.336 1.00 42.62 ? 111 ASP A OD2   1 
ATOM   2097 N N     . ILE E 3 105 ? 24.368 22.732 -26.033 1.00 32.26 ? 112 ILE A N     1 
ATOM   2098 C CA    . ILE E 3 105 ? 25.447 23.480 -25.395 1.00 29.77 ? 112 ILE A CA    1 
ATOM   2099 C C     . ILE E 3 105 ? 25.076 23.744 -23.933 1.00 27.95 ? 112 ILE A C     1 
ATOM   2100 O O     . ILE E 3 105 ? 25.908 24.210 -23.159 1.00 27.09 ? 112 ILE A O     1 
ATOM   2101 C CB    . ILE E 3 105 ? 25.693 24.847 -26.117 1.00 30.29 ? 112 ILE A CB    1 
ATOM   2102 C CG1   . ILE E 3 105 ? 26.926 25.568 -25.552 1.00 30.08 ? 112 ILE A CG1   1 
ATOM   2103 C CG2   . ILE E 3 105 ? 24.488 25.752 -25.918 1.00 31.95 ? 112 ILE A CG2   1 
ATOM   2104 C CD1   . ILE E 3 105 ? 28.229 24.900 -25.859 1.00 28.80 ? 112 ILE A CD1   1 
ATOM   2105 N N     . LEU E 3 106 ? 23.828 23.462 -23.562 1.00 25.44 ? 113 LEU A N     1 
ATOM   2106 C CA    . LEU E 3 106 ? 23.396 23.661 -22.189 1.00 25.30 ? 113 LEU A CA    1 
ATOM   2107 C C     . LEU E 3 106 ? 23.584 22.348 -21.453 1.00 28.05 ? 113 LEU A C     1 
ATOM   2108 O O     . LEU E 3 106 ? 23.455 22.277 -20.226 1.00 28.65 ? 113 LEU A O     1 
ATOM   2109 C CB    . LEU E 3 106 ? 21.937 24.063 -22.110 1.00 23.46 ? 113 LEU A CB    1 
ATOM   2110 C CG    . LEU E 3 106 ? 21.556 24.975 -20.940 1.00 23.01 ? 113 LEU A CG    1 
ATOM   2111 C CD1   . LEU E 3 106 ? 20.086 25.269 -21.023 1.00 22.19 ? 113 LEU A CD1   1 
ATOM   2112 C CD2   . LEU E 3 106 ? 21.883 24.342 -19.596 1.00 22.90 ? 113 LEU A CD2   1 
ATOM   2113 N N     . MET E 3 107 ? 23.883 21.297 -22.207 1.00 29.06 ? 114 MET A N     1 
ATOM   2114 C CA    . MET E 3 107 ? 24.110 20.000 -21.596 1.00 29.56 ? 114 MET A CA    1 
ATOM   2115 C C     . MET E 3 107 ? 25.555 19.955 -21.137 1.00 30.49 ? 114 MET A C     1 
ATOM   2116 O O     . MET E 3 107 ? 25.807 20.117 -19.951 1.00 31.67 ? 114 MET A O     1 
ATOM   2117 C CB    . MET E 3 107 ? 23.830 18.865 -22.587 1.00 29.58 ? 114 MET A CB    1 
ATOM   2118 C CG    . MET E 3 107 ? 22.359 18.561 -22.794 1.00 30.12 ? 114 MET A CG    1 
ATOM   2119 S SD    . MET E 3 107 ? 21.566 17.725 -21.386 1.00 32.16 ? 114 MET A SD    1 
ATOM   2120 C CE    . MET E 3 107 ? 21.959 16.034 -21.738 1.00 30.79 ? 114 MET A CE    1 
ATOM   2121 N N     . ARG E 3 108 ? 26.493 19.774 -22.077 1.00 30.84 ? 115 ARG A N     1 
ATOM   2122 C CA    . ARG E 3 108 ? 27.930 19.678 -21.767 1.00 28.72 ? 115 ARG A CA    1 
ATOM   2123 C C     . ARG E 3 108 ? 28.269 20.373 -20.470 1.00 26.53 ? 115 ARG A C     1 
ATOM   2124 O O     . ARG E 3 108 ? 28.856 19.777 -19.587 1.00 25.07 ? 115 ARG A O     1 
ATOM   2125 C CB    . ARG E 3 108 ? 28.786 20.258 -22.897 1.00 29.27 ? 115 ARG A CB    1 
ATOM   2126 C CG    . ARG E 3 108 ? 30.205 19.706 -22.893 1.00 29.90 ? 115 ARG A CG    1 
ATOM   2127 C CD    . ARG E 3 108 ? 30.995 20.066 -24.156 1.00 32.70 ? 115 ARG A CD    1 
ATOM   2128 N NE    . ARG E 3 108 ? 30.349 19.572 -25.379 1.00 35.44 ? 115 ARG A NE    1 
ATOM   2129 C CZ    . ARG E 3 108 ? 30.861 19.655 -26.611 1.00 35.03 ? 115 ARG A CZ    1 
ATOM   2130 N NH1   . ARG E 3 108 ? 32.054 20.217 -26.818 1.00 32.71 ? 115 ARG A NH1   1 
ATOM   2131 N NH2   . ARG E 3 108 ? 30.164 19.179 -27.643 1.00 33.62 ? 115 ARG A NH2   1 
ATOM   2132 N N     . LEU E 3 109 ? 27.871 21.632 -20.357 1.00 26.33 ? 116 LEU A N     1 
ATOM   2133 C CA    . LEU E 3 109 ? 28.097 22.430 -19.146 1.00 26.34 ? 116 LEU A CA    1 
ATOM   2134 C C     . LEU E 3 109 ? 27.595 21.716 -17.868 1.00 24.75 ? 116 LEU A C     1 
ATOM   2135 O O     . LEU E 3 109 ? 28.372 21.321 -17.002 1.00 24.76 ? 116 LEU A O     1 
ATOM   2136 C CB    . LEU E 3 109 ? 27.391 23.784 -19.304 1.00 25.32 ? 116 LEU A CB    1 
ATOM   2137 C CG    . LEU E 3 109 ? 27.634 24.883 -18.274 1.00 25.79 ? 116 LEU A CG    1 
ATOM   2138 C CD1   . LEU E 3 109 ? 27.188 26.224 -18.827 1.00 26.10 ? 116 LEU A CD1   1 
ATOM   2139 C CD2   . LEU E 3 109 ? 26.905 24.548 -17.003 1.00 24.85 ? 116 LEU A CD2   1 
ATOM   2140 N N     . SER E 3 110 ? 26.283 21.566 -17.772 1.00 23.53 ? 117 SER A N     1 
ATOM   2141 C CA    . SER E 3 110 ? 25.636 20.903 -16.647 1.00 21.83 ? 117 SER A CA    1 
ATOM   2142 C C     . SER E 3 110 ? 26.179 19.505 -16.329 1.00 22.62 ? 117 SER A C     1 
ATOM   2143 O O     . SER E 3 110 ? 25.928 18.970 -15.251 1.00 22.99 ? 117 SER A O     1 
ATOM   2144 C CB    . SER E 3 110 ? 24.140 20.808 -16.921 1.00 18.73 ? 117 SER A CB    1 
ATOM   2145 O OG    . SER E 3 110 ? 23.630 22.081 -17.231 1.00 15.53 ? 117 SER A OG    1 
ATOM   2146 N N     . ALA E 3 111 ? 26.896 18.895 -17.263 1.00 22.46 ? 118 ALA A N     1 
ATOM   2147 C CA    . ALA E 3 111 ? 27.453 17.572 -16.992 1.00 22.83 ? 118 ALA A CA    1 
ATOM   2148 C C     . ALA E 3 111 ? 28.812 17.802 -16.383 1.00 22.97 ? 118 ALA A C     1 
ATOM   2149 O O     . ALA E 3 111 ? 29.438 16.866 -15.884 1.00 23.88 ? 118 ALA A O     1 
ATOM   2150 C CB    . ALA E 3 111 ? 27.585 16.754 -18.268 1.00 23.15 ? 118 ALA A CB    1 
ATOM   2151 N N     . GLN E 3 112 ? 29.258 19.060 -16.457 1.00 21.25 ? 119 GLN A N     1 
ATOM   2152 C CA    . GLN E 3 112 ? 30.526 19.488 -15.894 1.00 19.84 ? 119 GLN A CA    1 
ATOM   2153 C C     . GLN E 3 112 ? 30.291 19.717 -14.414 1.00 19.77 ? 119 GLN A C     1 
ATOM   2154 O O     . GLN E 3 112 ? 30.945 19.115 -13.554 1.00 20.36 ? 119 GLN A O     1 
ATOM   2155 C CB    . GLN E 3 112 ? 30.989 20.803 -16.510 1.00 19.42 ? 119 GLN A CB    1 
ATOM   2156 C CG    . GLN E 3 112 ? 31.388 20.720 -17.946 1.00 19.71 ? 119 GLN A CG    1 
ATOM   2157 C CD    . GLN E 3 112 ? 32.401 21.773 -18.313 1.00 19.88 ? 119 GLN A CD    1 
ATOM   2158 O OE1   . GLN E 3 112 ? 32.359 22.881 -17.797 1.00 22.27 ? 119 GLN A OE1   1 
ATOM   2159 N NE2   . GLN E 3 112 ? 33.309 21.441 -19.214 1.00 19.81 ? 119 GLN A NE2   1 
ATOM   2160 N N     . MET E 3 113 ? 29.362 20.617 -14.127 1.00 18.16 ? 120 MET A N     1 
ATOM   2161 C CA    . MET E 3 113 ? 29.017 20.919 -12.758 1.00 17.41 ? 120 MET A CA    1 
ATOM   2162 C C     . MET E 3 113 ? 28.710 19.559 -12.152 1.00 18.11 ? 120 MET A C     1 
ATOM   2163 O O     . MET E 3 113 ? 29.049 19.275 -11.002 1.00 19.97 ? 120 MET A O     1 
ATOM   2164 C CB    . MET E 3 113 ? 27.747 21.776 -12.690 1.00 17.18 ? 120 MET A CB    1 
ATOM   2165 C CG    . MET E 3 113 ? 27.796 23.160 -13.331 1.00 12.14 ? 120 MET A CG    1 
ATOM   2166 S SD    . MET E 3 113 ? 26.183 23.929 -13.062 1.00 6.81  ? 120 MET A SD    1 
ATOM   2167 C CE    . MET E 3 113 ? 25.356 23.318 -14.425 1.00 9.95  ? 120 MET A CE    1 
ATOM   2168 N N     . ALA E 3 114 ? 28.045 18.722 -12.939 1.00 17.26 ? 121 ALA A N     1 
ATOM   2169 C CA    . ALA E 3 114 ? 27.692 17.385 -12.494 1.00 16.71 ? 121 ALA A CA    1 
ATOM   2170 C C     . ALA E 3 114 ? 28.833 16.933 -11.630 1.00 16.69 ? 121 ALA A C     1 
ATOM   2171 O O     . ALA E 3 114 ? 28.725 16.888 -10.409 1.00 15.97 ? 121 ALA A O     1 
ATOM   2172 C CB    . ALA E 3 114 ? 27.559 16.480 -13.676 1.00 17.63 ? 121 ALA A CB    1 
ATOM   2173 N N     . ARG E 3 115 ? 29.941 16.658 -12.313 1.00 17.94 ? 122 ARG A N     1 
ATOM   2174 C CA    . ARG E 3 115 ? 31.198 16.218 -11.743 1.00 17.07 ? 122 ARG A CA    1 
ATOM   2175 C C     . ARG E 3 115 ? 31.670 17.163 -10.655 1.00 16.60 ? 122 ARG A C     1 
ATOM   2176 O O     . ARG E 3 115 ? 31.942 16.737 -9.536  1.00 17.76 ? 122 ARG A O     1 
ATOM   2177 C CB    . ARG E 3 115 ? 32.257 16.173 -12.844 1.00 19.95 ? 122 ARG A CB    1 
ATOM   2178 C CG    . ARG E 3 115 ? 33.661 15.709 -12.408 1.00 23.56 ? 122 ARG A CG    1 
ATOM   2179 C CD    . ARG E 3 115 ? 33.803 14.185 -12.439 1.00 28.72 ? 122 ARG A CD    1 
ATOM   2180 N NE    . ARG E 3 115 ? 33.314 13.592 -13.694 1.00 32.71 ? 122 ARG A NE    1 
ATOM   2181 C CZ    . ARG E 3 115 ? 32.030 13.332 -13.948 1.00 34.11 ? 122 ARG A CZ    1 
ATOM   2182 N NH1   . ARG E 3 115 ? 31.106 13.607 -13.034 1.00 35.13 ? 122 ARG A NH1   1 
ATOM   2183 N NH2   . ARG E 3 115 ? 31.664 12.797 -15.108 1.00 33.05 ? 122 ARG A NH2   1 
ATOM   2184 N N     . ARG E 3 116 ? 31.788 18.445 -10.982 1.00 14.78 ? 123 ARG A N     1 
ATOM   2185 C CA    . ARG E 3 116 ? 32.265 19.426 -10.007 1.00 13.78 ? 123 ARG A CA    1 
ATOM   2186 C C     . ARG E 3 116 ? 31.571 19.303 -8.661  1.00 12.88 ? 123 ARG A C     1 
ATOM   2187 O O     . ARG E 3 116 ? 32.183 19.517 -7.616  1.00 13.29 ? 123 ARG A O     1 
ATOM   2188 C CB    . ARG E 3 116 ? 32.098 20.835 -10.561 1.00 13.79 ? 123 ARG A CB    1 
ATOM   2189 C CG    . ARG E 3 116 ? 32.878 21.034 -11.806 1.00 12.90 ? 123 ARG A CG    1 
ATOM   2190 C CD    . ARG E 3 116 ? 32.556 22.333 -12.462 1.00 14.49 ? 123 ARG A CD    1 
ATOM   2191 N NE    . ARG E 3 116 ? 33.543 22.632 -13.500 1.00 16.21 ? 123 ARG A NE    1 
ATOM   2192 C CZ    . ARG E 3 116 ? 33.618 23.789 -14.153 1.00 15.62 ? 123 ARG A CZ    1 
ATOM   2193 N NH1   . ARG E 3 116 ? 32.753 24.777 -13.885 1.00 8.31  ? 123 ARG A NH1   1 
ATOM   2194 N NH2   . ARG E 3 116 ? 34.580 23.960 -15.055 1.00 13.66 ? 123 ARG A NH2   1 
ATOM   2195 N N     . LEU E 3 117 ? 30.290 18.958 -8.689  1.00 11.44 ? 124 LEU A N     1 
ATOM   2196 C CA    . LEU E 3 117 ? 29.559 18.798 -7.458  1.00 10.11 ? 124 LEU A CA    1 
ATOM   2197 C C     . LEU E 3 117 ? 29.981 17.494 -6.812  1.00 8.24  ? 124 LEU A C     1 
ATOM   2198 O O     . LEU E 3 117 ? 30.268 17.442 -5.632  1.00 8.86  ? 124 LEU A O     1 
ATOM   2199 C CB    . LEU E 3 117 ? 28.039 18.821 -7.704  1.00 9.35  ? 124 LEU A CB    1 
ATOM   2200 C CG    . LEU E 3 117 ? 27.181 18.772 -6.417  1.00 8.41  ? 124 LEU A CG    1 
ATOM   2201 C CD1   . LEU E 3 117 ? 25.739 19.149 -6.718  1.00 11.28 ? 124 LEU A CD1   1 
ATOM   2202 C CD2   . LEU E 3 117 ? 27.215 17.384 -5.802  1.00 7.97  ? 124 LEU A CD2   1 
ATOM   2203 N N     . GLN E 3 118 ? 30.003 16.424 -7.572  1.00 8.74  ? 125 GLN A N     1 
ATOM   2204 C CA    . GLN E 3 118 ? 30.408 15.167 -6.988  1.00 11.17 ? 125 GLN A CA    1 
ATOM   2205 C C     . GLN E 3 118 ? 31.782 15.356 -6.315  1.00 10.99 ? 125 GLN A C     1 
ATOM   2206 O O     . GLN E 3 118 ? 31.992 14.908 -5.196  1.00 10.99 ? 125 GLN A O     1 
ATOM   2207 C CB    . GLN E 3 118 ? 30.521 14.086 -8.072  1.00 14.80 ? 125 GLN A CB    1 
ATOM   2208 C CG    . GLN E 3 118 ? 29.325 13.953 -9.016  1.00 17.93 ? 125 GLN A CG    1 
ATOM   2209 C CD    . GLN E 3 118 ? 29.604 13.020 -10.222 1.00 22.13 ? 125 GLN A CD    1 
ATOM   2210 O OE1   . GLN E 3 118 ? 28.752 12.882 -11.109 1.00 22.88 ? 125 GLN A OE1   1 
ATOM   2211 N NE2   . GLN E 3 118 ? 30.792 12.382 -10.250 1.00 18.63 ? 125 GLN A NE2   1 
ATOM   2212 N N     . VAL E 3 119 ? 32.689 16.038 -7.011  1.00 9.16  ? 126 VAL A N     1 
ATOM   2213 C CA    . VAL E 3 119 ? 34.056 16.291 -6.553  1.00 8.85  ? 126 VAL A CA    1 
ATOM   2214 C C     . VAL E 3 119 ? 34.208 17.189 -5.314  1.00 9.64  ? 126 VAL A C     1 
ATOM   2215 O O     . VAL E 3 119 ? 34.802 16.803 -4.308  1.00 8.15  ? 126 VAL A O     1 
ATOM   2216 C CB    . VAL E 3 119 ? 34.916 16.919 -7.709  1.00 7.43  ? 126 VAL A CB    1 
ATOM   2217 C CG1   . VAL E 3 119 ? 36.352 17.014 -7.285  1.00 4.33  ? 126 VAL A CG1   1 
ATOM   2218 C CG2   . VAL E 3 119 ? 34.804 16.102 -8.971  1.00 3.11  ? 126 VAL A CG2   1 
ATOM   2219 N N     . THR E 3 120 ? 33.708 18.410 -5.414  1.00 10.82 ? 127 THR A N     1 
ATOM   2220 C CA    . THR E 3 120 ? 33.812 19.338 -4.310  1.00 13.26 ? 127 THR A CA    1 
ATOM   2221 C C     . THR E 3 120 ? 33.124 18.734 -3.113  1.00 14.98 ? 127 THR A C     1 
ATOM   2222 O O     . THR E 3 120 ? 33.323 19.141 -1.966  1.00 16.31 ? 127 THR A O     1 
ATOM   2223 C CB    . THR E 3 120 ? 33.117 20.687 -4.618  1.00 13.53 ? 127 THR A CB    1 
ATOM   2224 O OG1   . THR E 3 120 ? 33.988 21.538 -5.394  1.00 13.81 ? 127 THR A OG1   1 
ATOM   2225 C CG2   . THR E 3 120 ? 32.751 21.383 -3.294  1.00 13.23 ? 127 THR A CG2   1 
ATOM   2226 N N     . SER E 3 121 ? 32.287 17.758 -3.400  1.00 16.22 ? 128 SER A N     1 
ATOM   2227 C CA    . SER E 3 121 ? 31.522 17.120 -2.371  1.00 16.51 ? 128 SER A CA    1 
ATOM   2228 C C     . SER E 3 121 ? 32.492 16.301 -1.568  1.00 17.02 ? 128 SER A C     1 
ATOM   2229 O O     . SER E 3 121 ? 32.482 16.322 -0.348  1.00 18.37 ? 128 SER A O     1 
ATOM   2230 C CB    . SER E 3 121 ? 30.448 16.250 -3.011  1.00 15.24 ? 128 SER A CB    1 
ATOM   2231 O OG    . SER E 3 121 ? 29.515 15.825 -2.041  1.00 17.29 ? 128 SER A OG    1 
ATOM   2232 N N     . GLU E 3 122 ? 33.349 15.589 -2.278  1.00 18.34 ? 129 GLU A N     1 
ATOM   2233 C CA    . GLU E 3 122 ? 34.347 14.749 -1.656  1.00 18.29 ? 129 GLU A CA    1 
ATOM   2234 C C     . GLU E 3 122 ? 35.364 15.623 -0.885  1.00 18.31 ? 129 GLU A C     1 
ATOM   2235 O O     . GLU E 3 122 ? 35.950 15.176 0.111   1.00 20.35 ? 129 GLU A O     1 
ATOM   2236 C CB    . GLU E 3 122 ? 35.038 13.914 -2.738  1.00 19.11 ? 129 GLU A CB    1 
ATOM   2237 C CG    . GLU E 3 122 ? 35.778 12.702 -2.201  1.00 23.09 ? 129 GLU A CG    1 
ATOM   2238 C CD    . GLU E 3 122 ? 36.360 11.812 -3.298  1.00 25.41 ? 129 GLU A CD    1 
ATOM   2239 O OE1   . GLU E 3 122 ? 37.214 12.298 -4.086  1.00 23.28 ? 129 GLU A OE1   1 
ATOM   2240 O OE2   . GLU E 3 122 ? 35.954 10.622 -3.355  1.00 25.24 ? 129 GLU A OE2   1 
ATOM   2241 N N     . LYS E 3 123 ? 35.576 16.864 -1.327  1.00 14.06 ? 130 LYS A N     1 
ATOM   2242 C CA    . LYS E 3 123 ? 36.507 17.716 -0.612  1.00 10.97 ? 130 LYS A CA    1 
ATOM   2243 C C     . LYS E 3 123 ? 36.007 17.752 0.812   1.00 8.74  ? 130 LYS A C     1 
ATOM   2244 O O     . LYS E 3 123 ? 36.744 17.491 1.745   1.00 10.63 ? 130 LYS A O     1 
ATOM   2245 C CB    . LYS E 3 123 ? 36.527 19.128 -1.200  1.00 11.89 ? 130 LYS A CB    1 
ATOM   2246 C CG    . LYS E 3 123 ? 37.798 19.973 -0.887  1.00 11.54 ? 130 LYS A CG    1 
ATOM   2247 C CD    . LYS E 3 123 ? 39.078 19.452 -1.582  1.00 14.37 ? 130 LYS A CD    1 
ATOM   2248 C CE    . LYS E 3 123 ? 40.200 20.528 -1.630  1.00 16.10 ? 130 LYS A CE    1 
ATOM   2249 N NZ    . LYS E 3 123 ? 41.317 20.180 -2.563  1.00 15.61 ? 130 LYS A NZ    1 
ATOM   2250 N N     . VAL E 3 124 ? 34.733 18.054 0.968   1.00 7.01  ? 131 VAL A N     1 
ATOM   2251 C CA    . VAL E 3 124 ? 34.093 18.119 2.273   1.00 4.52  ? 131 VAL A CA    1 
ATOM   2252 C C     . VAL E 3 124 ? 34.321 16.862 3.100   1.00 5.24  ? 131 VAL A C     1 
ATOM   2253 O O     . VAL E 3 124 ? 34.497 16.933 4.311   1.00 3.98  ? 131 VAL A O     1 
ATOM   2254 C CB    . VAL E 3 124 ? 32.615 18.276 2.092   1.00 2.14  ? 131 VAL A CB    1 
ATOM   2255 C CG1   . VAL E 3 124 ? 31.967 18.755 3.344   1.00 2.07  ? 131 VAL A CG1   1 
ATOM   2256 C CG2   . VAL E 3 124 ? 32.376 19.197 0.988   1.00 6.15  ? 131 VAL A CG2   1 
ATOM   2257 N N     . GLY E 3 125 ? 34.323 15.715 2.430   1.00 6.14  ? 132 GLY A N     1 
ATOM   2258 C CA    . GLY E 3 125 ? 34.488 14.443 3.109   1.00 9.20  ? 132 GLY A CA    1 
ATOM   2259 C C     . GLY E 3 125 ? 35.898 14.024 3.474   1.00 11.94 ? 132 GLY A C     1 
ATOM   2260 O O     . GLY E 3 125 ? 36.089 13.237 4.397   1.00 12.34 ? 132 GLY A O     1 
ATOM   2261 N N     . ASN E 3 126 ? 36.888 14.523 2.742   1.00 13.86 ? 133 ASN A N     1 
ATOM   2262 C CA    . ASN E 3 126 ? 38.270 14.195 3.043   1.00 15.61 ? 133 ASN A CA    1 
ATOM   2263 C C     . ASN E 3 126 ? 38.680 15.092 4.192   1.00 14.61 ? 133 ASN A C     1 
ATOM   2264 O O     . ASN E 3 126 ? 39.542 14.757 5.002   1.00 14.60 ? 133 ASN A O     1 
ATOM   2265 C CB    . ASN E 3 126 ? 39.170 14.475 1.832   1.00 18.07 ? 133 ASN A CB    1 
ATOM   2266 C CG    . ASN E 3 126 ? 38.988 13.459 0.725   1.00 20.95 ? 133 ASN A CG    1 
ATOM   2267 O OD1   . ASN E 3 126 ? 39.693 13.495 -0.290  1.00 21.43 ? 133 ASN A OD1   1 
ATOM   2268 N ND2   . ASN E 3 126 ? 38.034 12.541 0.911   1.00 20.95 ? 133 ASN A ND2   1 
ATOM   2269 N N     . LEU E 3 127 ? 38.014 16.232 4.263   1.00 12.86 ? 134 LEU A N     1 
ATOM   2270 C CA    . LEU E 3 127 ? 38.324 17.223 5.256   1.00 11.78 ? 134 LEU A CA    1 
ATOM   2271 C C     . LEU E 3 127 ? 37.817 16.927 6.649   1.00 13.00 ? 134 LEU A C     1 
ATOM   2272 O O     . LEU E 3 127 ? 38.535 17.150 7.629   1.00 16.75 ? 134 LEU A O     1 
ATOM   2273 C CB    . LEU E 3 127 ? 37.822 18.587 4.774   1.00 8.70  ? 134 LEU A CB    1 
ATOM   2274 C CG    . LEU E 3 127 ? 38.941 19.606 4.609   1.00 6.33  ? 134 LEU A CG    1 
ATOM   2275 C CD1   . LEU E 3 127 ? 38.432 20.912 4.028   1.00 5.37  ? 134 LEU A CD1   1 
ATOM   2276 C CD2   . LEU E 3 127 ? 39.573 19.821 5.972   1.00 6.21  ? 134 LEU A CD2   1 
ATOM   2277 N N     . ALA E 3 128 ? 36.597 16.424 6.760   1.00 11.55 ? 135 ALA A N     1 
ATOM   2278 C CA    . ALA E 3 128 ? 36.053 16.145 8.073   1.00 10.88 ? 135 ALA A CA    1 
ATOM   2279 C C     . ALA E 3 128 ? 36.374 14.743 8.486   1.00 10.71 ? 135 ALA A C     1 
ATOM   2280 O O     . ALA E 3 128 ? 36.299 14.401 9.651   1.00 10.91 ? 135 ALA A O     1 
ATOM   2281 C CB    . ALA E 3 128 ? 34.553 16.356 8.072   1.00 11.15 ? 135 ALA A CB    1 
ATOM   2282 N N     . PHE E 3 129 ? 36.748 13.924 7.528   1.00 11.72 ? 136 PHE A N     1 
ATOM   2283 C CA    . PHE E 3 129 ? 37.047 12.548 7.843   1.00 15.10 ? 136 PHE A CA    1 
ATOM   2284 C C     . PHE E 3 129 ? 38.518 12.184 8.006   1.00 16.87 ? 136 PHE A C     1 
ATOM   2285 O O     . PHE E 3 129 ? 38.877 11.384 8.879   1.00 16.76 ? 136 PHE A O     1 
ATOM   2286 C CB    . PHE E 3 129 ? 36.435 11.636 6.775   1.00 15.23 ? 136 PHE A CB    1 
ATOM   2287 C CG    . PHE E 3 129 ? 34.963 11.482 6.890   1.00 16.52 ? 136 PHE A CG    1 
ATOM   2288 C CD1   . PHE E 3 129 ? 34.330 11.661 8.115   1.00 16.74 ? 136 PHE A CD1   1 
ATOM   2289 C CD2   . PHE E 3 129 ? 34.209 11.105 5.792   1.00 17.88 ? 136 PHE A CD2   1 
ATOM   2290 C CE1   . PHE E 3 129 ? 32.969 11.466 8.250   1.00 16.99 ? 136 PHE A CE1   1 
ATOM   2291 C CE2   . PHE E 3 129 ? 32.841 10.905 5.908   1.00 19.05 ? 136 PHE A CE2   1 
ATOM   2292 C CZ    . PHE E 3 129 ? 32.220 11.087 7.149   1.00 19.48 ? 136 PHE A CZ    1 
ATOM   2293 N N     . LEU E 3 130 ? 39.362 12.761 7.158   1.00 16.82 ? 137 LEU A N     1 
ATOM   2294 C CA    . LEU E 3 130 ? 40.769 12.434 7.169   1.00 18.24 ? 137 LEU A CA    1 
ATOM   2295 C C     . LEU E 3 130 ? 41.632 13.425 7.886   1.00 19.50 ? 137 LEU A C     1 
ATOM   2296 O O     . LEU E 3 130 ? 41.254 14.567 8.096   1.00 19.54 ? 137 LEU A O     1 
ATOM   2297 C CB    . LEU E 3 130 ? 41.253 12.283 5.733   1.00 18.14 ? 137 LEU A CB    1 
ATOM   2298 C CG    . LEU E 3 130 ? 40.159 11.570 4.952   1.00 18.34 ? 137 LEU A CG    1 
ATOM   2299 C CD1   . LEU E 3 130 ? 40.339 11.717 3.473   1.00 21.34 ? 137 LEU A CD1   1 
ATOM   2300 C CD2   . LEU E 3 130 ? 40.154 10.135 5.355   1.00 19.55 ? 137 LEU A CD2   1 
ATOM   2301 N N     . ASP E 3 131 ? 42.809 12.948 8.260   1.00 22.60 ? 138 ASP A N     1 
ATOM   2302 C CA    . ASP E 3 131 ? 43.834 13.731 8.942   1.00 25.32 ? 138 ASP A CA    1 
ATOM   2303 C C     . ASP E 3 131 ? 44.720 14.354 7.864   1.00 25.61 ? 138 ASP A C     1 
ATOM   2304 O O     . ASP E 3 131 ? 44.799 13.855 6.734   1.00 25.79 ? 138 ASP A O     1 
ATOM   2305 C CB    . ASP E 3 131 ? 44.678 12.796 9.775   1.00 27.24 ? 138 ASP A CB    1 
ATOM   2306 C CG    . ASP E 3 131 ? 44.874 11.483 9.081   1.00 30.30 ? 138 ASP A CG    1 
ATOM   2307 O OD1   . ASP E 3 131 ? 43.850 10.777 8.920   1.00 30.55 ? 138 ASP A OD1   1 
ATOM   2308 O OD2   . ASP E 3 131 ? 46.015 11.173 8.669   1.00 31.19 ? 138 ASP A OD2   1 
ATOM   2309 N N     . VAL E 3 132 ? 45.405 15.429 8.229   1.00 25.79 ? 139 VAL A N     1 
ATOM   2310 C CA    . VAL E 3 132 ? 46.277 16.125 7.294   1.00 24.80 ? 139 VAL A CA    1 
ATOM   2311 C C     . VAL E 3 132 ? 47.058 15.120 6.460   1.00 23.88 ? 139 VAL A C     1 
ATOM   2312 O O     . VAL E 3 132 ? 47.222 15.293 5.250   1.00 23.81 ? 139 VAL A O     1 
ATOM   2313 C CB    . VAL E 3 132 ? 47.259 17.071 8.027   1.00 25.70 ? 139 VAL A CB    1 
ATOM   2314 C CG1   . VAL E 3 132 ? 48.542 16.326 8.436   1.00 23.33 ? 139 VAL A CG1   1 
ATOM   2315 C CG2   . VAL E 3 132 ? 47.555 18.261 7.138   1.00 25.03 ? 139 VAL A CG2   1 
ATOM   2316 N N     . THR E 3 133 ? 47.539 14.063 7.094   1.00 20.99 ? 140 THR A N     1 
ATOM   2317 C CA    . THR E 3 133 ? 48.254 13.082 6.325   1.00 19.62 ? 140 THR A CA    1 
ATOM   2318 C C     . THR E 3 133 ? 47.289 12.589 5.269   1.00 19.48 ? 140 THR A C     1 
ATOM   2319 O O     . THR E 3 133 ? 47.354 13.023 4.120   1.00 18.13 ? 140 THR A O     1 
ATOM   2320 C CB    . THR E 3 133 ? 48.741 11.925 7.197   1.00 19.02 ? 140 THR A CB    1 
ATOM   2321 O OG1   . THR E 3 133 ? 49.782 12.410 8.049   1.00 17.57 ? 140 THR A OG1   1 
ATOM   2322 C CG2   . THR E 3 133 ? 49.278 10.791 6.342   1.00 17.33 ? 140 THR A CG2   1 
ATOM   2323 N N     . GLY E 3 134 ? 46.374 11.716 5.667   1.00 19.21 ? 141 GLY A N     1 
ATOM   2324 C CA    . GLY E 3 134 ? 45.417 11.182 4.717   1.00 20.26 ? 141 GLY A CA    1 
ATOM   2325 C C     . GLY E 3 134 ? 45.082 12.125 3.577   1.00 21.98 ? 141 GLY A C     1 
ATOM   2326 O O     . GLY E 3 134 ? 44.989 11.703 2.417   1.00 23.05 ? 141 GLY A O     1 
ATOM   2327 N N     . ARG E 3 135 ? 44.919 13.405 3.908   1.00 21.65 ? 142 ARG A N     1 
ATOM   2328 C CA    . ARG E 3 135 ? 44.581 14.424 2.922   1.00 21.70 ? 142 ARG A CA    1 
ATOM   2329 C C     . ARG E 3 135 ? 45.728 14.856 2.025   1.00 22.77 ? 142 ARG A C     1 
ATOM   2330 O O     . ARG E 3 135 ? 45.536 15.664 1.112   1.00 23.19 ? 142 ARG A O     1 
ATOM   2331 C CB    . ARG E 3 135 ? 43.994 15.654 3.618   1.00 20.18 ? 142 ARG A CB    1 
ATOM   2332 C CG    . ARG E 3 135 ? 42.601 15.421 4.151   1.00 20.80 ? 142 ARG A CG    1 
ATOM   2333 C CD    . ARG E 3 135 ? 42.046 16.642 4.824   1.00 19.00 ? 142 ARG A CD    1 
ATOM   2334 N NE    . ARG E 3 135 ? 42.480 16.728 6.209   1.00 17.42 ? 142 ARG A NE    1 
ATOM   2335 C CZ    . ARG E 3 135 ? 42.993 17.825 6.739   1.00 18.05 ? 142 ARG A CZ    1 
ATOM   2336 N NH1   . ARG E 3 135 ? 43.136 18.903 5.990   1.00 17.77 ? 142 ARG A NH1   1 
ATOM   2337 N NH2   . ARG E 3 135 ? 43.340 17.856 8.015   1.00 19.42 ? 142 ARG A NH2   1 
ATOM   2338 N N     . ILE E 3 136 ? 46.922 14.349 2.295   1.00 22.67 ? 143 ILE A N     1 
ATOM   2339 C CA    . ILE E 3 136 ? 48.068 14.700 1.484   1.00 24.19 ? 143 ILE A CA    1 
ATOM   2340 C C     . ILE E 3 136 ? 48.252 13.512 0.573   1.00 26.66 ? 143 ILE A C     1 
ATOM   2341 O O     . ILE E 3 136 ? 48.527 13.648 -0.616  1.00 27.72 ? 143 ILE A O     1 
ATOM   2342 C CB    . ILE E 3 136 ? 49.319 14.920 2.345   1.00 23.65 ? 143 ILE A CB    1 
ATOM   2343 C CG1   . ILE E 3 136 ? 49.171 16.224 3.140   1.00 24.93 ? 143 ILE A CG1   1 
ATOM   2344 C CG2   . ILE E 3 136 ? 50.552 14.955 1.466   1.00 22.76 ? 143 ILE A CG2   1 
ATOM   2345 C CD1   . ILE E 3 136 ? 50.350 16.556 4.053   1.00 22.81 ? 143 ILE A CD1   1 
ATOM   2346 N N     . ALA E 3 137 ? 48.085 12.334 1.154   1.00 27.94 ? 144 ALA A N     1 
ATOM   2347 C CA    . ALA E 3 137 ? 48.186 11.105 0.408   1.00 27.71 ? 144 ALA A CA    1 
ATOM   2348 C C     . ALA E 3 137 ? 47.108 11.178 -0.677  1.00 28.89 ? 144 ALA A C     1 
ATOM   2349 O O     . ALA E 3 137 ? 47.357 10.872 -1.843  1.00 30.37 ? 144 ALA A O     1 
ATOM   2350 C CB    . ALA E 3 137 ? 47.927 9.944  1.325   1.00 28.12 ? 144 ALA A CB    1 
ATOM   2351 N N     . GLN E 3 138 ? 45.905 11.588 -0.296  1.00 27.08 ? 145 GLN A N     1 
ATOM   2352 C CA    . GLN E 3 138 ? 44.839 11.695 -1.273  1.00 27.30 ? 145 GLN A CA    1 
ATOM   2353 C C     . GLN E 3 138 ? 45.050 12.854 -2.250  1.00 28.26 ? 145 GLN A C     1 
ATOM   2354 O O     . GLN E 3 138 ? 44.493 12.855 -3.357  1.00 28.00 ? 145 GLN A O     1 
ATOM   2355 C CB    . GLN E 3 138 ? 43.490 11.836 -0.567  1.00 26.99 ? 145 GLN A CB    1 
ATOM   2356 C CG    . GLN E 3 138 ? 42.825 10.502 -0.310  1.00 26.22 ? 145 GLN A CG    1 
ATOM   2357 C CD    . GLN E 3 138 ? 42.578 9.773  -1.606  1.00 25.21 ? 145 GLN A CD    1 
ATOM   2358 O OE1   . GLN E 3 138 ? 42.872 8.584  -1.739  1.00 25.28 ? 145 GLN A OE1   1 
ATOM   2359 N NE2   . GLN E 3 138 ? 42.046 10.490 -2.578  1.00 23.57 ? 145 GLN A NE2   1 
ATOM   2360 N N     . THR E 3 139 ? 45.862 13.830 -1.841  1.00 27.67 ? 146 THR A N     1 
ATOM   2361 C CA    . THR E 3 139 ? 46.159 14.993 -2.674  1.00 25.95 ? 146 THR A CA    1 
ATOM   2362 C C     . THR E 3 139 ? 47.256 14.709 -3.682  1.00 25.18 ? 146 THR A C     1 
ATOM   2363 O O     . THR E 3 139 ? 47.222 15.218 -4.795  1.00 25.13 ? 146 THR A O     1 
ATOM   2364 C CB    . THR E 3 139 ? 46.607 16.192 -1.833  1.00 25.87 ? 146 THR A CB    1 
ATOM   2365 O OG1   . THR E 3 139 ? 45.487 16.709 -1.112  1.00 25.83 ? 146 THR A OG1   1 
ATOM   2366 C CG2   . THR E 3 139 ? 47.207 17.290 -2.729  1.00 25.26 ? 146 THR A CG2   1 
ATOM   2367 N N     . LEU E 3 140 ? 48.234 13.903 -3.287  1.00 25.42 ? 147 LEU A N     1 
ATOM   2368 C CA    . LEU E 3 140 ? 49.337 13.574 -4.170  1.00 24.16 ? 147 LEU A CA    1 
ATOM   2369 C C     . LEU E 3 140 ? 48.853 12.828 -5.389  1.00 25.30 ? 147 LEU A C     1 
ATOM   2370 O O     . LEU E 3 140 ? 49.200 13.177 -6.525  1.00 25.25 ? 147 LEU A O     1 
ATOM   2371 C CB    . LEU E 3 140 ? 50.369 12.756 -3.420  1.00 22.32 ? 147 LEU A CB    1 
ATOM   2372 C CG    . LEU E 3 140 ? 51.441 13.631 -2.777  1.00 23.18 ? 147 LEU A CG    1 
ATOM   2373 C CD1   . LEU E 3 140 ? 51.143 15.104 -3.047  1.00 22.24 ? 147 LEU A CD1   1 
ATOM   2374 C CD2   . LEU E 3 140 ? 51.506 13.351 -1.288  1.00 22.92 ? 147 LEU A CD2   1 
ATOM   2375 N N     . LEU E 3 141 ? 48.039 11.808 -5.148  1.00 24.84 ? 148 LEU A N     1 
ATOM   2376 C CA    . LEU E 3 141 ? 47.482 11.013 -6.217  1.00 25.31 ? 148 LEU A CA    1 
ATOM   2377 C C     . LEU E 3 141 ? 46.524 11.885 -7.026  1.00 26.85 ? 148 LEU A C     1 
ATOM   2378 O O     . LEU E 3 141 ? 46.527 11.852 -8.260  1.00 27.64 ? 148 LEU A O     1 
ATOM   2379 C CB    . LEU E 3 141 ? 46.769 9.792  -5.620  1.00 25.21 ? 148 LEU A CB    1 
ATOM   2380 C CG    . LEU E 3 141 ? 45.711 8.967  -6.376  1.00 24.72 ? 148 LEU A CG    1 
ATOM   2381 C CD1   . LEU E 3 141 ? 45.565 7.610  -5.684  1.00 22.91 ? 148 LEU A CD1   1 
ATOM   2382 C CD2   . LEU E 3 141 ? 44.348 9.706  -6.406  1.00 26.03 ? 148 LEU A CD2   1 
ATOM   2383 N N     . ASN E 3 142 ? 45.717 12.683 -6.338  1.00 28.32 ? 149 ASN A N     1 
ATOM   2384 C CA    . ASN E 3 142 ? 44.759 13.547 -7.023  1.00 30.35 ? 149 ASN A CA    1 
ATOM   2385 C C     . ASN E 3 142 ? 45.451 14.298 -8.158  1.00 30.88 ? 149 ASN A C     1 
ATOM   2386 O O     . ASN E 3 142 ? 44.955 14.359 -9.276  1.00 30.53 ? 149 ASN A O     1 
ATOM   2387 C CB    . ASN E 3 142 ? 44.150 14.552 -6.043  1.00 31.48 ? 149 ASN A CB    1 
ATOM   2388 C CG    . ASN E 3 142 ? 42.777 15.021 -6.473  1.00 31.90 ? 149 ASN A CG    1 
ATOM   2389 O OD1   . ASN E 3 142 ? 41.871 14.207 -6.647  1.00 32.85 ? 149 ASN A OD1   1 
ATOM   2390 N ND2   . ASN E 3 142 ? 42.611 16.336 -6.643  1.00 32.14 ? 149 ASN A ND2   1 
ATOM   2391 N N     . LEU E 3 143 ? 46.614 14.859 -7.852  1.00 32.29 ? 150 LEU A N     1 
ATOM   2392 C CA    . LEU E 3 143 ? 47.401 15.613 -8.823  1.00 31.89 ? 150 LEU A CA    1 
ATOM   2393 C C     . LEU E 3 143 ? 48.183 14.709 -9.767  1.00 32.13 ? 150 LEU A C     1 
ATOM   2394 O O     . LEU E 3 143 ? 48.222 14.938 -10.979 1.00 31.05 ? 150 LEU A O     1 
ATOM   2395 C CB    . LEU E 3 143 ? 48.379 16.538 -8.098  1.00 30.24 ? 150 LEU A CB    1 
ATOM   2396 C CG    . LEU E 3 143 ? 47.870 17.891 -7.618  1.00 29.93 ? 150 LEU A CG    1 
ATOM   2397 C CD1   . LEU E 3 143 ? 49.045 18.700 -7.074  1.00 30.42 ? 150 LEU A CD1   1 
ATOM   2398 C CD2   . LEU E 3 143 ? 47.211 18.635 -8.772  1.00 30.39 ? 150 LEU A CD2   1 
ATOM   2399 N N     . ALA E 3 144 ? 48.814 13.692 -9.199  1.00 32.63 ? 151 ALA A N     1 
ATOM   2400 C CA    . ALA E 3 144 ? 49.615 12.758 -9.974  1.00 34.93 ? 151 ALA A CA    1 
ATOM   2401 C C     . ALA E 3 144 ? 48.938 12.324 -11.259 1.00 36.51 ? 151 ALA A C     1 
ATOM   2402 O O     . ALA E 3 144 ? 49.579 11.736 -12.125 1.00 37.00 ? 151 ALA A O     1 
ATOM   2403 C CB    . ALA E 3 144 ? 49.943 11.534 -9.134  1.00 34.78 ? 151 ALA A CB    1 
ATOM   2404 N N     . LYS E 3 145 ? 47.646 12.614 -11.391 1.00 38.41 ? 152 LYS A N     1 
ATOM   2405 C CA    . LYS E 3 145 ? 46.908 12.211 -12.582 1.00 38.48 ? 152 LYS A CA    1 
ATOM   2406 C C     . LYS E 3 145 ? 45.989 13.274 -13.202 1.00 39.18 ? 152 LYS A C     1 
ATOM   2407 O O     . LYS E 3 145 ? 44.780 13.070 -13.345 1.00 40.16 ? 152 LYS A O     1 
ATOM   2408 C CB    . LYS E 3 145 ? 46.127 10.931 -12.268 1.00 38.41 ? 152 LYS A CB    1 
ATOM   2409 C CG    . LYS E 3 145 ? 45.334 10.967 -10.964 1.00 38.68 ? 152 LYS A CG    1 
ATOM   2410 C CD    . LYS E 3 145 ? 43.837 11.014 -11.243 1.00 37.71 ? 152 LYS A CD    1 
ATOM   2411 C CE    . LYS E 3 145 ? 43.034 11.162 -9.969  1.00 38.93 ? 152 LYS A CE    1 
ATOM   2412 N NZ    . LYS E 3 145 ? 43.278 12.462 -9.285  1.00 38.79 ? 152 LYS A NZ    1 
ATOM   2413 N N     . GLN E 3 146 ? 46.577 14.407 -13.582 1.00 39.26 ? 153 GLN A N     1 
ATOM   2414 C CA    . GLN E 3 146 ? 45.833 15.492 -14.212 1.00 39.21 ? 153 GLN A CA    1 
ATOM   2415 C C     . GLN E 3 146 ? 46.650 15.933 -15.424 1.00 40.88 ? 153 GLN A C     1 
ATOM   2416 O O     . GLN E 3 146 ? 47.808 15.558 -15.565 1.00 40.97 ? 153 GLN A O     1 
ATOM   2417 C CB    . GLN E 3 146 ? 45.671 16.663 -13.241 1.00 37.77 ? 153 GLN A CB    1 
ATOM   2418 C CG    . GLN E 3 146 ? 44.366 17.436 -13.398 1.00 35.83 ? 153 GLN A CG    1 
ATOM   2419 C CD    . GLN E 3 146 ? 44.339 18.727 -12.600 1.00 33.70 ? 153 GLN A CD    1 
ATOM   2420 O OE1   . GLN E 3 146 ? 44.566 18.722 -11.402 1.00 34.35 ? 153 GLN A OE1   1 
ATOM   2421 N NE2   . GLN E 3 146 ? 44.053 19.837 -13.267 1.00 32.17 ? 153 GLN A NE2   1 
ATOM   2422 N N     . PRO E 3 147 ? 46.046 16.715 -16.329 1.00 42.76 ? 154 PRO A N     1 
ATOM   2423 C CA    . PRO E 3 147 ? 46.728 17.207 -17.530 1.00 43.48 ? 154 PRO A CA    1 
ATOM   2424 C C     . PRO E 3 147 ? 47.997 17.985 -17.228 1.00 44.76 ? 154 PRO A C     1 
ATOM   2425 O O     . PRO E 3 147 ? 48.005 19.212 -17.352 1.00 45.41 ? 154 PRO A O     1 
ATOM   2426 C CB    . PRO E 3 147 ? 45.677 18.101 -18.172 1.00 43.07 ? 154 PRO A CB    1 
ATOM   2427 C CG    . PRO E 3 147 ? 44.402 17.396 -17.836 1.00 43.25 ? 154 PRO A CG    1 
ATOM   2428 C CD    . PRO E 3 147 ? 44.599 17.008 -16.394 1.00 43.20 ? 154 PRO A CD    1 
ATOM   2429 N N     . ASP E 3 148 ? 49.056 17.282 -16.829 1.00 46.13 ? 155 ASP A N     1 
ATOM   2430 C CA    . ASP E 3 148 ? 50.339 17.922 -16.524 1.00 48.28 ? 155 ASP A CA    1 
ATOM   2431 C C     . ASP E 3 148 ? 51.271 17.050 -15.689 1.00 48.29 ? 155 ASP A C     1 
ATOM   2432 O O     . ASP E 3 148 ? 52.240 17.552 -15.110 1.00 47.51 ? 155 ASP A O     1 
ATOM   2433 C CB    . ASP E 3 148 ? 50.147 19.234 -15.763 1.00 49.85 ? 155 ASP A CB    1 
ATOM   2434 C CG    . ASP E 3 148 ? 50.102 19.023 -14.261 1.00 51.94 ? 155 ASP A CG    1 
ATOM   2435 O OD1   . ASP E 3 148 ? 50.570 19.922 -13.525 1.00 53.01 ? 155 ASP A OD1   1 
ATOM   2436 O OD2   . ASP E 3 148 ? 49.600 17.958 -13.823 1.00 51.48 ? 155 ASP A OD2   1 
ATOM   2437 N N     . ALA E 3 149 ? 50.981 15.757 -15.614 1.00 48.80 ? 156 ALA A N     1 
ATOM   2438 C CA    . ALA E 3 149 ? 51.817 14.843 -14.839 1.00 49.44 ? 156 ALA A CA    1 
ATOM   2439 C C     . ALA E 3 149 ? 52.821 14.051 -15.704 1.00 50.07 ? 156 ALA A C     1 
ATOM   2440 O O     . ALA E 3 149 ? 52.564 12.901 -16.079 1.00 49.80 ? 156 ALA A O     1 
