data_1O4X
# 
_entry.id   1O4X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O4X         
RCSB  RCSB001808   
WWPDB D_1000001808 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O4X 
_pdbx_database_status.recvd_initial_deposition_date   2003-07-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'    1 
'Williams, D.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            279 
_citation.page_first                1449 
_citation.page_last                 1457 
_citation.year                      2004 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14559893 
_citation.pdbx_database_id_DOI      10.1074/jbc.M309790200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Williams, D.C.' 1 
primary 'Cai, M.'        2 
primary 'Clore, G.M.'    3 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*G)-3'" 5816.767  1 ? C61A ? ? 
2 polymer syn "5'-D(*CP*AP*TP*TP*AP*GP*CP*AP*TP*GP*AP*CP*AP*AP*AP*GP*AP*CP*A)-3'" 5830.827  1 ? ?    ? ? 
3 polymer man 'transcription factor Oct-1'                                        19081.643 1 ? ?    ? ? 
4 polymer man 'Transcription factor SOX-2'                                        10717.653 1 ? ?    ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DC)(DT)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DC)(DT)(DA)(DA)(DT)(DG)' TGTCTTTGTCATGCTAATG 
C ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DG)(DC)(DA)(DT)(DG)(DA)(DC)(DA)(DA)(DA)(DG)(DA)(DC)(DA)' CATTAGCATGACAAAGACA 
D ? 
3 'polypeptide(L)'        no no 
;GSHMEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAEN
LSSDSSLSSPSALNSPGIEGLSERRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEK
RINPPSS
;
;GSHMEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAEN
LSSDSSLSSPSALNSPGIEGLSERRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEK
RINPPSS
;
A ? 
4 'polypeptide(L)'        no no 
;GSHMPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPR
RKTKTLMK
;
;GSHMPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPR
RKTKTLMK
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DG  n 
1 3   DT  n 
1 4   DC  n 
1 5   DT  n 
1 6   DT  n 
1 7   DT  n 
1 8   DG  n 
1 9   DT  n 
1 10  DC  n 
1 11  DA  n 
1 12  DT  n 
1 13  DG  n 
1 14  DC  n 
1 15  DT  n 
1 16  DA  n 
1 17  DA  n 
1 18  DT  n 
1 19  DG  n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DG  n 
2 7   DC  n 
2 8   DA  n 
2 9   DT  n 
2 10  DG  n 
2 11  DA  n 
2 12  DC  n 
2 13  DA  n 
2 14  DA  n 
2 15  DA  n 
2 16  DG  n 
2 17  DA  n 
2 18  DC  n 
2 19  DA  n 
3 1   GLY n 
3 2   SER n 
3 3   HIS n 
3 4   MET n 
3 5   GLU n 
3 6   GLU n 
3 7   PRO n 
3 8   SER n 
3 9   ASP n 
3 10  LEU n 
3 11  GLU n 
3 12  GLU n 
3 13  LEU n 
3 14  GLU n 
3 15  GLN n 
3 16  PHE n 
3 17  ALA n 
3 18  LYS n 
3 19  THR n 
3 20  PHE n 
3 21  LYS n 
3 22  GLN n 
3 23  ARG n 
3 24  ARG n 
3 25  ILE n 
3 26  LYS n 
3 27  LEU n 
3 28  GLY n 
3 29  PHE n 
3 30  THR n 
3 31  GLN n 
3 32  GLY n 
3 33  ASP n 
3 34  VAL n 
3 35  GLY n 
3 36  LEU n 
3 37  ALA n 
3 38  MET n 
3 39  GLY n 
3 40  LYS n 
3 41  LEU n 
3 42  TYR n 
3 43  GLY n 
3 44  ASN n 
3 45  ASP n 
3 46  PHE n 
3 47  SER n 
3 48  GLN n 
3 49  THR n 
3 50  THR n 
3 51  ILE n 
3 52  SER n 
3 53  ARG n 
3 54  PHE n 
3 55  GLU n 
3 56  ALA n 
3 57  LEU n 
3 58  ASN n 
3 59  LEU n 
3 60  SER n 
3 61  PHE n 
3 62  LYS n 
3 63  ASN n 
3 64  MET n 
3 65  ALA n 
3 66  LYS n 
3 67  LEU n 
3 68  LYS n 
3 69  PRO n 
3 70  LEU n 
3 71  LEU n 
3 72  GLU n 
3 73  LYS n 
3 74  TRP n 
3 75  LEU n 
3 76  ASN n 
3 77  ASP n 
3 78  ALA n 
3 79  GLU n 
3 80  ASN n 
3 81  LEU n 
3 82  SER n 
3 83  SER n 
3 84  ASP n 
3 85  SER n 
3 86  SER n 
3 87  LEU n 
3 88  SER n 
3 89  SER n 
3 90  PRO n 
3 91  SER n 
3 92  ALA n 
3 93  LEU n 
3 94  ASN n 
3 95  SER n 
3 96  PRO n 
3 97  GLY n 
3 98  ILE n 
3 99  GLU n 
3 100 GLY n 
3 101 LEU n 
3 102 SER n 
3 103 GLU n 
3 104 ARG n 
3 105 ARG n 
3 106 LYS n 
3 107 LYS n 
3 108 ARG n 
3 109 THR n 
3 110 SER n 
3 111 ILE n 
3 112 GLU n 
3 113 THR n 
3 114 ASN n 
3 115 ILE n 
3 116 ARG n 
3 117 VAL n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 LYS n 
3 122 SER n 
3 123 PHE n 
3 124 LEU n 
3 125 GLU n 
3 126 ASN n 
3 127 GLN n 
3 128 LYS n 
3 129 PRO n 
3 130 THR n 
3 131 SER n 
3 132 GLU n 
3 133 GLU n 
3 134 ILE n 
3 135 THR n 
3 136 MET n 
3 137 ILE n 
3 138 ALA n 
3 139 ASP n 
3 140 GLN n 
3 141 LEU n 
3 142 ASN n 
3 143 MET n 
3 144 GLU n 
3 145 LYS n 
3 146 GLU n 
3 147 VAL n 
3 148 ILE n 
3 149 ARG n 
3 150 VAL n 
3 151 TRP n 
3 152 PHE n 
3 153 CYS n 
3 154 ASN n 
3 155 ARG n 
3 156 ARG n 
3 157 GLN n 
3 158 LYS n 
3 159 GLU n 
3 160 LYS n 
3 161 ARG n 
3 162 ILE n 
3 163 ASN n 
3 164 PRO n 
3 165 PRO n 
3 166 SER n 
3 167 SER n 
4 1   GLY n 
4 2   SER n 
4 3   HIS n 
4 4   MET n 
4 5   PRO n 
4 6   ASP n 
4 7   ARG n 
4 8   VAL n 
4 9   LYS n 
4 10  ARG n 
4 11  PRO n 
4 12  MET n 
4 13  ASN n 
4 14  ALA n 
4 15  PHE n 
4 16  MET n 
4 17  VAL n 
4 18  TRP n 
4 19  SER n 
4 20  ARG n 
4 21  GLY n 
4 22  GLN n 
4 23  ARG n 
4 24  ARG n 
4 25  LYS n 
4 26  MET n 
4 27  ALA n 
4 28  GLN n 
4 29  GLU n 
4 30  ASN n 
4 31  PRO n 
4 32  LYS n 
4 33  MET n 
4 34  HIS n 
4 35  ASN n 
4 36  SER n 
4 37  GLU n 
4 38  ILE n 
4 39  SER n 
4 40  LYS n 
4 41  ARG n 
4 42  LEU n 
4 43  GLY n 
4 44  ALA n 
4 45  GLU n 
4 46  TRP n 
4 47  LYS n 
4 48  LEU n 
4 49  LEU n 
4 50  SER n 
4 51  GLU n 
4 52  THR n 
4 53  GLU n 
4 54  LYS n 
4 55  ARG n 
4 56  PRO n 
4 57  PHE n 
4 58  ILE n 
4 59  ASP n 
4 60  GLU n 
4 61  ALA n 
4 62  LYS n 
4 63  ARG n 
4 64  LEU n 
4 65  ARG n 
4 66  ALA n 
4 67  LEU n 
4 68  HIS n 
4 69  MET n 
4 70  LYS n 
4 71  GLU n 
4 72  HIS n 
4 73  PRO n 
4 74  ASP n 
4 75  TYR n 
4 76  LYS n 
4 77  TYR n 
4 78  ARG n 
4 79  PRO n 
4 80  ARG n 
4 81  ARG n 
4 82  LYS n 
4 83  THR n 
4 84  LYS n 
4 85  THR n 
4 86  LEU n 
4 87  MET n 
4 88  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? human Homo ?    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? human Homo SOX2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PO2F1_HUMAN P14859 3 
;EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSD
SSLSSPSALNSPGIEGLSERRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
PSS
;
303 ? 
2 UNP SOX2_HUMAN  P48431 4 
;DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
LMK
;
39  ? 
3 PDB 1O4X        1O4X   1 ? ?   ? 
4 PDB 1O4X        1O4X   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O4X A 5 ? 167 ? P14859 303 ? 465 ? 5   167 
2 2 1O4X B 6 ? 88  ? P48431 39  ? 121 ? 206 288 
3 3 1O4X C 1 ? 19  ? 1O4X   301 ? 319 ? 301 319 
4 4 1O4X D 1 ? 19  ? 1O4X   320 ? 338 ? 320 338 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1O4X GLY A 1  ? UNP P14859 ?   ?   'CLONING ARTIFACT' 1   1  
1 1O4X SER A 2  ? UNP P14859 ?   ?   'CLONING ARTIFACT' 2   2  
1 1O4X HIS A 3  ? UNP P14859 ?   ?   'CLONING ARTIFACT' 3   3  
1 1O4X MET A 4  ? UNP P14859 ?   ?   'CLONING ARTIFACT' 4   4  
1 1O4X ALA A 65 ? UNP P14859 CYS 363 ENGINEERED         65  5  
2 1O4X GLY B 1  ? UNP P48431 ?   ?   'CLONING ARTIFACT' 201 6  
2 1O4X SER B 2  ? UNP P48431 ?   ?   'CLONING ARTIFACT' 202 7  
2 1O4X HIS B 3  ? UNP P48431 ?   ?   'CLONING ARTIFACT' 203 8  
2 1O4X MET B 4  ? UNP P48431 ?   ?   'CLONING ARTIFACT' 204 9  
2 1O4X PRO B 5  ? UNP P48431 ?   ?   'CLONING ARTIFACT' 205 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '1) TRIPLE RESONANCE FOR ASSIGNMENT OF PROTEIN'                                       1 
2 1 '(2) QUANTITATIVE J CORRELATION FOR COUPLING CONSTANTS'                               1 
3 1 '(3) 3D HETERONUCLEAR SEPARATED'                                                      1 
4 1 'FILTERED NOE EXPTS'                                                                  1 
5 1 '(4) IPAP EXPERIMENTS'                                                                1 
6 1 'TRIPLE RESONANC FOR DIPOLAR COUPLINGS. DIPOLAR COUPLINGS WERE MEASURED IN PHAGE PF1' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303.00 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.50 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10 mM SODIUM PHOSPHATE' 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX500 Bruker 500 ? 
2 DMX600 Bruker 600 ? 
3 DRX600 Bruker 750 ? 
4 DRX750 Bruker 800 ? 
5 DRX800 Bruker 800 ? 
# 
_pdbx_nmr_refine.entry_id           1O4X 
_pdbx_nmr_refine.method             'CONJOINED RIGID BODY/TORSION ANGLE DYNAMICS' 
_pdbx_nmr_refine.details            
;THE STRUCTURES WERE CALCULATED BY CONJOINED RIGID BODY/TORSION ANGLE DYNAMICS (SCHWIETERS & CLORE (2001) J.MAGN.RESON 152, 288-302). THE TARGET FUNCTION COMPRISES TERMS FOR THE DIPOLAR COUPLING RESTRAINTS (CLORE ET AL. J.MAGN.RESON. 131, 159-162 (1998); J.MAGN.RESON. 133, 216- 221(1998)), INTERMOLECULAR NOE RESTRAINTS AND TORSION ANGLE RESTRAINTS. THE NON-BONDED TERMS INCLUDE A QUARTIC VAN DER WAALS REPULSION TERM (NILGES ET AL. (1988) FEBS LETT. 229, 129-136), RADIUS OF GYRATION RESTRAINTS 
(KUSZEWSKI ET AL. (1999) J.AM.CHEM.SOC 121, 2337-2338) AT THE PROTEIN-PROTEIN AND PROTEIN-DNA INTERFACES, AND DATABASE TORSION ANGLE AND BASE-BASE POSITIONAL POTENTIALS OF MEAN FORCE (KUSZEWSKI ET AL. (2001) J.AM.CHEM.SOC 123, 3903-3918; CLORE & KUSZEWSKI (2003) J.AM.CHEM.SOC. 125, 1518-1525). THE STARTING COORDINATES FOR THE POUHD AND POUS DOMAINS OF OCT1 ARE TAKEN FROM THE 1.9 A RESOLUTION CRYSTAL STRUCTURE OF THE OCT1/MORE-DNA COMPLEX (1E3O) AND PLACED IN THE ORIENTATION OF THE 2.7 A RESOLUTION CRYSTAL STRUCTURE OF THE OCT1/PORE-DNA COMPLEX (1HFO) (REMENYI ET AL. (2001) MOL.CELL 8, 569-580). THE STARTING COORDINATES FOR SOX2 ARE DERIVED FROM THE NMR STRUCTURE OF THE RELATED BINARY SRY-DNA COMPLEX (1J46) (MURPHY ET AL. (2001) J.MOL.BIOL. 312, 481-499). THE STARTING COORDINATES FOR THE 19MER DNA WERE BUILT AS FOLLOWS: THE POUS AND POUHD HEMI-BINDING SITES (B.P. 11-14 AND 17-19, RESPECTIVELY) WERE DERIVED FROM THE 1.9 A RESIOLUTION STRUCTURE OF THE OCT1/MORE-DNA COMPLEX (1E3O); THE 
SOX2 BINDING SITE (B.P. 1-10) WAS DERIVED FROM THE NMR STRUCTURE OF THE BINARY SRY/DNA COMPLEX (1J46); AND THE INTERVENING SEQUENCES (B.P. 15-16) AND REGIONS CONTAINING SUBSTITUTIONS (B.P. 1, 4 AND 10) WERE DERIVED FROM CLASSICAL DNA. THE RESULTING MODEL WAS SUBJECTED TO REGULARIZATION. THE STRATEGY USED IN THE CONJOINED RIGID BODY/TORSION ANGLE DYNAMICS CALCULATIONS IS AS FOLLOWS: THERE ARE 4 RIGID BODIES: (1) BACKBONE AND NON-INTERFACIAL SIDE CHAINS OF POUHD + B.P. 17-19 OF THE DNA (2) BACKBONE AND NON-INTERFACIAL SIDE CHAINS OF POUS; (3) BACKBONE AND NON-INTERFACIAL SIDE CHAINS OF SOX2 + B.P. 1-4 OF THE DNA; (4) THE AXIS OF THE DIPOLAR COUPLING ALIGNMENT TENSOR.  RIGID BODIES 1-3 HAVE ROTATIONAL AND TRANSLATIONAL DEGREES OF FREEDOM, WHILE RIGID BODY 4 IS GIVEN ONLY ROTATIONAL DEGREES OF FREEDOM. THE FOLLOWING SIDE CHAINS WERE GIVEN TORSIONAL DEGREES OF FREEDOM: (1) POUHD: 10 RESIDUES AT POUHD-DNA INTERFACE (RESIDUES 107, 108, 113, 144, 147, 148, 151, 154, 155 AND 158) WITH 24 SIDE C
AIN TORSION ANGLES RESTRAINED TO WITHIN A RANGE OF +/-20 DEGREES OF VALUES IN BINARY OCT1/DNA COMPLEXES (2) POUS: (A) 6 RESIDUES AT POUS/SOX2 INTERFACE (RESIDUES 14, 17, 18, 21, 26 AND 52); (B) 14 RESIDUES AT POUS/DNA INTERFACE (RESIDUES 20, 27, 41, 42, 44, 45, 46, 48, 49, 54, 58, 59, 62 AND 63) WITH 35 SIDE CHAIN TORSION ANGLES RESTRAINED TO WITHIN A RANGE OF +/-20 DEGREES OF VALUES IN BINARY OCT1/DNA COMPLEXES (3) SOX2: (A) 7 RESIDUES AT POUS/SOX2 INTERFACE (RESIDUES 59, 62, 63, 66, 67, 71, 
73); (B) 18 RESIDUES AT SOX2/DNA INTERFACE (RESIDUES 4, 6, 7, 8, 9, 10, 12, 13 17, 31, 35, 43, 44, 51, 55, 76, 78, 79) WITH 35 SIDE CHAIN TORSION ANGLES RESTRAINED TO WITHIN A RANGE OF +/-20 DEGREES OF VALUES IN BINARY SRY/DNA COMPLEXES. BASE PAIRS 5-16 OF THE DNA WERE GIVEN TORSIONAL DEGREES OF FREEDOM WITH 220 LOOSE BACKBONE PHOSPHODIESTER TORSION ANGLE RESTRAINTS TO PREVENT LOCAL MIRROR IMAGES (MURPHY ET AL. (2001) J.MOL.BIOL. 312, 481-499).
THE NUMBERING SYSTEM IS AS FOLLOWS:
    OCT1 POUS DOMAIN: 5-79
    OCT1 POUHD DOMAIN: 110-163
    SOX-2 HMG-BOX: 206-282
RESIDUES 1-4, 80-109, 201-205 AND 283-288 ARE DISORDERED
IN SOLUTION AND THUS NOT INCLUDED IN THE COORDINATES.

IN THIS ENTRY THE LAST COLUMN REPRESENTS THE AVERAGE RMS
DIFFERENCE BETWEEN THE INDIVIDUAL SIMULATED ANNEALING
STRUCTURES AND THE MEAN COORDINATE POSITIONS. IT IS
IMPORTANT TO NOTE THAT SINCE THE BACKBONE AND NON-
INTERFACIAL SIECHAINS OF THE THREE PROTEIN DOMAINS ARE 
TREATED AS RIGID BODIES, THESE NUMBERS DO NOT TAKE INTO 
ACCOUNT THE ERRORS IN THE X-RAY COORDINATES OF OCT1 OR 
THE NMR COORDINATES OF THE HOMOLOGOUS SRY.

RESIDUE NUMBERING: THIS FOLLOWS THE NUMBERING USED
PREVIOUS STRUCTURAL WORK ON THE BINARY OCT1/DNA
COMPLEX (KLEMM ET AL. (1994) CELL 77, 21-32;
REMENYI ET AL. MOL.CELL (2001) 8, 569-580);
AND THE BINARY SRY/DNA COMPLEX  (MURPHY ET AL.
(2001) J.MOL.BIOL. 312, 481-499).

THE SIDECHAINS OF K18, Q22, K262, R265 AND K276 ARE IN 
MULTIPLE CONFORMATIONS.

EXPERIMENTAL NMR RESTRAINTS:
  RESIDUAL DIPOLAR COUPLINGS: 345
    (1) SOX2: 51 NH, 39 NC', 49 CaC'
    (2) POUS: 39 NH, 33 NC', 34 CaC'
    (3) POUHD: 39 NH, 34 NC', 27 CaC'
  INTERMOLECULAR NOE-DERIVED INTERPROTON DISTANCE 
  RESTRAINTS: 
    67 (16, 48 AND 3 at POUS/SOX2, SOX2/DNA
      AND POUHD/DNA INTERFACES)
  TORSION ANGLE RESTRAINTS: 21
      (18 AT POUS/SOX2 INTERFACE AND 3 AT SOX2/DNA 
INTERFACE).
NH DIPOLAR COUPLING R-FACTORS
            TERNARY COMPLEX  INDIVIDUAL DOMAINS
  SOX2         17.7%           16.5%
  POUS         16.7%           16.2%
  POUHD        17.7%           17.5%
  (THE VALUES GIVEN FOR THE INDIVIDUAL DOMAINS
  ARE CALCULATED USING A SEPARATED ALIGNMENT
  TENSOR FOR EACH DOMAIN AND ARE SIMPLY LISTED
  FOR REFERENCE. THE VALUES FOR THE TERNARY
  COMPLEX (USING THE RESTRAINED REGULARIZED MEAN
  COORDINATES) MAKE USE OF A SINGLE ALIGNMENT
  TENSOR FOR THE ENTIRE COMPLEX).
NON-EXPERIMENTAL RESTRAINTS:
  (1) 220 LOOSE TORSION ANGLE RESTRAINTS FOR THE 
   SUGAR-PHOSPHATE BACKBONE
  (2) 106 LOOSE TORSION ANGLE RESTRAINTS FOR SIDE CHAINS
      AT PROTEIN-DNA INTERFACES
  (3) 35 LOOSE DISTANCE RESTRAINTS AT THE POUS/DNA AND
      POUHD/DNA INTERFACES TO PRESERVE HYDROGEN BONDING
      INTERCATIONS AND SALT BRIDGES TO BASES AND PHOSPHATES
  (4) WEAK NCS RESTRAINT TO PROVIDE A TRANSLATIONAL RESTRANT
      BETWEEN POUS AND POUHD.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1O4X 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'REGULARIZED MEAN STRUCTURE' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR_NIH 
_pdbx_nmr_software.version          '(HTTP://NMR.CIT.NIH.GOV/XPLOR_NIH)' 
_pdbx_nmr_software.authors          'SCHWIETERS, KUSZEWSKI, TJANDRA, CLORE' 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1O4X 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1O4X 
_struct.title                     
;TERNARY COMPLEX OF THE DNA BINDING DOMAINS OF THE OCT1 AND SOX2 TRANSCRIPTION FACTORS WITH A 19MER OLIGONUCLEOTIDE FROM THE HOXB1 REGULATORY ELEMENT
;
_struct.pdbx_descriptor           'transcription factor Oct-1/Transcription factor SOX-2/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O4X 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'OCT1, POU, POUS, POUHD, SOX2, HMG-BOX, TRANSCRIPTION FACTORS, DNA, PROTEIN-DNA COMPLEX, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP C 9   ? LEU C 27  ? ASP A 9   LEU A 27  1 ? 19 
HELX_P HELX_P2  2  THR C 30  ? GLY C 43  ? THR A 30  GLY A 43  1 ? 14 
HELX_P HELX_P3  3  SER C 47  ? LEU C 57  ? SER A 47  LEU A 57  1 ? 11 
HELX_P HELX_P4  4  SER C 60  ? GLU C 79  ? SER A 60  GLU A 79  1 ? 20 
HELX_P HELX_P5  5  GLU C 112 ? ASN C 126 ? GLU A 112 ASN A 126 1 ? 15 
HELX_P HELX_P6  6  THR C 130 ? ASN C 142 ? THR A 130 ASN A 142 1 ? 13 
HELX_P HELX_P7  7  GLU C 144 ? LYS C 160 ? GLU A 144 LYS A 160 1 ? 17 
HELX_P HELX_P8  8  ASN D 13  ? ASN D 30  ? ASN B 213 ASN B 230 1 ? 18 
HELX_P HELX_P9  9  HIS D 34  ? LYS D 47  ? HIS B 234 LYS B 247 1 ? 14 
HELX_P HELX_P10 10 SER D 50  ? HIS D 72  ? SER B 250 HIS B 272 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 1  N3 ? ? ? 1_555 B DA 19 N1 ? ? C DT 301 D DA 338 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DT 1  O4 ? ? ? 1_555 B DA 19 N6 ? ? C DT 301 D DA 338 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 18 N3 ? ? C DG 302 D DC 337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 18 O2 ? ? C DG 302 D DC 337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 18 N4 ? ? C DG 302 D DC 337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 17 N1 ? ? C DT 303 D DA 336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 17 N6 ? ? C DT 303 D DA 336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG 16 N1 ? ? C DC 304 D DG 335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG 16 O6 ? ? C DC 304 D DG 335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG 16 N2 ? ? C DC 304 D DG 335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 15 N1 ? ? C DT 305 D DA 334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 15 N6 ? ? C DT 305 D DA 334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 14 N1 ? ? C DT 306 D DA 333 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 14 N6 ? ? C DT 306 D DA 333 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 13 N1 ? ? C DT 307 D DA 332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 13 N6 ? ? C DT 307 D DA 332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 12 N3 ? ? C DG 308 D DC 331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 12 O2 ? ? C DG 308 D DC 331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 12 N4 ? ? C DG 308 D DC 331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 11 N1 ? ? C DT 309 D DA 330 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 11 N6 ? ? C DT 309 D DA 330 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 10 N1 ? ? C DC 310 D DG 329 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 10 O6 ? ? C DC 310 D DG 329 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 10 N2 ? ? C DC 310 D DG 329 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 9  N3 ? ? C DA 311 D DT 328 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 9  O4 ? ? C DA 311 D DT 328 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 8  N1 ? ? C DT 312 D DA 327 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 8  N6 ? ? C DT 312 D DA 327 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 7  N3 ? ? C DG 313 D DC 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 7  O2 ? ? C DG 313 D DC 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 7  N4 ? ? C DG 313 D DC 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DC 14 N3 ? ? ? 1_555 B DG 6  N1 ? ? C DC 314 D DG 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DC 14 N4 ? ? ? 1_555 B DG 6  O6 ? ? C DC 314 D DG 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DC 14 O2 ? ? ? 1_555 B DG 6  N2 ? ? C DC 314 D DG 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DT 15 N3 ? ? ? 1_555 B DA 5  N1 ? ? C DT 315 D DA 324 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DT 15 O4 ? ? ? 1_555 B DA 5  N6 ? ? C DT 315 D DA 324 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 4  N3 ? ? C DA 316 D DT 323 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 4  O4 ? ? C DA 316 D DT 323 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 3  N3 ? ? C DA 317 D DT 322 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 3  O4 ? ? C DA 317 D DT 322 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DT 18 N3 ? ? ? 1_555 B DA 2  N1 ? ? C DT 318 D DA 321 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DT 18 O4 ? ? ? 1_555 B DA 2  N6 ? ? C DT 318 D DA 321 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? A DG 19 N1 ? ? ? 1_555 B DC 1  N3 ? ? C DG 319 D DC 320 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? A DG 19 N2 ? ? ? 1_555 B DC 1  O2 ? ? C DG 319 D DC 320 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? A DG 19 O6 ? ? ? 1_555 B DC 1  N4 ? ? C DG 319 D DC 320 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1O4X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O4X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    O "O5'"  . DT  A 1 1   ? 20.344  2.700   20.665 1.00 0.23 ? 301 DT  C "O5'"  1 
ATOM 2    C "C5'"  . DT  A 1 1   ? 21.355  3.322   21.464 1.00 0.24 ? 301 DT  C "C5'"  1 
ATOM 3    C "C4'"  . DT  A 1 1   ? 20.844  4.608   22.115 1.00 0.25 ? 301 DT  C "C4'"  1 
ATOM 4    O "O4'"  . DT  A 1 1   ? 20.658  5.604   21.100 1.00 0.27 ? 301 DT  C "O4'"  1 
ATOM 5    C "C3'"  . DT  A 1 1   ? 19.516  4.452   22.862 1.00 0.25 ? 301 DT  C "C3'"  1 
ATOM 6    O "O3'"  . DT  A 1 1   ? 19.549  5.212   24.081 1.00 0.26 ? 301 DT  C "O3'"  1 
ATOM 7    C "C2'"  . DT  A 1 1   ? 18.475  5.030   21.920 1.00 0.26 ? 301 DT  C "C2'"  1 
ATOM 8    C "C1'"  . DT  A 1 1   ? 19.272  5.940   20.988 1.00 0.27 ? 301 DT  C "C1'"  1 
ATOM 9    N N1     . DT  A 1 1   ? 18.894  5.827   19.550 1.00 0.27 ? 301 DT  C N1     1 
ATOM 10   C C2     . DT  A 1 1   ? 18.584  7.002   18.866 1.00 0.28 ? 301 DT  C C2     1 
ATOM 11   O O2     . DT  A 1 1   ? 18.577  8.098   19.420 1.00 0.30 ? 301 DT  C O2     1 
ATOM 12   N N3     . DT  A 1 1   ? 18.271  6.852   17.522 1.00 0.29 ? 301 DT  C N3     1 
ATOM 13   C C4     . DT  A 1 1   ? 18.242  5.654   16.812 1.00 0.27 ? 301 DT  C C4     1 
ATOM 14   O O4     . DT  A 1 1   ? 17.949  5.640   15.617 1.00 0.28 ? 301 DT  C O4     1 
ATOM 15   C C5     . DT  A 1 1   ? 18.575  4.485   17.601 1.00 0.25 ? 301 DT  C C5     1 
ATOM 16   C C7     . DT  A 1 1   ? 18.566  3.110   16.944 1.00 0.24 ? 301 DT  C C7     1 
ATOM 17   C C6     . DT  A 1 1   ? 18.885  4.601   18.915 1.00 0.25 ? 301 DT  C C6     1 
ATOM 18   H "H5'"  . DT  A 1 1   ? 22.211  3.560   20.833 1.00 0.24 ? 301 DT  C "H5'"  1 
ATOM 19   H "H5''" . DT  A 1 1   ? 21.669  2.628   22.243 1.00 0.23 ? 301 DT  C "H5''" 1 
ATOM 20   H "H4'"  . DT  A 1 1   ? 21.598  4.963   22.818 1.00 0.26 ? 301 DT  C "H4'"  1 
ATOM 21   H "H3'"  . DT  A 1 1   ? 19.306  3.402   23.074 1.00 0.23 ? 301 DT  C "H3'"  1 
ATOM 22   H "H2'"  . DT  A 1 1   ? 17.974  4.240   21.362 1.00 0.25 ? 301 DT  C "H2'"  1 
ATOM 23   H "H2''" . DT  A 1 1   ? 17.760  5.606   22.481 1.00 0.27 ? 301 DT  C "H2''" 1 
ATOM 24   H "H1'"  . DT  A 1 1   ? 19.145  6.977   21.320 1.00 0.28 ? 301 DT  C "H1'"  1 
ATOM 25   H H3     . DT  A 1 1   ? 18.040  7.694   17.009 1.00 0.30 ? 301 DT  C H3     1 
ATOM 26   H H71    . DT  A 1 1   ? 19.356  2.496   17.377 1.00 0.23 ? 301 DT  C H71    1 
ATOM 27   H H72    . DT  A 1 1   ? 18.735  3.218   15.873 1.00 0.25 ? 301 DT  C H72    1 
ATOM 28   H H73    . DT  A 1 1   ? 17.601  2.633   17.114 1.00 0.23 ? 301 DT  C H73    1 
ATOM 29   H H6     . DT  A 1 1   ? 19.147  3.706   19.476 1.00 0.24 ? 301 DT  C H6     1 
ATOM 30   H "HO5'" . DT  A 1 1   ? 19.804  2.167   21.252 1.00 0.22 ? 301 DT  C "HO5'" 1 
ATOM 31   P P      . DG  A 1 2   ? 18.296  5.201   25.105 1.00 0.26 ? 302 DG  C P      1 
ATOM 32   O OP1    . DG  A 1 2   ? 18.796  5.539   26.456 1.00 0.28 ? 302 DG  C OP1    1 
ATOM 33   O OP2    . DG  A 1 2   ? 17.540  3.946   24.894 1.00 0.25 ? 302 DG  C OP2    1 
ATOM 34   O "O5'"  . DG  A 1 2   ? 17.380  6.425   24.591 1.00 0.28 ? 302 DG  C "O5'"  1 
ATOM 35   C "C5'"  . DG  A 1 2   ? 17.872  7.769   24.621 1.00 0.30 ? 302 DG  C "C5'"  1 
ATOM 36   C "C4'"  . DG  A 1 2   ? 16.842  8.756   24.080 1.00 0.32 ? 302 DG  C "C4'"  1 
ATOM 37   O "O4'"  . DG  A 1 2   ? 16.712  8.570   22.658 1.00 0.31 ? 302 DG  C "O4'"  1 
ATOM 38   C "C3'"  . DG  A 1 2   ? 15.443  8.605   24.685 1.00 0.32 ? 302 DG  C "C3'"  1 
ATOM 39   O "O3'"  . DG  A 1 2   ? 14.897  9.900   24.932 1.00 0.34 ? 302 DG  C "O3'"  1 
ATOM 40   C "C2'"  . DG  A 1 2   ? 14.646  7.894   23.608 1.00 0.31 ? 302 DG  C "C2'"  1 
ATOM 41   C "C1'"  . DG  A 1 2   ? 15.337  8.337   22.329 1.00 0.31 ? 302 DG  C "C1'"  1 
ATOM 42   N N9     . DG  A 1 2   ? 15.278  7.352   21.223 1.00 0.29 ? 302 DG  C N9     1 
ATOM 43   C C8     . DG  A 1 2   ? 15.489  5.997   21.239 1.00 0.27 ? 302 DG  C C8     1 
ATOM 44   N N7     . DG  A 1 2   ? 15.374  5.401   20.092 1.00 0.26 ? 302 DG  C N7     1 
ATOM 45   C C5     . DG  A 1 2   ? 15.047  6.439   19.232 1.00 0.28 ? 302 DG  C C5     1 
ATOM 46   C C6     . DG  A 1 2   ? 14.779  6.423   17.827 1.00 0.28 ? 302 DG  C C6     1 
ATOM 47   O O6     . DG  A 1 2   ? 14.807  5.458   17.063 1.00 0.27 ? 302 DG  C O6     1 
ATOM 48   N N1     . DG  A 1 2   ? 14.467  7.703   17.338 1.00 0.31 ? 302 DG  C N1     1 
ATOM 49   C C2     . DG  A 1 2   ? 14.425  8.861   18.102 1.00 0.32 ? 302 DG  C C2     1 
ATOM 50   N N2     . DG  A 1 2   ? 14.098  9.984   17.468 1.00 0.34 ? 302 DG  C N2     1 
ATOM 51   N N3     . DG  A 1 2   ? 14.687  8.877   19.418 1.00 0.32 ? 302 DG  C N3     1 
ATOM 52   C C4     . DG  A 1 2   ? 14.985  7.641   19.916 1.00 0.30 ? 302 DG  C C4     1 
ATOM 53   H "H5'"  . DG  A 1 2   ? 18.774  7.832   24.012 1.00 0.30 ? 302 DG  C "H5'"  1 
ATOM 54   H "H5''" . DG  A 1 2   ? 18.114  8.036   25.648 1.00 0.31 ? 302 DG  C "H5''" 1 
ATOM 55   H "H4'"  . DG  A 1 2   ? 17.195  9.770   24.272 1.00 0.33 ? 302 DG  C "H4'"  1 
ATOM 56   H "H3'"  . DG  A 1 2   ? 15.469  8.015   25.601 1.00 0.32 ? 302 DG  C "H3'"  1 
ATOM 57   H "H2'"  . DG  A 1 2   ? 14.719  6.821   23.736 1.00 0.29 ? 302 DG  C "H2'"  1 
ATOM 58   H "H2''" . DG  A 1 2   ? 13.612  8.214   23.620 1.00 0.32 ? 302 DG  C "H2''" 1 
ATOM 59   H "H1'"  . DG  A 1 2   ? 14.893  9.272   21.990 1.00 0.32 ? 302 DG  C "H1'"  1 
ATOM 60   H H8     . DG  A 1 2   ? 15.659  5.444   22.156 1.00 0.26 ? 302 DG  C H8     1 
ATOM 61   H H1     . DG  A 1 2   ? 14.264  7.766   16.352 1.00 0.31 ? 302 DG  C H1     1 
ATOM 62   H H21    . DG  A 1 2   ? 13.898  9.966   16.473 1.00 0.35 ? 302 DG  C H21    1 
ATOM 63   H H22    . DG  A 1 2   ? 14.048  10.853  17.976 1.00 0.35 ? 302 DG  C H22    1 
ATOM 64   P P      . DT  A 1 3   ? 13.393  10.073  25.472 1.00 0.36 ? 303 DT  C P      1 
ATOM 65   O OP1    . DT  A 1 3   ? 13.316  11.295  26.304 1.00 0.38 ? 303 DT  C OP1    1 
ATOM 66   O OP2    . DT  A 1 3   ? 12.935  8.774   26.011 1.00 0.34 ? 303 DT  C OP2    1 
ATOM 67   O "O5'"  . DT  A 1 3   ? 12.614  10.344  24.095 1.00 0.36 ? 303 DT  C "O5'"  1 
ATOM 68   C "C5'"  . DT  A 1 3   ? 13.010  11.440  23.269 1.00 0.37 ? 303 DT  C "C5'"  1 
ATOM 69   C "C4'"  . DT  A 1 3   ? 11.998  11.701  22.163 1.00 0.38 ? 303 DT  C "C4'"  1 
ATOM 70   O "O4'"  . DT  A 1 3   ? 12.195  10.733  21.126 1.00 0.36 ? 303 DT  C "O4'"  1 
ATOM 71   C "C3'"  . DT  A 1 3   ? 10.541  11.605  22.635 1.00 0.38 ? 303 DT  C "C3'"  1 
ATOM 72   O "O3'"  . DT  A 1 3   ? 9.769   12.687  22.114 1.00 0.41 ? 303 DT  C "O3'"  1 
ATOM 73   C "C2'"  . DT  A 1 3   ? 10.024  10.318  22.017 1.00 0.36 ? 303 DT  C "C2'"  1 
ATOM 74   C "C1'"  . DT  A 1 3   ? 10.956  10.096  20.830 1.00 0.35 ? 303 DT  C "C1'"  1 
ATOM 75   N N1     . DT  A 1 3   ? 11.237  8.667   20.501 1.00 0.33 ? 303 DT  C N1     1 
ATOM 76   C C2     . DT  A 1 3   ? 11.146  8.298   19.167 1.00 0.32 ? 303 DT  C C2     1 
ATOM 77   O O2     . DT  A 1 3   ? 10.815  9.101   18.296 1.00 0.34 ? 303 DT  C O2     1 
ATOM 78   N N3     . DT  A 1 3   ? 11.441  6.972   18.885 1.00 0.30 ? 303 DT  C N3     1 
ATOM 79   C C4     . DT  A 1 3   ? 11.812  5.994   19.807 1.00 0.28 ? 303 DT  C C4     1 
ATOM 80   O O4     . DT  A 1 3   ? 12.059  4.845   19.436 1.00 0.27 ? 303 DT  C O4     1 
ATOM 81   C C5     . DT  A 1 3   ? 11.879  6.465   21.175 1.00 0.29 ? 303 DT  C C5     1 
ATOM 82   C C7     . DT  A 1 3   ? 12.233  5.492   22.297 1.00 0.27 ? 303 DT  C C7     1 
ATOM 83   C C6     . DT  A 1 3   ? 11.600  7.756   21.475 1.00 0.31 ? 303 DT  C C6     1 
ATOM 84   H "H5'"  . DT  A 1 3   ? 13.974  11.214  22.819 1.00 0.36 ? 303 DT  C "H5'"  1 
ATOM 85   H "H5''" . DT  A 1 3   ? 13.108  12.333  23.885 1.00 0.39 ? 303 DT  C "H5''" 1 
ATOM 86   H "H4'"  . DT  A 1 3   ? 12.173  12.698  21.756 1.00 0.39 ? 303 DT  C "H4'"  1 
ATOM 87   H "H3'"  . DT  A 1 3   ? 10.477  11.568  23.726 1.00 0.39 ? 303 DT  C "H3'"  1 
ATOM 88   H "H2'"  . DT  A 1 3   ? 10.069  9.503   22.728 1.00 0.35 ? 303 DT  C "H2'"  1 
ATOM 89   H "H2''" . DT  A 1 3   ? 9.011   10.459  21.669 1.00 0.37 ? 303 DT  C "H2''" 1 
ATOM 90   H "H1'"  . DT  A 1 3   ? 10.521  10.594  19.956 1.00 0.36 ? 303 DT  C "H1'"  1 
ATOM 91   H H3     . DT  A 1 3   ? 11.379  6.687   17.916 1.00 0.30 ? 303 DT  C H3     1 
ATOM 92   H H71    . DT  A 1 3   ? 13.286  5.564   22.522 1.00 0.27 ? 303 DT  C H71    1 
ATOM 93   H H72    . DT  A 1 3   ? 12.005  4.473   21.986 1.00 0.26 ? 303 DT  C H72    1 
ATOM 94   H H73    . DT  A 1 3   ? 11.656  5.740   23.187 1.00 0.28 ? 303 DT  C H73    1 
ATOM 95   H H6     . DT  A 1 3   ? 11.674  8.077   22.505 1.00 0.32 ? 303 DT  C H6     1 
ATOM 96   P P      . DC  A 1 4   ? 8.304   12.969  22.721 1.00 0.42 ? 304 DC  C P      1 
ATOM 97   O OP1    . DC  A 1 4   ? 7.922   14.355  22.368 1.00 0.45 ? 304 DC  C OP1    1 
ATOM 98   O OP2    . DC  A 1 4   ? 8.295   12.545  24.139 1.00 0.42 ? 304 DC  C OP2    1 
ATOM 99   O "O5'"  . DC  A 1 4   ? 7.334   11.978  21.907 1.00 0.41 ? 304 DC  C "O5'"  1 
ATOM 100  C "C5'"  . DC  A 1 4   ? 7.051   12.188  20.523 1.00 0.42 ? 304 DC  C "C5'"  1 
ATOM 101  C "C4'"  . DC  A 1 4   ? 5.979   11.214  20.045 1.00 0.41 ? 304 DC  C "C4'"  1 
ATOM 102  O "O4'"  . DC  A 1 4   ? 6.589   9.979   19.659 1.00 0.38 ? 304 DC  C "O4'"  1 
ATOM 103  C "C3'"  . DC  A 1 4   ? 4.917   10.907  21.112 1.00 0.41 ? 304 DC  C "C3'"  1 
ATOM 104  O "O3'"  . DC  A 1 4   ? 3.611   11.040  20.562 1.00 0.42 ? 304 DC  C "O3'"  1 
ATOM 105  C "C2'"  . DC  A 1 4   ? 5.177   9.449   21.495 1.00 0.38 ? 304 DC  C "C2'"  1 
ATOM 106  C "C1'"  . DC  A 1 4   ? 5.886   8.894   20.259 1.00 0.37 ? 304 DC  C "C1'"  1 
ATOM 107  N N1     . DC  A 1 4   ? 6.881   7.808   20.509 1.00 0.34 ? 304 DC  C N1     1 
ATOM 108  C C2     . DC  A 1 4   ? 6.887   6.731   19.621 1.00 0.33 ? 304 DC  C C2     1 
ATOM 109  O O2     . DC  A 1 4   ? 6.087   6.692   18.688 1.00 0.33 ? 304 DC  C O2     1 
ATOM 110  N N3     . DC  A 1 4   ? 7.813   5.748   19.815 1.00 0.30 ? 304 DC  C N3     1 
ATOM 111  C C4     . DC  A 1 4   ? 8.695   5.799   20.824 1.00 0.30 ? 304 DC  C C4     1 
ATOM 112  N N4     . DC  A 1 4   ? 9.580   4.815   20.966 1.00 0.28 ? 304 DC  C N4     1 
ATOM 113  C C5     . DC  A 1 4   ? 8.700   6.895   21.745 1.00 0.32 ? 304 DC  C C5     1 
ATOM 114  C C6     . DC  A 1 4   ? 7.784   7.871   21.555 1.00 0.34 ? 304 DC  C C6     1 
ATOM 115  H "H5'"  . DC  A 1 4   ? 7.961   12.021  19.945 1.00 0.41 ? 304 DC  C "H5'"  1 
ATOM 116  H "H5''" . DC  A 1 4   ? 6.711   13.211  20.374 1.00 0.43 ? 304 DC  C "H5''" 1 
ATOM 117  H "H4'"  . DC  A 1 4   ? 5.480   11.644  19.173 1.00 0.42 ? 304 DC  C "H4'"  1 
ATOM 118  H "H3'"  . DC  A 1 4   ? 5.032   11.557  21.982 1.00 0.42 ? 304 DC  C "H3'"  1 
ATOM 119  H "H2'"  . DC  A 1 4   ? 5.804   9.402   22.374 1.00 0.38 ? 304 DC  C "H2'"  1 
ATOM 120  H "H2''" . DC  A 1 4   ? 4.247   8.916   21.672 1.00 0.38 ? 304 DC  C "H2''" 1 
ATOM 121  H "H1'"  . DC  A 1 4   ? 5.124   8.539   19.558 1.00 0.37 ? 304 DC  C "H1'"  1 
ATOM 122  H H41    . DC  A 1 4   ? 9.589   4.044   20.314 1.00 0.27 ? 304 DC  C H41    1 
ATOM 123  H H42    . DC  A 1 4   ? 10.246  4.846   21.722 1.00 0.28 ? 304 DC  C H42    1 
ATOM 124  H H5     . DC  A 1 4   ? 9.396   6.929   22.579 1.00 0.32 ? 304 DC  C H5     1 
ATOM 125  H H6     . DC  A 1 4   ? 7.775   8.714   22.231 1.00 0.35 ? 304 DC  C H6     1 
ATOM 126  P P      . DT  A 1 5   ? 2.329   10.703  21.470 1.00 0.43 ? 305 DT  C P      1 
ATOM 127  O OP1    . DT  A 1 5   ? 1.213   11.590  21.077 1.00 0.46 ? 305 DT  C OP1    1 
ATOM 128  O OP2    . DT  A 1 5   ? 2.765   10.635  22.883 1.00 0.43 ? 305 DT  C OP2    1 
ATOM 129  O "O5'"  . DT  A 1 5   ? 1.988   9.215   20.981 1.00 0.41 ? 305 DT  C "O5'"  1 
ATOM 130  C "C5'"  . DT  A 1 5   ? 1.638   9.004   19.615 1.00 0.41 ? 305 DT  C "C5'"  1 
ATOM 131  C "C4'"  . DT  A 1 5   ? 1.195   7.573   19.364 1.00 0.40 ? 305 DT  C "C4'"  1 
ATOM 132  O "O4'"  . DT  A 1 5   ? 2.318   6.737   19.140 1.00 0.37 ? 305 DT  C "O4'"  1 
ATOM 133  C "C3'"  . DT  A 1 5   ? 0.416   6.954   20.510 1.00 0.39 ? 305 DT  C "C3'"  1 
ATOM 134  O "O3'"  . DT  A 1 5   ? -0.980  7.239   20.374 1.00 0.42 ? 305 DT  C "O3'"  1 
ATOM 135  C "C2'"  . DT  A 1 5   ? 0.696   5.461   20.377 1.00 0.37 ? 305 DT  C "C2'"  1 
ATOM 136  C "C1'"  . DT  A 1 5   ? 1.973   5.406   19.527 1.00 0.35 ? 305 DT  C "C1'"  1 
ATOM 137  N N1     . DT  A 1 5   ? 3.135   4.856   20.245 1.00 0.33 ? 305 DT  C N1     1 
ATOM 138  C C2     . DT  A 1 5   ? 3.581   3.598   19.878 1.00 0.31 ? 305 DT  C C2     1 
ATOM 139  O O2     . DT  A 1 5   ? 3.016   2.937   19.008 1.00 0.31 ? 305 DT  C O2     1 
ATOM 140  N N3     . DT  A 1 5   ? 4.689   3.135   20.566 1.00 0.29 ? 305 DT  C N3     1 
ATOM 141  C C4     . DT  A 1 5   ? 5.377   3.813   21.574 1.00 0.29 ? 305 DT  C C4     1 
ATOM 142  O O4     . DT  A 1 5   ? 6.351   3.292   22.123 1.00 0.28 ? 305 DT  C O4     1 
ATOM 143  C C5     . DT  A 1 5   ? 4.831   5.124   21.888 1.00 0.33 ? 305 DT  C C5     1 
ATOM 144  C C7     . DT  A 1 5   ? 5.483   5.987   22.968 1.00 0.37 ? 305 DT  C C7     1 
ATOM 145  C C6     . DT  A 1 5   ? 3.750   5.591   21.225 1.00 0.35 ? 305 DT  C C6     1 
ATOM 146  H "H5'"  . DT  A 1 5   ? 2.515   9.210   19.000 1.00 0.41 ? 305 DT  C "H5'"  1 
ATOM 147  H "H5''" . DT  A 1 5   ? 0.840   9.689   19.337 1.00 0.44 ? 305 DT  C "H5''" 1 
ATOM 148  H "H4'"  . DT  A 1 5   ? 0.567   7.557   18.472 1.00 0.40 ? 305 DT  C "H4'"  1 
ATOM 149  H "H3'"  . DT  A 1 5   ? 0.788   7.327   21.467 1.00 0.39 ? 305 DT  C "H3'"  1 
ATOM 150  H "H2'"  . DT  A 1 5   ? 0.878   5.021   21.354 1.00 0.36 ? 305 DT  C "H2'"  1 
ATOM 151  H "H2''" . DT  A 1 5   ? -0.130  4.956   19.879 1.00 0.37 ? 305 DT  C "H2''" 1 
ATOM 152  H "H1'"  . DT  A 1 5   ? 1.788   4.823   18.631 1.00 0.35 ? 305 DT  C "H1'"  1 
ATOM 153  H H3     . DT  A 1 5   ? 5.037   2.221   20.305 1.00 0.28 ? 305 DT  C H3     1 
ATOM 154  H H71    . DT  A 1 5   ? 5.156   5.647   23.950 1.00 1.10 ? 305 DT  C H71    1 
ATOM 155  H H72    . DT  A 1 5   ? 5.192   7.030   22.832 1.00 1.08 ? 305 DT  C H72    1 
ATOM 156  H H73    . DT  A 1 5   ? 6.563   5.903   22.897 1.00 1.10 ? 305 DT  C H73    1 
ATOM 157  H H6     . DT  A 1 5   ? 3.355   6.572   21.477 1.00 0.39 ? 305 DT  C H6     1 
ATOM 158  P P      . DT  A 1 6   ? -1.994  6.860   21.565 1.00 0.43 ? 306 DT  C P      1 
ATOM 159  O OP1    . DT  A 1 6   ? -3.280  7.551   21.328 1.00 0.47 ? 306 DT  C OP1    1 
ATOM 160  O OP2    . DT  A 1 6   ? -1.283  7.031   22.852 1.00 0.43 ? 306 DT  C OP2    1 
ATOM 161  O "O5'"  . DT  A 1 6   ? -2.208  5.285   21.322 1.00 0.40 ? 306 DT  C "O5'"  1 
ATOM 162  C "C5'"  . DT  A 1 6   ? -2.877  4.819   20.145 1.00 0.40 ? 306 DT  C "C5'"  1 
ATOM 163  C "C4'"  . DT  A 1 6   ? -2.921  3.307   20.110 1.00 0.36 ? 306 DT  C "C4'"  1 
ATOM 164  O "O4'"  . DT  A 1 6   ? -1.626  2.780   19.890 1.00 0.34 ? 306 DT  C "O4'"  1 
ATOM 165  C "C3'"  . DT  A 1 6   ? -3.462  2.654   21.361 1.00 0.34 ? 306 DT  C "C3'"  1 
ATOM 166  O "O3'"  . DT  A 1 6   ? -4.889  2.607   21.275 1.00 0.36 ? 306 DT  C "O3'"  1 
ATOM 167  C "C2'"  . DT  A 1 6   ? -2.801  1.284   21.356 1.00 0.30 ? 306 DT  C "C2'"  1 
ATOM 168  C "C1'"  . DT  A 1 6   ? -1.507  1.527   20.565 1.00 0.30 ? 306 DT  C "C1'"  1 
ATOM 169  N N1     . DT  A 1 6   ? -0.294  1.637   21.407 1.00 0.29 ? 306 DT  C N1     1 
ATOM 170  C C2     . DT  A 1 6   ? 0.636   0.611   21.336 1.00 0.27 ? 306 DT  C C2     1 
ATOM 171  O O2     . DT  A 1 6   ? 0.453   -0.384  20.640 1.00 0.26 ? 306 DT  C O2     1 
ATOM 172  N N3     . DT  A 1 6   ? 1.773   0.779   22.110 1.00 0.26 ? 306 DT  C N3     1 
ATOM 173  C C4     . DT  A 1 6   ? 2.054   1.864   22.940 1.00 0.28 ? 306 DT  C C4     1 
ATOM 174  O O4     . DT  A 1 6   ? 3.103   1.905   23.580 1.00 0.28 ? 306 DT  C O4     1 
ATOM 175  C C5     . DT  A 1 6   ? 1.023   2.884   22.958 1.00 0.31 ? 306 DT  C C5     1 
ATOM 176  C C7     . DT  A 1 6   ? 1.200   4.117   23.848 1.00 0.34 ? 306 DT  C C7     1 
ATOM 177  C C6     . DT  A 1 6   ? -0.096  2.742   22.204 1.00 0.31 ? 306 DT  C C6     1 
ATOM 178  H "H5'"  . DT  A 1 6   ? -2.336  5.166   19.271 1.00 0.41 ? 306 DT  C "H5'"  1 
ATOM 179  H "H5''" . DT  A 1 6   ? -3.892  5.213   20.123 1.00 0.42 ? 306 DT  C "H5''" 1 
ATOM 180  H "H4'"  . DT  A 1 6   ? -3.558  3.010   19.280 1.00 0.36 ? 306 DT  C "H4'"  1 
ATOM 181  H "H3'"  . DT  A 1 6   ? -3.158  3.221   22.241 1.00 0.35 ? 306 DT  C "H3'"  1 
ATOM 182  H "H2'"  . DT  A 1 6   ? -2.565  0.975   22.364 1.00 0.29 ? 306 DT  C "H2'"  1 
ATOM 183  H "H2''" . DT  A 1 6   ? -3.427  0.549   20.863 1.00 0.30 ? 306 DT  C "H2''" 1 
ATOM 184  H "H1'"  . DT  A 1 6   ? -1.383  0.733   19.824 1.00 0.29 ? 306 DT  C "H1'"  1 
ATOM 185  H H3     . DT  A 1 6   ? 2.468   0.045   22.065 1.00 0.25 ? 306 DT  C H3     1 
ATOM 186  H H71    . DT  A 1 6   ? 0.440   4.863   23.613 1.00 1.05 ? 306 DT  C H71    1 
ATOM 187  H H72    . DT  A 1 6   ? 2.189   4.546   23.680 1.00 1.09 ? 306 DT  C H72    1 
ATOM 188  H H73    . DT  A 1 6   ? 1.105   3.825   24.893 1.00 1.10 ? 306 DT  C H73    1 
ATOM 189  H H6     . DT  A 1 6   ? -0.855  3.521   22.230 1.00 0.34 ? 306 DT  C H6     1 
ATOM 190  P P      . DT  A 1 7   ? -5.814  2.429   22.580 1.00 0.36 ? 307 DT  C P      1 
ATOM 191  O OP1    . DT  A 1 7   ? -7.202  2.733   22.205 1.00 0.39 ? 307 DT  C OP1    1 
ATOM 192  O OP2    . DT  A 1 7   ? -5.182  3.172   23.690 1.00 0.38 ? 307 DT  C OP2    1 
ATOM 193  O "O5'"  . DT  A 1 7   ? -5.695  0.853   22.905 1.00 0.32 ? 307 DT  C "O5'"  1 
ATOM 194  C "C5'"  . DT  A 1 7   ? -6.156  -0.131  21.965 1.00 0.30 ? 307 DT  C "C5'"  1 
ATOM 195  C "C4'"  . DT  A 1 7   ? -6.028  -1.549  22.523 1.00 0.27 ? 307 DT  C "C4'"  1 
ATOM 196  O "O4'"  . DT  A 1 7   ? -4.634  -1.827  22.724 1.00 0.26 ? 307 DT  C "O4'"  1 
ATOM 197  C "C3'"  . DT  A 1 7   ? -6.734  -1.776  23.861 1.00 0.28 ? 307 DT  C "C3'"  1 
ATOM 198  O "O3'"  . DT  A 1 7   ? -7.376  -3.058  23.847 1.00 0.27 ? 307 DT  C "O3'"  1 
ATOM 199  C "C2'"  . DT  A 1 7   ? -5.635  -1.771  24.907 1.00 0.28 ? 307 DT  C "C2'"  1 
ATOM 200  C "C1'"  . DT  A 1 7   ? -4.364  -2.066  24.112 1.00 0.26 ? 307 DT  C "C1'"  1 
ATOM 201  N N1     . DT  A 1 7   ? -3.184  -1.235  24.501 1.00 0.26 ? 307 DT  C N1     1 
ATOM 202  C C2     . DT  A 1 7   ? -1.975  -1.896  24.700 1.00 0.24 ? 307 DT  C C2     1 
ATOM 203  O O2     . DT  A 1 7   ? -1.871  -3.113  24.574 1.00 0.22 ? 307 DT  C O2     1 
ATOM 204  N N3     . DT  A 1 7   ? -0.897  -1.094  25.048 1.00 0.25 ? 307 DT  C N3     1 
ATOM 205  C C4     . DT  A 1 7   ? -0.914  0.288   25.214 1.00 0.28 ? 307 DT  C C4     1 
ATOM 206  O O4     . DT  A 1 7   ? 0.111   0.896   25.534 1.00 0.30 ? 307 DT  C O4     1 