ATOM   2441 C CB    . ALA E 3 149 ? 50.926 13.888 -14.051 1.00 49.09 ? 156 ALA A CB    1 
ATOM   2442 N N     . MET E 3 150 ? 53.964 14.666 -16.014 1.00 49.93 ? 157 MET A N     1 
ATOM   2443 C CA    . MET E 3 150 ? 54.991 14.012 -16.829 1.00 50.65 ? 157 MET A CA    1 
ATOM   2444 C C     . MET E 3 150 ? 55.278 12.603 -16.316 1.00 51.24 ? 157 MET A C     1 
ATOM   2445 O O     . MET E 3 150 ? 55.329 12.372 -15.105 1.00 51.65 ? 157 MET A O     1 
ATOM   2446 C CB    . MET E 3 150 ? 56.290 14.833 -16.829 1.00 49.68 ? 157 MET A CB    1 
ATOM   2447 C CG    . MET E 3 150 ? 56.343 15.993 -17.836 1.00 49.06 ? 157 MET A CG    1 
ATOM   2448 S SD    . MET E 3 150 ? 55.008 17.227 -17.700 1.00 48.89 ? 157 MET A SD    1 
ATOM   2449 C CE    . MET E 3 150 ? 55.161 17.723 -15.985 1.00 50.25 ? 157 MET A CE    1 
ATOM   2450 N N     . THR E 3 151 ? 55.468 11.663 -17.240 1.00 51.69 ? 158 THR A N     1 
ATOM   2451 C CA    . THR E 3 151 ? 55.736 10.275 -16.867 1.00 51.33 ? 158 THR A CA    1 
ATOM   2452 C C     . THR E 3 151 ? 57.187 10.073 -16.480 1.00 50.72 ? 158 THR A C     1 
ATOM   2453 O O     . THR E 3 151 ? 58.093 10.429 -17.224 1.00 50.41 ? 158 THR A O     1 
ATOM   2454 C CB    . THR E 3 151 ? 55.409 9.275  -18.014 1.00 51.74 ? 158 THR A CB    1 
ATOM   2455 O OG1   . THR E 3 151 ? 56.592 9.020  -18.790 1.00 50.41 ? 158 THR A OG1   1 
ATOM   2456 C CG2   . THR E 3 151 ? 54.300 9.838  -18.918 1.00 51.27 ? 158 THR A CG2   1 
ATOM   2457 N N     . HIS E 3 152 ? 57.384 9.513  -15.296 1.00 50.56 ? 159 HIS A N     1 
ATOM   2458 C CA    . HIS E 3 152 ? 58.702 9.209  -14.765 1.00 51.27 ? 159 HIS A CA    1 
ATOM   2459 C C     . HIS E 3 152 ? 58.767 7.699  -14.968 1.00 51.62 ? 159 HIS A C     1 
ATOM   2460 O O     . HIS E 3 152 ? 57.727 7.041  -14.960 1.00 51.89 ? 159 HIS A O     1 
ATOM   2461 C CB    . HIS E 3 152 ? 58.726 9.579  -13.284 1.00 52.46 ? 159 HIS A CB    1 
ATOM   2462 C CG    . HIS E 3 152 ? 59.985 9.205  -12.566 1.00 52.55 ? 159 HIS A CG    1 
ATOM   2463 N ND1   . HIS E 3 152 ? 60.303 7.902  -12.246 1.00 52.85 ? 159 HIS A ND1   1 
ATOM   2464 C CD2   . HIS E 3 152 ? 60.972 9.972  -12.043 1.00 53.09 ? 159 HIS A CD2   1 
ATOM   2465 C CE1   . HIS E 3 152 ? 61.428 7.884  -11.553 1.00 53.36 ? 159 HIS A CE1   1 
ATOM   2466 N NE2   . HIS E 3 152 ? 61.854 9.127  -11.414 1.00 53.58 ? 159 HIS A NE2   1 
ATOM   2467 N N     . PRO E 3 153 ? 59.968 7.129  -15.181 1.00 51.24 ? 160 PRO A N     1 
ATOM   2468 C CA    . PRO E 3 153 ? 59.991 5.677  -15.375 1.00 50.83 ? 160 PRO A CA    1 
ATOM   2469 C C     . PRO E 3 153 ? 59.019 4.949  -14.459 1.00 50.27 ? 160 PRO A C     1 
ATOM   2470 O O     . PRO E 3 153 ? 58.319 4.033  -14.894 1.00 51.64 ? 160 PRO A O     1 
ATOM   2471 C CB    . PRO E 3 153 ? 61.457 5.304  -15.118 1.00 50.84 ? 160 PRO A CB    1 
ATOM   2472 C CG    . PRO E 3 153 ? 62.021 6.491  -14.373 1.00 50.89 ? 160 PRO A CG    1 
ATOM   2473 C CD    . PRO E 3 153 ? 61.334 7.649  -15.036 1.00 51.25 ? 160 PRO A CD    1 
ATOM   2474 N N     . ASP E 3 154 ? 58.957 5.382  -13.203 1.00 49.05 ? 161 ASP A N     1 
ATOM   2475 C CA    . ASP E 3 154 ? 58.064 4.776  -12.208 1.00 48.03 ? 161 ASP A CA    1 
ATOM   2476 C C     . ASP E 3 154 ? 57.069 5.803  -11.645 1.00 47.24 ? 161 ASP A C     1 
ATOM   2477 O O     . ASP E 3 154 ? 57.456 6.717  -10.904 1.00 47.49 ? 161 ASP A O     1 
ATOM   2478 C CB    . ASP E 3 154 ? 58.907 4.169  -11.081 1.00 46.61 ? 161 ASP A CB    1 
ATOM   2479 C CG    . ASP E 3 154 ? 60.245 4.859  -10.928 1.00 44.09 ? 161 ASP A CG    1 
ATOM   2480 O OD1   . ASP E 3 154 ? 61.110 4.685  -11.812 1.00 41.83 ? 161 ASP A OD1   1 
ATOM   2481 O OD2   . ASP E 3 154 ? 60.422 5.585  -9.930  1.00 44.52 ? 161 ASP A OD2   1 
ATOM   2482 N N     . GLY E 3 155 ? 55.793 5.643  -11.996 1.00 45.92 ? 162 GLY A N     1 
ATOM   2483 C CA    . GLY E 3 155 ? 54.775 6.584  -11.552 1.00 45.62 ? 162 GLY A CA    1 
ATOM   2484 C C     . GLY E 3 155 ? 54.794 7.836  -12.429 1.00 45.62 ? 162 GLY A C     1 
ATOM   2485 O O     . GLY E 3 155 ? 54.541 7.749  -13.634 1.00 44.51 ? 162 GLY A O     1 
ATOM   2486 N N     . MET E 3 156 ? 55.088 8.996  -11.832 1.00 44.94 ? 163 MET A N     1 
ATOM   2487 C CA    . MET E 3 156 ? 55.169 10.256 -12.576 1.00 44.29 ? 163 MET A CA    1 
ATOM   2488 C C     . MET E 3 156 ? 55.612 11.457 -11.754 1.00 43.85 ? 163 MET A C     1 
ATOM   2489 O O     . MET E 3 156 ? 55.610 11.417 -10.522 1.00 43.91 ? 163 MET A O     1 
ATOM   2490 C CB    . MET E 3 156 ? 53.849 10.580 -13.291 1.00 44.43 ? 163 MET A CB    1 
ATOM   2491 C CG    . MET E 3 156 ? 52.600 10.556 -12.455 1.00 42.80 ? 163 MET A CG    1 
ATOM   2492 S SD    . MET E 3 156 ? 51.426 9.540  -13.350 1.00 43.04 ? 163 MET A SD    1 
ATOM   2493 C CE    . MET E 3 156 ? 50.609 10.683 -14.441 1.00 43.35 ? 163 MET A CE    1 
ATOM   2494 N N     . GLN E 3 157 ? 55.963 12.532 -12.462 1.00 42.67 ? 164 GLN A N     1 
ATOM   2495 C CA    . GLN E 3 157 ? 56.483 13.752 -11.851 1.00 40.56 ? 164 GLN A CA    1 
ATOM   2496 C C     . GLN E 3 157 ? 55.577 14.974 -11.722 1.00 39.30 ? 164 GLN A C     1 
ATOM   2497 O O     . GLN E 3 157 ? 55.519 15.811 -12.622 1.00 40.70 ? 164 GLN A O     1 
ATOM   2498 C CB    . GLN E 3 157 ? 57.760 14.167 -12.595 1.00 39.80 ? 164 GLN A CB    1 
ATOM   2499 C CG    . GLN E 3 157 ? 58.480 15.359 -11.991 1.00 39.63 ? 164 GLN A CG    1 
ATOM   2500 C CD    . GLN E 3 157 ? 59.830 15.617 -12.642 1.00 39.83 ? 164 GLN A CD    1 
ATOM   2501 O OE1   . GLN E 3 157 ? 59.908 16.022 -13.803 1.00 39.22 ? 164 GLN A OE1   1 
ATOM   2502 N NE2   . GLN E 3 157 ? 60.901 15.373 -11.893 1.00 38.35 ? 164 GLN A NE2   1 
ATOM   2503 N N     . ILE E 3 158 ? 54.883 15.092 -10.598 1.00 36.70 ? 165 ILE A N     1 
ATOM   2504 C CA    . ILE E 3 158 ? 54.047 16.257 -10.361 1.00 33.96 ? 165 ILE A CA    1 
ATOM   2505 C C     . ILE E 3 158 ? 55.020 17.390 -10.023 1.00 33.65 ? 165 ILE A C     1 
ATOM   2506 O O     . ILE E 3 158 ? 56.166 17.122 -9.642  1.00 35.13 ? 165 ILE A O     1 
ATOM   2507 C CB    . ILE E 3 158 ? 53.062 16.013 -9.167  1.00 33.21 ? 165 ILE A CB    1 
ATOM   2508 C CG1   . ILE E 3 158 ? 51.703 15.534 -9.694  1.00 29.13 ? 165 ILE A CG1   1 
ATOM   2509 C CG2   . ILE E 3 158 ? 52.903 17.293 -8.316  1.00 33.84 ? 165 ILE A CG2   1 
ATOM   2510 C CD1   . ILE E 3 158 ? 50.982 16.538 -10.589 1.00 24.02 ? 165 ILE A CD1   1 
ATOM   2511 N N     . LYS E 3 159 ? 54.571 18.641 -10.171 1.00 31.84 ? 166 LYS A N     1 
ATOM   2512 C CA    . LYS E 3 159 ? 55.380 19.835 -9.871  1.00 28.57 ? 166 LYS A CA    1 
ATOM   2513 C C     . LYS E 3 159 ? 54.600 20.783 -8.944  1.00 27.18 ? 166 LYS A C     1 
ATOM   2514 O O     . LYS E 3 159 ? 53.745 21.539 -9.403  1.00 28.20 ? 166 LYS A O     1 
ATOM   2515 C CB    . LYS E 3 159 ? 55.715 20.557 -11.178 1.00 27.12 ? 166 LYS A CB    1 
ATOM   2516 C CG    . LYS E 3 159 ? 56.244 21.963 -10.990 1.00 25.28 ? 166 LYS A CG    1 
ATOM   2517 C CD    . LYS E 3 159 ? 57.749 22.005 -10.791 1.00 21.92 ? 166 LYS A CD    1 
ATOM   2518 C CE    . LYS E 3 159 ? 58.456 22.037 -12.141 1.00 20.87 ? 166 LYS A CE    1 
ATOM   2519 N NZ    . LYS E 3 159 ? 58.026 23.173 -13.006 1.00 15.35 ? 166 LYS A NZ    1 
ATOM   2520 N N     . ILE E 3 160 ? 54.887 20.769 -7.649  1.00 24.87 ? 167 ILE A N     1 
ATOM   2521 C CA    . ILE E 3 160 ? 54.135 21.639 -6.747  1.00 24.81 ? 167 ILE A CA    1 
ATOM   2522 C C     . ILE E 3 160 ? 54.922 22.163 -5.534  1.00 26.00 ? 167 ILE A C     1 
ATOM   2523 O O     . ILE E 3 160 ? 55.938 21.584 -5.149  1.00 26.80 ? 167 ILE A O     1 
ATOM   2524 C CB    . ILE E 3 160 ? 52.879 20.903 -6.228  1.00 22.25 ? 167 ILE A CB    1 
ATOM   2525 C CG1   . ILE E 3 160 ? 51.789 21.899 -5.905  1.00 21.52 ? 167 ILE A CG1   1 
ATOM   2526 C CG2   . ILE E 3 160 ? 53.187 20.141 -4.985  1.00 21.99 ? 167 ILE A CG2   1 
ATOM   2527 C CD1   . ILE E 3 160 ? 51.046 22.355 -7.125  1.00 23.90 ? 167 ILE A CD1   1 
ATOM   2528 N N     . THR E 3 161 ? 54.450 23.255 -4.933  1.00 25.90 ? 168 THR A N     1 
ATOM   2529 C CA    . THR E 3 161 ? 55.110 23.814 -3.757  1.00 26.19 ? 168 THR A CA    1 
ATOM   2530 C C     . THR E 3 161 ? 54.315 23.368 -2.548  1.00 27.27 ? 168 THR A C     1 
ATOM   2531 O O     . THR E 3 161 ? 53.100 23.169 -2.631  1.00 25.28 ? 168 THR A O     1 
ATOM   2532 C CB    . THR E 3 161 ? 55.087 25.338 -3.719  1.00 26.74 ? 168 THR A CB    1 
ATOM   2533 O OG1   . THR E 3 161 ? 53.871 25.763 -3.093  1.00 29.53 ? 168 THR A OG1   1 
ATOM   2534 C CG2   . THR E 3 161 ? 55.141 25.921 -5.112  1.00 27.88 ? 168 THR A CG2   1 
ATOM   2535 N N     . ARG E 3 162 ? 55.010 23.237 -1.423  1.00 28.42 ? 169 ARG A N     1 
ATOM   2536 C CA    . ARG E 3 162 ? 54.406 22.818 -0.168  1.00 28.73 ? 169 ARG A CA    1 
ATOM   2537 C C     . ARG E 3 162 ? 53.272 23.760 0.283   1.00 29.15 ? 169 ARG A C     1 
ATOM   2538 O O     . ARG E 3 162 ? 52.418 23.379 1.071   1.00 30.04 ? 169 ARG A O     1 
ATOM   2539 C CB    . ARG E 3 162 ? 55.503 22.722 0.900   1.00 28.82 ? 169 ARG A CB    1 
ATOM   2540 C CG    . ARG E 3 162 ? 56.045 21.313 1.135   1.00 27.88 ? 169 ARG A CG    1 
ATOM   2541 C CD    . ARG E 3 162 ? 57.388 21.366 1.827   1.00 28.59 ? 169 ARG A CD    1 
ATOM   2542 N NE    . ARG E 3 162 ? 58.403 21.872 0.910   1.00 29.86 ? 169 ARG A NE    1 
ATOM   2543 C CZ    . ARG E 3 162 ? 58.984 21.145 -0.045  1.00 29.59 ? 169 ARG A CZ    1 
ATOM   2544 N NH1   . ARG E 3 162 ? 58.679 19.859 -0.212  1.00 28.16 ? 169 ARG A NH1   1 
ATOM   2545 N NH2   . ARG E 3 162 ? 59.836 21.721 -0.876  1.00 30.24 ? 169 ARG A NH2   1 
ATOM   2546 N N     . GLN E 3 163 ? 53.264 24.985 -0.226  1.00 27.84 ? 170 GLN A N     1 
ATOM   2547 C CA    . GLN E 3 163 ? 52.234 25.936 0.129   1.00 26.70 ? 170 GLN A CA    1 
ATOM   2548 C C     . GLN E 3 163 ? 50.972 25.720 -0.693  1.00 28.10 ? 170 GLN A C     1 
ATOM   2549 O O     . GLN E 3 163 ? 49.874 25.984 -0.193  1.00 30.10 ? 170 GLN A O     1 
ATOM   2550 C CB    . GLN E 3 163 ? 52.728 27.369 -0.045  1.00 25.15 ? 170 GLN A CB    1 
ATOM   2551 C CG    . GLN E 3 163 ? 53.644 27.807 1.066   1.00 21.98 ? 170 GLN A CG    1 
ATOM   2552 C CD    . GLN E 3 163 ? 54.034 29.261 0.981   1.00 20.59 ? 170 GLN A CD    1 
ATOM   2553 O OE1   . GLN E 3 163 ? 54.776 29.759 1.826   1.00 20.84 ? 170 GLN A OE1   1 
ATOM   2554 N NE2   . GLN E 3 163 ? 53.538 29.953 -0.030  1.00 16.42 ? 170 GLN A NE2   1 
ATOM   2555 N N     . GLU E 3 164 ? 51.098 25.275 -1.947  1.00 27.34 ? 171 GLU A N     1 
ATOM   2556 C CA    . GLU E 3 164 ? 49.891 24.993 -2.737  1.00 26.06 ? 171 GLU A CA    1 
ATOM   2557 C C     . GLU E 3 164 ? 49.178 23.866 -1.988  1.00 24.51 ? 171 GLU A C     1 
ATOM   2558 O O     . GLU E 3 164 ? 47.986 23.967 -1.689  1.00 25.79 ? 171 GLU A O     1 
ATOM   2559 C CB    . GLU E 3 164 ? 50.222 24.525 -4.162  1.00 26.81 ? 171 GLU A CB    1 
ATOM   2560 C CG    . GLU E 3 164 ? 50.389 25.634 -5.195  1.00 32.08 ? 171 GLU A CG    1 
ATOM   2561 C CD    . GLU E 3 164 ? 49.202 25.762 -6.173  1.00 34.43 ? 171 GLU A CD    1 
ATOM   2562 O OE1   . GLU E 3 164 ? 48.058 26.048 -5.738  1.00 35.24 ? 171 GLU A OE1   1 
ATOM   2563 O OE2   . GLU E 3 164 ? 49.422 25.580 -7.394  1.00 35.87 ? 171 GLU A OE2   1 
ATOM   2564 N N     . ILE E 3 165 ? 49.930 22.806 -1.669  1.00 23.26 ? 172 ILE A N     1 
ATOM   2565 C CA    . ILE E 3 165 ? 49.421 21.644 -0.941  1.00 19.82 ? 172 ILE A CA    1 
ATOM   2566 C C     . ILE E 3 165 ? 48.563 22.148 0.215   1.00 21.03 ? 172 ILE A C     1 
ATOM   2567 O O     . ILE E 3 165 ? 47.354 21.887 0.273   1.00 21.32 ? 172 ILE A O     1 
ATOM   2568 C CB    . ILE E 3 165 ? 50.566 20.789 -0.357  1.00 16.37 ? 172 ILE A CB    1 
ATOM   2569 C CG1   . ILE E 3 165 ? 51.531 20.352 -1.467  1.00 13.26 ? 172 ILE A CG1   1 
ATOM   2570 C CG2   . ILE E 3 165 ? 49.980 19.573 0.382   1.00 17.08 ? 172 ILE A CG2   1 
ATOM   2571 C CD1   . ILE E 3 165 ? 51.224 19.030 -2.144  1.00 6.45  ? 172 ILE A CD1   1 
ATOM   2572 N N     . GLY E 3 166 ? 49.193 22.888 1.125   1.00 20.10 ? 173 GLY A N     1 
ATOM   2573 C CA    . GLY E 3 166 ? 48.469 23.433 2.258   1.00 18.43 ? 173 GLY A CA    1 
ATOM   2574 C C     . GLY E 3 166 ? 47.131 24.050 1.887   1.00 16.95 ? 173 GLY A C     1 
ATOM   2575 O O     . GLY E 3 166 ? 46.129 23.762 2.526   1.00 17.33 ? 173 GLY A O     1 
ATOM   2576 N N     . GLN E 3 167 ? 47.130 24.899 0.858   1.00 15.53 ? 174 GLN A N     1 
ATOM   2577 C CA    . GLN E 3 167 ? 45.931 25.577 0.381   1.00 13.49 ? 174 GLN A CA    1 
ATOM   2578 C C     . GLN E 3 167 ? 44.882 24.570 -0.049  1.00 13.27 ? 174 GLN A C     1 
ATOM   2579 O O     . GLN E 3 167 ? 43.679 24.803 0.107   1.00 9.69  ? 174 GLN A O     1 
ATOM   2580 C CB    . GLN E 3 167 ? 46.271 26.516 -0.784  1.00 11.94 ? 174 GLN A CB    1 
ATOM   2581 C CG    . GLN E 3 167 ? 47.091 27.699 -0.348  1.00 12.79 ? 174 GLN A CG    1 
ATOM   2582 C CD    . GLN E 3 167 ? 47.323 28.724 -1.431  1.00 12.76 ? 174 GLN A CD    1 
ATOM   2583 O OE1   . GLN E 3 167 ? 47.738 28.393 -2.533  1.00 14.86 ? 174 GLN A OE1   1 
ATOM   2584 N NE2   . GLN E 3 167 ? 47.079 29.984 -1.114  1.00 11.96 ? 174 GLN A NE2   1 
ATOM   2585 N N     . ILE E 3 168 ? 45.361 23.443 -0.568  1.00 13.90 ? 175 ILE A N     1 
ATOM   2586 C CA    . ILE E 3 168 ? 44.503 22.361 -1.045  1.00 16.24 ? 175 ILE A CA    1 
ATOM   2587 C C     . ILE E 3 168 ? 44.075 21.432 0.087   1.00 18.07 ? 175 ILE A C     1 
ATOM   2588 O O     . ILE E 3 168 ? 43.031 20.767 0.023   1.00 19.17 ? 175 ILE A O     1 
ATOM   2589 C CB    . ILE E 3 168 ? 45.246 21.515 -2.096  1.00 14.20 ? 175 ILE A CB    1 
ATOM   2590 C CG1   . ILE E 3 168 ? 45.583 22.391 -3.287  1.00 14.53 ? 175 ILE A CG1   1 
ATOM   2591 C CG2   . ILE E 3 168 ? 44.418 20.305 -2.496  1.00 11.64 ? 175 ILE A CG2   1 
ATOM   2592 C CD1   . ILE E 3 168 ? 46.249 21.652 -4.393  1.00 16.80 ? 175 ILE A CD1   1 
ATOM   2593 N N     . VAL E 3 169 ? 44.901 21.393 1.122   1.00 19.19 ? 176 VAL A N     1 
ATOM   2594 C CA    . VAL E 3 169 ? 44.659 20.524 2.249   1.00 19.22 ? 176 VAL A CA    1 
ATOM   2595 C C     . VAL E 3 169 ? 43.968 21.254 3.365   1.00 19.89 ? 176 VAL A C     1 
ATOM   2596 O O     . VAL E 3 169 ? 42.963 20.768 3.895   1.00 21.27 ? 176 VAL A O     1 
ATOM   2597 C CB    . VAL E 3 169 ? 45.980 19.903 2.746   1.00 17.81 ? 176 VAL A CB    1 
ATOM   2598 C CG1   . VAL E 3 169 ? 45.852 19.454 4.175   1.00 18.64 ? 176 VAL A CG1   1 
ATOM   2599 C CG2   . VAL E 3 169 ? 46.328 18.716 1.876   1.00 18.43 ? 176 VAL A CG2   1 
ATOM   2600 N N     . GLY E 3 170 ? 44.498 22.415 3.725   1.00 19.35 ? 177 GLY A N     1 
ATOM   2601 C CA    . GLY E 3 170 ? 43.883 23.177 4.790   1.00 21.52 ? 177 GLY A CA    1 
ATOM   2602 C C     . GLY E 3 170 ? 44.817 23.393 5.949   1.00 21.42 ? 177 GLY A C     1 
ATOM   2603 O O     . GLY E 3 170 ? 44.585 24.242 6.812   1.00 22.87 ? 177 GLY A O     1 
ATOM   2604 N N     . CYS E 3 171 ? 45.888 22.621 5.979   1.00 21.12 ? 178 CYS A N     1 
ATOM   2605 C CA    . CYS E 3 171 ? 46.857 22.776 7.044   1.00 20.30 ? 178 CYS A CA    1 
ATOM   2606 C C     . CYS E 3 171 ? 47.964 23.727 6.634   1.00 19.55 ? 178 CYS A C     1 
ATOM   2607 O O     . CYS E 3 171 ? 47.917 24.359 5.581   1.00 18.76 ? 178 CYS A O     1 
ATOM   2608 C CB    . CYS E 3 171 ? 47.498 21.460 7.379   1.00 21.07 ? 178 CYS A CB    1 
ATOM   2609 S SG    . CYS E 3 171 ? 48.651 21.084 6.151   1.00 15.72 ? 178 CYS A SG    1 
ATOM   2610 N N     . SER E 3 172 ? 48.996 23.775 7.465   1.00 20.00 ? 179 SER A N     1 
ATOM   2611 C CA    . SER E 3 172 ? 50.106 24.689 7.237   1.00 19.38 ? 179 SER A CA    1 
ATOM   2612 C C     . SER E 3 172 ? 51.268 24.285 6.342   1.00 20.06 ? 179 SER A C     1 
ATOM   2613 O O     . SER E 3 172 ? 51.518 23.113 6.036   1.00 16.95 ? 179 SER A O     1 
ATOM   2614 C CB    . SER E 3 172 ? 50.685 25.119 8.577   1.00 18.31 ? 179 SER A CB    1 
ATOM   2615 O OG    . SER E 3 172 ? 51.265 24.009 9.238   1.00 17.47 ? 179 SER A OG    1 
ATOM   2616 N N     . ARG E 3 173 ? 51.962 25.339 5.931   1.00 22.54 ? 180 ARG A N     1 
ATOM   2617 C CA    . ARG E 3 173 ? 53.158 25.313 5.122   1.00 22.42 ? 180 ARG A CA    1 
ATOM   2618 C C     . ARG E 3 173 ? 54.088 24.345 5.843   1.00 24.25 ? 180 ARG A C     1 
ATOM   2619 O O     . ARG E 3 173 ? 54.648 23.437 5.236   1.00 24.83 ? 180 ARG A O     1 
ATOM   2620 C CB    . ARG E 3 173 ? 53.722 26.718 5.147   1.00 23.60 ? 180 ARG A CB    1 
ATOM   2621 C CG    . ARG E 3 173 ? 53.700 27.297 6.582   1.00 26.01 ? 180 ARG A CG    1 
ATOM   2622 C CD    . ARG E 3 173 ? 53.382 28.816 6.688   1.00 26.47 ? 180 ARG A CD    1 
ATOM   2623 N NE    . ARG E 3 173 ? 53.282 29.281 8.083   1.00 24.34 ? 180 ARG A NE    1 
ATOM   2624 C CZ    . ARG E 3 173 ? 52.865 30.492 8.449   1.00 23.92 ? 180 ARG A CZ    1 
ATOM   2625 N NH1   . ARG E 3 173 ? 52.496 31.385 7.540   1.00 22.97 ? 180 ARG A NH1   1 
ATOM   2626 N NH2   . ARG E 3 173 ? 52.824 30.819 9.728   1.00 24.12 ? 180 ARG A NH2   1 
ATOM   2627 N N     . GLU E 3 174 ? 54.241 24.537 7.150   1.00 25.43 ? 181 GLU A N     1 
ATOM   2628 C CA    . GLU E 3 174 ? 55.086 23.658 7.950   1.00 27.57 ? 181 GLU A CA    1 
ATOM   2629 C C     . GLU E 3 174 ? 54.510 22.248 7.902   1.00 28.10 ? 181 GLU A C     1 
ATOM   2630 O O     . GLU E 3 174 ? 54.879 21.448 7.046   1.00 29.65 ? 181 GLU A O     1 
ATOM   2631 C CB    . GLU E 3 174 ? 55.138 24.118 9.410   1.00 28.42 ? 181 GLU A CB    1 
ATOM   2632 C CG    . GLU E 3 174 ? 55.672 25.530 9.640   1.00 32.88 ? 181 GLU A CG    1 
ATOM   2633 C CD    . GLU E 3 174 ? 54.599 26.606 9.546   1.00 35.46 ? 181 GLU A CD    1 
ATOM   2634 O OE1   . GLU E 3 174 ? 53.480 26.372 10.042  1.00 36.64 ? 181 GLU A OE1   1 
ATOM   2635 O OE2   . GLU E 3 174 ? 54.878 27.699 9.002   1.00 37.17 ? 181 GLU A OE2   1 
ATOM   2636 N N     . THR E 3 175 ? 53.594 21.959 8.823   1.00 27.51 ? 182 THR A N     1 
ATOM   2637 C CA    . THR E 3 175 ? 52.940 20.654 8.925   1.00 27.12 ? 182 THR A CA    1 
ATOM   2638 C C     . THR E 3 175 ? 52.860 19.850 7.625   1.00 27.06 ? 182 THR A C     1 
ATOM   2639 O O     . THR E 3 175 ? 52.828 18.630 7.664   1.00 25.74 ? 182 THR A O     1 
ATOM   2640 C CB    . THR E 3 175 ? 51.530 20.822 9.511   1.00 26.81 ? 182 THR A CB    1 
ATOM   2641 O OG1   . THR E 3 175 ? 51.640 21.510 10.758  1.00 26.91 ? 182 THR A OG1   1 
ATOM   2642 C CG2   . THR E 3 175 ? 50.864 19.480 9.746   1.00 26.14 ? 182 THR A CG2   1 
ATOM   2643 N N     . VAL E 3 176 ? 52.812 20.536 6.484   1.00 26.72 ? 183 VAL A N     1 
ATOM   2644 C CA    . VAL E 3 176 ? 52.782 19.870 5.189   1.00 25.66 ? 183 VAL A CA    1 
ATOM   2645 C C     . VAL E 3 176 ? 54.099 19.115 5.030   1.00 27.06 ? 183 VAL A C     1 
ATOM   2646 O O     . VAL E 3 176 ? 54.121 17.876 5.031   1.00 28.34 ? 183 VAL A O     1 
ATOM   2647 C CB    . VAL E 3 176 ? 52.618 20.897 4.021   1.00 25.33 ? 183 VAL A CB    1 
ATOM   2648 C CG1   . VAL E 3 176 ? 53.283 20.382 2.735   1.00 21.44 ? 183 VAL A CG1   1 
ATOM   2649 C CG2   . VAL E 3 176 ? 51.133 21.155 3.770   1.00 20.75 ? 183 VAL A CG2   1 
ATOM   2650 N N     . GLY E 3 177 ? 55.193 19.862 4.918   1.00 26.67 ? 184 GLY A N     1 
ATOM   2651 C CA    . GLY E 3 177 ? 56.498 19.250 4.756   1.00 27.50 ? 184 GLY A CA    1 
ATOM   2652 C C     . GLY E 3 177 ? 56.824 18.341 5.916   1.00 28.89 ? 184 GLY A C     1 
ATOM   2653 O O     . GLY E 3 177 ? 57.208 17.180 5.742   1.00 28.26 ? 184 GLY A O     1 
ATOM   2654 N N     . ARG E 3 178 ? 56.674 18.875 7.119   1.00 30.44 ? 185 ARG A N     1 
ATOM   2655 C CA    . ARG E 3 178 ? 56.947 18.094 8.309   1.00 31.84 ? 185 ARG A CA    1 
ATOM   2656 C C     . ARG E 3 178 ? 56.212 16.784 8.138   1.00 31.65 ? 185 ARG A C     1 
ATOM   2657 O O     . ARG E 3 178 ? 56.634 15.759 8.662   1.00 32.69 ? 185 ARG A O     1 
ATOM   2658 C CB    . ARG E 3 178 ? 56.463 18.846 9.554   1.00 34.07 ? 185 ARG A CB    1 
ATOM   2659 C CG    . ARG E 3 178 ? 57.387 20.015 9.953   1.00 36.69 ? 185 ARG A CG    1 
ATOM   2660 C CD    . ARG E 3 178 ? 56.672 21.181 10.670  1.00 38.20 ? 185 ARG A CD    1 
ATOM   2661 N NE    . ARG E 3 178 ? 55.606 20.751 11.575  1.00 38.49 ? 185 ARG A NE    1 
ATOM   2662 C CZ    . ARG E 3 178 ? 55.218 21.434 12.648  1.00 38.92 ? 185 ARG A CZ    1 
ATOM   2663 N NH1   . ARG E 3 178 ? 54.234 20.975 13.410  1.00 39.50 ? 185 ARG A NH1   1 
ATOM   2664 N NH2   . ARG E 3 178 ? 55.831 22.564 12.976  1.00 37.98 ? 185 ARG A NH2   1 
ATOM   2665 N N     . ILE E 3 179 ? 55.128 16.826 7.364   1.00 31.83 ? 186 ILE A N     1 
ATOM   2666 C CA    . ILE E 3 179 ? 54.297 15.650 7.089   1.00 31.49 ? 186 ILE A CA    1 
ATOM   2667 C C     . ILE E 3 179 ? 54.658 14.971 5.777   1.00 29.91 ? 186 ILE A C     1 
ATOM   2668 O O     . ILE E 3 179 ? 54.220 13.851 5.506   1.00 28.70 ? 186 ILE A O     1 
ATOM   2669 C CB    . ILE E 3 179 ? 52.789 16.034 7.083   1.00 32.28 ? 186 ILE A CB    1 
ATOM   2670 C CG1   . ILE E 3 179 ? 52.302 16.219 8.531   1.00 33.59 ? 186 ILE A CG1   1 
ATOM   2671 C CG2   . ILE E 3 179 ? 51.957 14.985 6.360   1.00 31.88 ? 186 ILE A CG2   1 
ATOM   2672 C CD1   . ILE E 3 179 ? 52.249 14.945 9.372   1.00 33.66 ? 186 ILE A CD1   1 
ATOM   2673 N N     . LEU E 3 180 ? 55.478 15.642 4.976   1.00 29.10 ? 187 LEU A N     1 
ATOM   2674 C CA    . LEU E 3 180 ? 55.894 15.101 3.690   1.00 28.05 ? 187 LEU A CA    1 
ATOM   2675 C C     . LEU E 3 180 ? 57.236 14.385 3.804   1.00 29.05 ? 187 LEU A C     1 
ATOM   2676 O O     . LEU E 3 180 ? 57.503 13.442 3.054   1.00 28.92 ? 187 LEU A O     1 
ATOM   2677 C CB    . LEU E 3 180 ? 55.970 16.225 2.645   1.00 23.65 ? 187 LEU A CB    1 
ATOM   2678 C CG    . LEU E 3 180 ? 55.992 15.818 1.165   1.00 20.35 ? 187 LEU A CG    1 
ATOM   2679 C CD1   . LEU E 3 180 ? 54.746 15.004 0.844   1.00 21.03 ? 187 LEU A CD1   1 
ATOM   2680 C CD2   . LEU E 3 180 ? 56.069 17.046 0.271   1.00 17.09 ? 187 LEU A CD2   1 
ATOM   2681 N N     . LYS E 3 181 ? 58.072 14.841 4.739   1.00 31.34 ? 188 LYS A N     1 
ATOM   2682 C CA    . LYS E 3 181 ? 59.407 14.261 4.978   1.00 31.85 ? 188 LYS A CA    1 
ATOM   2683 C C     . LYS E 3 181 ? 59.255 12.774 5.181   1.00 33.02 ? 188 LYS A C     1 
ATOM   2684 O O     . LYS E 3 181 ? 59.757 11.959 4.402   1.00 32.16 ? 188 LYS A O     1 
ATOM   2685 C CB    . LYS E 3 181 ? 60.021 14.828 6.258   1.00 32.52 ? 188 LYS A CB    1 
ATOM   2686 C CG    . LYS E 3 181 ? 61.450 15.336 6.136   1.00 33.55 ? 188 LYS A CG    1 
ATOM   2687 C CD    . LYS E 3 181 ? 62.430 14.268 5.670   1.00 33.72 ? 188 LYS A CD    1 
ATOM   2688 C CE    . LYS E 3 181 ? 63.756 14.924 5.247   1.00 33.54 ? 188 LYS A CE    1 
ATOM   2689 N NZ    . LYS E 3 181 ? 63.566 16.051 4.261   1.00 29.60 ? 188 LYS A NZ    1 
ATOM   2690 N N     . MET E 3 182 ? 58.541 12.440 6.254   1.00 34.69 ? 189 MET A N     1 
ATOM   2691 C CA    . MET E 3 182 ? 58.304 11.057 6.628   1.00 34.90 ? 189 MET A CA    1 
ATOM   2692 C C     . MET E 3 182 ? 57.502 10.276 5.598   1.00 35.89 ? 189 MET A C     1 
ATOM   2693 O O     . MET E 3 182 ? 57.840 9.128  5.302   1.00 37.23 ? 189 MET A O     1 
ATOM   2694 C CB    . MET E 3 182 ? 57.654 10.989 8.014   1.00 34.66 ? 189 MET A CB    1 
ATOM   2695 C CG    . MET E 3 182 ? 56.295 11.634 8.148   1.00 36.47 ? 189 MET A CG    1 
ATOM   2696 S SD    . MET E 3 182 ? 54.949 10.482 7.802   1.00 41.58 ? 189 MET A SD    1 
ATOM   2697 C CE    . MET E 3 182 ? 55.591 8.895  8.515   1.00 38.71 ? 189 MET A CE    1 
ATOM   2698 N N     . LEU E 3 183 ? 56.455 10.871 5.034   1.00 34.87 ? 190 LEU A N     1 
ATOM   2699 C CA    . LEU E 3 183 ? 55.689 10.146 4.024   1.00 34.24 ? 190 LEU A CA    1 
ATOM   2700 C C     . LEU E 3 183 ? 56.723 9.675  2.994   1.00 33.76 ? 190 LEU A C     1 
ATOM   2701 O O     . LEU E 3 183 ? 56.537 8.680  2.302   1.00 31.87 ? 190 LEU A O     1 
ATOM   2702 C CB    . LEU E 3 183 ? 54.644 11.068 3.372   1.00 33.91 ? 190 LEU A CB    1 
ATOM   2703 C CG    . LEU E 3 183 ? 53.368 10.408 2.821   1.00 32.90 ? 190 LEU A CG    1 
ATOM   2704 C CD1   . LEU E 3 183 ? 52.583 9.790  3.969   1.00 30.61 ? 190 LEU A CD1   1 
ATOM   2705 C CD2   . LEU E 3 183 ? 52.498 11.436 2.089   1.00 34.25 ? 190 LEU A CD2   1 
ATOM   2706 N N     . GLU E 3 184 ? 57.832 10.409 2.926   1.00 35.77 ? 191 GLU A N     1 
ATOM   2707 C CA    . GLU E 3 184 ? 58.940 10.096 2.023   1.00 37.00 ? 191 GLU A CA    1 
ATOM   2708 C C     . GLU E 3 184 ? 59.768 8.994  2.682   1.00 38.04 ? 191 GLU A C     1 
ATOM   2709 O O     . GLU E 3 184 ? 60.095 7.991  2.037   1.00 36.79 ? 191 GLU A O     1 
ATOM   2710 C CB    . GLU E 3 184 ? 59.812 11.333 1.798   1.00 35.68 ? 191 GLU A CB    1 
ATOM   2711 C CG    . GLU E 3 184 ? 61.020 11.107 0.904   1.00 33.13 ? 191 GLU A CG    1 
ATOM   2712 C CD    . GLU E 3 184 ? 62.211 11.988 1.290   1.00 31.65 ? 191 GLU A CD    1 
ATOM   2713 O OE1   . GLU E 3 184 ? 62.832 12.567 0.363   1.00 29.76 ? 191 GLU A OE1   1 
ATOM   2714 O OE2   . GLU E 3 184 ? 62.516 12.085 2.509   1.00 27.14 ? 191 GLU A OE2   1 
ATOM   2715 N N     . ASP E 3 185 ? 60.100 9.187  3.964   1.00 39.48 ? 192 ASP A N     1 
ATOM   2716 C CA    . ASP E 3 185 ? 60.869 8.184  4.720   1.00 41.57 ? 192 ASP A CA    1 
ATOM   2717 C C     . ASP E 3 185 ? 60.090 6.873  4.704   1.00 41.57 ? 192 ASP A C     1 
ATOM   2718 O O     . ASP E 3 185 ? 60.678 5.802  4.816   1.00 41.92 ? 192 ASP A O     1 
ATOM   2719 C CB    . ASP E 3 185 ? 61.082 8.605  6.185   1.00 42.44 ? 192 ASP A CB    1 
ATOM   2720 C CG    . ASP E 3 185 ? 62.021 9.788  6.337   1.00 43.26 ? 192 ASP A CG    1 
ATOM   2721 O OD1   . ASP E 3 185 ? 62.075 10.350 7.454   1.00 43.55 ? 192 ASP A OD1   1 
ATOM   2722 O OD2   . ASP E 3 185 ? 62.704 10.152 5.357   1.00 44.99 ? 192 ASP A OD2   1 
ATOM   2723 N N     . GLN E 3 186 ? 58.765 6.973  4.585   1.00 42.26 ? 193 GLN A N     1 
ATOM   2724 C CA    . GLN E 3 186 ? 57.888 5.802  4.527   1.00 43.36 ? 193 GLN A CA    1 
ATOM   2725 C C     . GLN E 3 186 ? 58.231 5.087  3.217   1.00 43.64 ? 193 GLN A C     1 
ATOM   2726 O O     . GLN E 3 186 ? 57.894 3.915  3.013   1.00 43.20 ? 193 GLN A O     1 
ATOM   2727 C CB    . GLN E 3 186 ? 56.415 6.239  4.539   1.00 44.27 ? 193 GLN A CB    1 
ATOM   2728 C CG    . GLN E 3 186 ? 55.417 5.140  4.910   1.00 44.19 ? 193 GLN A CG    1 
ATOM   2729 C CD    . GLN E 3 186 ? 54.243 5.681  5.718   1.00 45.70 ? 193 GLN A CD    1 
ATOM   2730 O OE1   . GLN E 3 186 ? 54.448 6.372  6.724   1.00 45.56 ? 193 GLN A OE1   1 
ATOM   2731 N NE2   . GLN E 3 186 ? 53.011 5.363  5.295   1.00 44.75 ? 193 GLN A NE2   1 
ATOM   2732 N N     . ASN E 3 187 ? 58.907 5.833  2.340   1.00 42.98 ? 194 ASN A N     1 
ATOM   2733 C CA    . ASN E 3 187 ? 59.387 5.356  1.052   1.00 42.13 ? 194 ASN A CA    1 
ATOM   2734 C C     . ASN E 3 187 ? 58.379 5.171  -0.084  1.00 42.24 ? 194 ASN A C     1 
ATOM   2735 O O     . ASN E 3 187 ? 58.628 4.413  -1.028  1.00 42.68 ? 194 ASN A O     1 
ATOM   2736 C CB    . ASN E 3 187 ? 60.192 4.082  1.282   1.00 41.98 ? 194 ASN A CB    1 
ATOM   2737 C CG    . ASN E 3 187 ? 61.154 4.226  2.444   1.00 42.17 ? 194 ASN A CG    1 
ATOM   2738 O OD1   . ASN E 3 187 ? 61.850 5.231  2.551   1.00 42.60 ? 194 ASN A OD1   1 
ATOM   2739 N ND2   . ASN E 3 187 ? 61.194 3.228  3.323   1.00 42.85 ? 194 ASN A ND2   1 
ATOM   2740 N N     . LEU E 3 188 ? 57.253 5.881  -0.017  1.00 41.36 ? 195 LEU A N     1 
ATOM   2741 C CA    . LEU E 3 188 ? 56.258 5.790  -1.081  1.00 39.55 ? 195 LEU A CA    1 
ATOM   2742 C C     . LEU E 3 188 ? 56.606 6.836  -2.147  1.00 38.70 ? 195 LEU A C     1 
ATOM   2743 O O     . LEU E 3 188 ? 56.452 6.579  -3.335  1.00 38.38 ? 195 LEU A O     1 
ATOM   2744 C CB    . LEU E 3 188 ? 54.847 6.046  -0.535  1.00 39.78 ? 195 LEU A CB    1 
ATOM   2745 C CG    . LEU E 3 188 ? 53.674 5.349  -1.241  1.00 38.36 ? 195 LEU A CG    1 
ATOM   2746 C CD1   . LEU E 3 188 ? 52.392 5.793  -0.564  1.00 39.16 ? 195 LEU A CD1   1 
ATOM   2747 C CD2   . LEU E 3 188 ? 53.635 5.669  -2.733  1.00 37.10 ? 195 LEU A CD2   1 
ATOM   2748 N N     . ILE E 3 189 ? 57.081 8.006  -1.717  1.00 37.83 ? 196 ILE A N     1 
ATOM   2749 C CA    . ILE E 3 189 ? 57.466 9.082  -2.639  1.00 37.37 ? 196 ILE A CA    1 
ATOM   2750 C C     . ILE E 3 189 ? 58.678 9.816  -2.099  1.00 36.96 ? 196 ILE A C     1 
ATOM   2751 O O     . ILE E 3 189 ? 59.018 9.677  -0.922  1.00 37.69 ? 196 ILE A O     1 
ATOM   2752 C CB    . ILE E 3 189 ? 56.321 10.164 -2.839  1.00 38.67 ? 196 ILE A CB    1 
ATOM   2753 C CG1   . ILE E 3 189 ? 55.989 10.874 -1.513  1.00 38.85 ? 196 ILE A CG1   1 
ATOM   2754 C CG2   . ILE E 3 189 ? 55.048 9.521  -3.404  1.00 36.86 ? 196 ILE A CG2   1 
ATOM   2755 C CD1   . ILE E 3 189 ? 56.849 12.086 -1.179  1.00 37.98 ? 196 ILE A CD1   1 
ATOM   2756 N N     . SER E 3 190 ? 59.322 10.594 -2.968  1.00 36.75 ? 197 SER A N     1 
ATOM   2757 C CA    . SER E 3 190 ? 60.482 11.417 -2.608  1.00 35.60 ? 197 SER A CA    1 
ATOM   2758 C C     . SER E 3 190 ? 60.185 12.806 -3.153  1.00 35.42 ? 197 SER A C     1 
ATOM   2759 O O     . SER E 3 190 ? 59.508 12.926 -4.173  1.00 35.33 ? 197 SER A O     1 
ATOM   2760 C CB    . SER E 3 190 ? 61.763 10.871 -3.243  1.00 36.27 ? 197 SER A CB    1 
ATOM   2761 O OG    . SER E 3 190 ? 62.340 9.851  -2.441  1.00 35.95 ? 197 SER A OG    1 
ATOM   2762 N N     . ALA E 3 191 ? 60.684 13.850 -2.496  1.00 35.14 ? 198 ALA A N     1 
ATOM   2763 C CA    . ALA E 3 191 ? 60.410 15.221 -2.946  1.00 34.33 ? 198 ALA A CA    1 
ATOM   2764 C C     . ALA E 3 191 ? 61.580 16.011 -3.525  1.00 33.78 ? 198 ALA A C     1 
ATOM   2765 O O     . ALA E 3 191 ? 62.071 15.685 -4.597  1.00 34.73 ? 198 ALA A O     1 
ATOM   2766 C CB    . ALA E 3 191 ? 59.776 16.014 -1.816  1.00 34.47 ? 198 ALA A CB    1 
ATOM   2767 N N     . HIS E 3 192 ? 61.997 17.065 -2.819  1.00 34.21 ? 199 HIS A N     1 
ATOM   2768 C CA    . HIS E 3 192 ? 63.100 17.949 -3.234  1.00 33.99 ? 199 HIS A CA    1 
ATOM   2769 C C     . HIS E 3 192 ? 62.647 18.929 -4.325  1.00 34.52 ? 199 HIS A C     1 
ATOM   2770 O O     . HIS E 3 192 ? 62.827 18.666 -5.523  1.00 32.59 ? 199 HIS A O     1 
ATOM   2771 C CB    . HIS E 3 192 ? 64.306 17.124 -3.720  1.00 33.99 ? 199 HIS A CB    1 
ATOM   2772 C CG    . HIS E 3 192 ? 65.434 17.952 -4.268  1.00 34.34 ? 199 HIS A CG    1 
ATOM   2773 N ND1   . HIS E 3 192 ? 65.480 18.383 -5.578  1.00 33.95 ? 199 HIS A ND1   1 
ATOM   2774 C CD2   . HIS E 3 192 ? 66.543 18.453 -3.671  1.00 32.52 ? 199 HIS A CD2   1 
ATOM   2775 C CE1   . HIS E 3 192 ? 66.565 19.112 -5.763  1.00 31.31 ? 199 HIS A CE1   1 
ATOM   2776 N NE2   . HIS E 3 192 ? 67.227 19.170 -4.622  1.00 32.28 ? 199 HIS A NE2   1 
ATOM   2777 N N     . GLY E 3 193 ? 62.049 20.046 -3.883  1.00 35.11 ? 200 GLY A N     1 
ATOM   2778 C CA    . GLY E 3 193 ? 61.545 21.094 -4.771  1.00 36.27 ? 200 GLY A CA    1 
ATOM   2779 C C     . GLY E 3 193 ? 60.315 20.710 -5.583  1.00 37.27 ? 200 GLY A C     1 
ATOM   2780 O O     . GLY E 3 193 ? 59.444 21.538 -5.883  1.00 35.07 ? 200 GLY A O     1 
ATOM   2781 N N     . LYS E 3 194 ? 60.293 19.432 -5.959  1.00 38.82 ? 201 LYS A N     1 
ATOM   2782 C CA    . LYS E 3 194 ? 59.228 18.805 -6.733  1.00 40.62 ? 201 LYS A CA    1 
ATOM   2783 C C     . LYS E 3 194 ? 59.096 17.428 -6.091  1.00 40.75 ? 201 LYS A C     1 
ATOM   2784 O O     . LYS E 3 194 ? 59.946 17.053 -5.289  1.00 41.23 ? 201 LYS A O     1 
ATOM   2785 C CB    . LYS E 3 194 ? 59.619 18.663 -8.218  1.00 41.28 ? 201 LYS A CB    1 