ATOM 207  C C5     . DT  A 1 7   ? -2.208  0.896   24.987 1.00 0.30 ? 307 DT  C C5     1 
ATOM 208  C C7     . DT  A 1 7   ? -2.355  2.409   25.123 1.00 0.34 ? 307 DT  C C7     1 
ATOM 209  C C6     . DT  A 1 7   ? -3.281  0.138   24.644 1.00 0.29 ? 307 DT  C C6     1 
ATOM 210  H "H5'"  . DT  A 1 7   ? -5.580  -0.056  21.049 1.00 0.30 ? 307 DT  C "H5'"  1 
ATOM 211  H "H5''" . DT  A 1 7   ? -7.204  0.063   21.736 1.00 0.32 ? 307 DT  C "H5''" 1 
ATOM 212  H "H4'"  . DT  A 1 7   ? -6.425  -2.252  21.792 1.00 0.27 ? 307 DT  C "H4'"  1 
ATOM 213  H "H3'"  . DT  A 1 7   ? -7.464  -0.987  24.057 1.00 0.30 ? 307 DT  C "H3'"  1 
ATOM 214  H "H2'"  . DT  A 1 7   ? -5.583  -0.808  25.405 1.00 0.30 ? 307 DT  C "H2'"  1 
ATOM 215  H "H2''" . DT  A 1 7   ? -5.816  -2.552  25.630 1.00 0.28 ? 307 DT  C "H2''" 1 
ATOM 216  H "H1'"  . DT  A 1 7   ? -4.120  -3.128  24.234 1.00 0.24 ? 307 DT  C "H1'"  1 
ATOM 217  H H3     . DT  A 1 7   ? -0.012  -1.558  25.192 1.00 0.24 ? 307 DT  C H3     1 
ATOM 218  H H71    . DT  A 1 7   ? -3.222  2.748   24.555 1.00 1.08 ? 307 DT  C H71    1 
ATOM 219  H H72    . DT  A 1 7   ? -1.458  2.896   24.739 1.00 1.09 ? 307 DT  C H72    1 
ATOM 220  H H73    . DT  A 1 7   ? -2.486  2.665   26.174 1.00 1.05 ? 307 DT  C H73    1 
ATOM 221  H H6     . DT  A 1 7   ? -4.229  0.634   24.445 1.00 0.31 ? 307 DT  C H6     1 
ATOM 222  P P      . DG  A 1 8   ? -8.250  -3.549  25.109 1.00 0.28 ? 308 DG  C P      1 
ATOM 223  O OP1    . DG  A 1 8   ? -9.323  -4.442  24.615 1.00 0.29 ? 308 DG  C OP1    1 
ATOM 224  O OP2    . DG  A 1 8   ? -8.599  -2.359  25.917 1.00 0.31 ? 308 DG  C OP2    1 
ATOM 225  O "O5'"  . DG  A 1 8   ? -7.210  -4.442  25.959 1.00 0.27 ? 308 DG  C "O5'"  1 
ATOM 226  C "C5'"  . DG  A 1 8   ? -6.675  -5.654  25.416 1.00 0.26 ? 308 DG  C "C5'"  1 
ATOM 227  C "C4'"  . DG  A 1 8   ? -5.830  -6.402  26.445 1.00 0.24 ? 308 DG  C "C4'"  1 
ATOM 228  O "O4'"  . DG  A 1 8   ? -4.600  -5.691  26.654 1.00 0.24 ? 308 DG  C "O4'"  1 
ATOM 229  C "C3'"  . DG  A 1 8   ? -6.509  -6.566  27.809 1.00 0.25 ? 308 DG  C "C3'"  1 
ATOM 230  O "O3'"  . DG  A 1 8   ? -6.296  -7.894  28.289 1.00 0.25 ? 308 DG  C "O3'"  1 
ATOM 231  C "C2'"  . DG  A 1 8   ? -5.800  -5.565  28.711 1.00 0.25 ? 308 DG  C "C2'"  1 
ATOM 232  C "C1'"  . DG  A 1 8   ? -4.439  -5.393  28.045 1.00 0.24 ? 308 DG  C "C1'"  1 
ATOM 233  N N9     . DG  A 1 8   ? -3.876  -4.028  28.152 1.00 0.24 ? 308 DG  C N9     1 
ATOM 234  C C8     . DG  A 1 8   ? -4.489  -2.816  27.972 1.00 0.25 ? 308 DG  C C8     1 
ATOM 235  N N7     . DG  A 1 8   ? -3.727  -1.778  28.129 1.00 0.26 ? 308 DG  C N7     1 
ATOM 236  C C5     . DG  A 1 8   ? -2.496  -2.336  28.448 1.00 0.25 ? 308 DG  C C5     1 
ATOM 237  C C6     . DG  A 1 8   ? -1.247  -1.705  28.742 1.00 0.26 ? 308 DG  C C6     1 
ATOM 238  O O6     . DG  A 1 8   ? -0.999  -0.503  28.768 1.00 0.27 ? 308 DG  C O6     1 
ATOM 239  N N1     . DG  A 1 8   ? -0.236  -2.638  29.023 1.00 0.25 ? 308 DG  C N1     1 
ATOM 240  C C2     . DG  A 1 8   ? -0.403  -4.016  29.019 1.00 0.24 ? 308 DG  C C2     1 
ATOM 241  N N2     . DG  A 1 8   ? 0.668   -4.748  29.318 1.00 0.24 ? 308 DG  C N2     1 
ATOM 242  N N3     . DG  A 1 8   ? -1.578  -4.611  28.739 1.00 0.23 ? 308 DG  C N3     1 
ATOM 243  C C4     . DG  A 1 8   ? -2.576  -3.718  28.466 1.00 0.24 ? 308 DG  C C4     1 
ATOM 244  H "H5'"  . DG  A 1 8   ? -6.051  -5.413  24.555 1.00 0.25 ? 308 DG  C "H5'"  1 
ATOM 245  H "H5''" . DG  A 1 8   ? -7.494  -6.295  25.095 1.00 0.26 ? 308 DG  C "H5''" 1 
ATOM 246  H "H4'"  . DG  A 1 8   ? -5.599  -7.393  26.051 1.00 0.25 ? 308 DG  C "H4'"  1 
ATOM 247  H "H3'"  . DG  A 1 8   ? -7.577  -6.346  27.749 1.00 0.26 ? 308 DG  C "H3'"  1 
ATOM 248  H "H2'"  . DG  A 1 8   ? -6.343  -4.625  28.732 1.00 0.26 ? 308 DG  C "H2'"  1 
ATOM 249  H "H2''" . DG  A 1 8   ? -5.690  -5.962  29.713 1.00 0.26 ? 308 DG  C "H2''" 1 
ATOM 250  H "H1'"  . DG  A 1 8   ? -3.733  -6.103  28.482 1.00 0.24 ? 308 DG  C "H1'"  1 
ATOM 251  H H8     . DG  A 1 8   ? -5.550  -2.724  27.775 1.00 0.26 ? 308 DG  C H8     1 
ATOM 252  H H1     . DG  A 1 8   ? 0.673   -2.259  29.244 1.00 0.25 ? 308 DG  C H1     1 
ATOM 253  H H21    . DG  A 1 8   ? 1.547   -4.295  29.530 1.00 0.25 ? 308 DG  C H21    1 
ATOM 254  H H22    . DG  A 1 8   ? 0.602   -5.754  29.335 1.00 0.24 ? 308 DG  C H22    1 
ATOM 255  P P      . DT  A 1 9   ? -6.836  -8.344  29.737 1.00 0.26 ? 309 DT  C P      1 
ATOM 256  O OP1    . DT  A 1 9   ? -7.186  -9.779  29.689 1.00 0.27 ? 309 DT  C OP1    1 
ATOM 257  O OP2    . DT  A 1 9   ? -7.832  -7.348  30.190 1.00 0.26 ? 309 DT  C OP2    1 
ATOM 258  O "O5'"  . DT  A 1 9   ? -5.515  -8.174  30.636 1.00 0.25 ? 309 DT  C "O5'"  1 
ATOM 259  C "C5'"  . DT  A 1 9   ? -4.345  -8.918  30.292 1.00 0.25 ? 309 DT  C "C5'"  1 
ATOM 260  C "C4'"  . DT  A 1 9   ? -3.298  -8.885  31.394 1.00 0.25 ? 309 DT  C "C4'"  1 
ATOM 261  O "O4'"  . DT  A 1 9   ? -2.605  -7.628  31.336 1.00 0.24 ? 309 DT  C "O4'"  1 
ATOM 262  C "C3'"  . DT  A 1 9   ? -3.866  -9.041  32.808 1.00 0.25 ? 309 DT  C "C3'"  1 
ATOM 263  O "O3'"  . DT  A 1 9   ? -3.068  -9.974  33.535 1.00 0.27 ? 309 DT  C "O3'"  1 
ATOM 264  C "C2'"  . DT  A 1 9   ? -3.744  -7.658  33.434 1.00 0.24 ? 309 DT  C "C2'"  1 
ATOM 265  C "C1'"  . DT  A 1 9   ? -2.633  -6.996  32.617 1.00 0.23 ? 309 DT  C "C1'"  1 
ATOM 266  N N1     . DT  A 1 9   ? -2.802  -5.528  32.395 1.00 0.23 ? 309 DT  C N1     1 
ATOM 267  C C2     . DT  A 1 9   ? -1.696  -4.707  32.617 1.00 0.23 ? 309 DT  C C2     1 
ATOM 268  O O2     . DT  A 1 9   ? -0.611  -5.156  32.983 1.00 0.24 ? 309 DT  C O2     1 
ATOM 269  N N3     . DT  A 1 9   ? -1.901  -3.351  32.400 1.00 0.23 ? 309 DT  C N3     1 
ATOM 270  C C4     . DT  A 1 9   ? -3.092  -2.753  31.989 1.00 0.23 ? 309 DT  C C4     1 
ATOM 271  O O4     . DT  A 1 9   ? -3.160  -1.537  31.827 1.00 0.24 ? 309 DT  C O4     1 
ATOM 272  C C5     . DT  A 1 9   ? -4.184  -3.679  31.784 1.00 0.23 ? 309 DT  C C5     1 
ATOM 273  C C7     . DT  A 1 9   ? -5.558  -3.151  31.377 1.00 0.23 ? 309 DT  C C7     1 
ATOM 274  C C6     . DT  A 1 9   ? -4.010  -5.004  31.983 1.00 0.22 ? 309 DT  C C6     1 
ATOM 275  H "H5'"  . DT  A 1 9   ? -3.915  -8.491  29.386 1.00 0.25 ? 309 DT  C "H5'"  1 
ATOM 276  H "H5''" . DT  A 1 9   ? -4.626  -9.952  30.099 1.00 0.27 ? 309 DT  C "H5''" 1 
ATOM 277  H "H4'"  . DT  A 1 9   ? -2.580  -9.688  31.217 1.00 0.26 ? 309 DT  C "H4'"  1 
ATOM 278  H "H3'"  . DT  A 1 9   ? -4.910  -9.366  32.782 1.00 0.25 ? 309 DT  C "H3'"  1 
ATOM 279  H "H2'"  . DT  A 1 9   ? -4.681  -7.124  33.351 1.00 0.23 ? 309 DT  C "H2'"  1 
ATOM 280  H "H2''" . DT  A 1 9   ? -3.455  -7.736  34.471 1.00 0.24 ? 309 DT  C "H2''" 1 
ATOM 281  H "H1'"  . DT  A 1 9   ? -1.677  -7.184  33.116 1.00 0.24 ? 309 DT  C "H1'"  1 
ATOM 282  H H3     . DT  A 1 9   ? -1.109  -2.738  32.555 1.00 0.24 ? 309 DT  C H3     1 
ATOM 283  H H71    . DT  A 1 9   ? -6.331  -3.842  31.716 1.00 1.04 ? 309 DT  C H71    1 
ATOM 284  H H72    . DT  A 1 9   ? -5.608  -3.059  30.298 1.00 1.05 ? 309 DT  C H72    1 
ATOM 285  H H73    . DT  A 1 9   ? -5.721  -2.175  31.832 1.00 1.06 ? 309 DT  C H73    1 
ATOM 286  H H6     . DT  A 1 9   ? -4.842  -5.668  31.791 1.00 0.23 ? 309 DT  C H6     1 
ATOM 287  P P      . DC  A 1 10  ? -3.381  -10.292 35.080 1.00 0.28 ? 310 DC  C P      1 
ATOM 288  O OP1    . DC  A 1 10  ? -3.037  -11.703 35.357 1.00 0.31 ? 310 DC  C OP1    1 
ATOM 289  O OP2    . DC  A 1 10  ? -4.733  -9.777  35.393 1.00 0.28 ? 310 DC  C OP2    1 
ATOM 290  O "O5'"  . DC  A 1 10  ? -2.307  -9.355  35.818 1.00 0.27 ? 310 DC  C "O5'"  1 
ATOM 291  C "C5'"  . DC  A 1 10  ? -0.919  -9.577  35.575 1.00 0.28 ? 310 DC  C "C5'"  1 
ATOM 292  C "C4'"  . DC  A 1 10  ? -0.034  -8.759  36.503 1.00 0.26 ? 310 DC  C "C4'"  1 
ATOM 293  O "O4'"  . DC  A 1 10  ? -0.100  -7.379  36.111 1.00 0.25 ? 310 DC  C "O4'"  1 
ATOM 294  C "C3'"  . DC  A 1 10  ? -0.421  -8.843  37.983 1.00 0.25 ? 310 DC  C "C3'"  1 
ATOM 295  O "O3'"  . DC  A 1 10  ? 0.754   -9.029  38.776 1.00 0.25 ? 310 DC  C "O3'"  1 
ATOM 296  C "C2'"  . DC  A 1 10  ? -1.046  -7.494  38.303 1.00 0.23 ? 310 DC  C "C2'"  1 
ATOM 297  C "C1'"  . DC  A 1 10  ? -0.468  -6.570  37.231 1.00 0.23 ? 310 DC  C "C1'"  1 
ATOM 298  N N1     . DC  A 1 10  ? -1.398  -5.506  36.743 1.00 0.22 ? 310 DC  C N1     1 
ATOM 299  C C2     . DC  A 1 10  ? -0.898  -4.206  36.655 1.00 0.21 ? 310 DC  C C2     1 
ATOM 300  O O2     . DC  A 1 10  ? 0.259   -3.970  36.988 1.00 0.22 ? 310 DC  C O2     1 
ATOM 301  N N3     . DC  A 1 10  ? -1.731  -3.227  36.193 1.00 0.21 ? 310 DC  C N3     1 
ATOM 302  C C4     . DC  A 1 10  ? -2.999  -3.494  35.829 1.00 0.21 ? 310 DC  C C4     1 
ATOM 303  N N4     . DC  A 1 10  ? -3.781  -2.502  35.393 1.00 0.21 ? 310 DC  C N4     1 
ATOM 304  C C5     . DC  A 1 10  ? -3.524  -4.825  35.912 1.00 0.21 ? 310 DC  C C5     1 
ATOM 305  C C6     . DC  A 1 10  ? -2.695  -5.794  36.372 1.00 0.21 ? 310 DC  C C6     1 
ATOM 306  H "H5'"  . DC  A 1 10  ? -0.696  -9.300  34.544 1.00 0.29 ? 310 DC  C "H5'"  1 
ATOM 307  H "H5''" . DC  A 1 10  ? -0.697  -10.635 35.712 1.00 0.30 ? 310 DC  C "H5''" 1 
ATOM 308  H "H4'"  . DC  A 1 10  ? 0.991   -9.108  36.392 1.00 0.27 ? 310 DC  C "H4'"  1 
ATOM 309  H "H3'"  . DC  A 1 10  ? -1.134  -9.651  38.159 1.00 0.27 ? 310 DC  C "H3'"  1 
ATOM 310  H "H2'"  . DC  A 1 10  ? -2.125  -7.550  38.246 1.00 0.24 ? 310 DC  C "H2'"  1 
ATOM 311  H "H2''" . DC  A 1 10  ? -0.742  -7.166  39.286 1.00 0.23 ? 310 DC  C "H2''" 1 
ATOM 312  H "H1'"  . DC  A 1 10  ? 0.440   -6.106  37.631 1.00 0.23 ? 310 DC  C "H1'"  1 
ATOM 313  H H41    . DC  A 1 10  ? -3.417  -1.561  35.332 1.00 0.22 ? 310 DC  C H41    1 
ATOM 314  H H42    . DC  A 1 10  ? -4.737  -2.692  35.122 1.00 0.21 ? 310 DC  C H42    1 
ATOM 315  H H5     . DC  A 1 10  ? -4.545  -5.050  35.610 1.00 0.21 ? 310 DC  C H5     1 
ATOM 316  H H6     . DC  A 1 10  ? -3.063  -6.811  36.447 1.00 0.22 ? 310 DC  C H6     1 
ATOM 317  P P      . DA  A 1 11  ? 0.644   -9.142  40.378 1.00 0.26 ? 311 DA  C P      1 
ATOM 318  O OP1    . DA  A 1 11  ? 1.689   -10.067 40.866 1.00 0.29 ? 311 DA  C OP1    1 
ATOM 319  O OP2    . DA  A 1 11  ? -0.774  -9.381  40.720 1.00 0.27 ? 311 DA  C OP2    1 
ATOM 320  O "O5'"  . DA  A 1 11  ? 1.027   -7.650  40.849 1.00 0.24 ? 311 DA  C "O5'"  1 
ATOM 321  C "C5'"  . DA  A 1 11  ? 2.326   -7.131  40.547 1.00 0.23 ? 311 DA  C "C5'"  1 
ATOM 322  C "C4'"  . DA  A 1 11  ? 2.571   -5.778  41.204 1.00 0.22 ? 311 DA  C "C4'"  1 
ATOM 323  O "O4'"  . DA  A 1 11  ? 1.758   -4.786  40.554 1.00 0.22 ? 311 DA  C "O4'"  1 
ATOM 324  C "C3'"  . DA  A 1 11  ? 2.241   -5.734  42.698 1.00 0.22 ? 311 DA  C "C3'"  1 
ATOM 325  O "O3'"  . DA  A 1 11  ? 3.262   -5.015  43.389 1.00 0.23 ? 311 DA  C "O3'"  1 
ATOM 326  C "C2'"  . DA  A 1 11  ? 0.928   -4.978  42.778 1.00 0.21 ? 311 DA  C "C2'"  1 
ATOM 327  C "C1'"  . DA  A 1 11  ? 0.931   -4.127  41.519 1.00 0.20 ? 311 DA  C "C1'"  1 
ATOM 328  N N9     . DA  A 1 11  ? -0.411  -3.940  40.928 1.00 0.19 ? 311 DA  C N9     1 
ATOM 329  C C8     . DA  A 1 11  ? -1.395  -4.863  40.699 1.00 0.19 ? 311 DA  C C8     1 
ATOM 330  N N7     . DA  A 1 11  ? -2.477  -4.398  40.151 1.00 0.18 ? 311 DA  C N7     1 
ATOM 331  C C5     . DA  A 1 11  ? -2.196  -3.047  40.007 1.00 0.17 ? 311 DA  C C5     1 
ATOM 332  C C6     . DA  A 1 11  ? -2.930  -1.958  39.493 1.00 0.17 ? 311 DA  C C6     1 
ATOM 333  N N6     . DA  A 1 11  ? -4.160  -2.085  38.986 1.00 0.18 ? 311 DA  C N6     1 
ATOM 334  N N1     . DA  A 1 11  ? -2.344  -0.734  39.511 1.00 0.18 ? 311 DA  C N1     1 
ATOM 335  C C2     . DA  A 1 11  ? -1.105  -0.576  40.000 1.00 0.19 ? 311 DA  C C2     1 
ATOM 336  N N3     . DA  A 1 11  ? -0.324  -1.539  40.505 1.00 0.19 ? 311 DA  C N3     1 
ATOM 337  C C4     . DA  A 1 11  ? -0.936  -2.757  40.478 1.00 0.18 ? 311 DA  C C4     1 
ATOM 338  H "H5'"  . DA  A 1 11  ? 2.419   -7.020  39.466 1.00 0.25 ? 311 DA  C "H5'"  1 
ATOM 339  H "H5''" . DA  A 1 11  ? 3.078   -7.837  40.897 1.00 0.24 ? 311 DA  C "H5''" 1 
ATOM 340  H "H4'"  . DA  A 1 11  ? 3.619   -5.511  41.073 1.00 0.23 ? 311 DA  C "H4'"  1 
ATOM 341  H "H3'"  . DA  A 1 11  ? 2.135   -6.740  43.108 1.00 0.23 ? 311 DA  C "H3'"  1 
ATOM 342  H "H2'"  . DA  A 1 11  ? 0.094   -5.673  42.772 1.00 0.21 ? 311 DA  C "H2'"  1 
ATOM 343  H "H2''" . DA  A 1 11  ? 0.899   -4.352  43.660 1.00 0.21 ? 311 DA  C "H2''" 1 
ATOM 344  H "H1'"  . DA  A 1 11  ? 1.359   -3.149  41.746 1.00 0.21 ? 311 DA  C "H1'"  1 
ATOM 345  H H8     . DA  A 1 11  ? -1.303  -5.900  40.995 1.00 0.20 ? 311 DA  C H8     1 
ATOM 346  H H61    . DA  A 1 11  ? -4.647  -1.272  38.627 1.00 0.18 ? 311 DA  C H61    1 
ATOM 347  H H62    . DA  A 1 11  ? -4.605  -2.993  38.958 1.00 0.18 ? 311 DA  C H62    1 
ATOM 348  H H2     . DA  A 1 11  ? -0.698  0.434   39.992 1.00 0.20 ? 311 DA  C H2     1 
ATOM 349  P P      . DT  A 1 12  ? 3.130   -4.712  44.965 1.00 0.25 ? 312 DT  C P      1 
ATOM 350  O OP1    . DT  A 1 12  ? 4.481   -4.705  45.564 1.00 0.29 ? 312 DT  C OP1    1 
ATOM 351  O OP2    . DT  A 1 12  ? 2.071   -5.584  45.520 1.00 0.27 ? 312 DT  C OP2    1 
ATOM 352  O "O5'"  . DT  A 1 12  ? 2.579   -3.204  44.944 1.00 0.25 ? 312 DT  C "O5'"  1 
ATOM 353  C "C5'"  . DT  A 1 12  ? 3.380   -2.201  44.326 1.00 0.27 ? 312 DT  C "C5'"  1 
ATOM 354  C "C4'"  . DT  A 1 12  ? 2.859   -0.793  44.576 1.00 0.29 ? 312 DT  C "C4'"  1 
ATOM 355  O "O4'"  . DT  A 1 12  ? 1.684   -0.589  43.786 1.00 0.27 ? 312 DT  C "O4'"  1 
ATOM 356  C "C3'"  . DT  A 1 12  ? 2.513   -0.485  46.038 1.00 0.31 ? 312 DT  C "C3'"  1 
ATOM 357  O "O3'"  . DT  A 1 12  ? 3.052   0.792   46.405 1.00 0.38 ? 312 DT  C "O3'"  1 
ATOM 358  C "C2'"  . DT  A 1 12  ? 0.993   -0.408  46.062 1.00 0.32 ? 312 DT  C "C2'"  1 
ATOM 359  C "C1'"  . DT  A 1 12  ? 0.629   -0.099  44.608 1.00 0.28 ? 312 DT  C "C1'"  1 
ATOM 360  N N1     . DT  A 1 12  ? -0.631  -0.733  44.131 1.00 0.25 ? 312 DT  C N1     1 
ATOM 361  C C2     . DT  A 1 12  ? -1.560  0.075   43.479 1.00 0.24 ? 312 DT  C C2     1 
ATOM 362  O O2     . DT  A 1 12  ? -1.371  1.277   43.303 1.00 0.26 ? 312 DT  C O2     1 
ATOM 363  N N3     . DT  A 1 12  ? -2.714  -0.565  43.047 1.00 0.21 ? 312 DT  C N3     1 
ATOM 364  C C4     . DT  A 1 12  ? -3.015  -1.917  43.211 1.00 0.21 ? 312 DT  C C4     1 
ATOM 365  O O4     . DT  A 1 12  ? -4.074  -2.379  42.790 1.00 0.21 ? 312 DT  C O4     1 
ATOM 366  C C5     . DT  A 1 12  ? -1.992  -2.674  43.902 1.00 0.23 ? 312 DT  C C5     1 
ATOM 367  C C7     . DT  A 1 12  ? -2.217  -4.150  44.205 1.00 0.24 ? 312 DT  C C7     1 
ATOM 368  C C6     . DT  A 1 12  ? -0.860  -2.076  44.325 1.00 0.24 ? 312 DT  C C6     1 
ATOM 369  H "H5'"  . DT  A 1 12  ? 3.393   -2.381  43.250 1.00 0.26 ? 312 DT  C "H5'"  1 
ATOM 370  H "H5''" . DT  A 1 12  ? 4.399   -2.275  44.706 1.00 0.30 ? 312 DT  C "H5''" 1 
ATOM 371  H "H4'"  . DT  A 1 12  ? 3.609   -0.100  44.253 1.00 0.32 ? 312 DT  C "H4'"  1 
ATOM 372  H "H3'"  . DT  A 1 12  ? 2.877   -1.267  46.704 1.00 0.31 ? 312 DT  C "H3'"  1 
ATOM 373  H "H2'"  . DT  A 1 12  ? 0.570   -1.349  46.395 1.00 0.33 ? 312 DT  C "H2'"  1 
ATOM 374  H "H2''" . DT  A 1 12  ? 0.669   0.395   46.710 1.00 0.39 ? 312 DT  C "H2''" 1 
ATOM 375  H "H1'"  . DT  A 1 12  ? 0.569   0.986   44.485 1.00 0.31 ? 312 DT  C "H1'"  1 
ATOM 376  H H3     . DT  A 1 12  ? -3.400  0.004   42.567 1.00 0.21 ? 312 DT  C H3     1 
ATOM 377  H H71    . DT  A 1 12  ? -1.264  -4.656  44.301 1.00 1.05 ? 312 DT  C H71    1 
ATOM 378  H H72    . DT  A 1 12  ? -2.792  -4.608  43.399 1.00 1.04 ? 312 DT  C H72    1 
ATOM 379  H H73    . DT  A 1 12  ? -2.756  -4.240  45.142 1.00 1.04 ? 312 DT  C H73    1 
ATOM 380  H H6     . DT  A 1 12  ? -0.104  -2.680  44.812 1.00 0.26 ? 312 DT  C H6     1 
ATOM 381  P P      . DG  A 1 13  ? 2.847   1.377   47.900 1.00 0.39 ? 313 DG  C P      1 
ATOM 382  O OP1    . DG  A 1 13  ? 4.090   2.063   48.322 1.00 0.48 ? 313 DG  C OP1    1 
ATOM 383  O OP2    . DG  A 1 13  ? 2.300   0.287   48.737 1.00 0.40 ? 313 DG  C OP2    1 
ATOM 384  O "O5'"  . DG  A 1 13  ? 1.684   2.489   47.714 1.00 0.36 ? 313 DG  C "O5'"  1 
ATOM 385  C "C5'"  . DG  A 1 13  ? 1.915   3.678   46.934 1.00 0.36 ? 313 DG  C "C5'"  1 
ATOM 386  C "C4'"  . DG  A 1 13  ? 0.843   4.715   47.133 1.00 0.34 ? 313 DG  C "C4'"  1 
ATOM 387  O "O4'"  . DG  A 1 13  ? -0.365  4.249   46.540 1.00 0.30 ? 313 DG  C "O4'"  1 
ATOM 388  C "C3'"  . DG  A 1 13  ? 0.560   5.035   48.589 1.00 0.34 ? 313 DG  C "C3'"  1 
ATOM 389  O "O3'"  . DG  A 1 13  ? 0.370   6.439   48.718 1.00 0.36 ? 313 DG  C "O3'"  1 
ATOM 390  C "C2'"  . DG  A 1 13  ? -0.721  4.288   48.903 1.00 0.30 ? 313 DG  C "C2'"  1 
ATOM 391  C "C1'"  . DG  A 1 13  ? -1.372  4.096   47.536 1.00 0.28 ? 313 DG  C "C1'"  1 
ATOM 392  N N9     . DG  A 1 13  ? -1.980  2.770   47.334 1.00 0.25 ? 313 DG  C N9     1 
ATOM 393  C C8     . DG  A 1 13  ? -1.533  1.530   47.709 1.00 0.24 ? 313 DG  C C8     1 
ATOM 394  N N7     . DG  A 1 13  ? -2.313  0.541   47.390 1.00 0.22 ? 313 DG  C N7     1 
ATOM 395  C C5     . DG  A 1 13  ? -3.373  1.174   46.750 1.00 0.22 ? 313 DG  C C5     1 
ATOM 396  C C6     . DG  A 1 13  ? -4.559  0.630   46.168 1.00 0.20 ? 313 DG  C C6     1 
ATOM 397  O O6     . DG  A 1 13  ? -4.901  -0.547  46.116 1.00 0.19 ? 313 DG  C O6     1 
ATOM 398  N N1     . DG  A 1 13  ? -5.383  1.626   45.619 1.00 0.22 ? 313 DG  C N1     1 
ATOM 399  C C2     . DG  A 1 13  ? -5.099  2.987   45.625 1.00 0.24 ? 313 DG  C C2     1 
ATOM 400  N N2     . DG  A 1 13  ? -5.992  3.791   45.052 1.00 0.26 ? 313 DG  C N2     1 
ATOM 401  N N3     . DG  A 1 13  ? -3.985  3.496   46.172 1.00 0.25 ? 313 DG  C N3     1 
ATOM 402  C C4     . DG  A 1 13  ? -3.173  2.541   46.712 1.00 0.24 ? 313 DG  C C4     1 
ATOM 403  H "H5'"  . DG  A 1 13  ? 1.942   3.414   45.875 1.00 0.36 ? 313 DG  C "H5'"  1 
ATOM 404  H "H5''" . DG  A 1 13  ? 2.870   4.115   47.229 1.00 0.41 ? 313 DG  C "H5''" 1 
ATOM 405  H "H4'"  . DG  A 1 13  ? 1.148   5.633   46.628 1.00 0.37 ? 313 DG  C "H4'"  1 
ATOM 406  H "H3'"  . DG  A 1 13  ? 1.374   4.699   49.236 1.00 0.36 ? 313 DG  C "H3'"  1 
ATOM 407  H "H2'"  . DG  A 1 13  ? -0.503  3.331   49.368 1.00 0.30 ? 313 DG  C "H2'"  1 
ATOM 408  H "H2''" . DG  A 1 13  ? -1.348  4.884   49.543 1.00 0.30 ? 313 DG  C "H2''" 1 
ATOM 409  H "H1'"  . DG  A 1 13  ? -2.135  4.863   47.390 1.00 0.29 ? 313 DG  C "H1'"  1 
ATOM 410  H H8     . DG  A 1 13  ? -0.606  1.383   48.254 1.00 0.25 ? 313 DG  C H8     1 
ATOM 411  H H1     . DG  A 1 13  ? -6.241  1.310   45.197 1.00 0.22 ? 313 DG  C H1     1 
ATOM 412  H H21    . DG  A 1 13  ? -6.830  3.405   44.643 1.00 0.26 ? 313 DG  C H21    1 
ATOM 413  H H22    . DG  A 1 13  ? -5.829  4.787   45.025 1.00 0.28 ? 313 DG  C H22    1 
ATOM 414  P P      . DC  A 1 14  ? -0.009  7.088   50.134 1.00 0.37 ? 314 DC  C P      1 
ATOM 415  O OP1    . DC  A 1 14  ? 0.594   8.435   50.210 1.00 0.41 ? 314 DC  C OP1    1 
ATOM 416  O OP2    . DC  A 1 14  ? 0.265   6.087   51.190 1.00 0.37 ? 314 DC  C OP2    1 
ATOM 417  O "O5'"  . DC  A 1 14  ? -1.601  7.250   49.990 1.00 0.34 ? 314 DC  C "O5'"  1 
ATOM 418  C "C5'"  . DC  A 1 14  ? -2.140  7.895   48.832 1.00 0.34 ? 314 DC  C "C5'"  1 
ATOM 419  C "C4'"  . DC  A 1 14  ? -3.662  7.892   48.837 1.00 0.33 ? 314 DC  C "C4'"  1 
ATOM 420  O "O4'"  . DC  A 1 14  ? -4.135  6.570   48.541 1.00 0.30 ? 314 DC  C "O4'"  1 
ATOM 421  C "C3'"  . DC  A 1 14  ? -4.273  8.319   50.173 1.00 0.33 ? 314 DC  C "C3'"  1 
ATOM 422  O "O3'"  . DC  A 1 14  ? -5.359  9.205   49.943 1.00 0.35 ? 314 DC  C "O3'"  1 
ATOM 423  C "C2'"  . DC  A 1 14  ? -4.776  7.018   50.789 1.00 0.30 ? 314 DC  C "C2'"  1 
ATOM 424  C "C1'"  . DC  A 1 14  ? -5.030  6.136   49.567 1.00 0.29 ? 314 DC  C "C1'"  1 
ATOM 425  N N1     . DC  A 1 14  ? -4.808  4.670   49.768 1.00 0.27 ? 314 DC  C N1     1 
ATOM 426  C C2     . DC  A 1 14  ? -5.742  3.802   49.205 1.00 0.25 ? 314 DC  C C2     1 
ATOM 427  O O2     . DC  A 1 14  ? -6.710  4.255   48.602 1.00 0.26 ? 314 DC  C O2     1 
ATOM 428  N N3     . DC  A 1 14  ? -5.540  2.456   49.349 1.00 0.24 ? 314 DC  C N3     1 
ATOM 429  C C4     . DC  A 1 14  ? -4.473  1.973   50.013 1.00 0.24 ? 314 DC  C C4     1 
ATOM 430  N N4     . DC  A 1 14  ? -4.320  0.652   50.142 1.00 0.24 ? 314 DC  C N4     1 
ATOM 431  C C5     . DC  A 1 14  ? -3.506  2.854   50.594 1.00 0.26 ? 314 DC  C C5     1 
ATOM 432  C C6     . DC  A 1 14  ? -3.712  4.184   50.453 1.00 0.27 ? 314 DC  C C6     1 
ATOM 433  H "H5'"  . DC  A 1 14  ? -1.795  7.359   47.947 1.00 0.34 ? 314 DC  C "H5'"  1 
ATOM 434  H "H5''" . DC  A 1 14  ? -1.781  8.921   48.789 1.00 0.37 ? 314 DC  C "H5''" 1 
ATOM 435  H "H4'"  . DC  A 1 14  ? -4.013  8.572   48.061 1.00 0.34 ? 314 DC  C "H4'"  1 
ATOM 436  H "H3'"  . DC  A 1 14  ? -3.525  8.789   50.818 1.00 0.35 ? 314 DC  C "H3'"  1 
ATOM 437  H "H2'"  . DC  A 1 14  ? -4.018  6.606   51.431 1.00 0.31 ? 314 DC  C "H2'"  1 
ATOM 438  H "H2''" . DC  A 1 14  ? -5.696  7.175   51.343 1.00 0.30 ? 314 DC  C "H2''" 1 
ATOM 439  H "H1'"  . DC  A 1 14  ? -6.058  6.305   49.229 1.00 0.29 ? 314 DC  C "H1'"  1 
ATOM 440  H H41    . DC  A 1 14  ? -4.999  0.023   49.739 1.00 0.23 ? 314 DC  C H41    1 
ATOM 441  H H42    . DC  A 1 14  ? -3.525  0.283   50.648 1.00 0.25 ? 314 DC  C H42    1 
ATOM 442  H H5     . DC  A 1 14  ? -2.633  2.469   51.116 1.00 0.27 ? 314 DC  C H5     1 
ATOM 443  H H6     . DC  A 1 14  ? -3.008  4.870   50.903 1.00 0.29 ? 314 DC  C H6     1 
ATOM 444  P P      . DT  A 1 15  ? -6.225  9.731   51.184 1.00 0.37 ? 315 DT  C P      1 
ATOM 445  O OP1    . DT  A 1 15  ? -6.673  11.113  50.918 1.00 0.41 ? 315 DT  C OP1    1 
ATOM 446  O OP2    . DT  A 1 15  ? -5.476  9.410   52.412 1.00 0.38 ? 315 DT  C OP2    1 
ATOM 447  O "O5'"  . DT  A 1 15  ? -7.492  8.752   51.101 1.00 0.34 ? 315 DT  C "O5'"  1 
ATOM 448  C "C5'"  . DT  A 1 15  ? -8.262  8.747   49.901 1.00 0.34 ? 315 DT  C "C5'"  1 
ATOM 449  C "C4'"  . DT  A 1 15  ? -9.535  7.932   50.035 1.00 0.32 ? 315 DT  C "C4'"  1 
ATOM 450  O "O4'"  . DT  A 1 15  ? -9.198  6.539   50.061 1.00 0.30 ? 315 DT  C "O4'"  1 
ATOM 451  C "C3'"  . DT  A 1 15  ? -10.350 8.236   51.294 1.00 0.32 ? 315 DT  C "C3'"  1 
ATOM 452  O "O3'"  . DT  A 1 15  ? -11.717 8.358   50.930 1.00 0.33 ? 315 DT  C "O3'"  1 
ATOM 453  C "C2'"  . DT  A 1 15  ? -10.161 7.016   52.183 1.00 0.31 ? 315 DT  C "C2'"  1 
ATOM 454  C "C1'"  . DT  A 1 15  ? -9.826  5.916   51.180 1.00 0.29 ? 315 DT  C "C1'"  1 
ATOM 455  N N1     . DT  A 1 15  ? -8.903  4.866   51.687 1.00 0.28 ? 315 DT  C N1     1 
ATOM 456  C C2     . DT  A 1 15  ? -9.259  3.541   51.465 1.00 0.26 ? 315 DT  C C2     1 
ATOM 457  O O2     . DT  A 1 15  ? -10.292 3.235   50.873 1.00 0.26 ? 315 DT  C O2     1 
ATOM 458  N N3     . DT  A 1 15  ? -8.377  2.593   51.960 1.00 0.25 ? 315 DT  C N3     1 
ATOM 459  C C4     . DT  A 1 15  ? -7.191  2.851   52.647 1.00 0.26 ? 315 DT  C C4     1 
ATOM 460  O O4     . DT  A 1 15  ? -6.481  1.930   53.043 1.00 0.25 ? 315 DT  C O4     1 
ATOM 461  C C5     . DT  A 1 15  ? -6.904  4.259   52.832 1.00 0.28 ? 315 DT  C C5     1 
ATOM 462  C C7     . DT  A 1 15  ? -5.664  4.689   53.605 1.00 0.29 ? 315 DT  C C7     1 
ATOM 463  C C6     . DT  A 1 15  ? -7.741  5.199   52.353 1.00 0.29 ? 315 DT  C C6     1 
ATOM 464  H "H5'"  . DT  A 1 15  ? -7.655  8.319   49.102 1.00 0.34 ? 315 DT  C "H5'"  1 
ATOM 465  H "H5''" . DT  A 1 15  ? -8.520  9.771   49.640 1.00 0.36 ? 315 DT  C "H5''" 1 
ATOM 466  H "H4'"  . DT  A 1 15  ? -10.161 8.123   49.163 1.00 0.33 ? 315 DT  C "H4'"  1 
ATOM 467  H "H3'"  . DT  A 1 15  ? -9.995  9.141   51.791 1.00 0.34 ? 315 DT  C "H3'"  1 
ATOM 468  H "H2'"  . DT  A 1 15  ? -9.355  7.185   52.885 1.00 0.33 ? 315 DT  C "H2'"  1 
ATOM 469  H "H2''" . DT  A 1 15  ? -11.073 6.780   52.715 1.00 0.32 ? 315 DT  C "H2''" 1 
ATOM 470  H "H1'"  . DT  A 1 15  ? -10.762 5.456   50.845 1.00 0.30 ? 315 DT  C "H1'"  1 
ATOM 471  H H3     . DT  A 1 15  ? -8.614  1.622   51.800 1.00 0.24 ? 315 DT  C H3     1 
ATOM 472  H H71    . DT  A 1 15  ? -5.096  5.395   53.010 1.00 1.03 ? 315 DT  C H71    1 
ATOM 473  H H72    . DT  A 1 15  ? -5.046  3.820   53.826 1.00 1.04 ? 315 DT  C H72    1 
ATOM 474  H H73    . DT  A 1 15  ? -5.968  5.167   54.536 1.00 1.09 ? 315 DT  C H73    1 
ATOM 475  H H6     . DT  A 1 15  ? -7.475  6.243   52.475 1.00 0.30 ? 315 DT  C H6     1 
ATOM 476  P P      . DA  A 1 16  ? -12.833 8.597   52.050 1.00 0.33 ? 316 DA  C P      1 
ATOM 477  O OP1    . DA  A 1 16  ? -13.901 9.414   51.462 1.00 0.36 ? 316 DA  C OP1    1 
ATOM 478  O OP2    . DA  A 1 16  ? -12.162 8.999   53.302 1.00 0.34 ? 316 DA  C OP2    1 
ATOM 479  O "O5'"  . DA  A 1 16  ? -13.398 7.119   52.262 1.00 0.30 ? 316 DA  C "O5'"  1 
ATOM 480  C "C5'"  . DA  A 1 16  ? -14.021 6.459   51.170 1.00 0.29 ? 316 DA  C "C5'"  1 
ATOM 481  C "C4'"  . DA  A 1 16  ? -14.745 5.214   51.630 1.00 0.27 ? 316 DA  C "C4'"  1 
ATOM 482  O "O4'"  . DA  A 1 16  ? -13.782 4.211   51.983 1.00 0.26 ? 316 DA  C "O4'"  1 
ATOM 483  C "C3'"  . DA  A 1 16  ? -15.647 5.437   52.844 1.00 0.26 ? 316 DA  C "C3'"  1 
ATOM 484  O "O3'"  . DA  A 1 16  ? -16.870 4.745   52.635 1.00 0.24 ? 316 DA  C "O3'"  1 
ATOM 485  C "C2'"  . DA  A 1 16  ? -14.884 4.818   54.003 1.00 0.25 ? 316 DA  C "C2'"  1 
ATOM 486  C "C1'"  . DA  A 1 16  ? -14.018 3.769   53.322 1.00 0.25 ? 316 DA  C "C1'"  1 
ATOM 487  N N9     . DA  A 1 16  ? -12.707 3.557   53.970 1.00 0.25 ? 316 DA  C N9     1 
ATOM 488  C C8     . DA  A 1 16  ? -11.801 4.476   54.425 1.00 0.26 ? 316 DA  C C8     1 
ATOM 489  N N7     . DA  A 1 16  ? -10.719 3.980   54.948 1.00 0.27 ? 316 DA  C N7     1 
ATOM 490  C C5     . DA  A 1 16  ? -10.921 2.612   54.837 1.00 0.26 ? 316 DA  C C5     1 
ATOM 491  C C6     . DA  A 1 16  ? -10.152 1.491   55.207 1.00 0.26 ? 316 DA  C C6     1 
ATOM 492  N N6     . DA  A 1 16  ? -8.954  1.590   55.788 1.00 0.27 ? 316 DA  C N6     1 
ATOM 493  N N1     . DA  A 1 16  ? -10.661 0.261   54.951 1.00 0.25 ? 316 DA  C N1     1 
ATOM 494  C C2     . DA  A 1 16  ? -11.859 0.126   54.363 1.00 0.24 ? 316 DA  C C2     1 
ATOM 495  N N3     . DA  A 1 16  ? -12.665 1.118   53.972 1.00 0.24 ? 316 DA  C N3     1 
ATOM 496  C C4     . DA  A 1 16  ? -12.131 2.344   54.242 1.00 0.25 ? 316 DA  C C4     1 
ATOM 497  H "H5'"  . DA  A 1 16  ? -13.261 6.183   50.440 1.00 0.30 ? 316 DA  C "H5'"  1 
ATOM 498  H "H5''" . DA  A 1 16  ? -14.735 7.138   50.705 1.00 0.31 ? 316 DA  C "H5''" 1 
ATOM 499  H "H4'"  . DA  A 1 16  ? -15.355 4.840   50.806 1.00 0.27 ? 316 DA  C "H4'"  1 
ATOM 500  H "H3'"  . DA  A 1 16  ? -15.828 6.501   53.020 1.00 0.27 ? 316 DA  C "H3'"  1 
ATOM 501  H "H2'"  . DA  A 1 16  ? -14.269 5.564   54.499 1.00 0.26 ? 316 DA  C "H2'"  1 
ATOM 502  H "H2''" . DA  A 1 16  ? -15.563 4.357   54.707 1.00 0.24 ? 316 DA  C "H2''" 1 
ATOM 503  H "H1'"  . DA  A 1 16  ? -14.558 2.822   53.292 1.00 0.24 ? 316 DA  C "H1'"  1 
ATOM 504  H H8     . DA  A 1 16  ? -11.978 5.544   54.375 1.00 0.27 ? 316 DA  C H8     1 
ATOM 505  H H61    . DA  A 1 16  ? -8.440  0.755   56.036 1.00 0.27 ? 316 DA  C H61    1 
ATOM 506  H H62    . DA  A 1 16  ? -8.559  2.501   55.978 1.00 0.27 ? 316 DA  C H62    1 
ATOM 507  H H2     . DA  A 1 16  ? -12.211 -0.890  54.190 1.00 0.24 ? 316 DA  C H2     1 
ATOM 508  P P      . DA  A 1 17  ? -18.004 4.701   53.768 1.00 0.23 ? 317 DA  C P      1 
ATOM 509  O OP1    . DA  A 1 17  ? -19.325 4.600   53.114 1.00 0.22 ? 317 DA  C OP1    1 
ATOM 510  O OP2    . DA  A 1 17  ? -17.731 5.777   54.748 1.00 0.24 ? 317 DA  C OP2    1 
ATOM 511  O "O5'"  . DA  A 1 17  ? -17.666 3.293   54.458 1.00 0.22 ? 317 DA  C "O5'"  1 
ATOM 512  C "C5'"  . DA  A 1 17  ? -17.640 2.120   53.647 1.00 0.22 ? 317 DA  C "C5'"  1 
ATOM 513  C "C4'"  . DA  A 1 17  ? -17.523 0.857   54.482 1.00 0.22 ? 317 DA  C "C4'"  1 
ATOM 514  O "O4'"  . DA  A 1 17  ? -16.153 0.678   54.892 1.00 0.23 ? 317 DA  C "O4'"  1 
ATOM 515  C "C3'"  . DA  A 1 17  ? -18.387 0.880   55.744 1.00 0.21 ? 317 DA  C "C3'"  1 
ATOM 516  O "O3'"  . DA  A 1 17  ? -19.072 -0.363  55.840 1.00 0.20 ? 317 DA  C "O3'"  1 
ATOM 517  C "C2'"  . DA  A 1 17  ? -17.392 1.031   56.890 1.00 0.21 ? 317 DA  C "C2'"  1 
ATOM 518  C "C1'"  . DA  A 1 17  ? -16.098 0.483   56.309 1.00 0.22 ? 317 DA  C "C1'"  1 
ATOM 519  N N9     . DA  A 1 17  ? -14.882 1.150   56.829 1.00 0.23 ? 317 DA  C N9     1 
ATOM 520  C C8     . DA  A 1 17  ? -14.605 2.483   56.932 1.00 0.24 ? 317 DA  C C8     1 
ATOM 521  N N7     . DA  A 1 17  ? -13.444 2.778   57.440 1.00 0.25 ? 317 DA  C N7     1 
ATOM 522  C C5     . DA  A 1 17  ? -12.896 1.530   57.704 1.00 0.25 ? 317 DA  C C5     1 
ATOM 523  C C6     . DA  A 1 17  ? -11.667 1.106   58.262 1.00 0.26 ? 317 DA  C C6     1 
ATOM 524  N N6     . DA  A 1 17  ? -10.705 1.946   58.666 1.00 0.27 ? 317 DA  C N6     1 
ATOM 525  N N1     . DA  A 1 17  ? -11.459 -0.225  58.385 1.00 0.26 ? 317 DA  C N1     1 
ATOM 526  C C2     . DA  A 1 17  ? -12.388 -1.107  57.986 1.00 0.25 ? 317 DA  C C2     1 
ATOM 527  N N3     . DA  A 1 17  ? -13.575 -0.817  57.444 1.00 0.24 ? 317 DA  C N3     1 
ATOM 528  C C4     . DA  A 1 17  ? -13.767 0.528   57.332 1.00 0.24 ? 317 DA  C C4     1 
ATOM 529  H "H5'"  . DA  A 1 17  ? -16.785 2.179   52.972 1.00 0.23 ? 317 DA  C "H5'"  1 
ATOM 530  H "H5''" . DA  A 1 17  ? -18.554 2.074   53.058 1.00 0.22 ? 317 DA  C "H5''" 1 
ATOM 531  H "H4'"  . DA  A 1 17  ? -17.821 0.003   53.870 1.00 0.21 ? 317 DA  C "H4'"  1 
ATOM 532  H "H3'"  . DA  A 1 17  ? -19.094 1.712   55.731 1.00 0.21 ? 317 DA  C "H3'"  1 
ATOM 533  H "H2'"  . DA  A 1 17  ? -17.275 2.080   57.160 1.00 0.22 ? 317 DA  C "H2'"  1 
ATOM 534  H "H2''" . DA  A 1 17  ? -17.703 0.450   57.750 1.00 0.21 ? 317 DA  C "H2''" 1 
ATOM 535  H "H1'"  . DA  A 1 17  ? -16.034 -0.586  56.517 1.00 0.22 ? 317 DA  C "H1'"  1 
ATOM 536  H H8     . DA  A 1 17  ? -15.312 3.243   56.633 1.00 0.24 ? 317 DA  C H8     1 
ATOM 537  H H61    . DA  A 1 17  ? -9.845  1.578   59.061 1.00 0.28 ? 317 DA  C H61    1 
ATOM 538  H H62    . DA  A 1 17  ? -10.832 2.946   58.574 1.00 0.28 ? 317 DA  C H62    1 
ATOM 539  H H2     . DA  A 1 17  ? -12.153 -2.162  58.123 1.00 0.25 ? 317 DA  C H2     1 
ATOM 540  P P      . DT  A 1 18  ? -19.996 -0.709  57.103 1.00 0.20 ? 318 DT  C P      1 
ATOM 541  O OP1    . DT  A 1 18  ? -21.185 -1.450  56.633 1.00 0.19 ? 318 DT  C OP1    1 
ATOM 542  O OP2    . DT  A 1 18  ? -20.152 0.519   57.917 1.00 0.20 ? 318 DT  C OP2    1 
ATOM 543  O "O5'"  . DT  A 1 18  ? -19.043 -1.722  57.897 1.00 0.20 ? 318 DT  C "O5'"  1 
ATOM 544  C "C5'"  . DT  A 1 18  ? -18.641 -2.927  57.243 1.00 0.20 ? 318 DT  C "C5'"  1 
ATOM 545  C "C4'"  . DT  A 1 18  ? -17.964 -3.891  58.200 1.00 0.21 ? 318 DT  C "C4'"  1 
ATOM 546  O "O4'"  . DT  A 1 18  ? -16.668 -3.381  58.539 1.00 0.22 ? 318 DT  C "O4'"  1 
ATOM 547  C "C3'"  . DT  A 1 18  ? -18.737 -4.117  59.500 1.00 0.21 ? 318 DT  C "C3'"  1 
ATOM 548  O "O3'"  . DT  A 1 18  ? -18.747 -5.508  59.804 1.00 0.22 ? 318 DT  C "O3'"  1 
ATOM 549  C "C2'"  . DT  A 1 18  ? -17.942 -3.366  60.558 1.00 0.22 ? 318 DT  C "C2'"  1 
ATOM 550  C "C1'"  . DT  A 1 18  ? -16.540 -3.288  59.958 1.00 0.22 ? 318 DT  C "C1'"  1 
ATOM 551  N N1     . DT  A 1 18  ? -15.800 -2.030  60.263 1.00 0.23 ? 318 DT  C N1     1 
ATOM 552  C C2     . DT  A 1 18  ? -14.506 -2.147  60.759 1.00 0.24 ? 318 DT  C C2     1 
ATOM 553  O O2     . DT  A 1 18  ? -13.980 -3.241  60.953 1.00 0.24 ? 318 DT  C O2     1 
ATOM 554  N N3     . DT  A 1 18  ? -13.853 -0.952  61.026 1.00 0.25 ? 318 DT  C N3     1 
ATOM 555  C C4     . DT  A 1 18  ? -14.368 0.330   60.842 1.00 0.24 ? 318 DT  C C4     1 
ATOM 556  O O4     . DT  A 1 18  ? -13.697 1.324   61.127 1.00 0.25 ? 318 DT  C O4     1 
ATOM 557  C C5     . DT  A 1 18  ? -15.719 0.359   60.319 1.00 0.23 ? 318 DT  C C5     1 
ATOM 558  C C7     . DT  A 1 18  ? -16.402 1.707   60.079 1.00 0.23 ? 318 DT  C C7     1 
ATOM 559  C C6     . DT  A 1 18  ? -16.378 -0.797  60.049 1.00 0.22 ? 318 DT  C C6     1 
ATOM 560  H "H5'"  . DT  A 1 18  ? -17.946 -2.676  56.442 1.00 0.21 ? 318 DT  C "H5'"  1 
ATOM 561  H "H5''" . DT  A 1 18  ? -19.519 -3.408  56.814 1.00 0.20 ? 318 DT  C "H5''" 1 
ATOM 562  H "H4'"  . DT  A 1 18  ? -17.842 -4.851  57.697 1.00 0.21 ? 318 DT  C "H4'"  1 
ATOM 563  H "H3'"  . DT  A 1 18  ? -19.756 -3.729  59.432 1.00 0.21 ? 318 DT  C "H3'"  1 
ATOM 564  H "H2'"  . DT  A 1 18  ? -18.363 -2.380  60.723 1.00 0.22 ? 318 DT  C "H2'"  1 
ATOM 565  H "H2''" . DT  A 1 18  ? -17.928 -3.924  61.484 1.00 0.23 ? 318 DT  C "H2''" 1 
ATOM 566  H "H1'"  . DT  A 1 18  ? -15.963 -4.149  60.309 1.00 0.23 ? 318 DT  C "H1'"  1 
ATOM 567  H H3     . DT  A 1 18  ? -12.911 -1.019  61.386 1.00 0.25 ? 318 DT  C H3     1 
ATOM 568  H H71    . DT  A 1 18  ? -17.447 1.553   59.805 1.00 0.22 ? 318 DT  C H71    1 
ATOM 569  H H72    . DT  A 1 18  ? -15.892 2.234   59.273 1.00 0.23 ? 318 DT  C H72    1 
ATOM 570  H H73    . DT  A 1 18  ? -16.355 2.303   60.990 1.00 0.24 ? 318 DT  C H73    1 
ATOM 571  H H6     . DT  A 1 18  ? -17.379 -0.746  59.641 1.00 0.22 ? 318 DT  C H6     1 
ATOM 572  P P      . DG  A 1 19  ? -19.509 -6.050  61.109 1.00 0.23 ? 319 DG  C P      1 
ATOM 573  O OP1    . DG  A 1 19  ? -20.000 -7.419  60.838 1.00 0.23 ? 319 DG  C OP1    1 
ATOM 574  O OP2    . DG  A 1 19  ? -20.451 -5.001  61.561 1.00 0.22 ? 319 DG  C OP2    1 
ATOM 575  O "O5'"  . DG  A 1 19  ? -18.318 -6.144  62.183 1.00 0.24 ? 319 DG  C "O5'"  1 
ATOM 576  C "C5'"  . DG  A 1 19  ? -17.176 -6.960  61.920 1.00 0.24 ? 319 DG  C "C5'"  1 
ATOM 577  C "C4'"  . DG  A 1 19  ? -16.371 -7.197  63.191 1.00 0.25 ? 319 DG  C "C4'"  1 
ATOM 578  O "O4'"  . DG  A 1 19  ? -15.515 -6.077  63.425 1.00 0.25 ? 319 DG  C "O4'"  1 
ATOM 579  C "C3'"  . DG  A 1 19  ? -17.238 -7.406  64.438 1.00 0.26 ? 319 DG  C "C3'"  1 
ATOM 580  O "O3'"  . DG  A 1 19  ? -16.751 -8.486  65.239 1.00 0.28 ? 319 DG  C "O3'"  1 
ATOM 581  C "C2'"  . DG  A 1 19  ? -17.149 -6.068  65.172 1.00 0.26 ? 319 DG  C "C2'"  1 
ATOM 582  C "C1'"  . DG  A 1 19  ? -15.824 -5.481  64.684 1.00 0.26 ? 319 DG  C "C1'"  1 
ATOM 583  N N9     . DG  A 1 19  ? -15.815 -4.013  64.485 1.00 0.26 ? 319 DG  C N9     1 
ATOM 584  C C8     . DG  A 1 19  ? -16.777 -3.180  63.974 1.00 0.25 ? 319 DG  C C8     1 
ATOM 585  N N7     . DG  A 1 19  ? -16.444 -1.923  63.903 1.00 0.25 ? 319 DG  C N7     1 
ATOM 586  C C5     . DG  A 1 19  ? -15.151 -1.913  64.414 1.00 0.26 ? 319 DG  C C5     1 
ATOM 587  C C6     . DG  A 1 19  ? -14.233 -0.827  64.611 1.00 0.27 ? 319 DG  C C6     1 
ATOM 588  O O6     . DG  A 1 19  ? -14.399 0.367   64.354 1.00 0.27 ? 319 DG  C O6     1 
ATOM 589  N N1     . DG  A 1 19  ? -13.018 -1.264  65.171 1.00 0.28 ? 319 DG  C N1     1 
ATOM 590  C C2     . DG  A 1 19  ? -12.721 -2.580  65.496 1.00 0.28 ? 319 DG  C C2     1 
ATOM 591  N N2     . DG  A 1 19  ? -11.513 -2.821  65.986 1.00 0.29 ? 319 DG  C N2     1 
ATOM 592  N N3     . DG  A 1 19  ? -13.576 -3.589  65.306 1.00 0.27 ? 319 DG  C N3     1 
ATOM 593  C C4     . DG  A 1 19  ? -14.763 -3.191  64.772 1.00 0.26 ? 319 DG  C C4     1 
ATOM 594  H "H5'"  . DG  A 1 19  ? -16.541 -6.453  61.192 1.00 0.24 ? 319 DG  C "H5'"  1 
ATOM 595  H "H5''" . DG  A 1 19  ? -17.501 -7.914  61.509 1.00 0.24 ? 319 DG  C "H5''" 1 
ATOM 596  H "H4'"  . DG  A 1 19  ? -15.753 -8.085  63.049 1.00 0.26 ? 319 DG  C "H4'"  1 
ATOM 597  H "H3'"  . DG  A 1 19  ? -18.275 -7.603  64.152 1.00 0.26 ? 319 DG  C "H3'"  1 
ATOM 598  H "HO3'" . DG  A 1 19  ? -15.903 -8.217  65.598 1.00 0.28 ? 319 DG  C "HO3'" 1 
ATOM 599  H "H2'"  . DG  A 1 19  ? -17.981 -5.424  64.899 1.00 0.26 ? 319 DG  C "H2'"  1 
ATOM 600  H "H2''" . DG  A 1 19  ? -17.128 -6.226  66.251 1.00 0.27 ? 319 DG  C "H2''" 1 
ATOM 601  H "H1'"  . DG  A 1 19  ? -15.038 -5.742  65.396 1.00 0.27 ? 319 DG  C "H1'"  1 
ATOM 602  H H8     . DG  A 1 19  ? -17.756 -3.533  63.672 1.00 0.24 ? 319 DG  C H8     1 
ATOM 603  H H1     . DG  A 1 19  ? -12.324 -0.553  65.345 1.00 0.29 ? 319 DG  C H1     1 
ATOM 604  H H21    . DG  A 1 19  ? -10.863 -2.062  66.124 1.00 0.30 ? 319 DG  C H21    1 
ATOM 605  H H22    . DG  A 1 19  ? -11.245 -3.763  66.219 1.00 0.30 ? 319 DG  C H22    1 
ATOM 606  O "O5'"  . DC  B 2 1   ? -7.432  3.856   69.427 1.00 0.37 ? 320 DC  D "O5'"  1 
ATOM 607  C "C5'"  . DC  B 2 1   ? -7.272  2.925   70.499 1.00 0.38 ? 320 DC  D "C5'"  1 
ATOM 608  C "C4'"  . DC  B 2 1   ? -7.091  1.506   69.979 1.00 0.37 ? 320 DC  D "C4'"  1 
ATOM 609  O "O4'"  . DC  B 2 1   ? -8.334  1.072   69.416 1.00 0.35 ? 320 DC  D "O4'"  1 
ATOM 610  C "C3'"  . DC  B 2 1   ? -6.018  1.349   68.895 1.00 0.37 ? 320 DC  D "C3'"  1 
ATOM 611  O "O3'"  . DC  B 2 1   ? -5.289  0.138   69.124 1.00 0.37 ? 320 DC  D "O3'"  1 
ATOM 612  C "C2'"  . DC  B 2 1   ? -6.793  1.249   67.594 1.00 0.35 ? 320 DC  D "C2'"  1 
ATOM 613  C "C1'"  . DC  B 2 1   ? -8.153  0.724   68.044 1.00 0.34 ? 320 DC  D "C1'"  1 
ATOM 614  N N1     . DC  B 2 1   ? -9.324  1.255   67.285 1.00 0.33 ? 320 DC  D N1     1 
ATOM 615  C C2     . DC  B 2 1   ? -10.262 0.322   66.860 1.00 0.31 ? 320 DC  D C2     1 
ATOM 616  O O2     . DC  B 2 1   ? -10.106 -0.861  67.139 1.00 0.31 ? 320 DC  D O2     1 
ATOM 617  N N3     . DC  B 2 1   ? -11.345 0.767   66.165 1.00 0.30 ? 320 DC  D N3     1 
ATOM 618  C C4     . DC  B 2 1   ? -11.520 2.072   65.889 1.00 0.30 ? 320 DC  D C4     1 
ATOM 619  N N4     . DC  B 2 1   ? -12.604 2.453   65.200 1.00 0.29 ? 320 DC  D N4     1 
ATOM 620  C C5     . DC  B 2 1   ? -10.563 3.052   66.324 1.00 0.32 ? 320 DC  D C5     1 
ATOM 621  C C6     . DC  B 2 1   ? -9.484  2.604   67.017 1.00 0.33 ? 320 DC  D C6     1 
ATOM 622  H "H5'"  . DC  B 2 1   ? -8.159  2.958   71.133 1.00 0.38 ? 320 DC  D "H5'"  1 
ATOM 623  H "H5''" . DC  B 2 1   ? -6.401  3.204   71.088 1.00 0.39 ? 320 DC  D "H5''" 1 
ATOM 624  H "H4'"  . DC  B 2 1   ? -6.841  0.854   70.816 1.00 0.37 ? 320 DC  D "H4'"  1 
ATOM 625  H "H3'"  . DC  B 2 1   ? -5.345  2.210   68.882 1.00 0.38 ? 320 DC  D "H3'"  1 
ATOM 626  H "H2'"  . DC  B 2 1   ? -6.875  2.220   67.121 1.00 0.35 ? 320 DC  D "H2'"  1 
ATOM 627  H "H2''" . DC  B 2 1   ? -6.316  0.544   66.924 1.00 0.35 ? 320 DC  D "H2''" 1 
ATOM 628  H "H1'"  . DC  B 2 1   ? -8.139  -0.368  67.968 1.00 0.34 ? 320 DC  D "H1'"  1 
ATOM 629  H H41    . DC  B 2 1   ? -13.279 1.763   64.896 1.00 0.28 ? 320 DC  D H41    1 
ATOM 630  H H42    . DC  B 2 1   ? -12.748 3.433   64.985 1.00 0.29 ? 320 DC  D H42    1 
ATOM 631  H H5     . DC  B 2 1   ? -10.698 4.110   66.107 1.00 0.32 ? 320 DC  D H5     1 
ATOM 632  H H6     . DC  B 2 1   ? -8.754  3.323   67.384 1.00 0.34 ? 320 DC  D H6     1 
ATOM 633  H "HO5'" . DC  B 2 1   ? -8.340  3.784   69.123 1.00 0.36 ? 320 DC  D "HO5'" 1 
ATOM 634  P P      . DA  B 2 2   ? -4.118  -0.326  68.118 1.00 0.37 ? 321 DA  D P      1 