ATOM   2786 C CG    . LYS E 3 194 ? 60.533 17.477 -8.575  1.00 42.12 ? 201 LYS A CG    1 
ATOM   2787 C CD    . LYS E 3 194 ? 61.950 17.633 -8.012  1.00 43.63 ? 201 LYS A CD    1 
ATOM   2788 C CE    . LYS E 3 194 ? 62.870 16.488 -8.444  1.00 44.04 ? 201 LYS A CE    1 
ATOM   2789 N NZ    . LYS E 3 194 ? 63.038 16.373 -9.931  1.00 43.39 ? 201 LYS A NZ    1 
ATOM   2790 N N     . THR E 3 195 ? 58.051 16.680 -6.428  1.00 39.90 ? 202 THR A N     1 
ATOM   2791 C CA    . THR E 3 195 ? 57.866 15.370 -5.836  1.00 39.40 ? 202 THR A CA    1 
ATOM   2792 C C     . THR E 3 195 ? 57.511 14.346 -6.890  1.00 40.31 ? 202 THR A C     1 
ATOM   2793 O O     . THR E 3 195 ? 56.937 14.685 -7.919  1.00 39.80 ? 202 THR A O     1 
ATOM   2794 C CB    . THR E 3 195 ? 56.744 15.389 -4.773  1.00 39.11 ? 202 THR A CB    1 
ATOM   2795 O OG1   . THR E 3 195 ? 57.033 16.380 -3.781  1.00 39.90 ? 202 THR A OG1   1 
ATOM   2796 C CG2   . THR E 3 195 ? 56.636 14.043 -4.083  1.00 39.17 ? 202 THR A CG2   1 
ATOM   2797 N N     . ILE E 3 196 ? 57.878 13.091 -6.622  1.00 42.06 ? 203 ILE A N     1 
ATOM   2798 C CA    . ILE E 3 196 ? 57.598 11.963 -7.505  1.00 42.31 ? 203 ILE A CA    1 
ATOM   2799 C C     . ILE E 3 196 ? 56.750 10.984 -6.710  1.00 43.22 ? 203 ILE A C     1 
ATOM   2800 O O     . ILE E 3 196 ? 57.116 10.586 -5.607  1.00 43.41 ? 203 ILE A O     1 
ATOM   2801 C CB    . ILE E 3 196 ? 58.889 11.210 -7.960  1.00 42.31 ? 203 ILE A CB    1 
ATOM   2802 C CG1   . ILE E 3 196 ? 59.812 12.125 -8.779  1.00 42.87 ? 203 ILE A CG1   1 
ATOM   2803 C CG2   . ILE E 3 196 ? 58.511 10.022 -8.823  1.00 42.05 ? 203 ILE A CG2   1 
ATOM   2804 C CD1   . ILE E 3 196 ? 60.897 12.811 -7.970  1.00 42.10 ? 203 ILE A CD1   1 
ATOM   2805 N N     . VAL E 3 197 ? 55.612 10.608 -7.276  1.00 44.43 ? 204 VAL A N     1 
ATOM   2806 C CA    . VAL E 3 197 ? 54.694 9.668  -6.647  1.00 45.09 ? 204 VAL A CA    1 
ATOM   2807 C C     . VAL E 3 197 ? 55.152 8.236  -6.890  1.00 46.07 ? 204 VAL A C     1 
ATOM   2808 O O     . VAL E 3 197 ? 55.718 7.939  -7.936  1.00 45.81 ? 204 VAL A O     1 
ATOM   2809 C CB    . VAL E 3 197 ? 53.273 9.840  -7.229  1.00 45.37 ? 204 VAL A CB    1 
ATOM   2810 C CG1   . VAL E 3 197 ? 53.351 9.941  -8.752  1.00 45.24 ? 204 VAL A CG1   1 
ATOM   2811 C CG2   . VAL E 3 197 ? 52.395 8.659  -6.835  1.00 44.66 ? 204 VAL A CG2   1 
ATOM   2812 N N     . VAL E 3 198 ? 54.908 7.353  -5.927  1.00 47.55 ? 205 VAL A N     1 
ATOM   2813 C CA    . VAL E 3 198 ? 55.280 5.946  -6.054  1.00 50.04 ? 205 VAL A CA    1 
ATOM   2814 C C     . VAL E 3 198 ? 56.797 5.715  -6.274  1.00 51.43 ? 205 VAL A C     1 
ATOM   2815 O O     . VAL E 3 198 ? 57.251 5.441  -7.391  1.00 51.34 ? 205 VAL A O     1 
ATOM   2816 C CB    . VAL E 3 198 ? 54.456 5.280  -7.207  1.00 50.68 ? 205 VAL A CB    1 
ATOM   2817 C CG1   . VAL E 3 198 ? 54.896 3.840  -7.427  1.00 51.61 ? 205 VAL A CG1   1 
ATOM   2818 C CG2   . VAL E 3 198 ? 52.971 5.318  -6.874  1.00 50.49 ? 205 VAL A CG2   1 
ATOM   2819 N N     . TYR E 3 199 ? 57.567 5.822  -5.191  1.00 52.81 ? 206 TYR A N     1 
ATOM   2820 C CA    . TYR E 3 199 ? 59.018 5.627  -5.212  1.00 54.16 ? 206 TYR A CA    1 
ATOM   2821 C C     . TYR E 3 199 ? 59.684 6.511  -6.268  1.00 55.09 ? 206 TYR A C     1 
ATOM   2822 O O     . TYR E 3 199 ? 59.040 6.937  -7.234  1.00 54.88 ? 206 TYR A O     1 
ATOM   2823 C CB    . TYR E 3 199 ? 59.346 4.145  -5.482  1.00 55.61 ? 206 TYR A CB    1 
ATOM   2824 C CG    . TYR E 3 199 ? 60.814 3.749  -5.312  1.00 55.39 ? 206 TYR A CG    1 
ATOM   2825 C CD1   . TYR E 3 199 ? 61.445 2.916  -6.244  1.00 54.45 ? 206 TYR A CD1   1 
ATOM   2826 C CD2   . TYR E 3 199 ? 61.563 4.200  -4.222  1.00 55.52 ? 206 TYR A CD2   1 
ATOM   2827 C CE1   . TYR E 3 199 ? 62.781 2.548  -6.097  1.00 54.63 ? 206 TYR A CE1   1 
ATOM   2828 C CE2   . TYR E 3 199 ? 62.906 3.838  -4.065  1.00 55.07 ? 206 TYR A CE2   1 
ATOM   2829 C CZ    . TYR E 3 199 ? 63.509 3.013  -5.005  1.00 55.28 ? 206 TYR A CZ    1 
ATOM   2830 O OH    . TYR E 3 199 ? 64.833 2.653  -4.847  1.00 54.30 ? 206 TYR A OH    1 
ATOM   2831 N N     . GLY E 3 200 ? 60.977 6.781  -6.073  1.00 56.41 ? 207 GLY A N     1 
ATOM   2832 C CA    . GLY E 3 200 ? 61.733 7.605  -7.005  1.00 57.32 ? 207 GLY A CA    1 
ATOM   2833 C C     . GLY E 3 200 ? 63.191 7.193  -7.161  1.00 57.96 ? 207 GLY A C     1 
ATOM   2834 O O     . GLY E 3 200 ? 63.932 7.855  -7.931  1.00 58.26 ? 207 GLY A O     1 
ATOM   2835 O OXT   . GLY E 3 200 ? 63.599 6.205  -6.515  1.00 30.99 ? 207 GLY A OXT   1 
ATOM   2836 N N     . PRO F 3 2   ? 3.704  24.403 -14.143 1.00 49.45 ? 9   PRO B N     1 
ATOM   2837 C CA    . PRO F 3 2   ? 3.751  25.008 -15.494 1.00 48.75 ? 9   PRO B CA    1 
ATOM   2838 C C     . PRO F 3 2   ? 4.332  24.010 -16.499 1.00 47.35 ? 9   PRO B C     1 
ATOM   2839 O O     . PRO F 3 2   ? 3.643  23.100 -16.977 1.00 45.69 ? 9   PRO B O     1 
ATOM   2840 C CB    . PRO F 3 2   ? 4.648  26.233 -15.383 1.00 49.79 ? 9   PRO B CB    1 
ATOM   2841 C CG    . PRO F 3 2   ? 5.648  25.752 -14.318 1.00 49.96 ? 9   PRO B CG    1 
ATOM   2842 C CD    . PRO F 3 2   ? 4.760  24.995 -13.296 1.00 50.20 ? 9   PRO B CD    1 
ATOM   2843 N N     . THR F 3 3   ? 5.609  24.213 -16.815 1.00 46.27 ? 10  THR B N     1 
ATOM   2844 C CA    . THR F 3 3   ? 6.337  23.359 -17.740 1.00 44.58 ? 10  THR B CA    1 
ATOM   2845 C C     . THR F 3 3   ? 6.640  22.116 -16.933 1.00 43.76 ? 10  THR B C     1 
ATOM   2846 O O     . THR F 3 3   ? 6.409  20.995 -17.372 1.00 43.12 ? 10  THR B O     1 
ATOM   2847 C CB    . THR F 3 3   ? 7.667  24.028 -18.195 1.00 44.76 ? 10  THR B CB    1 
ATOM   2848 O OG1   . THR F 3 3   ? 8.589  24.068 -17.096 1.00 45.15 ? 10  THR B OG1   1 
ATOM   2849 C CG2   . THR F 3 3   ? 7.416  25.467 -18.696 1.00 42.49 ? 10  THR B CG2   1 
ATOM   2850 N N     . LEU F 3 4   ? 7.139  22.345 -15.724 1.00 43.99 ? 11  LEU B N     1 
ATOM   2851 C CA    . LEU F 3 4   ? 7.480  21.281 -14.789 1.00 44.26 ? 11  LEU B CA    1 
ATOM   2852 C C     . LEU F 3 4   ? 6.230  20.435 -14.563 1.00 44.95 ? 11  LEU B C     1 
ATOM   2853 O O     . LEU F 3 4   ? 6.250  19.449 -13.833 1.00 45.28 ? 11  LEU B O     1 
ATOM   2854 C CB    . LEU F 3 4   ? 7.988  21.906 -13.473 1.00 42.39 ? 11  LEU B CB    1 
ATOM   2855 C CG    . LEU F 3 4   ? 8.406  21.101 -12.234 1.00 41.66 ? 11  LEU B CG    1 
ATOM   2856 C CD1   . LEU F 3 4   ? 7.192  20.766 -11.368 1.00 41.71 ? 11  LEU B CD1   1 
ATOM   2857 C CD2   . LEU F 3 4   ? 9.155  19.862 -12.664 1.00 40.88 ? 11  LEU B CD2   1 
ATOM   2858 N N     . GLU F 3 5   ? 5.135  20.824 -15.203 1.00 45.77 ? 12  GLU B N     1 
ATOM   2859 C CA    . GLU F 3 5   ? 3.898  20.079 -15.068 1.00 47.42 ? 12  GLU B CA    1 
ATOM   2860 C C     . GLU F 3 5   ? 3.934  18.867 -15.985 1.00 48.30 ? 12  GLU B C     1 
ATOM   2861 O O     . GLU F 3 5   ? 3.419  17.808 -15.638 1.00 49.37 ? 12  GLU B O     1 
ATOM   2862 C CB    . GLU F 3 5   ? 2.694  20.968 -15.407 1.00 46.93 ? 12  GLU B CB    1 
ATOM   2863 C CG    . GLU F 3 5   ? 1.988  21.578 -14.196 1.00 45.31 ? 12  GLU B CG    1 
ATOM   2864 C CD    . GLU F 3 5   ? 1.415  20.514 -13.269 1.00 45.85 ? 12  GLU B CD    1 
ATOM   2865 O OE1   . GLU F 3 5   ? 0.507  20.824 -12.461 1.00 45.60 ? 12  GLU B OE1   1 
ATOM   2866 O OE2   . GLU F 3 5   ? 1.880  19.359 -13.345 1.00 43.58 ? 12  GLU B OE2   1 
ATOM   2867 N N     . TRP F 3 6   ? 4.569  19.021 -17.143 1.00 49.59 ? 13  TRP B N     1 
ATOM   2868 C CA    . TRP F 3 6   ? 4.677  17.940 -18.132 1.00 50.99 ? 13  TRP B CA    1 
ATOM   2869 C C     . TRP F 3 6   ? 5.443  16.733 -17.586 1.00 50.15 ? 13  TRP B C     1 
ATOM   2870 O O     . TRP F 3 6   ? 5.178  15.583 -17.962 1.00 49.94 ? 13  TRP B O     1 
ATOM   2871 C CB    . TRP F 3 6   ? 5.400  18.440 -19.395 1.00 53.46 ? 13  TRP B CB    1 
ATOM   2872 C CG    . TRP F 3 6   ? 6.874  18.076 -19.421 1.00 56.71 ? 13  TRP B CG    1 
ATOM   2873 C CD1   . TRP F 3 6   ? 7.848  18.505 -18.558 1.00 57.05 ? 13  TRP B CD1   1 
ATOM   2874 C CD2   . TRP F 3 6   ? 7.511  17.137 -20.303 1.00 58.13 ? 13  TRP B CD2   1 
ATOM   2875 N NE1   . TRP F 3 6   ? 9.043  17.883 -18.844 1.00 57.91 ? 13  TRP B NE1   1 
ATOM   2876 C CE2   . TRP F 3 6   ? 8.863  17.042 -19.911 1.00 57.21 ? 13  TRP B CE2   1 
ATOM   2877 C CE3   . TRP F 3 6   ? 7.067  16.366 -21.386 1.00 58.56 ? 13  TRP B CE3   1 
ATOM   2878 C CZ2   . TRP F 3 6   ? 9.771  16.210 -20.560 1.00 57.17 ? 13  TRP B CZ2   1 
ATOM   2879 C CZ3   . TRP F 3 6   ? 7.977  15.539 -22.031 1.00 58.00 ? 13  TRP B CZ3   1 
ATOM   2880 C CH2   . TRP F 3 6   ? 9.311  15.470 -21.615 1.00 56.58 ? 13  TRP B CH2   1 
ATOM   2881 N N     . PHE F 3 7   ? 6.408  17.027 -16.718 1.00 48.94 ? 14  PHE B N     1 
ATOM   2882 C CA    . PHE F 3 7   ? 7.273  16.031 -16.096 1.00 48.10 ? 14  PHE B CA    1 
ATOM   2883 C C     . PHE F 3 7   ? 6.528  15.219 -15.051 1.00 48.08 ? 14  PHE B C     1 
ATOM   2884 O O     . PHE F 3 7   ? 6.353  14.015 -15.188 1.00 47.07 ? 14  PHE B O     1 
ATOM   2885 C CB    . PHE F 3 7   ? 8.455  16.738 -15.432 1.00 47.48 ? 14  PHE B CB    1 
ATOM   2886 C CG    . PHE F 3 7   ? 9.440  15.807 -14.799 1.00 45.77 ? 14  PHE B CG    1 
ATOM   2887 C CD1   . PHE F 3 7   ? 10.313 15.073 -15.579 1.00 44.77 ? 14  PHE B CD1   1 
ATOM   2888 C CD2   . PHE F 3 7   ? 9.481  15.659 -13.423 1.00 45.08 ? 14  PHE B CD2   1 
ATOM   2889 C CE1   . PHE F 3 7   ? 11.213 14.204 -14.994 1.00 45.66 ? 14  PHE B CE1   1 
ATOM   2890 C CE2   . PHE F 3 7   ? 10.374 14.796 -12.830 1.00 44.40 ? 14  PHE B CE2   1 
ATOM   2891 C CZ    . PHE F 3 7   ? 11.244 14.065 -13.613 1.00 45.03 ? 14  PHE B CZ    1 
ATOM   2892 N N     . LEU F 3 8   ? 6.105  15.912 -14.001 1.00 49.23 ? 15  LEU B N     1 
ATOM   2893 C CA    . LEU F 3 8   ? 5.373  15.331 -12.882 1.00 50.22 ? 15  LEU B CA    1 
ATOM   2894 C C     . LEU F 3 8   ? 4.482  14.165 -13.285 1.00 50.42 ? 15  LEU B C     1 
ATOM   2895 O O     . LEU F 3 8   ? 4.498  13.106 -12.646 1.00 50.08 ? 15  LEU B O     1 
ATOM   2896 C CB    . LEU F 3 8   ? 4.524  16.423 -12.227 1.00 50.47 ? 15  LEU B CB    1 
ATOM   2897 C CG    . LEU F 3 8   ? 5.349  17.638 -11.792 1.00 51.05 ? 15  LEU B CG    1 
ATOM   2898 C CD1   . LEU F 3 8   ? 4.485  18.891 -11.747 1.00 51.53 ? 15  LEU B CD1   1 
ATOM   2899 C CD2   . LEU F 3 8   ? 6.001  17.342 -10.445 1.00 51.11 ? 15  LEU B CD2   1 
ATOM   2900 N N     . SER F 3 9   ? 3.712  14.372 -14.350 1.00 50.57 ? 16  SER B N     1 
ATOM   2901 C CA    . SER F 3 9   ? 2.784  13.364 -14.853 1.00 50.30 ? 16  SER B CA    1 
ATOM   2902 C C     . SER F 3 9   ? 3.389  12.495 -15.965 1.00 49.48 ? 16  SER B C     1 
ATOM   2903 O O     . SER F 3 9   ? 2.671  11.928 -16.789 1.00 49.07 ? 16  SER B O     1 
ATOM   2904 C CB    . SER F 3 9   ? 1.511  14.057 -15.347 1.00 51.18 ? 16  SER B CB    1 
ATOM   2905 O OG    . SER F 3 9   ? 0.970  14.905 -14.342 1.00 50.75 ? 16  SER B OG    1 
ATOM   2906 N N     . HIS F 3 10  ? 4.716  12.402 -15.968 1.00 48.80 ? 17  HIS B N     1 
ATOM   2907 C CA    . HIS F 3 10  ? 5.462  11.604 -16.938 1.00 48.01 ? 17  HIS B CA    1 
ATOM   2908 C C     . HIS F 3 10  ? 6.303  10.593 -16.118 1.00 48.60 ? 17  HIS B C     1 
ATOM   2909 O O     . HIS F 3 10  ? 6.863  9.624  -16.657 1.00 47.63 ? 17  HIS B O     1 
ATOM   2910 C CB    . HIS F 3 10  ? 6.357  12.533 -17.783 1.00 46.42 ? 17  HIS B CB    1 
ATOM   2911 C CG    . HIS F 3 10  ? 6.544  12.078 -19.201 1.00 45.66 ? 17  HIS B CG    1 
ATOM   2912 N ND1   . HIS F 3 10  ? 7.398  11.052 -19.554 1.00 44.90 ? 17  HIS B ND1   1 
ATOM   2913 C CD2   . HIS F 3 10  ? 5.958  12.489 -20.352 1.00 44.62 ? 17  HIS B CD2   1 
ATOM   2914 C CE1   . HIS F 3 10  ? 7.327  10.850 -20.858 1.00 44.24 ? 17  HIS B CE1   1 
ATOM   2915 N NE2   . HIS F 3 10  ? 6.461  11.709 -21.366 1.00 43.65 ? 17  HIS B NE2   1 
ATOM   2916 N N     . CYS F 3 11  ? 6.356  10.833 -14.804 1.00 49.14 ? 18  CYS B N     1 
ATOM   2917 C CA    . CYS F 3 11  ? 7.089  9.996  -13.847 1.00 50.24 ? 18  CYS B CA    1 
ATOM   2918 C C     . CYS F 3 11  ? 6.095  9.275  -12.932 1.00 50.71 ? 18  CYS B C     1 
ATOM   2919 O O     . CYS F 3 11  ? 4.880  9.345  -13.141 1.00 51.43 ? 18  CYS B O     1 
ATOM   2920 C CB    . CYS F 3 11  ? 8.016  10.844 -12.959 1.00 50.11 ? 18  CYS B CB    1 
ATOM   2921 S SG    . CYS F 3 11  ? 8.961  12.140 -13.784 1.00 50.61 ? 18  CYS B SG    1 
ATOM   2922 N N     . HIS F 3 12  ? 6.622  8.612  -11.900 1.00 50.52 ? 19  HIS B N     1 
ATOM   2923 C CA    . HIS F 3 12  ? 5.801  7.865  -10.941 1.00 49.75 ? 19  HIS B CA    1 
ATOM   2924 C C     . HIS F 3 12  ? 5.754  8.469  -9.533  1.00 48.43 ? 19  HIS B C     1 
ATOM   2925 O O     . HIS F 3 12  ? 6.404  9.475  -9.241  1.00 49.12 ? 19  HIS B O     1 
ATOM   2926 C CB    . HIS F 3 12  ? 6.297  6.421  -10.838 1.00 50.11 ? 19  HIS B CB    1 
ATOM   2927 C CG    . HIS F 3 12  ? 6.346  5.711  -12.152 1.00 50.51 ? 19  HIS B CG    1 
ATOM   2928 N ND1   . HIS F 3 12  ? 5.327  5.793  -13.076 1.00 50.25 ? 19  HIS B ND1   1 
ATOM   2929 C CD2   . HIS F 3 12  ? 7.281  4.894  -12.691 1.00 50.34 ? 19  HIS B CD2   1 
ATOM   2930 C CE1   . HIS F 3 12  ? 5.633  5.057  -14.130 1.00 50.68 ? 19  HIS B CE1   1 
ATOM   2931 N NE2   . HIS F 3 12  ? 6.813  4.501  -13.921 1.00 51.03 ? 19  HIS B NE2   1 
ATOM   2932 N N     . ILE F 3 13  ? 4.969  7.842  -8.665  1.00 45.30 ? 20  ILE B N     1 
ATOM   2933 C CA    . ILE F 3 13  ? 4.831  8.296  -7.296  1.00 42.39 ? 20  ILE B CA    1 
ATOM   2934 C C     . ILE F 3 13  ? 5.069  7.067  -6.444  1.00 41.42 ? 20  ILE B C     1 
ATOM   2935 O O     . ILE F 3 13  ? 4.337  6.099  -6.520  1.00 40.07 ? 20  ILE B O     1 
ATOM   2936 C CB    . ILE F 3 13  ? 3.408  8.878  -7.035  1.00 41.67 ? 20  ILE B CB    1 
ATOM   2937 C CG1   . ILE F 3 13  ? 3.045  9.880  -8.139  1.00 40.94 ? 20  ILE B CG1   1 
ATOM   2938 C CG2   . ILE F 3 13  ? 3.358  9.588  -5.691  1.00 39.15 ? 20  ILE B CG2   1 
ATOM   2939 C CD1   . ILE F 3 13  ? 3.941  11.110 -8.197  1.00 39.05 ? 20  ILE B CD1   1 
ATOM   2940 N N     . HIS F 3 14  ? 6.130  7.093  -5.656  1.00 42.35 ? 21  HIS B N     1 
ATOM   2941 C CA    . HIS F 3 14  ? 6.448  5.961  -4.806  1.00 42.92 ? 21  HIS B CA    1 
ATOM   2942 C C     . HIS F 3 14  ? 6.174  6.302  -3.355  1.00 41.97 ? 21  HIS B C     1 
ATOM   2943 O O     . HIS F 3 14  ? 5.880  7.446  -3.005  1.00 41.12 ? 21  HIS B O     1 
ATOM   2944 C CB    . HIS F 3 14  ? 7.923  5.563  -4.962  1.00 44.50 ? 21  HIS B CB    1 
ATOM   2945 C CG    . HIS F 3 14  ? 8.256  4.963  -6.294  1.00 47.22 ? 21  HIS B CG    1 
ATOM   2946 N ND1   . HIS F 3 14  ? 7.314  4.767  -7.285  1.00 47.43 ? 21  HIS B ND1   1 
ATOM   2947 C CD2   . HIS F 3 14  ? 9.433  4.519  -6.800  1.00 47.83 ? 21  HIS B CD2   1 
ATOM   2948 C CE1   . HIS F 3 14  ? 7.897  4.229  -8.341  1.00 48.07 ? 21  HIS B CE1   1 
ATOM   2949 N NE2   . HIS F 3 14  ? 9.182  4.068  -8.074  1.00 48.19 ? 21  HIS B NE2   1 
ATOM   2950 N N     . LYS F 3 15  ? 6.264  5.297  -2.503  1.00 40.77 ? 22  LYS B N     1 
ATOM   2951 C CA    . LYS F 3 15  ? 6.052  5.544  -1.102  1.00 39.79 ? 22  LYS B CA    1 
ATOM   2952 C C     . LYS F 3 15  ? 7.216  5.056  -0.276  1.00 38.55 ? 22  LYS B C     1 
ATOM   2953 O O     . LYS F 3 15  ? 7.651  3.905  -0.382  1.00 38.30 ? 22  LYS B O     1 
ATOM   2954 C CB    . LYS F 3 15  ? 4.746  4.911  -0.631  1.00 40.75 ? 22  LYS B CB    1 
ATOM   2955 C CG    . LYS F 3 15  ? 3.524  5.775  -0.958  1.00 43.15 ? 22  LYS B CG    1 
ATOM   2956 C CD    . LYS F 3 15  ? 3.489  7.078  -0.133  1.00 42.25 ? 22  LYS B CD    1 
ATOM   2957 C CE    . LYS F 3 15  ? 2.276  7.943  -0.496  1.00 41.85 ? 22  LYS B CE    1 
ATOM   2958 N NZ    . LYS F 3 15  ? 2.041  9.075  0.453   1.00 39.90 ? 22  LYS B NZ    1 
ATOM   2959 N N     . TYR F 3 16  ? 7.737  5.981  0.518   1.00 36.48 ? 23  TYR B N     1 
ATOM   2960 C CA    . TYR F 3 16  ? 8.831  5.707  1.416   1.00 34.21 ? 23  TYR B CA    1 
ATOM   2961 C C     . TYR F 3 16  ? 8.422  6.364  2.722   1.00 32.82 ? 23  TYR B C     1 
ATOM   2962 O O     . TYR F 3 16  ? 8.007  7.526  2.728   1.00 30.44 ? 23  TYR B O     1 
ATOM   2963 C CB    . TYR F 3 16  ? 10.131 6.341  0.911   1.00 34.35 ? 23  TYR B CB    1 
ATOM   2964 C CG    . TYR F 3 16  ? 10.715 5.742  -0.354  1.00 34.02 ? 23  TYR B CG    1 
ATOM   2965 C CD1   . TYR F 3 16  ? 11.942 5.086  -0.330  1.00 34.52 ? 23  TYR B CD1   1 
ATOM   2966 C CD2   . TYR F 3 16  ? 10.070 5.883  -1.578  1.00 33.89 ? 23  TYR B CD2   1 
ATOM   2967 C CE1   . TYR F 3 16  ? 12.520 4.589  -1.504  1.00 35.99 ? 23  TYR B CE1   1 
ATOM   2968 C CE2   . TYR F 3 16  ? 10.630 5.389  -2.757  1.00 34.75 ? 23  TYR B CE2   1 
ATOM   2969 C CZ    . TYR F 3 16  ? 11.857 4.745  -2.721  1.00 35.30 ? 23  TYR B CZ    1 
ATOM   2970 O OH    . TYR F 3 16  ? 12.431 4.280  -3.894  1.00 34.07 ? 23  TYR B OH    1 
ATOM   2971 N N     . PRO F 3 17  ? 8.503  5.608  3.836   1.00 32.28 ? 24  PRO B N     1 
ATOM   2972 C CA    . PRO F 3 17  ? 8.176  6.011  5.209   1.00 31.12 ? 24  PRO B CA    1 
ATOM   2973 C C     . PRO F 3 17  ? 9.346  6.732  5.891   1.00 30.27 ? 24  PRO B C     1 
ATOM   2974 O O     . PRO F 3 17  ? 10.404 6.903  5.296   1.00 30.31 ? 24  PRO B O     1 
ATOM   2975 C CB    . PRO F 3 17  ? 7.847  4.686  5.879   1.00 31.31 ? 24  PRO B CB    1 
ATOM   2976 C CG    . PRO F 3 17  ? 8.831  3.771  5.242   1.00 32.75 ? 24  PRO B CG    1 
ATOM   2977 C CD    . PRO F 3 17  ? 8.711  4.149  3.772   1.00 32.53 ? 24  PRO B CD    1 
ATOM   2978 N N     . SER F 3 18  ? 9.148  7.127  7.146   1.00 30.12 ? 25  SER B N     1 
ATOM   2979 C CA    . SER F 3 18  ? 10.137 7.866  7.950   1.00 29.68 ? 25  SER B CA    1 
ATOM   2980 C C     . SER F 3 18  ? 11.423 7.096  8.338   1.00 28.73 ? 25  SER B C     1 
ATOM   2981 O O     . SER F 3 18  ? 11.538 6.602  9.454   1.00 28.18 ? 25  SER B O     1 
ATOM   2982 C CB    . SER F 3 18  ? 9.431  8.381  9.220   1.00 30.53 ? 25  SER B CB    1 
ATOM   2983 O OG    . SER F 3 18  ? 9.947  9.621  9.677   1.00 30.61 ? 25  SER B OG    1 
ATOM   2984 N N     . LYS F 3 19  ? 12.377 7.016  7.409   1.00 28.56 ? 26  LYS B N     1 
ATOM   2985 C CA    . LYS F 3 19  ? 13.677 6.333  7.593   1.00 28.14 ? 26  LYS B CA    1 
ATOM   2986 C C     . LYS F 3 19  ? 14.141 5.490  6.402   1.00 26.92 ? 26  LYS B C     1 
ATOM   2987 O O     . LYS F 3 19  ? 15.296 5.091  6.330   1.00 25.60 ? 26  LYS B O     1 
ATOM   2988 C CB    . LYS F 3 19  ? 13.701 5.423  8.823   1.00 29.39 ? 26  LYS B CB    1 
ATOM   2989 C CG    . LYS F 3 19  ? 15.035 4.709  8.969   1.00 30.83 ? 26  LYS B CG    1 
ATOM   2990 C CD    . LYS F 3 19  ? 16.173 5.740  8.897   1.00 33.34 ? 26  LYS B CD    1 
ATOM   2991 C CE    . LYS F 3 19  ? 17.528 5.115  8.562   1.00 34.00 ? 26  LYS B CE    1 
ATOM   2992 N NZ    . LYS F 3 19  ? 17.606 4.611  7.157   1.00 33.64 ? 26  LYS B NZ    1 
ATOM   2993 N N     . SER F 3 20  ? 13.250 5.185  5.473   1.00 26.64 ? 27  SER B N     1 
ATOM   2994 C CA    . SER F 3 20  ? 13.685 4.408  4.328   1.00 26.00 ? 27  SER B CA    1 
ATOM   2995 C C     . SER F 3 20  ? 14.799 5.168  3.611   1.00 23.97 ? 27  SER B C     1 
ATOM   2996 O O     . SER F 3 20  ? 14.778 6.395  3.514   1.00 22.22 ? 27  SER B O     1 
ATOM   2997 C CB    . SER F 3 20  ? 12.504 4.094  3.378   1.00 27.60 ? 27  SER B CB    1 
ATOM   2998 O OG    . SER F 3 20  ? 11.606 5.181  3.220   1.00 27.70 ? 27  SER B OG    1 
ATOM   2999 N N     . THR F 3 21  ? 15.776 4.404  3.139   1.00 23.10 ? 28  THR B N     1 
ATOM   3000 C CA    . THR F 3 21  ? 16.956 4.895  2.434   1.00 21.33 ? 28  THR B CA    1 
ATOM   3001 C C     . THR F 3 21  ? 16.644 5.066  0.960   1.00 21.83 ? 28  THR B C     1 
ATOM   3002 O O     . THR F 3 21  ? 16.825 4.150  0.170   1.00 24.62 ? 28  THR B O     1 
ATOM   3003 C CB    . THR F 3 21  ? 18.076 3.876  2.561   1.00 20.28 ? 28  THR B CB    1 
ATOM   3004 O OG1   . THR F 3 21  ? 18.260 3.567  3.945   1.00 19.56 ? 28  THR B OG1   1 
ATOM   3005 C CG2   . THR F 3 21  ? 19.365 4.405  1.950   1.00 20.01 ? 28  THR B CG2   1 
ATOM   3006 N N     . LEU F 3 22  ? 16.196 6.246  0.582   1.00 21.01 ? 29  LEU B N     1 
ATOM   3007 C CA    . LEU F 3 22  ? 15.835 6.493  -0.793  1.00 19.74 ? 29  LEU B CA    1 
ATOM   3008 C C     . LEU F 3 22  ? 16.770 5.933  -1.827  1.00 19.43 ? 29  LEU B C     1 
ATOM   3009 O O     . LEU F 3 22  ? 16.325 5.244  -2.720  1.00 21.05 ? 29  LEU B O     1 
ATOM   3010 C CB    . LEU F 3 22  ? 15.631 7.983  -1.016  1.00 18.60 ? 29  LEU B CB    1 
ATOM   3011 C CG    . LEU F 3 22  ? 14.241 8.424  -0.585  1.00 14.99 ? 29  LEU B CG    1 
ATOM   3012 C CD1   . LEU F 3 22  ? 13.981 7.998  0.826   1.00 13.11 ? 29  LEU B CD1   1 
ATOM   3013 C CD2   . LEU F 3 22  ? 14.145 9.904  -0.717  1.00 14.94 ? 29  LEU B CD2   1 
ATOM   3014 N N     . ILE F 3 23  ? 18.051 6.236  -1.727  1.00 20.37 ? 30  ILE B N     1 
ATOM   3015 C CA    . ILE F 3 23  ? 19.020 5.715  -2.678  1.00 22.33 ? 30  ILE B CA    1 
ATOM   3016 C C     . ILE F 3 23  ? 20.264 5.363  -1.869  1.00 25.72 ? 30  ILE B C     1 
ATOM   3017 O O     . ILE F 3 23  ? 20.555 6.062  -0.894  1.00 27.72 ? 30  ILE B O     1 
ATOM   3018 C CB    . ILE F 3 23  ? 19.430 6.763  -3.729  1.00 20.97 ? 30  ILE B CB    1 
ATOM   3019 C CG1   . ILE F 3 23  ? 20.187 7.883  -3.063  1.00 21.06 ? 30  ILE B CG1   1 
ATOM   3020 C CG2   . ILE F 3 23  ? 18.238 7.355  -4.412  1.00 18.66 ? 30  ILE B CG2   1 
ATOM   3021 C CD1   . ILE F 3 23  ? 20.898 8.722  -4.062  1.00 25.66 ? 30  ILE B CD1   1 
ATOM   3022 N N     . HIS F 3 24  ? 20.995 4.313  -2.274  1.00 27.07 ? 31  HIS B N     1 
ATOM   3023 C CA    . HIS F 3 24  ? 22.202 3.857  -1.569  1.00 28.52 ? 31  HIS B CA    1 
ATOM   3024 C C     . HIS F 3 24  ? 23.498 4.112  -2.315  1.00 29.01 ? 31  HIS B C     1 
ATOM   3025 O O     . HIS F 3 24  ? 23.531 4.055  -3.528  1.00 30.51 ? 31  HIS B O     1 
ATOM   3026 C CB    . HIS F 3 24  ? 22.122 2.367  -1.293  1.00 31.31 ? 31  HIS B CB    1 
ATOM   3027 C CG    . HIS F 3 24  ? 21.229 2.006  -0.155  1.00 34.32 ? 31  HIS B CG    1 
ATOM   3028 N ND1   . HIS F 3 24  ? 19.922 1.611  -0.331  1.00 36.59 ? 31  HIS B ND1   1 
ATOM   3029 C CD2   . HIS F 3 24  ? 21.460 1.959  1.178   1.00 36.94 ? 31  HIS B CD2   1 
ATOM   3030 C CE1   . HIS F 3 24  ? 19.386 1.332  0.845   1.00 38.26 ? 31  HIS B CE1   1 
ATOM   3031 N NE2   . HIS F 3 24  ? 20.300 1.533  1.778   1.00 38.56 ? 31  HIS B NE2   1 
ATOM   3032 N N     . GLN F 3 25  ? 24.578 4.342  -1.581  1.00 29.33 ? 32  GLN B N     1 
ATOM   3033 C CA    . GLN F 3 25  ? 25.871 4.629  -2.197  1.00 30.49 ? 32  GLN B CA    1 
ATOM   3034 C C     . GLN F 3 25  ? 26.430 3.495  -3.004  1.00 31.48 ? 32  GLN B C     1 
ATOM   3035 O O     . GLN F 3 25  ? 26.328 2.343  -2.604  1.00 32.52 ? 32  GLN B O     1 
ATOM   3036 C CB    . GLN F 3 25  ? 26.915 5.023  -1.140  1.00 29.85 ? 32  GLN B CB    1 
ATOM   3037 C CG    . GLN F 3 25  ? 28.360 5.026  -1.681  1.00 28.32 ? 32  GLN B CG    1 
ATOM   3038 C CD    . GLN F 3 25  ? 29.340 5.897  -0.868  1.00 28.57 ? 32  GLN B CD    1 
ATOM   3039 O OE1   . GLN F 3 25  ? 29.668 5.589  0.289   1.00 27.97 ? 32  GLN B OE1   1 
ATOM   3040 N NE2   . GLN F 3 25  ? 29.812 6.988  -1.482  1.00 23.94 ? 32  GLN B NE2   1 
ATOM   3041 N N     . GLY F 3 26  ? 27.041 3.844  -4.134  1.00 33.38 ? 33  GLY B N     1 
ATOM   3042 C CA    . GLY F 3 26  ? 27.669 2.865  -5.026  1.00 35.14 ? 33  GLY B CA    1 
ATOM   3043 C C     . GLY F 3 26  ? 26.795 1.820  -5.719  1.00 35.09 ? 33  GLY B C     1 
ATOM   3044 O O     . GLY F 3 26  ? 27.058 0.628  -5.592  1.00 34.93 ? 33  GLY B O     1 
ATOM   3045 N N     . GLU F 3 27  ? 25.773 2.251  -6.461  1.00 34.75 ? 34  GLU B N     1 
ATOM   3046 C CA    . GLU F 3 27  ? 24.885 1.317  -7.139  1.00 34.06 ? 34  GLU B CA    1 
ATOM   3047 C C     . GLU F 3 27  ? 24.369 1.756  -8.515  1.00 35.08 ? 34  GLU B C     1 
ATOM   3048 O O     . GLU F 3 27  ? 23.164 1.898  -8.722  1.00 35.98 ? 34  GLU B O     1 
ATOM   3049 C CB    . GLU F 3 27  ? 23.715 1.000  -6.224  1.00 33.21 ? 34  GLU B CB    1 
ATOM   3050 C CG    . GLU F 3 27  ? 24.161 0.373  -4.943  1.00 33.92 ? 34  GLU B CG    1 
ATOM   3051 C CD    . GLU F 3 27  ? 23.049 -0.309 -4.198  1.00 35.19 ? 34  GLU B CD    1 
ATOM   3052 O OE1   . GLU F 3 27  ? 23.340 -0.808 -3.097  1.00 36.67 ? 34  GLU B OE1   1 
ATOM   3053 O OE2   . GLU F 3 27  ? 21.899 -0.358 -4.700  1.00 35.19 ? 34  GLU B OE2   1 
ATOM   3054 N N     . LYS F 3 28  ? 25.290 1.944  -9.455  1.00 35.32 ? 35  LYS B N     1 
ATOM   3055 C CA    . LYS F 3 28  ? 24.958 2.356  -10.814 1.00 35.23 ? 35  LYS B CA    1 
ATOM   3056 C C     . LYS F 3 28  ? 23.699 3.216  -10.871 1.00 34.26 ? 35  LYS B C     1 
ATOM   3057 O O     . LYS F 3 28  ? 22.600 2.713  -10.715 1.00 31.80 ? 35  LYS B O     1 
ATOM   3058 C CB    . LYS F 3 28  ? 24.771 1.118  -11.708 1.00 36.12 ? 35  LYS B CB    1 
ATOM   3059 C CG    . LYS F 3 28  ? 26.021 0.271  -11.923 1.00 35.62 ? 35  LYS B CG    1 
ATOM   3060 C CD    . LYS F 3 28  ? 25.684 -1.113 -12.505 1.00 34.75 ? 35  LYS B CD    1 
ATOM   3061 C CE    . LYS F 3 28  ? 26.955 -1.936 -12.727 1.00 36.16 ? 35  LYS B CE    1 
ATOM   3062 N NZ    . LYS F 3 28  ? 27.826 -1.983 -11.505 1.00 36.36 ? 35  LYS B NZ    1 
ATOM   3063 N N     . ALA F 3 29  ? 23.865 4.509  -11.115 1.00 35.26 ? 36  ALA B N     1 
ATOM   3064 C CA    . ALA F 3 29  ? 22.719 5.408  -11.185 1.00 37.99 ? 36  ALA B CA    1 
ATOM   3065 C C     . ALA F 3 29  ? 21.998 5.303  -12.525 1.00 38.93 ? 36  ALA B C     1 
ATOM   3066 O O     . ALA F 3 29  ? 22.593 5.534  -13.570 1.00 39.68 ? 36  ALA B O     1 
ATOM   3067 C CB    . ALA F 3 29  ? 23.170 6.855  -10.946 1.00 37.65 ? 36  ALA B CB    1 
ATOM   3068 N N     . GLU F 3 30  ? 20.722 4.942  -12.511 1.00 39.81 ? 37  GLU B N     1 
ATOM   3069 C CA    . GLU F 3 30  ? 19.996 4.862  -13.769 1.00 41.49 ? 37  GLU B CA    1 
ATOM   3070 C C     . GLU F 3 30  ? 18.564 5.357  -13.631 1.00 42.25 ? 37  GLU B C     1 
ATOM   3071 O O     . GLU F 3 30  ? 17.685 4.983  -14.410 1.00 43.01 ? 37  GLU B O     1 
ATOM   3072 C CB    . GLU F 3 30  ? 19.995 3.437  -14.311 1.00 41.64 ? 37  GLU B CB    1 
ATOM   3073 C CG    . GLU F 3 30  ? 19.704 3.397  -15.799 1.00 42.77 ? 37  GLU B CG    1 
ATOM   3074 C CD    . GLU F 3 30  ? 20.772 4.115  -16.609 1.00 43.94 ? 37  GLU B CD    1 
ATOM   3075 O OE1   . GLU F 3 30  ? 20.569 4.329  -17.825 1.00 44.23 ? 37  GLU B OE1   1 
ATOM   3076 O OE2   . GLU F 3 30  ? 21.825 4.458  -16.024 1.00 44.07 ? 37  GLU B OE2   1 
ATOM   3077 N N     . THR F 3 31  ? 18.353 6.227  -12.647 1.00 41.88 ? 38  THR B N     1 
ATOM   3078 C CA    . THR F 3 31  ? 17.039 6.786  -12.357 1.00 40.85 ? 38  THR B CA    1 
ATOM   3079 C C     . THR F 3 31  ? 17.147 8.027  -11.448 1.00 40.18 ? 38  THR B C     1 
ATOM   3080 O O     . THR F 3 31  ? 17.984 8.056  -10.535 1.00 40.91 ? 38  THR B O     1 
ATOM   3081 C CB    . THR F 3 31  ? 16.163 5.706  -11.674 1.00 40.18 ? 38  THR B CB    1 
ATOM   3082 O OG1   . THR F 3 31  ? 14.975 6.304  -11.153 1.00 39.97 ? 38  THR B OG1   1 
ATOM   3083 C CG2   . THR F 3 31  ? 16.921 5.044  -10.547 1.00 39.73 ? 38  THR B CG2   1 
ATOM   3084 N N     . LEU F 3 32  ? 16.327 9.055  -11.710 1.00 38.51 ? 39  LEU B N     1 
ATOM   3085 C CA    . LEU F 3 32  ? 16.337 10.273 -10.883 1.00 37.11 ? 39  LEU B CA    1 
ATOM   3086 C C     . LEU F 3 32  ? 15.015 10.461 -10.164 1.00 35.98 ? 39  LEU B C     1 
ATOM   3087 O O     . LEU F 3 32  ? 13.955 10.371 -10.764 1.00 35.99 ? 39  LEU B O     1 
ATOM   3088 C CB    . LEU F 3 32  ? 16.637 11.542 -11.702 1.00 36.22 ? 39  LEU B CB    1 
ATOM   3089 C CG    . LEU F 3 32  ? 15.715 12.025 -12.823 1.00 35.40 ? 39  LEU B CG    1 
ATOM   3090 C CD1   . LEU F 3 32  ? 15.729 13.544 -12.909 1.00 35.35 ? 39  LEU B CD1   1 
ATOM   3091 C CD2   . LEU F 3 32  ? 16.177 11.424 -14.130 1.00 35.82 ? 39  LEU B CD2   1 
ATOM   3092 N N     . TYR F 3 33  ? 15.094 10.745 -8.871  1.00 34.73 ? 40  TYR B N     1 
ATOM   3093 C CA    . TYR F 3 33  ? 13.915 10.929 -8.047  1.00 33.73 ? 40  TYR B CA    1 
ATOM   3094 C C     . TYR F 3 33  ? 13.502 12.398 -7.988  1.00 32.68 ? 40  TYR B C     1 
ATOM   3095 O O     . TYR F 3 33  ? 14.310 13.277 -8.295  1.00 34.01 ? 40  TYR B O     1 
ATOM   3096 C CB    . TYR F 3 33  ? 14.206 10.375 -6.651  1.00 33.59 ? 40  TYR B CB    1 
ATOM   3097 C CG    . TYR F 3 33  ? 14.722 8.952  -6.701  1.00 31.91 ? 40  TYR B CG    1 
ATOM   3098 C CD1   . TYR F 3 33  ? 15.799 8.622  -7.515  1.00 32.85 ? 40  TYR B CD1   1 
ATOM   3099 C CD2   . TYR F 3 33  ? 14.120 7.938  -5.971  1.00 30.52 ? 40  TYR B CD2   1 
ATOM   3100 C CE1   . TYR F 3 33  ? 16.270 7.318  -7.616  1.00 33.92 ? 40  TYR B CE1   1 
ATOM   3101 C CE2   . TYR F 3 33  ? 14.578 6.624  -6.058  1.00 33.37 ? 40  TYR B CE2   1 
ATOM   3102 C CZ    . TYR F 3 33  ? 15.661 6.315  -6.893  1.00 33.97 ? 40  TYR B CZ    1 
ATOM   3103 O OH    . TYR F 3 33  ? 16.131 5.020  -7.037  1.00 31.78 ? 40  TYR B OH    1 
ATOM   3104 N N     . TYR F 3 34  ? 12.242 12.657 -7.626  1.00 30.33 ? 41  TYR B N     1 
ATOM   3105 C CA    . TYR F 3 34  ? 11.731 14.021 -7.523  1.00 28.70 ? 41  TYR B CA    1 
ATOM   3106 C C     . TYR F 3 34  ? 10.782 14.232 -6.344  1.00 28.65 ? 41  TYR B C     1 
ATOM   3107 O O     . TYR F 3 34  ? 9.555  14.238 -6.499  1.00 29.85 ? 41  TYR B O     1 
ATOM   3108 C CB    . TYR F 3 34  ? 11.029 14.428 -8.819  1.00 29.45 ? 41  TYR B CB    1 
ATOM   3109 C CG    . TYR F 3 34  ? 10.531 15.865 -8.813  1.00 29.33 ? 41  TYR B CG    1 
ATOM   3110 C CD1   . TYR F 3 34  ? 9.211  16.183 -8.456  1.00 28.44 ? 41  TYR B CD1   1 
ATOM   3111 C CD2   . TYR F 3 34  ? 11.395 16.911 -9.111  1.00 29.78 ? 41  TYR B CD2   1 
ATOM   3112 C CE1   . TYR F 3 34  ? 8.778  17.507 -8.397  1.00 27.47 ? 41  TYR B CE1   1 
ATOM   3113 C CE2   . TYR F 3 34  ? 10.968 18.234 -9.050  1.00 29.95 ? 41  TYR B CE2   1 
ATOM   3114 C CZ    . TYR F 3 34  ? 9.666  18.527 -8.694  1.00 28.41 ? 41  TYR B CZ    1 
ATOM   3115 O OH    . TYR F 3 34  ? 9.290  19.855 -8.631  1.00 29.60 ? 41  TYR B OH    1 
ATOM   3116 N N     . ILE F 3 35  ? 11.356 14.413 -5.163  1.00 26.86 ? 42  ILE B N     1 
ATOM   3117 C CA    . ILE F 3 35  ? 10.590 14.647 -3.942  1.00 25.34 ? 42  ILE B CA    1 
ATOM   3118 C C     . ILE F 3 35  ? 9.297  15.456 -4.135  1.00 23.80 ? 42  ILE B C     1 
ATOM   3119 O O     . ILE F 3 35  ? 9.336  16.658 -4.328  1.00 23.68 ? 42  ILE B O     1 
ATOM   3120 C CB    . ILE F 3 35  ? 11.452 15.392 -2.929  1.00 24.78 ? 42  ILE B CB    1 
ATOM   3121 C CG1   . ILE F 3 35  ? 12.638 14.527 -2.523  1.00 25.04 ? 42  ILE B CG1   1 
ATOM   3122 C CG2   . ILE F 3 35  ? 10.622 15.792 -1.744  1.00 25.82 ? 42  ILE B CG2   1 
ATOM   3123 C CD1   . ILE F 3 35  ? 13.615 15.240 -1.606  1.00 27.37 ? 42  ILE B CD1   1 
ATOM   3124 N N     . VAL F 3 36  ? 8.153  14.796 -4.080  1.00 23.58 ? 43  VAL B N     1 
ATOM   3125 C CA    . VAL F 3 36  ? 6.878  15.495 -4.227  1.00 23.26 ? 43  VAL B CA    1 
ATOM   3126 C C     . VAL F 3 36  ? 6.498  16.169 -2.893  1.00 23.45 ? 43  VAL B C     1 
ATOM   3127 O O     . VAL F 3 36  ? 6.239  17.378 -2.844  1.00 23.40 ? 43  VAL B O     1 
ATOM   3128 C CB    . VAL F 3 36  ? 5.752  14.527 -4.652  1.00 23.10 ? 43  VAL B CB    1 
ATOM   3129 C CG1   . VAL F 3 36  ? 4.400  15.213 -4.493  1.00 23.19 ? 43  VAL B CG1   1 
ATOM   3130 C CG2   . VAL F 3 36  ? 5.956  14.091 -6.101  1.00 20.14 ? 43  VAL B CG2   1 