ATOM 635  O OP1    . DA  B 2 2   ? -3.107  -1.089  68.881 1.00 0.38 ? 321 DA  D OP1    1 
ATOM 636  O OP2    . DA  B 2 2   ? -3.712  0.843   67.309 1.00 0.37 ? 321 DA  D OP2    1 
ATOM 637  O "O5'"  . DA  B 2 2   ? -4.897  -1.353  67.148 1.00 0.35 ? 321 DA  D "O5'"  1 
ATOM 638  C "C5'"  . DA  B 2 2   ? -5.507  -2.528  67.688 1.00 0.35 ? 321 DA  D "C5'"  1 
ATOM 639  C "C4'"  . DA  B 2 2   ? -5.989  -3.467  66.591 1.00 0.34 ? 321 DA  D "C4'"  1 
ATOM 640  O "O4'"  . DA  B 2 2   ? -7.228  -2.978  66.055 1.00 0.32 ? 321 DA  D "O4'"  1 
ATOM 641  C "C3'"  . DA  B 2 2   ? -5.012  -3.616  65.421 1.00 0.34 ? 321 DA  D "C3'"  1 
ATOM 642  O "O3'"  . DA  B 2 2   ? -4.936  -4.990  65.058 1.00 0.33 ? 321 DA  D "O3'"  1 
ATOM 643  C "C2'"  . DA  B 2 2   ? -5.640  -2.813  64.294 1.00 0.33 ? 321 DA  D "C2'"  1 
ATOM 644  C "C1'"  . DA  B 2 2   ? -7.120  -2.861  64.633 1.00 0.32 ? 321 DA  D "C1'"  1 
ATOM 645  N N9     . DA  B 2 2   ? -7.874  -1.661  64.214 1.00 0.31 ? 321 DA  D N9     1 
ATOM 646  C C8     . DA  B 2 2   ? -7.549  -0.338  64.344 1.00 0.32 ? 321 DA  D C8     1 
ATOM 647  N N7     . DA  B 2 2   ? -8.429  0.500   63.884 1.00 0.31 ? 321 DA  D N7     1 
ATOM 648  C C5     . DA  B 2 2   ? -9.426  -0.335  63.403 1.00 0.29 ? 321 DA  D C5     1 
ATOM 649  C C6     . DA  B 2 2   ? -10.663 -0.095  62.773 1.00 0.28 ? 321 DA  D C6     1 
ATOM 650  N N6     . DA  B 2 2   ? -11.126 1.132   62.521 1.00 0.28 ? 321 DA  D N6     1 
ATOM 651  N N1     . DA  B 2 2   ? -11.411 -1.168  62.419 1.00 0.27 ? 321 DA  D N1     1 
ATOM 652  C C2     . DA  B 2 2   ? -10.981 -2.414  62.663 1.00 0.27 ? 321 DA  D C2     1 
ATOM 653  N N3     . DA  B 2 2   ? -9.830  -2.751  63.253 1.00 0.29 ? 321 DA  D N3     1 
ATOM 654  C C4     . DA  B 2 2   ? -9.096  -1.656  63.599 1.00 0.29 ? 321 DA  D C4     1 
ATOM 655  H "H5'"  . DA  B 2 2   ? -6.360  -2.233  68.300 1.00 0.35 ? 321 DA  D "H5'"  1 
ATOM 656  H "H5''" . DA  B 2 2   ? -4.784  -3.051  68.313 1.00 0.36 ? 321 DA  D "H5''" 1 
ATOM 657  H "H4'"  . DA  B 2 2   ? -6.161  -4.453  67.026 1.00 0.34 ? 321 DA  D "H4'"  1 
ATOM 658  H "H3'"  . DA  B 2 2   ? -4.025  -3.225  65.674 1.00 0.35 ? 321 DA  D "H3'"  1 
ATOM 659  H "H2'"  . DA  B 2 2   ? -5.272  -1.791  64.303 1.00 0.33 ? 321 DA  D "H2'"  1 
ATOM 660  H "H2''" . DA  B 2 2   ? -5.448  -3.277  63.332 1.00 0.32 ? 321 DA  D "H2''" 1 
ATOM 661  H "H1'"  . DA  B 2 2   ? -7.566  -3.742  64.169 1.00 0.31 ? 321 DA  D "H1'"  1 
ATOM 662  H H8     . DA  B 2 2   ? -6.615  -0.006  64.776 1.00 0.33 ? 321 DA  D H8     1 
ATOM 663  H H61    . DA  B 2 2   ? -12.021 1.252   62.064 1.00 0.27 ? 321 DA  D H61    1 
ATOM 664  H H62    . DA  B 2 2   ? -10.581 1.942   62.786 1.00 0.29 ? 321 DA  D H62    1 
ATOM 665  H H2     . DA  B 2 2   ? -11.629 -3.229  62.346 1.00 0.27 ? 321 DA  D H2     1 
ATOM 666  P P      . DT  B 2 3   ? -4.050  -5.469  63.809 1.00 0.34 ? 322 DT  D P      1 
ATOM 667  O OP1    . DT  B 2 3   ? -3.559  -6.839  64.068 1.00 0.34 ? 322 DT  D OP1    1 
ATOM 668  O OP2    . DT  B 2 3   ? -3.102  -4.386  63.463 1.00 0.34 ? 322 DT  D OP2    1 
ATOM 669  O "O5'"  . DT  B 2 3   ? -5.170  -5.538  62.662 1.00 0.32 ? 322 DT  D "O5'"  1 
ATOM 670  C "C5'"  . DT  B 2 3   ? -6.314  -6.359  62.873 1.00 0.31 ? 322 DT  D "C5'"  1 
ATOM 671  C "C4'"  . DT  B 2 3   ? -7.178  -6.458  61.631 1.00 0.30 ? 322 DT  D "C4'"  1 
ATOM 672  O "O4'"  . DT  B 2 3   ? -7.966  -5.263  61.523 1.00 0.29 ? 322 DT  D "O4'"  1 
ATOM 673  C "C3'"  . DT  B 2 3   ? -6.377  -6.609  60.333 1.00 0.30 ? 322 DT  D "C3'"  1 
ATOM 674  O "O3'"  . DT  B 2 3   ? -6.956  -7.643  59.555 1.00 0.29 ? 322 DT  D "O3'"  1 
ATOM 675  C "C2'"  . DT  B 2 3   ? -6.572  -5.284  59.606 1.00 0.30 ? 322 DT  D "C2'"  1 
ATOM 676  C "C1'"  . DT  B 2 3   ? -7.884  -4.768  60.191 1.00 0.29 ? 322 DT  D "C1'"  1 
ATOM 677  N N1     . DT  B 2 3   ? -8.012  -3.282  60.234 1.00 0.29 ? 322 DT  D N1     1 
ATOM 678  C C2     . DT  B 2 3   ? -9.179  -2.725  59.722 1.00 0.28 ? 322 DT  D C2     1 
ATOM 679  O O2     . DT  B 2 3   ? -10.092 -3.422  59.282 1.00 0.27 ? 322 DT  D O2     1 
ATOM 680  N N3     . DT  B 2 3   ? -9.246  -1.339  59.746 1.00 0.28 ? 322 DT  D N3     1 
ATOM 681  C C4     . DT  B 2 3   ? -8.263  -0.471  60.228 1.00 0.29 ? 322 DT  D C4     1 
ATOM 682  O O4     . DT  B 2 3   ? -8.425  0.751   60.171 1.00 0.29 ? 322 DT  D O4     1 
ATOM 683  C C5     . DT  B 2 3   ? -7.086  -1.142  60.749 1.00 0.30 ? 322 DT  D C5     1 
ATOM 684  C C7     . DT  B 2 3   ? -5.921  -0.328  61.308 1.00 0.32 ? 322 DT  D C7     1 
ATOM 685  C C6     . DT  B 2 3   ? -7.000  -2.490  60.739 1.00 0.30 ? 322 DT  D C6     1 
ATOM 686  H "H5'"  . DT  B 2 3   ? -6.909  -5.934  63.682 1.00 0.31 ? 322 DT  D "H5'"  1 
ATOM 687  H "H5''" . DT  B 2 3   ? -5.987  -7.354  63.160 1.00 0.31 ? 322 DT  D "H5''" 1 
ATOM 688  H "H4'"  . DT  B 2 3   ? -7.849  -7.313  61.733 1.00 0.29 ? 322 DT  D "H4'"  1 
ATOM 689  H "H3'"  . DT  B 2 3   ? -5.317  -6.803  60.527 1.00 0.31 ? 322 DT  D "H3'"  1 
ATOM 690  H "H2'"  . DT  B 2 3   ? -5.747  -4.615  59.814 1.00 0.31 ? 322 DT  D "H2'"  1 
ATOM 691  H "H2''" . DT  B 2 3   ? -6.671  -5.440  58.537 1.00 0.29 ? 322 DT  D "H2''" 1 
ATOM 692  H "H1'"  . DT  B 2 3   ? -8.711  -5.192  59.614 1.00 0.28 ? 322 DT  D "H1'"  1 
ATOM 693  H H3     . DT  B 2 3   ? -10.092 -0.919  59.381 1.00 0.27 ? 322 DT  D H3     1 
ATOM 694  H H71    . DT  B 2 3   ? -5.169  -0.194  60.530 1.00 0.32 ? 322 DT  D H71    1 
ATOM 695  H H72    . DT  B 2 3   ? -5.477  -0.864  62.149 1.00 0.32 ? 322 DT  D H72    1 
ATOM 696  H H73    . DT  B 2 3   ? -6.276  0.646   61.645 1.00 0.32 ? 322 DT  D H73    1 
ATOM 697  H H6     . DT  B 2 3   ? -6.120  -2.956  61.162 1.00 0.31 ? 322 DT  D H6     1 
ATOM 698  P P      . DT  B 2 4   ? -6.317  -8.061  58.146 1.00 0.30 ? 323 DT  D P      1 
ATOM 699  O OP1    . DT  B 2 4   ? -6.096  -9.522  58.134 1.00 0.30 ? 323 DT  D OP1    1 
ATOM 700  O OP2    . DT  B 2 4   ? -5.203  -7.137  57.838 1.00 0.31 ? 323 DT  D OP2    1 
ATOM 701  O "O5'"  . DT  B 2 4   ? -7.541  -7.731  57.170 1.00 0.27 ? 323 DT  D "O5'"  1 
ATOM 702  C "C5'"  . DT  B 2 4   ? -8.832  -8.233  57.506 1.00 0.25 ? 323 DT  D "C5'"  1 
ATOM 703  C "C4'"  . DT  B 2 4   ? -9.869  -7.843  56.471 1.00 0.22 ? 323 DT  D "C4'"  1 
ATOM 704  O "O4'"  . DT  B 2 4   ? -10.170 -6.445  56.601 1.00 0.22 ? 323 DT  D "O4'"  1 
ATOM 705  C "C3'"  . DT  B 2 4   ? -9.417  -8.097  55.034 1.00 0.22 ? 323 DT  D "C3'"  1 
ATOM 706  O "O3'"  . DT  B 2 4   ? -10.486 -8.687  54.299 1.00 0.21 ? 323 DT  D "O3'"  1 
ATOM 707  C "C2'"  . DT  B 2 4   ? -9.102  -6.715  54.480 1.00 0.23 ? 323 DT  D "C2'"  1 
ATOM 708  C "C1'"  . DT  B 2 4   ? -9.927  -5.779  55.362 1.00 0.22 ? 323 DT  D "C1'"  1 
ATOM 709  N N1     . DT  B 2 4   ? -9.269  -4.476  55.671 1.00 0.24 ? 323 DT  D N1     1 
ATOM 710  C C2     . DT  B 2 4   ? -9.996  -3.312  55.437 1.00 0.24 ? 323 DT  D C2     1 
ATOM 711  O O2     . DT  B 2 4   ? -11.137 -3.337  54.981 1.00 0.22 ? 323 DT  D O2     1 
ATOM 712  N N3     . DT  B 2 4   ? -9.349  -2.124  55.748 1.00 0.25 ? 323 DT  D N3     1 
ATOM 713  C C4     . DT  B 2 4   ? -8.062  -1.998  56.267 1.00 0.27 ? 323 DT  D C4     1 
ATOM 714  O O4     . DT  B 2 4   ? -7.584  -0.886  56.497 1.00 0.29 ? 323 DT  D O4     1 
ATOM 715  C C5     . DT  B 2 4   ? -7.381  -3.257  56.483 1.00 0.28 ? 323 DT  D C5     1 
ATOM 716  C C7     . DT  B 2 4   ? -5.959  -3.253  57.044 1.00 0.30 ? 323 DT  D C7     1 
ATOM 717  C C6     . DT  B 2 4   ? -7.992  -4.433  56.188 1.00 0.26 ? 323 DT  D C6     1 
ATOM 718  H "H5'"  . DT  B 2 4   ? -9.125  -7.823  58.472 1.00 0.26 ? 323 DT  D "H5'"  1 
ATOM 719  H "H5''" . DT  B 2 4   ? -8.786  -9.319  57.578 1.00 0.25 ? 323 DT  D "H5''" 1 
ATOM 720  H "H4'"  . DT  B 2 4   ? -10.779 -8.415  56.657 1.00 0.21 ? 323 DT  D "H4'"  1 
ATOM 721  H "H3'"  . DT  B 2 4   ? -8.531  -8.737  55.003 1.00 0.24 ? 323 DT  D "H3'"  1 
ATOM 722  H "H2'"  . DT  B 2 4   ? -8.041  -6.503  54.562 1.00 0.25 ? 323 DT  D "H2'"  1 
ATOM 723  H "H2''" . DT  B 2 4   ? -9.419  -6.643  53.449 1.00 0.24 ? 323 DT  D "H2''" 1 
ATOM 724  H "H1'"  . DT  B 2 4   ? -10.890 -5.599  54.873 1.00 0.21 ? 323 DT  D "H1'"  1 
ATOM 725  H H3     . DT  B 2 4   ? -9.861  -1.268  55.580 1.00 0.25 ? 323 DT  D H3     1 
ATOM 726  H H71    . DT  B 2 4   ? -5.991  -3.026  58.109 1.00 1.06 ? 323 DT  D H71    1 
ATOM 727  H H72    . DT  B 2 4   ? -5.370  -2.495  56.528 1.00 1.08 ? 323 DT  D H72    1 
ATOM 728  H H73    . DT  B 2 4   ? -5.498  -4.231  56.895 1.00 1.07 ? 323 DT  D H73    1 
ATOM 729  H H6     . DT  B 2 4   ? -7.464  -5.361  56.381 1.00 0.27 ? 323 DT  D H6     1 
ATOM 730  P P      . DA  B 2 5   ? -10.294 -9.055  52.747 1.00 0.23 ? 324 DA  D P      1 
ATOM 731  O OP1    . DA  B 2 5   ? -11.115 -10.245 52.437 1.00 0.24 ? 324 DA  D OP1    1 
ATOM 732  O OP2    . DA  B 2 5   ? -8.844  -9.053  52.448 1.00 0.25 ? 324 DA  D OP2    1 
ATOM 733  O "O5'"  . DA  B 2 5   ? -10.954 -7.781  52.024 1.00 0.22 ? 324 DA  D "O5'"  1 
ATOM 734  C "C5'"  . DA  B 2 5   ? -12.335 -7.488  52.238 1.00 0.21 ? 324 DA  D "C5'"  1 
ATOM 735  C "C4'"  . DA  B 2 5   ? -12.829 -6.391  51.306 1.00 0.20 ? 324 DA  D "C4'"  1 
ATOM 736  O "O4'"  . DA  B 2 5   ? -12.276 -5.128  51.714 1.00 0.22 ? 324 DA  D "O4'"  1 
ATOM 737  C "C3'"  . DA  B 2 5   ? -12.454 -6.603  49.839 1.00 0.20 ? 324 DA  D "C3'"  1 
ATOM 738  O "O3'"  . DA  B 2 5   ? -13.578 -6.291  49.024 1.00 0.21 ? 324 DA  D "O3'"  1 
ATOM 739  C "C2'"  . DA  B 2 5   ? -11.331 -5.613  49.581 1.00 0.20 ? 324 DA  D "C2'"  1 
ATOM 740  C "C1'"  . DA  B 2 5   ? -11.584 -4.526  50.614 1.00 0.20 ? 324 DA  D "C1'"  1 
ATOM 741  N N9     . DA  B 2 5   ? -10.352 -3.901  51.138 1.00 0.21 ? 324 DA  D N9     1 
ATOM 742  C C8     . DA  B 2 5   ? -9.206  -4.493  51.591 1.00 0.22 ? 324 DA  D C8     1 
ATOM 743  N N7     . DA  B 2 5   ? -8.291  -3.680  52.023 1.00 0.22 ? 324 DA  D N7     1 
ATOM 744  C C5     . DA  B 2 5   ? -8.871  -2.434  51.836 1.00 0.22 ? 324 DA  D C5     1 
ATOM 745  C C6     . DA  B 2 5   ? -8.428  -1.120  52.082 1.00 0.23 ? 324 DA  D C6     1 
ATOM 746  N N6     . DA  B 2 5   ? -7.236  -0.844  52.614 1.00 0.24 ? 324 DA  D N6     1 
ATOM 747  N N1     . DA  B 2 5   ? -9.262  -0.100  51.768 1.00 0.23 ? 324 DA  D N1     1 
ATOM 748  C C2     . DA  B 2 5   ? -10.473 -0.344  51.241 1.00 0.22 ? 324 DA  D C2     1 
ATOM 749  N N3     . DA  B 2 5   ? -10.991 -1.548  50.974 1.00 0.21 ? 324 DA  D N3     1 
ATOM 750  C C4     . DA  B 2 5   ? -10.130 -2.556  51.296 1.00 0.21 ? 324 DA  D C4     1 
ATOM 751  H "H5'"  . DA  B 2 5   ? -12.470 -7.163  53.270 1.00 0.22 ? 324 DA  D "H5'"  1 
ATOM 752  H "H5''" . DA  B 2 5   ? -12.922 -8.391  52.071 1.00 0.21 ? 324 DA  D "H5''" 1 
ATOM 753  H "H4'"  . DA  B 2 5   ? -13.916 -6.337  51.381 1.00 0.20 ? 324 DA  D "H4'"  1 
ATOM 754  H "H3'"  . DA  B 2 5   ? -12.119 -7.625  49.657 1.00 0.21 ? 324 DA  D "H3'"  1 
ATOM 755  H "H2'"  . DA  B 2 5   ? -10.363 -6.083  49.742 1.00 0.20 ? 324 DA  D "H2'"  1 
ATOM 756  H "H2''" . DA  B 2 5   ? -11.397 -5.212  48.577 1.00 0.21 ? 324 DA  D "H2''" 1 
ATOM 757  H "H1'"  . DA  B 2 5   ? -12.216 -3.753  50.176 1.00 0.22 ? 324 DA  D "H1'"  1 
ATOM 758  H H8     . DA  B 2 5   ? -9.052  -5.564  51.554 1.00 0.22 ? 324 DA  D H8     1 
ATOM 759  H H61    . DA  B 2 5   ? -6.963  0.117   52.770 1.00 0.25 ? 324 DA  D H61    1 
ATOM 760  H H62    . DA  B 2 5   ? -6.605  -1.594  52.860 1.00 0.25 ? 324 DA  D H62    1 
ATOM 761  H H2     . DA  B 2 5   ? -11.090 0.522   51.005 1.00 0.23 ? 324 DA  D H2     1 
ATOM 762  P P      . DG  B 2 6   ? -13.479 -6.390  47.426 1.00 0.21 ? 325 DG  D P      1 
ATOM 763  O OP1    . DG  B 2 6   ? -14.800 -6.776  46.887 1.00 0.23 ? 325 DG  D OP1    1 
ATOM 764  O OP2    . DG  B 2 6   ? -12.275 -7.182  47.089 1.00 0.21 ? 325 DG  D OP2    1 
ATOM 765  O "O5'"  . DG  B 2 6   ? -13.195 -4.858  47.042 1.00 0.22 ? 325 DG  D "O5'"  1 
ATOM 766  C "C5'"  . DG  B 2 6   ? -14.133 -3.854  47.438 1.00 0.24 ? 325 DG  D "C5'"  1 
ATOM 767  C "C4'"  . DG  B 2 6   ? -13.835 -2.515  46.780 1.00 0.25 ? 325 DG  D "C4'"  1 
ATOM 768  O "O4'"  . DG  B 2 6   ? -12.741 -1.879  47.461 1.00 0.25 ? 325 DG  D "O4'"  1 
ATOM 769  C "C3'"  . DG  B 2 6   ? -13.460 -2.629  45.302 1.00 0.26 ? 325 DG  D "C3'"  1 
ATOM 770  O "O3'"  . DG  B 2 6   ? -14.139 -1.612  44.568 1.00 0.31 ? 325 DG  D "O3'"  1 
ATOM 771  C "C2'"  . DG  B 2 6   ? -11.963 -2.372  45.269 1.00 0.26 ? 325 DG  D "C2'"  1 
ATOM 772  C "C1'"  . DG  B 2 6   ? -11.724 -1.540  46.516 1.00 0.26 ? 325 DG  D "C1'"  1 
ATOM 773  N N9     . DG  B 2 6   ? -10.408 -1.772  47.150 1.00 0.24 ? 325 DG  D N9     1 
ATOM 774  C C8     . DG  B 2 6   ? -9.775  -2.951  47.446 1.00 0.23 ? 325 DG  D C8     1 
ATOM 775  N N7     . DG  B 2 6   ? -8.617  -2.832  48.028 1.00 0.22 ? 325 DG  D N7     1 
ATOM 776  C C5     . DG  B 2 6   ? -8.460  -1.454  48.127 1.00 0.22 ? 325 DG  D C5     1 
ATOM 777  C C6     . DG  B 2 6   ? -7.385  -0.680  48.671 1.00 0.22 ? 325 DG  D C6     1 
ATOM 778  O O6     . DG  B 2 6   ? -6.346  -1.086  49.190 1.00 0.22 ? 325 DG  D O6     1 
ATOM 779  N N1     . DG  B 2 6   ? -7.624  0.702   48.563 1.00 0.23 ? 325 DG  D N1     1 
ATOM 780  C C2     . DG  B 2 6   ? -8.761  1.270   48.003 1.00 0.23 ? 325 DG  D C2     1 
ATOM 781  N N2     . DG  B 2 6   ? -8.817  2.595   47.970 1.00 0.25 ? 325 DG  D N2     1 
ATOM 782  N N3     . DG  B 2 6   ? -9.767  0.543   47.498 1.00 0.24 ? 325 DG  D N3     1 
ATOM 783  C C4     . DG  B 2 6   ? -9.554  -0.799  47.590 1.00 0.23 ? 325 DG  D C4     1 
ATOM 784  H "H5'"  . DG  B 2 6   ? -14.086 -3.734  48.521 1.00 0.24 ? 325 DG  D "H5'"  1 
ATOM 785  H "H5''" . DG  B 2 6   ? -15.136 -4.174  47.159 1.00 0.25 ? 325 DG  D "H5''" 1 
ATOM 786  H "H4'"  . DG  B 2 6   ? -14.719 -1.882  46.866 1.00 0.28 ? 325 DG  D "H4'"  1 
ATOM 787  H "H3'"  . DG  B 2 6   ? -13.695 -3.617  44.902 1.00 0.25 ? 325 DG  D "H3'"  1 
ATOM 788  H "H2'"  . DG  B 2 6   ? -11.406 -3.298  45.323 1.00 0.25 ? 325 DG  D "H2'"  1 
ATOM 789  H "H2''" . DG  B 2 6   ? -11.699 -1.821  44.379 1.00 0.31 ? 325 DG  D "H2''" 1 
ATOM 790  H "H1'"  . DG  B 2 6   ? -11.815 -0.481  46.264 1.00 0.29 ? 325 DG  D "H1'"  1 
ATOM 791  H H8     . DG  B 2 6   ? -10.196 -3.916  47.190 1.00 0.24 ? 325 DG  D H8     1 
ATOM 792  H H1     . DG  B 2 6   ? -6.905  1.310   48.924 1.00 0.23 ? 325 DG  D H1     1 
ATOM 793  H H21    . DG  B 2 6   ? -8.059  3.143   48.350 1.00 0.25 ? 325 DG  D H21    1 
ATOM 794  H H22    . DG  B 2 6   ? -9.616  3.053   47.561 1.00 0.26 ? 325 DG  D H22    1 
ATOM 795  P P      . DC  B 2 7   ? -14.018 -1.531  42.967 1.00 0.33 ? 326 DC  D P      1 
ATOM 796  O OP1    . DC  B 2 7   ? -15.382 -1.520  42.392 1.00 0.39 ? 326 DC  D OP1    1 
ATOM 797  O OP2    . DC  B 2 7   ? -13.037 -2.548  42.524 1.00 0.36 ? 326 DC  D OP2    1 
ATOM 798  O "O5'"  . DC  B 2 7   ? -13.368 -0.080  42.749 1.00 0.30 ? 326 DC  D "O5'"  1 
ATOM 799  C "C5'"  . DC  B 2 7   ? -13.992 1.071   43.323 1.00 0.30 ? 326 DC  D "C5'"  1 
ATOM 800  C "C4'"  . DC  B 2 7   ? -13.191 2.338   43.046 1.00 0.29 ? 326 DC  D "C4'"  1 
ATOM 801  O "O4'"  . DC  B 2 7   ? -11.980 2.289   43.810 1.00 0.28 ? 326 DC  D "O4'"  1 
ATOM 802  C "C3'"  . DC  B 2 7   ? -12.810 2.527   41.575 1.00 0.30 ? 326 DC  D "C3'"  1 
ATOM 803  O "O3'"  . DC  B 2 7   ? -12.988 3.897   41.203 1.00 0.32 ? 326 DC  D "O3'"  1 
ATOM 804  C "C2'"  . DC  B 2 7   ? -11.333 2.170   41.505 1.00 0.28 ? 326 DC  D "C2'"  1 
ATOM 805  C "C1'"  . DC  B 2 7   ? -10.844 2.345   42.944 1.00 0.27 ? 326 DC  D "C1'"  1 
ATOM 806  N N1     . DC  B 2 7   ? -9.882  1.302   43.405 1.00 0.24 ? 326 DC  D N1     1 
ATOM 807  C C2     . DC  B 2 7   ? -8.708  1.733   44.022 1.00 0.24 ? 326 DC  D C2     1 
ATOM 808  O O2     . DC  B 2 7   ? -8.486  2.932   44.150 1.00 0.25 ? 326 DC  D O2     1 
ATOM 809  N N3     . DC  B 2 7   ? -7.833  0.785   44.470 1.00 0.22 ? 326 DC  D N3     1 
ATOM 810  C C4     . DC  B 2 7   ? -8.086  -0.529  44.327 1.00 0.21 ? 326 DC  D C4     1 
ATOM 811  N N4     . DC  B 2 7   ? -7.203  -1.420  44.783 1.00 0.20 ? 326 DC  D N4     1 
ATOM 812  C C5     . DC  B 2 7   ? -9.289  -0.984  43.693 1.00 0.22 ? 326 DC  D C5     1 
ATOM 813  C C6     . DC  B 2 7   ? -10.154 -0.039  43.251 1.00 0.24 ? 326 DC  D C6     1 
ATOM 814  H "H5'"  . DC  B 2 7   ? -14.069 0.930   44.402 1.00 0.31 ? 326 DC  D "H5'"  1 
ATOM 815  H "H5''" . DC  B 2 7   ? -14.993 1.180   42.906 1.00 0.33 ? 326 DC  D "H5''" 1 
ATOM 816  H "H4'"  . DC  B 2 7   ? -13.775 3.198   43.370 1.00 0.31 ? 326 DC  D "H4'"  1 
ATOM 817  H "H3'"  . DC  B 2 7   ? -13.399 1.874   40.926 1.00 0.31 ? 326 DC  D "H3'"  1 
ATOM 818  H "H2'"  . DC  B 2 7   ? -11.201 1.149   41.161 1.00 0.28 ? 326 DC  D "H2'"  1 
ATOM 819  H "H2''" . DC  B 2 7   ? -10.820 2.856   40.848 1.00 0.30 ? 326 DC  D "H2''" 1 
ATOM 820  H "H1'"  . DC  B 2 7   ? -10.386 3.336   43.040 1.00 0.28 ? 326 DC  D "H1'"  1 
ATOM 821  H H41    . DC  B 2 7   ? -6.355  -1.107  45.233 1.00 0.19 ? 326 DC  D H41    1 
ATOM 822  H H42    . DC  B 2 7   ? -7.384  -2.409  44.682 1.00 0.20 ? 326 DC  D H42    1 
ATOM 823  H H5     . DC  B 2 7   ? -9.502  -2.045  43.577 1.00 0.22 ? 326 DC  D H5     1 
ATOM 824  H H6     . DC  B 2 7   ? -11.080 -0.349  42.770 1.00 0.25 ? 326 DC  D H6     1 
ATOM 825  P P      . DA  B 2 8   ? -12.706 4.375   39.688 1.00 0.35 ? 327 DA  D P      1 
ATOM 826  O OP1    . DA  B 2 8   ? -13.605 5.509   39.378 1.00 0.40 ? 327 DA  D OP1    1 
ATOM 827  O OP2    . DA  B 2 8   ? -12.709 3.175   38.822 1.00 0.35 ? 327 DA  D OP2    1 
ATOM 828  O "O5'"  . DA  B 2 8   ? -11.197 4.935   39.755 1.00 0.33 ? 327 DA  D "O5'"  1 
ATOM 829  C "C5'"  . DA  B 2 8   ? -10.881 6.052   40.590 1.00 0.33 ? 327 DA  D "C5'"  1 
ATOM 830  C "C4'"  . DA  B 2 8   ? -9.413  6.448   40.474 1.00 0.31 ? 327 DA  D "C4'"  1 
ATOM 831  O "O4'"  . DA  B 2 8   ? -8.602  5.431   41.085 1.00 0.29 ? 327 DA  D "O4'"  1 
ATOM 832  C "C3'"  . DA  B 2 8   ? -8.911  6.623   39.037 1.00 0.32 ? 327 DA  D "C3'"  1 
ATOM 833  O "O3'"  . DA  B 2 8   ? -8.074  7.775   38.979 1.00 0.32 ? 327 DA  D "O3'"  1 
ATOM 834  C "C2'"  . DA  B 2 8   ? -8.096  5.373   38.759 1.00 0.29 ? 327 DA  D "C2'"  1 
ATOM 835  C "C1'"  . DA  B 2 8   ? -7.632  4.949   40.144 1.00 0.27 ? 327 DA  D "C1'"  1 
ATOM 836  N N9     . DA  B 2 8   ? -7.520  3.484   40.312 1.00 0.25 ? 327 DA  D N9     1 
ATOM 837  C C8     . DA  B 2 8   ? -8.374  2.493   39.906 1.00 0.25 ? 327 DA  D C8     1 
ATOM 838  N N7     . DA  B 2 8   ? -8.008  1.287   40.207 1.00 0.24 ? 327 DA  D N7     1 
ATOM 839  C C5     . DA  B 2 8   ? -6.804  1.482   40.864 1.00 0.22 ? 327 DA  D C5     1 
ATOM 840  C C6     . DA  B 2 8   ? -5.876  0.599   41.446 1.00 0.20 ? 327 DA  D C6     1 
ATOM 841  N N6     . DA  B 2 8   ? -6.056  -0.722  41.471 1.00 0.21 ? 327 DA  D N6     1 
ATOM 842  N N1     . DA  B 2 8   ? -4.763  1.129   42.016 1.00 0.20 ? 327 DA  D N1     1 
ATOM 843  C C2     . DA  B 2 8   ? -4.568  2.457   42.020 1.00 0.21 ? 327 DA  D C2     1 
ATOM 844  N N3     . DA  B 2 8   ? -5.387  3.381   41.500 1.00 0.23 ? 327 DA  D N3     1 
ATOM 845  C C4     . DA  B 2 8   ? -6.493  2.819   40.933 1.00 0.23 ? 327 DA  D C4     1 
ATOM 846  H "H5'"  . DA  B 2 8   ? -11.095 5.790   41.627 1.00 0.33 ? 327 DA  D "H5'"  1 
ATOM 847  H "H5''" . DA  B 2 8   ? -11.501 6.899   40.302 1.00 0.36 ? 327 DA  D "H5''" 1 
ATOM 848  H "H4'"  . DA  B 2 8   ? -9.262  7.386   41.011 1.00 0.33 ? 327 DA  D "H4'"  1 
ATOM 849  H "H3'"  . DA  B 2 8   ? -9.743  6.711   38.335 1.00 0.33 ? 327 DA  D "H3'"  1 
ATOM 850  H "H2'"  . DA  B 2 8   ? -8.720  4.610   38.307 1.00 0.29 ? 327 DA  D "H2'"  1 
ATOM 851  H "H2''" . DA  B 2 8   ? -7.251  5.596   38.122 1.00 0.29 ? 327 DA  D "H2''" 1 
ATOM 852  H "H1'"  . DA  B 2 8   ? -6.666  5.408   40.358 1.00 0.27 ? 327 DA  D "H1'"  1 
ATOM 853  H H8     . DA  B 2 8   ? -9.268  2.690   39.327 1.00 0.27 ? 327 DA  D H8     1 
ATOM 854  H H61    . DA  B 2 8   ? -5.363  -1.319  41.899 1.00 0.20 ? 327 DA  D H61    1 
ATOM 855  H H62    . DA  B 2 8   ? -6.890  -1.125  41.066 1.00 0.22 ? 327 DA  D H62    1 
ATOM 856  H H2     . DA  B 2 8   ? -3.652  2.818   42.487 1.00 0.22 ? 327 DA  D H2     1 
ATOM 857  P P      . DT  B 2 9   ? -7.291  8.170   37.631 1.00 0.34 ? 328 DT  D P      1 
ATOM 858  O OP1    . DT  B 2 9   ? -7.152  9.640   37.571 1.00 0.37 ? 328 DT  D OP1    1 
ATOM 859  O OP2    . DT  B 2 9   ? -7.898  7.428   36.503 1.00 0.35 ? 328 DT  D OP2    1 
ATOM 860  O "O5'"  . DT  B 2 9   ? -5.846  7.533   37.931 1.00 0.31 ? 328 DT  D "O5'"  1 
ATOM 861  C "C5'"  . DT  B 2 9   ? -5.153  7.933   39.113 1.00 0.31 ? 328 DT  D "C5'"  1 
ATOM 862  C "C4'"  . DT  B 2 9   ? -3.715  7.439   39.141 1.00 0.29 ? 328 DT  D "C4'"  1 
ATOM 863  O "O4'"  . DT  B 2 9   ? -3.715  6.050   39.508 1.00 0.28 ? 328 DT  D "O4'"  1 
ATOM 864  C "C3'"  . DT  B 2 9   ? -2.983  7.570   37.803 1.00 0.30 ? 328 DT  D "C3'"  1 
ATOM 865  O "O3'"  . DT  B 2 9   ? -1.692  8.132   38.032 1.00 0.33 ? 328 DT  D "O3'"  1 
ATOM 866  C "C2'"  . DT  B 2 9   ? -2.834  6.139   37.295 1.00 0.31 ? 328 DT  D "C2'"  1 
ATOM 867  C "C1'"  . DT  B 2 9   ? -2.957  5.292   38.564 1.00 0.27 ? 328 DT  D "C1'"  1 
ATOM 868  N N1     . DT  B 2 9   ? -3.642  3.973   38.379 1.00 0.25 ? 328 DT  D N1     1 
ATOM 869  C C2     . DT  B 2 9   ? -3.020  2.838   38.899 1.00 0.23 ? 328 DT  D C2     1 
ATOM 870  O O2     . DT  B 2 9   ? -1.940  2.893   39.482 1.00 0.23 ? 328 DT  D O2     1 
ATOM 871  N N3     . DT  B 2 9   ? -3.698  1.639   38.713 1.00 0.22 ? 328 DT  D N3     1 
ATOM 872  C C4     . DT  B 2 9   ? -4.918  1.471   38.062 1.00 0.23 ? 328 DT  D C4     1 
ATOM 873  O O4     . DT  B 2 9   ? -5.425  0.352   37.955 1.00 0.22 ? 328 DT  D O4     1 
ATOM 874  C C5     . DT  B 2 9   ? -5.492  2.700   37.552 1.00 0.25 ? 328 DT  D C5     1 
ATOM 875  C C7     . DT  B 2 9   ? -6.820  2.655   36.795 1.00 0.28 ? 328 DT  D C7     1 
ATOM 876  C C6     . DT  B 2 9   ? -4.854  3.885   37.722 1.00 0.26 ? 328 DT  D C6     1 
ATOM 877  H "H5'"  . DT  B 2 9   ? -5.679  7.529   39.978 1.00 0.31 ? 328 DT  D "H5'"  1 
ATOM 878  H "H5''" . DT  B 2 9   ? -5.156  9.021   39.175 1.00 0.33 ? 328 DT  D "H5''" 1 
ATOM 879  H "H4'"  . DT  B 2 9   ? -3.165  8.002   39.898 1.00 0.30 ? 328 DT  D "H4'"  1 
ATOM 880  H "H3'"  . DT  B 2 9   ? -3.551  8.181   37.095 1.00 0.30 ? 328 DT  D "H3'"  1 
ATOM 881  H "H2'"  . DT  B 2 9   ? -3.617  5.907   36.582 1.00 0.32 ? 328 DT  D "H2'"  1 
ATOM 882  H "H2''" . DT  B 2 9   ? -1.864  6.000   36.840 1.00 0.35 ? 328 DT  D "H2''" 1 
ATOM 883  H "H1'"  . DT  B 2 9   ? -1.954  5.131   38.973 1.00 0.28 ? 328 DT  D "H1'"  1 
ATOM 884  H H3     . DT  B 2 9   ? -3.262  0.806   39.089 1.00 0.20 ? 328 DT  D H3     1 
ATOM 885  H H71    . DT  B 2 9   ? -7.500  1.965   37.294 1.00 1.06 ? 328 DT  D H71    1 
ATOM 886  H H72    . DT  B 2 9   ? -6.642  2.316   35.775 1.00 1.08 ? 328 DT  D H72    1 
ATOM 887  H H73    . DT  B 2 9   ? -7.266  3.649   36.771 1.00 1.04 ? 328 DT  D H73    1 
ATOM 888  H H6     . DT  B 2 9   ? -5.316  4.784   37.338 1.00 0.29 ? 328 DT  D H6     1 
ATOM 889  P P      . DG  B 2 10  ? -0.675  8.370   36.811 1.00 0.34 ? 329 DG  D P      1 
ATOM 890  O OP1    . DG  B 2 10  ? 0.103   9.599   37.072 1.00 0.41 ? 329 DG  D OP1    1 
ATOM 891  O OP2    . DG  B 2 10  ? -1.434  8.224   35.547 1.00 0.38 ? 329 DG  D OP2    1 
ATOM 892  O "O5'"  . DG  B 2 10  ? 0.304   7.109   36.950 1.00 0.31 ? 329 DG  D "O5'"  1 
ATOM 893  C "C5'"  . DG  B 2 10  ? 1.083   6.960   38.138 1.00 0.32 ? 329 DG  D "C5'"  1 
ATOM 894  C "C4'"  . DG  B 2 10  ? 2.098   5.835   38.008 1.00 0.32 ? 329 DG  D "C4'"  1 
ATOM 895  O "O4'"  . DG  B 2 10  ? 1.408   4.577   38.008 1.00 0.30 ? 329 DG  D "O4'"  1 
ATOM 896  C "C3'"  . DG  B 2 10  ? 2.944   5.893   36.735 1.00 0.34 ? 329 DG  D "C3'"  1 
ATOM 897  O "O3'"  . DG  B 2 10  ? 4.296   5.581   37.059 1.00 0.37 ? 329 DG  D "O3'"  1 
ATOM 898  C "C2'"  . DG  B 2 10  ? 2.363   4.819   35.836 1.00 0.32 ? 329 DG  D "C2'"  1 
ATOM 899  C "C1'"  . DG  B 2 10  ? 1.732   3.846   36.821 1.00 0.29 ? 329 DG  D "C1'"  1 
ATOM 900  N N9     . DG  B 2 10  ? 0.494   3.213   36.327 1.00 0.27 ? 329 DG  D N9     1 
ATOM 901  C C8     . DG  B 2 10  ? -0.576  3.777   35.686 1.00 0.27 ? 329 DG  D C8     1 
ATOM 902  N N7     . DG  B 2 10  ? -1.534  2.957   35.376 1.00 0.25 ? 329 DG  D N7     1 
ATOM 903  C C5     . DG  B 2 10  ? -1.065  1.737   35.845 1.00 0.24 ? 329 DG  D C5     1 
ATOM 904  C C6     . DG  B 2 10  ? -1.663  0.439   35.799 1.00 0.23 ? 329 DG  D C6     1 
ATOM 905  O O6     . DG  B 2 10  ? -2.756  0.128   35.329 1.00 0.23 ? 329 DG  D O6     1 
ATOM 906  N N1     . DG  B 2 10  ? -0.845  -0.540  36.385 1.00 0.23 ? 329 DG  D N1     1 
ATOM 907  C C2     . DG  B 2 10  ? 0.401   -0.302  36.951 1.00 0.24 ? 329 DG  D C2     1 
ATOM 908  N N2     . DG  B 2 10  ? 1.040   -1.352  37.456 1.00 0.25 ? 329 DG  D N2     1 
ATOM 909  N N3     . DG  B 2 10  ? 0.961   0.919   36.997 1.00 0.26 ? 329 DG  D N3     1 
ATOM 910  C C4     . DG  B 2 10  ? 0.180   1.884   36.429 1.00 0.25 ? 329 DG  D C4     1 
ATOM 911  H "H5'"  . DG  B 2 10  ? 0.416   6.738   38.971 1.00 0.31 ? 329 DG  D "H5'"  1 
ATOM 912  H "H5''" . DG  B 2 10  ? 1.608   7.893   38.341 1.00 0.34 ? 329 DG  D "H5''" 1 
ATOM 913  H "H4'"  . DG  B 2 10  ? 2.766   5.869   38.870 1.00 0.34 ? 329 DG  D "H4'"  1 
ATOM 914  H "H3'"  . DG  B 2 10  ? 2.879   6.874   36.260 1.00 0.35 ? 329 DG  D "H3'"  1 
ATOM 915  H "H2'"  . DG  B 2 10  ? 1.614   5.240   35.171 1.00 0.32 ? 329 DG  D "H2'"  1 
ATOM 916  H "H2''" . DG  B 2 10  ? 3.147   4.336   35.268 1.00 0.33 ? 329 DG  D "H2''" 1 
ATOM 917  H "H1'"  . DG  B 2 10  ? 2.456   3.067   37.070 1.00 0.30 ? 329 DG  D "H1'"  1 
ATOM 918  H H8     . DG  B 2 10  ? -0.610  4.829   35.424 1.00 0.28 ? 329 DG  D H8     1 
ATOM 919  H H1     . DG  B 2 10  ? -1.206  -1.482  36.383 1.00 0.22 ? 329 DG  D H1     1 
ATOM 920  H H21    . DG  B 2 10  ? 0.616   -2.269  37.418 1.00 0.24 ? 329 DG  D H21    1 
ATOM 921  H H22    . DG  B 2 10  ? 1.950   -1.234  37.876 1.00 0.27 ? 329 DG  D H22    1 
ATOM 922  P P      . DA  B 2 11  ? 5.428   5.534   35.919 1.00 0.41 ? 330 DA  D P      1 
ATOM 923  O OP1    . DA  B 2 11  ? 6.722   5.931   36.515 1.00 0.46 ? 330 DA  D OP1    1 
ATOM 924  O OP2    . DA  B 2 11  ? 4.912   6.239   34.722 1.00 0.41 ? 330 DA  D OP2    1 
ATOM 925  O "O5'"  . DA  B 2 11  ? 5.478   3.962   35.591 1.00 0.40 ? 330 DA  D "O5'"  1 
ATOM 926  C "C5'"  . DA  B 2 11  ? 5.775   3.031   36.636 1.00 0.41 ? 330 DA  D "C5'"  1 
ATOM 927  C "C4'"  . DA  B 2 11  ? 5.989   1.625   36.092 1.00 0.39 ? 330 DA  D "C4'"  1 
ATOM 928  O "O4'"  . DA  B 2 11  ? 4.719   1.021   35.809 1.00 0.35 ? 330 DA  D "O4'"  1 
ATOM 929  C "C3'"  . DA  B 2 11  ? 6.819   1.580   34.809 1.00 0.40 ? 330 DA  D "C3'"  1 
ATOM 930  O "O3'"  . DA  B 2 11  ? 7.761   0.518   34.900 1.00 0.42 ? 330 DA  D "O3'"  1 
ATOM 931  C "C2'"  . DA  B 2 11  ? 5.813   1.278   33.714 1.00 0.35 ? 330 DA  D "C2'"  1 
ATOM 932  C "C1'"  . DA  B 2 11  ? 4.705   0.551   34.460 1.00 0.32 ? 330 DA  D "C1'"  1 
ATOM 933  N N9     . DA  B 2 11  ? 3.357   0.788   33.914 1.00 0.30 ? 330 DA  D N9     1 
ATOM 934  C C8     . DA  B 2 11  ? 2.775   1.963   33.532 1.00 0.30 ? 330 DA  D C8     1 
ATOM 935  N N7     . DA  B 2 11  ? 1.555   1.867   33.106 1.00 0.29 ? 330 DA  D N7     1 
ATOM 936  C C5     . DA  B 2 11  ? 1.298   0.508   33.206 1.00 0.27 ? 330 DA  D C5     1 
ATOM 937  C C6     . DA  B 2 11  ? 0.172   -0.279  32.906 1.00 0.26 ? 330 DA  D C6     1 
ATOM 938  N N6     . DA  B 2 11  ? -0.959  0.239   32.428 1.00 0.25 ? 330 DA  D N6     1 
ATOM 939  N N1     . DA  B 2 11  ? 0.253   -1.617  33.121 1.00 0.25 ? 330 DA  D N1     1 
ATOM 940  C C2     . DA  B 2 11  ? 1.380   -2.161  33.607 1.00 0.26 ? 330 DA  D C2     1 
ATOM 941  N N3     . DA  B 2 11  ? 2.504   -1.503  33.927 1.00 0.28 ? 330 DA  D N3     1 
ATOM 942  C C4     . DA  B 2 11  ? 2.391   -0.162  33.698 1.00 0.28 ? 330 DA  D C4     1 
ATOM 943  H "H5'"  . DA  B 2 11  ? 4.944   3.014   37.341 1.00 0.40 ? 330 DA  D "H5'"  1 
ATOM 944  H "H5''" . DA  B 2 11  ? 6.676   3.354   37.155 1.00 0.44 ? 330 DA  D "H5''" 1 
ATOM 945  H "H4'"  . DA  B 2 11  ? 6.492   1.031   36.851 1.00 0.40 ? 330 DA  D "H4'"  1 
ATOM 946  H "H3'"  . DA  B 2 11  ? 7.322   2.530   34.623 1.00 0.44 ? 330 DA  D "H3'"  1 
ATOM 947  H "H2'"  . DA  B 2 11  ? 5.446   2.198   33.267 1.00 0.38 ? 330 DA  D "H2'"  1 
ATOM 948  H "H2''" . DA  B 2 11  ? 6.252   0.638   32.958 1.00 0.34 ? 330 DA  D "H2''" 1 
ATOM 949  H "H1'"  . DA  B 2 11  ? 4.909   -0.521  34.453 1.00 0.31 ? 330 DA  D "H1'"  1 
ATOM 950  H H8     . DA  B 2 11  ? 3.300   2.909   33.558 1.00 0.32 ? 330 DA  D H8     1 
ATOM 951  H H61    . DA  B 2 11  ? -1.744  -0.362  32.225 1.00 0.25 ? 330 DA  D H61    1 
ATOM 952  H H62    . DA  B 2 11  ? -1.032  1.236   32.271 1.00 0.26 ? 330 DA  D H62    1 
ATOM 953  H H2     . DA  B 2 11  ? 1.383   -3.240  33.752 1.00 0.26 ? 330 DA  D H2     1 
ATOM 954  P P      . DC  B 2 12  ? 8.793   0.248   33.702 1.00 0.44 ? 331 DC  D P      1 
ATOM 955  O OP1    . DC  B 2 12  ? 10.028  -0.338  34.269 1.00 0.50 ? 331 DC  D OP1    1 
ATOM 956  O OP2    . DC  B 2 12  ? 8.866   1.466   32.865 1.00 0.49 ? 331 DC  D OP2    1 
ATOM 957  O "O5'"  . DC  B 2 12  ? 8.031   -0.892  32.864 1.00 0.37 ? 331 DC  D "O5'"  1 
ATOM 958  C "C5'"  . DC  B 2 12  ? 7.697   -2.130  33.493 1.00 0.33 ? 331 DC  D "C5'"  1 
ATOM 959  C "C4'"  . DC  B 2 12  ? 7.239   -3.162  32.470 1.00 0.30 ? 331 DC  D "C4'"  1 
ATOM 960  O "O4'"  . DC  B 2 12  ? 5.854   -2.946  32.169 1.00 0.30 ? 331 DC  D "O4'"  1 
ATOM 961  C "C3'"  . DC  B 2 12  ? 8.033   -3.098  31.158 1.00 0.31 ? 331 DC  D "C3'"  1 
ATOM 962  O "O3'"  . DC  B 2 12  ? 8.484   -4.405  30.782 1.00 0.34 ? 331 DC  D "O3'"  1 
ATOM 963  C "C2'"  . DC  B 2 12  ? 7.027   -2.577  30.131 1.00 0.35 ? 331 DC  D "C2'"  1 
ATOM 964  C "C1'"  . DC  B 2 12  ? 5.670   -2.917  30.756 1.00 0.30 ? 331 DC  D "C1'"  1 
ATOM 965  N N1     . DC  B 2 12  ? 4.560   -1.951  30.472 1.00 0.29 ? 331 DC  D N1     1 
ATOM 966  C C2     . DC  B 2 12  ? 3.322   -2.480  30.095 1.00 0.27 ? 331 DC  D C2     1 
ATOM 967  O O2     . DC  B 2 12  ? 3.178   -3.694  29.992 1.00 0.27 ? 331 DC  D O2     1 
ATOM 968  N N3     . DC  B 2 12  ? 2.291   -1.610  29.863 1.00 0.27 ? 331 DC  D N3     1 
ATOM 969  C C4     . DC  B 2 12  ? 2.453   -0.279  29.992 1.00 0.29 ? 331 DC  D C4     1 
ATOM 970  N N4     . DC  B 2 12  ? 1.420   0.535   29.760 1.00 0.30 ? 331 DC  D N4     1 
ATOM 971  C C5     . DC  B 2 12  ? 3.717   0.275   30.379 1.00 0.32 ? 331 DC  D C5     1 
ATOM 972  C C6     . DC  B 2 12  ? 4.735   -0.589  30.608 1.00 0.31 ? 331 DC  D C6     1 
ATOM 973  H "H5'"  . DC  B 2 12  ? 6.888   -1.955  34.203 1.00 0.33 ? 331 DC  D "H5'"  1 
ATOM 974  H "H5''" . DC  B 2 12  ? 8.567   -2.507  34.027 1.00 0.38 ? 331 DC  D "H5''" 1 
ATOM 975  H "H4'"  . DC  B 2 12  ? 7.353   -4.157  32.900 1.00 0.32 ? 331 DC  D "H4'"  1 
ATOM 976  H "H3'"  . DC  B 2 12  ? 8.882   -2.414  31.242 1.00 0.33 ? 331 DC  D "H3'"  1 
ATOM 977  H "H2'"  . DC  B 2 12  ? 7.144   -1.508  29.991 1.00 0.41 ? 331 DC  D "H2'"  1 
ATOM 978  H "H2''" . DC  B 2 12  ? 7.154   -3.093  29.189 1.00 0.42 ? 331 DC  D "H2''" 1 
ATOM 979  H "H1'"  . DC  B 2 12  ? 5.378   -3.918  30.424 1.00 0.31 ? 331 DC  D "H1'"  1 
ATOM 980  H H41    . DC  B 2 12  ? 0.527   0.152   29.487 1.00 0.29 ? 331 DC  D H41    1 
ATOM 981  H H42    . DC  B 2 12  ? 1.533   1.536   29.856 1.00 0.33 ? 331 DC  D H42    1 
ATOM 982  H H5     . DC  B 2 12  ? 3.850   1.350   30.488 1.00 0.35 ? 331 DC  D H5     1 
ATOM 983  H H6     . DC  B 2 12  ? 5.695   -0.197  30.918 1.00 0.34 ? 331 DC  D H6     1 
ATOM 984  P P      . DA  B 2 13  ? 9.386   -4.578  29.456 1.00 0.34 ? 332 DA  D P      1 
ATOM 985  O OP1    . DA  B 2 13  ? 10.461  -5.552  29.747 1.00 0.44 ? 332 DA  D OP1    1 
ATOM 986  O OP2    . DA  B 2 13  ? 9.733   -3.224  28.969 1.00 0.39 ? 332 DA  D OP2    1 
ATOM 987  O "O5'"  . DA  B 2 13  ? 8.377   -5.243  28.392 1.00 0.28 ? 332 DA  D "O5'"  1 
ATOM 988  C "C5'"  . DA  B 2 13  ? 7.936   -6.598  28.555 1.00 0.28 ? 332 DA  D "C5'"  1 
ATOM 989  C "C4'"  . DA  B 2 13  ? 6.868   -6.950  27.524 1.00 0.25 ? 332 DA  D "C4'"  1 
ATOM 990  O "O4'"  . DA  B 2 13  ? 5.674   -6.240  27.788 1.00 0.24 ? 332 DA  D "O4'"  1 
ATOM 991  C "C3'"  . DA  B 2 13  ? 7.249   -6.660  26.078 1.00 0.23 ? 332 DA  D "C3'"  1 
ATOM 992  O "O3'"  . DA  B 2 13  ? 7.921   -7.787  25.504 1.00 0.29 ? 332 DA  D "O3'"  1 
ATOM 993  C "C2'"  . DA  B 2 13  ? 5.922   -6.392  25.398 1.00 0.23 ? 332 DA  D "C2'"  1 
ATOM 994  C "C1'"  . DA  B 2 13  ? 5.023   -5.946  26.551 1.00 0.24 ? 332 DA  D "C1'"  1 
ATOM 995  N N9     . DA  B 2 13  ? 4.757   -4.507  26.553 1.00 0.24 ? 332 DA  D N9     1 
ATOM 996  C C8     . DA  B 2 13  ? 5.590   -3.475  26.867 1.00 0.25 ? 332 DA  D C8     1 
ATOM 997  N N7     . DA  B 2 13  ? 5.050   -2.292  26.818 1.00 0.26 ? 332 DA  D N7     1 
ATOM 998  C C5     . DA  B 2 13  ? 3.745   -2.573  26.427 1.00 0.25 ? 332 DA  D C5     1 
ATOM 999  C C6     . DA  B 2 13  ? 2.613   -1.773  26.174 1.00 0.25 ? 332 DA  D C6     1 
ATOM 1000 N N6     . DA  B 2 13  ? 2.609   -0.444  26.307 1.00 0.27 ? 332 DA  D N6     1 
ATOM 1001 N N1     . DA  B 2 13  ? 1.472   -2.400  25.794 1.00 0.24 ? 332 DA  D N1     1 
ATOM 1002 C C2     . DA  B 2 13  ? 1.428   -3.731  25.666 1.00 0.23 ? 332 DA  D C2     1 
ATOM 1003 N N3     . DA  B 2 13  ? 2.434   -4.574  25.884 1.00 0.23 ? 332 DA  D N3     1 
ATOM 1004 C C4     . DA  B 2 13  ? 3.566   -3.924  26.262 1.00 0.23 ? 332 DA  D C4     1 
ATOM 1005 H "H5'"  . DA  B 2 13  ? 7.516   -6.714  29.555 1.00 0.29 ? 332 DA  D "H5'"  1 
ATOM 1006 H "H5''" . DA  B 2 13  ? 8.786   -7.269  28.443 1.00 0.34 ? 332 DA  D "H5''" 1 
ATOM 1007 H "H4'"  . DA  B 2 13  ? 6.660   -8.018  27.609 1.00 0.31 ? 332 DA  D "H4'"  1 
ATOM 1008 H "H3'"  . DA  B 2 13  ? 7.891   -5.777  26.031 1.00 0.24 ? 332 DA  D "H3'"  1 
ATOM 1009 H "H2'"  . DA  B 2 13  ? 6.023   -5.590  24.664 1.00 0.24 ? 332 DA  D "H2'"  1 
ATOM 1010 H "H2''" . DA  B 2 13  ? 5.536   -7.292  24.939 1.00 0.26 ? 332 DA  D "H2''" 1 
ATOM 1011 H "H1'"  . DA  B 2 13  ? 4.076   -6.491  26.505 1.00 0.24 ? 332 DA  D "H1'"  1 
ATOM 1012 H H8     . DA  B 2 13  ? 6.641   -3.628  27.092 1.00 0.26 ? 332 DA  D H8     1 
ATOM 1013 H H61    . DA  B 2 13  ? 1.765   0.081   26.111 1.00 0.27 ? 332 DA  D H61    1 
ATOM 1014 H H62    . DA  B 2 13  ? 3.446   0.036   26.607 1.00 0.28 ? 332 DA  D H62    1 
ATOM 1015 H H2     . DA  B 2 13  ? 0.482   -4.165  25.346 1.00 0.23 ? 332 DA  D H2     1 
ATOM 1016 P P      . DA  B 2 14  ? 8.927   -7.609  24.261 1.00 0.32 ? 333 DA  D P      1 
ATOM 1017 O OP1    . DA  B 2 14  ? 9.506   -8.941  23.959 1.00 0.42 ? 333 DA  D OP1    1 
ATOM 1018 O OP2    . DA  B 2 14  ? 9.816   -6.458  24.551 1.00 0.36 ? 333 DA  D OP2    1 
ATOM 1019 O "O5'"  . DA  B 2 14  ? 8.035   -7.222  23.004 1.00 0.27 ? 333 DA  D "O5'"  1 
ATOM 1020 C "C5'"  . DA  B 2 14  ? 7.110   -8.146  22.452 1.00 0.24 ? 333 DA  D "C5'"  1 
ATOM 1021 C "C4'"  . DA  B 2 14  ? 6.673   -7.660  21.089 1.00 0.20 ? 333 DA  D "C4'"  1 
ATOM 1022 O "O4'"  . DA  B 2 14  ? 5.889   -6.481  21.257 1.00 0.21 ? 333 DA  D "O4'"  1 
ATOM 1023 C "C3'"  . DA  B 2 14  ? 7.857   -7.309  20.187 1.00 0.19 ? 333 DA  D "C3'"  1 
ATOM 1024 O "O3'"  . DA  B 2 14  ? 7.621   -7.805  18.875 1.00 0.20 ? 333 DA  D "O3'"  1 
ATOM 1025 C "C2'"  . DA  B 2 14  ? 7.904   -5.787  20.171 1.00 0.20 ? 333 DA  D "C2'"  1 
ATOM 1026 C "C1'"  . DA  B 2 14  ? 6.489   -5.380  20.571 1.00 0.20 ? 333 DA  D "C1'"  1 
ATOM 1027 N N9     . DA  B 2 14  ? 6.416   -4.200  21.469 1.00 0.19 ? 333 DA  D N9     1 
ATOM 1028 C C8     . DA  B 2 14  ? 7.215   -3.845  22.527 1.00 0.19 ? 333 DA  D C8     1 
ATOM 1029 N N7     . DA  B 2 14  ? 6.862   -2.756  23.148 1.00 0.20 ? 333 DA  D N7     1 
ATOM 1030 C C5     . DA  B 2 14  ? 5.732   -2.352  22.448 1.00 0.21 ? 333 DA  D C5     1 
ATOM 1031 C C6     . DA  B 2 14  ? 4.840   -1.264  22.589 1.00 0.22 ? 333 DA  D C6     1 
ATOM 1032 N N6     . DA  B 2 14  ? 4.971   -0.331  23.534 1.00 0.24 ? 333 DA  D N6     1 
ATOM 1033 N N1     . DA  B 2 14  ? 3.805   -1.176  21.719 1.00 0.23 ? 333 DA  D N1     1 
ATOM 1034 C C2     . DA  B 2 14  ? 3.642   -2.095  20.755 1.00 0.23 ? 333 DA  D C2     1 
ATOM 1035 N N3     . DA  B 2 14  ? 4.426   -3.154  20.532 1.00 0.22 ? 333 DA  D N3     1 
ATOM 1036 C C4     . DA  B 2 14  ? 5.457   -3.223  21.422 1.00 0.20 ? 333 DA  D C4     1 
ATOM 1037 H "H5'"  . DA  B 2 14  ? 6.248   -8.235  23.093 1.00 0.26 ? 333 DA  D "H5'"  1 
ATOM 1038 H "H5''" . DA  B 2 14  ? 7.589   -9.119  22.353 1.00 0.29 ? 333 DA  D "H5''" 1 
ATOM 1039 H "H4'"  . DA  B 2 14  ? 6.070   -8.429  20.608 1.00 0.23 ? 333 DA  D "H4'"  1 
ATOM 1040 H "H3'"  . DA  B 2 14  ? 8.792   -7.718  20.582 1.00 0.22 ? 333 DA  D "H3'"  1 
ATOM 1041 H "H2'"  . DA  B 2 14  ? 8.633   -5.418  20.889 1.00 0.23 ? 333 DA  D "H2'"  1 
ATOM 1042 H "H2''" . DA  B 2 14  ? 8.140   -5.427  19.175 1.00 0.22 ? 333 DA  D "H2''" 1 
ATOM 1043 H "H1'"  . DA  B 2 14  ? 5.908   -5.175  19.671 1.00 0.21 ? 333 DA  D "H1'"  1 
ATOM 1044 H H8     . DA  B 2 14  ? 8.070   -4.436  22.844 1.00 0.19 ? 333 DA  D H8     1 
ATOM 1045 H H61    . DA  B 2 14  ? 4.304   0.428   23.591 1.00 0.25 ? 333 DA  D H61    1 
ATOM 1046 H H62    . DA  B 2 14  ? 5.736   -0.381  24.192 1.00 0.24 ? 333 DA  D H62    1 
ATOM 1047 H H2     . DA  B 2 14  ? 2.787   -1.969  20.093 1.00 0.24 ? 333 DA  D H2     1 
ATOM 1048 P P      . DA  B 2 15  ? 8.754   -7.653  17.751 1.00 0.21 ? 334 DA  D P      1 
ATOM 1049 O OP1    . DA  B 2 15  ? 8.622   -8.781  16.802 1.00 0.24 ? 334 DA  D OP1    1 
ATOM 1050 O OP2    . DA  B 2 15  ? 10.047  -7.405  18.427 1.00 0.23 ? 334 DA  D OP2    1 
ATOM 1051 O "O5'"  . DA  B 2 15  ? 8.315   -6.308  16.997 1.00 0.21 ? 334 DA  D "O5'"  1 
ATOM 1052 C "C5'"  . DA  B 2 15  ? 7.066   -6.258  16.317 1.00 0.22 ? 334 DA  D "C5'"  1 
ATOM 1053 C "C4'"  . DA  B 2 15  ? 6.931   -4.982  15.503 1.00 0.22 ? 334 DA  D "C4'"  1 
ATOM 1054 O "O4'"  . DA  B 2 15  ? 6.531   -3.915  16.371 1.00 0.22 ? 334 DA  D "O4'"  1 
ATOM 1055 C "C3'"  . DA  B 2 15  ? 8.222   -4.557  14.796 1.00 0.23 ? 334 DA  D "C3'"  1 
ATOM 1056 O "O3'"  . DA  B 2 15  ? 7.924   -4.203  13.450 1.00 0.25 ? 334 DA  D "O3'"  1 
ATOM 1057 C "C2'"  . DA  B 2 15  ? 8.697   -3.322  15.560 1.00 0.22 ? 334 DA  D "C2'"  1 
ATOM 1058 C "C1'"  . DA  B 2 15  ? 7.422   -2.807  16.226 1.00 0.23 ? 334 DA  D "C1'"  1 
ATOM 1059 N N9     . DA  B 2 15  ? 7.617   -2.208  17.569 1.00 0.22 ? 334 DA  D N9     1 
ATOM 1060 C C8     . DA  B 2 15  ? 8.446   -2.587  18.595 1.00 0.20 ? 334 DA  D C8     1 
ATOM 1061 N N7     . DA  B 2 15  ? 8.391   -1.839  19.661 1.00 0.20 ? 334 DA  D N7     1 