ATOM   3131 N N     . LYS F 3 37  ? 6.464  15.381 -1.818  1.00 21.87 ? 44  LYS B N     1 
ATOM   3132 C CA    . LYS F 3 37  ? 6.157  15.907 -0.496  1.00 19.81 ? 44  LYS B CA    1 
ATOM   3133 C C     . LYS F 3 37  ? 7.068  15.305 0.577   1.00 19.84 ? 44  LYS B C     1 
ATOM   3134 O O     . LYS F 3 37  ? 7.179  14.084 0.720   1.00 18.90 ? 44  LYS B O     1 
ATOM   3135 C CB    . LYS F 3 37  ? 4.685  15.661 -0.139  1.00 18.75 ? 44  LYS B CB    1 
ATOM   3136 C CG    . LYS F 3 37  ? 4.368  15.723 1.368   1.00 16.33 ? 44  LYS B CG    1 
ATOM   3137 C CD    . LYS F 3 37  ? 4.142  14.308 1.949   1.00 18.03 ? 44  LYS B CD    1 
ATOM   3138 C CE    . LYS F 3 37  ? 4.182  14.277 3.495   1.00 17.70 ? 44  LYS B CE    1 
ATOM   3139 N NZ    . LYS F 3 37  ? 3.948  12.901 4.052   1.00 16.50 ? 44  LYS B NZ    1 
ATOM   3140 N N     . GLY F 3 38  ? 7.719  16.183 1.332   1.00 19.42 ? 45  GLY B N     1 
ATOM   3141 C CA    . GLY F 3 38  ? 8.605  15.731 2.389   1.00 18.78 ? 45  GLY B CA    1 
ATOM   3142 C C     . GLY F 3 38  ? 10.017 16.270 2.272   1.00 17.71 ? 45  GLY B C     1 
ATOM   3143 O O     . GLY F 3 38  ? 10.257 17.294 1.637   1.00 17.00 ? 45  GLY B O     1 
ATOM   3144 N N     . SER F 3 39  ? 10.960 15.576 2.891   1.00 17.32 ? 46  SER B N     1 
ATOM   3145 C CA    . SER F 3 39  ? 12.341 16.012 2.851   1.00 18.07 ? 46  SER B CA    1 
ATOM   3146 C C     . SER F 3 39  ? 13.289 14.894 3.163   1.00 17.44 ? 46  SER B C     1 
ATOM   3147 O O     . SER F 3 39  ? 13.204 14.284 4.213   1.00 18.62 ? 46  SER B O     1 
ATOM   3148 C CB    . SER F 3 39  ? 12.583 17.130 3.860   1.00 19.85 ? 46  SER B CB    1 
ATOM   3149 O OG    . SER F 3 39  ? 12.879 16.604 5.139   1.00 23.37 ? 46  SER B OG    1 
ATOM   3150 N N     . VAL F 3 40  ? 14.204 14.634 2.245   1.00 16.99 ? 47  VAL B N     1 
ATOM   3151 C CA    . VAL F 3 40  ? 15.185 13.593 2.445   1.00 15.22 ? 47  VAL B CA    1 
ATOM   3152 C C     . VAL F 3 40  ? 16.419 14.334 2.943   1.00 14.87 ? 47  VAL B C     1 
ATOM   3153 O O     . VAL F 3 40  ? 16.446 15.568 2.915   1.00 14.43 ? 47  VAL B O     1 
ATOM   3154 C CB    . VAL F 3 40  ? 15.498 12.892 1.113   1.00 15.17 ? 47  VAL B CB    1 
ATOM   3155 C CG1   . VAL F 3 40  ? 14.244 12.758 0.305   1.00 13.43 ? 47  VAL B CG1   1 
ATOM   3156 C CG2   . VAL F 3 40  ? 16.501 13.681 0.334   1.00 15.08 ? 47  VAL B CG2   1 
ATOM   3157 N N     . ALA F 3 41  ? 17.411 13.571 3.405   1.00 14.12 ? 48  ALA B N     1 
ATOM   3158 C CA    . ALA F 3 41  ? 18.702 14.066 3.896   1.00 12.01 ? 48  ALA B CA    1 
ATOM   3159 C C     . ALA F 3 41  ? 19.804 13.336 3.092   1.00 12.77 ? 48  ALA B C     1 
ATOM   3160 O O     . ALA F 3 41  ? 19.647 12.171 2.755   1.00 12.44 ? 48  ALA B O     1 
ATOM   3161 C CB    . ALA F 3 41  ? 18.832 13.762 5.356   1.00 10.21 ? 48  ALA B CB    1 
ATOM   3162 N N     . VAL F 3 42  ? 20.916 14.003 2.788   1.00 13.49 ? 49  VAL B N     1 
ATOM   3163 C CA    . VAL F 3 42  ? 21.983 13.392 1.980   1.00 14.35 ? 49  VAL B CA    1 
ATOM   3164 C C     . VAL F 3 42  ? 23.229 13.067 2.789   1.00 14.74 ? 49  VAL B C     1 
ATOM   3165 O O     . VAL F 3 42  ? 23.806 13.966 3.387   1.00 16.73 ? 49  VAL B O     1 
ATOM   3166 C CB    . VAL F 3 42  ? 22.380 14.348 0.827   1.00 12.64 ? 49  VAL B CB    1 
ATOM   3167 C CG1   . VAL F 3 42  ? 23.140 13.625 -0.259  1.00 11.32 ? 49  VAL B CG1   1 
ATOM   3168 C CG2   . VAL F 3 42  ? 21.152 14.964 0.260   1.00 12.86 ? 49  VAL B CG2   1 
ATOM   3169 N N     . LEU F 3 43  ? 23.666 11.808 2.812   1.00 13.89 ? 50  LEU B N     1 
ATOM   3170 C CA    . LEU F 3 43  ? 24.866 11.508 3.594   1.00 15.05 ? 50  LEU B CA    1 
ATOM   3171 C C     . LEU F 3 43  ? 25.938 10.536 3.127   1.00 16.35 ? 50  LEU B C     1 
ATOM   3172 O O     . LEU F 3 43  ? 25.674 9.535  2.468   1.00 16.35 ? 50  LEU B O     1 
ATOM   3173 C CB    . LEU F 3 43  ? 24.484 11.141 5.033   1.00 12.82 ? 50  LEU B CB    1 
ATOM   3174 C CG    . LEU F 3 43  ? 23.301 10.230 5.340   1.00 11.70 ? 50  LEU B CG    1 
ATOM   3175 C CD1   . LEU F 3 43  ? 23.622 8.801  4.991   1.00 12.37 ? 50  LEU B CD1   1 
ATOM   3176 C CD2   . LEU F 3 43  ? 22.973 10.339 6.806   1.00 10.55 ? 50  LEU B CD2   1 
ATOM   3177 N N     . ILE F 3 44  ? 27.172 10.878 3.485   1.00 18.81 ? 51  ILE B N     1 
ATOM   3178 C CA    . ILE F 3 44  ? 28.337 10.058 3.186   1.00 23.00 ? 51  ILE B CA    1 
ATOM   3179 C C     . ILE F 3 44  ? 28.862 9.623  4.544   1.00 25.54 ? 51  ILE B C     1 
ATOM   3180 O O     . ILE F 3 44  ? 28.566 10.254 5.554   1.00 25.12 ? 51  ILE B O     1 
ATOM   3181 C CB    . ILE F 3 44  ? 29.431 10.843 2.443   1.00 22.57 ? 51  ILE B CB    1 
ATOM   3182 C CG1   . ILE F 3 44  ? 29.638 12.197 3.122   1.00 23.17 ? 51  ILE B CG1   1 
ATOM   3183 C CG2   . ILE F 3 44  ? 29.073 10.971 0.964   1.00 22.47 ? 51  ILE B CG2   1 
ATOM   3184 C CD1   . ILE F 3 44  ? 30.679 13.075 2.456   1.00 21.50 ? 51  ILE B CD1   1 
ATOM   3185 N N     . LYS F 3 45  ? 29.631 8.545  4.570   1.00 29.60 ? 52  LYS B N     1 
ATOM   3186 C CA    . LYS F 3 45  ? 30.159 8.023  5.824   1.00 33.02 ? 52  LYS B CA    1 
ATOM   3187 C C     . LYS F 3 45  ? 31.671 7.773  5.756   1.00 34.47 ? 52  LYS B C     1 
ATOM   3188 O O     . LYS F 3 45  ? 32.273 7.842  4.680   1.00 33.87 ? 52  LYS B O     1 
ATOM   3189 C CB    . LYS F 3 45  ? 29.436 6.720  6.173   1.00 34.77 ? 52  LYS B CB    1 
ATOM   3190 C CG    . LYS F 3 45  ? 27.883 6.795  6.111   1.00 38.15 ? 52  LYS B CG    1 
ATOM   3191 C CD    . LYS F 3 45  ? 27.234 5.446  6.517   1.00 38.10 ? 52  LYS B CD    1 
ATOM   3192 C CE    . LYS F 3 45  ? 25.740 5.557  6.789   1.00 37.64 ? 52  LYS B CE    1 
ATOM   3193 N NZ    . LYS F 3 45  ? 25.233 4.379  7.555   1.00 36.20 ? 52  LYS B NZ    1 
ATOM   3194 N N     . ASP F 3 46  ? 32.266 7.483  6.915   1.00 36.48 ? 53  ASP B N     1 
ATOM   3195 C CA    . ASP F 3 46  ? 33.703 7.223  7.042   1.00 38.02 ? 53  ASP B CA    1 
ATOM   3196 C C     . ASP F 3 46  ? 33.954 5.826  7.594   1.00 38.65 ? 53  ASP B C     1 
ATOM   3197 O O     . ASP F 3 46  ? 33.263 5.378  8.505   1.00 38.40 ? 53  ASP B O     1 
ATOM   3198 C CB    . ASP F 3 46  ? 34.350 8.271  7.961   1.00 39.24 ? 53  ASP B CB    1 
ATOM   3199 C CG    . ASP F 3 46  ? 34.852 7.688  9.281   1.00 40.76 ? 53  ASP B CG    1 
ATOM   3200 O OD1   . ASP F 3 46  ? 36.011 7.220  9.327   1.00 42.44 ? 53  ASP B OD1   1 
ATOM   3201 O OD2   . ASP F 3 46  ? 34.090 7.697  10.274  1.00 39.62 ? 53  ASP B OD2   1 
ATOM   3202 N N     . GLU F 3 47  ? 34.947 5.149  7.021   1.00 40.04 ? 54  GLU B N     1 
ATOM   3203 C CA    . GLU F 3 47  ? 35.350 3.795  7.408   1.00 40.14 ? 54  GLU B CA    1 
ATOM   3204 C C     . GLU F 3 47  ? 34.809 3.320  8.748   1.00 39.86 ? 54  GLU B C     1 
ATOM   3205 O O     . GLU F 3 47  ? 34.010 2.398  8.804   1.00 40.23 ? 54  GLU B O     1 
ATOM   3206 C CB    . GLU F 3 47  ? 36.872 3.709  7.441   1.00 41.20 ? 54  GLU B CB    1 
ATOM   3207 C CG    . GLU F 3 47  ? 37.548 3.934  6.100   1.00 42.32 ? 54  GLU B CG    1 
ATOM   3208 C CD    . GLU F 3 47  ? 37.289 2.807  5.131   1.00 43.91 ? 54  GLU B CD    1 
ATOM   3209 O OE1   . GLU F 3 47  ? 38.061 2.689  4.154   1.00 44.26 ? 54  GLU B OE1   1 
ATOM   3210 O OE2   . GLU F 3 47  ? 36.317 2.044  5.347   1.00 44.15 ? 54  GLU B OE2   1 
ATOM   3211 N N     . GLU F 3 48  ? 35.255 3.954  9.826   1.00 39.64 ? 55  GLU B N     1 
ATOM   3212 C CA    . GLU F 3 48  ? 34.823 3.595  11.172  1.00 38.95 ? 55  GLU B CA    1 
ATOM   3213 C C     . GLU F 3 48  ? 33.294 3.651  11.374  1.00 38.03 ? 55  GLU B C     1 
ATOM   3214 O O     . GLU F 3 48  ? 32.789 3.378  12.471  1.00 37.75 ? 55  GLU B O     1 
ATOM   3215 C CB    . GLU F 3 48  ? 35.529 4.492  12.204  1.00 40.05 ? 55  GLU B CB    1 
ATOM   3216 C CG    . GLU F 3 48  ? 36.836 3.932  12.806  1.00 41.48 ? 55  GLU B CG    1 
ATOM   3217 C CD    . GLU F 3 48  ? 38.013 3.854  11.816  1.00 44.57 ? 55  GLU B CD    1 
ATOM   3218 O OE1   . GLU F 3 48  ? 39.168 3.701  12.282  1.00 43.72 ? 55  GLU B OE1   1 
ATOM   3219 O OE2   . GLU F 3 48  ? 37.794 3.935  10.581  1.00 45.52 ? 55  GLU B OE2   1 
ATOM   3220 N N     . GLY F 3 49  ? 32.558 4.009  10.324  1.00 36.23 ? 56  GLY B N     1 
ATOM   3221 C CA    . GLY F 3 49  ? 31.109 4.052  10.432  1.00 33.36 ? 56  GLY B CA    1 
ATOM   3222 C C     . GLY F 3 49  ? 30.355 5.380  10.502  1.00 32.27 ? 56  GLY B C     1 
ATOM   3223 O O     . GLY F 3 49  ? 29.251 5.447  9.948   1.00 33.37 ? 56  GLY B O     1 
ATOM   3224 N N     . LYS F 3 50  ? 30.913 6.417  11.151  1.00 28.92 ? 57  LYS B N     1 
ATOM   3225 C CA    . LYS F 3 50  ? 30.239 7.717  11.302  1.00 23.61 ? 57  LYS B CA    1 
ATOM   3226 C C     . LYS F 3 50  ? 29.726 8.322  10.017  1.00 21.80 ? 57  LYS B C     1 
ATOM   3227 O O     . LYS F 3 50  ? 30.257 8.100  8.939   1.00 19.86 ? 57  LYS B O     1 
ATOM   3228 C CB    . LYS F 3 50  ? 31.131 8.748  12.013  1.00 23.15 ? 57  LYS B CB    1 
ATOM   3229 C CG    . LYS F 3 50  ? 30.461 10.177 12.281  1.00 20.33 ? 57  LYS B CG    1 
ATOM   3230 C CD    . LYS F 3 50  ? 29.616 10.363 13.610  1.00 13.40 ? 57  LYS B CD    1 
ATOM   3231 C CE    . LYS F 3 50  ? 29.406 11.869 13.932  1.00 5.83  ? 57  LYS B CE    1 
ATOM   3232 N NZ    . LYS F 3 50  ? 28.560 12.204 15.105  1.00 0.76  ? 57  LYS B NZ    1 
ATOM   3233 N N     . GLU F 3 51  ? 28.670 9.105  10.167  1.00 20.67 ? 58  GLU B N     1 
ATOM   3234 C CA    . GLU F 3 51  ? 28.028 9.740  9.056   1.00 20.36 ? 58  GLU B CA    1 
ATOM   3235 C C     . GLU F 3 51  ? 28.213 11.240 9.163   1.00 21.10 ? 58  GLU B C     1 
ATOM   3236 O O     . GLU F 3 51  ? 28.589 11.749 10.212  1.00 21.33 ? 58  GLU B O     1 
ATOM   3237 C CB    . GLU F 3 51  ? 26.545 9.404  9.104   1.00 21.45 ? 58  GLU B CB    1 
ATOM   3238 C CG    . GLU F 3 51  ? 26.248 7.934  9.313   1.00 21.92 ? 58  GLU B CG    1 
ATOM   3239 C CD    . GLU F 3 51  ? 24.767 7.669  9.500   1.00 23.29 ? 58  GLU B CD    1 
ATOM   3240 O OE1   . GLU F 3 51  ? 24.176 8.280  10.406  1.00 23.76 ? 58  GLU B OE1   1 
ATOM   3241 O OE2   . GLU F 3 51  ? 24.189 6.851  8.754   1.00 23.06 ? 58  GLU B OE2   1 
ATOM   3242 N N     . MET F 3 52  ? 27.990 11.933 8.049   1.00 20.76 ? 59  MET B N     1 
ATOM   3243 C CA    . MET F 3 52  ? 28.039 13.390 7.984   1.00 19.66 ? 59  MET B CA    1 
ATOM   3244 C C     . MET F 3 52  ? 26.918 13.715 7.029   1.00 21.10 ? 59  MET B C     1 
ATOM   3245 O O     . MET F 3 52  ? 26.694 12.997 6.051   1.00 22.13 ? 59  MET B O     1 
ATOM   3246 C CB    . MET F 3 52  ? 29.338 13.949 7.432   1.00 18.24 ? 59  MET B CB    1 
ATOM   3247 C CG    . MET F 3 52  ? 29.236 15.463 7.249   1.00 16.50 ? 59  MET B CG    1 
ATOM   3248 S SD    . MET F 3 52  ? 30.780 16.391 7.458   1.00 15.36 ? 59  MET B SD    1 
ATOM   3249 C CE    . MET F 3 52  ? 31.398 16.430 5.762   1.00 12.09 ? 59  MET B CE    1 
ATOM   3250 N N     . ILE F 3 53  ? 26.205 14.790 7.330   1.00 21.07 ? 60  ILE B N     1 
ATOM   3251 C CA    . ILE F 3 53  ? 25.058 15.177 6.554   1.00 19.51 ? 60  ILE B CA    1 
ATOM   3252 C C     . ILE F 3 53  ? 25.453 16.245 5.606   1.00 19.54 ? 60  ILE B C     1 
ATOM   3253 O O     . ILE F 3 53  ? 25.511 17.407 5.982   1.00 19.98 ? 60  ILE B O     1 
ATOM   3254 C CB    . ILE F 3 53  ? 23.956 15.695 7.467   1.00 20.57 ? 60  ILE B CB    1 
ATOM   3255 C CG1   . ILE F 3 53  ? 23.521 14.582 8.450   1.00 21.43 ? 60  ILE B CG1   1 
ATOM   3256 C CG2   . ILE F 3 53  ? 22.811 16.202 6.630   1.00 22.28 ? 60  ILE B CG2   1 
ATOM   3257 C CD1   . ILE F 3 53  ? 22.298 14.910 9.344   1.00 18.17 ? 60  ILE B CD1   1 
ATOM   3258 N N     . LEU F 3 54  ? 25.727 15.847 4.366   1.00 18.87 ? 61  LEU B N     1 
ATOM   3259 C CA    . LEU F 3 54  ? 26.133 16.798 3.351   1.00 17.18 ? 61  LEU B CA    1 
ATOM   3260 C C     . LEU F 3 54  ? 25.088 17.847 3.131   1.00 18.42 ? 61  LEU B C     1 
ATOM   3261 O O     . LEU F 3 54  ? 25.403 19.030 3.209   1.00 20.43 ? 61  LEU B O     1 
ATOM   3262 C CB    . LEU F 3 54  ? 26.441 16.103 2.033   1.00 15.49 ? 61  LEU B CB    1 
ATOM   3263 C CG    . LEU F 3 54  ? 27.845 15.540 2.017   1.00 12.58 ? 61  LEU B CG    1 
ATOM   3264 C CD1   . LEU F 3 54  ? 28.265 15.204 0.621   1.00 10.80 ? 61  LEU B CD1   1 
ATOM   3265 C CD2   . LEU F 3 54  ? 28.758 16.605 2.588   1.00 13.30 ? 61  LEU B CD2   1 
ATOM   3266 N N     . SER F 3 55  ? 23.849 17.420 2.868   1.00 18.66 ? 62  SER B N     1 
ATOM   3267 C CA    . SER F 3 55  ? 22.737 18.348 2.628   1.00 19.13 ? 62  SER B CA    1 
ATOM   3268 C C     . SER F 3 55  ? 21.375 17.828 3.147   1.00 20.16 ? 62  SER B C     1 
ATOM   3269 O O     . SER F 3 55  ? 21.306 16.714 3.660   1.00 21.57 ? 62  SER B O     1 
ATOM   3270 C CB    . SER F 3 55  ? 22.663 18.639 1.124   1.00 18.91 ? 62  SER B CB    1 
ATOM   3271 O OG    . SER F 3 55  ? 21.392 19.121 0.719   1.00 17.99 ? 62  SER B OG    1 
ATOM   3272 N N     . TYR F 3 56  ? 20.325 18.658 3.037   1.00 18.50 ? 63  TYR B N     1 
ATOM   3273 C CA    . TYR F 3 56  ? 18.938 18.334 3.421   1.00 16.52 ? 63  TYR B CA    1 
ATOM   3274 C C     . TYR F 3 56  ? 18.103 18.771 2.228   1.00 16.87 ? 63  TYR B C     1 
ATOM   3275 O O     . TYR F 3 56  ? 17.833 19.953 2.072   1.00 18.09 ? 63  TYR B O     1 
ATOM   3276 C CB    . TYR F 3 56  ? 18.436 19.162 4.617   1.00 14.37 ? 63  TYR B CB    1 
ATOM   3277 C CG    . TYR F 3 56  ? 18.674 18.608 6.015   1.00 14.19 ? 63  TYR B CG    1 
ATOM   3278 C CD1   . TYR F 3 56  ? 18.035 17.460 6.461   1.00 14.03 ? 63  TYR B CD1   1 
ATOM   3279 C CD2   . TYR F 3 56  ? 19.535 19.256 6.895   1.00 13.40 ? 63  TYR B CD2   1 
ATOM   3280 C CE1   . TYR F 3 56  ? 18.253 16.979 7.752   1.00 14.73 ? 63  TYR B CE1   1 
ATOM   3281 C CE2   . TYR F 3 56  ? 19.762 18.795 8.166   1.00 12.02 ? 63  TYR B CE2   1 
ATOM   3282 C CZ    . TYR F 3 56  ? 19.124 17.660 8.610   1.00 14.63 ? 63  TYR B CZ    1 
ATOM   3283 O OH    . TYR F 3 56  ? 19.335 17.235 9.922   1.00 12.15 ? 63  TYR B OH    1 
ATOM   3284 N N     . LEU F 3 57  ? 17.715 17.850 1.363   1.00 17.52 ? 64  LEU B N     1 
ATOM   3285 C CA    . LEU F 3 57  ? 16.889 18.210 0.214   1.00 16.69 ? 64  LEU B CA    1 
ATOM   3286 C C     . LEU F 3 57  ? 15.461 18.237 0.710   1.00 18.33 ? 64  LEU B C     1 
ATOM   3287 O O     . LEU F 3 57  ? 15.163 17.668 1.762   1.00 18.07 ? 64  LEU B O     1 
ATOM   3288 C CB    . LEU F 3 57  ? 16.989 17.162 -0.887  1.00 15.15 ? 64  LEU B CB    1 
ATOM   3289 C CG    . LEU F 3 57  ? 18.120 17.170 -1.899  1.00 11.01 ? 64  LEU B CG    1 
ATOM   3290 C CD1   . LEU F 3 57  ? 18.950 18.384 -1.667  1.00 12.00 ? 64  LEU B CD1   1 
ATOM   3291 C CD2   . LEU F 3 57  ? 18.913 15.892 -1.802  1.00 8.62  ? 64  LEU B CD2   1 
ATOM   3292 N N     . ASN F 3 58  ? 14.576 18.863 -0.060  1.00 19.41 ? 65  ASN B N     1 
ATOM   3293 C CA    . ASN F 3 58  ? 13.176 18.972 0.330   1.00 21.07 ? 65  ASN B CA    1 
ATOM   3294 C C     . ASN F 3 58  ? 12.135 18.792 -0.786  1.00 21.50 ? 65  ASN B C     1 
ATOM   3295 O O     . ASN F 3 58  ? 12.429 18.272 -1.865  1.00 21.60 ? 65  ASN B O     1 
ATOM   3296 C CB    . ASN F 3 58  ? 12.957 20.320 1.010   1.00 21.97 ? 65  ASN B CB    1 
ATOM   3297 C CG    . ASN F 3 58  ? 13.875 20.526 2.200   1.00 23.95 ? 65  ASN B CG    1 
ATOM   3298 O OD1   . ASN F 3 58  ? 13.822 19.780 3.180   1.00 23.67 ? 65  ASN B OD1   1 
ATOM   3299 N ND2   . ASN F 3 58  ? 14.728 21.543 2.118   1.00 25.04 ? 65  ASN B ND2   1 
ATOM   3300 N N     . GLN F 3 59  ? 10.917 19.245 -0.486  1.00 21.51 ? 66  GLN B N     1 
ATOM   3301 C CA    . GLN F 3 59  ? 9.757  19.186 -1.368  1.00 21.05 ? 66  GLN B CA    1 
ATOM   3302 C C     . GLN F 3 59  ? 9.916  19.883 -2.711  1.00 21.09 ? 66  GLN B C     1 
ATOM   3303 O O     . GLN F 3 59  ? 9.655  21.069 -2.826  1.00 21.44 ? 66  GLN B O     1 
ATOM   3304 C CB    . GLN F 3 59  ? 8.551  19.790 -0.658  1.00 23.04 ? 66  GLN B CB    1 
ATOM   3305 C CG    . GLN F 3 59  ? 7.311  19.872 -1.556  1.00 28.70 ? 66  GLN B CG    1 
ATOM   3306 C CD    . GLN F 3 59  ? 6.239  20.816 -1.033  1.00 29.75 ? 66  GLN B CD    1 
ATOM   3307 O OE1   . GLN F 3 59  ? 5.521  21.452 -1.817  1.00 30.19 ? 66  GLN B OE1   1 
ATOM   3308 N NE2   . GLN F 3 59  ? 6.119  20.909 0.294   1.00 31.12 ? 66  GLN B NE2   1 
ATOM   3309 N N     . GLY F 3 60  ? 10.317 19.138 -3.732  1.00 21.34 ? 67  GLY B N     1 
ATOM   3310 C CA    . GLY F 3 60  ? 10.486 19.716 -5.046  1.00 21.12 ? 67  GLY B CA    1 
ATOM   3311 C C     . GLY F 3 60  ? 11.927 19.853 -5.500  1.00 23.06 ? 67  GLY B C     1 
ATOM   3312 O O     . GLY F 3 60  ? 12.204 20.725 -6.330  1.00 25.15 ? 67  GLY B O     1 
ATOM   3313 N N     . ASP F 3 61  ? 12.831 19.017 -4.976  1.00 20.37 ? 68  ASP B N     1 
ATOM   3314 C CA    . ASP F 3 61  ? 14.261 19.042 -5.336  1.00 18.90 ? 68  ASP B CA    1 
ATOM   3315 C C     . ASP F 3 61  ? 14.617 17.755 -6.051  1.00 20.44 ? 68  ASP B C     1 
ATOM   3316 O O     . ASP F 3 61  ? 14.487 16.678 -5.474  1.00 22.93 ? 68  ASP B O     1 
ATOM   3317 C CB    . ASP F 3 61  ? 15.147 19.098 -4.084  1.00 17.14 ? 68  ASP B CB    1 
ATOM   3318 C CG    . ASP F 3 61  ? 15.567 20.503 -3.695  1.00 15.95 ? 68  ASP B CG    1 
ATOM   3319 O OD1   . ASP F 3 61  ? 15.714 20.742 -2.464  1.00 13.65 ? 68  ASP B OD1   1 
ATOM   3320 O OD2   . ASP F 3 61  ? 15.771 21.353 -4.598  1.00 15.79 ? 68  ASP B OD2   1 
ATOM   3321 N N     . PHE F 3 62  ? 15.097 17.839 -7.282  1.00 21.55 ? 69  PHE B N     1 
ATOM   3322 C CA    . PHE F 3 62  ? 15.473 16.633 -8.007  1.00 21.44 ? 69  PHE B CA    1 
ATOM   3323 C C     . PHE F 3 62  ? 16.502 15.928 -7.153  1.00 21.20 ? 69  PHE B C     1 
ATOM   3324 O O     . PHE F 3 62  ? 17.189 16.582 -6.385  1.00 22.19 ? 69  PHE B O     1 
ATOM   3325 C CB    . PHE F 3 62  ? 16.055 17.025 -9.358  1.00 23.21 ? 69  PHE B CB    1 
ATOM   3326 C CG    . PHE F 3 62  ? 15.013 17.419 -10.374 1.00 25.45 ? 69  PHE B CG    1 
ATOM   3327 C CD1   . PHE F 3 62  ? 14.328 16.445 -11.104 1.00 24.35 ? 69  PHE B CD1   1 
ATOM   3328 C CD2   . PHE F 3 62  ? 14.721 18.759 -10.616 1.00 24.48 ? 69  PHE B CD2   1 
ATOM   3329 C CE1   . PHE F 3 62  ? 13.375 16.804 -12.061 1.00 22.33 ? 69  PHE B CE1   1 
ATOM   3330 C CE2   . PHE F 3 62  ? 13.765 19.119 -11.574 1.00 23.38 ? 69  PHE B CE2   1 
ATOM   3331 C CZ    . PHE F 3 62  ? 13.099 18.138 -12.294 1.00 22.35 ? 69  PHE B CZ    1 
ATOM   3332 N N     . ILE F 3 63  ? 16.601 14.607 -7.263  1.00 21.56 ? 70  ILE B N     1 
ATOM   3333 C CA    . ILE F 3 63  ? 17.563 13.817 -6.468  1.00 22.35 ? 70  ILE B CA    1 
ATOM   3334 C C     . ILE F 3 63  ? 18.257 12.758 -7.325  1.00 22.68 ? 70  ILE B C     1 
ATOM   3335 O O     . ILE F 3 63  ? 17.645 12.178 -8.229  1.00 23.71 ? 70  ILE B O     1 
ATOM   3336 C CB    . ILE F 3 63  ? 16.877 13.037 -5.305  1.00 23.58 ? 70  ILE B CB    1 
ATOM   3337 C CG1   . ILE F 3 63  ? 16.160 13.984 -4.352  1.00 24.79 ? 70  ILE B CG1   1 
ATOM   3338 C CG2   . ILE F 3 63  ? 17.901 12.255 -4.516  1.00 22.92 ? 70  ILE B CG2   1 
ATOM   3339 C CD1   . ILE F 3 63  ? 15.473 13.241 -3.219  1.00 24.46 ? 70  ILE B CD1   1 
ATOM   3340 N N     . GLY F 3 64  ? 19.522 12.480 -7.015  1.00 22.39 ? 71  GLY B N     1 
ATOM   3341 C CA    . GLY F 3 64  ? 20.275 11.495 -7.770  1.00 20.70 ? 71  GLY B CA    1 
ATOM   3342 C C     . GLY F 3 64  ? 20.392 11.882 -9.236  1.00 20.15 ? 71  GLY B C     1 
ATOM   3343 O O     . GLY F 3 64  ? 20.033 11.113 -10.128 1.00 19.97 ? 71  GLY B O     1 
ATOM   3344 N N     . GLU F 3 65  ? 20.891 13.083 -9.486  1.00 19.82 ? 72  GLU B N     1 
ATOM   3345 C CA    . GLU F 3 65  ? 21.038 13.566 -10.846 1.00 20.65 ? 72  GLU B CA    1 
ATOM   3346 C C     . GLU F 3 65  ? 22.457 13.452 -11.344 1.00 19.41 ? 72  GLU B C     1 
ATOM   3347 O O     . GLU F 3 65  ? 22.688 13.269 -12.537 1.00 18.38 ? 72  GLU B O     1 
ATOM   3348 C CB    . GLU F 3 65  ? 20.593 15.019 -10.938 1.00 22.04 ? 72  GLU B CB    1 
ATOM   3349 C CG    . GLU F 3 65  ? 20.156 15.616 -9.628  1.00 24.88 ? 72  GLU B CG    1 
ATOM   3350 C CD    . GLU F 3 65  ? 21.320 16.074 -8.768  1.00 28.02 ? 72  GLU B CD    1 
ATOM   3351 O OE1   . GLU F 3 65  ? 21.065 16.800 -7.776  1.00 28.72 ? 72  GLU B OE1   1 
ATOM   3352 O OE2   . GLU F 3 65  ? 22.480 15.712 -9.073  1.00 29.13 ? 72  GLU B OE2   1 
ATOM   3353 N N     . LEU F 3 66  ? 23.386 13.561 -10.403 1.00 18.95 ? 73  LEU B N     1 
ATOM   3354 C CA    . LEU F 3 66  ? 24.813 13.502 -10.643 1.00 19.19 ? 73  LEU B CA    1 
ATOM   3355 C C     . LEU F 3 66  ? 25.315 12.479 -11.649 1.00 20.66 ? 73  LEU B C     1 
ATOM   3356 O O     . LEU F 3 66  ? 26.518 12.403 -11.888 1.00 19.70 ? 73  LEU B O     1 
ATOM   3357 C CB    . LEU F 3 66  ? 25.531 13.275 -9.322  1.00 18.34 ? 73  LEU B CB    1 
ATOM   3358 C CG    . LEU F 3 66  ? 25.501 14.468 -8.383  1.00 19.40 ? 73  LEU B CG    1 
ATOM   3359 C CD1   . LEU F 3 66  ? 26.448 14.230 -7.228  1.00 19.30 ? 73  LEU B CD1   1 
ATOM   3360 C CD2   . LEU F 3 66  ? 25.904 15.720 -9.129  1.00 18.47 ? 73  LEU B CD2   1 
ATOM   3361 N N     . GLY F 3 67  ? 24.413 11.690 -12.232 1.00 22.86 ? 74  GLY B N     1 
ATOM   3362 C CA    . GLY F 3 67  ? 24.836 10.680 -13.190 1.00 23.87 ? 74  GLY B CA    1 
ATOM   3363 C C     . GLY F 3 67  ? 24.026 10.606 -14.463 1.00 25.21 ? 74  GLY B C     1 
ATOM   3364 O O     . GLY F 3 67  ? 24.377 9.865  -15.371 1.00 24.38 ? 74  GLY B O     1 
ATOM   3365 N N     . LEU F 3 68  ? 22.945 11.377 -14.537 1.00 26.81 ? 75  LEU B N     1 
ATOM   3366 C CA    . LEU F 3 68  ? 22.099 11.370 -15.718 1.00 27.91 ? 75  LEU B CA    1 
ATOM   3367 C C     . LEU F 3 68  ? 22.910 11.822 -16.923 1.00 29.32 ? 75  LEU B C     1 
ATOM   3368 O O     . LEU F 3 68  ? 22.442 11.756 -18.054 1.00 30.57 ? 75  LEU B O     1 
ATOM   3369 C CB    . LEU F 3 68  ? 20.916 12.322 -15.514 1.00 28.45 ? 75  LEU B CB    1 
ATOM   3370 C CG    . LEU F 3 68  ? 21.032 13.795 -15.941 1.00 28.70 ? 75  LEU B CG    1 
ATOM   3371 C CD1   . LEU F 3 68  ? 20.716 13.904 -17.416 1.00 26.86 ? 75  LEU B CD1   1 
ATOM   3372 C CD2   . LEU F 3 68  ? 20.062 14.674 -15.144 1.00 28.00 ? 75  LEU B CD2   1 
ATOM   3373 N N     . PHE F 3 69  ? 24.136 12.263 -16.676 1.00 30.49 ? 76  PHE B N     1 
ATOM   3374 C CA    . PHE F 3 69  ? 25.000 12.786 -17.726 1.00 30.87 ? 76  PHE B CA    1 
ATOM   3375 C C     . PHE F 3 69  ? 26.112 11.916 -18.300 1.00 33.58 ? 76  PHE B C     1 
ATOM   3376 O O     . PHE F 3 69  ? 26.659 12.240 -19.360 1.00 35.16 ? 76  PHE B O     1 
ATOM   3377 C CB    . PHE F 3 69  ? 25.606 14.094 -17.252 1.00 26.83 ? 76  PHE B CB    1 
ATOM   3378 C CG    . PHE F 3 69  ? 24.653 15.238 -17.277 1.00 24.00 ? 76  PHE B CG    1 
ATOM   3379 C CD1   . PHE F 3 69  ? 24.187 15.734 -18.479 1.00 22.22 ? 76  PHE B CD1   1 
ATOM   3380 C CD2   . PHE F 3 69  ? 24.239 15.842 -16.100 1.00 23.73 ? 76  PHE B CD2   1 
ATOM   3381 C CE1   . PHE F 3 69  ? 23.328 16.817 -18.504 1.00 22.05 ? 76  PHE B CE1   1 
ATOM   3382 C CE2   . PHE F 3 69  ? 23.377 16.928 -16.119 1.00 21.31 ? 76  PHE B CE2   1 
ATOM   3383 C CZ    . PHE F 3 69  ? 22.924 17.415 -17.319 1.00 20.45 ? 76  PHE B CZ    1 
ATOM   3384 N N     . GLU F 3 70  ? 26.470 10.829 -17.630 1.00 35.77 ? 77  GLU B N     1 
ATOM   3385 C CA    . GLU F 3 70  ? 27.526 9.981  -18.170 1.00 38.69 ? 77  GLU B CA    1 
ATOM   3386 C C     . GLU F 3 70  ? 27.409 8.579  -17.647 1.00 39.28 ? 77  GLU B C     1 
ATOM   3387 O O     . GLU F 3 70  ? 27.876 8.291  -16.547 1.00 39.74 ? 77  GLU B O     1 
ATOM   3388 C CB    . GLU F 3 70  ? 28.910 10.534 -17.815 1.00 40.34 ? 77  GLU B CB    1 
ATOM   3389 C CG    . GLU F 3 70  ? 29.825 10.735 -19.028 1.00 43.59 ? 77  GLU B CG    1 
ATOM   3390 C CD    . GLU F 3 70  ? 30.024 9.464  -19.843 1.00 45.58 ? 77  GLU B CD    1 
ATOM   3391 O OE1   . GLU F 3 70  ? 30.727 8.549  -19.351 1.00 47.03 ? 77  GLU B OE1   1 
ATOM   3392 O OE2   . GLU F 3 70  ? 29.473 9.382  -20.972 1.00 45.75 ? 77  GLU B OE2   1 
ATOM   3393 N N     . GLU F 3 71  ? 26.802 7.706  -18.447 1.00 40.00 ? 78  GLU B N     1 
ATOM   3394 C CA    . GLU F 3 71  ? 26.603 6.313  -18.054 1.00 40.19 ? 78  GLU B CA    1 
ATOM   3395 C C     . GLU F 3 71  ? 27.895 5.694  -17.527 1.00 40.13 ? 78  GLU B C     1 
ATOM   3396 O O     . GLU F 3 71  ? 28.988 6.215  -17.771 1.00 40.86 ? 78  GLU B O     1 
ATOM   3397 C CB    . GLU F 3 71  ? 26.050 5.500  -19.232 1.00 39.58 ? 78  GLU B CB    1 
ATOM   3398 C CG    . GLU F 3 71  ? 25.361 4.203  -18.819 1.00 40.23 ? 78  GLU B CG    1 
ATOM   3399 C CD    . GLU F 3 71  ? 24.277 4.404  -17.754 1.00 40.14 ? 78  GLU B CD    1 
ATOM   3400 O OE1   . GLU F 3 71  ? 23.365 5.240  -17.943 1.00 40.36 ? 78  GLU B OE1   1 
ATOM   3401 O OE2   . GLU F 3 71  ? 24.334 3.712  -16.721 1.00 39.65 ? 78  GLU B OE2   1 
ATOM   3402 N N     . GLY F 3 72  ? 27.762 4.594  -16.790 1.00 39.80 ? 79  GLY B N     1 
ATOM   3403 C CA    . GLY F 3 72  ? 28.924 3.941  -16.219 1.00 39.82 ? 79  GLY B CA    1 
ATOM   3404 C C     . GLY F 3 72  ? 29.172 4.396  -14.787 1.00 39.73 ? 79  GLY B C     1 
ATOM   3405 O O     . GLY F 3 72  ? 30.114 3.929  -14.142 1.00 39.39 ? 79  GLY B O     1 
ATOM   3406 N N     . GLN F 3 73  ? 28.323 5.302  -14.288 1.00 39.29 ? 80  GLN B N     1 
ATOM   3407 C CA    . GLN F 3 73  ? 28.447 5.832  -12.922 1.00 37.56 ? 80  GLN B CA    1 
ATOM   3408 C C     . GLN F 3 73  ? 27.570 5.155  -11.890 1.00 35.79 ? 80  GLN B C     1 
ATOM   3409 O O     . GLN F 3 73  ? 26.638 4.429  -12.228 1.00 35.73 ? 80  GLN B O     1 
ATOM   3410 C CB    . GLN F 3 73  ? 28.146 7.334  -12.879 1.00 37.75 ? 80  GLN B CB    1 
ATOM   3411 C CG    . GLN F 3 73  ? 29.391 8.203  -12.945 1.00 38.49 ? 80  GLN B CG    1 
ATOM   3412 C CD    . GLN F 3 73  ? 29.950 8.326  -14.345 1.00 38.29 ? 80  GLN B CD    1 
ATOM   3413 O OE1   . GLN F 3 73  ? 30.096 7.335  -15.071 1.00 36.17 ? 80  GLN B OE1   1 
ATOM   3414 N NE2   . GLN F 3 73  ? 30.274 9.554  -14.733 1.00 39.73 ? 80  GLN B NE2   1 
ATOM   3415 N N     . GLU F 3 74  ? 27.888 5.399  -10.623 1.00 33.69 ? 81  GLU B N     1 
ATOM   3416 C CA    . GLU F 3 74  ? 27.111 4.844  -9.527  1.00 32.63 ? 81  GLU B CA    1 
ATOM   3417 C C     . GLU F 3 74  ? 27.091 5.799  -8.334  1.00 30.71 ? 81  GLU B C     1 
ATOM   3418 O O     . GLU F 3 74  ? 28.008 6.590  -8.153  1.00 29.97 ? 81  GLU B O     1 
ATOM   3419 C CB    . GLU F 3 74  ? 27.658 3.481  -9.102  1.00 33.44 ? 81  GLU B CB    1 
ATOM   3420 C CG    . GLU F 3 74  ? 28.862 3.516  -8.187  1.00 34.89 ? 81  GLU B CG    1 
ATOM   3421 C CD    . GLU F 3 74  ? 30.169 3.641  -8.935  1.00 33.94 ? 81  GLU B CD    1 
ATOM   3422 O OE1   . GLU F 3 74  ? 30.458 4.741  -9.454  1.00 33.65 ? 81  GLU B OE1   1 
ATOM   3423 O OE2   . GLU F 3 74  ? 30.895 2.624  -9.005  1.00 32.65 ? 81  GLU B OE2   1 
ATOM   3424 N N     . ARG F 3 75  ? 26.028 5.716  -7.541  1.00 28.04 ? 82  ARG B N     1 
ATOM   3425 C CA    . ARG F 3 75  ? 25.817 6.551  -6.368  1.00 27.18 ? 82  ARG B CA    1 
ATOM   3426 C C     . ARG F 3 75  ? 27.063 7.161  -5.680  1.00 26.75 ? 82  ARG B C     1 
ATOM   3427 O O     . ARG F 3 75  ? 28.181 6.663  -5.820  1.00 28.54 ? 82  ARG B O     1 
ATOM   3428 C CB    . ARG F 3 75  ? 24.984 5.757  -5.370  1.00 26.93 ? 82  ARG B CB    1 
ATOM   3429 C CG    . ARG F 3 75  ? 23.651 5.283  -5.953  1.00 29.09 ? 82  ARG B CG    1 
ATOM   3430 C CD    . ARG F 3 75  ? 22.706 6.442  -6.300  1.00 29.07 ? 82  ARG B CD    1 
ATOM   3431 N NE    . ARG F 3 75  ? 21.808 6.095  -7.409  1.00 29.77 ? 82  ARG B NE    1 
ATOM   3432 C CZ    . ARG F 3 75  ? 21.036 6.970  -8.045  1.00 28.88 ? 82  ARG B CZ    1 
ATOM   3433 N NH1   . ARG F 3 75  ? 21.050 8.236  -7.681  1.00 29.50 ? 82  ARG B NH1   1 
ATOM   3434 N NH2   . ARG F 3 75  ? 20.268 6.588  -9.053  1.00 27.52 ? 82  ARG B NH2   1 
ATOM   3435 N N     . SER F 3 76  ? 26.851 8.245  -4.931  1.00 23.98 ? 83  SER B N     1 
ATOM   3436 C CA    . SER F 3 76  ? 27.926 8.952  -4.234  1.00 20.61 ? 83  SER B CA    1 
ATOM   3437 C C     . SER F 3 76  ? 27.512 9.362  -2.824  1.00 19.43 ? 83  SER B C     1 
ATOM   3438 O O     . SER F 3 76  ? 28.293 9.959  -2.081  1.00 16.00 ? 83  SER B O     1 
ATOM   3439 C CB    . SER F 3 76  ? 28.280 10.201 -5.012  1.00 20.07 ? 83  SER B CB    1 
ATOM   3440 O OG    . SER F 3 76  ? 27.080 10.882 -5.331  1.00 18.71 ? 83  SER B OG    1 
ATOM   3441 N N     . ALA F 3 77  ? 26.276 9.052  -2.459  1.00 18.68 ? 84  ALA B N     1 
ATOM   3442 C CA    . ALA F 3 77  ? 25.801 9.411  -1.131  1.00 19.11 ? 84  ALA B CA    1 
ATOM   3443 C C     . ALA F 3 77  ? 24.512 8.727  -0.778  1.00 17.64 ? 84  ALA B C     1 
ATOM   3444 O O     . ALA F 3 77  ? 23.761 8.325  -1.649  1.00 18.17 ? 84  ALA B O     1 
ATOM   3445 C CB    . ALA F 3 77  ? 25.610 10.906 -1.035  1.00 17.53 ? 84  ALA B CB    1 
ATOM   3446 N N     . TRP F 3 78  ? 24.272 8.573  0.509   1.00 16.12 ? 85  TRP B N     1 
ATOM   3447 C CA    . TRP F 3 78  ? 23.031 7.971  0.943   1.00 16.01 ? 85  TRP B CA    1 
ATOM   3448 C C     . TRP F 3 78  ? 21.999 9.068  1.116   1.00 15.54 ? 85  TRP B C     1 
ATOM   3449 O O     . TRP F 3 78  ? 22.302 10.195 1.530   1.00 13.21 ? 85  TRP B O     1 
ATOM   3450 C CB    . TRP F 3 78  ? 23.176 7.280  2.292   1.00 17.45 ? 85  TRP B CB    1 
ATOM   3451 C CG    . TRP F 3 78  ? 23.805 5.994  2.236   1.00 21.13 ? 85  TRP B CG    1 
ATOM   3452 C CD1   . TRP F 3 78  ? 23.191 4.786  2.253   1.00 22.76 ? 85  TRP B CD1   1 
ATOM   3453 C CD2   . TRP F 3 78  ? 25.205 5.740  2.175   1.00 23.55 ? 85  TRP B CD2   1 
ATOM   3454 N NE1   . TRP F 3 78  ? 24.129 3.780  2.212   1.00 24.53 ? 85  TRP B NE1   1 
ATOM   3455 C CE2   . TRP F 3 78  ? 25.375 4.343  2.165   1.00 23.07 ? 85  TRP B CE2   1 
ATOM   3456 C CE3   . TRP F 3 78  ? 26.333 6.559  2.128   1.00 25.43 ? 85  TRP B CE3   1 
ATOM   3457 C CZ2   . TRP F 3 78  ? 26.617 3.749  2.114   1.00 22.41 ? 85  TRP B CZ2   1 
ATOM   3458 C CZ3   . TRP F 3 78  ? 27.569 5.963  2.076   1.00 26.76 ? 85  TRP B CZ3   1 
ATOM   3459 C CH2   . TRP F 3 78  ? 27.701 4.567  2.069   1.00 24.61 ? 85  TRP B CH2   1 
ATOM   3460 N N     . VAL F 3 79  ? 20.764 8.719  0.806   1.00 15.49 ? 86  VAL B N     1 
ATOM   3461 C CA    . VAL F 3 79  ? 19.674 9.643  0.968   1.00 14.67 ? 86  VAL B CA    1 
ATOM   3462 C C     . VAL F 3 79  ? 18.614 8.865  1.716   1.00 14.17 ? 86  VAL B C     1 
ATOM   3463 O O     . VAL F 3 79  ? 18.096 7.879  1.217   1.00 13.47 ? 86  VAL B O     1 
ATOM   3464 C CB    . VAL F 3 79  ? 19.134 10.101 -0.396  1.00 15.14 ? 86  VAL B CB    1 
ATOM   3465 C CG1   . VAL F 3 79  ? 18.047 11.139 -0.197  1.00 13.64 ? 86  VAL B CG1   1 
ATOM   3466 C CG2   . VAL F 3 79  ? 20.276 10.649 -1.260  1.00 13.35 ? 86  VAL B CG2   1 
ATOM   3467 N N     . ARG F 3 80  ? 18.335 9.275  2.941   1.00 16.35 ? 87  ARG B N     1 
ATOM   3468 C CA    . ARG F 3 80  ? 17.296 8.618  3.733   1.00 20.26 ? 87  ARG B CA    1 
ATOM   3469 C C     . ARG F 3 80  ? 16.206 9.638  4.092   1.00 19.80 ? 87  ARG B C     1 
ATOM   3470 O O     . ARG F 3 80  ? 16.500 10.709 4.596   1.00 20.15 ? 87  ARG B O     1 
ATOM   3471 C CB    . ARG F 3 80  ? 17.885 8.020  5.005   1.00 21.28 ? 87  ARG B CB    1 
ATOM   3472 C CG    . ARG F 3 80  ? 17.458 8.739  6.239   1.00 24.15 ? 87  ARG B CG    1 
ATOM   3473 C CD    . ARG F 3 80  ? 18.122 8.144  7.449   1.00 28.85 ? 87  ARG B CD    1 
ATOM   3474 N NE    . ARG F 3 80  ? 19.572 8.244  7.390   1.00 29.79 ? 87  ARG B NE    1 
ATOM   3475 C CZ    . ARG F 3 80  ? 20.365 7.731  8.316   1.00 31.09 ? 87  ARG B CZ    1 