ATOM 1062 C C5     . DA  B 2 15  ? 7.447   -0.879  19.319 1.00 0.22 ? 334 DA  D C5     1 
ATOM 1063 C C6     . DA  B 2 15  ? 6.900   0.236   19.998 1.00 0.23 ? 334 DA  D C6     1 
ATOM 1064 N N6     . DA  B 2 15  ? 7.247   0.595   21.240 1.00 0.23 ? 334 DA  D N6     1 
ATOM 1065 N N1     . DA  B 2 15  ? 5.974   0.974   19.346 1.00 0.25 ? 334 DA  D N1     1 
ATOM 1066 C C2     . DA  B 2 15  ? 5.590   0.658   18.102 1.00 0.26 ? 334 DA  D C2     1 
ATOM 1067 N N3     . DA  B 2 15  ? 6.039   -0.365  17.373 1.00 0.25 ? 334 DA  D N3     1 
ATOM 1068 C C4     . DA  B 2 15  ? 6.971   -1.098  18.045 1.00 0.23 ? 334 DA  D C4     1 
ATOM 1069 H "H5'"  . DA  B 2 15  ? 6.260   -6.295  17.052 1.00 0.22 ? 334 DA  D "H5'"  1 
ATOM 1070 H "H5''" . DA  B 2 15  ? 6.984   -7.119  15.655 1.00 0.23 ? 334 DA  D "H5''" 1 
ATOM 1071 H "H4'"  . DA  B 2 15  ? 6.160   -5.134  14.750 1.00 0.24 ? 334 DA  D "H4'"  1 
ATOM 1072 H "H3'"  . DA  B 2 15  ? 8.975   -5.349  14.830 1.00 0.22 ? 334 DA  D "H3'"  1 
ATOM 1073 H "H2'"  . DA  B 2 15  ? 9.440   -3.597  16.303 1.00 0.21 ? 334 DA  D "H2'"  1 
ATOM 1074 H "H2''" . DA  B 2 15  ? 9.102   -2.576  14.875 1.00 0.23 ? 334 DA  D "H2''" 1 
ATOM 1075 H "H1'"  . DA  B 2 15  ? 6.956   -2.065  15.575 1.00 0.24 ? 334 DA  D "H1'"  1 
ATOM 1076 H H8     . DA  B 2 15  ? 9.105   -3.445  18.530 1.00 0.19 ? 334 DA  D H8     1 
ATOM 1077 H H61    . DA  B 2 15  ? 6.818   1.409   21.671 1.00 0.25 ? 334 DA  D H61    1 
ATOM 1078 H H62    . DA  B 2 15  ? 7.932   0.053   21.751 1.00 0.22 ? 334 DA  D H62    1 
ATOM 1079 H H2     . DA  B 2 15  ? 4.838   1.297   17.641 1.00 0.27 ? 334 DA  D H2     1 
ATOM 1080 P P      . DG  B 2 16  ? 9.094   -3.726  12.463 1.00 0.26 ? 335 DG  D P      1 
ATOM 1081 O OP1    . DG  B 2 16  ? 8.782   -4.195  11.096 1.00 0.27 ? 335 DG  D OP1    1 
ATOM 1082 O OP2    . DG  B 2 16  ? 10.393  -4.064  13.086 1.00 0.24 ? 335 DG  D OP2    1 
ATOM 1083 O "O5'"  . DG  B 2 16  ? 8.923   -2.135  12.498 1.00 0.26 ? 335 DG  D "O5'"  1 
ATOM 1084 C "C5'"  . DG  B 2 16  ? 7.693   -1.568  12.052 1.00 0.28 ? 335 DG  D "C5'"  1 
ATOM 1085 C "C4'"  . DG  B 2 16  ? 7.822   -0.074  11.833 1.00 0.29 ? 335 DG  D "C4'"  1 
ATOM 1086 O "O4'"  . DG  B 2 16  ? 7.745   0.571   13.101 1.00 0.28 ? 335 DG  D "O4'"  1 
ATOM 1087 C "C3'"  . DG  B 2 16  ? 9.138   0.350   11.172 1.00 0.29 ? 335 DG  D "C3'"  1 
ATOM 1088 O "O3'"  . DG  B 2 16  ? 8.854   1.265   10.107 1.00 0.31 ? 335 DG  D "O3'"  1 
ATOM 1089 C "C2'"  . DG  B 2 16  ? 9.914   1.045   12.288 1.00 0.28 ? 335 DG  D "C2'"  1 
ATOM 1090 C "C1'"  . DG  B 2 16  ? 8.820   1.482   13.258 1.00 0.28 ? 335 DG  D "C1'"  1 
ATOM 1091 N N9     . DG  B 2 16  ? 9.197   1.472   14.694 1.00 0.26 ? 335 DG  D N9     1 
ATOM 1092 C C8     . DG  B 2 16  ? 9.964   0.578   15.396 1.00 0.25 ? 335 DG  D C8     1 
ATOM 1093 N N7     . DG  B 2 16  ? 10.104  0.841   16.664 1.00 0.24 ? 335 DG  D N7     1 
ATOM 1094 C C5     . DG  B 2 16  ? 9.369   2.010   16.829 1.00 0.25 ? 335 DG  D C5     1 
ATOM 1095 C C6     . DG  B 2 16  ? 9.129   2.803   18.002 1.00 0.26 ? 335 DG  D C6     1 
ATOM 1096 O O6     . DG  B 2 16  ? 9.553   2.619   19.142 1.00 0.25 ? 335 DG  D O6     1 
ATOM 1097 N N1     . DG  B 2 16  ? 8.312   3.915   17.729 1.00 0.28 ? 335 DG  D N1     1 
ATOM 1098 C C2     . DG  B 2 16  ? 7.790   4.230   16.486 1.00 0.29 ? 335 DG  D C2     1 
ATOM 1099 N N2     . DG  B 2 16  ? 6.988   5.294   16.424 1.00 0.31 ? 335 DG  D N2     1 
ATOM 1100 N N3     . DG  B 2 16  ? 8.024   3.489   15.389 1.00 0.29 ? 335 DG  D N3     1 
ATOM 1101 C C4     . DG  B 2 16  ? 8.810   2.403   15.627 1.00 0.27 ? 335 DG  D C4     1 
ATOM 1102 H "H5'"  . DG  B 2 16  ? 6.927   -1.749  12.809 1.00 0.27 ? 335 DG  D "H5'"  1 
ATOM 1103 H "H5''" . DG  B 2 16  ? 7.394   -2.044  11.121 1.00 0.29 ? 335 DG  D "H5''" 1 
ATOM 1104 H "H4'"  . DG  B 2 16  ? 6.990   0.263   11.211 1.00 0.30 ? 335 DG  D "H4'"  1 
ATOM 1105 H "H3'"  . DG  B 2 16  ? 9.691   -0.514  10.798 1.00 0.29 ? 335 DG  D "H3'"  1 
ATOM 1106 H "H2'"  . DG  B 2 16  ? 10.604  0.354   12.763 1.00 0.27 ? 335 DG  D "H2'"  1 
ATOM 1107 H "H2''" . DG  B 2 16  ? 10.443  1.897   11.899 1.00 0.29 ? 335 DG  D "H2''" 1 
ATOM 1108 H "H1'"  . DG  B 2 16  ? 8.478   2.483   12.989 1.00 0.29 ? 335 DG  D "H1'"  1 
ATOM 1109 H H8     . DG  B 2 16  ? 10.406  -0.302  14.936 1.00 0.24 ? 335 DG  D H8     1 
ATOM 1110 H H1     . DG  B 2 16  ? 8.091   4.512   18.512 1.00 0.29 ? 335 DG  D H1     1 
ATOM 1111 H H21    . DG  B 2 16  ? 6.816   5.848   17.254 1.00 0.32 ? 335 DG  D H21    1 
ATOM 1112 H H22    . DG  B 2 16  ? 6.546   5.540   15.552 1.00 0.32 ? 335 DG  D H22    1 
ATOM 1113 P P      . DA  B 2 17  ? 10.025  1.868   9.174  1.00 0.33 ? 336 DA  D P      1 
ATOM 1114 O OP1    . DA  B 2 17  ? 9.712   1.553   7.763  1.00 0.34 ? 336 DA  D OP1    1 
ATOM 1115 O OP2    . DA  B 2 17  ? 11.331  1.470   9.746  1.00 0.31 ? 336 DA  D OP2    1 
ATOM 1116 O "O5'"  . DA  B 2 17  ? 9.844   3.450   9.388  1.00 0.34 ? 336 DA  D "O5'"  1 
ATOM 1117 C "C5'"  . DA  B 2 17  ? 8.588   4.046   9.053  1.00 0.35 ? 336 DA  D "C5'"  1 
ATOM 1118 C "C4'"  . DA  B 2 17  ? 8.504   5.504   9.482  1.00 0.36 ? 336 DA  D "C4'"  1 
ATOM 1119 O "O4'"  . DA  B 2 17  ? 8.512   5.558   10.914 1.00 0.35 ? 336 DA  D "O4'"  1 
ATOM 1120 C "C3'"  . DA  B 2 17  ? 9.642   6.399   8.993  1.00 0.37 ? 336 DA  D "C3'"  1 
ATOM 1121 O "O3'"  . DA  B 2 17  ? 9.102   7.676   8.640  1.00 0.40 ? 336 DA  D "O3'"  1 
ATOM 1122 C "C2'"  . DA  B 2 17  ? 10.567  6.535   10.180 1.00 0.36 ? 336 DA  D "C2'"  1 
ATOM 1123 C "C1'"  . DA  B 2 17  ? 9.650   6.298   11.369 1.00 0.35 ? 336 DA  D "C1'"  1 
ATOM 1124 N N9     . DA  B 2 17  ? 10.291  5.530   12.448 1.00 0.33 ? 336 DA  D N9     1 
ATOM 1125 C C8     . DA  B 2 17  ? 11.035  4.389   12.373 1.00 0.31 ? 336 DA  D C8     1 
ATOM 1126 N N7     . DA  B 2 17  ? 11.503  3.953   13.506 1.00 0.29 ? 336 DA  D N7     1 
ATOM 1127 C C5     . DA  B 2 17  ? 11.030  4.892   14.413 1.00 0.30 ? 336 DA  D C5     1 
ATOM 1128 C C6     . DA  B 2 17  ? 11.164  5.048   15.807 1.00 0.29 ? 336 DA  D C6     1 
ATOM 1129 N N6     . DA  B 2 17  ? 11.835  4.191   16.583 1.00 0.27 ? 336 DA  D N6     1 
ATOM 1130 N N1     . DA  B 2 17  ? 10.568  6.119   16.378 1.00 0.30 ? 336 DA  D N1     1 
ATOM 1131 C C2     . DA  B 2 17  ? 9.869   6.995   15.642 1.00 0.32 ? 336 DA  D C2     1 
ATOM 1132 N N3     . DA  B 2 17  ? 9.675   6.936   14.327 1.00 0.33 ? 336 DA  D N3     1 
ATOM 1133 C C4     . DA  B 2 17  ? 10.289  5.857   13.772 1.00 0.32 ? 336 DA  D C4     1 
ATOM 1134 H "H5'"  . DA  B 2 17  ? 7.792   3.488   9.545  1.00 0.35 ? 336 DA  D "H5'"  1 
ATOM 1135 H "H5''" . DA  B 2 17  ? 8.447   3.985   7.973  1.00 0.37 ? 336 DA  D "H5''" 1 
ATOM 1136 H "H4'"  . DA  B 2 17  ? 7.562   5.916   9.122  1.00 0.38 ? 336 DA  D "H4'"  1 
ATOM 1137 H "H3'"  . DA  B 2 17  ? 10.159  5.950   8.145  1.00 0.38 ? 336 DA  D "H3'"  1 
ATOM 1138 H "H2'"  . DA  B 2 17  ? 11.355  5.787   10.142 1.00 0.35 ? 336 DA  D "H2'"  1 
ATOM 1139 H "H2''" . DA  B 2 17  ? 10.989  7.525   10.216 1.00 0.37 ? 336 DA  D "H2''" 1 
ATOM 1140 H "H1'"  . DA  B 2 17  ? 9.314   7.259   11.764 1.00 0.36 ? 336 DA  D "H1'"  1 
ATOM 1141 H H8     . DA  B 2 17  ? 11.256  3.900   11.429 1.00 0.31 ? 336 DA  D H8     1 
ATOM 1142 H H61    . DA  B 2 17  ? 11.895  4.354   17.581 1.00 0.27 ? 336 DA  D H61    1 
ATOM 1143 H H62    . DA  B 2 17  ? 12.280  3.380   16.175 1.00 0.26 ? 336 DA  D H62    1 
ATOM 1144 H H2     . DA  B 2 17  ? 9.418   7.833   16.171 1.00 0.33 ? 336 DA  D H2     1 
ATOM 1145 P P      . DC  B 2 18  ? 10.039  8.871   8.103  1.00 0.41 ? 337 DC  D P      1 
ATOM 1146 O OP1    . DC  B 2 18  ? 9.213   9.783   7.282  1.00 0.43 ? 337 DC  D OP1    1 
ATOM 1147 O OP2    . DC  B 2 18  ? 11.272  8.278   7.535  1.00 0.41 ? 337 DC  D OP2    1 
ATOM 1148 O "O5'"  . DC  B 2 18  ? 10.436  9.637   9.462  1.00 0.41 ? 337 DC  D "O5'"  1 
ATOM 1149 C "C5'"  . DC  B 2 18  ? 9.420   10.212  10.289 1.00 0.41 ? 337 DC  D "C5'"  1 
ATOM 1150 C "C4'"  . DC  B 2 18  ? 10.021  11.072  11.393 1.00 0.41 ? 337 DC  D "C4'"  1 
ATOM 1151 O "O4'"  . DC  B 2 18  ? 10.492  10.210  12.438 1.00 0.39 ? 337 DC  D "O4'"  1 
ATOM 1152 C "C3'"  . DC  B 2 18  ? 11.201  11.937  10.935 1.00 0.42 ? 337 DC  D "C3'"  1 
ATOM 1153 O "O3'"  . DC  B 2 18  ? 11.046  13.262  11.438 1.00 0.44 ? 337 DC  D "O3'"  1 
ATOM 1154 C "C2'"  . DC  B 2 18  ? 12.429  11.294  11.571 1.00 0.40 ? 337 DC  D "C2'"  1 
ATOM 1155 C "C1'"  . DC  B 2 18  ? 11.848  10.524  12.756 1.00 0.38 ? 337 DC  D "C1'"  1 
ATOM 1156 N N1     . DC  B 2 18  ? 12.540  9.241   13.097 1.00 0.36 ? 337 DC  D N1     1 
ATOM 1157 C C2     . DC  B 2 18  ? 12.774  8.988   14.446 1.00 0.35 ? 337 DC  D C2     1 
ATOM 1158 O O2     . DC  B 2 18  ? 12.460  9.822   15.292 1.00 0.36 ? 337 DC  D O2     1 
ATOM 1159 N N3     . DC  B 2 18  ? 13.363  7.807   14.784 1.00 0.33 ? 337 DC  D N3     1 
ATOM 1160 C C4     . DC  B 2 18  ? 13.720  6.901   13.863 1.00 0.32 ? 337 DC  D C4     1 
ATOM 1161 N N4     . DC  B 2 18  ? 14.309  5.766   14.258 1.00 0.30 ? 337 DC  D N4     1 
ATOM 1162 C C5     . DC  B 2 18  ? 13.490  7.142   12.468 1.00 0.33 ? 337 DC  D C5     1 
ATOM 1163 C C6     . DC  B 2 18  ? 12.903  8.319   12.130 1.00 0.35 ? 337 DC  D C6     1 
ATOM 1164 H "H5'"  . DC  B 2 18  ? 8.838   9.410   10.746 1.00 0.40 ? 337 DC  D "H5'"  1 
ATOM 1165 H "H5''" . DC  B 2 18  ? 8.763   10.825  9.675  1.00 0.43 ? 337 DC  D "H5''" 1 
ATOM 1166 H "H4'"  . DC  B 2 18  ? 9.244   11.723  11.797 1.00 0.42 ? 337 DC  D "H4'"  1 
ATOM 1167 H "H3'"  . DC  B 2 18  ? 11.288  11.945  9.847  1.00 0.43 ? 337 DC  D "H3'"  1 
ATOM 1168 H "H2'"  . DC  B 2 18  ? 12.920  10.637  10.866 1.00 0.39 ? 337 DC  D "H2'"  1 
ATOM 1169 H "H2''" . DC  B 2 18  ? 13.119  12.055  11.915 1.00 0.41 ? 337 DC  D "H2''" 1 
ATOM 1170 H "H1'"  . DC  B 2 18  ? 11.853  11.185  13.630 1.00 0.39 ? 337 DC  D "H1'"  1 
ATOM 1171 H H41    . DC  B 2 18  ? 14.470  5.596   15.243 1.00 0.29 ? 337 DC  D H41    1 
ATOM 1172 H H42    . DC  B 2 18  ? 14.591  5.077   13.572 1.00 0.29 ? 337 DC  D H42    1 
ATOM 1173 H H5     . DC  B 2 18  ? 13.767  6.409   11.714 1.00 0.33 ? 337 DC  D H5     1 
ATOM 1174 H H6     . DC  B 2 18  ? 12.731  8.536   11.085 1.00 0.36 ? 337 DC  D H6     1 
ATOM 1175 P P      . DA  B 2 19  ? 12.135  14.391  11.085 1.00 0.45 ? 338 DA  D P      1 
ATOM 1176 O OP1    . DA  B 2 19  ? 11.454  15.701  10.992 1.00 0.47 ? 338 DA  D OP1    1 
ATOM 1177 O OP2    . DA  B 2 19  ? 12.953  13.899  9.953  1.00 0.45 ? 338 DA  D OP2    1 
ATOM 1178 O "O5'"  . DA  B 2 19  ? 13.061  14.392  12.399 1.00 0.44 ? 338 DA  D "O5'"  1 
ATOM 1179 C "C5'"  . DA  B 2 19  ? 12.485  14.680  13.675 1.00 0.44 ? 338 DA  D "C5'"  1 
ATOM 1180 C "C4'"  . DA  B 2 19  ? 13.557  15.040  14.698 1.00 0.44 ? 338 DA  D "C4'"  1 
ATOM 1181 O "O4'"  . DA  B 2 19  ? 14.145  13.845  15.212 1.00 0.41 ? 338 DA  D "O4'"  1 
ATOM 1182 C "C3'"  . DA  B 2 19  ? 14.679  15.919  14.137 1.00 0.45 ? 338 DA  D "C3'"  1 
ATOM 1183 O "O3'"  . DA  B 2 19  ? 15.035  16.959  15.051 1.00 0.46 ? 338 DA  D "O3'"  1 
ATOM 1184 C "C2'"  . DA  B 2 19  ? 15.832  14.942  13.913 1.00 0.43 ? 338 DA  D "C2'"  1 
ATOM 1185 C "C1'"  . DA  B 2 19  ? 15.537  13.807  14.897 1.00 0.41 ? 338 DA  D "C1'"  1 
ATOM 1186 N N9     . DA  B 2 19  ? 15.829  12.445  14.395 1.00 0.39 ? 338 DA  D N9     1 
ATOM 1187 C C8     . DA  B 2 19  ? 15.645  11.910  13.146 1.00 0.39 ? 338 DA  D C8     1 
ATOM 1188 N N7     . DA  B 2 19  ? 15.948  10.650  13.032 1.00 0.37 ? 338 DA  D N7     1 
ATOM 1189 C C5     . DA  B 2 19  ? 16.374  10.316  14.311 1.00 0.35 ? 338 DA  D C5     1 
ATOM 1190 C C6     . DA  B 2 19  ? 16.846  9.118   14.889 1.00 0.33 ? 338 DA  D C6     1 
ATOM 1191 N N6     . DA  B 2 19  ? 16.967  7.982   14.200 1.00 0.32 ? 338 DA  D N6     1 
ATOM 1192 N N1     . DA  B 2 19  ? 17.191  9.138   16.203 1.00 0.33 ? 338 DA  D N1     1 
ATOM 1193 C C2     . DA  B 2 19  ? 17.080  10.267  16.918 1.00 0.34 ? 338 DA  D C2     1 
ATOM 1194 N N3     . DA  B 2 19  ? 16.645  11.450  16.469 1.00 0.36 ? 338 DA  D N3     1 
ATOM 1195 C C4     . DA  B 2 19  ? 16.307  11.403  15.148 1.00 0.37 ? 338 DA  D C4     1 
ATOM 1196 H "H5'"  . DA  B 2 19  ? 11.946  13.799  14.025 1.00 0.43 ? 338 DA  D "H5'"  1 
ATOM 1197 H "H5''" . DA  B 2 19  ? 11.786  15.510  13.574 1.00 0.46 ? 338 DA  D "H5''" 1 
ATOM 1198 H "H4'"  . DA  B 2 19  ? 13.081  15.576  15.521 1.00 0.44 ? 338 DA  D "H4'"  1 
ATOM 1199 H "H3'"  . DA  B 2 19  ? 14.376  16.359  13.184 1.00 0.46 ? 338 DA  D "H3'"  1 
ATOM 1200 H "HO3'" . DA  B 2 19  ? 14.464  16.872  15.818 1.00 0.46 ? 338 DA  D "HO3'" 1 
ATOM 1201 H "H2'"  . DA  B 2 19  ? 15.832  14.580  12.889 1.00 0.43 ? 338 DA  D "H2'"  1 
ATOM 1202 H "H2''" . DA  B 2 19  ? 16.785  15.418  14.146 1.00 0.43 ? 338 DA  D "H2''" 1 
ATOM 1203 H "H1'"  . DA  B 2 19  ? 16.109  13.972  15.812 1.00 0.40 ? 338 DA  D "H1'"  1 
ATOM 1204 H H8     . DA  B 2 19  ? 15.289  12.491  12.305 1.00 0.40 ? 338 DA  D H8     1 
ATOM 1205 H H61    . DA  B 2 19  ? 17.310  7.147   14.656 1.00 0.31 ? 338 DA  D H61    1 
ATOM 1206 H H62    . DA  B 2 19  ? 16.716  7.955   13.222 1.00 0.33 ? 338 DA  D H62    1 
ATOM 1207 H H2     . DA  B 2 19  ? 17.375  10.217  17.965 1.00 0.34 ? 338 DA  D H2     1 
ATOM 1208 N N      . GLU C 3 5   ? -3.122  -27.955 64.861 1.00 0.34 ? 5   GLU A N      1 
ATOM 1209 C CA     . GLU C 3 5   ? -3.312  -27.055 63.681 1.00 0.32 ? 5   GLU A CA     1 
ATOM 1210 C C      . GLU C 3 5   ? -4.121  -27.714 62.557 1.00 0.31 ? 5   GLU A C      1 
ATOM 1211 O O      . GLU C 3 5   ? -3.698  -28.721 61.971 1.00 0.31 ? 5   GLU A O      1 
ATOM 1212 C CB     . GLU C 3 5   ? -1.940  -26.656 63.136 1.00 0.32 ? 5   GLU A CB     1 
ATOM 1213 H H      . GLU C 3 5   ? -3.977  -27.934 65.454 1.00 0.34 ? 5   GLU A H      1 
ATOM 1214 H HA     . GLU C 3 5   ? -3.826  -26.163 64.002 1.00 0.32 ? 5   GLU A HA     1 
ATOM 1215 H HB2    . GLU C 3 5   ? -1.330  -27.539 63.016 1.00 0.32 ? 5   GLU A HB2    1 
ATOM 1216 H HB3    . GLU C 3 5   ? -1.461  -25.978 63.826 1.00 0.32 ? 5   GLU A HB3    1 
ATOM 1217 N N      . GLU C 3 6   ? -5.281  -27.126 62.266 1.00 0.30 ? 6   GLU A N      1 
ATOM 1218 C CA     . GLU C 3 6   ? -6.182  -27.610 61.220 1.00 0.29 ? 6   GLU A CA     1 
ATOM 1219 C C      . GLU C 3 6   ? -6.090  -26.736 59.963 1.00 0.28 ? 6   GLU A C      1 
ATOM 1220 O O      . GLU C 3 6   ? -6.026  -27.258 58.845 1.00 0.27 ? 6   GLU A O      1 
ATOM 1221 C CB     . GLU C 3 6   ? -7.618  -27.590 61.744 1.00 0.30 ? 6   GLU A CB     1 
ATOM 1222 C CG     . GLU C 3 6   ? -8.557  -28.158 60.679 1.00 0.29 ? 6   GLU A CG     1 
ATOM 1223 C CD     . GLU C 3 6   ? -9.946  -28.374 61.285 1.00 0.30 ? 6   GLU A CD     1 
ATOM 1224 O OE1    . GLU C 3 6   ? -10.564 -27.393 61.664 1.00 0.29 ? 6   GLU A OE1    1 
ATOM 1225 O OE2    . GLU C 3 6   ? -10.368 -29.516 61.360 1.00 0.31 ? 6   GLU A OE2    1 
ATOM 1226 H H      . GLU C 3 6   ? -5.540  -26.338 62.779 1.00 0.30 ? 6   GLU A H      1 
ATOM 1227 H HA     . GLU C 3 6   ? -5.916  -28.624 60.965 1.00 0.30 ? 6   GLU A HA     1 
ATOM 1228 H HB2    . GLU C 3 6   ? -7.682  -28.192 62.640 1.00 0.31 ? 6   GLU A HB2    1 
ATOM 1229 H HB3    . GLU C 3 6   ? -7.906  -26.574 61.971 1.00 0.29 ? 6   GLU A HB3    1 
ATOM 1230 H HG2    . GLU C 3 6   ? -8.627  -27.465 59.854 1.00 0.28 ? 6   GLU A HG2    1 
ATOM 1231 H HG3    . GLU C 3 6   ? -8.172  -29.102 60.326 1.00 0.29 ? 6   GLU A HG3    1 
ATOM 1232 N N      . PRO C 3 7   ? -6.085  -25.396 60.126 1.00 0.27 ? 7   PRO A N      1 
ATOM 1233 C CA     . PRO C 3 7   ? -5.995  -24.533 58.944 1.00 0.26 ? 7   PRO A CA     1 
ATOM 1234 C C      . PRO C 3 7   ? -4.677  -24.697 58.195 1.00 0.26 ? 7   PRO A C      1 
ATOM 1235 O O      . PRO C 3 7   ? -3.672  -25.149 58.749 1.00 0.27 ? 7   PRO A O      1 
ATOM 1236 C CB     . PRO C 3 7   ? -6.117  -23.112 59.509 1.00 0.26 ? 7   PRO A CB     1 
ATOM 1237 C CG     . PRO C 3 7   ? -5.824  -23.220 60.972 1.00 0.27 ? 7   PRO A CG     1 
ATOM 1238 C CD     . PRO C 3 7   ? -6.159  -24.652 61.387 1.00 0.28 ? 7   PRO A CD     1 
ATOM 1239 H HA     . PRO C 3 7   ? -6.824  -24.723 58.284 1.00 0.25 ? 7   PRO A HA     1 
ATOM 1240 H HB2    . PRO C 3 7   ? -5.400  -22.461 59.030 1.00 0.25 ? 7   PRO A HB2    1 
ATOM 1241 H HB3    . PRO C 3 7   ? -7.119  -22.738 59.362 1.00 0.25 ? 7   PRO A HB3    1 
ATOM 1242 H HG2    . PRO C 3 7   ? -4.779  -23.014 61.154 1.00 0.27 ? 7   PRO A HG2    1 
ATOM 1243 H HG3    . PRO C 3 7   ? -6.442  -22.530 61.526 1.00 0.27 ? 7   PRO A HG3    1 
ATOM 1244 H HD2    . PRO C 3 7   ? -5.431  -25.022 62.096 1.00 0.29 ? 7   PRO A HD2    1 
ATOM 1245 H HD3    . PRO C 3 7   ? -7.157  -24.708 61.795 1.00 0.28 ? 7   PRO A HD3    1 
ATOM 1246 N N      . SER C 3 8   ? -4.698  -24.330 56.922 1.00 0.25 ? 8   SER A N      1 
ATOM 1247 C CA     . SER C 3 8   ? -3.523  -24.421 56.064 1.00 0.24 ? 8   SER A CA     1 
ATOM 1248 C C      . SER C 3 8   ? -2.342  -23.628 56.647 1.00 0.25 ? 8   SER A C      1 
ATOM 1249 O O      . SER C 3 8   ? -2.526  -22.498 57.103 1.00 0.25 ? 8   SER A O      1 
ATOM 1250 C CB     . SER C 3 8   ? -3.864  -23.869 54.680 1.00 0.23 ? 8   SER A CB     1 
ATOM 1251 O OG     . SER C 3 8   ? -2.752  -24.054 53.814 1.00 0.23 ? 8   SER A OG     1 
ATOM 1252 H H      . SER C 3 8   ? -5.533  -23.982 56.544 1.00 0.24 ? 8   SER A H      1 
ATOM 1253 H HA     . SER C 3 8   ? -3.238  -25.456 55.966 1.00 0.25 ? 8   SER A HA     1 
ATOM 1254 H HB2    . SER C 3 8   ? -4.716  -24.396 54.280 1.00 0.23 ? 8   SER A HB2    1 
ATOM 1255 H HB3    . SER C 3 8   ? -4.101  -22.818 54.760 1.00 0.23 ? 8   SER A HB3    1 
ATOM 1256 H HG     . SER C 3 8   ? -2.181  -23.289 53.898 1.00 0.24 ? 8   SER A HG     1 
ATOM 1257 N N      . ASP C 3 9   ? -1.147  -24.227 56.653 1.00 0.26 ? 9   ASP A N      1 
ATOM 1258 C CA     . ASP C 3 9   ? 0.030   -23.525 57.146 1.00 0.27 ? 9   ASP A CA     1 
ATOM 1259 C C      . ASP C 3 9   ? 0.579   -22.768 55.943 1.00 0.26 ? 9   ASP A C      1 
ATOM 1260 O O      . ASP C 3 9   ? 0.021   -22.856 54.833 1.00 0.25 ? 9   ASP A O      1 
ATOM 1261 C CB     . ASP C 3 9   ? 1.067   -24.526 57.665 1.00 0.28 ? 9   ASP A CB     1 
ATOM 1262 C CG     . ASP C 3 9   ? 1.668   -25.297 56.489 1.00 0.28 ? 9   ASP A CG     1 
ATOM 1263 O OD1    . ASP C 3 9   ? 1.366   -24.950 55.359 1.00 0.27 ? 9   ASP A OD1    1 
ATOM 1264 O OD2    . ASP C 3 9   ? 2.422   -26.224 56.740 1.00 0.29 ? 9   ASP A OD2    1 
ATOM 1265 H H      . ASP C 3 9   ? -1.057  -25.133 56.293 1.00 0.26 ? 9   ASP A H      1 
ATOM 1266 H HA     . ASP C 3 9   ? -0.250  -22.833 57.926 1.00 0.27 ? 9   ASP A HA     1 
ATOM 1267 H HB2    . ASP C 3 9   ? 1.851   -23.994 58.186 1.00 0.29 ? 9   ASP A HB2    1 
ATOM 1268 H HB3    . ASP C 3 9   ? 0.591   -25.218 58.342 1.00 0.28 ? 9   ASP A HB3    1 
ATOM 1269 N N      . LEU C 3 10  ? 1.660   -22.019 56.155 1.00 0.27 ? 10  LEU A N      1 
ATOM 1270 C CA     . LEU C 3 10  ? 2.224   -21.187 55.105 1.00 0.27 ? 10  LEU A CA     1 
ATOM 1271 C C      . LEU C 3 10  ? 2.601   -21.940 53.838 1.00 0.27 ? 10  LEU A C      1 
ATOM 1272 O O      . LEU C 3 10  ? 2.310   -21.499 52.719 1.00 0.26 ? 10  LEU A O      1 
ATOM 1273 C CB     . LEU C 3 10  ? 3.472   -20.491 55.653 1.00 0.28 ? 10  LEU A CB     1 
ATOM 1274 C CG     . LEU C 3 10  ? 3.785   -19.257 54.806 1.00 0.28 ? 10  LEU A CG     1 
ATOM 1275 C CD1    . LEU C 3 10  ? 4.678   -18.304 55.603 1.00 0.29 ? 10  LEU A CD1    1 
ATOM 1276 C CD2    . LEU C 3 10  ? 4.514   -19.689 53.532 1.00 0.28 ? 10  LEU A CD2    1 
ATOM 1277 H H      . LEU C 3 10  ? 2.049   -21.986 57.054 1.00 0.28 ? 10  LEU A H      1 
ATOM 1278 H HA     . LEU C 3 10  ? 1.507   -20.425 54.849 1.00 0.26 ? 10  LEU A HA     1 
ATOM 1279 H HB2    . LEU C 3 10  ? 3.294   -20.190 56.677 1.00 0.28 ? 10  LEU A HB2    1 
ATOM 1280 H HB3    . LEU C 3 10  ? 4.309   -21.172 55.618 1.00 0.29 ? 10  LEU A HB3    1 
ATOM 1281 H HG     . LEU C 3 10  ? 2.865   -18.754 54.546 1.00 0.27 ? 10  LEU A HG     1 
ATOM 1282 H HD11   . LEU C 3 10  ? 4.134   -17.930 56.457 1.00 0.29 ? 10  LEU A HD11   1 
ATOM 1283 H HD12   . LEU C 3 10  ? 4.972   -17.477 54.975 1.00 0.29 ? 10  LEU A HD12   1 
ATOM 1284 H HD13   . LEU C 3 10  ? 5.558   -18.831 55.940 1.00 0.30 ? 10  LEU A HD13   1 
ATOM 1285 H HD21   . LEU C 3 10  ? 4.929   -20.676 53.672 1.00 0.28 ? 10  LEU A HD21   1 
ATOM 1286 H HD22   . LEU C 3 10  ? 5.309   -18.990 53.319 1.00 0.29 ? 10  LEU A HD22   1 
ATOM 1287 H HD23   . LEU C 3 10  ? 3.817   -19.703 52.708 1.00 0.27 ? 10  LEU A HD23   1 
ATOM 1288 N N      . GLU C 3 11  ? 3.254   -23.086 53.986 1.00 0.27 ? 11  GLU A N      1 
ATOM 1289 C CA     . GLU C 3 11  ? 3.636   -23.854 52.804 1.00 0.27 ? 11  GLU A CA     1 
ATOM 1290 C C      . GLU C 3 11  ? 2.430   -24.355 52.038 1.00 0.26 ? 11  GLU A C      1 
ATOM 1291 O O      . GLU C 3 11  ? 2.445   -24.388 50.812 1.00 0.26 ? 11  GLU A O      1 
ATOM 1292 C CB     . GLU C 3 11  ? 4.490   -25.048 53.234 1.00 0.29 ? 11  GLU A CB     1 
ATOM 1293 C CG     . GLU C 3 11  ? 5.471   -24.609 54.322 1.00 0.30 ? 11  GLU A CG     1 
ATOM 1294 C CD     . GLU C 3 11  ? 6.112   -25.844 54.959 1.00 0.31 ? 11  GLU A CD     1 
ATOM 1295 O OE1    . GLU C 3 11  ? 6.608   -26.678 54.220 1.00 0.31 ? 11  GLU A OE1    1 
ATOM 1296 O OE2    . GLU C 3 11  ? 6.096   -25.933 56.176 1.00 0.31 ? 11  GLU A OE2    1 
ATOM 1297 H H      . GLU C 3 11  ? 3.471   -23.417 54.883 1.00 0.28 ? 11  GLU A H      1 
ATOM 1298 H HA     . GLU C 3 11  ? 4.227   -23.226 52.157 1.00 0.28 ? 11  GLU A HA     1 
ATOM 1299 H HB2    . GLU C 3 11  ? 3.850   -25.828 53.619 1.00 0.28 ? 11  GLU A HB2    1 
ATOM 1300 H HB3    . GLU C 3 11  ? 5.040   -25.421 52.385 1.00 0.29 ? 11  GLU A HB3    1 
ATOM 1301 H HG2    . GLU C 3 11  ? 6.240   -23.988 53.884 1.00 0.30 ? 11  GLU A HG2    1 
ATOM 1302 H HG3    . GLU C 3 11  ? 4.943   -24.049 55.079 1.00 0.29 ? 11  GLU A HG3    1 
ATOM 1303 N N      . GLU C 3 12  ? 1.389   -24.758 52.758 1.00 0.26 ? 12  GLU A N      1 
ATOM 1304 C CA     . GLU C 3 12  ? 0.197   -25.256 52.095 1.00 0.25 ? 12  GLU A CA     1 
ATOM 1305 C C      . GLU C 3 12  ? -0.538  -24.122 51.360 1.00 0.24 ? 12  GLU A C      1 
ATOM 1306 O O      . GLU C 3 12  ? -1.078  -24.323 50.263 1.00 0.23 ? 12  GLU A O      1 
ATOM 1307 C CB     . GLU C 3 12  ? -0.739  -25.875 53.134 1.00 0.25 ? 12  GLU A CB     1 
ATOM 1308 C CG     . GLU C 3 12  ? 0.001   -26.968 53.906 1.00 0.26 ? 12  GLU A CG     1 
ATOM 1309 C CD     . GLU C 3 12  ? -0.947  -27.610 54.920 1.00 0.27 ? 12  GLU A CD     1 
ATOM 1310 O OE1    . GLU C 3 12  ? -1.451  -26.891 55.767 1.00 0.26 ? 12  GLU A OE1    1 
ATOM 1311 O OE2    . GLU C 3 12  ? -1.153  -28.810 54.833 1.00 0.27 ? 12  GLU A OE2    1 
ATOM 1312 H H      . GLU C 3 12  ? 1.427   -24.721 53.737 1.00 0.26 ? 12  GLU A H      1 
ATOM 1313 H HA     . GLU C 3 12  ? 0.480   -26.016 51.382 1.00 0.25 ? 12  GLU A HA     1 
ATOM 1314 H HB2    . GLU C 3 12  ? -1.071  -25.110 53.820 1.00 0.25 ? 12  GLU A HB2    1 
ATOM 1315 H HB3    . GLU C 3 12  ? -1.595  -26.306 52.635 1.00 0.25 ? 12  GLU A HB3    1 
ATOM 1316 H HG2    . GLU C 3 12  ? 0.354   -27.720 53.214 1.00 0.27 ? 12  GLU A HG2    1 
ATOM 1317 H HG3    . GLU C 3 12  ? 0.842   -26.535 54.425 1.00 0.27 ? 12  GLU A HG3    1 
ATOM 1318 N N      . LEU C 3 13  ? -0.555  -22.937 51.962 1.00 0.24 ? 13  LEU A N      1 
ATOM 1319 C CA     . LEU C 3 13  ? -1.227  -21.770 51.344 1.00 0.23 ? 13  LEU A CA     1 
ATOM 1320 C C      . LEU C 3 13  ? -0.466  -21.396 50.062 1.00 0.23 ? 13  LEU A C      1 
ATOM 1321 O O      . LEU C 3 13  ? -1.057  -21.036 49.030 1.00 0.22 ? 13  LEU A O      1 
ATOM 1322 C CB     . LEU C 3 13  ? -1.197  -20.588 52.318 1.00 0.23 ? 13  LEU A CB     1 
ATOM 1323 C CG     . LEU C 3 13  ? -2.582  -19.949 52.403 1.00 0.22 ? 13  LEU A CG     1 
ATOM 1324 C CD1    . LEU C 3 13  ? -3.640  -21.038 52.581 1.00 0.21 ? 13  LEU A CD1    1 
ATOM 1325 C CD2    . LEU C 3 13  ? -2.629  -18.995 53.600 1.00 0.22 ? 13  LEU A CD2    1 
ATOM 1326 H H      . LEU C 3 13  ? -0.113  -22.832 52.831 1.00 0.24 ? 13  LEU A H      1 
ATOM 1327 H HA     . LEU C 3 13  ? -2.250  -22.020 51.103 1.00 0.22 ? 13  LEU A HA     1 
ATOM 1328 H HB2    . LEU C 3 13  ? -0.902  -20.938 53.297 1.00 0.23 ? 13  LEU A HB2    1 
ATOM 1329 H HB3    . LEU C 3 13  ? -0.485  -19.854 51.969 1.00 0.23 ? 13  LEU A HB3    1 
ATOM 1330 H HG     . LEU C 3 13  ? -2.782  -19.399 51.494 1.00 0.21 ? 13  LEU A HG     1 
ATOM 1331 H HD11   . LEU C 3 13  ? -3.160  -22.005 52.608 1.00 0.22 ? 13  LEU A HD11   1 
ATOM 1332 H HD12   . LEU C 3 13  ? -4.335  -21.005 51.755 1.00 0.21 ? 13  LEU A HD12   1 
ATOM 1333 H HD13   . LEU C 3 13  ? -4.173  -20.875 53.507 1.00 0.21 ? 13  LEU A HD13   1 
ATOM 1334 H HD21   . LEU C 3 13  ? -2.528  -19.563 54.514 1.00 0.23 ? 13  LEU A HD21   1 
ATOM 1335 H HD22   . LEU C 3 13  ? -3.570  -18.468 53.605 1.00 0.21 ? 13  LEU A HD22   1 
ATOM 1336 H HD23   . LEU C 3 13  ? -1.818  -18.285 53.526 1.00 0.22 ? 13  LEU A HD23   1 
ATOM 1337 N N      . GLU C 3 14  ? 0.861   -21.490 50.094 1.00 0.24 ? 14  GLU A N      1 
ATOM 1338 C CA     . GLU C 3 14  ? 1.656   -21.179 48.919 1.00 0.25 ? 14  GLU A CA     1 
ATOM 1339 C C      . GLU C 3 14  ? 1.320   -22.154 47.791 1.00 0.24 ? 14  GLU A C      1 
ATOM 1340 O O      . GLU C 3 14  ? 1.318   -21.780 46.608 1.00 0.25 ? 14  GLU A O      1 
ATOM 1341 C CB     . GLU C 3 14  ? 3.143   -21.288 49.261 1.00 0.26 ? 14  GLU A CB     1 
ATOM 1342 C CG     . GLU C 3 14  ? 3.554   -20.100 50.132 1.00 0.26 ? 14  GLU A CG     1 
ATOM 1343 C CD     . GLU C 3 14  ? 4.995   -20.292 50.611 1.00 0.28 ? 14  GLU A CD     1 
ATOM 1344 O OE1    . GLU C 3 14  ? 5.310   -21.385 51.051 1.00 0.28 ? 14  GLU A OE1    1 
ATOM 1345 O OE2    . GLU C 3 14  ? 5.757   -19.343 50.531 1.00 0.29 ? 14  GLU A OE2    1 
ATOM 1346 H H      . GLU C 3 14  ? 1.304   -21.789 50.915 1.00 0.25 ? 14  GLU A H      1 
ATOM 1347 H HA     . GLU C 3 14  ? 1.439   -20.171 48.597 1.00 0.24 ? 14  GLU A HA     1 
ATOM 1348 H HB2    . GLU C 3 14  ? 3.321   -22.208 49.798 1.00 0.26 ? 14  GLU A HB2    1 
ATOM 1349 H HB3    . GLU C 3 14  ? 3.723   -21.283 48.351 1.00 0.26 ? 14  GLU A HB3    1 
ATOM 1350 H HG2    . GLU C 3 14  ? 3.484   -19.188 49.555 1.00 0.26 ? 14  GLU A HG2    1 
ATOM 1351 H HG3    . GLU C 3 14  ? 2.899   -20.035 50.988 1.00 0.26 ? 14  GLU A HG3    1 
ATOM 1352 N N      . GLN C 3 15  ? 1.062   -23.412 48.157 1.00 0.24 ? 15  GLN A N      1 
ATOM 1353 C CA     . GLN C 3 15  ? 0.726   -24.430 47.157 1.00 0.24 ? 15  GLN A CA     1 
ATOM 1354 C C      . GLN C 3 15  ? -0.688  -24.188 46.593 1.00 0.23 ? 15  GLN A C      1 
ATOM 1355 O O      . GLN C 3 15  ? -0.909  -24.325 45.390 1.00 0.24 ? 15  GLN A O      1 
ATOM 1356 C CB     . GLN C 3 15  ? 0.792   -25.814 47.803 1.00 0.25 ? 15  GLN A CB     1 
ATOM 1357 C CG     . GLN C 3 15  ? 0.409   -26.882 46.776 1.00 0.25 ? 15  GLN A CG     1 
ATOM 1358 C CD     . GLN C 3 15  ? 1.309   -26.761 45.544 1.00 0.26 ? 15  GLN A CD     1 
ATOM 1359 O OE1    . GLN C 3 15  ? 2.518   -26.804 45.654 1.00 0.27 ? 15  GLN A OE1    1 
ATOM 1360 N NE2    . GLN C 3 15  ? 0.766   -26.615 44.367 1.00 0.26 ? 15  GLN A NE2    1 
ATOM 1361 H H      . GLN C 3 15  ? 1.095   -23.658 49.105 1.00 0.25 ? 15  GLN A H      1 
ATOM 1362 H HA     . GLN C 3 15  ? 1.443   -24.383 46.350 1.00 0.25 ? 15  GLN A HA     1 
ATOM 1363 H HB2    . GLN C 3 15  ? 1.796   -25.998 48.158 1.00 0.26 ? 15  GLN A HB2    1 
ATOM 1364 H HB3    . GLN C 3 15  ? 0.104   -25.855 48.634 1.00 0.24 ? 15  GLN A HB3    1 
ATOM 1365 H HG2    . GLN C 3 15  ? 0.531   -27.862 47.214 1.00 0.26 ? 15  GLN A HG2    1 
ATOM 1366 H HG3    . GLN C 3 15  ? -0.620  -26.744 46.482 1.00 0.24 ? 15  GLN A HG3    1 
ATOM 1367 H HE21   . GLN C 3 15  ? -0.210  -26.582 44.277 1.00 0.25 ? 15  GLN A HE21   1 
ATOM 1368 H HE22   . GLN C 3 15  ? 1.333   -26.542 43.571 1.00 0.26 ? 15  GLN A HE22   1 
ATOM 1369 N N      . PHE C 3 16  ? -1.630  -23.870 47.472 1.00 0.23 ? 16  PHE A N      1 
ATOM 1370 C CA     . PHE C 3 16  ? -2.990  -23.586 47.053 1.00 0.22 ? 16  PHE A CA     1 
ATOM 1371 C C      . PHE C 3 16  ? -2.961  -22.393 46.081 1.00 0.22 ? 16  PHE A C      1 
ATOM 1372 O O      . PHE C 3 16  ? -3.621  -22.417 45.045 1.00 0.21 ? 16  PHE A O      1 
ATOM 1373 C CB     . PHE C 3 16  ? -3.841  -23.238 48.276 1.00 0.21 ? 16  PHE A CB     1 
ATOM 1374 C CG     . PHE C 3 16  ? -5.242  -22.888 47.834 1.00 0.20 ? 16  PHE A CG     1 
ATOM 1375 C CD1    . PHE C 3 16  ? -6.186  -23.901 47.632 1.00 0.20 ? 16  PHE A CD1    1 
ATOM 1376 C CD2    . PHE C 3 16  ? -5.596  -21.549 47.628 1.00 0.20 ? 16  PHE A CD2    1 
ATOM 1377 C CE1    . PHE C 3 16  ? -7.484  -23.577 47.223 1.00 0.20 ? 16  PHE A CE1    1 
ATOM 1378 C CE2    . PHE C 3 16  ? -6.895  -21.225 47.220 1.00 0.19 ? 16  PHE A CE2    1 
ATOM 1379 C CZ     . PHE C 3 16  ? -7.839  -22.239 47.018 1.00 0.19 ? 16  PHE A CZ     1 
ATOM 1380 H H      . PHE C 3 16  ? -1.397  -23.802 48.420 1.00 0.23 ? 16  PHE A H      1 
ATOM 1381 H HA     . PHE C 3 16  ? -3.406  -24.452 46.556 1.00 0.22 ? 16  PHE A HA     1 
ATOM 1382 H HB2    . PHE C 3 16  ? -3.877  -24.086 48.944 1.00 0.21 ? 16  PHE A HB2    1 
ATOM 1383 H HB3    . PHE C 3 16  ? -3.406  -22.393 48.790 1.00 0.21 ? 16  PHE A HB3    1 
ATOM 1384 H HD1    . PHE C 3 16  ? -5.911  -24.934 47.791 1.00 0.21 ? 16  PHE A HD1    1 
ATOM 1385 H HD2    . PHE C 3 16  ? -4.868  -20.768 47.784 1.00 0.20 ? 16  PHE A HD2    1 
ATOM 1386 H HE1    . PHE C 3 16  ? -8.213  -24.359 47.067 1.00 0.20 ? 16  PHE A HE1    1 
ATOM 1387 H HE2    . PHE C 3 16  ? -7.169  -20.192 47.060 1.00 0.19 ? 16  PHE A HE2    1 
ATOM 1388 H HZ     . PHE C 3 16  ? -8.841  -21.988 46.702 1.00 0.19 ? 16  PHE A HZ     1 
ATOM 1389 N N      . ALA C 3 17  ? -2.165  -21.366 46.410 1.00 0.22 ? 17  ALA A N      1 
ATOM 1390 C CA     . ALA C 3 17  ? -2.070  -20.162 45.564 1.00 0.22 ? 17  ALA A CA     1 
ATOM 1391 C C      . ALA C 3 17  ? -1.564  -20.524 44.194 1.00 0.23 ? 17  ALA A C      1 
ATOM 1392 O O      . ALA C 3 17  ? -2.011  -19.999 43.170 1.00 0.23 ? 17  ALA A O      1 
ATOM 1393 C CB     . ALA C 3 17  ? -1.113  -19.158 46.210 1.00 0.22 ? 17  ALA A CB     1 
ATOM 1394 H H      . ALA C 3 17  ? -1.639  -21.411 47.237 1.00 0.22 ? 17  ALA A H      1 
ATOM 1395 H HA     . ALA C 3 17  ? -3.047  -19.711 45.475 1.00 0.21 ? 17  ALA A HA     1 
ATOM 1396 H HB1    . ALA C 3 17  ? -1.478  -18.895 47.192 1.00 0.22 ? 17  ALA A HB1    1 
ATOM 1397 H HB2    . ALA C 3 17  ? -1.054  -18.271 45.597 1.00 0.23 ? 17  ALA A HB2    1 
ATOM 1398 H HB3    . ALA C 3 17  ? -0.133  -19.602 46.299 1.00 0.23 ? 17  ALA A HB3    1 
ATOM 1399 N N      . LYS C 3 18  ? -0.573  -21.407 44.185 1.00 0.24 ? 18  LYS A N      1 
ATOM 1400 C CA     . LYS C 3 18  ? 0.029   -21.890 42.959 1.00 0.24 ? 18  LYS A CA     1 
ATOM 1401 C C      . LYS C 3 18  ? -1.058  -22.580 42.128 1.00 0.24 ? 18  LYS A C      1 
ATOM 1402 O O      . LYS C 3 18  ? -1.269  -22.279 40.942 1.00 0.25 ? 18  LYS A O      1 
ATOM 1403 C CB     . LYS C 3 18  ? 1.157   -22.880 43.276 1.00 0.26 ? 18  LYS A CB     1 
ATOM 1404 C CG     A LYS C 3 18  ? 2.363   -22.114 43.841 0.50 1.10 ? 18  LYS A CG     1 
ATOM 1405 C CG     B LYS C 3 18  ? 1.814   -23.385 41.981 0.50 1.10 ? 18  LYS A CG     1 
ATOM 1406 C CD     A LYS C 3 18  ? 3.134   -21.402 42.723 0.50 1.04 ? 18  LYS A CD     1 
ATOM 1407 C CD     B LYS C 3 18  ? 2.597   -22.252 41.310 0.50 1.04 ? 18  LYS A CD     1 
ATOM 1408 C CE     A LYS C 3 18  ? 4.312   -20.650 43.334 0.50 1.91 ? 18  LYS A CE     1 
ATOM 1409 C CE     B LYS C 3 18  ? 3.551   -22.833 40.269 0.50 1.91 ? 18  LYS A CE     1 
ATOM 1410 N NZ     A LYS C 3 18  ? 5.031   -19.924 42.256 0.50 2.17 ? 18  LYS A NZ     1 
ATOM 1411 N NZ     B LYS C 3 18  ? 4.331   -21.724 39.657 0.50 2.17 ? 18  LYS A NZ     1 
ATOM 1412 H H      . LYS C 3 18  ? -0.243  -21.753 45.040 1.00 0.24 ? 18  LYS A H      1 
ATOM 1413 H HA     . LYS C 3 18  ? 0.440   -21.060 42.403 1.00 0.25 ? 18  LYS A HA     1 
ATOM 1414 H HB2    A LYS C 3 18  ? 0.813   -23.600 44.001 0.50 0.82 ? 18  LYS A HB2    1 
ATOM 1415 H HB2    B LYS C 3 18  ? 1.900   -22.392 43.889 0.50 0.82 ? 18  LYS A HB2    1 
ATOM 1416 H HB3    A LYS C 3 18  ? 1.451   -23.392 42.372 0.50 0.86 ? 18  LYS A HB3    1 
ATOM 1417 H HB3    B LYS C 3 18  ? 0.748   -23.721 43.816 0.50 0.86 ? 18  LYS A HB3    1 
ATOM 1418 H HG2    A LYS C 3 18  ? 2.020   -21.378 44.543 0.50 1.78 ? 18  LYS A HG2    1 
ATOM 1419 H HG2    B LYS C 3 18  ? 2.490   -24.193 42.220 0.50 1.78 ? 18  LYS A HG2    1 
ATOM 1420 H HG3    A LYS C 3 18  ? 3.023   -22.807 44.339 0.50 1.80 ? 18  LYS A HG3    1 
ATOM 1421 H HG3    B LYS C 3 18  ? 1.058   -23.747 41.302 0.50 1.80 ? 18  LYS A HG3    1 
ATOM 1422 H HD2    A LYS C 3 18  ? 3.495   -22.127 42.011 0.50 1.31 ? 18  LYS A HD2    1 
ATOM 1423 H HD2    B LYS C 3 18  ? 1.913   -21.578 40.819 0.50 1.31 ? 18  LYS A HD2    1 
ATOM 1424 H HD3    A LYS C 3 18  ? 2.500   -20.694 42.221 0.50 1.11 ? 18  LYS A HD3    1 
ATOM 1425 H HD3    B LYS C 3 18  ? 3.164   -21.715 42.054 0.50 1.11 ? 18  LYS A HD3    1 
ATOM 1426 H HE2    A LYS C 3 18  ? 3.948   -19.943 44.067 0.50 2.48 ? 18  LYS A HE2    1 
ATOM 1427 H HE2    B LYS C 3 18  ? 4.224   -23.532 40.744 0.50 2.48 ? 18  LYS A HE2    1 
ATOM 1428 H HE3    A LYS C 3 18  ? 4.980   -21.351 43.809 0.50 2.37 ? 18  LYS A HE3    1 
ATOM 1429 H HE3    B LYS C 3 18  ? 2.984   -23.342 39.503 0.50 2.37 ? 18  LYS A HE3    1 
ATOM 1430 H HZ1    A LYS C 3 18  ? 5.117   -20.541 41.425 0.50 2.44 ? 18  LYS A HZ1    1 
ATOM 1431 H HZ1    B LYS C 3 18  ? 3.702   -20.915 39.483 0.50 2.44 ? 18  LYS A HZ1    1 
ATOM 1432 H HZ2    A LYS C 3 18  ? 5.978   -19.655 42.592 0.50 2.54 ? 18  LYS A HZ2    1 
ATOM 1433 H HZ2    B LYS C 3 18  ? 4.744   -22.045 38.758 0.50 2.54 ? 18  LYS A HZ2    1 
ATOM 1434 H HZ3    A LYS C 3 18  ? 4.497   -19.071 41.998 0.50 2.49 ? 18  LYS A HZ3    1 
ATOM 1435 H HZ3    B LYS C 3 18  ? 5.090   -21.436 40.306 0.50 2.49 ? 18  LYS A HZ3    1 
ATOM 1436 N N      . THR C 3 19  ? -1.725  -23.530 42.770 1.00 0.24 ? 19  THR A N      1 
ATOM 1437 C CA     . THR C 3 19  ? -2.765  -24.323 42.120 1.00 0.23 ? 19  THR A CA     1 
ATOM 1438 C C      . THR C 3 19  ? -3.918  -23.476 41.580 1.00 0.23 ? 19  THR A C      1 
ATOM 1439 O O      . THR C 3 19  ? -4.359  -23.647 40.429 1.00 0.23 ? 19  THR A O      1 
ATOM 1440 C CB     . THR C 3 19  ? -3.318  -25.335 43.126 1.00 0.23 ? 19  THR A CB     1 
ATOM 1441 O OG1    . THR C 3 19  ? -2.288  -26.239 43.499 1.00 0.24 ? 19  THR A OG1    1 
ATOM 1442 C CG2    . THR C 3 19  ? -4.473  -26.110 42.490 1.00 0.23 ? 19  THR A CG2    1 
ATOM 1443 H H      . THR C 3 19  ? -1.493  -23.726 43.703 1.00 0.23 ? 19  THR A H      1 
ATOM 1444 H HA     . THR C 3 19  ? -2.324  -24.867 41.302 1.00 0.24 ? 19  THR A HA     1 
ATOM 1445 H HB     . THR C 3 19  ? -3.678  -24.816 44.001 1.00 0.22 ? 19  THR A HB     1 
ATOM 1446 H HG1    . THR C 3 19  ? -1.837  -26.522 42.699 1.00 0.24 ? 19  THR A HG1    1 
ATOM 1447 H HG21   . THR C 3 19  ? -4.701  -26.975 43.093 1.00 0.23 ? 19  THR A HG21   1 
ATOM 1448 H HG22   . THR C 3 19  ? -4.188  -26.429 41.498 1.00 0.24 ? 19  THR A HG22   1 
ATOM 1449 H HG23   . THR C 3 19  ? -5.342  -25.474 42.429 1.00 0.23 ? 19  THR A HG23   1 
ATOM 1450 N N      . PHE C 3 20  ? -4.397  -22.575 42.433 1.00 0.22 ? 20  PHE A N      1 
ATOM 1451 C CA     . PHE C 3 20  ? -5.481  -21.676 42.074 1.00 0.21 ? 20  PHE A CA     1 
ATOM 1452 C C      . PHE C 3 20  ? -5.134  -20.885 40.820 1.00 0.22 ? 20  PHE A C      1 
ATOM 1453 O O      . PHE C 3 20  ? -5.951  -20.786 39.905 1.00 0.22 ? 20  PHE A O      1 
ATOM 1454 C CB     . PHE C 3 20  ? -5.721  -20.713 43.242 1.00 0.21 ? 20  PHE A CB     1 
ATOM 1455 C CG     . PHE C 3 20  ? -6.855  -19.781 42.911 1.00 0.20 ? 20  PHE A CG     1 
ATOM 1456 C CD1    . PHE C 3 20  ? -6.611  -18.615 42.182 1.00 0.20 ? 20  PHE A CD1    1 
ATOM 1457 C CD2    . PHE C 3 20  ? -8.153  -20.084 43.336 1.00 0.19 ? 20  PHE A CD2    1 
ATOM 1458 C CE1    . PHE C 3 20  ? -7.663  -17.747 41.878 1.00 0.20 ? 20  PHE A CE1    1 
ATOM 1459 C CE2    . PHE C 3 20  ? -9.206  -19.219 43.033 1.00 0.19 ? 20  PHE A CE2    1 
ATOM 1460 C CZ     . PHE C 3 20  ? -8.962  -18.049 42.304 1.00 0.19 ? 20  PHE A CZ     1 
ATOM 1461 H H      . PHE C 3 20  ? -3.998  -22.503 43.326 1.00 0.22 ? 20  PHE A H      1 
ATOM 1462 H HA     . PHE C 3 20  ? -6.379  -22.247 41.900 1.00 0.21 ? 20  PHE A HA     1 
ATOM 1463 H HB2    . PHE C 3 20  ? -5.969  -21.276 44.130 1.00 0.20 ? 20  PHE A HB2    1 
ATOM 1464 H HB3    . PHE C 3 20  ? -4.826  -20.135 43.423 1.00 0.21 ? 20  PHE A HB3    1 
ATOM 1465 H HD1    . PHE C 3 20  ? -5.607  -18.385 41.853 1.00 0.21 ? 20  PHE A HD1    1 
ATOM 1466 H HD2    . PHE C 3 20  ? -8.340  -20.989 43.898 1.00 0.19 ? 20  PHE A HD2    1 
ATOM 1467 H HE1    . PHE C 3 20  ? -7.474  -16.845 41.315 1.00 0.21 ? 20  PHE A HE1    1 
ATOM 1468 H HE2    . PHE C 3 20  ? -10.209 -19.452 43.361 1.00 0.19 ? 20  PHE A HE2    1 
ATOM 1469 H HZ     . PHE C 3 20  ? -9.775  -17.379 42.070 1.00 0.19 ? 20  PHE A HZ     1 
ATOM 1470 N N      . LYS C 3 21  ? -3.932  -20.301 40.781 1.00 0.23 ? 21  LYS A N      1 
ATOM 1471 C CA     . LYS C 3 21  ? -3.536  -19.489 39.627 1.00 0.24 ? 21  LYS A CA     1 
ATOM 1472 C C      . LYS C 3 21  ? -3.413  -20.334 38.365 1.00 0.25 ? 21  LYS A C      1 
ATOM 1473 O O      . LYS C 3 21  ? -3.736  -19.906 37.260 1.00 0.25 ? 21  LYS A O      1 
ATOM 1474 C CB     . LYS C 3 21  ? -2.198  -18.817 39.951 1.00 0.25 ? 21  LYS A CB     1 
ATOM 1475 C CG     . LYS C 3 21  ? -1.824  -17.871 38.818 1.00 0.28 ? 21  LYS A CG     1 
ATOM 1476 C CD     . LYS C 3 21  ? -0.541  -17.112 39.159 1.00 0.47 ? 21  LYS A CD     1 
ATOM 1477 C CE     . LYS C 3 21  ? -0.207  -16.147 38.018 1.00 0.72 ? 21  LYS A CE     1 
ATOM 1478 N NZ     . LYS C 3 21  ? 0.992   -15.342 38.383 1.00 1.11 ? 21  LYS A NZ     1 
ATOM 1479 H H      . LYS C 3 21  ? -3.321  -20.395 41.541 1.00 0.23 ? 21  LYS A H      1 
ATOM 1480 H HA     . LYS C 3 21  ? -4.275  -18.718 39.467 1.00 0.23 ? 21  LYS A HA     1 
ATOM 1481 H HB2    . LYS C 3 21  ? -2.289  -18.260 40.872 1.00 0.25 ? 21  LYS A HB2    1 
ATOM 1482 H HB3    . LYS C 3 21  ? -1.431  -19.571 40.059 1.00 0.27 ? 21  LYS A HB3    1 
ATOM 1483 H HG2    . LYS C 3 21  ? -1.663  -18.450 37.936 1.00 0.41 ? 21  LYS A HG2    1 
ATOM 1484 H HG3    . LYS C 3 21  ? -2.625  -17.168 38.652 1.00 0.49 ? 21  LYS A HG3    1 
ATOM 1485 H HD2    . LYS C 3 21  ? -0.683  -16.556 40.074 1.00 0.91 ? 21  LYS A HD2    1 
ATOM 1486 H HD3    . LYS C 3 21  ? 0.271   -17.813 39.283 1.00 0.85 ? 21  LYS A HD3    1 
ATOM 1487 H HE2    . LYS C 3 21  ? 0.000   -16.711 37.119 1.00 1.33 ? 21  LYS A HE2    1 
ATOM 1488 H HE3    . LYS C 3 21  ? -1.045  -15.488 37.845 1.00 1.24 ? 21  LYS A HE3    1 
ATOM 1489 H HZ1    . LYS C 3 21  ? 1.152   -15.405 39.408 1.00 1.68 ? 21  LYS A HZ1    1 