ATOM   3476 N NH1   . ARG F 3 80  ? 19.819 7.096  9.348   1.00 32.52 ? 87  ARG B NH1   1 
ATOM   3477 N NH2   . ARG F 3 80  ? 21.683 7.853  8.212   1.00 29.60 ? 87  ARG B NH2   1 
ATOM   3478 N N     . ALA F 3 81  ? 14.948 9.309  3.845   1.00 20.09 ? 88  ALA B N     1 
ATOM   3479 C CA    . ALA F 3 81  ? 13.894 10.268 4.143   1.00 22.28 ? 88  ALA B CA    1 
ATOM   3480 C C     . ALA F 3 81  ? 13.871 10.747 5.591   1.00 21.99 ? 88  ALA B C     1 
ATOM   3481 O O     . ALA F 3 81  ? 13.870 9.954  6.517   1.00 21.83 ? 88  ALA B O     1 
ATOM   3482 C CB    . ALA F 3 81  ? 12.540 9.697  3.765   1.00 22.66 ? 88  ALA B CB    1 
ATOM   3483 N N     . LYS F 3 82  ? 13.853 12.059 5.770   1.00 22.39 ? 89  LYS B N     1 
ATOM   3484 C CA    . LYS F 3 82  ? 13.808 12.630 7.095   1.00 25.04 ? 89  LYS B CA    1 
ATOM   3485 C C     . LYS F 3 82  ? 12.383 12.522 7.615   1.00 25.58 ? 89  LYS B C     1 
ATOM   3486 O O     . LYS F 3 82  ? 12.156 12.002 8.701   1.00 25.16 ? 89  LYS B O     1 
ATOM   3487 C CB    . LYS F 3 82  ? 14.263 14.091 7.075   1.00 25.79 ? 89  LYS B CB    1 
ATOM   3488 C CG    . LYS F 3 82  ? 14.307 14.700 8.459   1.00 28.86 ? 89  LYS B CG    1 
ATOM   3489 C CD    . LYS F 3 82  ? 15.174 15.954 8.526   1.00 31.70 ? 89  LYS B CD    1 
ATOM   3490 C CE    . LYS F 3 82  ? 14.620 17.125 7.720   1.00 32.11 ? 89  LYS B CE    1 
ATOM   3491 N NZ    . LYS F 3 82  ? 15.461 18.356 7.926   1.00 32.77 ? 89  LYS B NZ    1 
ATOM   3492 N N     . THR F 3 83  ? 11.426 13.012 6.835   1.00 27.28 ? 90  THR B N     1 
ATOM   3493 C CA    . THR F 3 83  ? 10.019 12.943 7.220   1.00 29.31 ? 90  THR B CA    1 
ATOM   3494 C C     . THR F 3 83  ? 9.291  11.905 6.356   1.00 29.73 ? 90  THR B C     1 
ATOM   3495 O O     . THR F 3 83  ? 9.841  10.870 5.981   1.00 29.52 ? 90  THR B O     1 
ATOM   3496 C CB    . THR F 3 83  ? 9.316  14.305 7.036   1.00 29.72 ? 90  THR B CB    1 
ATOM   3497 O OG1   . THR F 3 83  ? 10.187 15.346 7.474   1.00 31.81 ? 90  THR B OG1   1 
ATOM   3498 C CG2   . THR F 3 83  ? 8.037  14.380 7.871   1.00 31.15 ? 90  THR B CG2   1 
ATOM   3499 N N     . ALA F 3 84  ? 8.037  12.189 6.051   1.00 30.48 ? 91  ALA B N     1 
ATOM   3500 C CA    . ALA F 3 84  ? 7.247  11.295 5.238   1.00 31.87 ? 91  ALA B CA    1 
ATOM   3501 C C     . ALA F 3 84  ? 7.446  11.779 3.812   1.00 32.89 ? 91  ALA B C     1 
ATOM   3502 O O     . ALA F 3 84  ? 6.921  12.833 3.437   1.00 32.96 ? 91  ALA B O     1 
ATOM   3503 C CB    . ALA F 3 84  ? 5.791  11.398 5.651   1.00 33.40 ? 91  ALA B CB    1 
ATOM   3504 N N     . CYS F 3 85  ? 8.206  11.032 3.012   1.00 33.48 ? 92  CYS B N     1 
ATOM   3505 C CA    . CYS F 3 85  ? 8.455  11.476 1.647   1.00 34.08 ? 92  CYS B CA    1 
ATOM   3506 C C     . CYS F 3 85  ? 7.939  10.637 0.493   1.00 35.75 ? 92  CYS B C     1 
ATOM   3507 O O     . CYS F 3 85  ? 8.032  9.405  0.504   1.00 37.35 ? 92  CYS B O     1 
ATOM   3508 C CB    . CYS F 3 85  ? 9.942  11.735 1.451   1.00 32.77 ? 92  CYS B CB    1 
ATOM   3509 S SG    . CYS F 3 85  ? 10.327 13.487 1.530   1.00 33.08 ? 92  CYS B SG    1 
ATOM   3510 N N     . GLU F 3 86  ? 7.387  11.334 -0.501  1.00 36.49 ? 93  GLU B N     1 
ATOM   3511 C CA    . GLU F 3 86  ? 6.839  10.722 -1.712  1.00 36.90 ? 93  GLU B CA    1 
ATOM   3512 C C     . GLU F 3 86  ? 7.745  11.133 -2.855  1.00 35.67 ? 93  GLU B C     1 
ATOM   3513 O O     . GLU F 3 86  ? 7.881  12.320 -3.149  1.00 36.13 ? 93  GLU B O     1 
ATOM   3514 C CB    . GLU F 3 86  ? 5.415  11.225 -1.986  1.00 37.80 ? 93  GLU B CB    1 
ATOM   3515 C CG    . GLU F 3 86  ? 4.478  11.079 -0.803  1.00 40.33 ? 93  GLU B CG    1 
ATOM   3516 C CD    . GLU F 3 86  ? 3.026  11.327 -1.164  1.00 41.72 ? 93  GLU B CD    1 
ATOM   3517 O OE1   . GLU F 3 86  ? 2.186  11.377 -0.233  1.00 40.98 ? 93  GLU B OE1   1 
ATOM   3518 O OE2   . GLU F 3 86  ? 2.729  11.463 -2.374  1.00 42.38 ? 93  GLU B OE2   1 
ATOM   3519 N N     . VAL F 3 87  ? 8.347  10.150 -3.508  1.00 34.21 ? 94  VAL B N     1 
ATOM   3520 C CA    . VAL F 3 87  ? 9.273  10.427 -4.590  1.00 32.82 ? 94  VAL B CA    1 
ATOM   3521 C C     . VAL F 3 87  ? 8.777  10.045 -5.990  1.00 32.77 ? 94  VAL B C     1 
ATOM   3522 O O     . VAL F 3 87  ? 8.252  8.951  -6.202  1.00 32.66 ? 94  VAL B O     1 
ATOM   3523 C CB    . VAL F 3 87  ? 10.639 9.730  -4.304  1.00 31.43 ? 94  VAL B CB    1 
ATOM   3524 C CG1   . VAL F 3 87  ? 11.149 10.141 -2.938  1.00 30.44 ? 94  VAL B CG1   1 
ATOM   3525 C CG2   . VAL F 3 87  ? 10.479 8.232  -4.346  1.00 30.56 ? 94  VAL B CG2   1 
ATOM   3526 N N     . ALA F 3 88  ? 8.969  10.968 -6.933  1.00 31.92 ? 95  ALA B N     1 
ATOM   3527 C CA    . ALA F 3 88  ? 8.581  10.797 -8.326  1.00 31.30 ? 95  ALA B CA    1 
ATOM   3528 C C     . ALA F 3 88  ? 9.688  10.115 -9.138  1.00 31.24 ? 95  ALA B C     1 
ATOM   3529 O O     . ALA F 3 88  ? 10.585 10.772 -9.647  1.00 31.05 ? 95  ALA B O     1 
ATOM   3530 C CB    . ALA F 3 88  ? 8.252  12.154 -8.928  1.00 30.01 ? 95  ALA B CB    1 
ATOM   3531 N N     . GLU F 3 89  ? 9.597  8.799  -9.272  1.00 32.30 ? 96  GLU B N     1 
ATOM   3532 C CA    . GLU F 3 89  ? 10.583 7.997  -9.991  1.00 33.86 ? 96  GLU B CA    1 
ATOM   3533 C C     . GLU F 3 89  ? 10.511 8.045  -11.519 1.00 35.30 ? 96  GLU B C     1 
ATOM   3534 O O     . GLU F 3 89  ? 9.422  8.208  -12.102 1.00 35.54 ? 96  GLU B O     1 
ATOM   3535 C CB    . GLU F 3 89  ? 10.460 6.546  -9.541  1.00 34.96 ? 96  GLU B CB    1 
ATOM   3536 C CG    . GLU F 3 89  ? 11.569 6.070  -8.633  1.00 37.99 ? 96  GLU B CG    1 
ATOM   3537 C CD    . GLU F 3 89  ? 12.739 5.500  -9.416  1.00 39.92 ? 96  GLU B CD    1 
ATOM   3538 O OE1   . GLU F 3 89  ? 12.654 5.480  -10.668 1.00 39.67 ? 96  GLU B OE1   1 
ATOM   3539 O OE2   . GLU F 3 89  ? 13.733 5.069  -8.781  1.00 39.77 ? 96  GLU B OE2   1 
ATOM   3540 N N     . ILE F 3 90  ? 11.684 7.903  -12.151 1.00 33.66 ? 97  ILE B N     1 
ATOM   3541 C CA    . ILE F 3 90  ? 11.827 7.889  -13.610 1.00 32.56 ? 97  ILE B CA    1 
ATOM   3542 C C     . ILE F 3 90  ? 13.262 7.601  -14.011 1.00 33.56 ? 97  ILE B C     1 
ATOM   3543 O O     . ILE F 3 90  ? 14.187 8.103  -13.391 1.00 33.35 ? 97  ILE B O     1 
ATOM   3544 C CB    . ILE F 3 90  ? 11.383 9.210  -14.263 1.00 31.11 ? 97  ILE B CB    1 
ATOM   3545 C CG1   . ILE F 3 90  ? 11.838 9.242  -15.725 1.00 30.14 ? 97  ILE B CG1   1 
ATOM   3546 C CG2   . ILE F 3 90  ? 11.921 10.374 -13.501 1.00 30.47 ? 97  ILE B CG2   1 
ATOM   3547 C CD1   . ILE F 3 90  ? 11.340 10.443 -16.498 1.00 28.76 ? 97  ILE B CD1   1 
ATOM   3548 N N     . SER F 3 91  ? 13.435 6.782  -15.049 1.00 35.26 ? 98  SER B N     1 
ATOM   3549 C CA    . SER F 3 91  ? 14.763 6.391  -15.536 1.00 36.05 ? 98  SER B CA    1 
ATOM   3550 C C     . SER F 3 91  ? 15.472 7.580  -16.150 1.00 37.15 ? 98  SER B C     1 
ATOM   3551 O O     . SER F 3 91  ? 14.855 8.646  -16.354 1.00 37.22 ? 98  SER B O     1 
ATOM   3552 C CB    . SER F 3 91  ? 14.660 5.307  -16.613 1.00 36.43 ? 98  SER B CB    1 
ATOM   3553 O OG    . SER F 3 91  ? 14.548 5.888  -17.912 1.00 35.68 ? 98  SER B OG    1 
ATOM   3554 N N     . TYR F 3 92  ? 16.758 7.384  -16.459 1.00 36.90 ? 99  TYR B N     1 
ATOM   3555 C CA    . TYR F 3 92  ? 17.573 8.434  -17.068 1.00 36.20 ? 99  TYR B CA    1 
ATOM   3556 C C     . TYR F 3 92  ? 17.282 8.527  -18.551 1.00 35.29 ? 99  TYR B C     1 
ATOM   3557 O O     . TYR F 3 92  ? 16.979 9.602  -19.062 1.00 36.07 ? 99  TYR B O     1 
ATOM   3558 C CB    . TYR F 3 92  ? 19.067 8.173  -16.858 1.00 36.94 ? 99  TYR B CB    1 
ATOM   3559 C CG    . TYR F 3 92  ? 19.578 8.408  -15.443 1.00 37.78 ? 99  TYR B CG    1 
ATOM   3560 C CD1   . TYR F 3 92  ? 18.993 9.354  -14.609 1.00 38.59 ? 99  TYR B CD1   1 
ATOM   3561 C CD2   . TYR F 3 92  ? 20.708 7.741  -14.975 1.00 38.24 ? 99  TYR B CD2   1 
ATOM   3562 C CE1   . TYR F 3 92  ? 19.533 9.630  -13.347 1.00 39.21 ? 99  TYR B CE1   1 
ATOM   3563 C CE2   . TYR F 3 92  ? 21.249 8.008  -13.728 1.00 37.53 ? 99  TYR B CE2   1 
ATOM   3564 C CZ    . TYR F 3 92  ? 20.665 8.950  -12.919 1.00 38.62 ? 99  TYR B CZ    1 
ATOM   3565 O OH    . TYR F 3 92  ? 21.220 9.217  -11.684 1.00 39.86 ? 99  TYR B OH    1 
ATOM   3566 N N     . LYS F 3 93  ? 17.360 7.398  -19.245 1.00 34.94 ? 100 LYS B N     1 
ATOM   3567 C CA    . LYS F 3 93  ? 17.092 7.386  -20.676 1.00 34.41 ? 100 LYS B CA    1 
ATOM   3568 C C     . LYS F 3 93  ? 15.774 8.119  -20.930 1.00 35.50 ? 100 LYS B C     1 
ATOM   3569 O O     . LYS F 3 93  ? 15.766 9.169  -21.568 1.00 35.04 ? 100 LYS B O     1 
ATOM   3570 C CB    . LYS F 3 93  ? 17.025 5.947  -21.178 1.00 32.54 ? 100 LYS B CB    1 
ATOM   3571 C CG    . LYS F 3 93  ? 17.746 5.706  -22.493 1.00 29.86 ? 100 LYS B CG    1 
ATOM   3572 C CD    . LYS F 3 93  ? 17.913 4.220  -22.730 1.00 29.20 ? 100 LYS B CD    1 
ATOM   3573 C CE    . LYS F 3 93  ? 18.630 3.553  -21.542 1.00 29.00 ? 100 LYS B CE    1 
ATOM   3574 N NZ    . LYS F 3 93  ? 18.593 2.047  -21.547 1.00 27.07 ? 100 LYS B NZ    1 
ATOM   3575 N N     . LYS F 3 94  ? 14.664 7.581  -20.421 1.00 36.91 ? 101 LYS B N     1 
ATOM   3576 C CA    . LYS F 3 94  ? 13.364 8.238  -20.589 1.00 37.88 ? 101 LYS B CA    1 
ATOM   3577 C C     . LYS F 3 94  ? 13.519 9.746  -20.369 1.00 38.61 ? 101 LYS B C     1 
ATOM   3578 O O     . LYS F 3 94  ? 13.390 10.535 -21.308 1.00 39.14 ? 101 LYS B O     1 
ATOM   3579 C CB    . LYS F 3 94  ? 12.340 7.675  -19.591 1.00 39.29 ? 101 LYS B CB    1 
ATOM   3580 C CG    . LYS F 3 94  ? 11.399 6.575  -20.138 1.00 39.78 ? 101 LYS B CG    1 
ATOM   3581 C CD    . LYS F 3 94  ? 10.169 7.151  -20.842 1.00 40.09 ? 101 LYS B CD    1 
ATOM   3582 C CE    . LYS F 3 94  ? 9.350  6.060  -21.530 1.00 40.52 ? 101 LYS B CE    1 
ATOM   3583 N NZ    . LYS F 3 94  ? 8.972  4.954  -20.608 1.00 40.61 ? 101 LYS B NZ    1 
ATOM   3584 N N     . PHE F 3 95  ? 13.811 10.140 -19.130 1.00 38.64 ? 102 PHE B N     1 
ATOM   3585 C CA    . PHE F 3 95  ? 13.986 11.547 -18.796 1.00 38.38 ? 102 PHE B CA    1 
ATOM   3586 C C     . PHE F 3 95  ? 14.803 12.237 -19.867 1.00 39.11 ? 102 PHE B C     1 
ATOM   3587 O O     . PHE F 3 95  ? 14.592 13.417 -20.161 1.00 39.43 ? 102 PHE B O     1 
ATOM   3588 C CB    . PHE F 3 95  ? 14.697 11.703 -17.450 1.00 37.99 ? 102 PHE B CB    1 
ATOM   3589 C CG    . PHE F 3 95  ? 15.114 13.131 -17.134 1.00 38.23 ? 102 PHE B CG    1 
ATOM   3590 C CD1   . PHE F 3 95  ? 14.188 14.059 -16.678 1.00 38.00 ? 102 PHE B CD1   1 
ATOM   3591 C CD2   . PHE F 3 95  ? 16.447 13.536 -17.291 1.00 38.26 ? 102 PHE B CD2   1 
ATOM   3592 C CE1   . PHE F 3 95  ? 14.580 15.367 -16.380 1.00 39.17 ? 102 PHE B CE1   1 
ATOM   3593 C CE2   . PHE F 3 95  ? 16.850 14.835 -16.999 1.00 37.59 ? 102 PHE B CE2   1 
ATOM   3594 C CZ    . PHE F 3 95  ? 15.918 15.754 -16.542 1.00 38.99 ? 102 PHE B CZ    1 
ATOM   3595 N N     . ARG F 3 96  ? 15.742 11.504 -20.453 1.00 39.27 ? 103 ARG B N     1 
ATOM   3596 C CA    . ARG F 3 96  ? 16.591 12.089 -21.479 1.00 40.86 ? 103 ARG B CA    1 
ATOM   3597 C C     . ARG F 3 96  ? 15.730 12.490 -22.663 1.00 42.51 ? 103 ARG B C     1 
ATOM   3598 O O     . ARG F 3 96  ? 15.560 13.680 -22.955 1.00 42.33 ? 103 ARG B O     1 
ATOM   3599 C CB    . ARG F 3 96  ? 17.652 11.091 -21.914 1.00 39.89 ? 103 ARG B CB    1 
ATOM   3600 C CG    . ARG F 3 96  ? 18.935 11.701 -22.395 1.00 37.78 ? 103 ARG B CG    1 
ATOM   3601 C CD    . ARG F 3 96  ? 19.977 10.612 -22.449 1.00 38.90 ? 103 ARG B CD    1 
ATOM   3602 N NE    . ARG F 3 96  ? 19.971 9.810  -21.226 1.00 39.35 ? 103 ARG B NE    1 
ATOM   3603 C CZ    . ARG F 3 96  ? 20.698 8.710  -21.045 1.00 40.42 ? 103 ARG B CZ    1 
ATOM   3604 N NH1   . ARG F 3 96  ? 21.503 8.270  -22.006 1.00 40.91 ? 103 ARG B NH1   1 
ATOM   3605 N NH2   . ARG F 3 96  ? 20.609 8.037  -19.905 1.00 41.27 ? 103 ARG B NH2   1 
ATOM   3606 N N     . GLN F 3 97  ? 15.172 11.493 -23.338 1.00 43.58 ? 104 GLN B N     1 
ATOM   3607 C CA    . GLN F 3 97  ? 14.318 11.755 -24.480 1.00 44.84 ? 104 GLN B CA    1 
ATOM   3608 C C     . GLN F 3 97  ? 13.245 12.797 -24.110 1.00 44.68 ? 104 GLN B C     1 
ATOM   3609 O O     . GLN F 3 97  ? 12.540 13.322 -24.978 1.00 44.96 ? 104 GLN B O     1 
ATOM   3610 C CB    . GLN F 3 97  ? 13.695 10.437 -24.941 1.00 46.10 ? 104 GLN B CB    1 
ATOM   3611 C CG    . GLN F 3 97  ? 12.716 10.539 -26.093 1.00 47.42 ? 104 GLN B CG    1 
ATOM   3612 C CD    . GLN F 3 97  ? 12.094 9.196  -26.408 1.00 47.99 ? 104 GLN B CD    1 
ATOM   3613 O OE1   . GLN F 3 97  ? 12.667 8.392  -27.148 1.00 47.21 ? 104 GLN B OE1   1 
ATOM   3614 N NE2   . GLN F 3 97  ? 10.924 8.935  -25.826 1.00 46.69 ? 104 GLN B NE2   1 
ATOM   3615 N N     . LEU F 3 98  ? 13.129 13.093 -22.817 1.00 44.49 ? 105 LEU B N     1 
ATOM   3616 C CA    . LEU F 3 98  ? 12.175 14.092 -22.343 1.00 44.43 ? 105 LEU B CA    1 
ATOM   3617 C C     . LEU F 3 98  ? 12.749 15.468 -22.648 1.00 43.96 ? 105 LEU B C     1 
ATOM   3618 O O     . LEU F 3 98  ? 12.047 16.355 -23.115 1.00 43.80 ? 105 LEU B O     1 
ATOM   3619 C CB    . LEU F 3 98  ? 11.945 13.968 -20.827 1.00 44.59 ? 105 LEU B CB    1 
ATOM   3620 C CG    . LEU F 3 98  ? 11.285 12.708 -20.244 1.00 44.84 ? 105 LEU B CG    1 
ATOM   3621 C CD1   . LEU F 3 98  ? 10.995 12.881 -18.755 1.00 42.91 ? 105 LEU B CD1   1 
ATOM   3622 C CD2   . LEU F 3 98  ? 10.007 12.435 -20.988 1.00 44.79 ? 105 LEU B CD2   1 
ATOM   3623 N N     . ILE F 3 99  ? 14.040 15.634 -22.386 1.00 44.46 ? 106 ILE B N     1 
ATOM   3624 C CA    . ILE F 3 99  ? 14.718 16.906 -22.627 1.00 43.83 ? 106 ILE B CA    1 
ATOM   3625 C C     . ILE F 3 99  ? 14.658 17.326 -24.099 1.00 44.08 ? 106 ILE B C     1 
ATOM   3626 O O     . ILE F 3 99  ? 14.452 18.497 -24.389 1.00 44.40 ? 106 ILE B O     1 
ATOM   3627 C CB    . ILE F 3 99  ? 16.198 16.842 -22.188 1.00 43.02 ? 106 ILE B CB    1 
ATOM   3628 C CG1   . ILE F 3 99  ? 16.291 16.430 -20.715 1.00 42.66 ? 106 ILE B CG1   1 
ATOM   3629 C CG2   . ILE F 3 99  ? 16.859 18.185 -22.412 1.00 42.11 ? 106 ILE B CG2   1 
ATOM   3630 C CD1   . ILE F 3 99  ? 17.718 16.287 -20.179 1.00 40.49 ? 106 ILE B CD1   1 
ATOM   3631 N N     . GLN F 3 100 ? 14.845 16.385 -25.027 1.00 43.56 ? 107 GLN B N     1 
ATOM   3632 C CA    . GLN F 3 100 ? 14.784 16.731 -26.447 1.00 43.91 ? 107 GLN B CA    1 
ATOM   3633 C C     . GLN F 3 100 ? 13.431 17.350 -26.769 1.00 44.59 ? 107 GLN B C     1 
ATOM   3634 O O     . GLN F 3 100 ? 13.326 18.257 -27.602 1.00 45.18 ? 107 GLN B O     1 
ATOM   3635 C CB    . GLN F 3 100 ? 14.992 15.511 -27.351 1.00 43.20 ? 107 GLN B CB    1 
ATOM   3636 C CG    . GLN F 3 100 ? 14.776 15.840 -28.836 1.00 42.21 ? 107 GLN B CG    1 
ATOM   3637 C CD    . GLN F 3 100 ? 15.179 14.720 -29.774 1.00 42.20 ? 107 GLN B CD    1 
ATOM   3638 O OE1   . GLN F 3 100 ? 16.361 14.416 -29.921 1.00 42.29 ? 107 GLN B OE1   1 
ATOM   3639 N NE2   . GLN F 3 100 ? 14.196 14.099 -30.414 1.00 40.45 ? 107 GLN B NE2   1 
ATOM   3640 N N     . VAL F 3 101 ? 12.384 16.848 -26.128 1.00 44.13 ? 108 VAL B N     1 
ATOM   3641 C CA    . VAL F 3 101 ? 11.076 17.419 -26.363 1.00 43.98 ? 108 VAL B CA    1 
ATOM   3642 C C     . VAL F 3 101 ? 11.214 18.815 -25.779 1.00 43.47 ? 108 VAL B C     1 
ATOM   3643 O O     . VAL F 3 101 ? 11.312 19.786 -26.518 1.00 45.10 ? 108 VAL B O     1 
ATOM   3644 C CB    . VAL F 3 101 ? 9.959  16.651 -25.620 1.00 44.87 ? 108 VAL B CB    1 
ATOM   3645 C CG1   . VAL F 3 101 ? 8.601  17.028 -26.204 1.00 43.36 ? 108 VAL B CG1   1 
ATOM   3646 C CG2   . VAL F 3 101 ? 10.208 15.136 -25.699 1.00 44.31 ? 108 VAL B CG2   1 
ATOM   3647 N N     . ASN F 3 102 ? 11.266 18.921 -24.458 1.00 41.65 ? 109 ASN B N     1 
ATOM   3648 C CA    . ASN F 3 102 ? 11.407 20.234 -23.851 1.00 41.19 ? 109 ASN B CA    1 
ATOM   3649 C C     . ASN F 3 102 ? 12.768 20.452 -23.211 1.00 40.51 ? 109 ASN B C     1 
ATOM   3650 O O     . ASN F 3 102 ? 13.303 19.568 -22.543 1.00 42.23 ? 109 ASN B O     1 
ATOM   3651 C CB    . ASN F 3 102 ? 10.326 20.483 -22.800 1.00 40.46 ? 109 ASN B CB    1 
ATOM   3652 C CG    . ASN F 3 102 ? 10.262 21.945 -22.377 1.00 39.39 ? 109 ASN B CG    1 
ATOM   3653 O OD1   . ASN F 3 102 ? 11.288 22.562 -22.093 1.00 37.91 ? 109 ASN B OD1   1 
ATOM   3654 N ND2   . ASN F 3 102 ? 9.058  22.501 -22.334 1.00 36.92 ? 109 ASN B ND2   1 
ATOM   3655 N N     . PRO F 3 103 ? 13.342 21.644 -23.416 1.00 38.54 ? 110 PRO B N     1 
ATOM   3656 C CA    . PRO F 3 103 ? 14.638 22.087 -22.904 1.00 37.44 ? 110 PRO B CA    1 
ATOM   3657 C C     . PRO F 3 103 ? 14.494 22.644 -21.495 1.00 36.22 ? 110 PRO B C     1 
ATOM   3658 O O     . PRO F 3 103 ? 15.239 22.299 -20.583 1.00 34.90 ? 110 PRO B O     1 
ATOM   3659 C CB    . PRO F 3 103 ? 15.016 23.177 -23.892 1.00 38.96 ? 110 PRO B CB    1 
ATOM   3660 C CG    . PRO F 3 103 ? 13.674 23.832 -24.154 1.00 37.62 ? 110 PRO B CG    1 
ATOM   3661 C CD    . PRO F 3 103 ? 12.804 22.624 -24.379 1.00 38.00 ? 110 PRO B CD    1 
ATOM   3662 N N     . ASP F 3 104 ? 13.527 23.544 -21.367 1.00 35.19 ? 111 ASP B N     1 
ATOM   3663 C CA    . ASP F 3 104 ? 13.176 24.222 -20.121 1.00 33.98 ? 111 ASP B CA    1 
ATOM   3664 C C     . ASP F 3 104 ? 13.397 23.348 -18.879 1.00 32.58 ? 111 ASP B C     1 
ATOM   3665 O O     . ASP F 3 104 ? 13.981 23.796 -17.893 1.00 30.12 ? 111 ASP B O     1 
ATOM   3666 C CB    . ASP F 3 104 ? 11.691 24.652 -20.205 1.00 33.69 ? 111 ASP B CB    1 
ATOM   3667 C CG    . ASP F 3 104 ? 11.268 25.613 -19.096 1.00 33.66 ? 111 ASP B CG    1 
ATOM   3668 O OD1   . ASP F 3 104 ? 11.450 26.849 -19.264 1.00 31.91 ? 111 ASP B OD1   1 
ATOM   3669 O OD2   . ASP F 3 104 ? 10.743 25.127 -18.063 1.00 33.00 ? 111 ASP B OD2   1 
ATOM   3670 N N     . ILE F 3 105 ? 12.940 22.099 -18.939 1.00 32.22 ? 112 ILE B N     1 
ATOM   3671 C CA    . ILE F 3 105 ? 13.046 21.209 -17.791 1.00 32.45 ? 112 ILE B CA    1 
ATOM   3672 C C     . ILE F 3 105 ? 14.476 20.808 -17.469 1.00 33.21 ? 112 ILE B C     1 
ATOM   3673 O O     . ILE F 3 105 ? 14.749 20.282 -16.387 1.00 32.69 ? 112 ILE B O     1 
ATOM   3674 C CB    . ILE F 3 105 ? 12.174 19.941 -17.967 1.00 32.27 ? 112 ILE B CB    1 
ATOM   3675 C CG1   . ILE F 3 105 ? 11.958 19.273 -16.609 1.00 31.79 ? 112 ILE B CG1   1 
ATOM   3676 C CG2   . ILE F 3 105 ? 12.826 18.975 -18.930 1.00 32.38 ? 112 ILE B CG2   1 
ATOM   3677 C CD1   . ILE F 3 105 ? 11.211 20.153 -15.598 1.00 30.07 ? 112 ILE B CD1   1 
ATOM   3678 N N     . LEU F 3 106 ? 15.384 21.052 -18.406 1.00 32.57 ? 113 LEU B N     1 
ATOM   3679 C CA    . LEU F 3 106 ? 16.779 20.750 -18.178 1.00 32.97 ? 113 LEU B CA    1 
ATOM   3680 C C     . LEU F 3 106 ? 17.295 21.973 -17.439 1.00 33.23 ? 113 LEU B C     1 
ATOM   3681 O O     . LEU F 3 106 ? 18.197 21.879 -16.617 1.00 33.51 ? 113 LEU B O     1 
ATOM   3682 C CB    . LEU F 3 106 ? 17.512 20.589 -19.507 1.00 34.79 ? 113 LEU B CB    1 
ATOM   3683 C CG    . LEU F 3 106 ? 19.013 20.254 -19.505 1.00 36.51 ? 113 LEU B CG    1 
ATOM   3684 C CD1   . LEU F 3 106 ? 19.250 18.852 -18.962 1.00 36.82 ? 113 LEU B CD1   1 
ATOM   3685 C CD2   . LEU F 3 106 ? 19.551 20.354 -20.929 1.00 36.88 ? 113 LEU B CD2   1 
ATOM   3686 N N     . MET F 3 107 ? 16.680 23.118 -17.733 1.00 33.92 ? 114 MET B N     1 
ATOM   3687 C CA    . MET F 3 107 ? 17.030 24.411 -17.130 1.00 33.99 ? 114 MET B CA    1 
ATOM   3688 C C     . MET F 3 107 ? 16.477 24.554 -15.726 1.00 33.60 ? 114 MET B C     1 
ATOM   3689 O O     . MET F 3 107 ? 16.417 25.663 -15.216 1.00 33.13 ? 114 MET B O     1 
ATOM   3690 C CB    . MET F 3 107 ? 16.475 25.592 -17.964 1.00 34.76 ? 114 MET B CB    1 
ATOM   3691 C CG    . MET F 3 107 ? 17.330 26.112 -19.125 1.00 33.60 ? 114 MET B CG    1 
ATOM   3692 S SD    . MET F 3 107 ? 18.564 27.338 -18.612 1.00 36.30 ? 114 MET B SD    1 
ATOM   3693 C CE    . MET F 3 107 ? 17.548 28.712 -18.155 1.00 34.10 ? 114 MET B CE    1 
ATOM   3694 N N     . ARG F 3 108 ? 16.043 23.466 -15.103 1.00 34.39 ? 115 ARG B N     1 
ATOM   3695 C CA    . ARG F 3 108 ? 15.519 23.594 -13.746 1.00 34.92 ? 115 ARG B CA    1 
ATOM   3696 C C     . ARG F 3 108 ? 16.429 22.941 -12.718 1.00 33.14 ? 115 ARG B C     1 
ATOM   3697 O O     . ARG F 3 108 ? 16.936 23.607 -11.822 1.00 32.91 ? 115 ARG B O     1 
ATOM   3698 C CB    . ARG F 3 108 ? 14.120 23.011 -13.652 1.00 36.58 ? 115 ARG B CB    1 
ATOM   3699 C CG    . ARG F 3 108 ? 13.330 23.548 -12.479 1.00 40.70 ? 115 ARG B CG    1 
ATOM   3700 C CD    . ARG F 3 108 ? 11.853 23.163 -12.581 1.00 45.09 ? 115 ARG B CD    1 
ATOM   3701 N NE    . ARG F 3 108 ? 11.060 24.142 -13.326 1.00 50.12 ? 115 ARG B NE    1 
ATOM   3702 C CZ    . ARG F 3 108 ? 11.246 24.472 -14.606 1.00 52.09 ? 115 ARG B CZ    1 
ATOM   3703 N NH1   . ARG F 3 108 ? 12.209 23.902 -15.318 1.00 53.42 ? 115 ARG B NH1   1 
ATOM   3704 N NH2   . ARG F 3 108 ? 10.465 25.385 -15.180 1.00 52.40 ? 115 ARG B NH2   1 
ATOM   3705 N N     . LEU F 3 109 ? 16.647 21.642 -12.847 1.00 31.16 ? 116 LEU B N     1 
ATOM   3706 C CA    . LEU F 3 109 ? 17.522 20.954 -11.915 1.00 30.95 ? 116 LEU B CA    1 
ATOM   3707 C C     . LEU F 3 109 ? 18.937 21.514 -12.102 1.00 31.95 ? 116 LEU B C     1 
ATOM   3708 O O     . LEU F 3 109 ? 19.649 21.766 -11.132 1.00 32.39 ? 116 LEU B O     1 
ATOM   3709 C CB    . LEU F 3 109 ? 17.529 19.458 -12.196 1.00 29.57 ? 116 LEU B CB    1 
ATOM   3710 C CG    . LEU F 3 109 ? 18.363 19.076 -13.411 1.00 29.46 ? 116 LEU B CG    1 
ATOM   3711 C CD1   . LEU F 3 109 ? 18.422 17.559 -13.540 1.00 30.21 ? 116 LEU B CD1   1 
ATOM   3712 C CD2   . LEU F 3 109 ? 17.786 19.738 -14.660 1.00 29.75 ? 116 LEU B CD2   1 
ATOM   3713 N N     . SER F 3 110 ? 19.336 21.706 -13.360 1.00 30.57 ? 117 SER B N     1 
ATOM   3714 C CA    . SER F 3 110 ? 20.647 22.251 -13.686 1.00 27.28 ? 117 SER B CA    1 
ATOM   3715 C C     . SER F 3 110 ? 20.927 23.356 -12.691 1.00 25.69 ? 117 SER B C     1 
ATOM   3716 O O     . SER F 3 110 ? 22.033 23.490 -12.181 1.00 25.36 ? 117 SER B O     1 
ATOM   3717 C CB    . SER F 3 110 ? 20.630 22.825 -15.099 1.00 27.19 ? 117 SER B CB    1 
ATOM   3718 O OG    . SER F 3 110 ? 19.527 23.707 -15.243 1.00 27.49 ? 117 SER B OG    1 
ATOM   3719 N N     . ALA F 3 111 ? 19.914 24.164 -12.425 1.00 25.04 ? 118 ALA B N     1 
ATOM   3720 C CA    . ALA F 3 111 ? 20.071 25.237 -11.466 1.00 24.94 ? 118 ALA B CA    1 
ATOM   3721 C C     . ALA F 3 111 ? 20.275 24.563 -10.108 1.00 24.23 ? 118 ALA B C     1 
ATOM   3722 O O     . ALA F 3 111 ? 21.299 24.778 -9.436  1.00 22.23 ? 118 ALA B O     1 
ATOM   3723 C CB    . ALA F 3 111 ? 18.837 26.101 -11.458 1.00 23.91 ? 118 ALA B CB    1 
ATOM   3724 N N     . GLN F 3 112 ? 19.292 23.733 -9.731  1.00 23.74 ? 119 GLN B N     1 
ATOM   3725 C CA    . GLN F 3 112 ? 19.319 22.985 -8.471  1.00 22.96 ? 119 GLN B CA    1 
ATOM   3726 C C     . GLN F 3 112 ? 20.762 22.533 -8.216  1.00 22.52 ? 119 GLN B C     1 
ATOM   3727 O O     . GLN F 3 112 ? 21.296 22.685 -7.111  1.00 22.54 ? 119 GLN B O     1 
ATOM   3728 C CB    . GLN F 3 112 ? 18.384 21.763 -8.551  1.00 21.96 ? 119 GLN B CB    1 
ATOM   3729 C CG    . GLN F 3 112 ? 16.934 22.066 -8.221  1.00 21.76 ? 119 GLN B CG    1 
ATOM   3730 C CD    . GLN F 3 112 ? 16.047 20.814 -8.081  1.00 21.96 ? 119 GLN B CD    1 
ATOM   3731 O OE1   . GLN F 3 112 ? 15.003 20.868 -7.421  1.00 20.31 ? 119 GLN B OE1   1 
ATOM   3732 N NE2   . GLN F 3 112 ? 16.448 19.698 -8.713  1.00 16.95 ? 119 GLN B NE2   1 
ATOM   3733 N N     . MET F 3 113 ? 21.375 21.972 -9.257  1.00 20.75 ? 120 MET B N     1 
ATOM   3734 C CA    . MET F 3 113 ? 22.749 21.537 -9.189  1.00 19.30 ? 120 MET B CA    1 
ATOM   3735 C C     . MET F 3 113 ? 23.581 22.701 -9.711  1.00 18.41 ? 120 MET B C     1 
ATOM   3736 O O     . MET F 3 113 ? 23.987 22.757 -10.858 1.00 19.41 ? 120 MET B O     1 
ATOM   3737 C CB    . MET F 3 113 ? 22.965 20.260 -10.011 1.00 19.27 ? 120 MET B CB    1 
ATOM   3738 C CG    . MET F 3 113 ? 23.046 20.401 -11.518 1.00 19.09 ? 120 MET B CG    1 
ATOM   3739 S SD    . MET F 3 113 ? 23.618 18.861 -12.266 1.00 22.28 ? 120 MET B SD    1 
ATOM   3740 C CE    . MET F 3 113 ? 24.769 18.245 -10.954 1.00 20.57 ? 120 MET B CE    1 
ATOM   3741 N N     . ALA F 3 114 ? 23.787 23.662 -8.838  1.00 17.52 ? 121 ALA B N     1 
ATOM   3742 C CA    . ALA F 3 114 ? 24.558 24.837 -9.142  1.00 17.99 ? 121 ALA B CA    1 
ATOM   3743 C C     . ALA F 3 114 ? 24.401 25.601 -7.858  1.00 18.02 ? 121 ALA B C     1 
ATOM   3744 O O     . ALA F 3 114 ? 25.317 26.283 -7.408  1.00 17.39 ? 121 ALA B O     1 
ATOM   3745 C CB    . ALA F 3 114 ? 23.953 25.584 -10.293 1.00 20.54 ? 121 ALA B CB    1 
ATOM   3746 N N     . ARG F 3 115 ? 23.221 25.453 -7.259  1.00 17.63 ? 122 ARG B N     1 
ATOM   3747 C CA    . ARG F 3 115 ? 22.926 26.090 -5.987  1.00 16.32 ? 122 ARG B CA    1 
ATOM   3748 C C     . ARG F 3 115 ? 23.606 25.229 -4.929  1.00 14.28 ? 122 ARG B C     1 
ATOM   3749 O O     . ARG F 3 115 ? 23.997 25.703 -3.870  1.00 15.02 ? 122 ARG B O     1 
ATOM   3750 C CB    . ARG F 3 115 ? 21.420 26.126 -5.732  1.00 16.74 ? 122 ARG B CB    1 
ATOM   3751 C CG    . ARG F 3 115 ? 20.990 27.021 -4.562  1.00 20.91 ? 122 ARG B CG    1 
ATOM   3752 C CD    . ARG F 3 115 ? 21.259 28.503 -4.869  1.00 23.80 ? 122 ARG B CD    1 
ATOM   3753 N NE    . ARG F 3 115 ? 22.591 28.989 -4.481  1.00 26.21 ? 122 ARG B NE    1 
ATOM   3754 C CZ    . ARG F 3 115 ? 23.348 29.810 -5.221  1.00 27.93 ? 122 ARG B CZ    1 
ATOM   3755 N NH1   . ARG F 3 115 ? 22.935 30.236 -6.412  1.00 29.04 ? 122 ARG B NH1   1 
ATOM   3756 N NH2   . ARG F 3 115 ? 24.498 30.274 -4.744  1.00 27.35 ? 122 ARG B NH2   1 
ATOM   3757 N N     . ARG F 3 116 ? 23.753 23.950 -5.230  1.00 12.77 ? 123 ARG B N     1 
ATOM   3758 C CA    . ARG F 3 116 ? 24.391 23.036 -4.300  1.00 12.07 ? 123 ARG B CA    1 
ATOM   3759 C C     . ARG F 3 116 ? 25.899 23.188 -4.446  1.00 12.24 ? 123 ARG B C     1 
ATOM   3760 O O     . ARG F 3 116 ? 26.596 23.333 -3.451  1.00 11.99 ? 123 ARG B O     1 
ATOM   3761 C CB    . ARG F 3 116 ? 23.913 21.612 -4.586  1.00 9.15  ? 123 ARG B CB    1 
ATOM   3762 C CG    . ARG F 3 116 ? 22.399 21.544 -4.618  1.00 5.17  ? 123 ARG B CG    1 
ATOM   3763 C CD    . ARG F 3 116 ? 21.871 20.170 -4.913  1.00 5.60  ? 123 ARG B CD    1 
ATOM   3764 N NE    . ARG F 3 116 ? 20.428 20.207 -5.167  1.00 8.35  ? 123 ARG B NE    1 
ATOM   3765 C CZ    . ARG F 3 116 ? 19.676 19.153 -5.493  1.00 8.51  ? 123 ARG B CZ    1 
ATOM   3766 N NH1   . ARG F 3 116 ? 20.219 17.938 -5.610  1.00 6.78  ? 123 ARG B NH1   1 
ATOM   3767 N NH2   . ARG F 3 116 ? 18.380 19.322 -5.719  1.00 5.60  ? 123 ARG B NH2   1 
ATOM   3768 N N     . LEU F 3 117 ? 26.386 23.205 -5.688  1.00 12.58 ? 124 LEU B N     1 
ATOM   3769 C CA    . LEU F 3 117 ? 27.802 23.370 -5.948  1.00 11.37 ? 124 LEU B CA    1 
ATOM   3770 C C     . LEU F 3 117 ? 28.227 24.584 -5.162  1.00 12.17 ? 124 LEU B C     1 
ATOM   3771 O O     . LEU F 3 117 ? 29.361 24.689 -4.709  1.00 12.69 ? 124 LEU B O     1 
ATOM   3772 C CB    . LEU F 3 117 ? 28.064 23.631 -7.424  1.00 12.62 ? 124 LEU B CB    1 
ATOM   3773 C CG    . LEU F 3 117 ? 29.495 23.483 -8.008  1.00 14.35 ? 124 LEU B CG    1 
ATOM   3774 C CD1   . LEU F 3 117 ? 30.603 23.534 -6.938  1.00 8.45  ? 124 LEU B CD1   1 
ATOM   3775 C CD2   . LEU F 3 117 ? 29.554 22.123 -8.720  1.00 14.76 ? 124 LEU B CD2   1 
ATOM   3776 N N     . GLN F 3 118 ? 27.318 25.527 -4.998  1.00 12.53 ? 125 GLN B N     1 
ATOM   3777 C CA    . GLN F 3 118 ? 27.667 26.705 -4.221  1.00 13.06 ? 125 GLN B CA    1 
ATOM   3778 C C     . GLN F 3 118 ? 27.728 26.391 -2.749  1.00 12.12 ? 125 GLN B C     1 
ATOM   3779 O O     . GLN F 3 118 ? 28.810 26.354 -2.178  1.00 12.27 ? 125 GLN B O     1 
ATOM   3780 C CB    . GLN F 3 118 ? 26.699 27.843 -4.504  1.00 12.41 ? 125 GLN B CB    1 
ATOM   3781 C CG    . GLN F 3 118 ? 27.195 28.667 -5.653  1.00 14.34 ? 125 GLN B CG    1 
ATOM   3782 C CD    . GLN F 3 118 ? 26.104 29.341 -6.401  1.00 18.12 ? 125 GLN B CD    1 
ATOM   3783 O OE1   . GLN F 3 118 ? 25.192 28.687 -6.921  1.00 20.62 ? 125 GLN B OE1   1 
ATOM   3784 N NE2   . GLN F 3 118 ? 26.172 30.668 -6.471  1.00 19.99 ? 125 GLN B NE2   1 
ATOM   3785 N N     . VAL F 3 119 ? 26.578 26.143 -2.140  1.00 12.67 ? 126 VAL B N     1 
ATOM   3786 C CA    . VAL F 3 119 ? 26.512 25.813 -0.715  1.00 12.97 ? 126 VAL B CA    1 
ATOM   3787 C C     . VAL F 3 119 ? 27.710 24.958 -0.249  1.00 12.19 ? 126 VAL B C     1 
ATOM   3788 O O     . VAL F 3 119 ? 28.475 25.369 0.619   1.00 9.46  ? 126 VAL B O     1 
ATOM   3789 C CB    . VAL F 3 119 ? 25.208 25.067 -0.412  1.00 13.74 ? 126 VAL B CB    1 
ATOM   3790 C CG1   . VAL F 3 119 ? 25.176 24.628 1.036   1.00 13.66 ? 126 VAL B CG1   1 
ATOM   3791 C CG2   . VAL F 3 119 ? 24.024 25.967 -0.735  1.00 14.20 ? 126 VAL B CG2   1 
ATOM   3792 N N     . THR F 3 120 ? 27.859 23.777 -0.845  1.00 12.32 ? 127 THR B N     1 
ATOM   3793 C CA    . THR F 3 120 ? 28.944 22.865 -0.528  1.00 11.90 ? 127 THR B CA    1 
ATOM   3794 C C     . THR F 3 120 ? 30.342 23.526 -0.487  1.00 13.80 ? 127 THR B C     1 
ATOM   3795 O O     . THR F 3 120 ? 31.182 23.171 0.346   1.00 11.71 ? 127 THR B O     1 
ATOM   3796 C CB    . THR F 3 120 ? 28.961 21.698 -1.520  1.00 10.70 ? 127 THR B CB    1 
ATOM   3797 O OG1   . THR F 3 120 ? 27.769 20.920 -1.376  1.00 4.48  ? 127 THR B OG1   1 
ATOM   3798 C CG2   . THR F 3 120 ? 30.141 20.802 -1.236  1.00 13.31 ? 127 THR B CG2   1 
ATOM   3799 N N     . SER F 3 121 ? 30.590 24.476 -1.385  1.00 14.48 ? 128 SER B N     1 
ATOM   3800 C CA    . SER F 3 121 ? 31.877 25.182 -1.413  1.00 16.94 ? 128 SER B CA    1 
ATOM   3801 C C     . SER F 3 121 ? 32.017 25.927 -0.093  1.00 17.35 ? 128 SER B C     1 
ATOM   3802 O O     . SER F 3 121 ? 33.098 26.043 0.475   1.00 17.65 ? 128 SER B O     1 
ATOM   3803 C CB    . SER F 3 121 ? 31.918 26.224 -2.547  1.00 18.18 ? 128 SER B CB    1 
ATOM   3804 O OG    . SER F 3 121 ? 31.416 25.710 -3.766  1.00 19.06 ? 128 SER B OG    1 
ATOM   3805 N N     . GLU F 3 122 ? 30.891 26.449 0.371   1.00 17.82 ? 129 GLU B N     1 
ATOM   3806 C CA    . GLU F 3 122 ? 30.848 27.196 1.604   1.00 17.04 ? 129 GLU B CA    1 
ATOM   3807 C C     . GLU F 3 122 ? 30.941 26.243 2.778   1.00 15.48 ? 129 GLU B C     1 
ATOM   3808 O O     . GLU F 3 122 ? 31.188 26.668 3.893   1.00 16.13 ? 129 GLU B O     1 
ATOM   3809 C CB    . GLU F 3 122 ? 29.553 27.998 1.691   1.00 20.64 ? 129 GLU B CB    1 
ATOM   3810 C CG    . GLU F 3 122 ? 29.624 29.179 2.645   1.00 25.15 ? 129 GLU B CG    1 
ATOM   3811 C CD    . GLU F 3 122 ? 28.253 29.695 3.055   1.00 26.92 ? 129 GLU B CD    1 
ATOM   3812 O OE1   . GLU F 3 122 ? 27.508 30.177 2.179   1.00 27.94 ? 129 GLU B OE1   1 
ATOM   3813 O OE2   . GLU F 3 122 ? 27.922 29.617 4.262   1.00 29.56 ? 129 GLU B OE2   1 
ATOM   3814 N N     . LYS F 3 123 ? 30.734 24.953 2.542   1.00 14.06 ? 130 LYS B N     1 
ATOM   3815 C CA    . LYS F 3 123 ? 30.837 23.985 3.637   1.00 13.66 ? 130 LYS B CA    1 
ATOM   3816 C C     . LYS F 3 123 ? 32.330 23.735 3.843   1.00 13.17 ? 130 LYS B C     1 
ATOM   3817 O O     . LYS F 3 123 ? 32.781 23.556 4.959   1.00 11.67 ? 130 LYS B O     1 
ATOM   3818 C CB    . LYS F 3 123 ? 30.120 22.675 3.295   1.00 13.46 ? 130 LYS B CB    1 
ATOM   3819 C CG    . LYS F 3 123 ? 29.561 21.985 4.494   1.00 13.80 ? 130 LYS B CG    1 
ATOM   3820 C CD    . LYS F 3 123 ? 28.822 20.734 4.125   1.00 13.89 ? 130 LYS B CD    1 