ATOM 1490 H HZ2    . LYS C 3 21  ? 0.836   -14.348 38.115 1.00 1.62 ? 21  LYS A HZ2    1 
ATOM 1491 H HZ3    . LYS C 3 21  ? 1.824   -15.711 37.881 1.00 1.55 ? 21  LYS A HZ3    1 
ATOM 1492 N N      . GLN C 3 22  ? -2.917  -21.553 38.522 1.00 0.25 ? 22  GLN A N      1 
ATOM 1493 C CA     . GLN C 3 22  ? -2.800  -22.432 37.362 1.00 0.26 ? 22  GLN A CA     1 
ATOM 1494 C C      . GLN C 3 22  ? -4.154  -22.766 36.765 1.00 0.26 ? 22  GLN A C      1 
ATOM 1495 O O      . GLN C 3 22  ? -4.318  -22.681 35.556 1.00 0.27 ? 22  GLN A O      1 
ATOM 1496 C CB     . GLN C 3 22  ? -2.122  -23.737 37.794 1.00 0.27 ? 22  GLN A CB     1 
ATOM 1497 C CG     A GLN C 3 22  ? -0.666  -23.478 38.149 0.50 0.50 ? 22  GLN A CG     1 
ATOM 1498 C CG     B GLN C 3 22  ? -0.627  -23.470 38.017 0.50 0.50 ? 22  GLN A CG     1 
ATOM 1499 C CD     A GLN C 3 22  ? 0.151   -23.353 36.877 0.50 1.00 ? 22  GLN A CD     1 
ATOM 1500 C CD     B GLN C 3 22  ? 0.068   -24.755 38.468 0.50 1.00 ? 22  GLN A CD     1 
ATOM 1501 O OE1    A GLN C 3 22  ? 0.000   -24.134 35.955 0.50 1.77 ? 22  GLN A OE1    1 
ATOM 1502 O OE1    B GLN C 3 22  ? -0.512  -25.560 39.169 0.50 1.77 ? 22  GLN A OE1    1 
ATOM 1503 N NE2    A GLN C 3 22  ? 1.001   -22.387 36.783 0.50 1.70 ? 22  GLN A NE2    1 
ATOM 1504 N NE2    B GLN C 3 22  ? 1.299   -24.982 38.095 0.50 1.70 ? 22  GLN A NE2    1 
ATOM 1505 H H      . GLN C 3 22  ? -2.652  -21.868 39.411 1.00 0.25 ? 22  GLN A H      1 
ATOM 1506 H HA     . GLN C 3 22  ? -2.196  -21.945 36.613 1.00 0.27 ? 22  GLN A HA     1 
ATOM 1507 H HB2    A GLN C 3 22  ? -2.633  -24.132 38.660 0.50 0.39 ? 22  GLN A HB2    1 
ATOM 1508 H HB2    B GLN C 3 22  ? -2.569  -24.091 38.712 0.50 0.39 ? 22  GLN A HB2    1 
ATOM 1509 H HB3    A GLN C 3 22  ? -2.177  -24.456 36.989 0.50 0.43 ? 22  GLN A HB3    1 
ATOM 1510 H HB3    B GLN C 3 22  ? -2.238  -24.483 37.022 0.50 0.43 ? 22  GLN A HB3    1 
ATOM 1511 H HG2    A GLN C 3 22  ? -0.588  -22.563 38.717 0.50 1.04 ? 22  GLN A HG2    1 
ATOM 1512 H HG2    B GLN C 3 22  ? -0.183  -23.126 37.094 0.50 1.04 ? 22  GLN A HG2    1 
ATOM 1513 H HG3    A GLN C 3 22  ? -0.287  -24.300 38.737 0.50 1.28 ? 22  GLN A HG3    1 
ATOM 1514 H HG3    B GLN C 3 22  ? -0.506  -22.713 38.775 0.50 1.28 ? 22  GLN A HG3    1 
ATOM 1515 H HE21   A GLN C 3 22  ? 1.101   -21.744 37.514 0.50 2.03 ? 22  GLN A HE21   1 
ATOM 1516 H HE21   B GLN C 3 22  ? 1.768   -24.332 37.532 0.50 2.03 ? 22  GLN A HE21   1 
ATOM 1517 H HE22   A GLN C 3 22  ? 1.556   -22.311 35.990 0.50 2.30 ? 22  GLN A HE22   1 
ATOM 1518 H HE22   B GLN C 3 22  ? 1.754   -25.803 38.379 0.50 2.30 ? 22  GLN A HE22   1 
ATOM 1519 N N      . ARG C 3 23  ? -5.105  -23.128 37.620 1.00 0.25 ? 23  ARG A N      1 
ATOM 1520 C CA     . ARG C 3 23  ? -6.446  -23.487 37.205 1.00 0.25 ? 23  ARG A CA     1 
ATOM 1521 C C      . ARG C 3 23  ? -7.147  -22.283 36.565 1.00 0.25 ? 23  ARG A C      1 
ATOM 1522 O O      . ARG C 3 23  ? -7.802  -22.384 35.521 1.00 0.26 ? 23  ARG A O      1 
ATOM 1523 C CB     . ARG C 3 23  ? -7.247  -23.951 38.424 1.00 0.24 ? 23  ARG A CB     1 
ATOM 1524 C CG     . ARG C 3 23  ? -8.478  -24.730 37.960 1.00 0.24 ? 23  ARG A CG     1 
ATOM 1525 C CD     . ARG C 3 23  ? -8.047  -26.098 37.425 1.00 0.25 ? 23  ARG A CD     1 
ATOM 1526 N NE     . ARG C 3 23  ? -9.089  -26.620 36.498 1.00 0.26 ? 23  ARG A NE     1 
ATOM 1527 C CZ     . ARG C 3 23  ? -8.813  -27.618 35.704 1.00 0.27 ? 23  ARG A CZ     1 
ATOM 1528 N NH1    . ARG C 3 23  ? -7.623  -28.155 35.719 1.00 0.27 ? 23  ARG A NH1    1 
ATOM 1529 N NH2    . ARG C 3 23  ? -9.728  -28.083 34.898 1.00 0.28 ? 23  ARG A NH2    1 
ATOM 1530 H H      . ARG C 3 23  ? -4.885  -23.162 38.576 1.00 0.24 ? 23  ARG A H      1 
ATOM 1531 H HA     . ARG C 3 23  ? -6.394  -24.293 36.490 1.00 0.26 ? 23  ARG A HA     1 
ATOM 1532 H HB2    . ARG C 3 23  ? -6.627  -24.588 39.039 1.00 0.24 ? 23  ARG A HB2    1 
ATOM 1533 H HB3    . ARG C 3 23  ? -7.561  -23.091 38.997 1.00 0.23 ? 23  ARG A HB3    1 
ATOM 1534 H HG2    . ARG C 3 23  ? -9.153  -24.866 38.793 1.00 0.24 ? 23  ARG A HG2    1 
ATOM 1535 H HG3    . ARG C 3 23  ? -8.979  -24.181 37.176 1.00 0.24 ? 23  ARG A HG3    1 
ATOM 1536 H HD2    . ARG C 3 23  ? -7.111  -25.998 36.897 1.00 0.26 ? 23  ARG A HD2    1 
ATOM 1537 H HD3    . ARG C 3 23  ? -7.921  -26.782 38.250 1.00 0.25 ? 23  ARG A HD3    1 
ATOM 1538 H HE     . ARG C 3 23  ? -9.981  -26.215 36.484 1.00 0.26 ? 23  ARG A HE     1 
ATOM 1539 H HH11   . ARG C 3 23  ? -6.924  -27.801 36.340 1.00 0.27 ? 23  ARG A HH11   1 
ATOM 1540 H HH12   . ARG C 3 23  ? -7.412  -28.920 35.111 1.00 0.28 ? 23  ARG A HH12   1 
ATOM 1541 H HH21   . ARG C 3 23  ? -10.641 -27.674 34.888 1.00 0.28 ? 23  ARG A HH21   1 
ATOM 1542 H HH22   . ARG C 3 23  ? -9.517  -28.848 34.288 1.00 0.29 ? 23  ARG A HH22   1 
ATOM 1543 N N      . ARG C 3 24  ? -6.988  -21.117 37.178 1.00 0.24 ? 24  ARG A N      1 
ATOM 1544 C CA     . ARG C 3 24  ? -7.600  -19.915 36.624 1.00 0.24 ? 24  ARG A CA     1 
ATOM 1545 C C      . ARG C 3 24  ? -7.125  -19.675 35.206 1.00 0.26 ? 24  ARG A C      1 
ATOM 1546 O O      . ARG C 3 24  ? -7.920  -19.399 34.296 1.00 0.26 ? 24  ARG A O      1 
ATOM 1547 C CB     . ARG C 3 24  ? -7.199  -18.708 37.463 1.00 0.24 ? 24  ARG A CB     1 
ATOM 1548 C CG     . ARG C 3 24  ? -7.939  -17.467 36.964 1.00 0.30 ? 24  ARG A CG     1 
ATOM 1549 C CD     . ARG C 3 24  ? -7.404  -16.256 37.701 1.00 0.50 ? 24  ARG A CD     1 
ATOM 1550 N NE     . ARG C 3 24  ? -5.985  -16.047 37.281 1.00 0.69 ? 24  ARG A NE     1 
ATOM 1551 C CZ     . ARG C 3 24  ? -5.394  -14.936 37.581 1.00 0.91 ? 24  ARG A CZ     1 
ATOM 1552 N NH1    . ARG C 3 24  ? -6.030  -14.066 38.272 1.00 1.61 ? 24  ARG A NH1    1 
ATOM 1553 N NH2    . ARG C 3 24  ? -4.169  -14.690 37.203 1.00 1.51 ? 24  ARG A NH2    1 
ATOM 1554 H H      . ARG C 3 24  ? -6.446  -21.060 37.995 1.00 0.24 ? 24  ARG A H      1 
ATOM 1555 H HA     . ARG C 3 24  ? -8.673  -20.024 36.629 1.00 0.24 ? 24  ARG A HA     1 
ATOM 1556 H HB2    . ARG C 3 24  ? -7.456  -18.888 38.497 1.00 0.24 ? 24  ARG A HB2    1 
ATOM 1557 H HB3    . ARG C 3 24  ? -6.135  -18.547 37.379 1.00 0.27 ? 24  ARG A HB3    1 
ATOM 1558 H HG2    . ARG C 3 24  ? -7.777  -17.338 35.905 1.00 0.45 ? 24  ARG A HG2    1 
ATOM 1559 H HG3    . ARG C 3 24  ? -8.996  -17.569 37.161 1.00 0.38 ? 24  ARG A HG3    1 
ATOM 1560 H HD2    . ARG C 3 24  ? -7.988  -15.385 37.449 1.00 1.07 ? 24  ARG A HD2    1 
ATOM 1561 H HD3    . ARG C 3 24  ? -7.449  -16.428 38.767 1.00 1.18 ? 24  ARG A HD3    1 
ATOM 1562 H HE     . ARG C 3 24  ? -5.513  -16.738 36.772 1.00 1.50 ? 24  ARG A HE     1 
ATOM 1563 H HH11   . ARG C 3 24  ? -6.967  -14.245 38.566 1.00 1.93 ? 24  ARG A HH11   1 
ATOM 1564 H HH12   . ARG C 3 24  ? -5.583  -13.213 38.514 1.00 2.17 ? 24  ARG A HH12   1 
ATOM 1565 H HH21   . ARG C 3 24  ? -3.661  -15.365 36.672 1.00 2.09 ? 24  ARG A HH21   1 
ATOM 1566 H HH22   . ARG C 3 24  ? -3.744  -13.813 37.436 1.00 1.76 ? 24  ARG A HH22   1 
ATOM 1567 N N      . ILE C 3 25  ? -5.807  -19.727 35.003 1.00 0.26 ? 25  ILE A N      1 
ATOM 1568 C CA     . ILE C 3 25  ? -5.248  -19.489 33.702 1.00 0.28 ? 25  ILE A CA     1 
ATOM 1569 C C      . ILE C 3 25  ? -5.626  -20.606 32.742 1.00 0.29 ? 25  ILE A C      1 
ATOM 1570 O O      . ILE C 3 25  ? -5.948  -20.352 31.575 1.00 0.30 ? 25  ILE A O      1 
ATOM 1571 C CB     . ILE C 3 25  ? -3.727  -19.387 33.766 1.00 0.29 ? 25  ILE A CB     1 
ATOM 1572 C CG1    . ILE C 3 25  ? -3.369  -18.084 34.499 1.00 0.28 ? 25  ILE A CG1    1 
ATOM 1573 C CG2    . ILE C 3 25  ? -3.156  -19.384 32.325 1.00 0.30 ? 25  ILE A CG2    1 
ATOM 1574 C CD1    . ILE C 3 25  ? -1.877  -18.046 34.834 1.00 0.29 ? 25  ILE A CD1    1 
ATOM 1575 H H      . ILE C 3 25  ? -5.211  -19.915 35.757 1.00 0.26 ? 25  ILE A H      1 
ATOM 1576 H HA     . ILE C 3 25  ? -5.618  -18.551 33.320 1.00 0.28 ? 25  ILE A HA     1 
ATOM 1577 H HB     . ILE C 3 25  ? -3.331  -20.233 34.310 1.00 0.28 ? 25  ILE A HB     1 
ATOM 1578 H HG12   . ILE C 3 25  ? -3.618  -17.244 33.867 1.00 0.29 ? 25  ILE A HG12   1 
ATOM 1579 H HG13   . ILE C 3 25  ? -3.945  -18.023 35.414 1.00 0.27 ? 25  ILE A HG13   1 
ATOM 1580 H HG21   . ILE C 3 25  ? -3.842  -18.877 31.662 1.00 1.05 ? 25  ILE A HG21   1 
ATOM 1581 H HG22   . ILE C 3 25  ? -3.031  -20.403 31.991 1.00 1.04 ? 25  ILE A HG22   1 
ATOM 1582 H HG23   . ILE C 3 25  ? -2.205  -18.886 32.292 1.00 1.05 ? 25  ILE A HG23   1 
ATOM 1583 H HD11   . ILE C 3 25  ? -1.737  -18.369 35.838 1.00 1.06 ? 25  ILE A HD11   1 
ATOM 1584 H HD12   . ILE C 3 25  ? -1.500  -17.041 34.727 1.00 1.05 ? 25  ILE A HD12   1 
ATOM 1585 H HD13   . ILE C 3 25  ? -1.343  -18.695 34.178 1.00 1.07 ? 25  ILE A HD13   1 
ATOM 1586 N N      . LYS C 3 26  ? -5.558  -21.840 33.231 1.00 0.28 ? 26  LYS A N      1 
ATOM 1587 C CA     . LYS C 3 26  ? -5.914  -22.968 32.369 1.00 0.29 ? 26  LYS A CA     1 
ATOM 1588 C C      . LYS C 3 26  ? -7.344  -22.773 31.847 1.00 0.29 ? 26  LYS A C      1 
ATOM 1589 O O      . LYS C 3 26  ? -7.636  -23.018 30.692 1.00 0.31 ? 26  LYS A O      1 
ATOM 1590 C CB     . LYS C 3 26  ? -5.835  -24.269 33.170 1.00 0.29 ? 26  LYS A CB     1 
ATOM 1591 C CG     . LYS C 3 26  ? -4.375  -24.711 33.288 1.00 0.29 ? 26  LYS A CG     1 
ATOM 1592 C CD     . LYS C 3 26  ? -4.236  -25.719 34.429 1.00 0.28 ? 26  LYS A CD     1 
ATOM 1593 C CE     . LYS C 3 26  ? -2.755  -26.001 34.686 1.00 0.29 ? 26  LYS A CE     1 
ATOM 1594 N NZ     . LYS C 3 26  ? -2.604  -26.720 35.984 1.00 0.28 ? 26  LYS A NZ     1 
ATOM 1595 H H      . LYS C 3 26  ? -5.276  -21.992 34.157 1.00 0.28 ? 26  LYS A H      1 
ATOM 1596 H HA     . LYS C 3 26  ? -5.229  -23.016 31.536 1.00 0.30 ? 26  LYS A HA     1 
ATOM 1597 H HB2    . LYS C 3 26  ? -6.244  -24.109 34.157 1.00 0.28 ? 26  LYS A HB2    1 
ATOM 1598 H HB3    . LYS C 3 26  ? -6.402  -25.037 32.666 1.00 0.29 ? 26  LYS A HB3    1 
ATOM 1599 H HG2    . LYS C 3 26  ? -4.062  -25.169 32.360 1.00 0.30 ? 26  LYS A HG2    1 
ATOM 1600 H HG3    . LYS C 3 26  ? -3.754  -23.852 33.492 1.00 0.29 ? 26  LYS A HG3    1 
ATOM 1601 H HD2    . LYS C 3 26  ? -4.687  -25.315 35.323 1.00 0.27 ? 26  LYS A HD2    1 
ATOM 1602 H HD3    . LYS C 3 26  ? -4.734  -26.639 34.158 1.00 0.29 ? 26  LYS A HD3    1 
ATOM 1603 H HE2    . LYS C 3 26  ? -2.360  -26.612 33.887 1.00 0.30 ? 26  LYS A HE2    1 
ATOM 1604 H HE3    . LYS C 3 26  ? -2.213  -25.068 34.726 1.00 0.29 ? 26  LYS A HE3    1 
ATOM 1605 H HZ1    . LYS C 3 26  ? -3.189  -26.257 36.707 1.00 0.27 ? 26  LYS A HZ1    1 
ATOM 1606 H HZ2    . LYS C 3 26  ? -1.605  -26.698 36.277 1.00 0.28 ? 26  LYS A HZ2    1 
ATOM 1607 H HZ3    . LYS C 3 26  ? -2.911  -27.706 35.871 1.00 0.28 ? 26  LYS A HZ3    1 
ATOM 1608 N N      . LEU C 3 27  ? -8.248  -22.328 32.716 1.00 0.28 ? 27  LEU A N      1 
ATOM 1609 C CA     . LEU C 3 27  ? -9.635  -22.110 32.335 1.00 0.28 ? 27  LEU A CA     1 
ATOM 1610 C C      . LEU C 3 27  ? -9.910  -20.826 31.558 1.00 0.29 ? 27  LEU A C      1 
ATOM 1611 O O      . LEU C 3 27  ? -11.049 -20.596 31.131 1.00 0.29 ? 27  LEU A O      1 
ATOM 1612 C CB     . LEU C 3 27  ? -10.492 -22.098 33.601 1.00 0.27 ? 27  LEU A CB     1 
ATOM 1613 C CG     . LEU C 3 27  ? -10.749 -23.534 34.064 1.00 0.27 ? 27  LEU A CG     1 
ATOM 1614 C CD1    . LEU C 3 27  ? -9.420  -24.194 34.435 1.00 0.27 ? 27  LEU A CD1    1 
ATOM 1615 C CD2    . LEU C 3 27  ? -11.667 -23.519 35.288 1.00 0.26 ? 27  LEU A CD2    1 
ATOM 1616 H H      . LEU C 3 27  ? -7.974  -22.142 33.639 1.00 0.27 ? 27  LEU A H      1 
ATOM 1617 H HA     . LEU C 3 27  ? -9.955  -22.944 31.734 1.00 0.29 ? 27  LEU A HA     1 
ATOM 1618 H HB2    . LEU C 3 27  ? -9.977  -21.555 34.380 1.00 0.26 ? 27  LEU A HB2    1 
ATOM 1619 H HB3    . LEU C 3 27  ? -11.437 -21.617 33.392 1.00 0.27 ? 27  LEU A HB3    1 
ATOM 1620 H HG     . LEU C 3 27  ? -11.217 -24.092 33.265 1.00 0.28 ? 27  LEU A HG     1 
ATOM 1621 H HD11   . LEU C 3 27  ? -9.092  -23.826 35.396 1.00 0.26 ? 27  LEU A HD11   1 
ATOM 1622 H HD12   . LEU C 3 27  ? -8.678  -23.957 33.687 1.00 0.28 ? 27  LEU A HD12   1 
ATOM 1623 H HD13   . LEU C 3 27  ? -9.553  -25.265 34.484 1.00 0.27 ? 27  LEU A HD13   1 
ATOM 1624 H HD21   . LEU C 3 27  ? -11.728 -24.513 35.703 1.00 0.26 ? 27  LEU A HD21   1 
ATOM 1625 H HD22   . LEU C 3 27  ? -12.653 -23.190 34.993 1.00 0.26 ? 27  LEU A HD22   1 
ATOM 1626 H HD23   . LEU C 3 27  ? -11.268 -22.842 36.029 1.00 0.25 ? 27  LEU A HD23   1 
ATOM 1627 N N      . GLY C 3 28  ? -8.886  -19.989 31.397 1.00 0.29 ? 28  GLY A N      1 
ATOM 1628 C CA     . GLY C 3 28  ? -9.051  -18.758 30.631 1.00 0.30 ? 28  GLY A CA     1 
ATOM 1629 C C      . GLY C 3 28  ? -9.692  -17.582 31.334 1.00 0.29 ? 28  GLY A C      1 
ATOM 1630 O O      . GLY C 3 28  ? -10.208 -16.680 30.673 1.00 0.30 ? 28  GLY A O      1 
ATOM 1631 H H      . GLY C 3 28  ? -8.009  -20.214 31.771 1.00 0.29 ? 28  GLY A H      1 
ATOM 1632 H HA2    . GLY C 3 28  ? -8.076  -18.443 30.295 1.00 0.31 ? 28  GLY A HA2    1 
ATOM 1633 H HA3    . GLY C 3 28  ? -9.643  -18.993 29.757 1.00 0.31 ? 28  GLY A HA3    1 
ATOM 1634 N N      . PHE C 3 29  ? -9.660  -17.567 32.663 1.00 0.28 ? 29  PHE A N      1 
ATOM 1635 C CA     . PHE C 3 29  ? -10.260 -16.461 33.410 1.00 0.27 ? 29  PHE A CA     1 
ATOM 1636 C C      . PHE C 3 29  ? -9.185  -15.415 33.837 1.00 0.27 ? 29  PHE A C      1 
ATOM 1637 O O      . PHE C 3 29  ? -8.058  -15.784 34.152 1.00 0.27 ? 29  PHE A O      1 
ATOM 1638 C CB     . PHE C 3 29  ? -10.923 -17.007 34.680 1.00 0.25 ? 29  PHE A CB     1 
ATOM 1639 C CG     . PHE C 3 29  ? -12.187 -17.739 34.321 1.00 0.26 ? 29  PHE A CG     1 
ATOM 1640 C CD1    . PHE C 3 29  ? -13.265 -17.042 33.770 1.00 0.26 ? 29  PHE A CD1    1 
ATOM 1641 C CD2    . PHE C 3 29  ? -12.278 -19.118 34.540 1.00 0.26 ? 29  PHE A CD2    1 
ATOM 1642 C CE1    . PHE C 3 29  ? -14.442 -17.723 33.440 1.00 0.27 ? 29  PHE A CE1    1 
ATOM 1643 C CE2    . PHE C 3 29  ? -13.452 -19.799 34.208 1.00 0.26 ? 29  PHE A CE2    1 
ATOM 1644 C CZ     . PHE C 3 29  ? -14.534 -19.102 33.658 1.00 0.27 ? 29  PHE A CZ     1 
ATOM 1645 H H      . PHE C 3 29  ? -9.227  -18.301 33.148 1.00 0.27 ? 29  PHE A H      1 
ATOM 1646 H HA     . PHE C 3 29  ? -11.007 -15.979 32.800 1.00 0.27 ? 29  PHE A HA     1 
ATOM 1647 H HB2    . PHE C 3 29  ? -10.246 -17.687 35.177 1.00 0.25 ? 29  PHE A HB2    1 
ATOM 1648 H HB3    . PHE C 3 29  ? -11.160 -16.188 35.344 1.00 0.25 ? 29  PHE A HB3    1 
ATOM 1649 H HD1    . PHE C 3 29  ? -13.190 -15.977 33.602 1.00 0.26 ? 29  PHE A HD1    1 
ATOM 1650 H HD2    . PHE C 3 29  ? -11.441 -19.654 34.963 1.00 0.25 ? 29  PHE A HD2    1 
ATOM 1651 H HE1    . PHE C 3 29  ? -15.276 -17.185 33.014 1.00 0.27 ? 29  PHE A HE1    1 
ATOM 1652 H HE2    . PHE C 3 29  ? -13.522 -20.863 34.377 1.00 0.26 ? 29  PHE A HE2    1 
ATOM 1653 H HZ     . PHE C 3 29  ? -15.441 -19.629 33.404 1.00 0.27 ? 29  PHE A HZ     1 
ATOM 1654 N N      . THR C 3 30  ? -9.561  -14.138 33.856 1.00 0.27 ? 30  THR A N      1 
ATOM 1655 C CA     . THR C 3 30  ? -8.665  -13.079 34.329 1.00 0.27 ? 30  THR A CA     1 
ATOM 1656 C C      . THR C 3 30  ? -8.876  -13.018 35.843 1.00 0.25 ? 30  THR A C      1 
ATOM 1657 O O      . THR C 3 30  ? -9.779  -13.662 36.375 1.00 0.24 ? 30  THR A O      1 
ATOM 1658 C CB     . THR C 3 30  ? -9.048  -11.739 33.687 1.00 0.28 ? 30  THR A CB     1 
ATOM 1659 O OG1    . THR C 3 30  ? -10.314 -11.328 34.181 1.00 0.30 ? 30  THR A OG1    1 
ATOM 1660 C CG2    . THR C 3 30  ? -9.125  -11.893 32.162 1.00 0.37 ? 30  THR A CG2    1 
ATOM 1661 H H      . THR C 3 30  ? -10.479 -13.910 33.605 1.00 0.27 ? 30  THR A H      1 
ATOM 1662 H HA     . THR C 3 30  ? -7.636  -13.328 34.103 1.00 0.27 ? 30  THR A HA     1 
ATOM 1663 H HB     . THR C 3 30  ? -8.305  -10.996 33.934 1.00 0.31 ? 30  THR A HB     1 
ATOM 1664 H HG1    . THR C 3 30  ? -10.944 -11.374 33.458 1.00 0.96 ? 30  THR A HG1    1 
ATOM 1665 H HG21   . THR C 3 30  ? -8.957  -10.933 31.694 1.00 1.09 ? 30  THR A HG21   1 
ATOM 1666 H HG22   . THR C 3 30  ? -10.103 -12.258 31.887 1.00 1.08 ? 30  THR A HG22   1 
ATOM 1667 H HG23   . THR C 3 30  ? -8.372  -12.592 31.825 1.00 1.12 ? 30  THR A HG23   1 
ATOM 1668 N N      . GLN C 3 31  ? -8.027  -12.290 36.574 1.00 0.25 ? 31  GLN A N      1 
ATOM 1669 C CA     . GLN C 3 31  ? -8.213  -12.182 38.009 1.00 0.24 ? 31  GLN A CA     1 
ATOM 1670 C C      . GLN C 3 31  ? -9.542  -11.475 38.237 1.00 0.23 ? 31  GLN A C      1 
ATOM 1671 O O      . GLN C 3 31  ? -10.288 -11.798 39.164 1.00 0.22 ? 31  GLN A O      1 
ATOM 1672 C CB     . GLN C 3 31  ? -7.011  -11.385 38.383 1.00 0.24 ? 31  GLN A CB     1 
ATOM 1673 C CG     . GLN C 3 31  ? -7.325  -10.641 39.581 1.00 0.23 ? 31  GLN A CG     1 
ATOM 1674 C CD     . GLN C 3 31  ? -6.051  -10.398 40.335 1.00 0.25 ? 31  GLN A CD     1 
ATOM 1675 O OE1    . GLN C 3 31  ? -5.264  -11.296 40.518 1.00 0.27 ? 31  GLN A OE1    1 
ATOM 1676 N NE2    . GLN C 3 31  ? -5.824  -9.232  40.783 1.00 0.25 ? 31  GLN A NE2    1 
ATOM 1677 H H      . GLN C 3 31  ? -7.290  -11.810 36.138 1.00 0.26 ? 31  GLN A H      1 
ATOM 1678 H HA     . GLN C 3 31  ? -8.245  -13.168 38.448 1.00 0.23 ? 31  GLN A HA     1 
ATOM 1679 H HB2    . GLN C 3 31  ? -6.182  -12.022 38.542 1.00 0.25 ? 31  GLN A HB2    1 
ATOM 1680 H HB3    . GLN C 3 31  ? -6.767  -10.693 37.585 1.00 0.25 ? 31  GLN A HB3    1 
ATOM 1681 H HG2    . GLN C 3 31  ? -7.789  -9.739  39.303 1.00 0.23 ? 31  GLN A HG2    1 
ATOM 1682 H HG3    . GLN C 3 31  ? -8.007  -11.191 40.159 1.00 0.23 ? 31  GLN A HG3    1 
ATOM 1683 H HE21   . GLN C 3 31  ? -6.465  -8.519  40.624 1.00 0.25 ? 31  GLN A HE21   1 
ATOM 1684 H HE22   . GLN C 3 31  ? -5.054  -9.069  41.318 1.00 0.27 ? 31  GLN A HE22   1 
ATOM 1685 N N      . GLY C 3 32  ? -9.827  -10.510 37.359 1.00 0.24 ? 32  GLY A N      1 
ATOM 1686 C CA     . GLY C 3 32  ? -11.088 -9.773  37.486 1.00 0.24 ? 32  GLY A CA     1 
ATOM 1687 C C      . GLY C 3 32  ? -12.302 -10.705 37.332 1.00 0.23 ? 32  GLY A C      1 
ATOM 1688 O O      . GLY C 3 32  ? -13.272 -10.603 38.117 1.00 0.23 ? 32  GLY A O      1 
ATOM 1689 H H      . GLY C 3 32  ? -9.204  -10.301 36.634 1.00 0.25 ? 32  GLY A H      1 
ATOM 1690 H HA2    . GLY C 3 32  ? -11.125 -9.302  38.459 1.00 0.23 ? 32  GLY A HA2    1 
ATOM 1691 H HA3    . GLY C 3 32  ? -11.132 -9.011  36.724 1.00 0.25 ? 32  GLY A HA3    1 
ATOM 1692 N N      . ASP C 3 33  ? -12.235 -11.569 36.333 1.00 0.24 ? 33  ASP A N      1 
ATOM 1693 C CA     . ASP C 3 33  ? -13.312 -12.553 36.055 1.00 0.24 ? 33  ASP A CA     1 
ATOM 1694 C C      . ASP C 3 33  ? -13.607 -13.350 37.313 1.00 0.23 ? 33  ASP A C      1 
ATOM 1695 O O      . ASP C 3 33  ? -14.767 -13.554 37.707 1.00 0.23 ? 33  ASP A O      1 
ATOM 1696 C CB     . ASP C 3 33  ? -12.859 -13.507 34.948 1.00 0.25 ? 33  ASP A CB     1 
ATOM 1697 C CG     . ASP C 3 33  ? -12.995 -12.817 33.589 1.00 0.27 ? 33  ASP A CG     1 
ATOM 1698 O OD1    . ASP C 3 33  ? -13.735 -11.850 33.508 1.00 0.27 ? 33  ASP A OD1    1 
ATOM 1699 O OD2    . ASP C 3 33  ? -12.355 -13.265 32.653 1.00 0.28 ? 33  ASP A OD2    1 
ATOM 1700 H H      . ASP C 3 33  ? -11.437 -11.566 35.760 1.00 0.25 ? 33  ASP A H      1 
ATOM 1701 H HA     . ASP C 3 33  ? -14.204 -12.033 35.741 1.00 0.25 ? 33  ASP A HA     1 
ATOM 1702 H HB2    . ASP C 3 33  ? -11.828 -13.782 35.112 1.00 0.25 ? 33  ASP A HB2    1 
ATOM 1703 H HB3    . ASP C 3 33  ? -13.477 -14.394 34.960 1.00 0.25 ? 33  ASP A HB3    1 
ATOM 1704 N N      . VAL C 3 34  ? -12.553 -13.857 37.949 1.00 0.22 ? 34  VAL A N      1 
ATOM 1705 C CA     . VAL C 3 34  ? -12.776 -14.612 39.179 1.00 0.21 ? 34  VAL A CA     1 
ATOM 1706 C C      . VAL C 3 34  ? -13.412 -13.803 40.277 1.00 0.20 ? 34  VAL A C      1 
ATOM 1707 O O      . VAL C 3 34  ? -14.355 -14.265 40.968 1.00 0.20 ? 34  VAL A O      1 
ATOM 1708 C CB     . VAL C 3 34  ? -11.435 -15.152 39.675 1.00 0.21 ? 34  VAL A CB     1 
ATOM 1709 C CG1    . VAL C 3 34  ? -11.635 -15.857 41.019 1.00 0.20 ? 34  VAL A CG1    1 
ATOM 1710 C CG2    . VAL C 3 34  ? -10.879 -16.148 38.657 1.00 0.22 ? 34  VAL A CG2    1 
ATOM 1711 H H      . VAL C 3 34  ? -11.645 -13.714 37.608 1.00 0.23 ? 34  VAL A H      1 
ATOM 1712 H HA     . VAL C 3 34  ? -13.412 -15.454 38.956 1.00 0.21 ? 34  VAL A HA     1 
ATOM 1713 H HB     . VAL C 3 34  ? -10.742 -14.333 39.800 1.00 0.21 ? 34  VAL A HB     1 
ATOM 1714 H HG11   . VAL C 3 34  ? -12.691 -15.993 41.201 1.00 0.20 ? 34  VAL A HG11   1 
ATOM 1715 H HG12   . VAL C 3 34  ? -11.207 -15.257 41.808 1.00 0.19 ? 34  VAL A HG12   1 
ATOM 1716 H HG13   . VAL C 3 34  ? -11.148 -16.821 40.996 1.00 0.20 ? 34  VAL A HG13   1 
ATOM 1717 H HG21   . VAL C 3 34  ? -10.047 -16.683 39.091 1.00 0.21 ? 34  VAL A HG21   1 
ATOM 1718 H HG22   . VAL C 3 34  ? -10.545 -15.616 37.778 1.00 0.23 ? 34  VAL A HG22   1 
ATOM 1719 H HG23   . VAL C 3 34  ? -11.652 -16.850 38.378 1.00 0.22 ? 34  VAL A HG23   1 
ATOM 1720 N N      . GLY C 3 35  ? -12.929 -12.568 40.463 1.00 0.20 ? 35  GLY A N      1 
ATOM 1721 C CA     . GLY C 3 35  ? -13.481 -11.751 41.509 1.00 0.20 ? 35  GLY A CA     1 
ATOM 1722 C C      . GLY C 3 35  ? -14.980 -11.535 41.271 1.00 0.20 ? 35  GLY A C      1 
ATOM 1723 O O      . GLY C 3 35  ? -15.786 -11.564 42.209 1.00 0.19 ? 35  GLY A O      1 
ATOM 1724 H H      . GLY C 3 35  ? -12.201 -12.230 39.903 1.00 0.21 ? 35  GLY A H      1 
ATOM 1725 H HA2    . GLY C 3 35  ? -13.333 -12.244 42.460 1.00 0.19 ? 35  GLY A HA2    1 
ATOM 1726 H HA3    . GLY C 3 35  ? -12.983 -10.794 41.519 1.00 0.20 ? 35  GLY A HA3    1 
ATOM 1727 N N      . LEU C 3 36  ? -15.333 -11.346 40.021 1.00 0.21 ? 36  LEU A N      1 
ATOM 1728 C CA     . LEU C 3 36  ? -16.754 -11.125 39.661 1.00 0.21 ? 36  LEU A CA     1 
ATOM 1729 C C      . LEU C 3 36  ? -17.570 -12.405 39.900 1.00 0.21 ? 36  LEU A C      1 
ATOM 1730 O O      . LEU C 3 36  ? -18.672 -12.341 40.453 1.00 0.21 ? 36  LEU A O      1 
ATOM 1731 C CB     . LEU C 3 36  ? -16.848 -10.732 38.184 1.00 0.23 ? 36  LEU A CB     1 
ATOM 1732 C CG     . LEU C 3 36  ? -16.310 -9.313  37.996 1.00 0.23 ? 36  LEU A CG     1 
ATOM 1733 C CD1    . LEU C 3 36  ? -16.136 -9.027  36.505 1.00 0.25 ? 36  LEU A CD1    1 
ATOM 1734 C CD2    . LEU C 3 36  ? -17.299 -8.311  38.595 1.00 0.23 ? 36  LEU A CD2    1 
ATOM 1735 H H      . LEU C 3 36  ? -14.650 -11.351 39.316 1.00 0.21 ? 36  LEU A H      1 
ATOM 1736 H HA     . LEU C 3 36  ? -17.157 -10.327 40.266 1.00 0.21 ? 36  LEU A HA     1 
ATOM 1737 H HB2    . LEU C 3 36  ? -16.265 -11.422 37.591 1.00 0.23 ? 36  LEU A HB2    1 
ATOM 1738 H HB3    . LEU C 3 36  ? -17.880 -10.769 37.866 1.00 0.23 ? 36  LEU A HB3    1 
ATOM 1739 H HG     . LEU C 3 36  ? -15.355 -9.223  38.494 1.00 0.23 ? 36  LEU A HG     1 
ATOM 1740 H HD11   . LEU C 3 36  ? -15.402 -9.702  36.090 1.00 0.25 ? 36  LEU A HD11   1 
ATOM 1741 H HD12   . LEU C 3 36  ? -15.805 -8.008  36.370 1.00 0.25 ? 36  LEU A HD12   1 
ATOM 1742 H HD13   . LEU C 3 36  ? -17.080 -9.168  35.998 1.00 0.25 ? 36  LEU A HD13   1 
ATOM 1743 H HD21   . LEU C 3 36  ? -18.308 -8.622  38.371 1.00 0.23 ? 36  LEU A HD21   1 
ATOM 1744 H HD22   . LEU C 3 36  ? -17.120 -7.334  38.171 1.00 0.24 ? 36  LEU A HD22   1 
ATOM 1745 H HD23   . LEU C 3 36  ? -17.165 -8.268  39.665 1.00 0.22 ? 36  LEU A HD23   1 
ATOM 1746 N N      . ALA C 3 37  ? -17.015 -13.552 39.509 1.00 0.21 ? 37  ALA A N      1 
ATOM 1747 C CA     . ALA C 3 37  ? -17.707 -14.866 39.682 1.00 0.22 ? 37  ALA A CA     1 
ATOM 1748 C C      . ALA C 3 37  ? -17.982 -15.184 41.153 1.00 0.21 ? 37  ALA A C      1 
ATOM 1749 O O      . ALA C 3 37  ? -19.022 -15.795 41.512 1.00 0.21 ? 37  ALA A O      1 
ATOM 1750 C CB     . ALA C 3 37  ? -16.835 -15.971 39.086 1.00 0.22 ? 37  ALA A CB     1 
ATOM 1751 H H      . ALA C 3 37  ? -16.128 -13.534 39.094 1.00 0.22 ? 37  ALA A H      1 
ATOM 1752 H HA     . ALA C 3 37  ? -18.645 -14.839 39.149 1.00 0.22 ? 37  ALA A HA     1 
ATOM 1753 H HB1    . ALA C 3 37  ? -15.902 -16.025 39.627 1.00 0.21 ? 37  ALA A HB1    1 
ATOM 1754 H HB2    . ALA C 3 37  ? -16.637 -15.754 38.047 1.00 0.23 ? 37  ALA A HB2    1 
ATOM 1755 H HB3    . ALA C 3 37  ? -17.351 -16.917 39.162 1.00 0.22 ? 37  ALA A HB3    1 
ATOM 1756 N N      . MET C 3 38  ? -17.058 -14.782 42.020 1.00 0.20 ? 38  MET A N      1 
ATOM 1757 C CA     . MET C 3 38  ? -17.205 -14.989 43.430 1.00 0.19 ? 38  MET A CA     1 
ATOM 1758 C C      . MET C 3 38  ? -18.459 -14.258 43.936 1.00 0.19 ? 38  MET A C      1 
ATOM 1759 O O      . MET C 3 38  ? -19.113 -14.719 44.864 1.00 0.19 ? 38  MET A O      1 
ATOM 1760 C CB     . MET C 3 38  ? -15.974 -14.446 44.158 1.00 0.18 ? 38  MET A CB     1 
ATOM 1761 C CG     . MET C 3 38  ? -14.758 -15.311 43.823 1.00 0.18 ? 38  MET A CG     1 
ATOM 1762 S SD     . MET C 3 38  ? -15.035 -17.000 44.417 1.00 0.18 ? 38  MET A SD     1 
ATOM 1763 C CE     . MET C 3 38  ? -15.166 -16.601 46.178 1.00 0.17 ? 38  MET A CE     1 
ATOM 1764 H H      . MET C 3 38  ? -16.263 -14.315 41.684 1.00 0.20 ? 38  MET A H      1 
ATOM 1765 H HA     . MET C 3 38  ? -17.300 -16.045 43.631 1.00 0.19 ? 38  MET A HA     1 
ATOM 1766 H HB2    . MET C 3 38  ? -15.790 -13.429 43.845 1.00 0.18 ? 38  MET A HB2    1 
ATOM 1767 H HB3    . MET C 3 38  ? -16.146 -14.470 45.224 1.00 0.18 ? 38  MET A HB3    1 
ATOM 1768 H HG2    . MET C 3 38  ? -14.611 -15.326 42.753 1.00 0.19 ? 38  MET A HG2    1 
ATOM 1769 H HG3    . MET C 3 38  ? -13.881 -14.901 44.301 1.00 0.18 ? 38  MET A HG3    1 
ATOM 1770 H HE1    . MET C 3 38  ? -16.209 -16.538 46.454 1.00 0.18 ? 38  MET A HE1    1 
ATOM 1771 H HE2    . MET C 3 38  ? -14.687 -15.656 46.372 1.00 0.17 ? 38  MET A HE2    1 
ATOM 1772 H HE3    . MET C 3 38  ? -14.680 -17.374 46.757 1.00 0.17 ? 38  MET A HE3    1 
ATOM 1773 N N      . GLY C 3 39  ? -18.750 -13.096 43.374 1.00 0.19 ? 39  GLY A N      1 
ATOM 1774 C CA     . GLY C 3 39  ? -19.951 -12.414 43.815 1.00 0.20 ? 39  GLY A CA     1 
ATOM 1775 C C      . GLY C 3 39  ? -21.185 -13.110 43.194 1.00 0.21 ? 39  GLY A C      1 
ATOM 1776 O O      . GLY C 3 39  ? -22.175 -13.391 43.883 1.00 0.21 ? 39  GLY A O      1 
ATOM 1777 H H      . GLY C 3 39  ? -18.186 -12.723 42.665 1.00 0.20 ? 39  GLY A H      1 
ATOM 1778 H HA2    . GLY C 3 39  ? -20.012 -12.455 44.893 1.00 0.19 ? 39  GLY A HA2    1 
ATOM 1779 H HA3    . GLY C 3 39  ? -19.924 -11.385 43.492 1.00 0.20 ? 39  GLY A HA3    1 
ATOM 1780 N N      . LYS C 3 40  ? -21.131 -13.410 41.909 1.00 0.22 ? 40  LYS A N      1 
ATOM 1781 C CA     . LYS C 3 40  ? -22.307 -14.034 41.268 1.00 0.23 ? 40  LYS A CA     1 
ATOM 1782 C C      . LYS C 3 40  ? -22.640 -15.413 41.788 1.00 0.23 ? 40  LYS A C      1 
ATOM 1783 O O      . LYS C 3 40  ? -23.812 -15.754 41.965 1.00 0.24 ? 40  LYS A O      1 
ATOM 1784 C CB     . LYS C 3 40  ? -22.059 -14.129 39.762 1.00 0.24 ? 40  LYS A CB     1 
ATOM 1785 C CG     . LYS C 3 40  ? -21.759 -12.737 39.202 1.00 0.24 ? 40  LYS A CG     1 
ATOM 1786 C CD     . LYS C 3 40  ? -21.761 -12.791 37.673 1.00 0.25 ? 40  LYS A CD     1 
ATOM 1787 C CE     . LYS C 3 40  ? -23.199 -12.917 37.167 1.00 0.26 ? 40  LYS A CE     1 
ATOM 1788 N NZ     . LYS C 3 40  ? -23.905 -11.616 37.345 1.00 0.26 ? 40  LYS A NZ     1 
ATOM 1789 H H      . LYS C 3 40  ? -20.330 -13.192 41.381 1.00 0.21 ? 40  LYS A H      1 
ATOM 1790 H HA     . LYS C 3 40  ? -23.162 -13.396 41.424 1.00 0.23 ? 40  LYS A HA     1 
ATOM 1791 H HB2    . LYS C 3 40  ? -21.218 -14.781 39.576 1.00 0.23 ? 40  LYS A HB2    1 
ATOM 1792 H HB3    . LYS C 3 40  ? -22.937 -14.527 39.277 1.00 0.25 ? 40  LYS A HB3    1 
ATOM 1793 H HG2    . LYS C 3 40  ? -22.515 -12.043 39.541 1.00 0.24 ? 40  LYS A HG2    1 
ATOM 1794 H HG3    . LYS C 3 40  ? -20.789 -12.411 39.548 1.00 0.23 ? 40  LYS A HG3    1 
ATOM 1795 H HD2    . LYS C 3 40  ? -21.319 -11.887 37.280 1.00 0.25 ? 40  LYS A HD2    1 
ATOM 1796 H HD3    . LYS C 3 40  ? -21.190 -13.644 37.342 1.00 0.25 ? 40  LYS A HD3    1 
ATOM 1797 H HE2    . LYS C 3 40  ? -23.191 -13.182 36.120 1.00 0.27 ? 40  LYS A HE2    1 
ATOM 1798 H HE3    . LYS C 3 40  ? -23.713 -13.684 37.727 1.00 0.26 ? 40  LYS A HE3    1 
ATOM 1799 H HZ1    . LYS C 3 40  ? -24.349 -11.587 38.283 1.00 0.26 ? 40  LYS A HZ1    1 
ATOM 1800 H HZ2    . LYS C 3 40  ? -24.637 -11.517 36.610 1.00 0.28 ? 40  LYS A HZ2    1 
ATOM 1801 H HZ3    . LYS C 3 40  ? -23.222 -10.836 37.263 1.00 0.26 ? 40  LYS A HZ3    1 
ATOM 1802 N N      . LEU C 3 41  ? -21.617 -16.221 42.026 1.00 0.22 ? 41  LEU A N      1 
ATOM 1803 C CA     . LEU C 3 41  ? -21.843 -17.590 42.463 1.00 0.23 ? 41  LEU A CA     1 
ATOM 1804 C C      . LEU C 3 41  ? -21.873 -17.829 43.953 1.00 0.22 ? 41  LEU A C      1 
ATOM 1805 O O      . LEU C 3 41  ? -22.596 -18.715 44.448 1.00 0.23 ? 41  LEU A O      1 
ATOM 1806 C CB     . LEU C 3 41  ? -20.760 -18.480 41.855 1.00 0.22 ? 41  LEU A CB     1 
ATOM 1807 C CG     . LEU C 3 41  ? -20.715 -18.275 40.340 1.00 0.23 ? 41  LEU A CG     1 
ATOM 1808 C CD1    . LEU C 3 41  ? -19.652 -19.192 39.733 1.00 0.23 ? 41  LEU A CD1    1 
ATOM 1809 C CD2    . LEU C 3 41  ? -22.082 -18.615 39.739 1.00 0.25 ? 41  LEU A CD2    1 
ATOM 1810 H H      . LEU C 3 41  ? -20.702 -15.909 41.864 1.00 0.22 ? 41  LEU A H      1 
ATOM 1811 H HA     . LEU C 3 41  ? -22.785 -17.916 42.056 1.00 0.24 ? 41  LEU A HA     1 
ATOM 1812 H HB2    . LEU C 3 41  ? -19.800 -18.221 42.281 1.00 0.22 ? 41  LEU A HB2    1 
ATOM 1813 H HB3    . LEU C 3 41  ? -20.981 -19.515 42.068 1.00 0.23 ? 41  LEU A HB3    1 
ATOM 1814 H HG     . LEU C 3 41  ? -20.470 -17.246 40.123 1.00 0.23 ? 41  LEU A HG     1 
ATOM 1815 H HD11   . LEU C 3 41  ? -19.904 -20.222 39.941 1.00 0.24 ? 41  LEU A HD11   1 
ATOM 1816 H HD12   . LEU C 3 41  ? -18.690 -18.962 40.165 1.00 0.22 ? 41  LEU A HD12   1 
ATOM 1817 H HD13   . LEU C 3 41  ? -19.614 -19.040 38.665 1.00 0.24 ? 41  LEU A HD13   1 
ATOM 1818 H HD21   . LEU C 3 41  ? -22.476 -19.498 40.219 1.00 0.25 ? 41  LEU A HD21   1 
ATOM 1819 H HD22   . LEU C 3 41  ? -21.973 -18.798 38.680 1.00 0.25 ? 41  LEU A HD22   1 
ATOM 1820 H HD23   . LEU C 3 41  ? -22.759 -17.787 39.894 1.00 0.25 ? 41  LEU A HD23   1 
ATOM 1821 N N      . TYR C 3 42  ? -21.093 -17.061 44.697 1.00 0.21 ? 42  TYR A N      1 
ATOM 1822 C CA     . TYR C 3 42  ? -21.032 -17.286 46.115 1.00 0.21 ? 42  TYR A CA     1 
ATOM 1823 C C      . TYR C 3 42  ? -21.456 -16.163 47.011 1.00 0.21 ? 42  TYR A C      1 
ATOM 1824 O O      . TYR C 3 42  ? -21.388 -16.282 48.222 1.00 0.20 ? 42  TYR A O      1 
ATOM 1825 C CB     . TYR C 3 42  ? -19.603 -17.711 46.456 1.00 0.20 ? 42  TYR A CB     1 
ATOM 1826 C CG     . TYR C 3 42  ? -19.200 -18.857 45.539 1.00 0.20 ? 42  TYR A CG     1 
ATOM 1827 C CD1    . TYR C 3 42  ? -19.896 -20.077 45.592 1.00 0.21 ? 42  TYR A CD1    1 
ATOM 1828 C CD2    . TYR C 3 42  ? -18.139 -18.700 44.637 1.00 0.20 ? 42  TYR A CD2    1 
ATOM 1829 C CE1    . TYR C 3 42  ? -19.529 -21.131 44.738 1.00 0.22 ? 42  TYR A CE1    1 
ATOM 1830 C CE2    . TYR C 3 42  ? -17.772 -19.757 43.788 1.00 0.20 ? 42  TYR A CE2    1 
ATOM 1831 C CZ     . TYR C 3 42  ? -18.469 -20.970 43.839 1.00 0.21 ? 42  TYR A CZ     1 
ATOM 1832 O OH     . TYR C 3 42  ? -18.112 -22.005 42.998 1.00 0.22 ? 42  TYR A OH     1 
ATOM 1833 H H      . TYR C 3 42  ? -20.530 -16.373 44.281 1.00 0.21 ? 42  TYR A H      1 
ATOM 1834 H HA     . TYR C 3 42  ? -21.664 -18.129 46.333 1.00 0.22 ? 42  TYR A HA     1 
ATOM 1835 H HB2    . TYR C 3 42  ? -18.933 -16.878 46.308 1.00 0.19 ? 42  TYR A HB2    1 
ATOM 1836 H HB3    . TYR C 3 42  ? -19.555 -18.044 47.483 1.00 0.20 ? 42  TYR A HB3    1 
ATOM 1837 H HD1    . TYR C 3 42  ? -20.714 -20.207 46.285 1.00 0.22 ? 42  TYR A HD1    1 
ATOM 1838 H HD2    . TYR C 3 42  ? -17.599 -17.768 44.598 1.00 0.19 ? 42  TYR A HD2    1 
ATOM 1839 H HE1    . TYR C 3 42  ? -20.066 -22.067 44.774 1.00 0.23 ? 42  TYR A HE1    1 
ATOM 1840 H HE2    . TYR C 3 42  ? -16.956 -19.632 43.091 1.00 0.20 ? 42  TYR A HE2    1 
ATOM 1841 H HH     . TYR C 3 42  ? -18.863 -22.205 42.433 1.00 0.23 ? 42  TYR A HH     1 
ATOM 1842 N N      . GLY C 3 43  ? -21.908 -15.065 46.413 1.00 0.21 ? 43  GLY A N      1 
ATOM 1843 C CA     . GLY C 3 43  ? -22.421 -13.989 47.220 1.00 0.21 ? 43  GLY A CA     1 
ATOM 1844 C C      . GLY C 3 43  ? -21.446 -13.012 47.824 1.00 0.20 ? 43  GLY A C      1 
ATOM 1845 O O      . GLY C 3 43  ? -21.845 -12.189 48.644 1.00 0.20 ? 43  GLY A O      1 
ATOM 1846 H H      . GLY C 3 43  ? -21.947 -15.015 45.435 1.00 0.21 ? 43  GLY A H      1 
ATOM 1847 H HA2    . GLY C 3 43  ? -23.104 -13.422 46.609 1.00 0.21 ? 43  GLY A HA2    1 
ATOM 1848 H HA3    . GLY C 3 43  ? -22.992 -14.433 48.024 1.00 0.21 ? 43  GLY A HA3    1 
ATOM 1849 N N      . ASN C 3 44  ? -20.181 -13.082 47.416 1.00 0.19 ? 44  ASN A N      1 
ATOM 1850 C CA     . ASN C 3 44  ? -19.178 -12.165 47.986 1.00 0.18 ? 44  ASN A CA     1 
ATOM 1851 C C      . ASN C 3 44  ? -18.189 -11.842 46.894 1.00 0.18 ? 44  ASN A C      1 
ATOM 1852 O O      . ASN C 3 44  ? -17.242 -12.574 46.689 1.00 0.18 ? 44  ASN A O      1 
ATOM 1853 C CB     . ASN C 3 44  ? -18.459 -12.833 49.156 1.00 0.18 ? 44  ASN A CB     1 
ATOM 1854 C CG     . ASN C 3 44  ? -18.367 -14.338 48.910 1.00 0.18 ? 44  ASN A CG     1 
ATOM 1855 O OD1    . ASN C 3 44  ? -19.074 -15.112 49.527 1.00 0.19 ? 44  ASN A OD1    1 
ATOM 1856 N ND2    . ASN C 3 44  ? -17.522 -14.790 48.025 1.00 0.18 ? 44  ASN A ND2    1 
ATOM 1857 H H      . ASN C 3 44  ? -19.916 -13.748 46.752 1.00 0.19 ? 44  ASN A H      1 
ATOM 1858 H HA     . ASN C 3 44  ? -19.661 -11.259 48.320 1.00 0.18 ? 44  ASN A HA     1 
ATOM 1859 H HB2    . ASN C 3 44  ? -17.464 -12.421 49.248 1.00 0.17 ? 44  ASN A HB2    1 
ATOM 1860 H HB3    . ASN C 3 44  ? -19.010 -12.654 50.067 1.00 0.18 ? 44  ASN A HB3    1 
ATOM 1861 H HD21   . ASN C 3 44  ? -16.957 -14.165 47.523 1.00 0.17 ? 44  ASN A HD21   1 
ATOM 1862 H HD22   . ASN C 3 44  ? -17.444 -15.754 47.869 1.00 0.18 ? 44  ASN A HD22   1 
ATOM 1863 N N      . ASP C 3 45  ? -18.422 -10.771 46.154 1.00 0.18 ? 45  ASP A N      1 
ATOM 1864 C CA     . ASP C 3 45  ? -17.474 -10.469 45.085 1.00 0.18 ? 45  ASP A CA     1 
ATOM 1865 C C      . ASP C 3 45  ? -16.145 -9.930  45.671 1.00 0.18 ? 45  ASP A C      1 
ATOM 1866 O O      . ASP C 3 45  ? -16.099 -9.401  46.794 1.00 0.17 ? 45  ASP A O      1 
ATOM 1867 C CB     . ASP C 3 45  ? -18.048 -9.378  44.153 1.00 0.19 ? 45  ASP A CB     1 
ATOM 1868 C CG     . ASP C 3 45  ? -18.053 -8.015  44.863 1.00 0.19 ? 45  ASP A CG     1 
ATOM 1869 O OD1    . ASP C 3 45  ? -17.838 -7.988  46.063 1.00 0.19 ? 45  ASP A OD1    1 
ATOM 1870 O OD2    . ASP C 3 45  ? -18.269 -7.021  44.189 1.00 0.21 ? 45  ASP A OD2    1 
ATOM 1871 H H      . ASP C 3 45  ? -19.211 -10.210 46.308 1.00 0.19 ? 45  ASP A H      1 
ATOM 1872 H HA     . ASP C 3 45  ? -17.272 -11.370 44.524 1.00 0.18 ? 45  ASP A HA     1 
ATOM 1873 H HB2    . ASP C 3 45  ? -17.446 -9.314  43.262 1.00 0.20 ? 45  ASP A HB2    1 
ATOM 1874 H HB3    . ASP C 3 45  ? -19.053 -9.618  43.883 1.00 0.20 ? 45  ASP A HB3    1 
ATOM 1875 N N      . PHE C 3 46  ? -15.084 -10.110 44.898 1.00 0.18 ? 46  PHE A N      1 
ATOM 1876 C CA     . PHE C 3 46  ? -13.775 -9.615  45.264 1.00 0.18 ? 46  PHE A CA     1 
ATOM 1877 C C      . PHE C 3 46  ? -13.202 -8.824  44.121 1.00 0.19 ? 46  PHE A C      1 
ATOM 1878 O O      . PHE C 3 46  ? -13.533 -9.071  42.987 1.00 0.19 ? 46  PHE A O      1 
ATOM 1879 C CB     . PHE C 3 46  ? -12.844 -10.783 45.591 1.00 0.17 ? 46  PHE A CB     1 
ATOM 1880 C CG     . PHE C 3 46  ? -13.301 -11.451 46.863 1.00 0.17 ? 46  PHE A CG     1 
ATOM 1881 C CD1    . PHE C 3 46  ? -12.855 -10.968 48.107 1.00 0.17 ? 46  PHE A CD1    1 
ATOM 1882 C CD2    . PHE C 3 46  ? -14.166 -12.557 46.808 1.00 0.17 ? 46  PHE A CD2    1 
ATOM 1883 C CE1    . PHE C 3 46  ? -13.275 -11.590 49.296 1.00 0.17 ? 46  PHE A CE1    1 
ATOM 1884 C CE2    . PHE C 3 46  ? -14.587 -13.179 47.998 1.00 0.18 ? 46  PHE A CE2    1 
ATOM 1885 C CZ     . PHE C 3 46  ? -14.142 -12.696 49.241 1.00 0.18 ? 46  PHE A CZ     1 
ATOM 1886 H H      . PHE C 3 46  ? -15.198 -10.557 44.033 1.00 0.18 ? 46  PHE A H      1 
ATOM 1887 H HA     . PHE C 3 46  ? -13.859 -8.982  46.134 1.00 0.18 ? 46  PHE A HA     1 
ATOM 1888 H HB2    . PHE C 3 46  ? -12.865 -11.497 44.781 1.00 0.18 ? 46  PHE A HB2    1 
ATOM 1889 H HB3    . PHE C 3 46  ? -11.837 -10.415 45.720 1.00 0.18 ? 46  PHE A HB3    1 
ATOM 1890 H HD1    . PHE C 3 46  ? -12.190 -10.119 48.149 1.00 0.18 ? 46  PHE A HD1    1 
ATOM 1891 H HD2    . PHE C 3 46  ? -14.508 -12.928 45.854 1.00 0.18 ? 46  PHE A HD2    1 
ATOM 1892 H HE1    . PHE C 3 46  ? -12.933 -11.219 50.250 1.00 0.18 ? 46  PHE A HE1    1 
ATOM 1893 H HE2    . PHE C 3 46  ? -15.249 -14.028 47.957 1.00 0.18 ? 46  PHE A HE2    1 
ATOM 1894 H HZ     . PHE C 3 46  ? -14.465 -13.174 50.153 1.00 0.18 ? 46  PHE A HZ     1 
ATOM 1895 N N      . SER C 3 47  ? -12.325 -7.855  44.423 1.00 0.19 ? 47  SER A N      1 
ATOM 1896 C CA     . SER C 3 47  ? -11.732 -7.065  43.366 1.00 0.20 ? 47  SER A CA     1 
ATOM 1897 C C      . SER C 3 47  ? -10.553 -7.774  42.683 1.00 0.21 ? 47  SER A C      1 
ATOM 1898 O O      . SER C 3 47  ? -9.947  -8.711  43.235 1.00 0.20 ? 47  SER A O      1 
ATOM 1899 C CB     . SER C 3 47  ? -11.242 -5.741  43.950 1.00 0.21 ? 47  SER A CB     1 
ATOM 1900 O OG     . SER C 3 47  ? -10.183 -5.994  44.863 1.00 0.20 ? 47  SER A OG     1 
ATOM 1901 H H      . SER C 3 47  ? -12.080 -7.688  45.356 1.00 0.19 ? 47  SER A H      1 
ATOM 1902 H HA     . SER C 3 47  ? -12.485 -6.852  42.626 1.00 0.21 ? 47  SER A HA     1 
ATOM 1903 H HB2    . SER C 3 47  ? -10.885 -5.105  43.158 1.00 0.22 ? 47  SER A HB2    1 
ATOM 1904 H HB3    . SER C 3 47  ? -12.060 -5.251  44.461 1.00 0.20 ? 47  SER A HB3    1 
ATOM 1905 H HG     . SER C 3 47  ? -10.051 -5.204  45.391 1.00 0.21 ? 47  SER A HG     1 
ATOM 1906 N N      . GLN C 3 48  ? -10.187 -7.280  41.522 1.00 0.22 ? 48  GLN A N      1 
ATOM 1907 C CA     . GLN C 3 48  ? -8.991  -7.819  40.803 1.00 0.23 ? 48  GLN A CA     1 
ATOM 1908 C C      . GLN C 3 48  ? -7.773  -7.667  41.747 1.00 0.22 ? 48  GLN A C      1 
ATOM 1909 O O      . GLN C 3 48  ? -6.869  -8.570  41.835 1.00 0.23 ? 48  GLN A O      1 
ATOM 1910 C CB     . GLN C 3 48  ? -8.780  -6.986  39.496 1.00 0.24 ? 48  GLN A CB     1 
ATOM 1911 C CG     . GLN C 3 48  ? -7.401  -7.233  38.811 1.00 0.23 ? 48  GLN A CG     1 
ATOM 1912 C CD     . GLN C 3 48  ? -6.352  -6.191  39.201 1.00 0.25 ? 48  GLN A CD     1 
ATOM 1913 O OE1    . GLN C 3 48  ? -6.669  -5.116  39.666 1.00 0.26 ? 48  GLN A OE1    1 
ATOM 1914 N NE2    . GLN C 3 48  ? -5.088  -6.486  39.010 1.00 0.33 ? 48  GLN A NE2    1 
ATOM 1915 H H      . GLN C 3 48  ? -10.663 -6.506  41.155 1.00 0.22 ? 48  GLN A H      1 
ATOM 1916 H HA     . GLN C 3 48  ? -9.147  -8.868  40.587 1.00 0.22 ? 48  GLN A HA     1 
ATOM 1917 H HB2    . GLN C 3 48  ? -9.559  -7.247  38.795 1.00 0.26 ? 48  GLN A HB2    1 
ATOM 1918 H HB3    . GLN C 3 48  ? -8.870  -5.935  39.731 1.00 0.26 ? 48  GLN A HB3    1 
ATOM 1919 H HG2    . GLN C 3 48  ? -7.026  -8.171  39.079 1.00 0.24 ? 48  GLN A HG2    1 
ATOM 1920 H HG3    . GLN C 3 48  ? -7.527  -7.207  37.740 1.00 0.26 ? 48  GLN A HG3    1 
ATOM 1921 H HE21   . GLN C 3 48  ? -4.842  -7.357  38.626 1.00 0.39 ? 48  GLN A HE21   1 
ATOM 1922 H HE22   . GLN C 3 48  ? -4.389  -5.842  39.245 1.00 0.37 ? 48  GLN A HE22   1 
ATOM 1923 N N      . THR C 3 49  ? -7.727  -6.527  42.444 1.00 0.23 ? 49  THR A N      1 
ATOM 1924 C CA     . THR C 3 49  ? -6.599  -6.284  43.393 1.00 0.23 ? 49  THR A CA     1 
ATOM 1925 C C      . THR C 3 49  ? -6.456  -7.396  44.437 1.00 0.22 ? 49  THR A C      1 
ATOM 1926 O O      . THR C 3 49  ? -5.353  -7.913  44.702 1.00 0.22 ? 49  THR A O      1 
ATOM 1927 C CB     . THR C 3 49  ? -6.840  -4.954  44.111 1.00 0.23 ? 49  THR A CB     1 
ATOM 1928 O OG1    . THR C 3 49  ? -6.832  -3.896  43.162 1.00 0.31 ? 49  THR A OG1    1 
ATOM 1929 C CG2    . THR C 3 49  ? -5.745  -4.727  45.148 1.00 0.29 ? 49  THR A CG2    1 
ATOM 1930 H H      . THR C 3 49  ? -8.435  -5.858  42.338 1.00 0.23 ? 49  THR A H      1 
ATOM 1931 H HA     . THR C 3 49  ? -5.681  -6.216  42.830 1.00 0.24 ? 49  THR A HA     1 
ATOM 1932 H HB     . THR C 3 49  ? -7.799  -4.984  44.608 1.00 0.24 ? 49  THR A HB     1 
ATOM 1933 H HG1    . THR C 3 49  ? -7.283  -4.201  42.372 1.00 0.96 ? 49  THR A HG1    1 
ATOM 1934 H HG21   . THR C 3 49  ? -4.797  -4.995  44.720 1.00 1.09 ? 49  THR A HG21   1 
ATOM 1935 H HG22   . THR C 3 49  ? -5.936  -5.344  46.014 1.00 1.08 ? 49  THR A HG22   1 
ATOM 1936 H HG23   . THR C 3 49  ? -5.732  -3.688  45.440 1.00 1.03 ? 49  THR A HG23   1 
ATOM 1937 N N      . THR C 3 50  ? -7.557  -7.797  45.029 1.00 0.21 ? 50  THR A N      1 
ATOM 1938 C CA     . THR C 3 50  ? -7.496  -8.842  46.064 1.00 0.20 ? 50  THR A CA     1 
ATOM 1939 C C      . THR C 3 50  ? -7.081  -10.180 45.469 1.00 0.20 ? 50  THR A C      1 
ATOM 1940 O O      . THR C 3 50  ? -6.325  -10.936 46.114 1.00 0.20 ? 50  THR A O      1 
ATOM 1941 C CB     . THR C 3 50  ? -8.872  -8.988  46.727 1.00 0.19 ? 50  THR A CB     1 
ATOM 1942 O OG1    . THR C 3 50  ? -9.347  -7.702  47.095 1.00 0.23 ? 50  THR A OG1    1 
ATOM 1943 C CG2    . THR C 3 50  ? -8.774  -9.875  47.987 1.00 0.23 ? 50  THR A CG2    1 
ATOM 1944 H H      . THR C 3 50  ? -8.417  -7.388  44.794 1.00 0.21 ? 50  THR A H      1 
ATOM 1945 H HA     . THR C 3 50  ? -6.778  -8.552  46.816 1.00 0.20 ? 50  THR A HA     1 
ATOM 1946 H HB     . THR C 3 50  ? -9.561  -9.436  46.024 1.00 0.20 ? 50  THR A HB     1 
ATOM 1947 H HG1    . THR C 3 50  ? -9.743  -7.770  47.967 1.00 0.93 ? 50  THR A HG1    1 
ATOM 1948 H HG21   . THR C 3 50  ? -9.577  -10.599 47.988 1.00 1.05 ? 50  THR A HG21   1 
ATOM 1949 H HG22   . THR C 3 50  ? -8.856  -9.255  48.868 1.00 1.06 ? 50  THR A HG22   1 
ATOM 1950 H HG23   . THR C 3 50  ? -7.825  -10.396 48.006 1.00 1.03 ? 50  THR A HG23   1 
ATOM 1951 N N      . ILE C 3 51  ? -7.596  -10.491 44.286 1.00 0.20 ? 51  ILE A N      1 
ATOM 1952 C CA     . ILE C 3 51  ? -7.232  -11.777 43.634 1.00 0.20 ? 51  ILE A CA     1 
ATOM 1953 C C      . ILE C 3 51  ? -5.709  -11.734 43.324 1.00 0.21 ? 51  ILE A C      1 
ATOM 1954 O O      . ILE C 3 51  ? -4.985  -12.713 43.557 1.00 0.21 ? 51  ILE A O      1 
ATOM 1955 C CB     . ILE C 3 51  ? -8.019  -11.940 42.332 1.00 0.20 ? 51  ILE A CB     1 
ATOM 1956 C CG1    . ILE C 3 51  ? -9.516  -11.986 42.645 1.00 0.20 ? 51  ILE A CG1    1 
ATOM 1957 C CG2    . ILE C 3 51  ? -7.604  -13.242 41.644 1.00 0.21 ? 51  ILE A CG2    1 
ATOM 1958 C CD1    . ILE C 3 51  ? -9.787  -13.065 43.695 1.00 0.19 ? 51  ILE A CD1    1 
ATOM 1959 H H      . ILE C 3 51  ? -8.211  -9.873  43.842 1.00 0.20 ? 51  ILE A H      1 
ATOM 1960 H HA     . ILE C 3 51  ? -7.445  -12.600 44.302 1.00 0.19 ? 51  ILE A HA     1 
ATOM 1961 H HB     . ILE C 3 51  ? -7.810  -11.106 41.680 1.00 0.21 ? 51  ILE A HB     1 
ATOM 1962 H HG12   . ILE C 3 51  ? -9.834  -11.025 43.026 1.00 0.19 ? 51  ILE A HG12   1 
ATOM 1963 H HG13   . ILE C 3 51  ? -10.066 -12.216 41.744 1.00 0.20 ? 51  ILE A HG13   1 
ATOM 1964 H HG21   . ILE C 3 51  ? -7.550  -14.035 42.375 1.00 0.20 ? 51  ILE A HG21   1 
ATOM 1965 H HG22   . ILE C 3 51  ? -6.637  -13.112 41.182 1.00 0.22 ? 51  ILE A HG22   1 
ATOM 1966 H HG23   . ILE C 3 51  ? -8.332  -13.498 40.888 1.00 0.21 ? 51  ILE A HG23   1 
ATOM 1967 H HD11   . ILE C 3 51  ? -9.167  -13.926 43.495 1.00 0.19 ? 51  ILE A HD11   1 
ATOM 1968 H HD12   . ILE C 3 51  ? -10.828 -13.354 43.652 1.00 0.18 ? 51  ILE A HD12   1 
ATOM 1969 H HD13   . ILE C 3 51  ? -9.562  -12.677 44.676 1.00 0.18 ? 51  ILE A HD13   1 
ATOM 1970 N N      . SER C 3 52  ? -5.220  -10.601 42.801 1.00 0.22 ? 52  SER A N      1 
ATOM 1971 C CA     . SER C 3 52  ? -3.771  -10.446 42.526 1.00 0.23 ? 52  SER A CA     1 
ATOM 1972 C C      . SER C 3 52  ? -2.965  -10.626 43.825 1.00 0.23 ? 52  SER A C      1 
ATOM 1973 O O      . SER C 3 52  ? -1.958  -11.399 43.824 1.00 0.24 ? 52  SER A O      1 
ATOM 1974 C CB     . SER C 3 52  ? -3.447  -9.041  41.975 1.00 0.25 ? 52  SER A CB     1 
ATOM 1975 O OG     . SER C 3 52  ? -3.544  -9.052  40.555 1.00 1.02 ? 52  SER A OG     1 
ATOM 1976 H H      . SER C 3 52  ? -5.827  -9.848  42.631 1.00 0.22 ? 52  SER A H      1 
ATOM 1977 H HA     . SER C 3 52  ? -3.461  -11.188 41.806 1.00 0.24 ? 52  SER A HA     1 
ATOM 1978 H HB2    . SER C 3 52  ? -4.149  -8.325  42.374 1.00 0.68 ? 52  SER A HB2    1 
ATOM 1979 H HB3    . SER C 3 52  ? -2.449  -8.744  42.269 1.00 0.70 ? 52  SER A HB3    1 
ATOM 1980 H HG     . SER C 3 52  ? -2.684  -8.815  40.197 1.00 1.46 ? 52  SER A HG     1 
ATOM 1981 N N      . ARG C 3 53  ? -3.378  -9.982  44.933 1.00 0.23 ? 53  ARG A N      1 
ATOM 1982 C CA     . ARG C 3 53  ? -2.619  -10.108 46.196 1.00 0.23 ? 53  ARG A CA     1 
ATOM 1983 C C      . ARG C 3 53  ? -2.648  -11.556 46.732 1.00 0.22 ? 53  ARG A C      1 
ATOM 1984 O O      . ARG C 3 53  ? -1.662  -12.110 47.257 1.00 0.23 ? 53  ARG A O      1 
ATOM 1985 C CB     . ARG C 3 53  ? -3.252  -9.150  47.203 1.00 0.22 ? 53  ARG A CB     1 
ATOM 1986 C CG     . ARG C 3 53  ? -2.987  -7.700  46.793 1.00 0.23 ? 53  ARG A CG     1 
ATOM 1987 C CD     . ARG C 3 53  ? -3.724  -6.769  47.759 1.00 0.22 ? 53  ARG A CD     1 
ATOM 1988 N NE     . ARG C 3 53  ? -3.480  -5.352  47.375 1.00 0.22 ? 53  ARG A NE     1 
ATOM 1989 C CZ     . ARG C 3 53  ? -4.241  -4.402  47.851 1.00 0.22 ? 53  ARG A CZ     1 
ATOM 1990 N NH1    . ARG C 3 53  ? -5.242  -4.691  48.641 1.00 0.22 ? 53  ARG A NH1    1 
ATOM 1991 N NH2    . ARG C 3 53  ? -4.003  -3.162  47.528 1.00 0.23 ? 53  ARG A NH2    1 
ATOM 1992 H H      . ARG C 3 53  ? -4.177  -9.418  44.900 1.00 0.22 ? 53  ARG A H      1 
ATOM 1993 H HA     . ARG C 3 53  ? -1.594  -9.820  46.018 1.00 0.24 ? 53  ARG A HA     1 
ATOM 1994 H HB2    . ARG C 3 53  ? -4.315  -9.324  47.252 1.00 0.21 ? 53  ARG A HB2    1 
ATOM 1995 H HB3    . ARG C 3 53  ? -2.822  -9.312  48.158 1.00 0.22 ? 53  ARG A HB3    1 
ATOM 1996 H HG2    . ARG C 3 53  ? -1.925  -7.499  46.836 1.00 0.23 ? 53  ARG A HG2    1 
ATOM 1997 H HG3    . ARG C 3 53  ? -3.344  -7.535  45.791 1.00 0.23 ? 53  ARG A HG3    1 
ATOM 1998 H HD2    . ARG C 3 53  ? -4.783  -6.977  47.718 1.00 0.21 ? 53  ARG A HD2    1 
ATOM 1999 H HD3    . ARG C 3 53  ? -3.363  -6.934  48.762 1.00 0.22 ? 53  ARG A HD3    1 
ATOM 2000 H HE     . ARG C 3 53  ? -2.742  -5.130  46.771 1.00 0.23 ? 53  ARG A HE     1 
ATOM 2001 H HH11   . ARG C 3 53  ? -5.430  -5.642  48.884 1.00 0.23 ? 53  ARG A HH11   1 
ATOM 2002 H HH12   . ARG C 3 53  ? -5.821  -3.959  49.001 1.00 0.23 ? 53  ARG A HH12   1 
ATOM 2003 H HH21   . ARG C 3 53  ? -3.242  -2.942  46.918 1.00 0.24 ? 53  ARG A HH21   1 
ATOM 2004 H HH22   . ARG C 3 53  ? -4.583  -2.431  47.888 1.00 0.23 ? 53  ARG A HH22   1 
ATOM 2005 N N      . PHE C 3 54  ? -3.819  -12.159 46.634 1.00 0.21 ? 54  PHE A N      1 
ATOM 2006 C CA     . PHE C 3 54  ? -3.910  -13.519 47.077 1.00 0.20 ? 54  PHE A CA     1 
ATOM 2007 C C      . PHE C 3 54  ? -2.931  -14.419 46.295 1.00 0.21 ? 54  PHE A C      1 
ATOM 2008 O O      . PHE C 3 54  ? -2.166  -15.150 46.918 1.00 0.22 ? 54  PHE A O      1 
ATOM 2009 C CB     . PHE C 3 54  ? -5.342  -14.018 46.868 1.00 0.19 ? 54  PHE A CB     1 
ATOM 2010 C CG     . PHE C 3 54  ? -5.482  -15.411 47.431 1.00 0.19 ? 54  PHE A CG     1 
ATOM 2011 C CD1    . PHE C 3 54  ? -5.862  -15.592 48.767 1.00 0.19 ? 54  PHE A CD1    1 
ATOM 2012 C CD2    . PHE C 3 54  ? -5.234  -16.522 46.618 1.00 0.19 ? 54  PHE A CD2    1 
ATOM 2013 C CE1    . PHE C 3 54  ? -5.993  -16.884 49.289 1.00 0.19 ? 54  PHE A CE1    1 
ATOM 2014 C CE2    . PHE C 3 54  ? -5.367  -17.814 47.139 1.00 0.19 ? 54  PHE A CE2    1 
ATOM 2015 C CZ     . PHE C 3 54  ? -5.746  -17.995 48.475 1.00 0.19 ? 54  PHE A CZ     1 
ATOM 2016 H H      . PHE C 3 54  ? -4.594  -11.700 46.245 1.00 0.21 ? 54  PHE A H      1 
ATOM 2017 H HA     . PHE C 3 54  ? -3.674  -13.567 48.129 1.00 0.20 ? 54  PHE A HA     1 
ATOM 2018 H HB2    . PHE C 3 54  ? -6.031  -13.356 47.371 1.00 0.19 ? 54  PHE A HB2    1 
ATOM 2019 H HB3    . PHE C 3 54  ? -5.567  -14.034 45.811 1.00 0.20 ? 54  PHE A HB3    1 
ATOM 2020 H HD1    . PHE C 3 54  ? -6.052  -14.733 49.395 1.00 0.19 ? 54  PHE A HD1    1 
ATOM 2021 H HD2    . PHE C 3 54  ? -4.940  -16.382 45.588 1.00 0.20 ? 54  PHE A HD2    1 
ATOM 2022 H HE1    . PHE C 3 54  ? -6.286  -17.022 50.318 1.00 0.19 ? 54  PHE A HE1    1 
ATOM 2023 H HE2    . PHE C 3 54  ? -5.175  -18.672 46.511 1.00 0.19 ? 54  PHE A HE2    1 
ATOM 2024 H HZ     . PHE C 3 54  ? -5.848  -18.992 48.876 1.00 0.19 ? 54  PHE A HZ     1 
ATOM 2025 N N      . GLU C 3 55  ? -2.948  -14.348 44.960 1.00 0.22 ? 55  GLU A N      1 
ATOM 2026 C CA     . GLU C 3 55  ? -2.094  -15.207 44.108 1.00 0.23 ? 55  GLU A CA     1 
ATOM 2027 C C      . GLU C 3 55  ? -0.605  -14.993 44.316 1.00 0.24 ? 55  GLU A C      1 
ATOM 2028 O O      . GLU C 3 55  ? 0.205   -15.896 44.062 1.00 0.24 ? 55  GLU A O      1 
ATOM 2029 C CB     . GLU C 3 55  ? -2.428  -14.937 42.641 1.00 0.23 ? 55  GLU A CB     1 
ATOM 2030 C CG     . GLU C 3 55  ? -3.813  -15.502 42.319 1.00 0.22 ? 55  GLU A CG     1 
ATOM 2031 C CD     . GLU C 3 55  ? -4.023  -15.509 40.804 1.00 0.23 ? 55  GLU A CD     1 
ATOM 2032 O OE1    . GLU C 3 55  ? -3.278  -14.827 40.119 1.00 0.24 ? 55  GLU A OE1    1 
ATOM 2033 O OE2    . GLU C 3 55  ? -4.926  -16.194 40.353 1.00 0.23 ? 55  GLU A OE2    1 
ATOM 2034 H H      . GLU C 3 55  ? -3.576  -13.731 44.528 1.00 0.21 ? 55  GLU A H      1 
ATOM 2035 H HA     . GLU C 3 55  ? -2.325  -16.238 44.321 1.00 0.22 ? 55  GLU A HA     1 
ATOM 2036 H HB2    . GLU C 3 55  ? -2.422  -13.873 42.460 1.00 0.23 ? 55  GLU A HB2    1 
ATOM 2037 H HB3    . GLU C 3 55  ? -1.693  -15.415 42.010 1.00 0.24 ? 55  GLU A HB3    1 
ATOM 2038 H HG2    . GLU C 3 55  ? -3.887  -16.513 42.698 1.00 0.22 ? 55  GLU A HG2    1 
ATOM 2039 H HG3    . GLU C 3 55  ? -4.569  -14.888 42.783 1.00 0.21 ? 55  GLU A HG3    1 
ATOM 2040 N N      . ALA C 3 56  ? -0.251  -13.808 44.790 1.00 0.24 ? 56  ALA A N      1 
ATOM 2041 C CA     . ALA C 3 56  ? 1.152   -13.466 45.082 1.00 0.25 ? 56  ALA A CA     1 
ATOM 2042 C C      . ALA C 3 56  ? 1.533   -13.604 46.569 1.00 0.25 ? 56  ALA A C      1 
ATOM 2043 O O      . ALA C 3 56  ? 2.726   -13.378 46.953 1.00 0.27 ? 56  ALA A O      1 
ATOM 2044 C CB     . ALA C 3 56  ? 1.409   -12.025 44.635 1.00 0.26 ? 56  ALA A CB     1 
ATOM 2045 H H      . ALA C 3 56  ? -0.949  -13.145 44.977 1.00 0.24 ? 56  ALA A H      1 
ATOM 2046 H HA     . ALA C 3 56  ? 1.790   -14.116 44.506 1.00 0.26 ? 56  ALA A HA     1 
ATOM 2047 H HB1    . ALA C 3 56  ? 1.426   -11.981 43.556 1.00 1.05 ? 56  ALA A HB1    1 
ATOM 2048 H HB2    . ALA C 3 56  ? 2.359   -11.689 45.023 1.00 1.07 ? 56  ALA A HB2    1 
ATOM 2049 H HB3    . ALA C 3 56  ? 0.621   -11.387 45.008 1.00 1.02 ? 56  ALA A HB3    1 
ATOM 2050 N N      . LEU C 3 57  ? 0.552   -13.975 47.386 1.00 0.24 ? 57  LEU A N      1 
ATOM 2051 C CA     . LEU C 3 57  ? 0.619   -14.008 48.841 1.00 0.24 ? 57  LEU A CA     1 
ATOM 2052 C C      . LEU C 3 57  ? 1.054   -12.612 49.379 1.00 0.25 ? 57  LEU A C      1 
ATOM 2053 O O      . LEU C 3 57  ? 1.825   -12.507 50.370 1.00 0.26 ? 57  LEU A O      1 
ATOM 2054 C CB     . LEU C 3 57  ? 1.633   -15.064 49.281 1.00 0.25 ? 57  LEU A CB     1 
ATOM 2055 C CG     . LEU C 3 57  ? 1.008   -16.454 49.159 1.00 0.24 ? 57  LEU A CG     1 
ATOM 2056 C CD1    . LEU C 3 57  ? 1.515   -17.133 47.885 1.00 0.24 ? 57  LEU A CD1    1 
ATOM 2057 C CD2    . LEU C 3 57  ? 1.400   -17.297 50.375 1.00 0.24 ? 57  LEU A CD2    1 
ATOM 2058 H H      . LEU C 3 57  ? -0.325  -14.133 46.981 1.00 0.23 ? 57  LEU A H      1 
ATOM 2059 H HA     . LEU C 3 57  ? -0.354  -14.257 49.239 1.00 0.23 ? 57  LEU A HA     1 
ATOM 2060 H HB2    . LEU C 3 57  ? 2.510   -15.005 48.651 1.00 0.26 ? 57  LEU A HB2    1 
ATOM 2061 H HB3    . LEU C 3 57  ? 1.916   -14.887 50.308 1.00 0.25 ? 57  LEU A HB3    1 
ATOM 2062 H HG     . LEU C 3 57  ? -0.067  -16.362 49.114 1.00 0.23 ? 57  LEU A HG     1 
ATOM 2063 H HD11   . LEU C 3 57  ? 2.592   -17.195 47.916 1.00 0.26 ? 57  LEU A HD11   1 
ATOM 2064 H HD12   . LEU C 3 57  ? 1.212   -16.556 47.025 1.00 0.24 ? 57  LEU A HD12   1 
ATOM 2065 H HD13   . LEU C 3 57  ? 1.098   -18.127 47.817 1.00 0.24 ? 57  LEU A HD13   1 
ATOM 2066 H HD21   . LEU C 3 57  ? 0.945   -16.883 51.262 1.00 0.24 ? 57  LEU A HD21   1 
ATOM 2067 H HD22   . LEU C 3 57  ? 2.473   -17.294 50.485 1.00 0.25 ? 57  LEU A HD22   1 
ATOM 2068 H HD23   . LEU C 3 57  ? 1.057   -18.313 50.235 1.00 0.24 ? 57  LEU A HD23   1 
ATOM 2069 N N      . ASN C 3 58  ? 0.634   -11.553 48.681 1.00 0.25 ? 58  ASN A N      1 
ATOM 2070 C CA     . ASN C 3 58  ? 0.908   -10.160 49.180 1.00 0.26 ? 58  ASN A CA     1 
ATOM 2071 C C      . ASN C 3 58  ? -0.172  -9.754  50.193 1.00 0.25 ? 58  ASN A C      1 
ATOM 2072 O O      . ASN C 3 58  ? -0.771  -8.669  50.072 1.00 0.25 ? 58  ASN A O      1 
ATOM 2073 C CB     . ASN C 3 58  ? 0.907   -9.173  48.013 1.00 0.26 ? 58  ASN A CB     1 
ATOM 2074 C CG     . ASN C 3 58  ? 2.080   -9.481  47.080 1.00 0.28 ? 58  ASN A CG     1 
ATOM 2075 O OD1    . ASN C 3 58  ? 3.111   -9.952  47.518 1.00 0.29 ? 58  ASN A OD1    1 
ATOM 2076 N ND2    . ASN C 3 58  ? 1.967   -9.232  45.805 1.00 0.33 ? 58  ASN A ND2    1 
ATOM 2077 H H      . ASN C 3 58  ? 0.084   -11.685 47.879 1.00 0.24 ? 58  ASN A H      1 
ATOM 2078 H HA     . ASN C 3 58  ? 1.876   -10.134 49.659 1.00 0.26 ? 58  ASN A HA     1 
ATOM 2079 H HB2    . ASN C 3 58  ? -0.016  -9.257  47.474 1.00 0.25 ? 58  ASN A HB2    1 
ATOM 2080 H HB3    . ASN C 3 58  ? 1.009   -8.168  48.393 1.00 0.27 ? 58  ASN A HB3    1 
ATOM 2081 H HD21   . ASN C 3 58  ? 1.135   -8.851  45.452 1.00 0.37 ? 58  ASN A HD21   1 
ATOM 2082 H HD22   . ASN C 3 58  ? 2.713   -9.425  45.199 1.00 0.35 ? 58  ASN A HD22   1 
ATOM 2083 N N      . LEU C 3 59  ? -0.429  -10.615 51.181 1.00 0.24 ? 59  LEU A N      1 
ATOM 2084 C CA     . LEU C 3 59  ? -1.375  -10.395 52.223 1.00 0.23 ? 59  LEU A CA     1 
ATOM 2085 C C      . LEU C 3 59  ? -0.795  -11.085 53.458 1.00 0.24 ? 59  LEU A C      1 
ATOM 2086 O O      . LEU C 3 59  ? 0.101   -11.925 53.341 1.00 0.25 ? 59  LEU A O      1 
ATOM 2087 C CB     . LEU C 3 59  ? -2.723  -11.018 51.853 1.00 0.22 ? 59  LEU A CB     1 
ATOM 2088 C CG     . LEU C 3 59  ? -3.319  -10.280 50.654 1.00 0.22 ? 59  LEU A CG     1 
ATOM 2089 C CD1    . LEU C 3 59  ? -4.615  -10.968 50.224 1.00 0.20 ? 59  LEU A CD1    1 
ATOM 2090 C CD2    . LEU C 3 59  ? -3.618  -8.831  51.045 1.00 0.22 ? 59  LEU A CD2    1 
ATOM 2091 H H      . LEU C 3 59  ? 0.085   -11.450 51.202 1.00 0.24 ? 59  LEU A H      1 
ATOM 2092 H HA     . LEU C 3 59  ? -1.490  -9.336  52.406 1.00 0.24 ? 59  LEU A HA     1 
ATOM 2093 H HB2    . LEU C 3 59  ? -2.580  -12.060 51.602 1.00 0.22 ? 59  LEU A HB2    1 
ATOM 2094 H HB3    . LEU C 3 59  ? -3.398  -10.940 52.693 1.00 0.22 ? 59  LEU A HB3    1 
ATOM 2095 H HG     . LEU C 3 59  ? -2.614  -10.296 49.835 1.00 0.22 ? 59  LEU A HG     1 
ATOM 2096 H HD11   . LEU C 3 59  ? -4.410  -11.998 49.971 1.00 0.20 ? 59  LEU A HD11   1 
ATOM 2097 H HD12   . LEU C 3 59  ? -5.024  -10.461 49.362 1.00 0.20 ? 59  LEU A HD12   1 
ATOM 2098 H HD13   . LEU C 3 59  ? -5.328  -10.932 51.035 1.00 0.20 ? 59  LEU A HD13   1 
ATOM 2099 H HD21   . LEU C 3 59  ? -4.075  -8.811  52.025 1.00 0.22 ? 59  LEU A HD21   1 
ATOM 2100 H HD22   . LEU C 3 59  ? -4.294  -8.395  50.324 1.00 0.22 ? 59  LEU A HD22   1 
ATOM 2101 H HD23   . LEU C 3 59  ? -2.699  -8.266  51.065 1.00 0.23 ? 59  LEU A HD23   1 
ATOM 2102 N N      . SER C 3 60  ? -1.337  -10.769 54.612 1.00 0.24 ? 60  SER A N      1 
ATOM 2103 C CA     . SER C 3 60  ? -0.881  -11.424 55.833 1.00 0.25 ? 60  SER A CA     1 
ATOM 2104 C C      . SER C 3 60  ? -1.370  -12.879 55.837 1.00 0.24 ? 60  SER A C      1 
ATOM 2105 O O      . SER C 3 60  ? -2.275  -13.258 55.089 1.00 0.23 ? 60  SER A O      1 
ATOM 2106 C CB     . SER C 3 60  ? -1.446  -10.690 57.050 1.00 0.25 ? 60  SER A CB     1 
ATOM 2107 O OG     . SER C 3 60  ? -2.844  -10.934 57.137 1.00 0.24 ? 60  SER A OG     1 
ATOM 2108 H H      . SER C 3 60  ? -2.070  -10.122 54.648 1.00 0.24 ? 60  SER A H      1 
ATOM 2109 H HA     . SER C 3 60  ? 0.199   -11.406 55.871 1.00 0.26 ? 60  SER A HA     1 
ATOM 2110 H HB2    . SER C 3 60  ? -0.965  -11.050 57.946 1.00 0.26 ? 60  SER A HB2    1 
ATOM 2111 H HB3    . SER C 3 60  ? -1.262  -9.628  56.945 1.00 0.26 ? 60  SER A HB3    1 
ATOM 2112 H HG     . SER C 3 60  ? -3.186  -11.010 56.245 1.00 0.23 ? 60  SER A HG     1 
ATOM 2113 N N      . PHE C 3 61  ? -0.756  -13.708 56.667 1.00 0.25 ? 61  PHE A N      1 
ATOM 2114 C CA     . PHE C 3 61  ? -1.202  -15.099 56.772 1.00 0.24 ? 61  PHE A CA     1 
ATOM 2115 C C      . PHE C 3 61  ? -2.635  -15.082 57.327 1.00 0.24 ? 61  PHE A C      1 
ATOM 2116 O O      . PHE C 3 61  ? -3.466  -15.871 56.936 1.00 0.23 ? 61  PHE A O      1 
ATOM 2117 C CB     . PHE C 3 61  ? -0.273  -15.855 57.726 1.00 0.26 ? 61  PHE A CB     1 
ATOM 2118 C CG     . PHE C 3 61  ? -0.869  -17.198 58.057 1.00 0.26 ? 61  PHE A CG     1 
ATOM 2119 C CD1    . PHE C 3 61  ? -0.802  -18.240 57.127 1.00 0.25 ? 61  PHE A CD1    1 
ATOM 2120 C CD2    . PHE C 3 61  ? -1.492  -17.398 59.292 1.00 0.26 ? 61  PHE A CD2    1 
ATOM 2121 C CE1    . PHE C 3 61  ? -1.353  -19.488 57.436 1.00 0.25 ? 61  PHE A CE1    1 
ATOM 2122 C CE2    . PHE C 3 61  ? -2.046  -18.644 59.601 1.00 0.26 ? 61  PHE A CE2    1 
ATOM 2123 C CZ     . PHE C 3 61  ? -1.977  -19.690 58.672 1.00 0.26 ? 61  PHE A CZ     1 
ATOM 2124 H H      . PHE C 3 61  ? -0.029  -13.382 57.240 1.00 0.26 ? 61  PHE A H      1 
ATOM 2125 H HA     . PHE C 3 61  ? -1.189  -15.565 55.797 1.00 0.24 ? 61  PHE A HA     1 
ATOM 2126 H HB2    . PHE C 3 61  ? 0.690   -15.997 57.257 1.00 0.26 ? 61  PHE A HB2    1 
ATOM 2127 H HB3    . PHE C 3 61  ? -0.147  -15.287 58.636 1.00 0.26 ? 61  PHE A HB3    1 
ATOM 2128 H HD1    . PHE C 3 61  ? -0.320  -18.082 56.173 1.00 0.25 ? 61  PHE A HD1    1 
ATOM 2129 H HD2    . PHE C 3 61  ? -1.545  -16.590 60.008 1.00 0.26 ? 61  PHE A HD2    1 
ATOM 2130 H HE1    . PHE C 3 61  ? -1.302  -20.294 56.719 1.00 0.25 ? 61  PHE A HE1    1 
ATOM 2131 H HE2    . PHE C 3 61  ? -2.527  -18.800 60.556 1.00 0.27 ? 61  PHE A HE2    1 
ATOM 2132 H HZ     . PHE C 3 61  ? -2.403  -20.653 58.912 1.00 0.26 ? 61  PHE A HZ     1 
ATOM 2133 N N      . LYS C 3 62  ? -2.929  -14.152 58.232 1.00 0.24 ? 62  LYS A N      1 
ATOM 2134 C CA     . LYS C 3 62  ? -4.268  -14.042 58.762 1.00 0.24 ? 62  LYS A CA     1 
ATOM 2135 C C      . LYS C 3 62  ? -5.330  -13.801 57.638 1.00 0.22 ? 62  LYS A C      1 
ATOM 2136 O O      . LYS C 3 62  ? -6.389  -14.462 57.579 1.00 0.22 ? 62  LYS A O      1 
ATOM 2137 C CB     . LYS C 3 62  ? -4.317  -12.880 59.756 1.00 0.25 ? 62  LYS A CB     1 
ATOM 2138 C CG     . LYS C 3 62  ? -5.675  -12.876 60.461 1.00 0.28 ? 62  LYS A CG     1 
ATOM 2139 C CD     . LYS C 3 62  ? -5.701  -11.788 61.543 1.00 0.31 ? 62  LYS A CD     1 
ATOM 2140 C CE     . LYS C 3 62  ? -5.912  -10.412 60.905 1.00 0.34 ? 62  LYS A CE     1 
ATOM 2141 N NZ     . LYS C 3 62  ? -6.221  -9.417  61.969 1.00 0.41 ? 62  LYS A NZ     1 
ATOM 2142 H H      . LYS C 3 62  ? -2.242  -13.515 58.518 1.00 0.25 ? 62  LYS A H      1 
ATOM 2143 H HA     . LYS C 3 62  ? -4.514  -14.953 59.285 1.00 0.24 ? 62  LYS A HA     1 
ATOM 2144 H HB2    . LYS C 3 62  ? -3.530  -12.998 60.487 1.00 0.28 ? 62  LYS A HB2    1 
ATOM 2145 H HB3    . LYS C 3 62  ? -4.183  -11.950 59.228 1.00 0.27 ? 62  LYS A HB3    1 
ATOM 2146 H HG2    . LYS C 3 62  ? -6.455  -12.691 59.738 1.00 0.31 ? 62  LYS A HG2    1 
ATOM 2147 H HG3    . LYS C 3 62  ? -5.839  -13.838 60.923 1.00 0.31 ? 62  LYS A HG3    1 
ATOM 2148 H HD2    . LYS C 3 62  ? -6.508  -11.989 62.232 1.00 0.37 ? 62  LYS A HD2    1 
ATOM 2149 H HD3    . LYS C 3 62  ? -4.764  -11.792 62.080 1.00 0.31 ? 62  LYS A HD3    1 
ATOM 2150 H HE2    . LYS C 3 62  ? -5.017  -10.112 60.382 1.00 0.33 ? 62  LYS A HE2    1 
ATOM 2151 H HE3    . LYS C 3 62  ? -6.738  -10.458 60.212 1.00 0.40 ? 62  LYS A HE3    1 
ATOM 2152 H HZ1    . LYS C 3 62  ? -6.284  -9.899  62.888 1.00 1.07 ? 62  LYS A HZ1    1 
ATOM 2153 H HZ2    . LYS C 3 62  ? -7.128  -8.955  61.757 1.00 1.08 ? 62  LYS A HZ2    1 
ATOM 2154 H HZ3    . LYS C 3 62  ? -5.467  -8.702  62.007 1.00 1.05 ? 62  LYS A HZ3    1 
ATOM 2155 N N      . ASN C 3 63  ? -5.028  -12.904 56.722 1.00 0.22 ? 63  ASN A N      1 
ATOM 2156 C CA     . ASN C 3 63  ? -6.007  -12.579 55.641 1.00 0.21 ? 63  ASN A CA     1 
ATOM 2157 C C      . ASN C 3 63  ? -6.086  -13.713 54.598 1.00 0.20 ? 63  ASN A C      1 
ATOM 2158 O O      . ASN C 3 63  ? -7.174  -14.066 54.127 1.00 0.19 ? 63  ASN A O      1 
ATOM 2159 C CB     . ASN C 3 63  ? -5.587  -11.279 54.968 1.00 0.21 ? 63  ASN A CB     1 
ATOM 2160 C CG     . ASN C 3 63  ? -6.719  -10.779 54.070 1.00 0.22 ? 63  ASN A CG     1 
ATOM 2161 O OD1    . ASN C 3 63  ? -7.879  -10.951 54.385 1.00 0.32 ? 63  ASN A OD1    1 
ATOM 2162 N ND2    . ASN C 3 63  ? -6.430  -10.147 52.969 1.00 0.21 ? 63  ASN A ND2    1 
ATOM 2163 H H      . ASN C 3 63  ? -4.174  -12.427 56.765 1.00 0.23 ? 63  ASN A H      1 
ATOM 2164 H HA     . ASN C 3 63  ? -6.981  -12.434 56.082 1.00 0.21 ? 63  ASN A HA     1 
ATOM 2165 H HB2    . ASN C 3 63  ? -5.369  -10.537 55.722 1.00 0.23 ? 63  ASN A HB2    1 
ATOM 2166 H HB3    . ASN C 3 63  ? -4.712  -11.456 54.379 1.00 0.22 ? 63  ASN A HB3    1 
ATOM 2167 H HD21   . ASN C 3 63  ? -5.494  -9.995  52.722 1.00 0.28 ? 63  ASN A HD21   1 
ATOM 2168 H HD22   . ASN C 3 63  ? -7.149  -9.825  52.385 1.00 0.22 ? 63  ASN A HD22   1 
ATOM 2169 N N      . MET C 3 64  ? -4.937  -14.279 54.229 1.00 0.21 ? 64  MET A N      1 
ATOM 2170 C CA     . MET C 3 64  ? -4.896  -15.408 53.288 1.00 0.20 ? 64  MET A CA     1 
ATOM 2171 C C      . MET C 3 64  ? -5.741  -16.563 53.817 1.00 0.20 ? 64  MET A C      1 
ATOM 2172 O O      . MET C 3 64  ? -6.373  -17.269 53.015 1.00 0.19 ? 64  MET A O      1 
ATOM 2173 C CB     . MET C 3 64  ? -3.449  -15.881 53.124 1.00 0.21 ? 64  MET A CB     1 
ATOM 2174 C CG     . MET C 3 64  ? -2.655  -14.840 52.334 1.00 0.21 ? 64  MET A CG     1 
ATOM 2175 S SD     . MET C 3 64  ? -3.318  -14.721 50.655 1.00 0.21 ? 64  MET A SD     1 
ATOM 2176 C CE     . MET C 3 64  ? -2.629  -16.272 50.027 1.00 0.21 ? 64  MET A CE     1 
ATOM 2177 H H      . MET C 3 64  ? -4.098  -13.963 54.626 1.00 0.21 ? 64  MET A H      1 
ATOM 2178 H HA     . MET C 3 64  ? -5.279  -15.091 52.330 1.00 0.20 ? 64  MET A HA     1 
ATOM 2179 H HB2    . MET C 3 64  ? -3.002  -16.012 54.099 1.00 0.22 ? 64  MET A HB2    1 
ATOM 2180 H HB3    . MET C 3 64  ? -3.437  -16.822 52.593 1.00 0.21 ? 64  MET A HB3    1 
ATOM 2181 H HG2    . MET C 3 64  ? -2.733  -13.881 52.822 1.00 0.22 ? 64  MET A HG2    1 
ATOM 2182 H HG3    . MET C 3 64  ? -1.616  -15.140 52.291 1.00 0.22 ? 64  MET A HG3    1 
ATOM 2183 H HE1    . MET C 3 64  ? -1.839  -16.607 50.685 1.00 0.22 ? 64  MET A HE1    1 
ATOM 2184 H HE2    . MET C 3 64  ? -2.229  -16.116 49.038 1.00 0.21 ? 64  MET A HE2    1 
ATOM 2185 H HE3    . MET C 3 64  ? -3.410  -17.019 49.982 1.00 0.20 ? 64  MET A HE3    1 
ATOM 2186 N N      . ALA C 3 65  ? -5.701  -16.779 55.135 1.00 0.21 ? 65  ALA A N      1 
ATOM 2187 C CA     . ALA C 3 65  ? -6.437  -17.862 55.766 1.00 0.21 ? 65  ALA A CA     1 
ATOM 2188 C C      . ALA C 3 65  ? -7.940  -17.649 55.653 1.00 0.20 ? 65  ALA A C      1 
ATOM 2189 O O      . ALA C 3 65  ? -8.689  -18.605 55.451 1.00 0.20 ? 65  ALA A O      1 
ATOM 2190 C CB     . ALA C 3 65  ? -6.047  -17.948 57.242 1.00 0.22 ? 65  ALA A CB     1 
ATOM 2191 H H      . ALA C 3 65  ? -5.144  -16.195 55.692 1.00 0.21 ? 65  ALA A H      1 
ATOM 2192 H HA     . ALA C 3 65  ? -6.176  -18.792 55.285 1.00 0.21 ? 65  ALA A HA     1 
ATOM 2193 H HB1    . ALA C 3 65  ? -6.581  -18.761 57.709 1.00 0.22 ? 65  ALA A HB1    1 
ATOM 2194 H HB2    . ALA C 3 65  ? -6.299  -17.021 57.735 1.00 0.22 ? 65  ALA A HB2    1 
ATOM 2195 H HB3    . ALA C 3 65  ? -4.983  -18.120 57.323 1.00 0.23 ? 65  ALA A HB3    1 
ATOM 2196 N N      . LYS C 3 66  ? -8.390  -16.396 55.757 1.00 0.20 ? 66  LYS A N      1 
ATOM 2197 C CA     . LYS C 3 66  ? -9.812  -16.074 55.622 1.00 0.19 ? 66  LYS A CA     1 
ATOM 2198 C C      . LYS C 3 66  ? -10.228 -16.334 54.184 1.00 0.19 ? 66  LYS A C      1 
ATOM 2199 O O      . LYS C 3 66  ? -11.228 -17.002 53.930 1.00 0.18 ? 66  LYS A O      1 
ATOM 2200 C CB     . LYS C 3 66  ? -10.043 -14.601 55.967 1.00 0.19 ? 66  LYS A CB     1 
ATOM 2201 C CG     . LYS C 3 66  ? -11.540 -14.293 55.916 1.00 0.19 ? 66  LYS A CG     1 
ATOM 2202 C CD     . LYS C 3 66  ? -11.773 -12.828 56.290 1.00 0.20 ? 66  LYS A CD     1 
ATOM 2203 C CE     . LYS C 3 66  ? -13.273 -12.528 56.270 1.00 0.20 ? 66  LYS A CE     1 
ATOM 2204 N NZ     . LYS C 3 66  ? -13.502 -11.112 56.674 1.00 0.21 ? 66  LYS A NZ     1 
ATOM 2205 H H      . LYS C 3 66  ? -7.748  -15.669 55.897 1.00 0.20 ? 66  LYS A H      1 
ATOM 2206 H HA     . LYS C 3 66  ? -10.392 -16.698 56.286 1.00 0.20 ? 66  LYS A HA     1 
ATOM 2207 H HB2    . LYS C 3 66  ? -9.666  -14.401 56.959 1.00 0.20 ? 66  LYS A HB2    1 
ATOM 2208 H HB3    . LYS C 3 66  ? -9.525  -13.979 55.253 1.00 0.19 ? 66  LYS A HB3    1 
ATOM 2209 H HG2    . LYS C 3 66  ? -11.911 -14.474 54.918 1.00 0.19 ? 66  LYS A HG2    1 
ATOM 2210 H HG3    . LYS C 3 66  ? -12.063 -14.928 56.616 1.00 0.20 ? 66  LYS A HG3    1 
ATOM 2211 H HD2    . LYS C 3 66  ? -11.381 -12.643 57.280 1.00 0.20 ? 66  LYS A HD2    1 
ATOM 2212 H HD3    . LYS C 3 66  ? -11.271 -12.190 55.579 1.00 0.19 ? 66  LYS A HD3    1 
ATOM 2213 H HE2    . LYS C 3 66  ? -13.658 -12.684 55.273 1.00 0.20 ? 66  LYS A HE2    1 
ATOM 2214 H HE3    . LYS C 3 66  ? -13.781 -13.186 56.959 1.00 0.21 ? 66  LYS A HE3    1 
ATOM 2215 H HZ1    . LYS C 3 66  ? -12.691 -10.774 57.230 1.00 0.99 ? 66  LYS A HZ1    1 
ATOM 2216 H HZ2    . LYS C 3 66  ? -14.367 -11.051 57.249 1.00 0.98 ? 66  LYS A HZ2    1 
ATOM 2217 H HZ3    . LYS C 3 66  ? -13.607 -10.521 55.825 1.00 1.02 ? 66  LYS A HZ3    1 
ATOM 2218 N N      . LEU C 3 67  ? -9.473  -15.813 53.228 1.00 0.18 ? 67  LEU A N      1 
ATOM 2219 C CA     . LEU C 3 67  ? -9.792  -15.972 51.807 1.00 0.18 ? 67  LEU A CA     1 
ATOM 2220 C C      . LEU C 3 67  ? -9.695  -17.388 51.165 1.00 0.18 ? 67  LEU A C      1 
ATOM 2221 O O      . LEU C 3 67  ? -10.441 -17.722 50.218 1.00 0.17 ? 67  LEU A O      1 
ATOM 2222 C CB     . LEU C 3 67  ? -8.882  -15.022 51.017 1.00 0.18 ? 67  LEU A CB     1 
ATOM 2223 C CG     . LEU C 3 67  ? -9.229  -13.550 51.336 1.00 0.18 ? 67  LEU A CG     1 
ATOM 2224 C CD1    . LEU C 3 67  ? -8.103  -12.641 50.809 1.00 0.18 ? 67  LEU A CD1    1 
ATOM 2225 C CD2    . LEU C 3 67  ? -10.561 -13.126 50.667 1.00 0.17 ? 67  LEU A CD2    1 
ATOM 2226 H H      . LEU C 3 67  ? -8.687  -15.290 53.479 1.00 0.18 ? 67  LEU A H      1 
ATOM 2227 H HA     . LEU C 3 67  ? -10.798 -15.620 51.660 1.00 0.17 ? 67  LEU A HA     1 
ATOM 2228 H HB2    . LEU C 3 67  ? -7.852  -15.212 51.284 1.00 0.18 ? 67  LEU A HB2    1 
ATOM 2229 H HB3    . LEU C 3 67  ? -9.013  -15.195 49.959 1.00 0.17 ? 67  LEU A HB3    1 
ATOM 2230 H HG     . LEU C 3 67  ? -9.310  -13.430 52.408 1.00 0.18 ? 67  LEU A HG     1 
ATOM 2231 H HD11   . LEU C 3 67  ? -7.706  -13.048 49.889 1.00 1.02 ? 67  LEU A HD11   1 
ATOM 2232 H HD12   . LEU C 3 67  ? -7.315  -12.584 51.544 1.00 1.03 ? 67  LEU A HD12   1 
ATOM 2233 H HD13   . LEU C 3 67  ? -8.489  -11.648 50.624 1.00 1.04 ? 67  LEU A HD13   1 
ATOM 2234 H HD21   . LEU C 3 67  ? -10.377 -12.832 49.643 1.00 1.03 ? 67  LEU A HD21   1 
ATOM 2235 H HD22   . LEU C 3 67  ? -10.975 -12.289 51.207 1.00 1.02 ? 67  LEU A HD22   1 
ATOM 2236 H HD23   . LEU C 3 67  ? -11.268 -13.929 50.679 1.00 1.01 ? 67  LEU A HD23   1 
ATOM 2237 N N      . LYS C 3 68  ? -8.786  -18.221 51.666 1.00 0.18 ? 68  LYS A N      1 
ATOM 2238 C CA     . LYS C 3 68  ? -8.583  -19.497 51.002 1.00 0.18 ? 68  LYS A CA     1 
ATOM 2239 C C      . LYS C 3 68  ? -9.851  -20.341 50.920 1.00 0.18 ? 68  LYS A C      1 
ATOM 2240 O O      . LYS C 3 68  ? -10.165 -20.858 49.855 1.00 0.18 ? 68  LYS A O      1 
ATOM 2241 C CB     . LYS C 3 68  ? -7.506  -20.282 51.756 1.00 0.19 ? 68  LYS A CB     1 
ATOM 2242 C CG     . LYS C 3 68  ? -7.250  -21.612 51.045 1.00 0.19 ? 68  LYS A CG     1 
ATOM 2243 C CD     . LYS C 3 68  ? -6.067  -22.323 51.705 1.00 0.20 ? 68  LYS A CD     1 
ATOM 2244 C CE     . LYS C 3 68  ? -6.067  -23.798 51.301 1.00 0.21 ? 68  LYS A CE     1 
ATOM 2245 N NZ     . LYS C 3 68  ? -7.103  -24.529 52.086 1.00 0.21 ? 68  LYS A NZ     1 
ATOM 2246 H H      . LYS C 3 68  ? -8.207  -17.945 52.406 1.00 0.19 ? 68  LYS A H      1 
ATOM 2247 H HA     . LYS C 3 68  ? -8.225  -19.312 50.002 1.00 0.18 ? 68  LYS A HA     1 
ATOM 2248 H HB2    . LYS C 3 68  ? -6.594  -19.704 51.781 1.00 0.19 ? 68  LYS A HB2    1 
ATOM 2249 H HB3    . LYS C 3 68  ? -7.841  -20.473 52.764 1.00 0.20 ? 68  LYS A HB3    1 
ATOM 2250 H HG2    . LYS C 3 68  ? -8.131  -22.233 51.114 1.00 0.20 ? 68  LYS A HG2    1 
ATOM 2251 H HG3    . LYS C 3 68  ? -7.021  -21.426 50.005 1.00 0.19 ? 68  LYS A HG3    1 
ATOM 2252 H HD2    . LYS C 3 68  ? -5.144  -21.862 51.384 1.00 0.21 ? 68  LYS A HD2    1 
ATOM 2253 H HD3    . LYS C 3 68  ? -6.153  -22.246 52.778 1.00 0.21 ? 68  LYS A HD3    1 
ATOM 2254 H HE2    . LYS C 3 68  ? -6.289  -23.883 50.247 1.00 0.21 ? 68  LYS A HE2    1 
ATOM 2255 H HE3    . LYS C 3 68  ? -5.096  -24.226 51.501 1.00 0.22 ? 68  LYS A HE3    1 
ATOM 2256 H HZ1    . LYS C 3 68  ? -6.641  -25.206 52.726 1.00 0.22 ? 68  LYS A HZ1    1 
ATOM 2257 H HZ2    . LYS C 3 68  ? -7.734  -25.040 51.435 1.00 0.21 ? 68  LYS A HZ2    1 
ATOM 2258 H HZ3    . LYS C 3 68  ? -7.657  -23.849 52.646 1.00 0.21 ? 68  LYS A HZ3    1 
ATOM 2259 N N      . PRO C 3 69  ? -10.569 -20.501 52.038 1.00 0.19 ? 69  PRO A N      1 
ATOM 2260 C CA     . PRO C 3 69  ? -11.810 -21.285 52.050 1.00 0.19 ? 69  PRO A CA     1 
ATOM 2261 C C      . PRO C 3 69  ? -12.809 -20.742 51.009 1.00 0.19 ? 69  PRO A C      1 
ATOM 2262 O O      . PRO C 3 69  ? -13.485 -21.502 50.315 1.00 0.19 ? 69  PRO A O      1 
ATOM 2263 C CB     . PRO C 3 69  ? -12.367 -21.099 53.465 1.00 0.20 ? 69  PRO A CB     1 
ATOM 2264 C CG     . PRO C 3 69  ? -11.213 -20.657 54.300 1.00 0.20 ? 69  PRO A CG     1 
ATOM 2265 C CD     . PRO C 3 69  ? -10.237 -19.954 53.360 1.00 0.19 ? 69  PRO A CD     1 
ATOM 2266 H HA     . PRO C 3 69  ? -11.604 -22.327 51.870 1.00 0.20 ? 69  PRO A HA     1 
ATOM 2267 H HB2    . PRO C 3 69  ? -13.140 -20.345 53.462 1.00 0.20 ? 69  PRO A HB2    1 
ATOM 2268 H HB3    . PRO C 3 69  ? -12.757 -22.034 53.839 1.00 0.21 ? 69  PRO A HB3    1 
ATOM 2269 H HG2    . PRO C 3 69  ? -11.554 -19.975 55.067 1.00 0.20 ? 69  PRO A HG2    1 
ATOM 2270 H HG3    . PRO C 3 69  ? -10.732 -21.512 54.750 1.00 0.21 ? 69  PRO A HG3    1 
ATOM 2271 H HD2    . PRO C 3 69  ? -10.393 -18.884 53.383 1.00 0.19 ? 69  PRO A HD2    1 
ATOM 2272 H HD3    . PRO C 3 69  ? -9.218  -20.198 53.618 1.00 0.20 ? 69  PRO A HD3    1 
ATOM 2273 N N      . LEU C 3 70  ? -12.902 -19.417 50.908 1.00 0.18 ? 70  LEU A N      1 
ATOM 2274 C CA     . LEU C 3 70  ? -13.841 -18.820 49.955 1.00 0.18 ? 70  LEU A CA     1 
ATOM 2275 C C      . LEU C 3 70  ? -13.433 -19.089 48.522 1.00 0.18 ? 70  LEU A C      1 
ATOM 2276 O O      . LEU C 3 70  ? -14.265 -19.461 47.690 1.00 0.18 ? 70  LEU A O      1 
ATOM 2277 C CB     . LEU C 3 70  ? -13.902 -17.309 50.186 1.00 0.17 ? 70  LEU A CB     1 
ATOM 2278 C CG     . LEU C 3 70  ? -14.502 -17.026 51.564 1.00 0.18 ? 70  LEU A CG     1 
ATOM 2279 C CD1    . LEU C 3 70  ? -15.661 -17.988 51.827 1.00 0.18 ? 70  LEU A CD1    1 
ATOM 2280 C CD2    . LEU C 3 70  ? -13.427 -17.219 52.635 1.00 0.18 ? 70  LEU A CD2    1 
ATOM 2281 H H      . LEU C 3 70  ? -12.352 -18.843 51.479 1.00 0.18 ? 70  LEU A H      1 
ATOM 2282 H HA     . LEU C 3 70  ? -14.824 -19.234 50.123 1.00 0.18 ? 70  LEU A HA     1 
ATOM 2283 H HB2    . LEU C 3 70  ? -12.905 -16.896 50.134 1.00 0.17 ? 70  LEU A HB2    1 
ATOM 2284 H HB3    . LEU C 3 70  ? -14.520 -16.854 49.426 1.00 0.17 ? 70  LEU A HB3    1 
ATOM 2285 H HG     . LEU C 3 70  ? -14.865 -16.009 51.596 1.00 0.17 ? 70  LEU A HG     1 
ATOM 2286 H HD11   . LEU C 3 70  ? -15.270 -18.971 52.049 1.00 0.19 ? 70  LEU A HD11   1 
ATOM 2287 H HD12   . LEU C 3 70  ? -16.292 -18.040 50.951 1.00 0.18 ? 70  LEU A HD12   1 
ATOM 2288 H HD13   . LEU C 3 70  ? -16.241 -17.634 52.667 1.00 0.19 ? 70  LEU A HD13   1 
ATOM 2289 H HD21   . LEU C 3 70  ? -13.695 -16.660 53.520 1.00 0.18 ? 70  LEU A HD21   1 
ATOM 2290 H HD22   . LEU C 3 70  ? -12.478 -16.867 52.261 1.00 0.18 ? 70  LEU A HD22   1 
ATOM 2291 H HD23   . LEU C 3 70  ? -13.350 -18.268 52.883 1.00 0.18 ? 70  LEU A HD23   1 
ATOM 2292 N N      . LEU C 3 71  ? -12.150 -18.904 48.206 1.00 0.17 ? 71  LEU A N      1 
ATOM 2293 C CA     . LEU C 3 71  ? -11.696 -19.136 46.849 1.00 0.18 ? 71  LEU A CA     1 
ATOM 2294 C C      . LEU C 3 71  ? -11.716 -20.606 46.522 1.00 0.18 ? 71  LEU A C      1 
ATOM 2295 O O      . LEU C 3 71  ? -11.734 -20.982 45.356 1.00 0.19 ? 71  LEU A O      1 
ATOM 2296 C CB     . LEU C 3 71  ? -10.270 -18.603 46.691 1.00 0.18 ? 71  LEU A CB     1 
ATOM 2297 C CG     . LEU C 3 71  ? -10.297 -17.075 46.654 1.00 0.17 ? 71  LEU A CG     1 
ATOM 2298 C CD1    . LEU C 3 71  ? -8.876  -16.545 46.451 1.00 0.18 ? 71  LEU A CD1    1 
ATOM 2299 C CD2    . LEU C 3 71  ? -11.182 -16.608 45.495 1.00 0.17 ? 71  LEU A CD2    1 
ATOM 2300 H H      . LEU C 3 71  ? -11.515 -18.606 48.890 1.00 0.17 ? 71  LEU A H      1 
ATOM 2301 H HA     . LEU C 3 71  ? -12.341 -18.612 46.164 1.00 0.18 ? 71  LEU A HA     1 
ATOM 2302 H HB2    . LEU C 3 71  ? -9.668  -18.934 47.525 1.00 0.18 ? 71  LEU A HB2    1 
ATOM 2303 H HB3    . LEU C 3 71  ? -9.846  -18.976 45.771 1.00 0.18 ? 71  LEU A HB3    1 
ATOM 2304 H HG     . LEU C 3 71  ? -10.692 -16.698 47.586 1.00 0.17 ? 71  LEU A HG     1 
ATOM 2305 H HD11   . LEU C 3 71  ? -8.264  -16.827 47.294 1.00 0.18 ? 71  LEU A HD11   1 
ATOM 2306 H HD12   . LEU C 3 71  ? -8.902  -15.468 46.368 1.00 0.18 ? 71  LEU A HD12   1 
ATOM 2307 H HD13   . LEU C 3 71  ? -8.461  -16.965 45.548 1.00 0.18 ? 71  LEU A HD13   1 
ATOM 2308 H HD21   . LEU C 3 71  ? -11.072 -17.287 44.662 1.00 0.18 ? 71  LEU A HD21   1 
ATOM 2309 H HD22   . LEU C 3 71  ? -10.884 -15.615 45.191 1.00 0.17 ? 71  LEU A HD22   1 
ATOM 2310 H HD23   . LEU C 3 71  ? -12.213 -16.593 45.814 1.00 0.17 ? 71  LEU A HD23   1 
ATOM 2311 N N      . GLU C 3 72  ? -11.721 -21.436 47.556 1.00 0.18 ? 72  GLU A N      1 
ATOM 2312 C CA     . GLU C 3 72  ? -11.725 -22.853 47.298 1.00 0.19 ? 72  GLU A CA     1 
ATOM 2313 C C      . GLU C 3 72  ? -13.085 -23.287 46.736 1.00 0.20 ? 72  GLU A C      1 
ATOM 2314 O O      . GLU C 3 72  ? -13.142 -24.210 45.943 1.00 0.20 ? 72  GLU A O      1 
ATOM 2315 C CB     . GLU C 3 72  ? -11.445 -23.605 48.600 1.00 0.20 ? 72  GLU A CB     1 
ATOM 2316 C CG     . GLU C 3 72  ? -11.039 -25.046 48.280 1.00 0.20 ? 72  GLU A CG     1 
ATOM 2317 C CD     . GLU C 3 72  ? -10.300 -25.645 49.479 1.00 0.21 ? 72  GLU A CD     1 
ATOM 2318 O OE1    . GLU C 3 72  ? -10.746 -25.430 50.594 1.00 0.21 ? 72  GLU A OE1    1 
ATOM 2319 O OE2    . GLU C 3 72  ? -9.299  -26.308 49.261 1.00 0.21 ? 72  GLU A OE2    1 
ATOM 2320 H H      . GLU C 3 72  ? -11.710 -21.094 48.473 1.00 0.18 ? 72  GLU A H      1 
ATOM 2321 H HA     . GLU C 3 72  ? -10.951 -23.086 46.583 1.00 0.19 ? 72  GLU A HA     1 
ATOM 2322 H HB2    . GLU C 3 72  ? -10.644 -23.115 49.134 1.00 0.19 ? 72  GLU A HB2    1 
ATOM 2323 H HB3    . GLU C 3 72  ? -12.336 -23.611 49.210 1.00 0.20 ? 72  GLU A HB3    1 
ATOM 2324 H HG2    . GLU C 3 72  ? -11.923 -25.632 48.073 1.00 0.21 ? 72  GLU A HG2    1 
ATOM 2325 H HG3    . GLU C 3 72  ? -10.390 -25.054 47.419 1.00 0.20 ? 72  GLU A HG3    1 
ATOM 2326 N N      . LYS C 3 73  ? -14.174 -22.619 47.120 1.00 0.20 ? 73  LYS A N      1 
ATOM 2327 C CA     . LYS C 3 73  ? -15.461 -23.003 46.551 1.00 0.20 ? 73  LYS A CA     1 
ATOM 2328 C C      . LYS C 3 73  ? -15.396 -22.721 45.061 1.00 0.20 ? 73  LYS A C      1 
ATOM 2329 O O      . LYS C 3 73  ? -15.852 -23.529 44.255 1.00 0.21 ? 73  LYS A O      1 
ATOM 2330 C CB     . LYS C 3 73  ? -16.580 -22.173 47.185 1.00 0.20 ? 73  LYS A CB     1 
ATOM 2331 C CG     . LYS C 3 73  ? -16.877 -22.699 48.591 1.00 0.21 ? 73  LYS A CG     1 
ATOM 2332 C CD     . LYS C 3 73  ? -18.192 -22.098 49.093 1.00 0.21 ? 73  LYS A CD     1 
ATOM 2333 C CE     . LYS C 3 73  ? -18.405 -22.485 50.557 1.00 0.22 ? 73  LYS A CE     1 
ATOM 2334 N NZ     . LYS C 3 73  ? -19.549 -21.709 51.114 1.00 0.22 ? 73  LYS A NZ     1 
ATOM 2335 H H      . LYS C 3 73  ? -14.106 -21.868 47.745 1.00 0.19 ? 73  LYS A H      1 
ATOM 2336 H HA     . LYS C 3 73  ? -15.641 -24.054 46.719 1.00 0.21 ? 73  LYS A HA     1 
ATOM 2337 H HB2    . LYS C 3 73  ? -16.271 -21.139 47.245 1.00 0.20 ? 73  LYS A HB2    1 
ATOM 2338 H HB3    . LYS C 3 73  ? -17.471 -22.247 46.581 1.00 0.21 ? 73  LYS A HB3    1 
ATOM 2339 H HG2    . LYS C 3 73  ? -16.959 -23.776 48.562 1.00 0.21 ? 73  LYS A HG2    1 
ATOM 2340 H HG3    . LYS C 3 73  ? -16.076 -22.416 49.257 1.00 0.20 ? 73  LYS A HG3    1 
ATOM 2341 H HD2    . LYS C 3 73  ? -18.151 -21.022 49.006 1.00 0.20 ? 73  LYS A HD2    1 
ATOM 2342 H HD3    . LYS C 3 73  ? -19.010 -22.476 48.500 1.00 0.22 ? 73  LYS A HD3    1 
ATOM 2343 H HE2    . LYS C 3 73  ? -18.621 -23.541 50.623 1.00 0.23 ? 73  LYS A HE2    1 
ATOM 2344 H HE3    . LYS C 3 73  ? -17.512 -22.265 51.122 1.00 0.21 ? 73  LYS A HE3    1 
ATOM 2345 H HZ1    . LYS C 3 73  ? -19.941 -22.209 51.936 1.00 0.23 ? 73  LYS A HZ1    1 