ATOM   3821 C CE    . LYS F 3 123 ? 28.116 20.131 5.353   1.00 15.64 ? 130 LYS B CE    1 
ATOM   3822 N NZ    . LYS F 3 123 ? 26.965 20.974 5.813   1.00 17.34 ? 130 LYS B NZ    1 
ATOM   3823 N N     . VAL F 3 124 ? 33.080 23.725 2.743   1.00 12.60 ? 131 VAL B N     1 
ATOM   3824 C CA    . VAL F 3 124 ? 34.523 23.572 2.800   1.00 12.70 ? 131 VAL B CA    1 
ATOM   3825 C C     . VAL F 3 124 ? 35.011 24.927 3.305   1.00 13.29 ? 131 VAL B C     1 
ATOM   3826 O O     . VAL F 3 124 ? 35.922 25.013 4.122   1.00 13.80 ? 131 VAL B O     1 
ATOM   3827 C CB    . VAL F 3 124 ? 35.129 23.325 1.422   1.00 11.52 ? 131 VAL B CB    1 
ATOM   3828 C CG1   . VAL F 3 124 ? 36.624 23.076 1.557   1.00 9.30  ? 131 VAL B CG1   1 
ATOM   3829 C CG2   . VAL F 3 124 ? 34.439 22.177 0.762   1.00 10.08 ? 131 VAL B CG2   1 
ATOM   3830 N N     . GLY F 3 125 ? 34.401 25.995 2.810   1.00 12.28 ? 132 GLY B N     1 
ATOM   3831 C CA    . GLY F 3 125 ? 34.794 27.290 3.304   1.00 14.39 ? 132 GLY B CA    1 
ATOM   3832 C C     . GLY F 3 125 ? 34.577 27.213 4.808   1.00 15.84 ? 132 GLY B C     1 
ATOM   3833 O O     . GLY F 3 125 ? 35.411 27.604 5.616   1.00 19.23 ? 132 GLY B O     1 
ATOM   3834 N N     . ASN F 3 126 ? 33.455 26.639 5.194   1.00 14.96 ? 133 ASN B N     1 
ATOM   3835 C CA    . ASN F 3 126 ? 33.132 26.531 6.600   1.00 13.51 ? 133 ASN B CA    1 
ATOM   3836 C C     . ASN F 3 126 ? 33.878 25.543 7.469   1.00 13.83 ? 133 ASN B C     1 
ATOM   3837 O O     . ASN F 3 126 ? 34.182 25.857 8.620   1.00 16.17 ? 133 ASN B O     1 
ATOM   3838 C CB    . ASN F 3 126 ? 31.654 26.275 6.751   1.00 11.07 ? 133 ASN B CB    1 
ATOM   3839 C CG    . ASN F 3 126 ? 30.932 27.491 7.120   1.00 6.41  ? 133 ASN B CG    1 
ATOM   3840 O OD1   . ASN F 3 126 ? 31.054 28.531 6.478   1.00 4.37  ? 133 ASN B OD1   1 
ATOM   3841 N ND2   . ASN F 3 126 ? 30.181 27.397 8.177   1.00 6.82  ? 133 ASN B ND2   1 
ATOM   3842 N N     . LEU F 3 127 ? 34.162 24.356 6.942   1.00 12.14 ? 134 LEU B N     1 
ATOM   3843 C CA    . LEU F 3 127 ? 34.860 23.342 7.714   1.00 9.67  ? 134 LEU B CA    1 
ATOM   3844 C C     . LEU F 3 127 ? 36.312 23.617 7.926   1.00 12.83 ? 134 LEU B C     1 
ATOM   3845 O O     . LEU F 3 127 ? 36.893 23.071 8.859   1.00 15.30 ? 134 LEU B O     1 
ATOM   3846 C CB    . LEU F 3 127 ? 34.728 21.993 7.056   1.00 5.55  ? 134 LEU B CB    1 
ATOM   3847 C CG    . LEU F 3 127 ? 33.432 21.317 7.498   1.00 5.61  ? 134 LEU B CG    1 
ATOM   3848 C CD1   . LEU F 3 127 ? 32.898 20.437 6.375   1.00 3.55  ? 134 LEU B CD1   1 
ATOM   3849 C CD2   . LEU F 3 127 ? 33.670 20.541 8.796   1.00 1.56  ? 134 LEU B CD2   1 
ATOM   3850 N N     . ALA F 3 128 ? 36.903 24.466 7.078   1.00 14.11 ? 135 ALA B N     1 
ATOM   3851 C CA    . ALA F 3 128 ? 38.335 24.782 7.160   1.00 13.19 ? 135 ALA B CA    1 
ATOM   3852 C C     . ALA F 3 128 ? 38.636 26.170 7.690   1.00 14.26 ? 135 ALA B C     1 
ATOM   3853 O O     . ALA F 3 128 ? 39.732 26.438 8.137   1.00 14.33 ? 135 ALA B O     1 
ATOM   3854 C CB    . ALA F 3 128 ? 38.956 24.629 5.819   1.00 12.02 ? 135 ALA B CB    1 
ATOM   3855 N N     . PHE F 3 129 ? 37.662 27.060 7.630   1.00 14.82 ? 136 PHE B N     1 
ATOM   3856 C CA    . PHE F 3 129 ? 37.869 28.414 8.120   1.00 14.53 ? 136 PHE B CA    1 
ATOM   3857 C C     . PHE F 3 129 ? 37.137 28.683 9.455   1.00 14.59 ? 136 PHE B C     1 
ATOM   3858 O O     . PHE F 3 129 ? 36.968 29.838 9.865   1.00 13.48 ? 136 PHE B O     1 
ATOM   3859 C CB    . PHE F 3 129 ? 37.385 29.432 7.064   1.00 13.90 ? 136 PHE B CB    1 
ATOM   3860 C CG    . PHE F 3 129 ? 38.193 29.430 5.799   1.00 12.90 ? 136 PHE B CG    1 
ATOM   3861 C CD1   . PHE F 3 129 ? 39.581 29.368 5.847   1.00 10.59 ? 136 PHE B CD1   1 
ATOM   3862 C CD2   . PHE F 3 129 ? 37.565 29.490 4.558   1.00 11.46 ? 136 PHE B CD2   1 
ATOM   3863 C CE1   . PHE F 3 129 ? 40.336 29.363 4.686   1.00 9.68  ? 136 PHE B CE1   1 
ATOM   3864 C CE2   . PHE F 3 129 ? 38.317 29.484 3.393   1.00 13.27 ? 136 PHE B CE2   1 
ATOM   3865 C CZ    . PHE F 3 129 ? 39.713 29.419 3.462   1.00 10.77 ? 136 PHE B CZ    1 
ATOM   3866 N N     . LEU F 3 130 ? 36.737 27.630 10.153  1.00 12.24 ? 137 LEU B N     1 
ATOM   3867 C CA    . LEU F 3 130 ? 35.983 27.848 11.364  1.00 9.07  ? 137 LEU B CA    1 
ATOM   3868 C C     . LEU F 3 130 ? 36.138 26.761 12.424  1.00 8.17  ? 137 LEU B C     1 
ATOM   3869 O O     . LEU F 3 130 ? 36.317 25.587 12.120  1.00 6.09  ? 137 LEU B O     1 
ATOM   3870 C CB    . LEU F 3 130 ? 34.520 27.986 10.966  1.00 9.64  ? 137 LEU B CB    1 
ATOM   3871 C CG    . LEU F 3 130 ? 33.789 29.313 11.098  1.00 10.33 ? 137 LEU B CG    1 
ATOM   3872 C CD1   . LEU F 3 130 ? 34.767 30.434 10.975  1.00 7.32  ? 137 LEU B CD1   1 
ATOM   3873 C CD2   . LEU F 3 130 ? 32.647 29.393 10.057  1.00 6.89  ? 137 LEU B CD2   1 
ATOM   3874 N N     . ASP F 3 131 ? 36.083 27.172 13.681  1.00 6.70  ? 138 ASP B N     1 
ATOM   3875 C CA    . ASP F 3 131 ? 36.169 26.224 14.758  1.00 6.44  ? 138 ASP B CA    1 
ATOM   3876 C C     . ASP F 3 131 ? 34.755 25.890 15.208  1.00 7.51  ? 138 ASP B C     1 
ATOM   3877 O O     . ASP F 3 131 ? 33.932 26.778 15.408  1.00 7.56  ? 138 ASP B O     1 
ATOM   3878 C CB    . ASP F 3 131 ? 36.861 26.833 15.936  1.00 6.19  ? 138 ASP B CB    1 
ATOM   3879 C CG    . ASP F 3 131 ? 36.027 27.903 16.566  1.00 6.62  ? 138 ASP B CG    1 
ATOM   3880 O OD1   . ASP F 3 131 ? 35.618 28.778 15.794  1.00 2.82  ? 138 ASP B OD1   1 
ATOM   3881 O OD2   . ASP F 3 131 ? 35.779 27.871 17.799  1.00 8.74  ? 138 ASP B OD2   1 
ATOM   3882 N N     . VAL F 3 132 ? 34.487 24.602 15.367  1.00 8.68  ? 139 VAL B N     1 
ATOM   3883 C CA    . VAL F 3 132 ? 33.205 24.104 15.849  1.00 11.07 ? 139 VAL B CA    1 
ATOM   3884 C C     . VAL F 3 132 ? 32.183 25.146 16.408  1.00 11.27 ? 139 VAL B C     1 
ATOM   3885 O O     . VAL F 3 132 ? 31.020 25.178 15.982  1.00 10.50 ? 139 VAL B O     1 
ATOM   3886 C CB    . VAL F 3 132 ? 33.503 22.982 16.856  1.00 11.57 ? 139 VAL B CB    1 
ATOM   3887 C CG1   . VAL F 3 132 ? 32.415 22.828 17.856  1.00 14.07 ? 139 VAL B CG1   1 
ATOM   3888 C CG2   . VAL F 3 132 ? 33.699 21.697 16.100  1.00 13.91 ? 139 VAL B CG2   1 
ATOM   3889 N N     . THR F 3 133 ? 32.587 25.998 17.340  1.00 11.97 ? 140 THR B N     1 
ATOM   3890 C CA    . THR F 3 133 ? 31.642 26.989 17.845  1.00 13.02 ? 140 THR B CA    1 
ATOM   3891 C C     . THR F 3 133 ? 31.055 27.749 16.655  1.00 13.67 ? 140 THR B C     1 
ATOM   3892 O O     . THR F 3 133 ? 29.913 27.529 16.265  1.00 12.78 ? 140 THR B O     1 
ATOM   3893 C CB    . THR F 3 133 ? 32.319 28.001 18.826  1.00 13.84 ? 140 THR B CB    1 
ATOM   3894 O OG1   . THR F 3 133 ? 32.426 27.415 20.130  1.00 13.40 ? 140 THR B OG1   1 
ATOM   3895 C CG2   . THR F 3 133 ? 31.507 29.291 18.932  1.00 14.26 ? 140 THR B CG2   1 
ATOM   3896 N N     . GLY F 3 134 ? 31.859 28.619 16.056  1.00 14.24 ? 141 GLY B N     1 
ATOM   3897 C CA    . GLY F 3 134 ? 31.380 29.408 14.939  1.00 12.38 ? 141 GLY B CA    1 
ATOM   3898 C C     . GLY F 3 134 ? 30.701 28.627 13.842  1.00 12.40 ? 141 GLY B C     1 
ATOM   3899 O O     . GLY F 3 134 ? 30.129 29.215 12.946  1.00 12.10 ? 141 GLY B O     1 
ATOM   3900 N N     . ARG F 3 135 ? 30.757 27.305 13.908  1.00 13.70 ? 142 ARG B N     1 
ATOM   3901 C CA    . ARG F 3 135 ? 30.168 26.460 12.865  1.00 13.97 ? 142 ARG B CA    1 
ATOM   3902 C C     . ARG F 3 135 ? 28.788 26.013 13.241  1.00 12.03 ? 142 ARG B C     1 
ATOM   3903 O O     . ARG F 3 135 ? 27.982 25.763 12.374  1.00 13.52 ? 142 ARG B O     1 
ATOM   3904 C CB    . ARG F 3 135 ? 31.031 25.215 12.626  1.00 16.32 ? 142 ARG B CB    1 
ATOM   3905 C CG    . ARG F 3 135 ? 31.429 24.960 11.188  1.00 19.78 ? 142 ARG B CG    1 
ATOM   3906 C CD    . ARG F 3 135 ? 32.209 23.627 11.062  1.00 23.92 ? 142 ARG B CD    1 
ATOM   3907 N NE    . ARG F 3 135 ? 33.395 23.576 11.926  1.00 24.41 ? 142 ARG B NE    1 
ATOM   3908 C CZ    . ARG F 3 135 ? 34.055 22.465 12.232  1.00 25.90 ? 142 ARG B CZ    1 
ATOM   3909 N NH1   . ARG F 3 135 ? 33.663 21.297 11.743  1.00 27.60 ? 142 ARG B NH1   1 
ATOM   3910 N NH2   . ARG F 3 135 ? 35.087 22.516 13.063  1.00 28.13 ? 142 ARG B NH2   1 
ATOM   3911 N N     . ILE F 3 136 ? 28.547 25.868 14.540  1.00 9.65  ? 143 ILE B N     1 
ATOM   3912 C CA    . ILE F 3 136 ? 27.251 25.472 15.053  1.00 8.25  ? 143 ILE B CA    1 
ATOM   3913 C C     . ILE F 3 136 ? 26.326 26.684 14.917  1.00 10.86 ? 143 ILE B C     1 
ATOM   3914 O O     . ILE F 3 136 ? 25.125 26.561 14.633  1.00 11.89 ? 143 ILE B O     1 
ATOM   3915 C CB    . ILE F 3 136 ? 27.363 25.072 16.493  1.00 5.68  ? 143 ILE B CB    1 
ATOM   3916 C CG1   . ILE F 3 136 ? 28.193 23.795 16.589  1.00 5.86  ? 143 ILE B CG1   1 
ATOM   3917 C CG2   . ILE F 3 136 ? 26.001 24.886 17.094  1.00 3.70  ? 143 ILE B CG2   1 
ATOM   3918 C CD1   . ILE F 3 136 ? 28.947 23.677 17.916  1.00 6.28  ? 143 ILE B CD1   1 
ATOM   3919 N N     . ALA F 3 137 ? 26.899 27.865 15.120  1.00 11.98 ? 144 ALA B N     1 
ATOM   3920 C CA    . ALA F 3 137 ? 26.164 29.102 14.959  1.00 11.00 ? 144 ALA B CA    1 
ATOM   3921 C C     . ALA F 3 137 ? 25.716 29.163 13.486  1.00 11.89 ? 144 ALA B C     1 
ATOM   3922 O O     . ALA F 3 137 ? 24.537 29.417 13.195  1.00 11.58 ? 144 ALA B O     1 
ATOM   3923 C CB    . ALA F 3 137 ? 27.046 30.260 15.288  1.00 7.92  ? 144 ALA B CB    1 
ATOM   3924 N N     . GLN F 3 138 ? 26.645 28.920 12.563  1.00 11.72 ? 145 GLN B N     1 
ATOM   3925 C CA    . GLN F 3 138 ? 26.311 28.929 11.138  1.00 14.64 ? 145 GLN B CA    1 
ATOM   3926 C C     . GLN F 3 138 ? 25.172 27.955 10.817  1.00 15.65 ? 145 GLN B C     1 
ATOM   3927 O O     . GLN F 3 138 ? 24.228 28.305 10.108  1.00 13.77 ? 145 GLN B O     1 
ATOM   3928 C CB    . GLN F 3 138 ? 27.517 28.529 10.284  1.00 15.88 ? 145 GLN B CB    1 
ATOM   3929 C CG    . GLN F 3 138 ? 28.525 29.609 10.118  1.00 19.97 ? 145 GLN B CG    1 
ATOM   3930 C CD    . GLN F 3 138 ? 27.926 30.845 9.513   1.00 22.61 ? 145 GLN B CD    1 
ATOM   3931 O OE1   . GLN F 3 138 ? 27.504 30.838 8.348   1.00 24.26 ? 145 GLN B OE1   1 
ATOM   3932 N NE2   . GLN F 3 138 ? 27.873 31.922 10.298  1.00 21.50 ? 145 GLN B NE2   1 
ATOM   3933 N N     . THR F 3 139 ? 25.289 26.729 11.334  1.00 15.96 ? 146 THR B N     1 
ATOM   3934 C CA    . THR F 3 139 ? 24.306 25.697 11.086  1.00 15.15 ? 146 THR B CA    1 
ATOM   3935 C C     . THR F 3 139 ? 22.964 25.935 11.711  1.00 15.58 ? 146 THR B C     1 
ATOM   3936 O O     . THR F 3 139 ? 21.993 25.387 11.223  1.00 16.82 ? 146 THR B O     1 
ATOM   3937 C CB    . THR F 3 139 ? 24.766 24.328 11.539  1.00 14.68 ? 146 THR B CB    1 
ATOM   3938 O OG1   . THR F 3 139 ? 26.164 24.355 11.798  1.00 15.79 ? 146 THR B OG1   1 
ATOM   3939 C CG2   . THR F 3 139 ? 24.491 23.315 10.452  1.00 14.23 ? 146 THR B CG2   1 
ATOM   3940 N N     . LEU F 3 140 ? 22.890 26.713 12.788  1.00 15.58 ? 147 LEU B N     1 
ATOM   3941 C CA    . LEU F 3 140 ? 21.586 26.973 13.379  1.00 16.64 ? 147 LEU B CA    1 
ATOM   3942 C C     . LEU F 3 140 ? 20.846 27.976 12.487  1.00 17.58 ? 147 LEU B C     1 
ATOM   3943 O O     . LEU F 3 140 ? 19.658 27.816 12.226  1.00 17.66 ? 147 LEU B O     1 
ATOM   3944 C CB    . LEU F 3 140 ? 21.699 27.502 14.823  1.00 15.40 ? 147 LEU B CB    1 
ATOM   3945 C CG    . LEU F 3 140 ? 21.936 26.481 15.947  1.00 16.46 ? 147 LEU B CG    1 
ATOM   3946 C CD1   . LEU F 3 140 ? 21.898 27.143 17.300  1.00 15.96 ? 147 LEU B CD1   1 
ATOM   3947 C CD2   . LEU F 3 140 ? 20.868 25.427 15.903  1.00 15.93 ? 147 LEU B CD2   1 
ATOM   3948 N N     . LEU F 3 141 ? 21.553 28.992 11.996  1.00 18.08 ? 148 LEU B N     1 
ATOM   3949 C CA    . LEU F 3 141 ? 20.931 29.983 11.135  1.00 17.77 ? 148 LEU B CA    1 
ATOM   3950 C C     . LEU F 3 141 ? 20.392 29.317 9.878   1.00 20.38 ? 148 LEU B C     1 
ATOM   3951 O O     . LEU F 3 141 ? 19.222 29.499 9.523   1.00 22.27 ? 148 LEU B O     1 
ATOM   3952 C CB    . LEU F 3 141 ? 21.921 31.082 10.756  1.00 15.88 ? 148 LEU B CB    1 
ATOM   3953 C CG    . LEU F 3 141 ? 22.426 31.984 11.889  1.00 15.00 ? 148 LEU B CG    1 
ATOM   3954 C CD1   . LEU F 3 141 ? 22.857 33.310 11.321  1.00 12.76 ? 148 LEU B CD1   1 
ATOM   3955 C CD2   . LEU F 3 141 ? 21.335 32.203 12.920  1.00 15.70 ? 148 LEU B CD2   1 
ATOM   3956 N N     . ASN F 3 142 ? 21.230 28.540 9.203   1.00 21.01 ? 149 ASN B N     1 
ATOM   3957 C CA    . ASN F 3 142 ? 20.811 27.831 7.995   1.00 22.13 ? 149 ASN B CA    1 
ATOM   3958 C C     . ASN F 3 142 ? 19.569 26.935 8.193   1.00 22.79 ? 149 ASN B C     1 
ATOM   3959 O O     . ASN F 3 142 ? 18.843 26.640 7.233   1.00 23.03 ? 149 ASN B O     1 
ATOM   3960 C CB    . ASN F 3 142 ? 21.984 27.013 7.464   1.00 22.41 ? 149 ASN B CB    1 
ATOM   3961 C CG    . ASN F 3 142 ? 23.107 27.895 6.964   1.00 24.48 ? 149 ASN B CG    1 
ATOM   3962 O OD1   . ASN F 3 142 ? 24.280 27.503 6.950   1.00 21.02 ? 149 ASN B OD1   1 
ATOM   3963 N ND2   . ASN F 3 142 ? 22.745 29.112 6.541   1.00 27.45 ? 149 ASN B ND2   1 
ATOM   3964 N N     . LEU F 3 143 ? 19.336 26.504 9.435   1.00 22.32 ? 150 LEU B N     1 
ATOM   3965 C CA    . LEU F 3 143 ? 18.175 25.680 9.760   1.00 20.62 ? 150 LEU B CA    1 
ATOM   3966 C C     . LEU F 3 143 ? 17.047 26.594 10.227  1.00 19.35 ? 150 LEU B C     1 
ATOM   3967 O O     . LEU F 3 143 ? 15.916 26.191 10.291  1.00 18.38 ? 150 LEU B O     1 
ATOM   3968 C CB    . LEU F 3 143 ? 18.486 24.681 10.876  1.00 20.60 ? 150 LEU B CB    1 
ATOM   3969 C CG    . LEU F 3 143 ? 19.717 23.778 10.867  1.00 21.03 ? 150 LEU B CG    1 
ATOM   3970 C CD1   . LEU F 3 143 ? 19.658 22.901 12.105  1.00 21.47 ? 150 LEU B CD1   1 
ATOM   3971 C CD2   . LEU F 3 143 ? 19.788 22.938 9.614   1.00 21.97 ? 150 LEU B CD2   1 
ATOM   3972 N N     . ALA F 3 144 ? 17.364 27.821 10.594  1.00 20.70 ? 151 ALA B N     1 
ATOM   3973 C CA    . ALA F 3 144 ? 16.322 28.742 11.007  1.00 24.04 ? 151 ALA B CA    1 
ATOM   3974 C C     . ALA F 3 144 ? 15.707 29.244 9.705   1.00 26.85 ? 151 ALA B C     1 
ATOM   3975 O O     . ALA F 3 144 ? 14.629 29.842 9.688   1.00 25.85 ? 151 ALA B O     1 
ATOM   3976 C CB    . ALA F 3 144 ? 16.913 29.901 11.786  1.00 22.58 ? 151 ALA B CB    1 
ATOM   3977 N N     . LYS F 3 145 ? 16.422 28.987 8.609   1.00 29.52 ? 152 LYS B N     1 
ATOM   3978 C CA    . LYS F 3 145 ? 15.991 29.398 7.281   1.00 31.17 ? 152 LYS B CA    1 
ATOM   3979 C C     . LYS F 3 145 ? 15.099 28.315 6.700   1.00 31.94 ? 152 LYS B C     1 
ATOM   3980 O O     . LYS F 3 145 ? 14.106 27.937 7.311   1.00 31.45 ? 152 LYS B O     1 
ATOM   3981 C CB    . LYS F 3 145 ? 17.201 29.593 6.374   1.00 32.23 ? 152 LYS B CB    1 
ATOM   3982 C CG    . LYS F 3 145 ? 17.155 30.849 5.527   1.00 33.80 ? 152 LYS B CG    1 
ATOM   3983 C CD    . LYS F 3 145 ? 18.024 31.935 6.145   1.00 34.43 ? 152 LYS B CD    1 
ATOM   3984 C CE    . LYS F 3 145 ? 19.445 31.420 6.335   1.00 35.13 ? 152 LYS B CE    1 
ATOM   3985 N NZ    . LYS F 3 145 ? 19.953 30.677 5.133   1.00 34.48 ? 152 LYS B NZ    1 
ATOM   3986 N N     . GLN F 3 146 ? 15.468 27.818 5.525   1.00 32.78 ? 153 GLN B N     1 
ATOM   3987 C CA    . GLN F 3 146 ? 14.706 26.770 4.856   1.00 35.08 ? 153 GLN B CA    1 
ATOM   3988 C C     . GLN F 3 146 ? 13.623 26.129 5.727   1.00 36.16 ? 153 GLN B C     1 
ATOM   3989 O O     . GLN F 3 146 ? 13.873 25.768 6.872   1.00 35.69 ? 153 GLN B O     1 
ATOM   3990 C CB    . GLN F 3 146 ? 15.657 25.700 4.298   1.00 34.43 ? 153 GLN B CB    1 
ATOM   3991 C CG    . GLN F 3 146 ? 16.828 25.302 5.201   1.00 32.12 ? 153 GLN B CG    1 
ATOM   3992 C CD    . GLN F 3 146 ? 16.555 24.041 5.989   1.00 30.64 ? 153 GLN B CD    1 
ATOM   3993 O OE1   . GLN F 3 146 ? 16.042 24.090 7.106   1.00 28.66 ? 153 GLN B OE1   1 
ATOM   3994 N NE2   . GLN F 3 146 ? 16.882 22.894 5.398   1.00 28.14 ? 153 GLN B NE2   1 
ATOM   3995 N N     . PRO F 3 147 ? 12.401 25.990 5.174   1.00 37.98 ? 154 PRO B N     1 
ATOM   3996 C CA    . PRO F 3 147 ? 11.152 25.436 5.716   1.00 39.19 ? 154 PRO B CA    1 
ATOM   3997 C C     . PRO F 3 147 ? 11.213 24.531 6.937   1.00 40.14 ? 154 PRO B C     1 
ATOM   3998 O O     . PRO F 3 147 ? 12.291 24.133 7.379   1.00 41.45 ? 154 PRO B O     1 
ATOM   3999 C CB    . PRO F 3 147 ? 10.556 24.734 4.510   1.00 38.20 ? 154 PRO B CB    1 
ATOM   4000 C CG    . PRO F 3 147 ? 10.818 25.757 3.445   1.00 39.79 ? 154 PRO B CG    1 
ATOM   4001 C CD    . PRO F 3 147 ? 12.259 26.205 3.719   1.00 38.72 ? 154 PRO B CD    1 
ATOM   4002 N N     . ASP F 3 148 ? 10.038 24.224 7.484   1.00 39.81 ? 155 ASP B N     1 
ATOM   4003 C CA    . ASP F 3 148 ? 9.937  23.345 8.642   1.00 39.49 ? 155 ASP B CA    1 
ATOM   4004 C C     . ASP F 3 148 ? 10.320 24.035 9.952   1.00 38.97 ? 155 ASP B C     1 
ATOM   4005 O O     . ASP F 3 148 ? 10.005 23.550 11.037  1.00 39.01 ? 155 ASP B O     1 
ATOM   4006 C CB    . ASP F 3 148 ? 10.813 22.100 8.424   1.00 39.81 ? 155 ASP B CB    1 
ATOM   4007 C CG    . ASP F 3 148 ? 11.896 21.949 9.482   1.00 42.57 ? 155 ASP B CG    1 
ATOM   4008 O OD1   . ASP F 3 148 ? 11.538 21.648 10.645  1.00 43.08 ? 155 ASP B OD1   1 
ATOM   4009 O OD2   . ASP F 3 148 ? 13.099 22.135 9.159   1.00 42.71 ? 155 ASP B OD2   1 
ATOM   4010 N N     . ALA F 3 149 ? 10.990 25.172 9.859   1.00 38.36 ? 156 ALA B N     1 
ATOM   4011 C CA    . ALA F 3 149 ? 11.405 25.877 11.059  1.00 38.63 ? 156 ALA B CA    1 
ATOM   4012 C C     . ALA F 3 149 ? 10.244 26.635 11.697  1.00 38.62 ? 156 ALA B C     1 
ATOM   4013 O O     . ALA F 3 149 ? 10.091 27.832 11.494  1.00 39.26 ? 156 ALA B O     1 
ATOM   4014 C CB    . ALA F 3 149 ? 12.540 26.823 10.718  1.00 38.89 ? 156 ALA B CB    1 
ATOM   4015 N N     . MET F 3 150 ? 9.438  25.941 12.491  1.00 39.74 ? 157 MET B N     1 
ATOM   4016 C CA    . MET F 3 150 ? 8.272  26.564 13.126  1.00 41.09 ? 157 MET B CA    1 
ATOM   4017 C C     . MET F 3 150 ? 8.527  27.899 13.835  1.00 40.90 ? 157 MET B C     1 
ATOM   4018 O O     . MET F 3 150 ? 9.354  27.968 14.739  1.00 41.00 ? 157 MET B O     1 
ATOM   4019 C CB    . MET F 3 150 ? 7.615  25.565 14.091  1.00 41.19 ? 157 MET B CB    1 
ATOM   4020 C CG    . MET F 3 150 ? 6.761  24.542 13.363  1.00 42.93 ? 157 MET B CG    1 
ATOM   4021 S SD    . MET F 3 150 ? 6.541  22.975 14.222  1.00 45.49 ? 157 MET B SD    1 
ATOM   4022 C CE    . MET F 3 150 ? 7.612  21.863 13.224  1.00 43.04 ? 157 MET B CE    1 
ATOM   4023 N N     . THR F 3 151 ? 7.810  28.949 13.411  1.00 40.10 ? 158 THR B N     1 
ATOM   4024 C CA    . THR F 3 151 ? 7.942  30.284 14.001  1.00 39.90 ? 158 THR B CA    1 
ATOM   4025 C C     . THR F 3 151 ? 7.626  30.211 15.476  1.00 40.51 ? 158 THR B C     1 
ATOM   4026 O O     . THR F 3 151 ? 6.849  29.353 15.912  1.00 40.47 ? 158 THR B O     1 
ATOM   4027 C CB    . THR F 3 151 ? 6.960  31.302 13.422  1.00 38.99 ? 158 THR B CB    1 
ATOM   4028 O OG1   . THR F 3 151 ? 5.626  30.862 13.695  1.00 38.38 ? 158 THR B OG1   1 
ATOM   4029 C CG2   . THR F 3 151 ? 7.179  31.486 11.926  1.00 38.54 ? 158 THR B CG2   1 
ATOM   4030 N N     . HIS F 3 152 ? 8.201  31.149 16.225  1.00 40.60 ? 159 HIS B N     1 
ATOM   4031 C CA    . HIS F 3 152 ? 8.048  31.209 17.675  1.00 41.28 ? 159 HIS B CA    1 
ATOM   4032 C C     . HIS F 3 152 ? 7.995  32.669 18.112  1.00 41.91 ? 159 HIS B C     1 
ATOM   4033 O O     . HIS F 3 152 ? 8.341  33.553 17.337  1.00 43.36 ? 159 HIS B O     1 
ATOM   4034 C CB    . HIS F 3 152 ? 9.250  30.475 18.308  1.00 40.78 ? 159 HIS B CB    1 
ATOM   4035 C CG    . HIS F 3 152 ? 9.537  30.850 19.732  1.00 39.59 ? 159 HIS B CG    1 
ATOM   4036 N ND1   . HIS F 3 152 ? 10.003 32.097 20.098  1.00 38.59 ? 159 HIS B ND1   1 
ATOM   4037 C CD2   . HIS F 3 152 ? 9.436  30.133 20.878  1.00 38.31 ? 159 HIS B CD2   1 
ATOM   4038 C CE1   . HIS F 3 152 ? 10.175 32.130 21.407  1.00 38.88 ? 159 HIS B CE1   1 
ATOM   4039 N NE2   . HIS F 3 152 ? 9.839  30.952 21.903  1.00 38.73 ? 159 HIS B NE2   1 
ATOM   4040 N N     . PRO F 3 153 ? 7.537  32.943 19.349  1.00 41.79 ? 160 PRO B N     1 
ATOM   4041 C CA    . PRO F 3 153 ? 7.468  34.320 19.835  1.00 41.78 ? 160 PRO B CA    1 
ATOM   4042 C C     . PRO F 3 153 ? 8.659  35.240 19.521  1.00 42.16 ? 160 PRO B C     1 
ATOM   4043 O O     . PRO F 3 153 ? 8.456  36.320 18.958  1.00 43.11 ? 160 PRO B O     1 
ATOM   4044 C CB    . PRO F 3 153 ? 7.254  34.129 21.330  1.00 41.09 ? 160 PRO B CB    1 
ATOM   4045 C CG    . PRO F 3 153 ? 6.303  33.000 21.358  1.00 41.20 ? 160 PRO B CG    1 
ATOM   4046 C CD    . PRO F 3 153 ? 6.862  32.038 20.301  1.00 42.20 ? 160 PRO B CD    1 
ATOM   4047 N N     . ASP F 3 154 ? 9.886  34.839 19.869  1.00 41.96 ? 161 ASP B N     1 
ATOM   4048 C CA    . ASP F 3 154 ? 11.051 35.705 19.611  1.00 41.68 ? 161 ASP B CA    1 
ATOM   4049 C C     . ASP F 3 154 ? 12.051 35.196 18.562  1.00 41.89 ? 161 ASP B C     1 
ATOM   4050 O O     . ASP F 3 154 ? 13.261 35.455 18.655  1.00 41.50 ? 161 ASP B O     1 
ATOM   4051 C CB    . ASP F 3 154 ? 11.779 36.013 20.930  1.00 41.07 ? 161 ASP B CB    1 
ATOM   4052 C CG    . ASP F 3 154 ? 12.056 34.766 21.753  1.00 42.47 ? 161 ASP B CG    1 
ATOM   4053 O OD1   . ASP F 3 154 ? 12.630 33.817 21.180  1.00 42.13 ? 161 ASP B OD1   1 
ATOM   4054 O OD2   . ASP F 3 154 ? 11.713 34.736 22.965  1.00 40.90 ? 161 ASP B OD2   1 
ATOM   4055 N N     . GLY F 3 155 ? 11.526 34.489 17.557  1.00 41.50 ? 162 GLY B N     1 
ATOM   4056 C CA    . GLY F 3 155 ? 12.351 33.951 16.486  1.00 39.79 ? 162 GLY B CA    1 
ATOM   4057 C C     . GLY F 3 155 ? 11.827 32.652 15.890  1.00 39.10 ? 162 GLY B C     1 
ATOM   4058 O O     . GLY F 3 155 ? 10.638 32.333 15.981  1.00 39.66 ? 162 GLY B O     1 
ATOM   4059 N N     . MET F 3 156 ? 12.720 31.893 15.264  1.00 37.03 ? 163 MET B N     1 
ATOM   4060 C CA    . MET F 3 156 ? 12.338 30.628 14.665  1.00 34.96 ? 163 MET B CA    1 
ATOM   4061 C C     . MET F 3 156 ? 12.691 29.494 15.622  1.00 33.66 ? 163 MET B C     1 
ATOM   4062 O O     . MET F 3 156 ? 13.568 29.635 16.470  1.00 35.01 ? 163 MET B O     1 
ATOM   4063 C CB    . MET F 3 156 ? 13.055 30.459 13.332  1.00 34.88 ? 163 MET B CB    1 
ATOM   4064 C CG    . MET F 3 156 ? 12.918 31.679 12.436  1.00 36.68 ? 163 MET B CG    1 
ATOM   4065 S SD    . MET F 3 156 ? 11.211 32.025 11.856  1.00 39.69 ? 163 MET B SD    1 
ATOM   4066 C CE    . MET F 3 156 ? 10.561 33.148 13.162  1.00 37.64 ? 163 MET B CE    1 
ATOM   4067 N N     . GLN F 3 157 ? 11.999 28.371 15.468  1.00 31.63 ? 164 GLN B N     1 
ATOM   4068 C CA    . GLN F 3 157 ? 12.177 27.182 16.299  1.00 28.25 ? 164 GLN B CA    1 
ATOM   4069 C C     . GLN F 3 157 ? 12.692 26.002 15.453  1.00 25.12 ? 164 GLN B C     1 
ATOM   4070 O O     . GLN F 3 157 ? 12.247 25.784 14.334  1.00 24.97 ? 164 GLN B O     1 
ATOM   4071 C CB    . GLN F 3 157 ? 10.821 26.854 16.932  1.00 29.32 ? 164 GLN B CB    1 
ATOM   4072 C CG    . GLN F 3 157 ? 10.718 25.594 17.762  1.00 31.16 ? 164 GLN B CG    1 
ATOM   4073 C CD    . GLN F 3 157 ? 9.292  25.387 18.302  1.00 31.53 ? 164 GLN B CD    1 
ATOM   4074 O OE1   . GLN F 3 157 ? 9.075  24.638 19.261  1.00 32.02 ? 164 GLN B OE1   1 
ATOM   4075 N NE2   . GLN F 3 157 ? 8.319  26.050 17.678  1.00 30.87 ? 164 GLN B NE2   1 
ATOM   4076 N N     . ILE F 3 158 ? 13.644 25.246 15.979  1.00 21.37 ? 165 ILE B N     1 
ATOM   4077 C CA    . ILE F 3 158 ? 14.180 24.111 15.241  1.00 17.17 ? 165 ILE B CA    1 
ATOM   4078 C C     . ILE F 3 158 ? 13.764 22.856 15.968  1.00 17.02 ? 165 ILE B C     1 
ATOM   4079 O O     . ILE F 3 158 ? 13.206 22.921 17.066  1.00 14.70 ? 165 ILE B O     1 
ATOM   4080 C CB    . ILE F 3 158 ? 15.744 24.113 15.178  1.00 13.39 ? 165 ILE B CB    1 
ATOM   4081 C CG1   . ILE F 3 158 ? 16.259 25.327 14.448  1.00 11.87 ? 165 ILE B CG1   1 
ATOM   4082 C CG2   . ILE F 3 158 ? 16.228 22.959 14.376  1.00 12.01 ? 165 ILE B CG2   1 
ATOM   4083 C CD1   . ILE F 3 158 ? 15.788 25.389 13.038  1.00 15.63 ? 165 ILE B CD1   1 
ATOM   4084 N N     . LYS F 3 159 ? 14.040 21.723 15.329  1.00 18.63 ? 166 LYS B N     1 
ATOM   4085 C CA    . LYS F 3 159 ? 13.774 20.405 15.885  1.00 21.43 ? 166 LYS B CA    1 
ATOM   4086 C C     . LYS F 3 159 ? 14.945 19.556 15.414  1.00 20.20 ? 166 LYS B C     1 
ATOM   4087 O O     . LYS F 3 159 ? 14.912 18.991 14.330  1.00 21.43 ? 166 LYS B O     1 
ATOM   4088 C CB    . LYS F 3 159 ? 12.451 19.840 15.358  1.00 23.73 ? 166 LYS B CB    1 
ATOM   4089 C CG    . LYS F 3 159 ? 11.525 19.315 16.459  1.00 27.30 ? 166 LYS B CG    1 
ATOM   4090 C CD    . LYS F 3 159 ? 12.155 18.152 17.231  1.00 30.31 ? 166 LYS B CD    1 
ATOM   4091 C CE    . LYS F 3 159 ? 11.144 17.518 18.181  1.00 31.36 ? 166 LYS B CE    1 
ATOM   4092 N NZ    . LYS F 3 159 ? 9.961  16.952 17.435  1.00 33.08 ? 166 LYS B NZ    1 
ATOM   4093 N N     . ILE F 3 160 ? 15.983 19.467 16.233  1.00 19.35 ? 167 ILE B N     1 
ATOM   4094 C CA    . ILE F 3 160 ? 17.167 18.722 15.831  1.00 18.13 ? 167 ILE B CA    1 
ATOM   4095 C C     . ILE F 3 160 ? 17.935 18.190 17.049  1.00 18.18 ? 167 ILE B C     1 
ATOM   4096 O O     . ILE F 3 160 ? 17.954 18.813 18.102  1.00 17.70 ? 167 ILE B O     1 
ATOM   4097 C CB    . ILE F 3 160 ? 18.055 19.657 14.979  1.00 16.70 ? 167 ILE B CB    1 
ATOM   4098 C CG1   . ILE F 3 160 ? 19.059 18.858 14.166  1.00 16.53 ? 167 ILE B CG1   1 
ATOM   4099 C CG2   . ILE F 3 160 ? 18.740 20.666 15.872  1.00 15.67 ? 167 ILE B CG2   1 
ATOM   4100 C CD1   . ILE F 3 160 ? 19.416 19.530 12.858  1.00 15.48 ? 167 ILE B CD1   1 
ATOM   4101 N N     . THR F 3 161 ? 18.557 17.027 16.914  1.00 18.03 ? 168 THR B N     1 
ATOM   4102 C CA    . THR F 3 161 ? 19.300 16.460 18.024  1.00 17.44 ? 168 THR B CA    1 
ATOM   4103 C C     . THR F 3 161 ? 20.695 16.963 17.952  1.00 17.31 ? 168 THR B C     1 
ATOM   4104 O O     . THR F 3 161 ? 21.238 17.106 16.879  1.00 17.97 ? 168 THR B O     1 
ATOM   4105 C CB    . THR F 3 161 ? 19.369 14.943 17.971  1.00 18.71 ? 168 THR B CB    1 
ATOM   4106 O OG1   . THR F 3 161 ? 19.978 14.531 16.739  1.00 17.51 ? 168 THR B OG1   1 
ATOM   4107 C CG2   . THR F 3 161 ? 17.984 14.354 18.094  1.00 17.58 ? 168 THR B CG2   1 
ATOM   4108 N N     . ARG F 3 162 ? 21.259 17.243 19.117  1.00 18.76 ? 169 ARG B N     1 
ATOM   4109 C CA    . ARG F 3 162 ? 22.621 17.744 19.264  1.00 18.28 ? 169 ARG B CA    1 
ATOM   4110 C C     . ARG F 3 162 ? 23.537 16.751 18.565  1.00 18.75 ? 169 ARG B C     1 
ATOM   4111 O O     . ARG F 3 162 ? 24.488 17.124 17.863  1.00 19.04 ? 169 ARG B O     1 
ATOM   4112 C CB    . ARG F 3 162 ? 22.964 17.858 20.764  1.00 16.85 ? 169 ARG B CB    1 
ATOM   4113 C CG    . ARG F 3 162 ? 22.088 18.875 21.530  1.00 15.03 ? 169 ARG B CG    1 
ATOM   4114 C CD    . ARG F 3 162 ? 22.173 18.712 23.044  1.00 12.84 ? 169 ARG B CD    1 
ATOM   4115 N NE    . ARG F 3 162 ? 21.487 19.769 23.794  1.00 12.01 ? 169 ARG B NE    1 
ATOM   4116 C CZ    . ARG F 3 162 ? 20.176 20.044 23.725  1.00 12.80 ? 169 ARG B CZ    1 
ATOM   4117 N NH1   . ARG F 3 162 ? 19.379 19.349 22.923  1.00 9.14  ? 169 ARG B NH1   1 
ATOM   4118 N NH2   . ARG F 3 162 ? 19.650 21.008 24.489  1.00 10.31 ? 169 ARG B NH2   1 
ATOM   4119 N N     . GLN F 3 163 ? 23.219 15.480 18.758  1.00 16.51 ? 170 GLN B N     1 
ATOM   4120 C CA    . GLN F 3 163 ? 23.960 14.389 18.157  1.00 16.81 ? 170 GLN B CA    1 
ATOM   4121 C C     . GLN F 3 163 ? 23.999 14.566 16.642  1.00 16.85 ? 170 GLN B C     1 
ATOM   4122 O O     . GLN F 3 163 ? 24.978 14.201 15.976  1.00 17.82 ? 170 GLN B O     1 
ATOM   4123 C CB    . GLN F 3 163 ? 23.251 13.093 18.516  1.00 17.23 ? 170 GLN B CB    1 
ATOM   4124 C CG    . GLN F 3 163 ? 23.809 11.837 17.940  1.00 16.89 ? 170 GLN B CG    1 
ATOM   4125 C CD    . GLN F 3 163 ? 23.369 10.636 18.767  1.00 20.14 ? 170 GLN B CD    1 
ATOM   4126 O OE1   . GLN F 3 163 ? 24.039 10.281 19.756  1.00 19.50 ? 170 GLN B OE1   1 
ATOM   4127 N NE2   . GLN F 3 163 ? 22.226 10.016 18.390  1.00 14.44 ? 170 GLN B NE2   1 
ATOM   4128 N N     . GLU F 3 164 ? 22.911 15.134 16.132  1.00 14.83 ? 171 GLU B N     1 
ATOM   4129 C CA    . GLU F 3 164 ? 22.678 15.396 14.724  1.00 14.09 ? 171 GLU B CA    1 
ATOM   4130 C C     . GLU F 3 164 ? 23.414 16.647 14.229  1.00 14.38 ? 171 GLU B C     1 
ATOM   4131 O O     . GLU F 3 164 ? 23.940 16.674 13.111  1.00 12.88 ? 171 GLU B O     1 
ATOM   4132 C CB    . GLU F 3 164 ? 21.167 15.546 14.524  1.00 15.63 ? 171 GLU B CB    1 
ATOM   4133 C CG    . GLU F 3 164 ? 20.737 16.110 13.202  1.00 17.87 ? 171 GLU B CG    1 
ATOM   4134 C CD    . GLU F 3 164 ? 20.105 15.068 12.324  1.00 19.94 ? 171 GLU B CD    1 
ATOM   4135 O OE1   . GLU F 3 164 ? 19.887 15.347 11.121  1.00 21.86 ? 171 GLU B OE1   1 
ATOM   4136 O OE2   . GLU F 3 164 ? 19.819 13.975 12.845  1.00 19.25 ? 171 GLU B OE2   1 
ATOM   4137 N N     . ILE F 3 165 ? 23.427 17.693 15.052  1.00 14.80 ? 172 ILE B N     1 
ATOM   4138 C CA    . ILE F 3 165 ? 24.123 18.919 14.689  1.00 15.05 ? 172 ILE B CA    1 
ATOM   4139 C C     . ILE F 3 165 ? 25.546 18.465 14.383  1.00 15.37 ? 172 ILE B C     1 
ATOM   4140 O O     . ILE F 3 165 ? 26.105 18.753 13.323  1.00 14.82 ? 172 ILE B O     1 
ATOM   4141 C CB    . ILE F 3 165 ? 24.188 19.941 15.886  1.00 15.47 ? 172 ILE B CB    1 
ATOM   4142 C CG1   . ILE F 3 165 ? 22.792 20.467 16.230  1.00 14.44 ? 172 ILE B CG1   1 
ATOM   4143 C CG2   . ILE F 3 165 ? 25.118 21.116 15.541  1.00 11.78 ? 172 ILE B CG2   1 
ATOM   4144 C CD1   . ILE F 3 165 ? 22.815 21.623 17.242  1.00 14.41 ? 172 ILE B CD1   1 
ATOM   4145 N N     . GLY F 3 166 ? 26.096 17.724 15.339  1.00 14.49 ? 173 GLY B N     1 
ATOM   4146 C CA    . GLY F 3 166 ? 27.443 17.228 15.234  1.00 14.40 ? 173 GLY B CA    1 
ATOM   4147 C C     . GLY F 3 166 ? 27.780 16.705 13.874  1.00 14.76 ? 173 GLY B C     1 
ATOM   4148 O O     . GLY F 3 166 ? 28.902 16.882 13.404  1.00 14.91 ? 173 GLY B O     1 
ATOM   4149 N N     . GLN F 3 167 ? 26.811 16.065 13.235  1.00 15.05 ? 174 GLN B N     1 
ATOM   4150 C CA    . GLN F 3 167 ? 27.051 15.500 11.924  1.00 16.84 ? 174 GLN B CA    1 
ATOM   4151 C C     . GLN F 3 167 ? 27.152 16.534 10.805  1.00 18.77 ? 174 GLN B C     1 
ATOM   4152 O O     . GLN F 3 167 ? 28.038 16.427 9.960   1.00 18.63 ? 174 GLN B O     1 
ATOM   4153 C CB    . GLN F 3 167 ? 25.976 14.482 11.593  1.00 17.39 ? 174 GLN B CB    1 
ATOM   4154 C CG    . GLN F 3 167 ? 26.101 13.173 12.352  1.00 15.71 ? 174 GLN B CG    1 
ATOM   4155 C CD    . GLN F 3 167 ? 25.162 12.109 11.825  1.00 13.94 ? 174 GLN B CD    1 
ATOM   4156 O OE1   . GLN F 3 167 ? 25.162 10.983 12.293  1.00 13.03 ? 174 GLN B OE1   1 
ATOM   4157 N NE2   . GLN F 3 167 ? 24.355 12.470 10.843  1.00 14.19 ? 174 GLN B NE2   1 
ATOM   4158 N N     . ILE F 3 168 ? 26.253 17.523 10.795  1.00 19.83 ? 175 ILE B N     1 
ATOM   4159 C CA    . ILE F 3 168 ? 26.271 18.567 9.764   1.00 20.25 ? 175 ILE B CA    1 
ATOM   4160 C C     . ILE F 3 168 ? 27.597 19.316 9.870   1.00 21.23 ? 175 ILE B C     1 
ATOM   4161 O O     . ILE F 3 168 ? 28.296 19.553 8.877   1.00 20.19 ? 175 ILE B O     1 
ATOM   4162 C CB    . ILE F 3 168 ? 25.119 19.588 9.954   1.00 19.84 ? 175 ILE B CB    1 
ATOM   4163 C CG1   . ILE F 3 168 ? 23.763 18.914 9.792   1.00 20.29 ? 175 ILE B CG1   1 
ATOM   4164 C CG2   . ILE F 3 168 ? 25.216 20.683 8.906   1.00 19.62 ? 175 ILE B CG2   1 
ATOM   4165 C CD1   . ILE F 3 168 ? 22.584 19.883 9.921   1.00 21.57 ? 175 ILE B CD1   1 