ATOM 2346 H HZ2    . LYS C 3 73  ? -20.286 -21.607 50.386 1.00 0.22 ? 73  LYS A HZ2    1 
ATOM 2347 H HZ3    . LYS C 3 73  ? -19.220 -20.768 51.408 1.00 0.22 ? 73  LYS A HZ3    1 
ATOM 2348 N N      . TRP C 3 74  ? -14.785 -21.591 44.678 1.00 0.20 ? 74  TRP A N      1 
ATOM 2349 C CA     . TRP C 3 74  ? -14.710 -21.275 43.263 1.00 0.20 ? 74  TRP A CA     1 
ATOM 2350 C C      . TRP C 3 74  ? -13.933 -22.288 42.494 1.00 0.21 ? 74  TRP A C      1 
ATOM 2351 O O      . TRP C 3 74  ? -14.364 -22.721 41.426 1.00 0.21 ? 74  TRP A O      1 
ATOM 2352 C CB     . TRP C 3 74  ? -14.064 -19.899 43.082 1.00 0.19 ? 74  TRP A CB     1 
ATOM 2353 C CG     . TRP C 3 74  ? -13.972 -19.580 41.620 1.00 0.20 ? 74  TRP A CG     1 
ATOM 2354 C CD1    . TRP C 3 74  ? -14.953 -19.005 40.886 1.00 0.21 ? 74  TRP A CD1    1 
ATOM 2355 C CD2    . TRP C 3 74  ? -12.860 -19.811 40.706 1.00 0.20 ? 74  TRP A CD2    1 
ATOM 2356 N NE1    . TRP C 3 74  ? -14.513 -18.870 39.579 1.00 0.21 ? 74  TRP A NE1    1 
ATOM 2357 C CE2    . TRP C 3 74  ? -13.229 -19.351 39.420 1.00 0.21 ? 74  TRP A CE2    1 
ATOM 2358 C CE3    . TRP C 3 74  ? -11.578 -20.368 40.867 1.00 0.20 ? 74  TRP A CE3    1 
ATOM 2359 C CZ2    . TRP C 3 74  ? -12.359 -19.440 38.331 1.00 0.22 ? 74  TRP A CZ2    1 
ATOM 2360 C CZ3    . TRP C 3 74  ? -10.699 -20.460 39.773 1.00 0.21 ? 74  TRP A CZ3    1 
ATOM 2361 C CH2    . TRP C 3 74  ? -11.090 -19.998 38.510 1.00 0.22 ? 74  TRP A CH2    1 
ATOM 2362 H H      . TRP C 3 74  ? -14.403 -20.983 45.342 1.00 0.19 ? 74  TRP A H      1 
ATOM 2363 H HA     . TRP C 3 74  ? -15.711 -21.232 42.864 1.00 0.20 ? 74  TRP A HA     1 
ATOM 2364 H HB2    . TRP C 3 74  ? -14.667 -19.152 43.577 1.00 0.19 ? 74  TRP A HB2    1 
ATOM 2365 H HB3    . TRP C 3 74  ? -13.073 -19.908 43.513 1.00 0.19 ? 74  TRP A HB3    1 
ATOM 2366 H HD1    . TRP C 3 74  ? -15.921 -18.703 41.256 1.00 0.20 ? 74  TRP A HD1    1 
ATOM 2367 H HE1    . TRP C 3 74  ? -15.033 -18.483 38.844 1.00 0.22 ? 74  TRP A HE1    1 
ATOM 2368 H HE3    . TRP C 3 74  ? -11.267 -20.726 41.837 1.00 0.20 ? 74  TRP A HE3    1 
ATOM 2369 H HZ2    . TRP C 3 74  ? -12.665 -19.084 37.359 1.00 0.23 ? 74  TRP A HZ2    1 
ATOM 2370 H HZ3    . TRP C 3 74  ? -9.718  -20.890 39.909 1.00 0.21 ? 74  TRP A HZ3    1 
ATOM 2371 H HH2    . TRP C 3 74  ? -10.410 -20.073 37.673 1.00 0.23 ? 74  TRP A HH2    1 
ATOM 2372 N N      . LEU C 3 75  ? -12.757 -22.642 43.028 1.00 0.20 ? 75  LEU A N      1 
ATOM 2373 C CA     . LEU C 3 75  ? -11.851 -23.584 42.385 1.00 0.21 ? 75  LEU A CA     1 
ATOM 2374 C C      . LEU C 3 75  ? -12.538 -24.926 42.149 1.00 0.22 ? 75  LEU A C      1 
ATOM 2375 O O      . LEU C 3 75  ? -12.541 -25.428 41.042 1.00 0.23 ? 75  LEU A O      1 
ATOM 2376 C CB     . LEU C 3 75  ? -10.624 -23.792 43.276 1.00 0.20 ? 75  LEU A CB     1 
ATOM 2377 C CG     . LEU C 3 75  ? -9.544  -24.542 42.493 1.00 0.21 ? 75  LEU A CG     1 
ATOM 2378 C CD1    . LEU C 3 75  ? -9.093  -23.694 41.302 1.00 0.21 ? 75  LEU A CD1    1 
ATOM 2379 C CD2    . LEU C 3 75  ? -8.346  -24.809 43.408 1.00 0.21 ? 75  LEU A CD2    1 
ATOM 2380 H H      . LEU C 3 75  ? -12.483 -22.228 43.873 1.00 0.20 ? 75  LEU A H      1 
ATOM 2381 H HA     . LEU C 3 75  ? -11.530 -23.177 41.438 1.00 0.21 ? 75  LEU A HA     1 
ATOM 2382 H HB2    . LEU C 3 75  ? -10.240 -22.832 43.589 1.00 0.20 ? 75  LEU A HB2    1 
ATOM 2383 H HB3    . LEU C 3 75  ? -10.903 -24.370 44.143 1.00 0.20 ? 75  LEU A HB3    1 
ATOM 2384 H HG     . LEU C 3 75  ? -9.944  -25.479 42.136 1.00 0.22 ? 75  LEU A HG     1 
ATOM 2385 H HD11   . LEU C 3 75  ? -8.192  -24.114 40.881 1.00 0.22 ? 75  LEU A HD11   1 
ATOM 2386 H HD12   . LEU C 3 75  ? -8.898  -22.684 41.631 1.00 0.21 ? 75  LEU A HD12   1 
ATOM 2387 H HD13   . LEU C 3 75  ? -9.870  -23.684 40.553 1.00 0.22 ? 75  LEU A HD13   1 
ATOM 2388 H HD21   . LEU C 3 75  ? -8.678  -25.335 44.290 1.00 0.21 ? 75  LEU A HD21   1 
ATOM 2389 H HD22   . LEU C 3 75  ? -7.897  -23.869 43.695 1.00 0.21 ? 75  LEU A HD22   1 
ATOM 2390 H HD23   . LEU C 3 75  ? -7.619  -25.409 42.882 1.00 0.22 ? 75  LEU A HD23   1 
ATOM 2391 N N      . ASN C 3 76  ? -13.138 -25.479 43.192 1.00 0.22 ? 76  ASN A N      1 
ATOM 2392 C CA     . ASN C 3 76  ? -13.844 -26.745 43.070 1.00 0.23 ? 76  ASN A CA     1 
ATOM 2393 C C      . ASN C 3 76  ? -14.875 -26.666 41.926 1.00 0.23 ? 76  ASN A C      1 
ATOM 2394 O O      . ASN C 3 76  ? -14.816 -27.446 40.972 1.00 0.24 ? 76  ASN A O      1 
ATOM 2395 C CB     . ASN C 3 76  ? -14.565 -27.054 44.384 1.00 0.23 ? 76  ASN A CB     1 
ATOM 2396 C CG     . ASN C 3 76  ? -13.536 -27.390 45.465 1.00 0.23 ? 76  ASN A CG     1 
ATOM 2397 O OD1    . ASN C 3 76  ? -12.412 -27.738 45.163 1.00 0.23 ? 76  ASN A OD1    1 
ATOM 2398 N ND2    . ASN C 3 76  ? -13.875 -27.298 46.721 1.00 0.22 ? 76  ASN A ND2    1 
ATOM 2399 H H      . ASN C 3 76  ? -13.117 -25.020 44.059 1.00 0.21 ? 76  ASN A H      1 
ATOM 2400 H HA     . ASN C 3 76  ? -13.136 -27.531 42.860 1.00 0.23 ? 76  ASN A HA     1 
ATOM 2401 H HB2    . ASN C 3 76  ? -15.143 -26.194 44.689 1.00 0.22 ? 76  ASN A HB2    1 
ATOM 2402 H HB3    . ASN C 3 76  ? -15.225 -27.898 44.243 1.00 0.24 ? 76  ASN A HB3    1 
ATOM 2403 H HD21   . ASN C 3 76  ? -14.782 -27.016 46.965 1.00 0.23 ? 76  ASN A HD21   1 
ATOM 2404 H HD22   . ASN C 3 76  ? -13.224 -27.513 47.421 1.00 0.22 ? 76  ASN A HD22   1 
ATOM 2405 N N      . ASP C 3 77  ? -15.791 -25.712 42.009 1.00 0.23 ? 77  ASP A N      1 
ATOM 2406 C CA     . ASP C 3 77  ? -16.849 -25.551 41.007 1.00 0.24 ? 77  ASP A CA     1 
ATOM 2407 C C      . ASP C 3 77  ? -16.376 -25.246 39.575 1.00 0.24 ? 77  ASP A C      1 
ATOM 2408 O O      . ASP C 3 77  ? -16.994 -25.693 38.614 1.00 0.25 ? 77  ASP A O      1 
ATOM 2409 C CB     . ASP C 3 77  ? -17.773 -24.420 41.464 1.00 0.24 ? 77  ASP A CB     1 
ATOM 2410 C CG     . ASP C 3 77  ? -19.069 -24.465 40.654 1.00 0.25 ? 77  ASP A CG     1 
ATOM 2411 O OD1    . ASP C 3 77  ? -18.990 -24.340 39.443 1.00 0.25 ? 77  ASP A OD1    1 
ATOM 2412 O OD2    . ASP C 3 77  ? -20.118 -24.618 41.259 1.00 0.25 ? 77  ASP A OD2    1 
ATOM 2413 H H      . ASP C 3 77  ? -15.778 -25.107 42.781 1.00 0.23 ? 77  ASP A H      1 
ATOM 2414 H HA     . ASP C 3 77  ? -17.433 -26.455 40.984 1.00 0.25 ? 77  ASP A HA     1 
ATOM 2415 H HB2    . ASP C 3 77  ? -18.000 -24.540 42.513 1.00 0.23 ? 77  ASP A HB2    1 
ATOM 2416 H HB3    . ASP C 3 77  ? -17.285 -23.468 41.306 1.00 0.23 ? 77  ASP A HB3    1 
ATOM 2417 N N      . ALA C 3 78  ? -15.298 -24.478 39.421 1.00 0.24 ? 78  ALA A N      1 
ATOM 2418 C CA     . ALA C 3 78  ? -14.807 -24.142 38.090 1.00 0.24 ? 78  ALA A CA     1 
ATOM 2419 C C      . ALA C 3 78  ? -14.376 -25.406 37.356 1.00 0.25 ? 78  ALA A C      1 
ATOM 2420 O O      . ALA C 3 78  ? -14.265 -25.406 36.130 1.00 0.26 ? 78  ALA A O      1 
ATOM 2421 C CB     . ALA C 3 78  ? -13.616 -23.192 38.212 1.00 0.23 ? 78  ALA A CB     1 
ATOM 2422 H H      . ALA C 3 78  ? -14.837 -24.128 40.212 1.00 0.23 ? 78  ALA A H      1 
ATOM 2423 H HA     . ALA C 3 78  ? -15.593 -23.654 37.532 1.00 0.25 ? 78  ALA A HA     1 
ATOM 2424 H HB1    . ALA C 3 78  ? -13.808 -22.471 38.994 1.00 0.23 ? 78  ALA A HB1    1 
ATOM 2425 H HB2    . ALA C 3 78  ? -13.470 -22.675 37.275 1.00 0.24 ? 78  ALA A HB2    1 
ATOM 2426 H HB3    . ALA C 3 78  ? -12.727 -23.757 38.452 1.00 0.23 ? 78  ALA A HB3    1 
ATOM 2427 N N      . GLU C 3 79  ? -14.153 -26.475 38.125 1.00 0.25 ? 79  GLU A N      1 
ATOM 2428 C CA     . GLU C 3 79  ? -13.743 -27.789 37.599 1.00 0.26 ? 79  GLU A CA     1 
ATOM 2429 C C      . GLU C 3 79  ? -14.956 -28.629 37.172 1.00 0.27 ? 79  GLU A C      1 
ATOM 2430 C CB     . GLU C 3 79  ? -12.967 -28.549 38.679 1.00 0.26 ? 79  GLU A CB     1 
ATOM 2431 C CG     . GLU C 3 79  ? -12.218 -27.555 39.569 1.00 0.24 ? 79  GLU A CG     1 
ATOM 2432 C CD     . GLU C 3 79  ? -11.045 -26.954 38.790 1.00 0.24 ? 79  GLU A CD     1 
ATOM 2433 O OE1    . GLU C 3 79  ? -11.285 -26.404 37.728 1.00 0.25 ? 79  GLU A OE1    1 
ATOM 2434 O OE2    . GLU C 3 79  ? -9.927  -27.058 39.268 1.00 0.24 ? 79  GLU A OE2    1 
ATOM 2435 H H      . GLU C 3 79  ? -14.276 -26.384 39.093 1.00 0.25 ? 79  GLU A H      1 
ATOM 2436 H HA     . GLU C 3 79  ? -13.099 -27.643 36.746 1.00 0.27 ? 79  GLU A HA     1 
ATOM 2437 H HB2    . GLU C 3 79  ? -13.657 -29.123 39.281 1.00 0.26 ? 79  GLU A HB2    1 
ATOM 2438 H HB3    . GLU C 3 79  ? -12.258 -29.215 38.211 1.00 0.26 ? 79  GLU A HB3    1 
ATOM 2439 H HG2    . GLU C 3 79  ? -12.890 -26.768 39.874 1.00 0.24 ? 79  GLU A HG2    1 
ATOM 2440 H HG3    . GLU C 3 79  ? -11.843 -28.067 40.442 1.00 0.24 ? 79  GLU A HG3    1 
ATOM 2441 N N      . SER C 3 110 ? -17.997 6.873   47.690 1.00 0.28 ? 110 SER A N      1 
ATOM 2442 C CA     . SER C 3 110 ? -16.757 7.597   47.374 1.00 0.30 ? 110 SER A CA     1 
ATOM 2443 C C      . SER C 3 110 ? -17.002 9.099   47.521 1.00 0.31 ? 110 SER A C      1 
ATOM 2444 O O      . SER C 3 110 ? -17.901 9.632   46.883 1.00 0.31 ? 110 SER A O      1 
ATOM 2445 C CB     . SER C 3 110 ? -16.334 7.285   45.938 1.00 0.31 ? 110 SER A CB     1 
ATOM 2446 O OG     . SER C 3 110 ? -15.341 8.217   45.529 1.00 0.44 ? 110 SER A OG     1 
ATOM 2447 H H      . SER C 3 110 ? -18.700 6.837   47.008 1.00 0.29 ? 110 SER A H      1 
ATOM 2448 H HA     . SER C 3 110 ? -15.977 7.290   48.054 1.00 0.30 ? 110 SER A HA     1 
ATOM 2449 H HB2    . SER C 3 110 ? -15.928 6.289   45.888 1.00 0.39 ? 110 SER A HB2    1 
ATOM 2450 H HB3    . SER C 3 110 ? -17.196 7.353   45.288 1.00 0.37 ? 110 SER A HB3    1 
ATOM 2451 H HG     . SER C 3 110 ? -14.486 7.786   45.593 1.00 1.02 ? 110 SER A HG     1 
ATOM 2452 N N      . ILE C 3 111 ? -16.197 9.754   48.355 1.00 0.31 ? 111 ILE A N      1 
ATOM 2453 C CA     . ILE C 3 111 ? -16.317 11.184  48.656 1.00 0.32 ? 111 ILE A CA     1 
ATOM 2454 C C      . ILE C 3 111 ? -15.743 12.122  47.589 1.00 0.34 ? 111 ILE A C      1 
ATOM 2455 O O      . ILE C 3 111 ? -14.642 11.916  47.080 1.00 0.35 ? 111 ILE A O      1 
ATOM 2456 C CB     . ILE C 3 111 ? -15.623 11.504  50.005 1.00 0.32 ? 111 ILE A CB     1 
ATOM 2457 C CG1    . ILE C 3 111 ? -16.310 10.708  51.124 1.00 0.30 ? 111 ILE A CG1    1 
ATOM 2458 C CG2    . ILE C 3 111 ? -15.734 13.007  50.335 1.00 0.33 ? 111 ILE A CG2    1 
ATOM 2459 C CD1    . ILE C 3 111 ? -15.670 11.021  52.496 1.00 0.30 ? 111 ILE A CD1    1 
ATOM 2460 H H      . ILE C 3 111 ? -15.503 9.241   48.820 1.00 0.31 ? 111 ILE A H      1 
ATOM 2461 H HA     . ILE C 3 111 ? -17.360 11.417  48.787 1.00 0.32 ? 111 ILE A HA     1 
ATOM 2462 H HB     . ILE C 3 111 ? -14.580 11.226  49.951 1.00 0.33 ? 111 ILE A HB     1 
ATOM 2463 H HG12   . ILE C 3 111 ? -17.359 10.963  51.149 1.00 0.30 ? 111 ILE A HG12   1 
ATOM 2464 H HG13   . ILE C 3 111 ? -16.208 9.652   50.914 1.00 0.30 ? 111 ILE A HG13   1 
ATOM 2465 H HG21   . ILE C 3 111 ? -15.442 13.600  49.490 1.00 1.09 ? 111 ILE A HG21   1 
ATOM 2466 H HG22   . ILE C 3 111 ? -15.085 13.246  51.163 1.00 1.05 ? 111 ILE A HG22   1 
ATOM 2467 H HG23   . ILE C 3 111 ? -16.753 13.242  50.602 1.00 1.02 ? 111 ILE A HG23   1 
ATOM 2468 H HD11   . ILE C 3 111 ? -15.657 10.125  53.100 1.00 1.08 ? 111 ILE A HD11   1 
ATOM 2469 H HD12   . ILE C 3 111 ? -16.250 11.780  52.999 1.00 1.05 ? 111 ILE A HD12   1 
ATOM 2470 H HD13   . ILE C 3 111 ? -14.658 11.378  52.369 1.00 1.06 ? 111 ILE A HD13   1 
ATOM 2471 N N      . GLU C 3 112 ? -16.500 13.167  47.287 1.00 0.35 ? 112 GLU A N      1 
ATOM 2472 C CA     . GLU C 3 112 ? -16.115 14.152  46.280 1.00 0.37 ? 112 GLU A CA     1 
ATOM 2473 C C      . GLU C 3 112 ? -14.880 14.954  46.670 1.00 0.38 ? 112 GLU A C      1 
ATOM 2474 O O      . GLU C 3 112 ? -14.650 15.231  47.849 1.00 0.38 ? 112 GLU A O      1 
ATOM 2475 C CB     . GLU C 3 112 ? -17.283 15.111  46.057 1.00 0.37 ? 112 GLU A CB     1 
ATOM 2476 C CG     . GLU C 3 112 ? -17.185 15.719  44.654 1.00 0.39 ? 112 GLU A CG     1 
ATOM 2477 C CD     . GLU C 3 112 ? -16.895 14.615  43.634 1.00 0.39 ? 112 GLU A CD     1 
ATOM 2478 O OE1    . GLU C 3 112 ? -17.655 13.662  43.589 1.00 0.38 ? 112 GLU A OE1    1 
ATOM 2479 O OE2    . GLU C 3 112 ? -15.922 14.748  42.911 1.00 0.41 ? 112 GLU A OE2    1 
ATOM 2480 H H      . GLU C 3 112 ? -17.359 13.277  47.747 1.00 0.34 ? 112 GLU A H      1 
ATOM 2481 H HA     . GLU C 3 112 ? -15.916 13.640  45.353 1.00 0.37 ? 112 GLU A HA     1 
ATOM 2482 H HB2    . GLU C 3 112 ? -18.214 14.571  46.151 1.00 0.36 ? 112 GLU A HB2    1 
ATOM 2483 H HB3    . GLU C 3 112 ? -17.246 15.901  46.790 1.00 0.37 ? 112 GLU A HB3    1 
ATOM 2484 H HG2    . GLU C 3 112 ? -18.121 16.203  44.407 1.00 0.39 ? 112 GLU A HG2    1 
ATOM 2485 H HG3    . GLU C 3 112 ? -16.389 16.445  44.632 1.00 0.40 ? 112 GLU A HG3    1 
ATOM 2486 N N      . THR C 3 113 ? -14.102 15.342  45.667 1.00 0.40 ? 113 THR A N      1 
ATOM 2487 C CA     . THR C 3 113 ? -12.871 16.096  45.873 1.00 0.42 ? 113 THR A CA     1 
ATOM 2488 C C      . THR C 3 113 ? -13.029 17.384  46.673 1.00 0.42 ? 113 THR A C      1 
ATOM 2489 O O      . THR C 3 113 ? -12.203 17.706  47.525 1.00 0.43 ? 113 THR A O      1 
ATOM 2490 C CB     . THR C 3 113 ? -12.271 16.437  44.508 1.00 0.44 ? 113 THR A CB     1 
ATOM 2491 O OG1    . THR C 3 113 ? -12.181 15.255  43.727 1.00 0.43 ? 113 THR A OG1    1 
ATOM 2492 C CG2    . THR C 3 113 ? -10.875 17.034  44.697 1.00 0.45 ? 113 THR A CG2    1 
ATOM 2493 H H      . THR C 3 113 ? -14.357 15.098  44.753 1.00 0.40 ? 113 THR A H      1 
ATOM 2494 H HA     . THR C 3 113 ? -12.169 15.463  46.390 1.00 0.41 ? 113 THR A HA     1 
ATOM 2495 H HB     . THR C 3 113 ? -12.899 17.155  44.007 1.00 0.44 ? 113 THR A HB     1 
ATOM 2496 H HG1    . THR C 3 113 ? -13.004 14.770  43.826 1.00 0.42 ? 113 THR A HG1    1 
ATOM 2497 H HG21   . THR C 3 113 ? -10.962 18.045  45.063 1.00 0.46 ? 113 THR A HG21   1 
ATOM 2498 H HG22   . THR C 3 113 ? -10.354 17.037  43.751 1.00 0.46 ? 113 THR A HG22   1 
ATOM 2499 H HG23   . THR C 3 113 ? -10.322 16.439  45.410 1.00 0.45 ? 113 THR A HG23   1 
ATOM 2500 N N      . ASN C 3 114 ? -14.091 18.132  46.397 1.00 0.42 ? 114 ASN A N      1 
ATOM 2501 C CA     . ASN C 3 114 ? -14.338 19.378  47.105 1.00 0.43 ? 114 ASN A CA     1 
ATOM 2502 C C      . ASN C 3 114 ? -14.790 19.126  48.548 1.00 0.41 ? 114 ASN A C      1 
ATOM 2503 O O      . ASN C 3 114 ? -14.421 19.861  49.466 1.00 0.42 ? 114 ASN A O      1 
ATOM 2504 C CB     . ASN C 3 114 ? -15.419 20.168  46.371 1.00 0.43 ? 114 ASN A CB     1 
ATOM 2505 C CG     . ASN C 3 114 ? -16.518 19.215  45.897 1.00 0.42 ? 114 ASN A CG     1 
ATOM 2506 O OD1    . ASN C 3 114 ? -16.321 18.450  44.975 1.00 0.42 ? 114 ASN A OD1    1 
ATOM 2507 N ND2    . ASN C 3 114 ? -17.677 19.230  46.495 1.00 0.41 ? 114 ASN A ND2    1 
ATOM 2508 H H      . ASN C 3 114 ? -14.721 17.837  45.706 1.00 0.42 ? 114 ASN A H      1 
ATOM 2509 H HA     . ASN C 3 114 ? -13.431 19.962  47.117 1.00 0.44 ? 114 ASN A HA     1 
ATOM 2510 H HB2    . ASN C 3 114 ? -15.843 20.903  47.039 1.00 0.43 ? 114 ASN A HB2    1 
ATOM 2511 H HB3    . ASN C 3 114 ? -14.984 20.664  45.516 1.00 0.45 ? 114 ASN A HB3    1 
ATOM 2512 H HD21   . ASN C 3 114 ? -17.835 19.846  47.242 1.00 0.41 ? 114 ASN A HD21   1 
ATOM 2513 H HD22   . ASN C 3 114 ? -18.391 18.629  46.197 1.00 0.40 ? 114 ASN A HD22   1 
ATOM 2514 N N      . ILE C 3 115 ? -15.596 18.089  48.748 1.00 0.39 ? 115 ILE A N      1 
ATOM 2515 C CA     . ILE C 3 115 ? -16.080 17.759  50.084 1.00 0.38 ? 115 ILE A CA     1 
ATOM 2516 C C      . ILE C 3 115 ? -14.880 17.405  50.977 1.00 0.38 ? 115 ILE A C      1 
ATOM 2517 O O      . ILE C 3 115 ? -14.823 17.778  52.162 1.00 0.38 ? 115 ILE A O      1 
ATOM 2518 C CB     . ILE C 3 115 ? -17.031 16.563  50.005 1.00 0.36 ? 115 ILE A CB     1 
ATOM 2519 C CG1    . ILE C 3 115 ? -18.063 16.806  48.901 1.00 0.36 ? 115 ILE A CG1    1 
ATOM 2520 C CG2    . ILE C 3 115 ? -17.749 16.393  51.343 1.00 0.34 ? 115 ILE A CG2    1 
ATOM 2521 C CD1    . ILE C 3 115 ? -18.973 15.584  48.774 1.00 0.34 ? 115 ILE A CD1    1 
ATOM 2522 H H      . ILE C 3 115 ? -15.866 17.533  47.987 1.00 0.39 ? 115 ILE A H      1 
ATOM 2523 H HA     . ILE C 3 115 ? -16.602 18.608  50.500 1.00 0.38 ? 115 ILE A HA     1 
ATOM 2524 H HB     . ILE C 3 115 ? -16.466 15.669  49.783 1.00 0.36 ? 115 ILE A HB     1 
ATOM 2525 H HG12   . ILE C 3 115 ? -18.656 17.675  49.148 1.00 0.36 ? 115 ILE A HG12   1 
ATOM 2526 H HG13   . ILE C 3 115 ? -17.554 16.972  47.963 1.00 0.37 ? 115 ILE A HG13   1 
ATOM 2527 H HG21   . ILE C 3 115 ? -17.364 15.522  51.852 1.00 0.34 ? 115 ILE A HG21   1 
ATOM 2528 H HG22   . ILE C 3 115 ? -18.808 16.271  51.171 1.00 0.34 ? 115 ILE A HG22   1 
ATOM 2529 H HG23   . ILE C 3 115 ? -17.584 17.268  51.955 1.00 0.35 ? 115 ILE A HG23   1 
ATOM 2530 H HD11   . ILE C 3 115 ? -18.372 14.687  48.759 1.00 0.34 ? 115 ILE A HD11   1 
ATOM 2531 H HD12   . ILE C 3 115 ? -19.542 15.652  47.859 1.00 0.35 ? 115 ILE A HD12   1 
ATOM 2532 H HD13   . ILE C 3 115 ? -19.649 15.550  49.616 1.00 0.33 ? 115 ILE A HD13   1 
ATOM 2533 N N      . ARG C 3 116 ? -13.913 16.704  50.392 1.00 0.38 ? 116 ARG A N      1 
ATOM 2534 C CA     . ARG C 3 116 ? -12.704 16.312  51.114 1.00 0.39 ? 116 ARG A CA     1 
ATOM 2535 C C      . ARG C 3 116 ? -12.000 17.535  51.706 1.00 0.40 ? 116 ARG A C      1 
ATOM 2536 O O      . ARG C 3 116 ? -11.822 17.637  52.927 1.00 0.40 ? 116 ARG A O      1 
ATOM 2537 C CB     . ARG C 3 116 ? -11.735 15.595  50.167 1.00 0.39 ? 116 ARG A CB     1 
ATOM 2538 C CG     . ARG C 3 116 ? -12.265 14.195  49.853 1.00 0.38 ? 116 ARG A CG     1 
ATOM 2539 C CD     . ARG C 3 116 ? -11.312 13.486  48.890 1.00 0.39 ? 116 ARG A CD     1 
ATOM 2540 N NE     . ARG C 3 116 ? -11.840 12.126  48.588 1.00 0.37 ? 116 ARG A NE     1 
ATOM 2541 C CZ     . ARG C 3 116 ? -11.346 11.442  47.594 1.00 0.38 ? 116 ARG A CZ     1 
ATOM 2542 N NH1    . ARG C 3 116 ? -10.393 11.952  46.863 1.00 0.41 ? 116 ARG A NH1    1 
ATOM 2543 N NH2    . ARG C 3 116 ? -11.807 10.250  47.328 1.00 0.37 ? 116 ARG A NH2    1 
ATOM 2544 H H      . ARG C 3 116 ? -14.008 16.453  49.449 1.00 0.39 ? 116 ARG A H      1 
ATOM 2545 H HA     . ARG C 3 116 ? -12.967 15.631  51.908 1.00 0.37 ? 116 ARG A HA     1 
ATOM 2546 H HB2    . ARG C 3 116 ? -11.642 16.161  49.251 1.00 0.40 ? 116 ARG A HB2    1 
ATOM 2547 H HB3    . ARG C 3 116 ? -10.766 15.512  50.637 1.00 0.40 ? 116 ARG A HB3    1 
ATOM 2548 H HG2    . ARG C 3 116 ? -12.341 13.627  50.768 1.00 0.36 ? 116 ARG A HG2    1 
ATOM 2549 H HG3    . ARG C 3 116 ? -13.235 14.274  49.400 1.00 0.37 ? 116 ARG A HG3    1 
ATOM 2550 H HD2    . ARG C 3 116 ? -11.231 14.051  47.976 1.00 0.40 ? 116 ARG A HD2    1 
ATOM 2551 H HD3    . ARG C 3 116 ? -10.337 13.403  49.348 1.00 0.39 ? 116 ARG A HD3    1 
ATOM 2552 H HE     . ARG C 3 116 ? -12.558 11.746  49.136 1.00 0.36 ? 116 ARG A HE     1 
ATOM 2553 H HH11   . ARG C 3 116 ? -10.043 12.866  47.067 1.00 0.42 ? 116 ARG A HH11   1 
ATOM 2554 H HH12   . ARG C 3 116 ? -10.014 11.429  46.100 1.00 0.42 ? 116 ARG A HH12   1 
ATOM 2555 H HH21   . ARG C 3 116 ? -12.539 9.861   47.886 1.00 0.36 ? 116 ARG A HH21   1 
ATOM 2556 H HH22   . ARG C 3 116 ? -11.428 9.726   46.565 1.00 0.38 ? 116 ARG A HH22   1 
ATOM 2557 N N      . VAL C 3 117 ? -11.619 18.467  50.835 1.00 0.42 ? 117 VAL A N      1 
ATOM 2558 C CA     . VAL C 3 117 ? -10.935 19.676  51.269 1.00 0.44 ? 117 VAL A CA     1 
ATOM 2559 C C      . VAL C 3 117 ? -11.657 20.360  52.430 1.00 0.43 ? 117 VAL A C      1 
ATOM 2560 O O      . VAL C 3 117 ? -11.031 20.693  53.444 1.00 0.44 ? 117 VAL A O      1 
ATOM 2561 C CB     . VAL C 3 117 ? -10.847 20.650  50.092 1.00 0.45 ? 117 VAL A CB     1 
ATOM 2562 C CG1    . VAL C 3 117 ? -9.714  20.221  49.159 1.00 0.46 ? 117 VAL A CG1    1 
ATOM 2563 C CG2    . VAL C 3 117 ? -12.170 20.642  49.323 1.00 0.45 ? 117 VAL A CG2    1 
ATOM 2564 H H      . VAL C 3 117 ? -11.798 18.332  49.880 1.00 0.42 ? 117 VAL A H      1 
ATOM 2565 H HA     . VAL C 3 117 ? -9.935  19.420  51.578 1.00 0.44 ? 117 VAL A HA     1 
ATOM 2566 H HB     . VAL C 3 117 ? -10.650 21.644  50.465 1.00 0.47 ? 117 VAL A HB     1 
ATOM 2567 H HG11   . VAL C 3 117 ? -8.786  20.186  49.711 1.00 0.47 ? 117 VAL A HG11   1 
ATOM 2568 H HG12   . VAL C 3 117 ? -9.625  20.931  48.350 1.00 0.48 ? 117 VAL A HG12   1 
ATOM 2569 H HG13   . VAL C 3 117 ? -9.929  19.242  48.757 1.00 0.45 ? 117 VAL A HG13   1 
ATOM 2570 H HG21   . VAL C 3 117 ? -12.950 21.058  49.943 1.00 0.44 ? 117 VAL A HG21   1 
ATOM 2571 H HG22   . VAL C 3 117 ? -12.426 19.627  49.057 1.00 0.43 ? 117 VAL A HG22   1 
ATOM 2572 H HG23   . VAL C 3 117 ? -12.068 21.234  48.427 1.00 0.46 ? 117 VAL A HG23   1 
ATOM 2573 N N      . ALA C 3 118 ? -12.967 20.560  52.288 1.00 0.42 ? 118 ALA A N      1 
ATOM 2574 C CA     . ALA C 3 118 ? -13.763 21.198  53.337 1.00 0.42 ? 118 ALA A CA     1 
ATOM 2575 C C      . ALA C 3 118 ? -13.682 20.362  54.601 1.00 0.41 ? 118 ALA A C      1 
ATOM 2576 O O      . ALA C 3 118 ? -13.492 20.887  55.712 1.00 0.41 ? 118 ALA A O      1 
ATOM 2577 C CB     . ALA C 3 118 ? -15.220 21.303  52.884 1.00 0.41 ? 118 ALA A CB     1 
ATOM 2578 H H      . ALA C 3 118 ? -13.410 20.266  51.464 1.00 0.42 ? 118 ALA A H      1 
ATOM 2579 H HA     . ALA C 3 118 ? -13.376 22.186  53.532 1.00 0.44 ? 118 ALA A HA     1 
ATOM 2580 H HB1    . ALA C 3 118 ? -15.804 21.777  53.659 1.00 0.41 ? 118 ALA A HB1    1 
ATOM 2581 H HB2    . ALA C 3 118 ? -15.610 20.314  52.694 1.00 0.40 ? 118 ALA A HB2    1 
ATOM 2582 H HB3    . ALA C 3 118 ? -15.274 21.892  51.982 1.00 0.42 ? 118 ALA A HB3    1 
ATOM 2583 N N      . LEU C 3 119 ? -13.816 19.051  54.431 1.00 0.39 ? 119 LEU A N      1 
ATOM 2584 C CA     . LEU C 3 119 ? -13.734 18.151  55.574 1.00 0.38 ? 119 LEU A CA     1 
ATOM 2585 C C      . LEU C 3 119 ? -12.397 18.363  56.271 1.00 0.39 ? 119 LEU A C      1 
ATOM 2586 O O      . LEU C 3 119 ? -12.350 18.471  57.496 1.00 0.40 ? 119 LEU A O      1 
ATOM 2587 C CB     . LEU C 3 119 ? -13.841 16.701  55.096 1.00 0.37 ? 119 LEU A CB     1 
ATOM 2588 C CG     . LEU C 3 119 ? -15.305 16.365  54.805 1.00 0.35 ? 119 LEU A CG     1 
ATOM 2589 C CD1    . LEU C 3 119 ? -15.388 15.002  54.117 1.00 0.34 ? 119 LEU A CD1    1 
ATOM 2590 C CD2    . LEU C 3 119 ? -16.087 16.321  56.120 1.00 0.34 ? 119 LEU A CD2    1 
ATOM 2591 H H      . LEU C 3 119 ? -13.959 18.686  53.534 1.00 0.39 ? 119 LEU A H      1 
ATOM 2592 H HA     . LEU C 3 119 ? -14.540 18.364  56.260 1.00 0.38 ? 119 LEU A HA     1 
ATOM 2593 H HB2    . LEU C 3 119 ? -13.256 16.575  54.196 1.00 0.37 ? 119 LEU A HB2    1 
ATOM 2594 H HB3    . LEU C 3 119 ? -13.469 16.040  55.865 1.00 0.36 ? 119 LEU A HB3    1 
ATOM 2595 H HG     . LEU C 3 119 ? -15.726 17.121  54.158 1.00 0.36 ? 119 LEU A HG     1 
ATOM 2596 H HD11   . LEU C 3 119 ? -14.907 14.257  54.734 1.00 0.33 ? 119 LEU A HD11   1 
ATOM 2597 H HD12   . LEU C 3 119 ? -14.893 15.051  53.159 1.00 0.35 ? 119 LEU A HD12   1 
ATOM 2598 H HD13   . LEU C 3 119 ? -16.425 14.734  53.974 1.00 0.33 ? 119 LEU A HD13   1 
ATOM 2599 H HD21   . LEU C 3 119 ? -15.527 15.760  56.854 1.00 0.34 ? 119 LEU A HD21   1 
ATOM 2600 H HD22   . LEU C 3 119 ? -17.042 15.842  55.955 1.00 0.33 ? 119 LEU A HD22   1 
ATOM 2601 H HD23   . LEU C 3 119 ? -16.247 17.326  56.478 1.00 0.35 ? 119 LEU A HD23   1 
ATOM 2602 N N      . GLU C 3 120 ? -11.318 18.451  55.496 1.00 0.41 ? 120 GLU A N      1 
ATOM 2603 C CA     . GLU C 3 120 ? -9.987  18.665  56.074 1.00 0.42 ? 120 GLU A CA     1 
ATOM 2604 C C      . GLU C 3 120 ? -9.942  19.980  56.844 1.00 0.43 ? 120 GLU A C      1 
ATOM 2605 O O      . GLU C 3 120 ? -9.389  20.054  57.945 1.00 0.44 ? 120 GLU A O      1 
ATOM 2606 C CB     . GLU C 3 120 ? -8.945  18.701  54.953 1.00 0.43 ? 120 GLU A CB     1 
ATOM 2607 C CG     . GLU C 3 120 ? -8.801  17.306  54.342 1.00 0.42 ? 120 GLU A CG     1 
ATOM 2608 C CD     . GLU C 3 120 ? -8.202  16.353  55.380 1.00 0.42 ? 120 GLU A CD     1 
ATOM 2609 O OE1    . GLU C 3 120 ? -7.988  16.787  56.498 1.00 0.42 ? 120 GLU A OE1    1 
ATOM 2610 O OE2    . GLU C 3 120 ? -7.968  15.206  55.035 1.00 0.41 ? 120 GLU A OE2    1 
ATOM 2611 H H      . GLU C 3 120 ? -11.414 18.378  54.524 1.00 0.41 ? 120 GLU A H      1 
ATOM 2612 H HA     . GLU C 3 120 ? -9.754  17.851  56.744 1.00 0.41 ? 120 GLU A HA     1 
ATOM 2613 H HB2    . GLU C 3 120 ? -9.262  19.398  54.191 1.00 0.44 ? 120 GLU A HB2    1 
ATOM 2614 H HB3    . GLU C 3 120 ? -7.994  19.016  55.356 1.00 0.45 ? 120 GLU A HB3    1 
ATOM 2615 H HG2    . GLU C 3 120 ? -9.773  16.945  54.038 1.00 0.41 ? 120 GLU A HG2    1 
ATOM 2616 H HG3    . GLU C 3 120 ? -8.150  17.356  53.484 1.00 0.43 ? 120 GLU A HG3    1 
ATOM 2617 N N      . LYS C 3 121 ? -10.530 21.014  56.251 1.00 0.44 ? 121 LYS A N      1 
ATOM 2618 C CA     . LYS C 3 121 ? -10.578 22.326  56.874 1.00 0.45 ? 121 LYS A CA     1 
ATOM 2619 C C      . LYS C 3 121 ? -11.252 22.172  58.232 1.00 0.45 ? 121 LYS A C      1 
ATOM 2620 O O      . LYS C 3 121 ? -10.747 22.645  59.251 1.00 0.46 ? 121 LYS A O      1 
ATOM 2621 C CB     . LYS C 3 121 ? -11.388 23.288  56.000 1.00 0.46 ? 121 LYS A CB     1 
ATOM 2622 H H      . LYS C 3 121 ? -10.951 20.886  55.375 1.00 0.44 ? 121 LYS A H      1 
ATOM 2623 H HA     . LYS C 3 121 ? -9.576  22.706  57.005 1.00 0.47 ? 121 LYS A HA     1 
ATOM 2624 H HB2    . LYS C 3 121 ? -11.268 24.296  56.367 1.00 0.47 ? 121 LYS A HB2    1 
ATOM 2625 H HB3    . LYS C 3 121 ? -11.035 23.230  54.981 1.00 0.46 ? 121 LYS A HB3    1 
ATOM 2626 N N      . SER C 3 122 ? -12.396 21.495  58.239 1.00 0.43 ? 122 SER A N      1 
ATOM 2627 C CA     . SER C 3 122 ? -13.125 21.280  59.479 1.00 0.42 ? 122 SER A CA     1 
ATOM 2628 C C      . SER C 3 122 ? -12.251 20.565  60.499 1.00 0.42 ? 122 SER A C      1 
ATOM 2629 O O      . SER C 3 122 ? -12.109 21.019  61.636 1.00 0.43 ? 122 SER A O      1 
ATOM 2630 C CB     . SER C 3 122 ? -14.369 20.440  59.197 1.00 0.40 ? 122 SER A CB     1 
ATOM 2631 O OG     . SER C 3 122 ? -15.055 20.196  60.418 1.00 0.39 ? 122 SER A OG     1 
ATOM 2632 H H      . SER C 3 122 ? -12.747 21.133  57.402 1.00 0.42 ? 122 SER A H      1 
ATOM 2633 H HA     . SER C 3 122 ? -13.431 22.234  59.879 1.00 0.43 ? 122 SER A HA     1 
ATOM 2634 H HB2    . SER C 3 122 ? -15.022 20.972  58.524 1.00 0.40 ? 122 SER A HB2    1 
ATOM 2635 H HB3    . SER C 3 122 ? -14.075 19.503  58.744 1.00 0.39 ? 122 SER A HB3    1 
ATOM 2636 H HG     . SER C 3 122 ? -14.964 20.979  60.970 1.00 0.40 ? 122 SER A HG     1 
ATOM 2637 N N      . PHE C 3 123 ? -11.672 19.438  60.092 1.00 0.41 ? 123 PHE A N      1 
ATOM 2638 C CA     . PHE C 3 123 ? -10.811 18.663  60.977 1.00 0.41 ? 123 PHE A CA     1 
ATOM 2639 C C      . PHE C 3 123 ? -9.806  19.596  61.670 1.00 0.43 ? 123 PHE A C      1 
ATOM 2640 O O      . PHE C 3 123 ? -9.532  19.470  62.874 1.00 0.44 ? 123 PHE A O      1 
ATOM 2641 C CB     . PHE C 3 123 ? -10.057 17.615  60.154 1.00 0.41 ? 123 PHE A CB     1 
ATOM 2642 C CG     . PHE C 3 123 ? -9.249  16.731  61.072 1.00 0.41 ? 123 PHE A CG     1 
ATOM 2643 C CD1    . PHE C 3 123 ? -9.895  15.942  62.031 1.00 0.40 ? 123 PHE A CD1    1 
ATOM 2644 C CD2    . PHE C 3 123 ? -7.855  16.702  60.964 1.00 0.42 ? 123 PHE A CD2    1 
ATOM 2645 C CE1    . PHE C 3 123 ? -9.145  15.121  62.882 1.00 0.40 ? 123 PHE A CE1    1 
ATOM 2646 C CE2    . PHE C 3 123 ? -7.104  15.883  61.815 1.00 0.42 ? 123 PHE A CE2    1 
ATOM 2647 C CZ     . PHE C 3 123 ? -7.749  15.092  62.773 1.00 0.41 ? 123 PHE A CZ     1 
ATOM 2648 H H      . PHE C 3 123 ? -11.828 19.124  59.175 1.00 0.41 ? 123 PHE A H      1 
ATOM 2649 H HA     . PHE C 3 123 ? -11.414 18.166  61.722 1.00 0.40 ? 123 PHE A HA     1 
ATOM 2650 H HB2    . PHE C 3 123 ? -10.765 17.010  59.606 1.00 0.39 ? 123 PHE A HB2    1 
ATOM 2651 H HB3    . PHE C 3 123 ? -9.394  18.111  59.460 1.00 0.42 ? 123 PHE A HB3    1 
ATOM 2652 H HD1    . PHE C 3 123 ? -10.972 15.966  62.113 1.00 0.39 ? 123 PHE A HD1    1 
ATOM 2653 H HD2    . PHE C 3 123 ? -7.357  17.313  60.226 1.00 0.43 ? 123 PHE A HD2    1 
ATOM 2654 H HE1    . PHE C 3 123 ? -9.642  14.512  63.621 1.00 0.39 ? 123 PHE A HE1    1 
ATOM 2655 H HE2    . PHE C 3 123 ? -6.028  15.861  61.732 1.00 0.43 ? 123 PHE A HE2    1 
ATOM 2656 H HZ     . PHE C 3 123 ? -7.171  14.459  63.430 1.00 0.41 ? 123 PHE A HZ     1 
ATOM 2657 N N      . LEU C 3 124 ? -9.278  20.531  60.878 1.00 0.45 ? 124 LEU A N      1 
ATOM 2658 C CA     . LEU C 3 124 ? -8.325  21.524  61.384 1.00 0.47 ? 124 LEU A CA     1 
ATOM 2659 C C      . LEU C 3 124 ? -8.913  22.334  62.543 1.00 0.47 ? 124 LEU A C      1 
ATOM 2660 O O      . LEU C 3 124 ? -8.288  22.549  63.563 1.00 0.48 ? 124 LEU A O      1 
ATOM 2661 C CB     . LEU C 3 124 ? -7.941  22.476  60.250 1.00 0.48 ? 124 LEU A CB     1 
ATOM 2662 C CG     . LEU C 3 124 ? -6.990  21.763  59.285 1.00 0.48 ? 124 LEU A CG     1 
ATOM 2663 C CD1    . LEU C 3 124 ? -6.765  22.639  58.053 1.00 0.49 ? 124 LEU A CD1    1 
ATOM 2664 C CD2    . LEU C 3 124 ? -5.651  21.513  59.983 1.00 0.49 ? 124 LEU A CD2    1 
ATOM 2665 H H      . LEU C 3 124 ? -9.552  20.569  59.936 1.00 0.44 ? 124 LEU A H      1 
ATOM 2666 H HA     . LEU C 3 124 ? -7.438  21.015  61.727 1.00 0.47 ? 124 LEU A HA     1 
ATOM 2667 H HB2    . LEU C 3 124 ? -8.831  22.781  59.720 1.00 0.48 ? 124 LEU A HB2    1 
ATOM 2668 H HB3    . LEU C 3 124 ? -7.449  23.343  60.661 1.00 0.50 ? 124 LEU A HB3    1 
ATOM 2669 H HG     . LEU C 3 124 ? -7.423  20.821  58.984 1.00 0.47 ? 124 LEU A HG     1 
ATOM 2670 H HD11   . LEU C 3 124 ? -6.126  23.470  58.313 1.00 0.51 ? 124 LEU A HD11   1 
ATOM 2671 H HD12   . LEU C 3 124 ? -7.714  23.012  57.698 1.00 0.49 ? 124 LEU A HD12   1 
ATOM 2672 H HD13   . LEU C 3 124 ? -6.295  22.053  57.277 1.00 0.49 ? 124 LEU A HD13   1 
ATOM 2673 H HD21   . LEU C 3 124 ? -4.883  21.354  59.241 1.00 0.50 ? 124 LEU A HD21   1 
ATOM 2674 H HD22   . LEU C 3 124 ? -5.730  20.638  60.612 1.00 0.48 ? 124 LEU A HD22   1 
ATOM 2675 H HD23   . LEU C 3 124 ? -5.394  22.369  60.589 1.00 0.50 ? 124 LEU A HD23   1 
ATOM 2676 N N      . GLU C 3 125 ? -10.155 22.771  62.362 1.00 0.47 ? 125 GLU A N      1 
ATOM 2677 C CA     . GLU C 3 125 ? -10.815 23.536  63.405 1.00 0.47 ? 125 GLU A CA     1 
ATOM 2678 C C      . GLU C 3 125 ? -11.048 22.660  64.618 1.00 0.46 ? 125 GLU A C      1 
ATOM 2679 O O      . GLU C 3 125 ? -10.548 22.948  65.706 1.00 0.47 ? 125 GLU A O      1 
ATOM 2680 C CB     . GLU C 3 125 ? -12.157 24.058  62.888 1.00 0.46 ? 125 GLU A CB     1 
ATOM 2681 C CG     . GLU C 3 125 ? -11.912 25.068  61.767 1.00 0.48 ? 125 GLU A CG     1 
ATOM 2682 C CD     . GLU C 3 125 ? -13.252 25.605  61.261 1.00 0.47 ? 125 GLU A CD     1 
ATOM 2683 O OE1    . GLU C 3 125 ? -13.943 26.242  62.037 1.00 0.47 ? 125 GLU A OE1    1 
ATOM 2684 O OE2    . GLU C 3 125 ? -13.563 25.369  60.106 1.00 0.46 ? 125 GLU A OE2    1 
ATOM 2685 H H      . GLU C 3 125 ? -10.628 22.580  61.524 1.00 0.46 ? 125 GLU A H      1 
ATOM 2686 H HA     . GLU C 3 125 ? -10.192 24.373  63.682 1.00 0.49 ? 125 GLU A HA     1 
ATOM 2687 H HB2    . GLU C 3 125 ? -12.743 23.232  62.509 1.00 0.45 ? 125 GLU A HB2    1 
ATOM 2688 H HB3    . GLU C 3 125 ? -12.690 24.540  63.694 1.00 0.47 ? 125 GLU A HB3    1 
ATOM 2689 H HG2    . GLU C 3 125 ? -11.314 25.887  62.144 1.00 0.49 ? 125 GLU A HG2    1 
ATOM 2690 H HG3    . GLU C 3 125 ? -11.390 24.585  60.954 1.00 0.47 ? 125 GLU A HG3    1 
ATOM 2691 N N      . ASN C 3 126 ? -11.820 21.592  64.427 1.00 0.44 ? 126 ASN A N      1 
ATOM 2692 C CA     . ASN C 3 126 ? -12.135 20.670  65.518 1.00 0.44 ? 126 ASN A CA     1 
ATOM 2693 C C      . ASN C 3 126 ? -11.871 19.228  65.066 1.00 0.42 ? 126 ASN A C      1 
ATOM 2694 O O      . ASN C 3 126 ? -12.486 18.737  64.116 1.00 0.41 ? 126 ASN A O      1 
ATOM 2695 C CB     . ASN C 3 126 ? -13.607 20.823  65.906 1.00 0.43 ? 126 ASN A CB     1 
ATOM 2696 C CG     . ASN C 3 126 ? -13.865 20.089  67.223 1.00 0.42 ? 126 ASN A CG     1 
ATOM 2697 O OD1    . ASN C 3 126 ? -13.064 19.283  67.651 1.00 0.43 ? 126 ASN A OD1    1 
ATOM 2698 N ND2    . ASN C 3 126 ? -14.962 20.337  67.889 1.00 0.42 ? 126 ASN A ND2    1 
ATOM 2699 H H      . ASN C 3 126 ? -12.192 21.425  63.537 1.00 0.44 ? 126 ASN A H      1 
ATOM 2700 H HA     . ASN C 3 126 ? -11.514 20.900  66.371 1.00 0.45 ? 126 ASN A HA     1 
ATOM 2701 H HB2    . ASN C 3 126 ? -13.840 21.872  66.024 1.00 0.44 ? 126 ASN A HB2    1 
ATOM 2702 H HB3    . ASN C 3 126 ? -14.228 20.401  65.133 1.00 0.41 ? 126 ASN A HB3    1 
ATOM 2703 H HD21   . ASN C 3 126 ? -15.607 20.990  67.543 1.00 0.42 ? 126 ASN A HD21   1 
ATOM 2704 H HD22   . ASN C 3 126 ? -15.138 19.871  68.732 1.00 0.42 ? 126 ASN A HD22   1 
ATOM 2705 N N      . GLN C 3 127 ? -10.945 18.563  65.751 1.00 0.43 ? 127 GLN A N      1 
ATOM 2706 C CA     . GLN C 3 127 ? -10.604 17.179  65.441 1.00 0.41 ? 127 GLN A CA     1 
ATOM 2707 C C      . GLN C 3 127 ? -11.712 16.210  65.844 1.00 0.40 ? 127 GLN A C      1 
ATOM 2708 O O      . GLN C 3 127 ? -11.929 15.210  65.163 1.00 0.38 ? 127 GLN A O      1 
ATOM 2709 C CB     . GLN C 3 127 ? -9.319  16.801  66.182 1.00 0.42 ? 127 GLN A CB     1 
ATOM 2710 C CG     . GLN C 3 127 ? -8.117  16.998  65.258 1.00 0.43 ? 127 GLN A CG     1 
ATOM 2711 C CD     . GLN C 3 127 ? -6.927  16.198  65.790 1.00 0.44 ? 127 GLN A CD     1 
ATOM 2712 O OE1    . GLN C 3 127 ? -7.071  15.054  66.171 1.00 0.43 ? 127 GLN A OE1    1 
ATOM 2713 N NE2    . GLN C 3 127 ? -5.748  16.755  65.830 1.00 0.46 ? 127 GLN A NE2    1 
ATOM 2714 H H      . GLN C 3 127 ? -10.486 19.010  66.493 1.00 0.44 ? 127 GLN A H      1 
ATOM 2715 H HA     . GLN C 3 127 ? -10.428 17.090  64.381 1.00 0.41 ? 127 GLN A HA     1 
ATOM 2716 H HB2    . GLN C 3 127 ? -9.210  17.430  67.055 1.00 0.44 ? 127 GLN A HB2    1 
ATOM 2717 H HB3    . GLN C 3 127 ? -9.371  15.767  66.488 1.00 0.42 ? 127 GLN A HB3    1 
ATOM 2718 H HG2    . GLN C 3 127 ? -8.367  16.655  64.263 1.00 0.42 ? 127 GLN A HG2    1 
ATOM 2719 H HG3    . GLN C 3 127 ? -7.857  18.046  65.223 1.00 0.45 ? 127 GLN A HG3    1 
ATOM 2720 H HE21   . GLN C 3 127 ? -5.631  17.678  65.523 1.00 0.46 ? 127 GLN A HE21   1 
ATOM 2721 H HE22   . GLN C 3 127 ? -4.978  16.251  66.170 1.00 0.46 ? 127 GLN A HE22   1 
ATOM 2722 N N      . LYS C 3 128 ? -12.419 16.506  66.936 1.00 0.40 ? 128 LYS A N      1 
ATOM 2723 C CA     . LYS C 3 128 ? -13.479 15.616  67.416 1.00 0.39 ? 128 LYS A CA     1 
ATOM 2724 C C      . LYS C 3 128 ? -14.866 16.252  67.601 1.00 0.38 ? 128 LYS A C      1 
ATOM 2725 O O      . LYS C 3 128 ? -15.307 16.476  68.737 1.00 0.39 ? 128 LYS A O      1 
ATOM 2726 C CB     . LYS C 3 128 ? -13.039 15.022  68.755 1.00 0.39 ? 128 LYS A CB     1 
ATOM 2727 H H      . LYS C 3 128 ? -12.211 17.321  67.437 1.00 0.41 ? 128 LYS A H      1 
ATOM 2728 H HA     . LYS C 3 128 ? -13.575 14.803  66.717 1.00 0.37 ? 128 LYS A HA     1 
ATOM 2729 H HB2    . LYS C 3 128 ? -12.652 15.805  69.388 1.00 0.41 ? 128 LYS A HB2    1 
ATOM 2730 H HB3    . LYS C 3 128 ? -12.272 14.279  68.585 1.00 0.39 ? 128 LYS A HB3    1 
ATOM 2731 N N      . PRO C 3 129 ? -15.576 16.541  66.487 1.00 0.37 ? 129 PRO A N      1 
ATOM 2732 C CA     . PRO C 3 129 ? -16.912 17.144  66.553 1.00 0.37 ? 129 PRO A CA     1 
ATOM 2733 C C      . PRO C 3 129 ? -17.922 16.180  67.154 1.00 0.36 ? 129 PRO A C      1 
ATOM 2734 O O      . PRO C 3 129 ? -17.819 14.969  66.959 1.00 0.35 ? 129 PRO A O      1 
ATOM 2735 C CB     . PRO C 3 129 ? -17.266 17.450  65.093 1.00 0.36 ? 129 PRO A CB     1 
ATOM 2736 C CG     . PRO C 3 129 ? -16.381 16.574  64.270 1.00 0.36 ? 129 PRO A CG     1 
ATOM 2737 C CD     . PRO C 3 129 ? -15.131 16.305  65.105 1.00 0.37 ? 129 PRO A CD     1 
ATOM 2738 H HA     . PRO C 3 129 ? -16.884 18.061  67.117 1.00 0.38 ? 129 PRO A HA     1 
ATOM 2739 H HB2    . PRO C 3 129 ? -18.305 17.218  64.907 1.00 0.35 ? 129 PRO A HB2    1 
ATOM 2740 H HB3    . PRO C 3 129 ? -17.068 18.487  64.870 1.00 0.37 ? 129 PRO A HB3    1 
ATOM 2741 H HG2    . PRO C 3 129 ? -16.888 15.644  64.047 1.00 0.34 ? 129 PRO A HG2    1 
ATOM 2742 H HG3    . PRO C 3 129 ? -16.105 17.077  63.358 1.00 0.36 ? 129 PRO A HG3    1 
ATOM 2743 H HD2    . PRO C 3 129 ? -14.803 15.283  64.977 1.00 0.36 ? 129 PRO A HD2    1 
ATOM 2744 H HD3    . PRO C 3 129 ? -14.345 16.996  64.845 1.00 0.38 ? 129 PRO A HD3    1 
ATOM 2745 N N      . THR C 3 130 ? -18.887 16.723  67.891 1.00 0.36 ? 130 THR A N      1 
ATOM 2746 C CA     . THR C 3 130 ? -19.916 15.918  68.551 1.00 0.35 ? 130 THR A CA     1 
ATOM 2747 C C      . THR C 3 130 ? -20.976 15.433  67.574 1.00 0.34 ? 130 THR A C      1 
ATOM 2748 O O      . THR C 3 130 ? -21.057 15.892  66.425 1.00 0.33 ? 130 THR A O      1 
ATOM 2749 C CB     . THR C 3 130 ? -20.591 16.758  69.638 1.00 0.37 ? 130 THR A CB     1 
ATOM 2750 O OG1    . THR C 3 130 ? -21.446 17.715  69.033 1.00 0.36 ? 130 THR A OG1    1 
ATOM 2751 C CG2    . THR C 3 130 ? -19.526 17.476  70.470 1.00 0.38 ? 130 THR A CG2    1 
ATOM 2752 H H      . THR C 3 130 ? -18.900 17.696  68.007 1.00 0.37 ? 130 THR A H      1 
ATOM 2753 H HA     . THR C 3 130 ? -19.451 15.065  69.015 1.00 0.35 ? 130 THR A HA     1 
ATOM 2754 H HB     . THR C 3 130 ? -21.169 16.114  70.283 1.00 0.36 ? 130 THR A HB     1 
ATOM 2755 H HG1    . THR C 3 130 ? -21.209 17.781  68.104 1.00 0.36 ? 130 THR A HG1    1 
ATOM 2756 H HG21   . THR C 3 130 ? -19.731 17.330  71.519 1.00 0.39 ? 130 THR A HG21   1 
ATOM 2757 H HG22   . THR C 3 130 ? -19.544 18.531  70.240 1.00 0.39 ? 130 THR A HG22   1 
ATOM 2758 H HG23   . THR C 3 130 ? -18.554 17.073  70.234 1.00 0.38 ? 130 THR A HG23   1 
ATOM 2759 N N      . SER C 3 131 ? -21.806 14.507  68.048 1.00 0.33 ? 131 SER A N      1 
ATOM 2760 C CA     . SER C 3 131 ? -22.864 13.955  67.211 1.00 0.31 ? 131 SER A CA     1 
ATOM 2761 C C      . SER C 3 131 ? -23.662 15.095  66.580 1.00 0.31 ? 131 SER A C      1 
ATOM 2762 O O      . SER C 3 131 ? -24.095 15.007  65.428 1.00 0.30 ? 131 SER A O      1 
ATOM 2763 C CB     . SER C 3 131 ? -23.792 13.090  68.062 1.00 0.31 ? 131 SER A CB     1 
ATOM 2764 O OG     . SER C 3 131 ? -24.596 12.287  67.209 1.00 0.29 ? 131 SER A OG     1 
ATOM 2765 H H      . SER C 3 131 ? -21.705 14.191  68.969 1.00 0.33 ? 131 SER A H      1 
ATOM 2766 H HA     . SER C 3 131 ? -22.427 13.350  66.431 1.00 0.30 ? 131 SER A HA     1 
ATOM 2767 H HB2    . SER C 3 131 ? -23.207 12.451  68.702 1.00 0.31 ? 131 SER A HB2    1 
ATOM 2768 H HB3    . SER C 3 131 ? -24.421 13.728  68.671 1.00 0.32 ? 131 SER A HB3    1 
ATOM 2769 H HG     . SER C 3 131 ? -25.027 12.865  66.576 1.00 0.29 ? 131 SER A HG     1 
ATOM 2770 N N      . GLU C 3 132 ? -23.845 16.166  67.351 1.00 0.33 ? 132 GLU A N      1 
ATOM 2771 C CA     . GLU C 3 132 ? -24.580 17.335  66.884 1.00 0.33 ? 132 GLU A CA     1 
ATOM 2772 C C      . GLU C 3 132 ? -23.770 18.113  65.840 1.00 0.33 ? 132 GLU A C      1 
ATOM 2773 O O      . GLU C 3 132 ? -24.285 18.435  64.755 1.00 0.33 ? 132 GLU A O      1 