ATOM   4166 N N     . VAL F 3 169 ? 27.906 19.684 11.106  1.00 22.33 ? 176 VAL B N     1 
ATOM   4167 C CA    . VAL F 3 169 ? 29.116 20.384 11.489  1.00 23.56 ? 176 VAL B CA    1 
ATOM   4168 C C     . VAL F 3 169 ? 30.342 19.521 11.199  1.00 23.88 ? 176 VAL B C     1 
ATOM   4169 O O     . VAL F 3 169 ? 31.007 19.667 10.169  1.00 25.50 ? 176 VAL B O     1 
ATOM   4170 C CB    . VAL F 3 169 ? 29.116 20.640 12.994  1.00 24.00 ? 176 VAL B CB    1 
ATOM   4171 C CG1   . VAL F 3 169 ? 30.237 21.595 13.359  1.00 26.50 ? 176 VAL B CG1   1 
ATOM   4172 C CG2   . VAL F 3 169 ? 27.764 21.124 13.428  1.00 23.46 ? 176 VAL B CG2   1 
ATOM   4173 N N     . GLY F 3 170 ? 30.625 18.623 12.138  1.00 22.97 ? 177 GLY B N     1 
ATOM   4174 C CA    . GLY F 3 170 ? 31.756 17.729 12.024  1.00 20.43 ? 177 GLY B CA    1 
ATOM   4175 C C     . GLY F 3 170 ? 32.303 17.356 13.385  1.00 20.05 ? 177 GLY B C     1 
ATOM   4176 O O     . GLY F 3 170 ? 33.220 16.558 13.458  1.00 19.25 ? 177 GLY B O     1 
ATOM   4177 N N     . CYS F 3 171 ? 31.749 17.921 14.462  1.00 19.71 ? 178 CYS B N     1 
ATOM   4178 C CA    . CYS F 3 171 ? 32.214 17.615 15.814  1.00 18.88 ? 178 CYS B CA    1 
ATOM   4179 C C     . CYS F 3 171 ? 31.512 16.431 16.451  1.00 19.27 ? 178 CYS B C     1 
ATOM   4180 O O     . CYS F 3 171 ? 30.741 15.734 15.786  1.00 20.18 ? 178 CYS B O     1 
ATOM   4181 C CB    . CYS F 3 171 ? 32.089 18.833 16.733  1.00 20.57 ? 178 CYS B CB    1 
ATOM   4182 S SG    . CYS F 3 171 ? 30.572 19.798 16.661  1.00 20.24 ? 178 CYS B SG    1 
ATOM   4183 N N     . SER F 3 172 ? 31.779 16.215 17.741  1.00 17.91 ? 179 SER B N     1 
ATOM   4184 C CA    . SER F 3 172 ? 31.203 15.096 18.489  1.00 17.73 ? 179 SER B CA    1 
ATOM   4185 C C     . SER F 3 172 ? 29.948 15.434 19.278  1.00 19.48 ? 179 SER B C     1 
ATOM   4186 O O     . SER F 3 172 ? 29.673 16.588 19.592  1.00 21.38 ? 179 SER B O     1 
ATOM   4187 C CB    . SER F 3 172 ? 32.224 14.520 19.467  1.00 14.76 ? 179 SER B CB    1 
ATOM   4188 O OG    . SER F 3 172 ? 32.578 15.458 20.466  1.00 12.77 ? 179 SER B OG    1 
ATOM   4189 N N     . ARG F 3 173 ? 29.201 14.395 19.616  1.00 19.02 ? 180 ARG B N     1 
ATOM   4190 C CA    . ARG F 3 173 ? 27.982 14.539 20.383  1.00 17.53 ? 180 ARG B CA    1 
ATOM   4191 C C     . ARG F 3 173 ? 28.210 15.517 21.527  1.00 16.46 ? 180 ARG B C     1 
ATOM   4192 O O     . ARG F 3 173 ? 27.499 16.493 21.656  1.00 17.83 ? 180 ARG B O     1 
ATOM   4193 C CB    . ARG F 3 173 ? 27.585 13.168 20.951  1.00 17.88 ? 180 ARG B CB    1 
ATOM   4194 C CG    . ARG F 3 173 ? 26.090 12.924 21.213  1.00 16.66 ? 180 ARG B CG    1 
ATOM   4195 C CD    . ARG F 3 173 ? 25.917 11.591 21.955  1.00 16.13 ? 180 ARG B CD    1 
ATOM   4196 N NE    . ARG F 3 173 ? 26.166 11.766 23.385  1.00 16.54 ? 180 ARG B NE    1 
ATOM   4197 C CZ    . ARG F 3 173 ? 26.723 10.865 24.188  1.00 16.54 ? 180 ARG B CZ    1 
ATOM   4198 N NH1   . ARG F 3 173 ? 27.121 9.681  23.727  1.00 15.46 ? 180 ARG B NH1   1 
ATOM   4199 N NH2   . ARG F 3 173 ? 26.875 11.158 25.469  1.00 15.06 ? 180 ARG B NH2   1 
ATOM   4200 N N     . GLU F 3 174 ? 29.210 15.241 22.349  1.00 15.78 ? 181 GLU B N     1 
ATOM   4201 C CA    . GLU F 3 174 ? 29.531 16.041 23.531  1.00 16.08 ? 181 GLU B CA    1 
ATOM   4202 C C     . GLU F 3 174 ? 30.456 17.225 23.343  1.00 16.59 ? 181 GLU B C     1 
ATOM   4203 O O     . GLU F 3 174 ? 31.600 17.232 23.836  1.00 17.64 ? 181 GLU B O     1 
ATOM   4204 C CB    . GLU F 3 174 ? 30.154 15.139 24.565  1.00 16.94 ? 181 GLU B CB    1 
ATOM   4205 C CG    . GLU F 3 174 ? 31.100 14.157 23.965  1.00 16.68 ? 181 GLU B CG    1 
ATOM   4206 C CD    . GLU F 3 174 ? 30.718 12.798 24.393  1.00 18.88 ? 181 GLU B CD    1 
ATOM   4207 O OE1   . GLU F 3 174 ? 30.425 12.687 25.602  1.00 21.07 ? 181 GLU B OE1   1 
ATOM   4208 O OE2   . GLU F 3 174 ? 30.697 11.861 23.560  1.00 19.13 ? 181 GLU B OE2   1 
ATOM   4209 N N     . THR F 3 175 ? 29.949 18.231 22.653  1.00 14.27 ? 182 THR B N     1 
ATOM   4210 C CA    . THR F 3 175 ? 30.683 19.444 22.354  1.00 11.11 ? 182 THR B CA    1 
ATOM   4211 C C     . THR F 3 175 ? 29.503 20.206 21.775  1.00 11.98 ? 182 THR B C     1 
ATOM   4212 O O     . THR F 3 175 ? 29.151 21.280 22.251  1.00 13.11 ? 182 THR B O     1 
ATOM   4213 C CB    . THR F 3 175 ? 31.799 19.198 21.279  1.00 8.31  ? 182 THR B CB    1 
ATOM   4214 O OG1   . THR F 3 175 ? 32.621 18.099 21.669  1.00 3.88  ? 182 THR B OG1   1 
ATOM   4215 C CG2   . THR F 3 175 ? 32.696 20.394 21.159  1.00 7.72  ? 182 THR B CG2   1 
ATOM   4216 N N     . VAL F 3 176 ? 28.871 19.626 20.764  1.00 9.83  ? 183 VAL B N     1 
ATOM   4217 C CA    . VAL F 3 176 ? 27.695 20.238 20.193  1.00 9.36  ? 183 VAL B CA    1 
ATOM   4218 C C     . VAL F 3 176 ? 26.867 20.679 21.382  1.00 12.43 ? 183 VAL B C     1 
ATOM   4219 O O     . VAL F 3 176 ? 26.597 21.856 21.541  1.00 15.48 ? 183 VAL B O     1 
ATOM   4220 C CB    . VAL F 3 176 ? 26.888 19.234 19.369  1.00 8.01  ? 183 VAL B CB    1 
ATOM   4221 C CG1   . VAL F 3 176 ? 25.447 19.694 19.247  1.00 6.13  ? 183 VAL B CG1   1 
ATOM   4222 C CG2   . VAL F 3 176 ? 27.523 19.080 17.997  1.00 4.00  ? 183 VAL B CG2   1 
ATOM   4223 N N     . GLY F 3 177 ? 26.504 19.731 22.241  1.00 13.38 ? 184 GLY B N     1 
ATOM   4224 C CA    . GLY F 3 177 ? 25.707 20.044 23.414  1.00 14.46 ? 184 GLY B CA    1 
ATOM   4225 C C     . GLY F 3 177 ? 26.390 20.887 24.477  1.00 16.52 ? 184 GLY B C     1 
ATOM   4226 O O     . GLY F 3 177 ? 25.732 21.609 25.237  1.00 16.47 ? 184 GLY B O     1 
ATOM   4227 N N     . ARG F 3 178 ? 27.708 20.788 24.564  1.00 17.30 ? 185 ARG B N     1 
ATOM   4228 C CA    . ARG F 3 178 ? 28.430 21.586 25.541  1.00 18.76 ? 185 ARG B CA    1 
ATOM   4229 C C     . ARG F 3 178 ? 28.493 23.023 25.023  1.00 18.70 ? 185 ARG B C     1 
ATOM   4230 O O     . ARG F 3 178 ? 28.580 23.958 25.809  1.00 19.75 ? 185 ARG B O     1 
ATOM   4231 C CB    . ARG F 3 178 ? 29.828 21.009 25.747  1.00 21.07 ? 185 ARG B CB    1 
ATOM   4232 C CG    . ARG F 3 178 ? 30.831 21.907 26.449  1.00 22.33 ? 185 ARG B CG    1 
ATOM   4233 C CD    . ARG F 3 178 ? 32.192 21.187 26.538  1.00 24.28 ? 185 ARG B CD    1 
ATOM   4234 N NE    . ARG F 3 178 ? 32.157 19.984 27.381  1.00 25.71 ? 185 ARG B NE    1 
ATOM   4235 C CZ    . ARG F 3 178 ? 32.521 18.757 26.993  1.00 25.98 ? 185 ARG B CZ    1 
ATOM   4236 N NH1   . ARG F 3 178 ? 32.959 18.523 25.760  1.00 25.32 ? 185 ARG B NH1   1 
ATOM   4237 N NH2   . ARG F 3 178 ? 32.447 17.750 27.849  1.00 26.78 ? 185 ARG B NH2   1 
ATOM   4238 N N     . ILE F 3 179 ? 28.437 23.184 23.695  1.00 18.15 ? 186 ILE B N     1 
ATOM   4239 C CA    . ILE F 3 179 ? 28.463 24.505 23.023  1.00 15.51 ? 186 ILE B CA    1 
ATOM   4240 C C     . ILE F 3 179 ? 27.077 25.160 23.182  1.00 13.65 ? 186 ILE B C     1 
ATOM   4241 O O     . ILE F 3 179 ? 26.976 26.311 23.598  1.00 11.93 ? 186 ILE B O     1 
ATOM   4242 C CB    . ILE F 3 179 ? 28.791 24.365 21.486  1.00 15.53 ? 186 ILE B CB    1 
ATOM   4243 C CG1   . ILE F 3 179 ? 30.110 23.609 21.282  1.00 15.38 ? 186 ILE B CG1   1 
ATOM   4244 C CG2   . ILE F 3 179 ? 28.848 25.723 20.811  1.00 13.55 ? 186 ILE B CG2   1 
ATOM   4245 C CD1   . ILE F 3 179 ? 31.317 24.230 21.927  1.00 15.75 ? 186 ILE B CD1   1 
ATOM   4246 N N     . LEU F 3 180 ? 26.024 24.407 22.848  1.00 12.32 ? 187 LEU B N     1 
ATOM   4247 C CA    . LEU F 3 180 ? 24.643 24.865 22.962  1.00 11.61 ? 187 LEU B CA    1 
ATOM   4248 C C     . LEU F 3 180 ? 24.359 25.442 24.342  1.00 14.92 ? 187 LEU B C     1 
ATOM   4249 O O     . LEU F 3 180 ? 23.654 26.442 24.457  1.00 15.52 ? 187 LEU B O     1 
ATOM   4250 C CB    . LEU F 3 180 ? 23.687 23.721 22.722  1.00 7.26  ? 187 LEU B CB    1 
ATOM   4251 C CG    . LEU F 3 180 ? 23.122 23.483 21.347  1.00 4.50  ? 187 LEU B CG    1 
ATOM   4252 C CD1   . LEU F 3 180 ? 23.897 24.191 20.291  1.00 4.46  ? 187 LEU B CD1   1 
ATOM   4253 C CD2   . LEU F 3 180 ? 23.134 22.031 21.125  1.00 3.33  ? 187 LEU B CD2   1 
ATOM   4254 N N     . LYS F 3 181 ? 24.891 24.811 25.392  1.00 17.65 ? 188 LYS B N     1 
ATOM   4255 C CA    . LYS F 3 181 ? 24.700 25.330 26.746  1.00 20.39 ? 188 LYS B CA    1 
ATOM   4256 C C     . LYS F 3 181 ? 25.383 26.700 26.824  1.00 21.77 ? 188 LYS B C     1 
ATOM   4257 O O     . LYS F 3 181 ? 24.822 27.664 27.352  1.00 21.96 ? 188 LYS B O     1 
ATOM   4258 C CB    . LYS F 3 181 ? 25.319 24.397 27.780  1.00 20.05 ? 188 LYS B CB    1 
ATOM   4259 C CG    . LYS F 3 181 ? 24.327 23.537 28.576  1.00 24.10 ? 188 LYS B CG    1 
ATOM   4260 C CD    . LYS F 3 181 ? 23.698 24.249 29.797  1.00 25.40 ? 188 LYS B CD    1 
ATOM   4261 C CE    . LYS F 3 181 ? 23.037 23.239 30.778  1.00 26.19 ? 188 LYS B CE    1 
ATOM   4262 N NZ    . LYS F 3 181 ? 22.242 22.140 30.106  1.00 25.09 ? 188 LYS B NZ    1 
ATOM   4263 N N     . MET F 3 182 ? 26.598 26.783 26.291  1.00 22.89 ? 189 MET B N     1 
ATOM   4264 C CA    . MET F 3 182 ? 27.321 28.037 26.309  1.00 24.05 ? 189 MET B CA    1 
ATOM   4265 C C     . MET F 3 182 ? 26.483 29.092 25.603  1.00 23.65 ? 189 MET B C     1 
ATOM   4266 O O     . MET F 3 182 ? 26.264 30.187 26.126  1.00 24.08 ? 189 MET B O     1 
ATOM   4267 C CB    . MET F 3 182 ? 28.674 27.885 25.634  1.00 25.89 ? 189 MET B CB    1 
ATOM   4268 C CG    . MET F 3 182 ? 29.366 29.208 25.411  1.00 30.67 ? 189 MET B CG    1 
ATOM   4269 S SD    . MET F 3 182 ? 31.008 29.045 24.666  1.00 37.42 ? 189 MET B SD    1 
ATOM   4270 C CE    . MET F 3 182 ? 32.093 29.689 26.097  1.00 33.94 ? 189 MET B CE    1 
ATOM   4271 N N     . LEU F 3 183 ? 26.011 28.760 24.409  1.00 22.28 ? 190 LEU B N     1 
ATOM   4272 C CA    . LEU F 3 183 ? 25.171 29.682 23.672  1.00 19.62 ? 190 LEU B CA    1 
ATOM   4273 C C     . LEU F 3 183 ? 23.924 29.957 24.507  1.00 18.09 ? 190 LEU B C     1 
ATOM   4274 O O     . LEU F 3 183 ? 23.487 31.096 24.603  1.00 18.02 ? 190 LEU B O     1 
ATOM   4275 C CB    . LEU F 3 183 ? 24.798 29.082 22.318  1.00 17.69 ? 190 LEU B CB    1 
ATOM   4276 C CG    . LEU F 3 183 ? 25.929 29.069 21.288  1.00 14.62 ? 190 LEU B CG    1 
ATOM   4277 C CD1   . LEU F 3 183 ? 25.483 28.321 20.052  1.00 14.26 ? 190 LEU B CD1   1 
ATOM   4278 C CD2   . LEU F 3 183 ? 26.309 30.493 20.926  1.00 13.57 ? 190 LEU B CD2   1 
ATOM   4279 N N     . GLU F 3 184 ? 23.368 28.908 25.112  1.00 16.77 ? 191 GLU B N     1 
ATOM   4280 C CA    . GLU F 3 184 ? 22.168 28.998 25.971  1.00 16.14 ? 191 GLU B CA    1 
ATOM   4281 C C     . GLU F 3 184 ? 22.374 30.070 27.027  1.00 16.45 ? 191 GLU B C     1 
ATOM   4282 O O     . GLU F 3 184 ? 21.666 31.068 27.081  1.00 15.08 ? 191 GLU B O     1 
ATOM   4283 C CB    . GLU F 3 184 ? 21.924 27.635 26.660  1.00 14.64 ? 191 GLU B CB    1 
ATOM   4284 C CG    . GLU F 3 184 ? 20.932 27.572 27.849  1.00 11.43 ? 191 GLU B CG    1 
ATOM   4285 C CD    . GLU F 3 184 ? 19.472 27.756 27.454  1.00 10.36 ? 191 GLU B CD    1 
ATOM   4286 O OE1   . GLU F 3 184 ? 19.090 28.912 27.162  1.00 6.98  ? 191 GLU B OE1   1 
ATOM   4287 O OE2   . GLU F 3 184 ? 18.716 26.743 27.438  1.00 8.91  ? 191 GLU B OE2   1 
ATOM   4288 N N     . ASP F 3 185 ? 23.365 29.815 27.872  1.00 19.34 ? 192 ASP B N     1 
ATOM   4289 C CA    . ASP F 3 185 ? 23.775 30.691 28.949  1.00 19.16 ? 192 ASP B CA    1 
ATOM   4290 C C     . ASP F 3 185 ? 23.940 32.113 28.450  1.00 17.68 ? 192 ASP B C     1 
ATOM   4291 O O     . ASP F 3 185 ? 23.445 33.025 29.067  1.00 17.90 ? 192 ASP B O     1 
ATOM   4292 C CB    . ASP F 3 185 ? 25.096 30.171 29.515  1.00 22.88 ? 192 ASP B CB    1 
ATOM   4293 C CG    . ASP F 3 185 ? 25.529 30.903 30.769  1.00 26.65 ? 192 ASP B CG    1 
ATOM   4294 O OD1   . ASP F 3 185 ? 24.708 30.993 31.718  1.00 29.38 ? 192 ASP B OD1   1 
ATOM   4295 O OD2   . ASP F 3 185 ? 26.691 31.372 30.812  1.00 25.33 ? 192 ASP B OD2   1 
ATOM   4296 N N     . GLN F 3 186 ? 24.638 32.293 27.333  1.00 18.08 ? 193 GLN B N     1 
ATOM   4297 C CA    . GLN F 3 186 ? 24.871 33.617 26.747  1.00 18.72 ? 193 GLN B CA    1 
ATOM   4298 C C     . GLN F 3 186 ? 23.615 34.374 26.357  1.00 18.89 ? 193 GLN B C     1 
ATOM   4299 O O     . GLN F 3 186 ? 23.596 35.608 26.413  1.00 21.62 ? 193 GLN B O     1 
ATOM   4300 C CB    . GLN F 3 186 ? 25.756 33.525 25.500  1.00 19.67 ? 193 GLN B CB    1 
ATOM   4301 C CG    . GLN F 3 186 ? 27.210 33.854 25.718  1.00 23.14 ? 193 GLN B CG    1 
ATOM   4302 C CD    . GLN F 3 186 ? 27.991 33.973 24.401  1.00 25.67 ? 193 GLN B CD    1 
ATOM   4303 O OE1   . GLN F 3 186 ? 27.921 33.099 23.543  1.00 26.62 ? 193 GLN B OE1   1 
ATOM   4304 N NE2   . GLN F 3 186 ? 28.745 35.055 24.251  1.00 25.45 ? 193 GLN B NE2   1 
ATOM   4305 N N     . ASN F 3 187 ? 22.588 33.635 25.941  1.00 17.76 ? 194 ASN B N     1 
ATOM   4306 C CA    . ASN F 3 187 ? 21.290 34.165 25.503  1.00 15.79 ? 194 ASN B CA    1 
ATOM   4307 C C     . ASN F 3 187 ? 21.167 34.357 24.018  1.00 15.40 ? 194 ASN B C     1 
ATOM   4308 O O     . ASN F 3 187 ? 20.444 35.231 23.543  1.00 14.61 ? 194 ASN B O     1 
ATOM   4309 C CB    . ASN F 3 187 ? 20.932 35.465 26.181  1.00 16.32 ? 194 ASN B CB    1 
ATOM   4310 C CG    . ASN F 3 187 ? 20.164 35.239 27.413  1.00 20.25 ? 194 ASN B CG    1 
ATOM   4311 O OD1   . ASN F 3 187 ? 20.605 34.486 28.278  1.00 21.71 ? 194 ASN B OD1   1 
ATOM   4312 N ND2   . ASN F 3 187 ? 18.990 35.870 27.523  1.00 21.29 ? 194 ASN B ND2   1 
ATOM   4313 N N     . LEU F 3 188 ? 21.890 33.541 23.275  1.00 14.39 ? 195 LEU B N     1 
ATOM   4314 C CA    . LEU F 3 188 ? 21.777 33.607 21.850  1.00 13.09 ? 195 LEU B CA    1 
ATOM   4315 C C     . LEU F 3 188 ? 20.586 32.691 21.410  1.00 14.70 ? 195 LEU B C     1 
ATOM   4316 O O     . LEU F 3 188 ? 19.866 33.029 20.473  1.00 14.05 ? 195 LEU B O     1 
ATOM   4317 C CB    . LEU F 3 188 ? 23.128 33.226 21.236  1.00 10.06 ? 195 LEU B CB    1 
ATOM   4318 C CG    . LEU F 3 188 ? 24.031 34.393 20.744  1.00 5.78  ? 195 LEU B CG    1 
ATOM   4319 C CD1   . LEU F 3 188 ? 23.476 35.709 21.176  1.00 0.83  ? 195 LEU B CD1   1 
ATOM   4320 C CD2   . LEU F 3 188 ? 25.440 34.238 21.248  1.00 0.76  ? 195 LEU B CD2   1 
ATOM   4321 N N     . ILE F 3 189 ? 20.351 31.576 22.116  1.00 15.18 ? 196 ILE B N     1 
ATOM   4322 C CA    . ILE F 3 189 ? 19.243 30.662 21.785  1.00 16.78 ? 196 ILE B CA    1 
ATOM   4323 C C     . ILE F 3 189 ? 18.348 30.137 22.939  1.00 18.50 ? 196 ILE B C     1 
ATOM   4324 O O     . ILE F 3 189 ? 17.916 30.899 23.806  1.00 18.62 ? 196 ILE B O     1 
ATOM   4325 C CB    . ILE F 3 189 ? 19.733 29.429 21.001  1.00 17.16 ? 196 ILE B CB    1 
ATOM   4326 C CG1   . ILE F 3 189 ? 20.885 28.746 21.740  1.00 16.98 ? 196 ILE B CG1   1 
ATOM   4327 C CG2   . ILE F 3 189 ? 20.118 29.837 19.605  1.00 18.91 ? 196 ILE B CG2   1 
ATOM   4328 C CD1   . ILE F 3 189 ? 21.446 27.566 21.002  1.00 14.63 ? 196 ILE B CD1   1 
ATOM   4329 N N     . SER F 3 190 ? 18.060 28.835 22.928  1.00 19.47 ? 197 SER B N     1 
ATOM   4330 C CA    . SER F 3 190 ? 17.195 28.205 23.936  1.00 21.64 ? 197 SER B CA    1 
ATOM   4331 C C     . SER F 3 190 ? 17.304 26.710 23.674  1.00 22.20 ? 197 SER B C     1 
ATOM   4332 O O     . SER F 3 190 ? 17.483 26.338 22.523  1.00 24.54 ? 197 SER B O     1 
ATOM   4333 C CB    . SER F 3 190 ? 15.750 28.659 23.722  1.00 21.95 ? 197 SER B CB    1 
ATOM   4334 O OG    . SER F 3 190 ? 14.948 28.352 24.836  1.00 23.28 ? 197 SER B OG    1 
ATOM   4335 N N     . ALA F 3 191 ? 17.171 25.850 24.689  1.00 22.06 ? 198 ALA B N     1 
ATOM   4336 C CA    . ALA F 3 191 ? 17.330 24.397 24.457  1.00 22.12 ? 198 ALA B CA    1 
ATOM   4337 C C     . ALA F 3 191 ? 16.442 23.405 25.215  1.00 21.50 ? 198 ALA B C     1 
ATOM   4338 O O     . ALA F 3 191 ? 16.115 23.598 26.376  1.00 22.36 ? 198 ALA B O     1 
ATOM   4339 C CB    . ALA F 3 191 ? 18.801 24.013 24.694  1.00 23.48 ? 198 ALA B CB    1 
ATOM   4340 N N     . HIS F 3 192 ? 16.100 22.306 24.561  1.00 20.91 ? 199 HIS B N     1 
ATOM   4341 C CA    . HIS F 3 192 ? 15.263 21.283 25.184  1.00 20.53 ? 199 HIS B CA    1 
ATOM   4342 C C     . HIS F 3 192 ? 14.795 20.315 24.090  1.00 17.97 ? 199 HIS B C     1 
ATOM   4343 O O     . HIS F 3 192 ? 13.606 20.325 23.726  1.00 17.67 ? 199 HIS B O     1 
ATOM   4344 C CB    . HIS F 3 192 ? 14.062 21.972 25.848  1.00 25.56 ? 199 HIS B CB    1 
ATOM   4345 C CG    . HIS F 3 192 ? 13.112 21.041 26.535  1.00 30.96 ? 199 HIS B CG    1 
ATOM   4346 N ND1   . HIS F 3 192 ? 13.430 20.371 27.699  1.00 32.47 ? 199 HIS B ND1   1 
ATOM   4347 C CD2   . HIS F 3 192 ? 11.834 20.695 26.237  1.00 32.77 ? 199 HIS B CD2   1 
ATOM   4348 C CE1   . HIS F 3 192 ? 12.388 19.657 28.091  1.00 33.70 ? 199 HIS B CE1   1 
ATOM   4349 N NE2   . HIS F 3 192 ? 11.406 19.836 27.222  1.00 34.92 ? 199 HIS B NE2   1 
ATOM   4350 N N     . GLY F 3 193 ? 15.725 19.504 23.559  1.00 13.81 ? 200 GLY B N     1 
ATOM   4351 C CA    . GLY F 3 193 ? 15.401 18.563 22.489  1.00 9.24  ? 200 GLY B CA    1 
ATOM   4352 C C     . GLY F 3 193 ? 14.843 19.283 21.265  1.00 7.07  ? 200 GLY B C     1 
ATOM   4353 O O     . GLY F 3 193 ? 14.812 18.740 20.161  1.00 6.20  ? 200 GLY B O     1 
ATOM   4354 N N     . LYS F 3 194 ? 14.363 20.505 21.500  1.00 6.77  ? 201 LYS B N     1 
ATOM   4355 C CA    . LYS F 3 194 ? 13.826 21.421 20.493  1.00 6.63  ? 201 LYS B CA    1 
ATOM   4356 C C     . LYS F 3 194 ? 14.406 22.822 20.865  1.00 4.59  ? 201 LYS B C     1 
ATOM   4357 O O     . LYS F 3 194 ? 14.067 23.411 21.894  1.00 3.55  ? 201 LYS B O     1 
ATOM   4358 C CB    . LYS F 3 194 ? 12.285 21.398 20.523  1.00 9.28  ? 201 LYS B CB    1 
ATOM   4359 C CG    . LYS F 3 194 ? 11.615 22.406 21.405  1.00 11.17 ? 201 LYS B CG    1 
ATOM   4360 C CD    . LYS F 3 194 ? 11.333 21.822 22.744  1.00 16.50 ? 201 LYS B CD    1 
ATOM   4361 C CE    . LYS F 3 194 ? 10.472 22.799 23.588  1.00 21.14 ? 201 LYS B CE    1 
ATOM   4362 N NZ    . LYS F 3 194 ? 9.931  22.179 24.850  1.00 22.15 ? 201 LYS B NZ    1 
ATOM   4363 N N     . THR F 3 195 ? 15.296 23.339 20.027  1.00 2.29  ? 202 THR B N     1 
ATOM   4364 C CA    . THR F 3 195 ? 15.973 24.603 20.322  1.00 1.22  ? 202 THR B CA    1 
ATOM   4365 C C     . THR F 3 195 ? 15.456 25.827 19.597  1.00 1.78  ? 202 THR B C     1 
ATOM   4366 O O     . THR F 3 195 ? 15.065 25.723 18.440  1.00 1.89  ? 202 THR B O     1 
ATOM   4367 C CB    . THR F 3 195 ? 17.529 24.467 20.080  1.00 1.62  ? 202 THR B CB    1 
ATOM   4368 O OG1   . THR F 3 195 ? 18.007 25.590 19.343  1.00 2.86  ? 202 THR B OG1   1 
ATOM   4369 C CG2   . THR F 3 195 ? 17.869 23.214 19.319  1.00 1.40  ? 202 THR B CG2   1 
ATOM   4370 N N     . ILE F 3 196 ? 15.461 26.986 20.264  1.00 1.86  ? 203 ILE B N     1 
ATOM   4371 C CA    . ILE F 3 196 ? 14.960 28.223 19.649  1.00 4.35  ? 203 ILE B CA    1 
ATOM   4372 C C     . ILE F 3 196 ? 16.095 29.204 19.490  1.00 6.10  ? 203 ILE B C     1 
ATOM   4373 O O     . ILE F 3 196 ? 16.627 29.681 20.483  1.00 7.84  ? 203 ILE B O     1 
ATOM   4374 C CB    . ILE F 3 196 ? 13.922 28.921 20.520  1.00 5.59  ? 203 ILE B CB    1 
ATOM   4375 C CG1   . ILE F 3 196 ? 12.938 27.915 21.111  1.00 9.23  ? 203 ILE B CG1   1 
ATOM   4376 C CG2   . ILE F 3 196 ? 13.226 29.963 19.715  1.00 4.26  ? 203 ILE B CG2   1 
ATOM   4377 C CD1   . ILE F 3 196 ? 12.121 27.152 20.068  1.00 11.36 ? 203 ILE B CD1   1 
ATOM   4378 N N     . VAL F 3 197 ? 16.430 29.543 18.248  1.00 7.20  ? 204 VAL B N     1 
ATOM   4379 C CA    . VAL F 3 197 ? 17.557 30.434 17.923  1.00 6.22  ? 204 VAL B CA    1 
ATOM   4380 C C     . VAL F 3 197 ? 17.332 31.917 18.112  1.00 6.23  ? 204 VAL B C     1 
ATOM   4381 O O     . VAL F 3 197 ? 17.634 32.718 17.238  1.00 5.34  ? 204 VAL B O     1 
ATOM   4382 C CB    . VAL F 3 197 ? 18.031 30.157 16.490  1.00 5.89  ? 204 VAL B CB    1 
ATOM   4383 C CG1   . VAL F 3 197 ? 19.165 30.999 16.131  1.00 4.36  ? 204 VAL B CG1   1 
ATOM   4384 C CG2   . VAL F 3 197 ? 18.411 28.692 16.371  1.00 7.93  ? 204 VAL B CG2   1 
ATOM   4385 N N     . VAL F 3 198 ? 16.801 32.255 19.283  1.00 7.41  ? 205 VAL B N     1 
ATOM   4386 C CA    . VAL F 3 198 ? 16.522 33.629 19.707  1.00 6.63  ? 205 VAL B CA    1 
ATOM   4387 C C     . VAL F 3 198 ? 17.382 34.602 18.919  1.00 6.37  ? 205 VAL B C     1 
ATOM   4388 O O     . VAL F 3 198 ? 16.917 34.986 17.833  1.00 6.01  ? 205 VAL B O     1 
ATOM   4389 C CB    . VAL F 3 198 ? 16.812 33.788 21.242  1.00 6.38  ? 205 VAL B CB    1 
ATOM   4390 C CG1   . VAL F 3 198 ? 16.540 35.172 21.706  1.00 6.22  ? 205 VAL B CG1   1 
ATOM   4391 C CG2   . VAL F 3 198 ? 15.955 32.817 22.037  1.00 7.18  ? 205 VAL B CG2   1 
HETATM 4392 P P     . CMP G 4 .   ? 30.761 31.760 -10.428 1.00 12.87 ? 762 CMP A P     1 
HETATM 4393 O O1P   . CMP G 4 .   ? 30.049 31.529 -9.149  1.00 11.45 ? 762 CMP A O1P   1 
HETATM 4394 O O2P   . CMP G 4 .   ? 30.115 32.546 -11.504 1.00 13.26 ? 762 CMP A O2P   1 
HETATM 4395 O "O5'" . CMP G 4 .   ? 32.176 32.412 -10.056 1.00 10.43 ? 762 CMP A "O5'" 1 
HETATM 4396 C "C5'" . CMP G 4 .   ? 33.224 31.616 -9.497  1.00 9.87  ? 762 CMP A "C5'" 1 
HETATM 4397 C "C4'" . CMP G 4 .   ? 33.331 30.345 -10.284 1.00 8.53  ? 762 CMP A "C4'" 1 
HETATM 4398 O "O4'" . CMP G 4 .   ? 34.270 29.405 -9.713  1.00 7.49  ? 762 CMP A "O4'" 1 
HETATM 4399 C "C3'" . CMP G 4 .   ? 32.039 29.563 -10.229 1.00 10.49 ? 762 CMP A "C3'" 1 
HETATM 4400 O "O3'" . CMP G 4 .   ? 31.126 30.307 -10.974 1.00 7.91  ? 762 CMP A "O3'" 1 
HETATM 4401 C "C2'" . CMP G 4 .   ? 32.500 28.241 -10.771 1.00 10.50 ? 762 CMP A "C2'" 1 
HETATM 4402 O "O2'" . CMP G 4 .   ? 32.774 28.425 -12.147 1.00 15.47 ? 762 CMP A "O2'" 1 
HETATM 4403 C "C1'" . CMP G 4 .   ? 33.809 28.092 -9.981  1.00 8.35  ? 762 CMP A "C1'" 1 
HETATM 4404 N N9    . CMP G 4 .   ? 33.605 27.405 -8.709  1.00 5.50  ? 762 CMP A N9    1 
HETATM 4405 C C8    . CMP G 4 .   ? 32.969 27.832 -7.572  1.00 3.68  ? 762 CMP A C8    1 
HETATM 4406 N N7    . CMP G 4 .   ? 32.900 26.925 -6.636  1.00 0.76  ? 762 CMP A N7    1 
HETATM 4407 C C5    . CMP G 4 .   ? 33.551 25.829 -7.186  1.00 3.89  ? 762 CMP A C5    1 
HETATM 4408 C C6    . CMP G 4 .   ? 33.802 24.524 -6.710  1.00 6.77  ? 762 CMP A C6    1 
HETATM 4409 N N6    . CMP G 4 .   ? 33.416 24.065 -5.503  1.00 6.90  ? 762 CMP A N6    1 
HETATM 4410 N N1    . CMP G 4 .   ? 34.474 23.682 -7.529  1.00 7.95  ? 762 CMP A N1    1 
HETATM 4411 C C2    . CMP G 4 .   ? 34.870 24.125 -8.728  1.00 8.00  ? 762 CMP A C2    1 
HETATM 4412 N N3    . CMP G 4 .   ? 34.694 25.313 -9.280  1.00 6.37  ? 762 CMP A N3    1 
HETATM 4413 C C4    . CMP G 4 .   ? 34.012 26.124 -8.451  1.00 5.33  ? 762 CMP A C4    1 
HETATM 4414 P P     . CMP H 4 .   ? 23.552 10.754 -6.951  1.00 20.22 ? 761 CMP B P     1 
HETATM 4415 O O1P   . CMP H 4 .   ? 22.802 10.173 -8.083  1.00 21.83 ? 761 CMP B O1P   1 
HETATM 4416 O O2P   . CMP H 4 .   ? 25.036 10.678 -6.940  1.00 20.56 ? 761 CMP B O2P   1 
HETATM 4417 O "O5'" . CMP H 4 .   ? 23.045 10.082 -5.590  1.00 21.44 ? 761 CMP B "O5'" 1 
HETATM 4418 C "C5'" . CMP H 4 .   ? 23.192 10.776 -4.338  1.00 19.26 ? 761 CMP B "C5'" 1 
HETATM 4419 C "C4'" . CMP H 4 .   ? 22.599 12.140 -4.486  1.00 16.20 ? 761 CMP B "C4'" 1 
HETATM 4420 O "O4'" . CMP H 4 .   ? 22.824 13.012 -3.348  1.00 14.88 ? 761 CMP B "O4'" 1 
HETATM 4421 C "C3'" . CMP H 4 .   ? 23.291 12.928 -5.565  1.00 17.18 ? 761 CMP B "C3'" 1 
HETATM 4422 O "O3'" . CMP H 4 .   ? 23.077 12.280 -6.799  1.00 18.30 ? 761 CMP B "O3'" 1 
HETATM 4423 C "C2'" . CMP H 4 .   ? 22.658 14.286 -5.332  1.00 17.62 ? 761 CMP B "C2'" 1 
HETATM 4424 O "O2'" . CMP H 4 .   ? 21.288 14.326 -5.692  1.00 18.93 ? 761 CMP B "O2'" 1 
HETATM 4425 C "C1'" . CMP H 4 .   ? 22.752 14.354 -3.806  1.00 15.03 ? 761 CMP B "C1'" 1 
HETATM 4426 N N9    . CMP H 4 .   ? 23.958 15.065 -3.422  1.00 11.63 ? 761 CMP B N9    1 
HETATM 4427 C C8    . CMP H 4 .   ? 25.265 14.654 -3.444  1.00 12.80 ? 761 CMP B C8    1 
HETATM 4428 N N7    . CMP H 4 .   ? 26.113 15.577 -3.053  1.00 12.11 ? 761 CMP B N7    1 
HETATM 4429 C C5    . CMP H 4 .   ? 25.301 16.658 -2.741  1.00 11.71 ? 761 CMP B C5    1 
HETATM 4430 C C6    . CMP H 4 .   ? 25.575 17.919 -2.240  1.00 9.96  ? 761 CMP B C6    1 
HETATM 4431 N N6    . CMP H 4 .   ? 26.794 18.341 -1.964  1.00 13.34 ? 761 CMP B N6    1 
HETATM 4432 N N1    . CMP H 4 .   ? 24.535 18.756 -2.023  1.00 12.29 ? 761 CMP B N1    1 
HETATM 4433 C C2    . CMP H 4 .   ? 23.303 18.335 -2.304  1.00 11.77 ? 761 CMP B C2    1 
HETATM 4434 N N3    . CMP H 4 .   ? 22.915 17.166 -2.779  1.00 14.31 ? 761 CMP B N3    1 
HETATM 4435 C C4    . CMP H 4 .   ? 23.976 16.358 -2.973  1.00 12.60 ? 761 CMP B C4    1 
HETATM 4436 O O     . HOH I 5 .   ? 76.809 28.036 -13.594 1.00 0.76  ? 116 HOH C O     1 
HETATM 4437 O O     . HOH I 5 .   ? 83.018 31.835 -11.190 1.00 36.82 ? 139 HOH C O     1 
HETATM 4438 O O     . HOH I 5 .   ? 72.375 39.964 -2.697  1.00 21.89 ? 140 HOH C O     1 
HETATM 4439 O O     . HOH I 5 .   ? 59.129 34.394 1.910   1.00 27.02 ? 152 HOH C O     1 
HETATM 4440 O O     . HOH J 5 .   ? 59.042 35.587 -16.226 1.00 5.99  ? 105 HOH D O     1 
HETATM 4441 O O     . HOH J 5 .   ? 52.751 15.589 18.958  1.00 7.38  ? 118 HOH D O     1 
HETATM 4442 O O     . HOH J 5 .   ? 58.149 35.681 8.484   1.00 1.80  ? 123 HOH D O     1 
HETATM 4443 O O     . HOH J 5 .   ? 64.767 25.074 1.262   1.00 19.19 ? 129 HOH D O     1 
HETATM 4444 O O     . HOH J 5 .   ? 49.493 11.761 13.218  1.00 36.48 ? 134 HOH D O     1 
HETATM 4445 O O     . HOH J 5 .   ? 69.634 22.862 -4.982  1.00 16.09 ? 145 HOH D O     1 
HETATM 4446 O O     . HOH J 5 .   ? 71.107 30.896 -2.700  1.00 55.63 ? 155 HOH D O     1 
HETATM 4447 O O     . HOH K 5 .   ? 38.529 5.998  19.153  1.00 4.74  ? 111 HOH E O     1 
HETATM 4448 O O     . HOH K 5 .   ? 39.189 8.675  31.470  1.00 10.93 ? 114 HOH E O     1 
HETATM 4449 O O     . HOH K 5 .   ? 7.784  14.964 28.077  1.00 31.44 ? 133 HOH E O     1 
HETATM 4450 O O     . HOH K 5 .   ? 48.929 23.803 28.930  1.00 18.15 ? 136 HOH E O     1 
HETATM 4451 O O     . HOH K 5 .   ? 36.762 7.521  30.534  1.00 31.72 ? 153 HOH E O     1 
HETATM 4452 O O     . HOH L 5 .   ? 18.322 2.712  24.967  1.00 19.55 ? 117 HOH F O     1 
HETATM 4453 O O     . HOH L 5 .   ? 37.607 14.430 39.677  1.00 31.18 ? 137 HOH F O     1 
HETATM 4454 O O     . HOH M 5 .   ? 56.698 28.285 6.356   1.00 9.23  ? 763 HOH A O     1 
HETATM 4455 O O     . HOH M 5 .   ? 40.061 42.289 -21.053 1.00 12.12 ? 764 HOH A O     1 
HETATM 4456 O O     . HOH M 5 .   ? 44.386 26.528 8.403   1.00 0.76  ? 765 HOH A O     1 
HETATM 4457 O O     . HOH M 5 .   ? 50.827 28.809 4.575   1.00 19.01 ? 766 HOH A O     1 
HETATM 4458 O O     . HOH M 5 .   ? 37.154 36.022 -0.171  1.00 12.25 ? 767 HOH A O     1 
HETATM 4459 O O     . HOH M 5 .   ? 21.006 29.765 -9.781  1.00 6.21  ? 768 HOH A O     1 
HETATM 4460 O O     . HOH M 5 .   ? 48.363 31.223 -9.540  1.00 0.76  ? 769 HOH A O     1 
HETATM 4461 O O     . HOH M 5 .   ? 34.785 10.522 -14.711 1.00 16.60 ? 770 HOH A O     1 
HETATM 4462 O O     . HOH M 5 .   ? 53.166 28.316 -3.330  1.00 21.73 ? 771 HOH A O     1 
HETATM 4463 O O     . HOH M 5 .   ? 14.874 30.263 -12.505 1.00 12.62 ? 772 HOH A O     1 
HETATM 4464 O O     . HOH M 5 .   ? 46.941 36.919 -2.704  1.00 14.76 ? 773 HOH A O     1 
HETATM 4465 O O     . HOH M 5 .   ? 54.898 1.754  5.575   1.00 29.52 ? 774 HOH A O     1 
HETATM 4466 O O     . HOH M 5 .   ? 36.351 38.008 2.295   1.00 6.22  ? 775 HOH A O     1 
HETATM 4467 O O     . HOH M 5 .   ? 34.800 21.652 -23.552 1.00 0.76  ? 776 HOH A O     1 
HETATM 4468 O O     . HOH M 5 .   ? 45.909 27.587 4.551   1.00 39.52 ? 777 HOH A O     1 
HETATM 4469 O O     . HOH M 5 .   ? 15.516 39.051 -10.467 1.00 32.12 ? 778 HOH A O     1 
HETATM 4470 O O     . HOH M 5 .   ? 57.355 19.769 14.581  1.00 33.89 ? 779 HOH A O     1 
HETATM 4471 O O     . HOH M 5 .   ? 50.878 33.033 -8.509  1.00 24.28 ? 780 HOH A O     1 
HETATM 4472 O O     . HOH M 5 .   ? 48.968 26.432 3.068   1.00 15.31 ? 781 HOH A O     1 
HETATM 4473 O O     . HOH N 5 .   ? 27.898 11.283 17.772  1.00 0.76  ? 762 HOH B O     1 
HETATM 4474 O O     . HOH N 5 .   ? 31.174 13.312 12.369  1.00 24.94 ? 763 HOH B O     1 
HETATM 4475 O O     . HOH N 5 .   ? 16.035 33.638 12.826  1.00 8.72  ? 764 HOH B O     1 
HETATM 4476 O O     . HOH N 5 .   ? 24.152 33.770 16.026  1.00 20.15 ? 765 HOH B O     1 
HETATM 4477 O O     . HOH N 5 .   ? -0.700 22.706 -11.488 1.00 15.64 ? 766 HOH B O     1 
HETATM 4478 O O     . HOH N 5 .   ? 12.937 16.640 -31.201 1.00 14.85 ? 767 HOH B O     1 
HETATM 4479 O O     . HOH N 5 .   ? 17.900 33.885 23.700  1.00 48.07 ? 768 HOH B O     1 
HETATM 4480 O O     . HOH N 5 .   ? 17.994 12.922 -27.923 1.00 30.35 ? 769 HOH B O     1 
HETATM 4481 O O     . HOH N 5 .   ? -0.935 19.666 -15.185 1.00 9.12  ? 770 HOH B O     1 
HETATM 4482 O O     . HOH N 5 .   ? 22.402 5.616  7.250   1.00 17.47 ? 771 HOH B O     1 
HETATM 4483 O O     . HOH N 5 .   ? 9.371  19.961 4.737   1.00 16.98 ? 772 HOH B O     1 
HETATM 4484 O O     . HOH N 5 .   ? 32.395 7.264  -4.528  1.00 6.54  ? 773 HOH B O     1 
HETATM 4485 O O     . HOH N 5 .   ? 5.138  24.970 -9.604  1.00 16.80 ? 774 HOH B O     1 
HETATM 4486 O O     . HOH N 5 .   ? 15.265 18.434 -31.010 1.00 26.54 ? 775 HOH B O     1 
HETATM 4487 O O     . HOH N 5 .   ? 14.895 11.942 10.914  1.00 23.04 ? 776 HOH B O     1 
HETATM 4488 O O     . HOH N 5 .   ? 33.995 31.774 6.230   1.00 7.37  ? 777 HOH B O     1 
HETATM 4489 O O     . HOH N 5 .   ? 14.423 24.237 -9.691  1.00 12.43 ? 778 HOH B O     1 
HETATM 4490 O O     . HOH N 5 .   ? 40.470 4.402  9.542   1.00 28.54 ? 779 HOH B O     1 
HETATM 4491 O O     . HOH N 5 .   ? 21.525 0.694  -20.660 1.00 9.92  ? 780 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   -5  -5  DG  G   C . n 
A 1 2   DC  2   -4  -4  DC  C   C . n 
A 1 3   DG  3   -3  -3  DG  G   C . n 
A 1 4   DA  4   -2  -2  DA  A   C . n 
A 1 5   DA  5   -1  -1  DA  A   C . n 
A 1 6   DA  6   1   1   DA  A   C . n 
A 1 7   DA  7   2   2   DA  A   C . n 
A 1 8   DA  8   3   3   DA  A   C . n 
A 1 9   DT  9   4   4   DT  T   C . n 
A 1 10  DG  10  5   5   DG  G   C . n 
A 1 11  DC  11  6   6   DC  C   C . n 
A 1 12  DG  12  7   7   DG  G   C . n 
A 1 13  DA  13  8   8   DA  A   C . n 
A 1 14  DT  14  9   9   DT  T   C . n 
B 2 1   DC  1   13  13  DC  C   D . n 
B 2 2   DT  2   12  12  DT  T   D . n 
B 2 3   DA  3   11  11  DA  A   D . n 
B 2 4   DG  4   10  10  DG  G   D . n 
B 2 5   DA  5   9   9   DA  A   D . n 
B 2 6   DT  6   8   8   DT  T   D . n 
B 2 7   DC  7   7   7   DC  C   D . n 
B 2 8   DG  8   6   6   DG  G   D . n 
B 2 9   DC  9   5   5   DC  C   D . n 
B 2 10  DA  10  4   4   DA  A   D . n 
B 2 11  DT  11  3   3   DT  T   D . n 
B 2 12  DT  12  2   2   DT  T   D . n 
B 2 13  DT  13  1   1   DT  T   D . n 
B 2 14  DT  14  -1  -1  DT  T   D . n 
B 2 15  DT  15  -2  -2  DT  T   D . n 
B 2 16  DC  16  -3  -3  DC  C   D . n 
B 2 17  DG  17  -4  -4  DG  G   D . n 
C 2 1   DC  1   10  10  DC  C   E . n 
C 2 2   DT  2   11  11  DT  T   E . n 
C 2 3   DA  3   12  12  DA  A   E . n 
C 2 4   DG  4   13  13  DG  G   E . n 
C 2 5   DA  5   14  14  DA  A   E . n 
C 2 6   DT  6   15  15  DT  T   E . n 
C 2 7   DC  7   16  16  DC  C   E . n 
C 2 8   DG  8   17  17  DG  G   E . n 
C 2 9   DC  9   18  18  DC  C   E . n 
C 2 10  DA  10  19  19  DA  A   E . n 
C 2 11  DT  11  20  20  DT  T   E . n 
C 2 12  DT  12  21  21  DT  T   E . n 
C 2 13  DT  13  22  22  DT  T   E . n 
C 2 14  DT  14  23  23  DT  T   E . n 
C 2 15  DT  15  24  24  DT  T   E . n 
C 2 16  DC  16  25  25  DC  C   E . n 
C 2 17  DG  17  26  26  DG  G   E . n 
D 1 1   DG  1   27  27  DG  G   F . n 
D 1 2   DC  2   26  26  DC  C   F . n 
D 1 3   DG  3   25  25  DG  G   F . n 
D 1 4   DA  4   24  24  DA  A   F . n 
D 1 5   DA  5   23  23  DA  A   F . n 
D 1 6   DA  6   22  22  DA  A   F . n 
D 1 7   DA  7   21  21  DA  A   F . n 
D 1 8   DA  8   20  20  DA  A   F . n 
D 1 9   DT  9   19  19  DT  T   F . n 
D 1 10  DG  10  18  18  DG  G   F . n 
D 1 11  DC  11  17  17  DC  C   F . n 
D 1 12  DG  12  16  16  DG  G   F . n 
D 1 13  DA  13  15  15  DA  A   F . n 
D 1 14  DT  14  14  14  DT  T   F . n 
E 3 1   ASP 1   8   ?   ?   ?   A . n 
E 3 2   PRO 2   9   9   PRO PRO A . n 
E 3 3   THR 3   10  10  THR THR A . n 
E 3 4   LEU 4   11  11  LEU LEU A . n 
E 3 5   GLU 5   12  12  GLU GLU A . n 
E 3 6   TRP 6   13  13  TRP TRP A . n 
E 3 7   PHE 7   14  14  PHE PHE A . n 
E 3 8   LEU 8   15  15  LEU LEU A . n 
E 3 9   SER 9   16  16  SER SER A . n 
E 3 10  HIS 10  17  17  HIS HIS A . n 
E 3 11  CYS 11  18  18  CYS CYS A . n 
E 3 12  HIS 12  19  19  HIS HIS A . n 
E 3 13  ILE 13  20  20  ILE ILE A . n 
E 3 14  HIS 14  21  21  HIS HIS A . n 
E 3 15  LYS 15  22  22  LYS LYS A . n 
E 3 16  TYR 16  23  23  TYR TYR A . n 
E 3 17  PRO 17  24  24  PRO PRO A . n 
E 3 18  SER 18  25  25  SER SER A . n 
E 3 19  LYS 19  26  26  LYS LYS A . n 
E 3 20  SER 20  27  27  SER SER A . n 
E 3 21  THR 21  28  28  THR THR A . n 
E 3 22  LEU 22  29  29  LEU LEU A . n 
E 3 23  ILE 23  30  30  ILE ILE A . n 
E 3 24  HIS 24  31  31  HIS HIS A . n 
E 3 25  GLN 25  32  32  GLN GLN A . n 
E 3 26  GLY 26  33  33  GLY GLY A . n 
E 3 27  GLU 27  34  34  GLU GLU A . n 
E 3 28  LYS 28  35  35  LYS LYS A . n 
E 3 29  ALA 29  36  36  ALA ALA A . n 
E 3 30  GLU 30  37  37  GLU GLU A . n 
E 3 31  THR 31  38  38  THR THR A . n 
E 3 32  LEU 32  39  39  LEU LEU A . n 
E 3 33  TYR 33  40  40  TYR TYR A . n 
E 3 34  TYR 34  41  41  TYR TYR A . n 
E 3 35  ILE 35  42  42  ILE ILE A . n 
E 3 36  VAL 36  43  43  VAL VAL A . n 
E 3 37  LYS 37  44  44  LYS LYS A . n 
E 3 38  GLY 38  45  45  GLY GLY A . n 
E 3 39  SER 39  46  46  SER SER A . n 
E 3 40  VAL 40  47  47  VAL VAL A . n 
E 3 41  ALA 41  48  48  ALA ALA A . n 
E 3 42  VAL 42  49  49  VAL VAL A . n 
E 3 43  LEU 43  50  50  LEU LEU A . n 
E 3 44  ILE 44  51  51  ILE ILE A . n 
E 3 45  LYS 45  52  52  LYS LYS A . n 
E 3 46  ASP 46  53  53  ASP ASP A . n 
E 3 47  GLU 47  54  54  GLU GLU A . n 
E 3 48  GLU 48  55  55  GLU GLU A . n 
E 3 49  GLY 49  56  56  GLY GLY A . n 
E 3 50  LYS 50  57  57  LYS LYS A . n 
E 3 51  GLU 51  58  58  GLU GLU A . n 
E 3 52  MET 52  59  59  MET MET A . n 
E 3 53  ILE 53  60  60  ILE ILE A . n 
E 3 54  LEU 54  61  61  LEU LEU A . n 
E 3 55  SER 55  62  62  SER SER A . n 
E 3 56  TYR 56  63  63  TYR TYR A . n 
E 3 57  LEU 57  64  64  LEU LEU A . n 
E 3 58  ASN 58  65  65  ASN ASN A . n 
E 3 59  GLN 59  66  66  GLN GLN A . n 
E 3 60  GLY 60  67  67  GLY GLY A . n 
E 3 61  ASP 61  68  68  ASP ASP A . n 
E 3 62  PHE 62  69  69  PHE PHE A . n 
E 3 63  ILE 63  70  70  ILE ILE A . n 
E 3 64  GLY 64  71  71  GLY GLY A . n 
E 3 65  GLU 65  72  72  GLU GLU A . n 
E 3 66  LEU 66  73  73  LEU LEU A . n 
E 3 67  GLY 67  74  74  GLY GLY A . n 
E 3 68  LEU 68  75  75  LEU LEU A . n 
E 3 69  PHE 69  76  76  PHE PHE A . n 
E 3 70  GLU 70  77  77  GLU GLU A . n 
E 3 71  GLU 71  78  78  GLU GLU A . n 
E 3 72  GLY 72  79  79  GLY GLY A . n 
E 3 73  GLN 73  80  80  GLN GLN A . n 
E 3 74  GLU 74  81  81  GLU GLU A . n 
E 3 75  ARG 75  82  82  ARG ARG A . n 
E 3 76  SER 76  83  83  SER SER A . n 
E 3 77  ALA 77  84  84  ALA ALA A . n 
E 3 78  TRP 78  85  85  TRP TRP A . n 
E 3 79  VAL 79  86  86  VAL VAL A . n 
E 3 80  ARG 80  87  87  ARG ARG A . n 
E 3 81  ALA 81  88  88  ALA ALA A . n 
E 3 82  LYS 82  89  89  LYS LYS A . n 
E 3 83  THR 83  90  90  THR THR A . n 
E 3 84  ALA 84  91  91  ALA ALA A . n 
E 3 85  CYS 85  92  92  CYS CYS A . n 
E 3 86  GLU 86  93  93  GLU GLU A . n 
E 3 87  VAL 87  94  94  VAL VAL A . n 
E 3 88  ALA 88  95  95  ALA ALA A . n 
E 3 89  GLU 89  96  96  GLU GLU A . n 
E 3 90  ILE 90  97  97  ILE ILE A . n 
E 3 91  SER 91  98  98  SER SER A . n 
E 3 92  TYR 92  99  99  TYR TYR A . n 
E 3 93  LYS 93  100 100 LYS LYS A . n 
E 3 94  LYS 94  101 101 LYS LYS A . n 
E 3 95  PHE 95  102 102 PHE PHE A . n 
E 3 96  ARG 96  103 103 ARG ARG A . n 
E 3 97  GLN 97  104 104 GLN GLN A . n 
E 3 98  LEU 98  105 105 LEU LEU A . n 
E 3 99  ILE 99  106 106 ILE ILE A . n 
E 3 100 GLN 100 107 107 GLN GLN A . n 
E 3 101 VAL 101 108 108 VAL VAL A . n 
E 3 102 ASN 102 109 109 ASN ASN A . n 
E 3 103 PRO 103 110 110 PRO PRO A . n 
E 3 104 ASP 104 111 111 ASP ASP A . n 
E 3 105 ILE 105 112 112 ILE ILE A . n 
E 3 106 LEU 106 113 113 LEU LEU A . n 
E 3 107 MET 107 114 114 MET MET A . n 
E 3 108 ARG 108 115 115 ARG ARG A . n 
E 3 109 LEU 109 116 116 LEU LEU A . n 
E 3 110 SER 110 117 117 SER SER A . n 
E 3 111 ALA 111 118 118 ALA ALA A . n 
E 3 112 GLN 112 119 119 GLN GLN A . n 
E 3 113 MET 113 120 120 MET MET A . n 
E 3 114 ALA 114 121 121 ALA ALA A . n 
E 3 115 ARG 115 122 122 ARG ARG A . n 
E 3 116 ARG 116 123 123 ARG ARG A . n 
E 3 117 LEU 117 124 124 LEU LEU A . n 
E 3 118 GLN 118 125 125 GLN GLN A . n 
E 3 119 VAL 119 126 126 VAL VAL A . n 
E 3 120 THR 120 127 127 THR THR A . n 
E 3 121 SER 121 128 128 SER SER A . n 
E 3 122 GLU 122 129 129 GLU GLU A . n 
E 3 123 LYS 123 130 130 LYS LYS A . n 
E 3 124 VAL 124 131 131 VAL VAL A . n 
E 3 125 GLY 125 132 132 GLY GLY A . n 
E 3 126 ASN 126 133 133 ASN ASN A . n 
E 3 127 LEU 127 134 134 LEU LEU A . n 
E 3 128 ALA 128 135 135 ALA ALA A . n 
E 3 129 PHE 129 136 136 PHE PHE A . n 
E 3 130 LEU 130 137 137 LEU LEU A . n 
E 3 131 ASP 131 138 138 ASP ASP A . n 
E 3 132 VAL 132 139 139 VAL VAL A . n 
E 3 133 THR 133 140 140 THR THR A . n 
E 3 134 GLY 134 141 141 GLY GLY A . n 
E 3 135 ARG 135 142 142 ARG ARG A . n 
E 3 136 ILE 136 143 143 ILE ILE A . n 
E 3 137 ALA 137 144 144 ALA ALA A . n 
E 3 138 GLN 138 145 145 GLN GLN A . n 
E 3 139 THR 139 146 146 THR THR A . n 
E 3 140 LEU 140 147 147 LEU LEU A . n 
E 3 141 LEU 141 148 148 LEU LEU A . n 
E 3 142 ASN 142 149 149 ASN ASN A . n 
E 3 143 LEU 143 150 150 LEU LEU A . n 
E 3 144 ALA 144 151 151 ALA ALA A . n 
E 3 145 LYS 145 152 152 LYS LYS A . n 
E 3 146 GLN 146 153 153 GLN GLN A . n 
E 3 147 PRO 147 154 154 PRO PRO A . n 
E 3 148 ASP 148 155 155 ASP ASP A . n 
E 3 149 ALA 149 156 156 ALA ALA A . n 
E 3 150 MET 150 157 157 MET MET A . n 
E 3 151 THR 151 158 158 THR THR A . n 
E 3 152 HIS 152 159 159 HIS HIS A . n 
E 3 153 PRO 153 160 160 PRO PRO A . n 
E 3 154 ASP 154 161 161 ASP ASP A . n 
E 3 155 GLY 155 162 162 GLY GLY A . n 
E 3 156 MET 156 163 163 MET MET A . n 
E 3 157 GLN 157 164 164 GLN GLN A . n 
E 3 158 ILE 158 165 165 ILE ILE A . n 
E 3 159 LYS 159 166 166 LYS LYS A . n 
E 3 160 ILE 160 167 167 ILE ILE A . n 
E 3 161 THR 161 168 168 THR THR A . n 
E 3 162 ARG 162 169 169 ARG ARG A . n 
E 3 163 GLN 163 170 170 GLN GLN A . n 
E 3 164 GLU 164 171 171 GLU GLU A . n 
E 3 165 ILE 165 172 172 ILE ILE A . n 
E 3 166 GLY 166 173 173 GLY GLY A . n 
E 3 167 GLN 167 174 174 GLN GLN A . n 
E 3 168 ILE 168 175 175 ILE ILE A . n 
E 3 169 VAL 169 176 176 VAL VAL A . n 
E 3 170 GLY 170 177 177 GLY GLY A . n 
E 3 171 CYS 171 178 178 CYS CYS A . n 
E 3 172 SER 172 179 179 SER SER A . n 
E 3 173 ARG 173 180 180 ARG ARG A . n 
E 3 174 GLU 174 181 181 GLU GLU A . n 
E 3 175 THR 175 182 182 THR THR A . n 
E 3 176 VAL 176 183 183 VAL VAL A . n 
E 3 177 GLY 177 184 184 GLY GLY A . n 
E 3 178 ARG 178 185 185 ARG ARG A . n 
E 3 179 ILE 179 186 186 ILE ILE A . n 
E 3 180 LEU 180 187 187 LEU LEU A . n 
E 3 181 LYS 181 188 188 LYS LYS A . n 
E 3 182 MET 182 189 189 MET MET A . n 
E 3 183 LEU 183 190 190 LEU LEU A . n 
E 3 184 GLU 184 191 191 GLU GLU A . n 
E 3 185 ASP 185 192 192 ASP ASP A . n 
E 3 186 GLN 186 193 193 GLN GLN A . n 
E 3 187 ASN 187 194 194 ASN ASN A . n 
E 3 188 LEU 188 195 195 LEU LEU A . n 
E 3 189 ILE 189 196 196 ILE ILE A . n 
E 3 190 SER 190 197 197 SER SER A . n 
E 3 191 ALA 191 198 198 ALA ALA A . n 
E 3 192 HIS 192 199 199 HIS HIS A . n 
E 3 193 GLY 193 200 200 GLY GLY A . n 
E 3 194 LYS 194 201 201 LYS LYS A . n 
E 3 195 THR 195 202 202 THR THR A . n 
E 3 196 ILE 196 203 203 ILE ILE A . n 
E 3 197 VAL 197 204 204 VAL VAL A . n 
E 3 198 VAL 198 205 205 VAL VAL A . n 
E 3 199 TYR 199 206 206 TYR TYR A . n 
E 3 200 GLY 200 207 207 GLY GLY A . n 
F 3 1   ASP 1   8   ?   ?   ?   B . n 
F 3 2   PRO 2   9   9   PRO PRO B . n 
F 3 3   THR 3   10  10  THR THR B . n 
F 3 4   LEU 4   11  11  LEU LEU B . n 
F 3 5   GLU 5   12  12  GLU GLU B . n 
F 3 6   TRP 6   13  13  TRP TRP B . n 
F 3 7   PHE 7   14  14  PHE PHE B . n 
F 3 8   LEU 8   15  15  LEU LEU B . n 
F 3 9   SER 9   16  16  SER SER B . n 
F 3 10  HIS 10  17  17  HIS HIS B . n 
F 3 11  CYS 11  18  18  CYS CYS B . n 
F 3 12  HIS 12  19  19  HIS HIS B . n 
F 3 13  ILE 13  20  20  ILE ILE B . n 
F 3 14  HIS 14  21  21  HIS HIS B . n 
F 3 15  LYS 15  22  22  LYS LYS B . n 
F 3 16  TYR 16  23  23  TYR TYR B . n 
F 3 17  PRO 17  24  24  PRO PRO B . n 
F 3 18  SER 18  25  25  SER SER B . n 
F 3 19  LYS 19  26  26  LYS LYS B . n 
F 3 20  SER 20  27  27  SER SER B . n 
F 3 21  THR 21  28  28  THR THR B . n 
F 3 22  LEU 22  29  29  LEU LEU B . n 
F 3 23  ILE 23  30  30  ILE ILE B . n 
F 3 24  HIS 24  31  31  HIS HIS B . n 
F 3 25  GLN 25  32  32  GLN GLN B . n 
F 3 26  GLY 26  33  33  GLY GLY B . n 
F 3 27  GLU 27  34  34  GLU GLU B . n 
F 3 28  LYS 28  35  35  LYS LYS B . n 
F 3 29  ALA 29  36  36  ALA ALA B . n 
F 3 30  GLU 30  37  37  GLU GLU B . n 
F 3 31  THR 31  38  38  THR THR B . n 
F 3 32  LEU 32  39  39  LEU LEU B . n 
F 3 33  TYR 33  40  40  TYR TYR B . n 
F 3 34  TYR 34  41  41  TYR TYR B . n 
F 3 35  ILE 35  42  42  ILE ILE B . n 
F 3 36  VAL 36  43  43  VAL VAL B . n 
F 3 37  LYS 37  44  44  LYS LYS B . n 
F 3 38  GLY 38  45  45  GLY GLY B . n 
F 3 39  SER 39  46  46  SER SER B . n 
F 3 40  VAL 40  47  47  VAL VAL B . n 
F 3 41  ALA 41  48  48  ALA ALA B . n 
F 3 42  VAL 42  49  49  VAL VAL B . n 
F 3 43  LEU 43  50  50  LEU LEU B . n 
F 3 44  ILE 44  51  51  ILE ILE B . n 
F 3 45  LYS 45  52  52  LYS LYS B . n 
F 3 46  ASP 46  53  53  ASP ASP B . n 
F 3 47  GLU 47  54  54  GLU GLU B . n 
F 3 48  GLU 48  55  55  GLU GLU B . n 
F 3 49  GLY 49  56  56  GLY GLY B . n 
F 3 50  LYS 50  57  57  LYS LYS B . n 
F 3 51  GLU 51  58  58  GLU GLU B . n 
F 3 52  MET 52  59  59  MET MET B . n 
F 3 53  ILE 53  60  60  ILE ILE B . n 
F 3 54  LEU 54  61  61  LEU LEU B . n 
F 3 55  SER 55  62  62  SER SER B . n 
F 3 56  TYR 56  63  63  TYR TYR B . n 
F 3 57  LEU 57  64  64  LEU LEU B . n 
F 3 58  ASN 58  65  65  ASN ASN B . n 
F 3 59  GLN 59  66  66  GLN GLN B . n 
F 3 60  GLY 60  67  67  GLY GLY B . n 
F 3 61  ASP 61  68  68  ASP ASP B . n 
F 3 62  PHE 62  69  69  PHE PHE B . n 
F 3 63  ILE 63  70  70  ILE ILE B . n 
F 3 64  GLY 64  71  71  GLY GLY B . n 
F 3 65  GLU 65  72  72  GLU GLU B . n 
F 3 66  LEU 66  73  73  LEU LEU B . n 
F 3 67  GLY 67  74  74  GLY GLY B . n 
F 3 68  LEU 68  75  75  LEU LEU B . n 
F 3 69  PHE 69  76  76  PHE PHE B . n 
F 3 70  GLU 70  77  77  GLU GLU B . n 
F 3 71  GLU 71  78  78  GLU GLU B . n 
F 3 72  GLY 72  79  79  GLY GLY B . n 
F 3 73  GLN 73  80  80  GLN GLN B . n 
F 3 74  GLU 74  81  81  GLU GLU B . n 
F 3 75  ARG 75  82  82  ARG ARG B . n 
F 3 76  SER 76  83  83  SER SER B . n 
F 3 77  ALA 77  84  84  ALA ALA B . n 
F 3 78  TRP 78  85  85  TRP TRP B . n 
F 3 79  VAL 79  86  86  VAL VAL B . n 
F 3 80  ARG 80  87  87  ARG ARG B . n 
F 3 81  ALA 81  88  88  ALA ALA B . n 
F 3 82  LYS 82  89  89  LYS LYS B . n 
F 3 83  THR 83  90  90  THR THR B . n 
F 3 84  ALA 84  91  91  ALA ALA B . n 
F 3 85  CYS 85  92  92  CYS CYS B . n 
F 3 86  GLU 86  93  93  GLU GLU B . n 
F 3 87  VAL 87  94  94  VAL VAL B . n 
F 3 88  ALA 88  95  95  ALA ALA B . n 
F 3 89  GLU 89  96  96  GLU GLU B . n 
F 3 90  ILE 90  97  97  ILE ILE B . n 
F 3 91  SER 91  98  98  SER SER B . n 
F 3 92  TYR 92  99  99  TYR TYR B . n 
F 3 93  LYS 93  100 100 LYS LYS B . n 
F 3 94  LYS 94  101 101 LYS LYS B . n 
F 3 95  PHE 95  102 102 PHE PHE B . n 
F 3 96  ARG 96  103 103 ARG ARG B . n 
F 3 97  GLN 97  104 104 GLN GLN B . n 
F 3 98  LEU 98  105 105 LEU LEU B . n 
F 3 99  ILE 99  106 106 ILE ILE B . n 
F 3 100 GLN 100 107 107 GLN GLN B . n 
F 3 101 VAL 101 108 108 VAL VAL B . n 
F 3 102 ASN 102 109 109 ASN ASN B . n 
F 3 103 PRO 103 110 110 PRO PRO B . n 
F 3 104 ASP 104 111 111 ASP ASP B . n 
F 3 105 ILE 105 112 112 ILE ILE B . n 
F 3 106 LEU 106 113 113 LEU LEU B . n 
F 3 107 MET 107 114 114 MET MET B . n 
F 3 108 ARG 108 115 115 ARG ARG B . n 
F 3 109 LEU 109 116 116 LEU LEU B . n 
F 3 110 SER 110 117 117 SER SER B . n 
F 3 111 ALA 111 118 118 ALA ALA B . n 
F 3 112 GLN 112 119 119 GLN GLN B . n 
F 3 113 MET 113 120 120 MET MET B . n 
F 3 114 ALA 114 121 121 ALA ALA B . n 
F 3 115 ARG 115 122 122 ARG ARG B . n 
F 3 116 ARG 116 123 123 ARG ARG B . n 
F 3 117 LEU 117 124 124 LEU LEU B . n 
F 3 118 GLN 118 125 125 GLN GLN B . n 
F 3 119 VAL 119 126 126 VAL VAL B . n 
F 3 120 THR 120 127 127 THR THR B . n 
F 3 121 SER 121 128 128 SER SER B . n 
F 3 122 GLU 122 129 129 GLU GLU B . n 
F 3 123 LYS 123 130 130 LYS LYS B . n 
F 3 124 VAL 124 131 131 VAL VAL B . n 
F 3 125 GLY 125 132 132 GLY GLY B . n 
F 3 126 ASN 126 133 133 ASN ASN B . n 
F 3 127 LEU 127 134 134 LEU LEU B . n 
F 3 128 ALA 128 135 135 ALA ALA B . n 
F 3 129 PHE 129 136 136 PHE PHE B . n 
F 3 130 LEU 130 137 137 LEU LEU B . n 
F 3 131 ASP 131 138 138 ASP ASP B . n 
F 3 132 VAL 132 139 139 VAL VAL B . n 
F 3 133 THR 133 140 140 THR THR B . n 
F 3 134 GLY 134 141 141 GLY GLY B . n 
F 3 135 ARG 135 142 142 ARG ARG B . n 
F 3 136 ILE 136 143 143 ILE ILE B . n 
F 3 137 ALA 137 144 144 ALA ALA B . n 
F 3 138 GLN 138 145 145 GLN GLN B . n 
F 3 139 THR 139 146 146 THR THR B . n 
F 3 140 LEU 140 147 147 LEU LEU B . n 
F 3 141 LEU 141 148 148 LEU LEU B . n 
F 3 142 ASN 142 149 149 ASN ASN B . n 
F 3 143 LEU 143 150 150 LEU LEU B . n 
F 3 144 ALA 144 151 151 ALA ALA B . n 
F 3 145 LYS 145 152 152 LYS LYS B . n 
F 3 146 GLN 146 153 153 GLN GLN B . n 
F 3 147 PRO 147 154 154 PRO PRO B . n 
F 3 148 ASP 148 155 155 ASP ASP B . n 
F 3 149 ALA 149 156 156 ALA ALA B . n 
F 3 150 MET 150 157 157 MET MET B . n 
F 3 151 THR 151 158 158 THR THR B . n 
F 3 152 HIS 152 159 159 HIS HIS B . n 
F 3 153 PRO 153 160 160 PRO PRO B . n 
F 3 154 ASP 154 161 161 ASP ASP B . n 
F 3 155 GLY 155 162 162 GLY GLY B . n 
F 3 156 MET 156 163 163 MET MET B . n 
F 3 157 GLN 157 164 164 GLN GLN B . n 
F 3 158 ILE 158 165 165 ILE ILE B . n 
F 3 159 LYS 159 166 166 LYS LYS B . n 
F 3 160 ILE 160 167 167 ILE ILE B . n 
F 3 161 THR 161 168 168 THR THR B . n 
F 3 162 ARG 162 169 169 ARG ARG B . n 
F 3 163 GLN 163 170 170 GLN GLN B . n 
F 3 164 GLU 164 171 171 GLU GLU B . n 
F 3 165 ILE 165 172 172 ILE ILE B . n 
F 3 166 GLY 166 173 173 GLY GLY B . n 
F 3 167 GLN 167 174 174 GLN GLN B . n 
F 3 168 ILE 168 175 175 ILE ILE B . n 
F 3 169 VAL 169 176 176 VAL VAL B . n 
F 3 170 GLY 170 177 177 GLY GLY B . n 
F 3 171 CYS 171 178 178 CYS CYS B . n 
F 3 172 SER 172 179 179 SER SER B . n 
F 3 173 ARG 173 180 180 ARG ARG B . n 
F 3 174 GLU 174 181 181 GLU GLU B . n 
F 3 175 THR 175 182 182 THR THR B . n 
F 3 176 VAL 176 183 183 VAL VAL B . n 
F 3 177 GLY 177 184 184 GLY GLY B . n 
F 3 178 ARG 178 185 185 ARG ARG B . n 
F 3 179 ILE 179 186 186 ILE ILE B . n 
F 3 180 LEU 180 187 187 LEU LEU B . n 
F 3 181 LYS 181 188 188 LYS LYS B . n 
F 3 182 MET 182 189 189 MET MET B . n 
F 3 183 LEU 183 190 190 LEU LEU B . n 
F 3 184 GLU 184 191 191 GLU GLU B . n 
F 3 185 ASP 185 192 192 ASP ASP B . n 
F 3 186 GLN 186 193 193 GLN GLN B . n 
F 3 187 ASN 187 194 194 ASN ASN B . n 
F 3 188 LEU 188 195 195 LEU LEU B . n 
F 3 189 ILE 189 196 196 ILE ILE B . n 
F 3 190 SER 190 197 197 SER SER B . n 
F 3 191 ALA 191 198 198 ALA ALA B . n 
F 3 192 HIS 192 199 199 HIS HIS B . n 
F 3 193 GLY 193 200 200 GLY GLY B . n 
F 3 194 LYS 194 201 201 LYS LYS B . n 
F 3 195 THR 195 202 202 THR THR B . n 
F 3 196 ILE 196 203 203 ILE ILE B . n 
F 3 197 VAL 197 204 204 VAL VAL B . n 
F 3 198 VAL 198 205 205 VAL VAL B . n 
F 3 199 TYR 199 206 ?   ?   ?   B . n 
F 3 200 GLY 200 207 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CMP 1  762 762 CMP CMP A . 
H 4 CMP 1  761 761 CMP CMP B . 
I 5 HOH 1  116 116 HOH HOH C . 
I 5 HOH 2  139 139 HOH HOH C . 
I 5 HOH 3  140 140 HOH HOH C . 
I 5 HOH 4  152 152 HOH HOH C . 
J 5 HOH 1  105 105 HOH HOH D . 
J 5 HOH 2  118 118 HOH HOH D . 
J 5 HOH 3  123 123 HOH HOH D . 
J 5 HOH 4  129 129 HOH HOH D . 
J 5 HOH 5  134 134 HOH HOH D . 
J 5 HOH 6  145 145 HOH HOH D . 
J 5 HOH 7  155 155 HOH HOH D . 
K 5 HOH 1  111 111 HOH HOH E . 
K 5 HOH 2  114 114 HOH HOH E . 
K 5 HOH 3  133 133 HOH HOH E . 
K 5 HOH 4  136 136 HOH HOH E . 
K 5 HOH 5  153 153 HOH HOH E . 
L 5 HOH 1  117 117 HOH HOH F . 
L 5 HOH 2  137 137 HOH HOH F . 
M 5 HOH 1  763 101 HOH HOH A . 
M 5 HOH 2  764 102 HOH HOH A . 
M 5 HOH 3  765 103 HOH HOH A . 
M 5 HOH 4  766 106 HOH HOH A . 
M 5 HOH 5  767 107 HOH HOH A . 
M 5 HOH 6  768 108 HOH HOH A . 
M 5 HOH 7  769 115 HOH HOH A . 
M 5 HOH 8  770 121 HOH HOH A . 
M 5 HOH 9  771 124 HOH HOH A . 
M 5 HOH 10 772 125 HOH HOH A . 
M 5 HOH 11 773 126 HOH HOH A . 
M 5 HOH 12 774 130 HOH HOH A . 
M 5 HOH 13 775 131 HOH HOH A . 
M 5 HOH 14 776 135 HOH HOH A . 
M 5 HOH 15 777 142 HOH HOH A . 
M 5 HOH 16 778 146 HOH HOH A . 
M 5 HOH 17 779 147 HOH HOH A . 
M 5 HOH 18 780 148 HOH HOH A . 
M 5 HOH 19 781 149 HOH HOH A . 
N 5 HOH 1  762 100 HOH HOH B . 
N 5 HOH 2  763 104 HOH HOH B . 
N 5 HOH 3  764 109 HOH HOH B . 
N 5 HOH 4  765 110 HOH HOH B . 
N 5 HOH 5  766 112 HOH HOH B . 
N 5 HOH 6  767 113 HOH HOH B . 
N 5 HOH 7  768 119 HOH HOH B . 
N 5 HOH 8  769 120 HOH HOH B . 
N 5 HOH 9  770 122 HOH HOH B . 
N 5 HOH 10 771 127 HOH HOH B . 
N 5 HOH 11 772 128 HOH HOH B . 
N 5 HOH 12 773 132 HOH HOH B . 
N 5 HOH 13 774 138 HOH HOH B . 
N 5 HOH 14 775 141 HOH HOH B . 
N 5 HOH 15 776 143 HOH HOH B . 
N 5 HOH 16 777 144 HOH HOH B . 
N 5 HOH 17 778 150 HOH HOH B . 
N 5 HOH 18 779 151 HOH HOH B . 
N 5 HOH 19 780 154 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-08 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
VRIED 'data reduction' .   ? 1 
AMoRE phasing          .   ? 2 
CNS   refinement       0.5 ? 3 
VRIED 'data scaling'   .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OP2 
_pdbx_validate_close_contact.auth_asym_id_1   D 
_pdbx_validate_close_contact.auth_comp_id_1   DA 
_pdbx_validate_close_contact.auth_seq_id_1    9 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OG1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   THR 
_pdbx_validate_close_contact.auth_seq_id_2    182 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.08 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLN 
_pdbx_validate_rmsd_angle.auth_seq_id_1              153 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              154 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              154 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                131.12 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            11.82 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 18  ? ? -171.19 73.37   
2  1 HIS A 19  ? ? -34.95  136.55  
3  1 SER A 25  ? ? -34.19  135.70  
4  1 GLU A 34  ? ? -37.22  150.76  
5  1 GLU A 37  ? ? -160.16 3.32    
6  1 LYS A 44  ? ? -176.96 140.86  
7  1 VAL A 47  ? ? -112.09 -166.13 
8  1 SER A 62  ? ? 171.07  171.57  
9  1 ASN A 65  ? ? -109.11 -166.04 
10 1 ILE A 97  ? ? -123.63 -58.63  
11 1 SER A 98  ? ? 122.05  129.85  
12 1 ILE A 106 ? ? -90.08  -63.70  
13 1 ASN A 109 ? ? -161.85 75.11   
14 1 PRO A 110 ? ? -55.21  -2.58   
15 1 ILE A 112 ? ? -54.86  -9.99   
16 1 MET A 114 ? ? -83.98  -76.06  
17 1 ARG A 115 ? ? -24.66  -53.05  
18 1 ALA A 121 ? ? -35.19  -71.72  
19 1 THR A 140 ? ? -58.98  -78.02  
20 1 ALA A 151 ? ? -44.14  -12.88  
21 1 PRO A 154 ? ? -56.49  73.45   
22 1 ASP A 155 ? ? 162.01  15.73   
23 1 GLU A 181 ? ? -62.42  -88.01  
24 1 THR A 182 ? ? -26.25  -28.90  
25 1 ALA A 198 ? ? -110.92 -113.11 
26 1 HIS A 199 ? ? 77.57   84.39   
27 1 VAL A 205 ? ? 59.09   77.48   
28 1 TYR A 206 ? ? 53.43   157.07  
29 1 LEU B 11  ? ? -56.75  -1.18   
30 1 SER B 25  ? ? -67.28  80.65   
31 1 LYS B 26  ? ? 137.64  -15.42  
32 1 LYS B 35  ? ? 30.12   107.32  
33 1 GLU B 37  ? ? -141.73 25.42   
34 1 ILE B 42  ? ? -34.27  105.50  
35 1 GLU B 54  ? ? -15.18  -66.47  
36 1 GLU B 55  ? ? -56.70  0.12    
37 1 GLN B 66  ? ? -58.26  93.69   
38 1 LEU B 73  ? ? -40.23  -0.89   
39 1 GLU B 78  ? ? -49.05  160.97  
40 1 ARG B 82  ? ? -24.56  157.94  
41 1 THR B 90  ? ? -107.80 -145.19 
42 1 ILE B 97  ? ? -175.45 139.31  
43 1 VAL B 108 ? ? -66.53  -72.12  
44 1 ALA B 121 ? ? 176.87  -34.42  
45 1 GLN B 125 ? ? -73.68  -70.38  
46 1 VAL B 139 ? ? -9.61   -51.89  
47 1 THR B 140 ? ? -53.23  -73.31  
48 1 LYS B 152 ? ? -87.44  -124.18 
49 1 GLN B 153 ? ? -10.69  132.59  
50 1 PRO B 154 ? ? -18.60  170.76  
51 1 ASP B 155 ? ? 76.77   -16.26  
52 1 VAL B 176 ? ? -63.18  -82.78  
53 1 THR B 182 ? ? -171.65 -56.18  
54 1 ASN B 194 ? ? 94.90   28.96   
55 1 ILE B 196 ? ? -134.41 -135.03 
56 1 SER B 197 ? ? -171.83 149.86  
57 1 HIS B 199 ? ? 167.52  70.45   
58 1 VAL B 204 ? ? -78.04  48.62   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 8   ? E ASP 1   
2 1 Y 1 B ASP 8   ? F ASP 1   
3 1 Y 1 B TYR 206 ? F TYR 199 
4 1 Y 1 B GLY 207 ? F GLY 200 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1O3T 'double helix'        
1O3T 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2  1_555 B DG 17 1_555 0.154  -0.033 0.719  -14.549 10.912  -3.192  1  C_DC-4:DG-4_D C -4 ? D -4 ? 19 1 
1 A DG 3  1_555 B DC 16 1_555 -0.471 -0.077 0.216  6.011   5.531   2.585   2  C_DG-3:DC-3_D C -3 ? D -3 ? 19 1 
1 A DA 4  1_555 B DT 15 1_555 0.007  -0.107 -1.111 -6.562  -34.043 -1.963  3  C_DA-2:DT-2_D C -2 ? D -2 ? 20 1 
1 A DA 5  1_555 B DT 14 1_555 0.050  -0.077 0.007  7.510   -15.631 1.829   4  C_DA-1:DT-1_D C -1 ? D -1 ? 20 1 
1 A DA 6  1_555 B DT 13 1_555 -0.098 -0.059 -0.140 2.718   -23.861 1.872   5  C_DA1:DT1_D   C 1  ? D 1  ? 20 1 
1 A DA 7  1_555 B DT 12 1_555 -0.040 -0.271 0.349  -1.939  -13.599 -1.770  6  C_DA2:DT2_D   C 2  ? D 2  ? 20 1 
1 A DA 8  1_555 B DT 11 1_555 -0.092 -0.840 1.826  2.283   2.021   6.250   7  C_DA3:DT3_D   C 3  ? D 3  ? 20 1 
1 A DT 9  1_555 B DA 10 1_555 -0.171 -0.502 1.891  -11.968 11.553  1.378   8  C_DT4:DA4_D   C 4  ? D 4  ? 20 1 
1 A DG 10 1_555 B DC 9  1_555 -0.180 0.090  -0.786 -8.589  12.618  0.198   9  C_DG5:DC5_D   C 5  ? D 5  ? 19 1 
1 A DC 11 1_555 B DG 8  1_555 0.004  -0.391 -1.353 4.067   -9.372  1.936   10 C_DC6:DG6_D   C 6  ? D 6  ? 19 1 
1 A DG 12 1_555 B DC 7  1_555 -0.101 -0.057 -0.945 -25.415 -11.678 -1.106  11 C_DG7:DC7_D   C 7  ? D 7  ? 19 1 
1 A DA 13 1_555 B DT 6  1_555 0.288  -0.002 -0.653 -2.536  -10.548 -4.087  12 C_DA8:DT8_D   C 8  ? D 8  ? 20 1 
1 A DT 14 1_555 B DA 5  1_555 -0.091 0.060  0.419  -3.786  -4.288  -6.847  13 C_DT9:DA9_D   C 9  ? D 9  ? 20 1 
1 C DC 1  1_555 B DG 4  1_555 -0.338 -0.198 -0.091 0.025   -1.545  -5.694  14 E_DC10:DG10_D E 10 ? D 10 ? 19 1 
1 C DT 2  1_555 B DA 3  1_555 0.181  -0.153 -1.185 9.631   -19.405 -1.042  15 E_DT11:DA11_D E 11 ? D 11 ? 20 1 
1 C DA 3  1_555 B DT 2  1_555 0.182  0.027  -0.180 -5.243  -2.440  -2.526  16 E_DA12:DT12_D E 12 ? D 12 ? 20 1 
1 C DG 4  1_555 B DC 1  1_555 -0.037 -0.160 -0.605 15.287  -10.809 4.325   17 E_DG13:DC13_D E 13 ? D 13 ? 19 1 
1 C DA 5  1_555 D DT 14 1_555 0.154  0.019  0.732  29.216  -17.224 1.913   18 E_DA14:DT14_F E 14 ? F 14 ? 20 1 
1 C DT 6  1_555 D DA 13 1_555 -0.258 -0.092 0.473  12.049  -12.795 -8.292  19 E_DT15:DA15_F E 15 ? F 15 ? 20 1 
1 C DC 7  1_555 D DG 12 1_555 -0.459 -0.181 -0.735 28.417  15.594  -12.333 20 E_DC16:DG16_F E 16 ? F 16 ? 19 1 
1 C DG 8  1_555 D DC 11 1_555 0.217  0.007  0.055  -13.822 14.865  -0.044  21 E_DG17:DC17_F E 17 ? F 17 ? 19 1 
1 C DC 9  1_555 D DG 10 1_555 0.254  -0.068 -0.708 8.568   1.556   -1.068  22 E_DC18:DG18_F E 18 ? F 18 ? 19 1 
1 C DA 10 1_555 D DT 9  1_555 0.118  -0.070 0.442  7.926   -0.792  0.180   23 E_DA19:DT19_F E 19 ? F 19 ? 20 1 
1 C DT 11 1_555 D DA 8  1_555 0.071  -0.143 0.613  -2.686  -9.931  0.116   24 E_DT20:DA20_F E 20 ? F 20 ? 20 1 
1 C DT 12 1_555 D DA 7  1_555 -0.074 -0.290 -0.286 2.902   10.462  -0.468  25 E_DT21:DA21_F E 21 ? F 21 ? 20 1 
1 C DT 13 1_555 D DA 6  1_555 -0.124 0.048  -0.435 -2.191  -0.440  0.759   26 E_DT22:DA22_F E 22 ? F 22 ? 20 1 
1 C DT 14 1_555 D DA 5  1_555 -0.299 -0.024 -0.247 -16.137 -16.855 -1.761  27 E_DT23:DA23_F E 23 ? F 23 ? 20 1 
1 C DT 15 1_555 D DA 4  1_555 -0.215 0.127  -0.227 -14.323 -18.077 -8.097  28 E_DT24:DA24_F E 24 ? F 24 ? 20 1 
1 C DC 16 1_555 D DG 3  1_555 0.202  -0.130 0.578  -19.189 -3.914  0.348   29 E_DC25:DG25_F E 25 ? F 25 ? 19 1 
1 C DG 17 1_555 D DC 2  1_555 0.158  -0.010 0.941  20.596  -3.354  -8.012  30 E_DG26:DC26_F E 26 ? F 26 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 B DG 17 1_555 A DG 3  1_555 B DC 16 1_555 0.742  0.273  3.131 4.423   -15.587 38.120 1.993  -0.595 2.876 -22.657 
-6.430  41.302 1  CC_DC-4DG-3:DC-3DG-4_DD C -4 ? D -4 ? C -3 ? D -3 ? 
1 A DG 3  1_555 B DC 16 1_555 A DA 4  1_555 B DT 15 1_555 -1.116 1.269  4.260 13.054  7.645   32.626 0.650  4.220  3.753 12.788  
-21.833 35.876 2  CC_DG-3DA-2:DT-2DC-3_DD C -3 ? D -3 ? C -2 ? D -2 ? 
1 A DA 4  1_555 B DT 15 1_555 A DA 5  1_555 B DT 14 1_555 0.780  0.238  2.963 -8.590  -6.440  36.700 1.075  -2.141 2.643 -9.968  
13.296  38.186 3  CC_DA-2DA-1:DT-1DT-2_DD C -2 ? D -2 ? C -1 ? D -1 ? 
1 A DA 5  1_555 B DT 14 1_555 A DA 6  1_555 B DT 13 1_555 0.184  -0.143 3.058 3.692   2.918   38.990 -0.538 0.138  3.044 4.352   
-5.506  39.262 4  CC_DA-1DA1:DT1DT-1_DD   C -1 ? D -1 ? C 1  ? D 1  ? 
1 A DA 6  1_555 B DT 13 1_555 A DA 7  1_555 B DT 12 1_555 0.038  -1.010 2.989 -2.826  2.811   34.214 -2.101 -0.460 2.887 4.758   
4.783   34.439 5  CC_DA1DA2:DT2DT1_DD     C 1  ? D 1  ? C 2  ? D 2  ? 
1 A DA 7  1_555 B DT 12 1_555 A DA 8  1_555 B DT 11 1_555 0.576  -0.113 2.876 -13.659 -7.642  38.397 0.544  -2.072 2.516 -11.076 
19.795  41.353 6  CC_DA2DA3:DT3DT2_DD     C 2  ? D 2  ? C 3  ? D 3  ? 
1 A DA 8  1_555 B DT 11 1_555 A DT 9  1_555 B DA 10 1_555 -0.301 -1.907 3.840 -0.340  -12.695 32.292 -0.690 0.438  4.270 -21.801 
0.583   34.638 7  CC_DA3DT4:DA4DT3_DD     C 3  ? D 3  ? C 4  ? D 4  ? 
1 A DT 9  1_555 B DA 10 1_555 A DG 10 1_555 B DC 9  1_555 0.493  0.065  3.431 23.557  -9.830  41.863 0.907  1.386  3.187 -12.468 
-29.879 48.731 8  CC_DT4DG5:DC5DA4_DD     C 4  ? D 4  ? C 5  ? D 5  ? 
1 A DG 10 1_555 B DC 9  1_555 A DC 11 1_555 B DG 8  1_555 -0.495 0.427  2.983 3.781   15.807  20.192 -3.216 2.104  2.523 38.090  
-9.112  25.868 9  CC_DG5DC6:DG6DC5_DD     C 5  ? D 5  ? C 6  ? D 6  ? 
1 A DC 11 1_555 B DG 8  1_555 A DG 12 1_555 B DC 7  1_555 0.570  2.645  4.812 3.827   40.707  19.101 -4.166 -0.028 4.509 65.716  
-6.179  44.955 10 CC_DC6DG7:DC7DG6_DD     C 6  ? D 6  ? C 7  ? D 7  ? 
1 A DG 12 1_555 B DC 7  1_555 A DA 13 1_555 B DT 6  1_555 -0.502 3.288  2.565 -11.246 -2.113  33.233 5.700  -0.482 2.397 -3.565  
18.977  35.095 11 CC_DG7DA8:DT8DC7_DD     C 7  ? D 7  ? C 8  ? D 8  ? 
1 A DA 13 1_555 B DT 6  1_555 A DT 14 1_555 B DA 5  1_555 0.410  -0.681 3.535 -8.540  5.991   25.892 -2.902 -2.973 3.020 12.733  
18.150  27.881 12 CC_DA8DT9:DA9DT8_DD     C 8  ? D 8  ? C 9  ? D 9  ? 
1 A DT 14 1_555 B DA 5  1_555 C DC 1  1_555 B DG 4  1_555 0.973  -0.790 3.028 6.831   0.234   35.710 -1.298 -0.651 3.150 0.377   
-11.015 36.337 13 CE_DT9DC10:DG10DA9_DD   C 9  ? D 9  ? E 10 ? D 10 ? 
1 C DC 1  1_555 B DG 4  1_555 C DT 2  1_555 B DA 3  1_555 -0.009 0.460  2.958 13.631  2.786   30.844 0.380  2.033  2.741 4.936   
-24.147 33.768 14 EE_DC10DT11:DA11DG10_DD E 10 ? D 10 ? E 11 ? D 11 ? 
1 C DT 2  1_555 B DA 3  1_555 C DA 3  1_555 B DT 2  1_555 -0.051 1.366  3.773 -6.738  8.931   43.598 0.821  -0.663 3.931 11.795  
8.899   44.943 15 EE_DT11DA12:DT12DA11_DD E 11 ? D 11 ? E 12 ? D 12 ? 
1 C DA 3  1_555 B DT 2  1_555 C DG 4  1_555 B DC 1  1_555 0.659  -0.019 3.068 8.306   3.302   30.272 -0.629 0.279  3.116 6.157   
-15.485 31.534 16 EE_DA12DG13:DC13DT12_DD E 12 ? D 12 ? E 13 ? D 13 ? 
1 C DG 4  1_555 B DC 1  1_555 C DA 5  1_555 D DT 14 1_555 -0.128 0.017  2.882 -6.645  0.138   36.450 0.011  -0.588 2.860 0.219   
10.515  37.031 17 EE_DG13DA14:DT14DC13_FD E 13 ? D 13 ? E 14 ? F 14 ? 
1 C DA 5  1_555 D DT 14 1_555 C DT 6  1_555 D DA 13 1_555 -1.113 -0.631 3.853 1.284   13.056  28.397 -3.983 2.345  3.208 24.996  
-2.459  31.224 18 EE_DA14DT15:DA15DT14_FF E 14 ? F 14 ? E 15 ? F 15 ? 
1 C DT 6  1_555 D DA 13 1_555 C DC 7  1_555 D DG 12 1_555 1.076  2.460  3.132 12.106  -9.161  33.649 5.042  -0.186 2.619 -14.919 
-19.714 36.824 19 EE_DT15DC16:DG16DA15_FF E 15 ? F 15 ? E 16 ? F 16 ? 
1 C DC 7  1_555 D DG 12 1_555 C DG 8  1_555 D DC 11 1_555 0.285  1.830  5.398 -5.264  42.989  24.500 -4.373 -1.144 4.273 61.421  
7.520   49.468 20 EE_DC16DG17:DC17DG16_FF E 16 ? F 16 ? E 17 ? F 17 ? 
1 C DG 8  1_555 D DC 11 1_555 C DC 9  1_555 D DG 10 1_555 -0.100 -0.214 2.782 5.500   15.831  22.714 -3.524 1.277  2.113 34.760  
-12.075 28.162 21 EE_DG17DC18:DG18DC17_FF E 17 ? F 17 ? E 18 ? F 18 ? 
1 C DC 9  1_555 D DG 10 1_555 C DA 10 1_555 D DT 9  1_555 -0.645 0.932  3.415 -13.383 0.319   40.845 1.241  -0.554 3.458 0.442   
18.584  42.894 22 EE_DC18DA19:DT19DG18_FF E 18 ? F 18 ? E 19 ? F 19 ? 
1 C DA 10 1_555 D DT 9  1_555 C DT 11 1_555 D DA 8  1_555 -0.224 -1.301 3.779 -1.648  -3.123  32.325 -1.681 0.062  3.891 -5.589  
2.949   32.512 23 EE_DA19DT20:DA20DT19_FF E 19 ? F 19 ? E 20 ? F 20 ? 
1 C DT 11 1_555 D DA 8  1_555 C DT 12 1_555 D DA 7  1_555 0.109  -0.630 3.324 1.266   -15.839 35.342 1.120  0.000  3.303 -24.612 
-1.967  38.645 24 EE_DT20DT21:DA21DA20_FF E 20 ? F 20 ? E 21 ? F 21 ? 
1 C DT 12 1_555 D DA 7  1_555 C DT 13 1_555 D DA 6  1_555 0.552  -0.813 3.302 3.550   2.897   37.936 -1.610 -0.393 3.270 4.436   
-5.436  38.201 25 EE_DT21DT22:DA22DA21_FF E 21 ? F 21 ? E 22 ? F 22 ? 
1 C DT 13 1_555 D DA 6  1_555 C DT 14 1_555 D DA 5  1_555 -0.255 -0.149 3.410 1.722   -0.476  34.450 -0.175 0.709  3.395 -0.803  
-2.905  34.495 26 EE_DT22DT23:DA23DA22_FF E 22 ? F 22 ? E 23 ? F 23 ? 
1 C DT 14 1_555 D DA 5  1_555 C DT 15 1_555 D DA 4  1_555 -0.503 -0.339 3.016 -0.604  -1.948  40.796 -0.288 0.659  3.036 -2.792  
0.866   40.845 27 EE_DT23DT24:DA24DA23_FF E 23 ? F 23 ? E 24 ? F 24 ? 
1 C DT 15 1_555 D DA 4  1_555 C DC 16 1_555 D DG 3  1_555 0.519  1.374  3.655 -6.116  -1.612  40.031 2.182  -1.500 3.486 -2.337  
8.868   40.508 28 EE_DT24DC25:DG25DA24_FF E 24 ? F 24 ? E 25 ? F 25 ? 
1 C DC 16 1_555 D DG 3  1_555 C DG 17 1_555 D DC 2  1_555 -0.819 0.210  2.453 -3.310  -8.335  33.618 1.313  0.990  2.401 -14.102 
5.600   34.760 29 EE_DC25DG26:DC26DG25_FF E 25 ? F 25 ? E 26 ? F 26 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
5 water                                  HOH 
#