ATOM 2774 C CB     . GLU C 3 132 ? -24.885 18.249  68.071 1.00 0.35 ? 132 GLU A CB     1 
ATOM 2775 H H      . GLU C 3 132 ? -23.470 16.170  68.257 1.00 0.34 ? 132 GLU A H      1 
ATOM 2776 H HA     . GLU C 3 132 ? -25.511 17.014  66.442 1.00 0.32 ? 132 GLU A HA     1 
ATOM 2777 H HB2    . GLU C 3 132 ? -23.964 18.508  68.572 1.00 0.36 ? 132 GLU A HB2    1 
ATOM 2778 H HB3    . GLU C 3 132 ? -25.540 17.739  68.762 1.00 0.34 ? 132 GLU A HB3    1 
ATOM 2779 N N      . GLU C 3 133 ? -22.517 18.437  66.213 1.00 0.35 ? 133 GLU A N      1 
ATOM 2780 C CA     . GLU C 3 133 ? -21.651 19.117  65.258 1.00 0.35 ? 133 GLU A CA     1 
ATOM 2781 C C      . GLU C 3 133 ? -21.624 18.389  63.919 1.00 0.34 ? 133 GLU A C      1 
ATOM 2782 O O      . GLU C 3 133 ? -21.839 18.921  62.851 1.00 0.34 ? 133 GLU A O      1 
ATOM 2783 C CB     . GLU C 3 133 ? -20.230 19.184  65.822 1.00 0.36 ? 133 GLU A CB     1 
ATOM 2784 C CG     . GLU C 3 133 ? -20.209 20.091  67.052 1.00 0.38 ? 133 GLU A CG     1 
ATOM 2785 C CD     . GLU C 3 133 ? -18.770 20.259  67.540 1.00 0.39 ? 133 GLU A CD     1 
ATOM 2786 O OE1    . GLU C 3 133 ? -17.878 20.256  66.708 1.00 0.39 ? 133 GLU A OE1    1 
ATOM 2787 O OE2    . GLU C 3 133 ? -18.583 20.385  68.740 1.00 0.40 ? 133 GLU A OE2    1 
ATOM 2788 H H      . GLU C 3 133 ? -22.177 18.177  67.093 1.00 0.35 ? 133 GLU A H      1 
ATOM 2789 H HA     . GLU C 3 133 ? -22.011 20.123  65.106 1.00 0.36 ? 133 GLU A HA     1 
ATOM 2790 H HB2    . GLU C 3 133 ? -19.907 18.191  66.099 1.00 0.36 ? 133 GLU A HB2    1 
ATOM 2791 H HB3    . GLU C 3 133 ? -19.563 19.583  65.072 1.00 0.37 ? 133 GLU A HB3    1 
ATOM 2792 H HG2    . GLU C 3 133 ? -20.617 21.058  66.793 1.00 0.39 ? 133 GLU A HG2    1 
ATOM 2793 H HG3    . GLU C 3 133 ? -20.805 19.648  67.837 1.00 0.38 ? 133 GLU A HG3    1 
ATOM 2794 N N      . ILE C 3 134 ? -21.378 17.079  64.072 1.00 0.33 ? 134 ILE A N      1 
ATOM 2795 C CA     . ILE C 3 134 ? -21.341 16.176  62.929 1.00 0.31 ? 134 ILE A CA     1 
ATOM 2796 C C      . ILE C 3 134 ? -22.615 16.213  62.064 1.00 0.30 ? 134 ILE A C      1 
ATOM 2797 O O      . ILE C 3 134 ? -22.541 16.384  60.844 1.00 0.30 ? 134 ILE A O      1 
ATOM 2798 C CB     . ILE C 3 134 ? -21.133 14.749  63.437 1.00 0.30 ? 134 ILE A CB     1 
ATOM 2799 C CG1    . ILE C 3 134 ? -19.671 14.568  63.857 1.00 0.31 ? 134 ILE A CG1    1 
ATOM 2800 C CG2    . ILE C 3 134 ? -21.469 13.756  62.324 1.00 0.29 ? 134 ILE A CG2    1 
ATOM 2801 C CD1    . ILE C 3 134 ? -19.517 13.251  64.619 1.00 0.30 ? 134 ILE A CD1    1 
ATOM 2802 H H      . ILE C 3 134 ? -21.191 16.716  64.964 1.00 0.33 ? 134 ILE A H      1 
ATOM 2803 H HA     . ILE C 3 134 ? -20.497 16.439  62.311 1.00 0.32 ? 134 ILE A HA     1 
ATOM 2804 H HB     . ILE C 3 134 ? -21.777 14.571  64.286 1.00 0.30 ? 134 ILE A HB     1 
ATOM 2805 H HG12   . ILE C 3 134 ? -19.044 14.551  62.976 1.00 0.31 ? 134 ILE A HG12   1 
ATOM 2806 H HG13   . ILE C 3 134 ? -19.376 15.386  64.495 1.00 0.32 ? 134 ILE A HG13   1 
ATOM 2807 H HG21   . ILE C 3 134 ? -20.979 12.814  62.522 1.00 0.28 ? 134 ILE A HG21   1 
ATOM 2808 H HG22   . ILE C 3 134 ? -21.128 14.146  61.376 1.00 0.29 ? 134 ILE A HG22   1 
ATOM 2809 H HG23   . ILE C 3 134 ? -22.538 13.606  62.288 1.00 0.28 ? 134 ILE A HG23   1 
ATOM 2810 H HD11   . ILE C 3 134 ? -18.474 13.088  64.850 1.00 0.31 ? 134 ILE A HD11   1 
ATOM 2811 H HD12   . ILE C 3 134 ? -19.882 12.437  64.009 1.00 0.29 ? 134 ILE A HD12   1 
ATOM 2812 H HD13   . ILE C 3 134 ? -20.085 13.297  65.535 1.00 0.31 ? 134 ILE A HD13   1 
ATOM 2813 N N      . THR C 3 135 ? -23.780 16.065  62.691 1.00 0.30 ? 135 THR A N      1 
ATOM 2814 C CA     . THR C 3 135 ? -25.044 16.070  61.945 1.00 0.29 ? 135 THR A CA     1 
ATOM 2815 C C      . THR C 3 135 ? -25.170 17.338  61.116 1.00 0.30 ? 135 THR A C      1 
ATOM 2816 O O      . THR C 3 135 ? -25.644 17.308  59.975 1.00 0.29 ? 135 THR A O      1 
ATOM 2817 C CB     . THR C 3 135 ? -26.213 15.988  62.928 1.00 0.29 ? 135 THR A CB     1 
ATOM 2818 O OG1    . THR C 3 135 ? -25.934 15.001  63.912 1.00 0.28 ? 135 THR A OG1    1 
ATOM 2819 C CG2    . THR C 3 135 ? -27.490 15.613  62.175 1.00 0.27 ? 135 THR A CG2    1 
ATOM 2820 H H      . THR C 3 135 ? -23.793 15.940  63.663 1.00 0.30 ? 135 THR A H      1 
ATOM 2821 H HA     . THR C 3 135 ? -25.073 15.213  61.291 1.00 0.28 ? 135 THR A HA     1 
ATOM 2822 H HB     . THR C 3 135 ? -26.352 16.946  63.408 1.00 0.30 ? 135 THR A HB     1 
ATOM 2823 H HG1    . THR C 3 135 ? -25.539 15.439  64.669 1.00 0.29 ? 135 THR A HG1    1 
ATOM 2824 H HG21   . THR C 3 135 ? -28.294 15.466  62.880 1.00 0.27 ? 135 THR A HG21   1 
ATOM 2825 H HG22   . THR C 3 135 ? -27.325 14.701  61.621 1.00 0.26 ? 135 THR A HG22   1 
ATOM 2826 H HG23   . THR C 3 135 ? -27.751 16.407  61.491 1.00 0.28 ? 135 THR A HG23   1 
ATOM 2827 N N      . MET C 3 136 ? -24.755 18.444  61.731 1.00 0.31 ? 136 MET A N      1 
ATOM 2828 C CA     . MET C 3 136 ? -24.778 19.719  61.026 1.00 0.32 ? 136 MET A CA     1 
ATOM 2829 C C      . MET C 3 136 ? -23.939 19.662  59.757 1.00 0.32 ? 136 MET A C      1 
ATOM 2830 O O      . MET C 3 136 ? -24.400 19.836  58.646 1.00 0.32 ? 136 MET A O      1 
ATOM 2831 C CB     . MET C 3 136 ? -24.233 20.815  61.942 1.00 0.34 ? 136 MET A CB     1 
ATOM 2832 C CG     . MET C 3 136 ? -25.091 20.898  63.207 1.00 0.34 ? 136 MET A CG     1 
ATOM 2833 S SD     . MET C 3 136 ? -26.178 22.342  63.104 1.00 0.35 ? 136 MET A SD     1 
ATOM 2834 C CE     . MET C 3 136 ? -25.018 23.551  63.785 1.00 0.37 ? 136 MET A CE     1 
ATOM 2835 H H      . MET C 3 136 ? -24.404 18.395  62.645 1.00 0.32 ? 136 MET A H      1 
ATOM 2836 H HA     . MET C 3 136 ? -25.797 19.960  60.765 1.00 0.32 ? 136 MET A HA     1 
ATOM 2837 H HB2    . MET C 3 136 ? -23.212 20.584  62.213 1.00 0.34 ? 136 MET A HB2    1 
ATOM 2838 H HB3    . MET C 3 136 ? -24.263 21.763  61.427 1.00 0.35 ? 136 MET A HB3    1 
ATOM 2839 H HG2    . MET C 3 136 ? -25.688 20.003  63.295 1.00 0.33 ? 136 MET A HG2    1 
ATOM 2840 H HG3    . MET C 3 136 ? -24.449 20.991  64.071 1.00 0.35 ? 136 MET A HG3    1 
ATOM 2841 H HE1    . MET C 3 136 ? -24.057 23.440  63.300 1.00 0.37 ? 136 MET A HE1    1 
ATOM 2842 H HE2    . MET C 3 136 ? -24.902 23.386  64.843 1.00 0.38 ? 136 MET A HE2    1 
ATOM 2843 H HE3    . MET C 3 136 ? -25.400 24.549  63.618 1.00 0.38 ? 136 MET A HE3    1 
ATOM 2844 N N      . ILE C 3 137 ? -22.656 19.377  59.988 1.00 0.33 ? 137 ILE A N      1 
ATOM 2845 C CA     . ILE C 3 137 ? -21.669 19.250  58.918 1.00 0.33 ? 137 ILE A CA     1 
ATOM 2846 C C      . ILE C 3 137 ? -22.160 18.348  57.785 1.00 0.32 ? 137 ILE A C      1 
ATOM 2847 O O      . ILE C 3 137 ? -21.868 18.604  56.612 1.00 0.32 ? 137 ILE A O      1 
ATOM 2848 C CB     . ILE C 3 137 ? -20.380 18.667  59.496 1.00 0.33 ? 137 ILE A CB     1 
ATOM 2849 C CG1    . ILE C 3 137 ? -19.886 19.559  60.637 1.00 0.35 ? 137 ILE A CG1    1 
ATOM 2850 C CG2    . ILE C 3 137 ? -19.313 18.603  58.401 1.00 0.34 ? 137 ILE A CG2    1 
ATOM 2851 C CD1    . ILE C 3 137 ? -18.897 18.779  61.505 1.00 0.35 ? 137 ILE A CD1    1 
ATOM 2852 H H      . ILE C 3 137 ? -22.354 19.261  60.912 1.00 0.33 ? 137 ILE A H      1 
ATOM 2853 H HA     . ILE C 3 137 ? -21.456 20.228  58.520 1.00 0.34 ? 137 ILE A HA     1 
ATOM 2854 H HB     . ILE C 3 137 ? -20.571 17.672  59.870 1.00 0.32 ? 137 ILE A HB     1 
ATOM 2855 H HG12   . ILE C 3 137 ? -19.396 20.431  60.226 1.00 0.36 ? 137 ILE A HG12   1 
ATOM 2856 H HG13   . ILE C 3 137 ? -20.726 19.869  61.242 1.00 0.35 ? 137 ILE A HG13   1 
ATOM 2857 H HG21   . ILE C 3 137 ? -18.345 18.433  58.851 1.00 0.35 ? 137 ILE A HG21   1 
ATOM 2858 H HG22   . ILE C 3 137 ? -19.298 19.537  57.860 1.00 0.35 ? 137 ILE A HG22   1 
ATOM 2859 H HG23   . ILE C 3 137 ? -19.542 17.797  57.721 1.00 0.33 ? 137 ILE A HG23   1 
ATOM 2860 H HD11   . ILE C 3 137 ? -19.097 18.977  62.547 1.00 0.35 ? 137 ILE A HD11   1 
ATOM 2861 H HD12   . ILE C 3 137 ? -17.889 19.086  61.268 1.00 0.36 ? 137 ILE A HD12   1 
ATOM 2862 H HD13   . ILE C 3 137 ? -19.005 17.722  61.313 1.00 0.34 ? 137 ILE A HD13   1 
ATOM 2863 N N      . ALA C 3 138 ? -22.908 17.305  58.132 1.00 0.30 ? 138 ALA A N      1 
ATOM 2864 C CA     . ALA C 3 138 ? -23.436 16.378  57.133 1.00 0.29 ? 138 ALA A CA     1 
ATOM 2865 C C      . ALA C 3 138 ? -24.430 17.091  56.230 1.00 0.29 ? 138 ALA A C      1 
ATOM 2866 O O      . ALA C 3 138 ? -24.230 17.199  55.015 1.00 0.30 ? 138 ALA A O      1 
ATOM 2867 C CB     . ALA C 3 138 ? -24.131 15.211  57.836 1.00 0.27 ? 138 ALA A CB     1 
ATOM 2868 H H      . ALA C 3 138 ? -23.112 17.156  59.081 1.00 0.30 ? 138 ALA A H      1 
ATOM 2869 H HA     . ALA C 3 138 ? -22.621 15.996  56.537 1.00 0.29 ? 138 ALA A HA     1 
ATOM 2870 H HB1    . ALA C 3 138 ? -23.483 14.347  57.829 1.00 0.27 ? 138 ALA A HB1    1 
ATOM 2871 H HB2    . ALA C 3 138 ? -25.050 14.976  57.321 1.00 0.27 ? 138 ALA A HB2    1 
ATOM 2872 H HB3    . ALA C 3 138 ? -24.352 15.485  58.858 1.00 0.28 ? 138 ALA A HB3    1 
ATOM 2873 N N      . ASP C 3 139 ? -25.539 17.558  56.829 1.00 0.29 ? 139 ASP A N      1 
ATOM 2874 C CA     . ASP C 3 139 ? -26.499 18.281  56.059 1.00 0.30 ? 139 ASP A CA     1 
ATOM 2875 C C      . ASP C 3 139 ? -25.858 19.413  55.286 1.00 0.31 ? 139 ASP A C      1 
ATOM 2876 O O      . ASP C 3 139 ? -26.066 19.598  54.103 1.00 0.32 ? 139 ASP A O      1 
ATOM 2877 C CB     . ASP C 3 139 ? -27.568 18.849  56.994 1.00 0.30 ? 139 ASP A CB     1 
ATOM 2878 C CG     . ASP C 3 139 ? -28.639 19.564  56.168 1.00 0.30 ? 139 ASP A CG     1 
ATOM 2879 O OD1    . ASP C 3 139 ? -28.465 20.740  55.898 1.00 0.31 ? 139 ASP A OD1    1 
ATOM 2880 O OD2    . ASP C 3 139 ? -29.617 18.923  55.821 1.00 0.29 ? 139 ASP A OD2    1 
ATOM 2881 H H      . ASP C 3 139 ? -25.671 17.431  57.792 1.00 0.29 ? 139 ASP A H      1 
ATOM 2882 H HA     . ASP C 3 139 ? -26.974 17.607  55.367 1.00 0.29 ? 139 ASP A HA     1 
ATOM 2883 H HB2    . ASP C 3 139 ? -28.021 18.045  57.553 1.00 0.29 ? 139 ASP A HB2    1 
ATOM 2884 H HB3    . ASP C 3 139 ? -27.115 19.552  57.677 1.00 0.31 ? 139 ASP A HB3    1 
ATOM 2885 N N      . GLN C 3 140 ? -25.016 20.174  56.005 1.00 0.32 ? 140 GLN A N      1 
ATOM 2886 C CA     . GLN C 3 140 ? -24.285 21.288  55.403 1.00 0.34 ? 140 GLN A CA     1 
ATOM 2887 C C      . GLN C 3 140 ? -23.596 20.878  54.092 1.00 0.34 ? 140 GLN A C      1 
ATOM 2888 O O      . GLN C 3 140 ? -23.578 21.639  53.119 1.00 0.36 ? 140 GLN A O      1 
ATOM 2889 C CB     . GLN C 3 140 ? -23.232 21.792  56.392 1.00 0.35 ? 140 GLN A CB     1 
ATOM 2890 C CG     . GLN C 3 140 ? -21.836 21.589  55.801 1.00 0.36 ? 140 GLN A CG     1 
ATOM 2891 C CD     . GLN C 3 140 ? -21.406 22.854  55.056 1.00 0.38 ? 140 GLN A CD     1 
ATOM 2892 O OE1    . GLN C 3 140 ? -21.232 23.897  55.655 1.00 0.39 ? 140 GLN A OE1    1 
ATOM 2893 N NE2    . GLN C 3 140 ? -21.224 22.806  53.764 1.00 0.38 ? 140 GLN A NE2    1 
ATOM 2894 H H      . GLN C 3 140 ? -24.893 19.986  56.959 1.00 0.32 ? 140 GLN A H      1 
ATOM 2895 H HA     . GLN C 3 140 ? -24.978 22.089  55.197 1.00 0.35 ? 140 GLN A HA     1 
ATOM 2896 H HB2    . GLN C 3 140 ? -23.393 22.844  56.582 1.00 0.36 ? 140 GLN A HB2    1 
ATOM 2897 H HB3    . GLN C 3 140 ? -23.313 21.241  57.316 1.00 0.34 ? 140 GLN A HB3    1 
ATOM 2898 H HG2    . GLN C 3 140 ? -21.135 21.383  56.597 1.00 0.36 ? 140 GLN A HG2    1 
ATOM 2899 H HG3    . GLN C 3 140 ? -21.854 20.757  55.113 1.00 0.35 ? 140 GLN A HG3    1 
ATOM 2900 H HE21   . GLN C 3 140 ? -21.365 21.966  53.281 1.00 0.37 ? 140 GLN A HE21   1 
ATOM 2901 H HE22   . GLN C 3 140 ? -20.948 23.611  53.278 1.00 0.39 ? 140 GLN A HE22   1 
ATOM 2902 N N      . LEU C 3 141 ? -23.039 19.665  54.077 1.00 0.33 ? 141 LEU A N      1 
ATOM 2903 C CA     . LEU C 3 141 ? -22.349 19.142  52.901 1.00 0.34 ? 141 LEU A CA     1 
ATOM 2904 C C      . LEU C 3 141 ? -23.261 18.253  52.088 1.00 0.32 ? 141 LEU A C      1 
ATOM 2905 O O      . LEU C 3 141 ? -22.916 17.848  50.975 1.00 0.33 ? 141 LEU A O      1 
ATOM 2906 C CB     . LEU C 3 141 ? -21.125 18.338  53.346 1.00 0.33 ? 141 LEU A CB     1 
ATOM 2907 C CG     . LEU C 3 141 ? -20.069 19.283  53.919 1.00 0.35 ? 141 LEU A CG     1 
ATOM 2908 C CD1    . LEU C 3 141 ? -18.885 18.467  54.439 1.00 0.35 ? 141 LEU A CD1    1 
ATOM 2909 C CD2    . LEU C 3 141 ? -19.587 20.234  52.821 1.00 0.37 ? 141 LEU A CD2    1 
ATOM 2910 H H      . LEU C 3 141 ? -23.093 19.106  54.881 1.00 0.32 ? 141 LEU A H      1 
ATOM 2911 H HA     . LEU C 3 141 ? -22.020 19.966  52.288 1.00 0.35 ? 141 LEU A HA     1 
ATOM 2912 H HB2    . LEU C 3 141 ? -21.421 17.625  54.102 1.00 0.32 ? 141 LEU A HB2    1 
ATOM 2913 H HB3    . LEU C 3 141 ? -20.714 17.812  52.497 1.00 0.33 ? 141 LEU A HB3    1 
ATOM 2914 H HG     . LEU C 3 141 ? -20.498 19.853  54.730 1.00 0.35 ? 141 LEU A HG     1 
ATOM 2915 H HD11   . LEU C 3 141 ? -17.972 19.029  54.302 1.00 0.36 ? 141 LEU A HD11   1 
ATOM 2916 H HD12   . LEU C 3 141 ? -18.821 17.537  53.894 1.00 0.34 ? 141 LEU A HD12   1 
ATOM 2917 H HD13   . LEU C 3 141 ? -19.026 18.259  55.489 1.00 0.34 ? 141 LEU A HD13   1 
ATOM 2918 H HD21   . LEU C 3 141 ? -18.709 20.760  53.162 1.00 0.38 ? 141 LEU A HD21   1 
ATOM 2919 H HD22   . LEU C 3 141 ? -20.367 20.945  52.593 1.00 0.37 ? 141 LEU A HD22   1 
ATOM 2920 H HD23   . LEU C 3 141 ? -19.346 19.667  51.934 1.00 0.37 ? 141 LEU A HD23   1 
ATOM 2921 N N      . ASN C 3 142 ? -24.428 17.954  52.648 1.00 0.31 ? 142 ASN A N      1 
ATOM 2922 C CA     . ASN C 3 142 ? -25.392 17.078  51.994 1.00 0.30 ? 142 ASN A CA     1 
ATOM 2923 C C      . ASN C 3 142 ? -24.690 15.744  51.798 1.00 0.29 ? 142 ASN A C      1 
ATOM 2924 O O      . ASN C 3 142 ? -24.394 15.341  50.666 1.00 0.29 ? 142 ASN A O      1 
ATOM 2925 C CB     . ASN C 3 142 ? -25.796 17.663  50.639 1.00 0.31 ? 142 ASN A CB     1 
ATOM 2926 C CG     . ASN C 3 142 ? -26.905 16.809  50.021 1.00 0.30 ? 142 ASN A CG     1 
ATOM 2927 O OD1    . ASN C 3 142 ? -26.803 16.388  48.886 1.00 0.31 ? 142 ASN A OD1    1 
ATOM 2928 N ND2    . ASN C 3 142 ? -27.966 16.532  50.726 1.00 0.29 ? 142 ASN A ND2    1 
ATOM 2929 H H      . ASN C 3 142 ? -24.636 18.315  53.536 1.00 0.31 ? 142 ASN A H      1 
ATOM 2930 H HA     . ASN C 3 142 ? -26.263 16.950  52.620 1.00 0.29 ? 142 ASN A HA     1 
ATOM 2931 H HB2    . ASN C 3 142 ? -26.153 18.673  50.777 1.00 0.32 ? 142 ASN A HB2    1 
ATOM 2932 H HB3    . ASN C 3 142 ? -24.940 17.670  49.981 1.00 0.32 ? 142 ASN A HB3    1 
ATOM 2933 H HD21   . ASN C 3 142 ? -28.047 16.868  51.643 1.00 0.29 ? 142 ASN A HD21   1 
ATOM 2934 H HD22   . ASN C 3 142 ? -28.684 15.988  50.339 1.00 0.29 ? 142 ASN A HD22   1 
ATOM 2935 N N      . MET C 3 143 ? -24.410 15.092  52.926 1.00 0.28 ? 143 MET A N      1 
ATOM 2936 C CA     . MET C 3 143 ? -23.742 13.798  52.971 1.00 0.27 ? 143 MET A CA     1 
ATOM 2937 C C      . MET C 3 143 ? -24.395 13.052  54.121 1.00 0.26 ? 143 MET A C      1 
ATOM 2938 O O      . MET C 3 143 ? -24.828 13.668  55.099 1.00 0.26 ? 143 MET A O      1 
ATOM 2939 C CB     . MET C 3 143 ? -22.249 13.982  53.249 1.00 0.28 ? 143 MET A CB     1 
ATOM 2940 C CG     . MET C 3 143 ? -21.613 14.800  52.121 1.00 0.30 ? 143 MET A CG     1 
ATOM 2941 S SD     . MET C 3 143 ? -21.239 13.711  50.725 1.00 0.30 ? 143 MET A SD     1 
ATOM 2942 C CE     . MET C 3 143 ? -19.492 13.441  51.109 1.00 0.30 ? 143 MET A CE     1 
ATOM 2943 H H      . MET C 3 143 ? -24.671 15.507  53.775 1.00 0.28 ? 143 MET A H      1 
ATOM 2944 H HA     . MET C 3 143 ? -23.894 13.264  52.043 1.00 0.27 ? 143 MET A HA     1 
ATOM 2945 H HB2    . MET C 3 143 ? -22.119 14.501  54.187 1.00 0.28 ? 143 MET A HB2    1 
ATOM 2946 H HB3    . MET C 3 143 ? -21.771 13.015  53.302 1.00 0.27 ? 143 MET A HB3    1 
ATOM 2947 H HG2    . MET C 3 143 ? -22.300 15.571  51.806 1.00 0.30 ? 143 MET A HG2    1 
ATOM 2948 H HG3    . MET C 3 143 ? -20.700 15.254  52.479 1.00 0.31 ? 143 MET A HG3    1 
ATOM 2949 H HE1    . MET C 3 143 ? -19.357 13.440  52.182 1.00 0.30 ? 143 MET A HE1    1 
ATOM 2950 H HE2    . MET C 3 143 ? -18.900 14.232  50.675 1.00 0.32 ? 143 MET A HE2    1 
ATOM 2951 H HE3    . MET C 3 143 ? -19.177 12.491  50.699 1.00 0.30 ? 143 MET A HE3    1 
ATOM 2952 N N      . GLU C 3 144 ? -24.464 11.731  54.010 1.00 0.24 ? 144 GLU A N      1 
ATOM 2953 C CA     . GLU C 3 144 ? -25.052 10.921  55.063 1.00 0.23 ? 144 GLU A CA     1 
ATOM 2954 C C      . GLU C 3 144 ? -24.268 11.071  56.380 1.00 0.23 ? 144 GLU A C      1 
ATOM 2955 O O      . GLU C 3 144 ? -23.042 11.155  56.385 1.00 0.24 ? 144 GLU A O      1 
ATOM 2956 C CB     . GLU C 3 144 ? -25.043 9.452   54.634 1.00 0.22 ? 144 GLU A CB     1 
ATOM 2957 C CG     . GLU C 3 144 ? -26.104 8.682   55.420 1.00 0.21 ? 144 GLU A CG     1 
ATOM 2958 C CD     . GLU C 3 144 ? -25.603 7.263   55.700 1.00 0.20 ? 144 GLU A CD     1 
ATOM 2959 O OE1    . GLU C 3 144 ? -25.019 6.676   54.803 1.00 0.20 ? 144 GLU A OE1    1 
ATOM 2960 O OE2    . GLU C 3 144 ? -25.810 6.790   56.804 1.00 0.20 ? 144 GLU A OE2    1 
ATOM 2961 H H      . GLU C 3 144 ? -24.104 11.294  53.210 1.00 0.25 ? 144 GLU A H      1 
ATOM 2962 H HA     . GLU C 3 144 ? -26.073 11.231  55.220 1.00 0.23 ? 144 GLU A HA     1 
ATOM 2963 H HB2    . GLU C 3 144 ? -25.258 9.386   53.576 1.00 0.22 ? 144 GLU A HB2    1 
ATOM 2964 H HB3    . GLU C 3 144 ? -24.069 9.026   54.830 1.00 0.22 ? 144 GLU A HB3    1 
ATOM 2965 H HG2    . GLU C 3 144 ? -26.294 9.188   56.356 1.00 0.21 ? 144 GLU A HG2    1 
ATOM 2966 H HG3    . GLU C 3 144 ? -27.015 8.632   54.845 1.00 0.21 ? 144 GLU A HG3    1 
ATOM 2967 N N      . LYS C 3 145 ? -24.974 11.086  57.497 1.00 0.23 ? 145 LYS A N      1 
ATOM 2968 C CA     . LYS C 3 145 ? -24.337 11.253  58.797 1.00 0.24 ? 145 LYS A CA     1 
ATOM 2969 C C      . LYS C 3 145 ? -23.236 10.239  59.110 1.00 0.23 ? 145 LYS A C      1 
ATOM 2970 O O      . LYS C 3 145 ? -22.115 10.615  59.458 1.00 0.24 ? 145 LYS A O      1 
ATOM 2971 C CB     . LYS C 3 145 ? -25.410 11.160  59.883 1.00 0.23 ? 145 LYS A CB     1 
ATOM 2972 H H      . LYS C 3 145 ? -25.950 11.002  57.448 1.00 0.23 ? 145 LYS A H      1 
ATOM 2973 H HA     . LYS C 3 145 ? -23.911 12.242  58.841 1.00 0.25 ? 145 LYS A HA     1 
ATOM 2974 H HB2    . LYS C 3 145 ? -26.064 12.018  59.818 1.00 0.24 ? 145 LYS A HB2    1 
ATOM 2975 H HB3    . LYS C 3 145 ? -25.986 10.257  59.745 1.00 0.23 ? 145 LYS A HB3    1 
ATOM 2976 N N      . GLU C 3 146 ? -23.570 8.956   59.014 1.00 0.22 ? 146 GLU A N      1 
ATOM 2977 C CA     . GLU C 3 146 ? -22.629 7.884   59.307 1.00 0.22 ? 146 GLU A CA     1 
ATOM 2978 C C      . GLU C 3 146 ? -21.320 8.011   58.528 1.00 0.23 ? 146 GLU A C      1 
ATOM 2979 O O      . GLU C 3 146 ? -20.244 7.759   59.076 1.00 0.23 ? 146 GLU A O      1 
ATOM 2980 C CB     . GLU C 3 146 ? -23.285 6.544   58.967 1.00 0.21 ? 146 GLU A CB     1 
ATOM 2981 C CG     . GLU C 3 146 ? -22.317 5.403   59.286 1.00 0.21 ? 146 GLU A CG     1 
ATOM 2982 C CD     . GLU C 3 146 ? -21.994 5.411   60.782 1.00 0.22 ? 146 GLU A CD     1 
ATOM 2983 O OE1    . GLU C 3 146 ? -22.598 6.194   61.496 1.00 0.22 ? 146 GLU A OE1    1 
ATOM 2984 O OE2    . GLU C 3 146 ? -21.146 4.633   61.187 1.00 0.22 ? 146 GLU A OE2    1 
ATOM 2985 H H      . GLU C 3 146 ? -24.486 8.725   58.752 1.00 0.22 ? 146 GLU A H      1 
ATOM 2986 H HA     . GLU C 3 146 ? -22.408 7.895   60.362 1.00 0.23 ? 146 GLU A HA     1 
ATOM 2987 H HB2    . GLU C 3 146 ? -24.187 6.427   59.550 1.00 0.21 ? 146 GLU A HB2    1 
ATOM 2988 H HB3    . GLU C 3 146 ? -23.530 6.521   57.915 1.00 0.21 ? 146 GLU A HB3    1 
ATOM 2989 H HG2    . GLU C 3 146 ? -22.773 4.460   59.020 1.00 0.20 ? 146 GLU A HG2    1 
ATOM 2990 H HG3    . GLU C 3 146 ? -21.408 5.534   58.722 1.00 0.21 ? 146 GLU A HG3    1 
ATOM 2991 N N      . VAL C 3 147 ? -21.420 8.411   57.261 1.00 0.23 ? 147 VAL A N      1 
ATOM 2992 C CA     . VAL C 3 147 ? -20.264 8.589   56.402 1.00 0.24 ? 147 VAL A CA     1 
ATOM 2993 C C      . VAL C 3 147 ? -19.344 9.650   56.960 1.00 0.25 ? 147 VAL A C      1 
ATOM 2994 O O      . VAL C 3 147 ? -18.115 9.526   56.925 1.00 0.26 ? 147 VAL A O      1 
ATOM 2995 C CB     . VAL C 3 147 ? -20.731 8.987   54.981 1.00 0.24 ? 147 VAL A CB     1 
ATOM 2996 C CG1    . VAL C 3 147 ? -19.532 9.518   54.173 1.00 0.25 ? 147 VAL A CG1    1 
ATOM 2997 C CG2    . VAL C 3 147 ? -21.344 7.749   54.256 1.00 0.23 ? 147 VAL A CG2    1 
ATOM 2998 H H      . VAL C 3 147 ? -22.312 8.598   56.896 1.00 0.22 ? 147 VAL A H      1 
ATOM 2999 H HA     . VAL C 3 147 ? -19.729 7.657   56.327 1.00 0.23 ? 147 VAL A HA     1 
ATOM 3000 H HB     . VAL C 3 147 ? -21.476 9.768   55.060 1.00 0.24 ? 147 VAL A HB     1 
ATOM 3001 H HG11   . VAL C 3 147 ? -19.764 9.503   53.118 1.00 1.03 ? 147 VAL A HG11   1 
ATOM 3002 H HG12   . VAL C 3 147 ? -18.669 8.895   54.361 1.00 1.05 ? 147 VAL A HG12   1 
ATOM 3003 H HG13   . VAL C 3 147 ? -19.316 10.530  54.479 1.00 1.06 ? 147 VAL A HG13   1 
ATOM 3004 H HG21   . VAL C 3 147 ? -21.416 6.914   54.937 1.00 1.04 ? 147 VAL A HG21   1 
ATOM 3005 H HG22   . VAL C 3 147 ? -20.729 7.459   53.416 1.00 1.05 ? 147 VAL A HG22   1 
ATOM 3006 H HG23   . VAL C 3 147 ? -22.327 7.992   53.894 1.00 1.04 ? 147 VAL A HG23   1 
ATOM 3007 N N      . ILE C 3 148 ? -19.951 10.702  57.485 1.00 0.26 ? 148 ILE A N      1 
ATOM 3008 C CA     . ILE C 3 148 ? -19.192 11.794  58.051 1.00 0.27 ? 148 ILE A CA     1 
ATOM 3009 C C      . ILE C 3 148 ? -18.589 11.402  59.395 1.00 0.27 ? 148 ILE A C      1 
ATOM 3010 O O      . ILE C 3 148 ? -17.438 11.742  59.676 1.00 0.29 ? 148 ILE A O      1 
ATOM 3011 C CB     . ILE C 3 148 ? -20.111 13.000  58.244 1.00 0.28 ? 148 ILE A CB     1 
ATOM 3012 C CG1    . ILE C 3 148 ? -20.532 13.544  56.876 1.00 0.28 ? 148 ILE A CG1    1 
ATOM 3013 C CG2    . ILE C 3 148 ? -19.369 14.090  59.018 1.00 0.29 ? 148 ILE A CG2    1 
ATOM 3014 C CD1    . ILE C 3 148 ? -19.287 13.929  56.075 1.00 0.29 ? 148 ILE A CD1    1 
ATOM 3015 H H      . ILE C 3 148 ? -20.930 10.743  57.486 1.00 0.25 ? 148 ILE A H      1 
ATOM 3016 H HA     . ILE C 3 148 ? -18.400 12.064  57.372 1.00 0.28 ? 148 ILE A HA     1 
ATOM 3017 H HB     . ILE C 3 148 ? -20.987 12.699  58.799 1.00 0.27 ? 148 ILE A HB     1 
ATOM 3018 H HG12   . ILE C 3 148 ? -21.084 12.784  56.343 1.00 0.27 ? 148 ILE A HG12   1 
ATOM 3019 H HG13   . ILE C 3 148 ? -21.155 14.414  57.011 1.00 0.28 ? 148 ILE A HG13   1 
ATOM 3020 H HG21   . ILE C 3 148 ? -19.291 13.806  60.056 1.00 0.29 ? 148 ILE A HG21   1 
ATOM 3021 H HG22   . ILE C 3 148 ? -19.912 15.021  58.939 1.00 0.30 ? 148 ILE A HG22   1 
ATOM 3022 H HG23   . ILE C 3 148 ? -18.379 14.215  58.604 1.00 0.30 ? 148 ILE A HG23   1 
ATOM 3023 H HD11   . ILE C 3 148 ? -18.481 14.166  56.752 1.00 0.30 ? 148 ILE A HD11   1 
ATOM 3024 H HD12   . ILE C 3 148 ? -19.507 14.790  55.460 1.00 0.30 ? 148 ILE A HD12   1 
ATOM 3025 H HD13   . ILE C 3 148 ? -18.996 13.102  55.444 1.00 0.29 ? 148 ILE A HD13   1 
ATOM 3026 N N      . ARG C 3 149 ? -19.344 10.676  60.210 1.00 0.26 ? 149 ARG A N      1 
ATOM 3027 C CA     . ARG C 3 149 ? -18.855 10.255  61.514 1.00 0.27 ? 149 ARG A CA     1 
ATOM 3028 C C      . ARG C 3 149 ? -17.606 9.388   61.271 1.00 0.27 ? 149 ARG A C      1 
ATOM 3029 O O      . ARG C 3 149 ? -16.598 9.524   61.955 1.00 0.28 ? 149 ARG A O      1 
ATOM 3030 C CB     . ARG C 3 149 ? -19.867 9.380   62.289 1.00 0.26 ? 149 ARG A CB     1 
ATOM 3031 C CG     . ARG C 3 149 ? -19.538 9.444   63.800 1.00 0.27 ? 149 ARG A CG     1 
ATOM 3032 C CD     . ARG C 3 149 ? -19.568 8.054   64.487 1.00 0.27 ? 149 ARG A CD     1 
ATOM 3033 N NE     . ARG C 3 149 ? -19.439 6.945   63.481 1.00 0.25 ? 149 ARG A NE     1 
ATOM 3034 C CZ     . ARG C 3 149 ? -19.290 5.696   63.882 1.00 0.25 ? 149 ARG A CZ     1 
ATOM 3035 N NH1    . ARG C 3 149 ? -19.126 5.411   65.154 1.00 0.26 ? 149 ARG A NH1    1 
ATOM 3036 N NH2    . ARG C 3 149 ? -19.285 4.727   63.004 1.00 0.24 ? 149 ARG A NH2    1 
ATOM 3037 H H      . ARG C 3 149 ? -20.249 10.422  59.930 1.00 0.25 ? 149 ARG A H      1 
ATOM 3038 H HA     . ARG C 3 149 ? -18.591 11.120  62.103 1.00 0.28 ? 149 ARG A HA     1 
ATOM 3039 H HB2    . ARG C 3 149 ? -20.865 9.752   62.119 1.00 0.25 ? 149 ARG A HB2    1 
ATOM 3040 H HB3    . ARG C 3 149 ? -19.795 8.356   61.951 1.00 0.25 ? 149 ARG A HB3    1 
ATOM 3041 H HG2    . ARG C 3 149 ? -18.553 9.875   63.929 1.00 0.28 ? 149 ARG A HG2    1 
ATOM 3042 H HG3    . ARG C 3 149 ? -20.263 10.084  64.285 1.00 0.27 ? 149 ARG A HG3    1 
ATOM 3043 H HD2    . ARG C 3 149 ? -18.752 7.982   65.183 1.00 0.27 ? 149 ARG A HD2    1 
ATOM 3044 H HD3    . ARG C 3 149 ? -20.496 7.959   65.039 1.00 0.26 ? 149 ARG A HD3    1 
ATOM 3045 H HE     . ARG C 3 149 ? -19.494 7.145   62.527 1.00 0.25 ? 149 ARG A HE     1 
ATOM 3046 H HH11   . ARG C 3 149 ? -19.103 6.143   65.833 1.00 0.27 ? 149 ARG A HH11   1 
ATOM 3047 H HH12   . ARG C 3 149 ? -19.033 4.455   65.448 1.00 0.26 ? 149 ARG A HH12   1 
ATOM 3048 H HH21   . ARG C 3 149 ? -19.384 4.931   62.027 1.00 0.23 ? 149 ARG A HH21   1 
ATOM 3049 H HH22   . ARG C 3 149 ? -19.197 3.777   63.309 1.00 0.24 ? 149 ARG A HH22   1 
ATOM 3050 N N      . VAL C 3 150 ? -17.707 8.501   60.286 1.00 0.26 ? 150 VAL A N      1 
ATOM 3051 C CA     . VAL C 3 150 ? -16.612 7.598   59.969 1.00 0.26 ? 150 VAL A CA     1 
ATOM 3052 C C      . VAL C 3 150 ? -15.401 8.343   59.417 1.00 0.27 ? 150 VAL A C      1 
ATOM 3053 O O      . VAL C 3 150 ? -14.261 7.972   59.708 1.00 0.28 ? 150 VAL A O      1 
ATOM 3054 C CB     . VAL C 3 150 ? -17.087 6.566   58.934 1.00 0.25 ? 150 VAL A CB     1 
ATOM 3055 C CG1    . VAL C 3 150 ? -15.890 5.740   58.411 1.00 0.25 ? 150 VAL A CG1    1 
ATOM 3056 C CG2    . VAL C 3 150 ? -18.107 5.632   59.595 1.00 0.23 ? 150 VAL A CG2    1 
ATOM 3057 H H      . VAL C 3 150 ? -18.542 8.441   59.778 1.00 0.25 ? 150 VAL A H      1 
ATOM 3058 H HA     . VAL C 3 150 ? -16.322 7.070   60.863 1.00 0.26 ? 150 VAL A HA     1 
ATOM 3059 H HB     . VAL C 3 150 ? -17.556 7.081   58.106 1.00 0.24 ? 150 VAL A HB     1 
ATOM 3060 H HG11   . VAL C 3 150 ? -15.113 5.702   59.163 1.00 1.06 ? 150 VAL A HG11   1 
ATOM 3061 H HG12   . VAL C 3 150 ? -15.497 6.200   57.516 1.00 1.03 ? 150 VAL A HG12   1 
ATOM 3062 H HG13   . VAL C 3 150 ? -16.211 4.734   58.180 1.00 1.04 ? 150 VAL A HG13   1 
ATOM 3063 H HG21   . VAL C 3 150 ? -17.598 4.975   60.286 1.00 1.02 ? 150 VAL A HG21   1 
ATOM 3064 H HG22   . VAL C 3 150 ? -18.600 5.042   58.836 1.00 1.02 ? 150 VAL A HG22   1 
ATOM 3065 H HG23   . VAL C 3 150 ? -18.838 6.217   60.128 1.00 1.07 ? 150 VAL A HG23   1 
ATOM 3066 N N      . TRP C 3 151 ? -15.634 9.396   58.628 1.00 0.28 ? 151 TRP A N      1 
ATOM 3067 C CA     . TRP C 3 151 ? -14.542 10.167  58.036 1.00 0.29 ? 151 TRP A CA     1 
ATOM 3068 C C      . TRP C 3 151 ? -13.685 10.799  59.120 1.00 0.31 ? 151 TRP A C      1 
ATOM 3069 O O      . TRP C 3 151 ? -12.453 10.797  59.014 1.00 0.32 ? 151 TRP A O      1 
ATOM 3070 C CB     . TRP C 3 151 ? -15.130 11.276  57.146 1.00 0.30 ? 151 TRP A CB     1 
ATOM 3071 C CG     . TRP C 3 151 ? -14.079 12.309  56.864 1.00 0.32 ? 151 TRP A CG     1 
ATOM 3072 C CD1    . TRP C 3 151 ? -13.888 13.421  57.611 1.00 0.37 ? 151 TRP A CD1    1 
ATOM 3073 C CD2    . TRP C 3 151 ? -13.085 12.354  55.800 1.00 0.46 ? 151 TRP A CD2    1 
ATOM 3074 N NE1    . TRP C 3 151 ? -12.829 14.136  57.089 1.00 0.36 ? 151 TRP A NE1    1 
ATOM 3075 C CE2    . TRP C 3 151 ? -12.304 13.529  55.970 1.00 0.44 ? 151 TRP A CE2    1 
ATOM 3076 C CE3    . TRP C 3 151 ? -12.781 11.502  54.715 1.00 0.69 ? 151 TRP A CE3    1 
ATOM 3077 C CZ2    . TRP C 3 151 ? -11.256 13.847  55.095 1.00 0.61 ? 151 TRP A CZ2    1 
ATOM 3078 C CZ3    . TRP C 3 151 ? -11.726 11.824  53.830 1.00 0.90 ? 151 TRP A CZ3    1 
ATOM 3079 C CH2    . TRP C 3 151 ? -10.968 12.992  54.022 1.00 0.85 ? 151 TRP A CH2    1 
ATOM 3080 H H      . TRP C 3 151 ? -16.562 9.651   58.433 1.00 0.27 ? 151 TRP A H      1 
ATOM 3081 H HA     . TRP C 3 151 ? -13.930 9.514   57.432 1.00 0.29 ? 151 TRP A HA     1 
ATOM 3082 H HB2    . TRP C 3 151 ? -15.471 10.847  56.216 1.00 0.29 ? 151 TRP A HB2    1 
ATOM 3083 H HB3    . TRP C 3 151 ? -15.962 11.739  57.655 1.00 0.30 ? 151 TRP A HB3    1 
ATOM 3084 H HD1    . TRP C 3 151 ? -14.461 13.696  58.485 1.00 0.51 ? 151 TRP A HD1    1 
ATOM 3085 H HE1    . TRP C 3 151 ? -12.484 14.979  57.450 1.00 0.40 ? 151 TRP A HE1    1 
ATOM 3086 H HE3    . TRP C 3 151 ? -13.359 10.605  54.561 1.00 0.73 ? 151 TRP A HE3    1 
ATOM 3087 H HZ2    . TRP C 3 151 ? -10.677 14.744  55.246 1.00 0.59 ? 151 TRP A HZ2    1 
ATOM 3088 H HZ3    . TRP C 3 151 ? -11.499 11.176  53.000 1.00 1.11 ? 151 TRP A HZ3    1 
ATOM 3089 H HH2    . TRP C 3 151 ? -10.164 13.231  53.342 1.00 1.02 ? 151 TRP A HH2    1 
ATOM 3090 N N      . PHE C 3 152 ? -14.335 11.379  60.128 1.00 0.31 ? 152 PHE A N      1 
ATOM 3091 C CA     . PHE C 3 152 ? -13.606 11.982  61.227 1.00 0.32 ? 152 PHE A CA     1 
ATOM 3092 C C      . PHE C 3 152 ? -12.904 10.907  62.064 1.00 0.32 ? 152 PHE A C      1 
ATOM 3093 O O      . PHE C 3 152 ? -11.809 11.128  62.603 1.00 0.34 ? 152 PHE A O      1 
ATOM 3094 C CB     . PHE C 3 152 ? -14.578 12.762  62.115 1.00 0.32 ? 152 PHE A CB     1 
ATOM 3095 C CG     . PHE C 3 152 ? -14.668 14.190  61.630 1.00 0.34 ? 152 PHE A CG     1 
ATOM 3096 C CD1    . PHE C 3 152 ? -13.716 15.131  62.042 1.00 0.35 ? 152 PHE A CD1    1 
ATOM 3097 C CD2    . PHE C 3 152 ? -15.703 14.572  60.769 1.00 0.33 ? 152 PHE A CD2    1 
ATOM 3098 C CE1    . PHE C 3 152 ? -13.800 16.454  61.593 1.00 0.37 ? 152 PHE A CE1    1 
ATOM 3099 C CE2    . PHE C 3 152 ? -15.787 15.896  60.320 1.00 0.34 ? 152 PHE A CE2    1 
ATOM 3100 C CZ     . PHE C 3 152 ? -14.836 16.837  60.732 1.00 0.36 ? 152 PHE A CZ     1 
ATOM 3101 H H      . PHE C 3 152 ? -15.316 11.381  60.137 1.00 0.30 ? 152 PHE A H      1 
ATOM 3102 H HA     . PHE C 3 152 ? -12.868 12.663  60.832 1.00 0.33 ? 152 PHE A HA     1 
ATOM 3103 H HB2    . PHE C 3 152 ? -15.555 12.303  62.068 1.00 0.31 ? 152 PHE A HB2    1 
ATOM 3104 H HB3    . PHE C 3 152 ? -14.221 12.750  63.134 1.00 0.33 ? 152 PHE A HB3    1 
ATOM 3105 H HD1    . PHE C 3 152 ? -12.918 14.836  62.707 1.00 0.36 ? 152 PHE A HD1    1 
ATOM 3106 H HD2    . PHE C 3 152 ? -16.436 13.847  60.449 1.00 0.31 ? 152 PHE A HD2    1 
ATOM 3107 H HE1    . PHE C 3 152 ? -13.066 17.181  61.910 1.00 0.38 ? 152 PHE A HE1    1 
ATOM 3108 H HE2    . PHE C 3 152 ? -16.585 16.192  59.655 1.00 0.34 ? 152 PHE A HE2    1 
ATOM 3109 H HZ     . PHE C 3 152 ? -14.902 17.858  60.386 1.00 0.37 ? 152 PHE A HZ     1 
ATOM 3110 N N      . CYS C 3 153 ? -13.554 9.757   62.220 1.00 0.31 ? 153 CYS A N      1 
ATOM 3111 C CA     . CYS C 3 153 ? -12.878 8.687   62.939 1.00 0.31 ? 153 CYS A CA     1 
ATOM 3112 C C      . CYS C 3 153 ? -11.612 8.247   62.214 1.00 0.31 ? 153 CYS A C      1 
ATOM 3113 O O      . CYS C 3 153 ? -10.545 8.083   62.818 1.00 0.32 ? 153 CYS A O      1 
ATOM 3114 C CB     . CYS C 3 153 ? -13.823 7.492   63.073 1.00 0.29 ? 153 CYS A CB     1 
ATOM 3115 S SG     . CYS C 3 153 ? -15.187 7.926   64.181 1.00 0.29 ? 153 CYS A SG     1 
ATOM 3116 H H      . CYS C 3 153 ? -14.434 9.615   61.813 1.00 0.30 ? 153 CYS A H      1 
ATOM 3117 H HA     . CYS C 3 153 ? -12.616 9.036   63.924 1.00 0.32 ? 153 CYS A HA     1 
ATOM 3118 H HB2    . CYS C 3 153 ? -14.217 7.232   62.102 1.00 0.28 ? 153 CYS A HB2    1 
ATOM 3119 H HB3    . CYS C 3 153 ? -13.282 6.650   63.479 1.00 0.29 ? 153 CYS A HB3    1 
ATOM 3120 H HG     . CYS C 3 153 ? -15.879 8.333   63.657 1.00 0.29 ? 153 CYS A HG     1 
ATOM 3121 N N      . ASN C 3 154 ? -11.724 8.056   60.887 1.00 0.31 ? 154 ASN A N      1 
ATOM 3122 C CA     . ASN C 3 154 ? -10.576 7.650   60.081 1.00 0.31 ? 154 ASN A CA     1 
ATOM 3123 C C      . ASN C 3 154 ? -9.495  8.729   60.104 1.00 0.33 ? 154 ASN A C      1 
ATOM 3124 O O      . ASN C 3 154 ? -8.304  8.431   60.129 1.00 0.34 ? 154 ASN A O      1 
ATOM 3125 C CB     . ASN C 3 154 ? -11.031 7.415   58.638 1.00 0.30 ? 154 ASN A CB     1 
ATOM 3126 C CG     . ASN C 3 154 ? -11.808 6.099   58.551 1.00 0.29 ? 154 ASN A CG     1 
ATOM 3127 O OD1    . ASN C 3 154 ? -11.701 5.257   59.421 1.00 0.29 ? 154 ASN A OD1    1 
ATOM 3128 N ND2    . ASN C 3 154 ? -12.593 5.886   57.530 1.00 0.29 ? 154 ASN A ND2    1 
ATOM 3129 H H      . ASN C 3 154 ? -12.587 8.204   60.449 1.00 0.30 ? 154 ASN A H      1 
ATOM 3130 H HA     . ASN C 3 154 ? -10.171 6.732   60.477 1.00 0.31 ? 154 ASN A HA     1 
ATOM 3131 H HB2    . ASN C 3 154 ? -11.667 8.231   58.325 1.00 0.31 ? 154 ASN A HB2    1 
ATOM 3132 H HB3    . ASN C 3 154 ? -10.168 7.364   57.991 1.00 0.31 ? 154 ASN A HB3    1 
ATOM 3133 H HD21   . ASN C 3 154 ? -12.682 6.566   56.830 1.00 0.29 ? 154 ASN A HD21   1 
ATOM 3134 H HD22   . ASN C 3 154 ? -13.096 5.048   57.465 1.00 0.29 ? 154 ASN A HD22   1 
ATOM 3135 N N      . ARG C 3 155 ? -9.918  9.980   60.115 1.00 0.34 ? 155 ARG A N      1 
ATOM 3136 C CA     . ARG C 3 155 ? -8.965  11.075  60.113 1.00 0.36 ? 155 ARG A CA     1 
ATOM 3137 C C      . ARG C 3 155 ? -8.172  11.170  61.417 1.00 0.37 ? 155 ARG A C      1 
ATOM 3138 O O      . ARG C 3 155 ? -6.958  11.455  61.380 1.00 0.38 ? 155 ARG A O      1 
ATOM 3139 C CB     . ARG C 3 155 ? -9.805  12.348  59.899 1.00 0.36 ? 155 ARG A CB     1 
ATOM 3140 C CG     . ARG C 3 155 ? -8.947  13.603  59.696 1.00 0.38 ? 155 ARG A CG     1 
ATOM 3141 C CD     . ARG C 3 155 ? -7.650  13.275  58.962 1.00 0.39 ? 155 ARG A CD     1 
ATOM 3142 N NE     . ARG C 3 155 ? -6.855  14.522  58.750 1.00 0.41 ? 155 ARG A NE     1 
ATOM 3143 C CZ     . ARG C 3 155 ? -5.555  14.443  58.776 1.00 0.42 ? 155 ARG A CZ     1 
ATOM 3144 N NH1    . ARG C 3 155 ? -4.997  13.400  59.348 1.00 0.42 ? 155 ARG A NH1    1 
ATOM 3145 N NH2    . ARG C 3 155 ? -4.816  15.433  58.329 1.00 0.44 ? 155 ARG A NH2    1 
ATOM 3146 H H      . ARG C 3 155 ? -10.879 10.171  60.109 1.00 0.33 ? 155 ARG A H      1 
ATOM 3147 H HA     . ARG C 3 155 ? -8.286  10.966  59.284 1.00 0.36 ? 155 ARG A HA     1 
ATOM 3148 H HB2    . ARG C 3 155 ? -10.431 12.208  59.030 1.00 0.35 ? 155 ARG A HB2    1 
ATOM 3149 H HB3    . ARG C 3 155 ? -10.438 12.497  60.762 1.00 0.36 ? 155 ARG A HB3    1 
ATOM 3150 H HG2    . ARG C 3 155 ? -9.505  14.332  59.123 1.00 0.38 ? 155 ARG A HG2    1 
ATOM 3151 H HG3    . ARG C 3 155 ? -8.710  14.023  60.660 1.00 0.39 ? 155 ARG A HG3    1 
ATOM 3152 H HD2    . ARG C 3 155 ? -7.079  12.548  59.555 1.00 0.39 ? 155 ARG A HD2    1 
ATOM 3153 H HD3    . ARG C 3 155 ? -7.869  12.883  57.982 1.00 0.38 ? 155 ARG A HD3    1 
ATOM 3154 H HE     . ARG C 3 155 ? -7.304  15.358  58.489 1.00 0.41 ? 155 ARG A HE     1 
ATOM 3155 H HH11   . ARG C 3 155 ? -5.579  12.692  59.755 1.00 0.40 ? 155 ARG A HH11   1 
ATOM 3156 H HH12   . ARG C 3 155 ? -4.001  13.303  59.378 1.00 0.43 ? 155 ARG A HH12   1 
ATOM 3157 H HH21   . ARG C 3 155 ? -5.251  16.261  57.966 1.00 0.44 ? 155 ARG A HH21   1 
ATOM 3158 H HH22   . ARG C 3 155 ? -3.819  15.353  58.336 1.00 0.45 ? 155 ARG A HH22   1 
ATOM 3159 N N      . ARG C 3 156 ? -8.829  10.932  62.554 1.00 0.36 ? 156 ARG A N      1 
ATOM 3160 C CA     . ARG C 3 156 ? -8.164  10.947  63.857 1.00 0.37 ? 156 ARG A CA     1 
ATOM 3161 C C      . ARG C 3 156 ? -7.161  9.781   63.933 1.00 0.37 ? 156 ARG A C      1 
ATOM 3162 O O      . ARG C 3 156 ? -6.063  9.890   64.521 1.00 0.39 ? 156 ARG A O      1 
ATOM 3163 C CB     . ARG C 3 156 ? -9.217  10.759  64.956 1.00 0.37 ? 156 ARG A CB     1 
ATOM 3164 C CG     . ARG C 3 156 ? -10.015 12.054  65.151 1.00 0.37 ? 156 ARG A CG     1 
ATOM 3165 C CD     . ARG C 3 156 ? -10.442 12.167  66.615 1.00 0.38 ? 156 ARG A CD     1 
ATOM 3166 N NE     . ARG C 3 156 ? -11.586 11.238  66.881 1.00 0.36 ? 156 ARG A NE     1 
ATOM 3167 C CZ     . ARG C 3 156 ? -12.644 11.241  66.124 1.00 0.35 ? 156 ARG A CZ     1 
ATOM 3168 N NH1    . ARG C 3 156 ? -12.745 12.086  65.139 1.00 0.35 ? 156 ARG A NH1    1 
ATOM 3169 N NH2    . ARG C 3 156 ? -13.612 10.399  66.358 1.00 0.33 ? 156 ARG A NH2    1 
ATOM 3170 H H      . ARG C 3 156 ? -9.782  10.707  62.511 1.00 0.35 ? 156 ARG A H      1 
ATOM 3171 H HA     . ARG C 3 156 ? -7.652  11.886  64.001 1.00 0.39 ? 156 ARG A HA     1 
ATOM 3172 H HB2    . ARG C 3 156 ? -9.890  9.961   64.670 1.00 0.35 ? 156 ARG A HB2    1 
ATOM 3173 H HB3    . ARG C 3 156 ? -8.725  10.499  65.881 1.00 0.37 ? 156 ARG A HB3    1 
ATOM 3174 H HG2    . ARG C 3 156 ? -9.396  12.899  64.889 1.00 0.38 ? 156 ARG A HG2    1 
ATOM 3175 H HG3    . ARG C 3 156 ? -10.891 12.040  64.520 1.00 0.36 ? 156 ARG A HG3    1 
ATOM 3176 H HD2    . ARG C 3 156 ? -9.626  11.879  67.249 1.00 0.39 ? 156 ARG A HD2    1 
ATOM 3177 H HD3    . ARG C 3 156 ? -10.714 13.199  66.832 1.00 0.38 ? 156 ARG A HD3    1 
ATOM 3178 H HE     . ARG C 3 156 ? -11.531 10.605  67.625 1.00 0.36 ? 156 ARG A HE     1 
ATOM 3179 H HH11   . ARG C 3 156 ? -12.007 12.734  64.963 1.00 0.36 ? 156 ARG A HH11   1 
ATOM 3180 H HH12   . ARG C 3 156 ? -13.562 12.086  64.563 1.00 0.34 ? 156 ARG A HH12   1 
ATOM 3181 H HH21   . ARG C 3 156 ? -13.538 9.753   67.118 1.00 0.34 ? 156 ARG A HH21   1 
ATOM 3182 H HH22   . ARG C 3 156 ? -14.427 10.404  65.781 1.00 0.32 ? 156 ARG A HH22   1 
ATOM 3183 N N      . GLN C 3 157 ? -7.548  8.656   63.331 1.00 0.36 ? 157 GLN A N      1 
ATOM 3184 C CA     . GLN C 3 157 ? -6.662  7.486   63.299 1.00 0.36 ? 157 GLN A CA     1 
ATOM 3185 C C      . GLN C 3 157 ? -5.420  7.778   62.467 1.00 0.37 ? 157 GLN A C      1 
ATOM 3186 O O      . GLN C 3 157 ? -4.303  7.451   62.882 1.00 0.38 ? 157 GLN A O      1 
ATOM 3187 C CB     . GLN C 3 157 ? -7.408  6.292   62.698 1.00 0.34 ? 157 GLN A CB     1 
ATOM 3188 C CG     . GLN C 3 157 ? -8.462  5.795   63.690 1.00 0.33 ? 157 GLN A CG     1 
ATOM 3189 C CD     . GLN C 3 157 ? -9.251  4.644   63.063 1.00 0.32 ? 157 GLN A CD     1 
ATOM 3190 O OE1    . GLN C 3 157 ? -8.677  3.746   62.480 1.00 0.41 ? 157 GLN A OE1    1 
ATOM 3191 N NE2    . GLN C 3 157 ? -10.552 4.628   63.167 1.00 0.42 ? 157 GLN A NE2    1 
ATOM 3192 H H      . GLN C 3 157 ? -8.418  8.618   62.883 1.00 0.35 ? 157 GLN A H      1 
ATOM 3193 H HA     . GLN C 3 157 ? -6.364  7.239   64.307 1.00 0.36 ? 157 GLN A HA     1 
ATOM 3194 H HB2    . GLN C 3 157 ? -7.890  6.595   61.780 1.00 0.34 ? 157 GLN A HB2    1 
ATOM 3195 H HB3    . GLN C 3 157 ? -6.707  5.497   62.492 1.00 0.34 ? 157 GLN A HB3    1 
ATOM 3196 H HG2    . GLN C 3 157 ? -7.973  5.449   64.589 1.00 0.34 ? 157 GLN A HG2    1 
ATOM 3197 H HG3    . GLN C 3 157 ? -9.135  6.600   63.936 1.00 0.33 ? 157 GLN A HG3    1 
ATOM 3198 H HE21   . GLN C 3 157 ? -11.015 5.348   63.643 1.00 0.58 ? 157 GLN A HE21   1 
ATOM 3199 H HE22   . GLN C 3 157 ? -11.066 3.894   62.769 1.00 0.41 ? 157 GLN A HE22   1 
ATOM 3200 N N      . LYS C 3 158 ? -5.600  8.380   61.301 1.00 0.37 ? 158 LYS A N      1 
ATOM 3201 C CA     . LYS C 3 158 ? -4.492  8.678   60.425 1.00 0.38 ? 158 LYS A CA     1 
ATOM 3202 C C      . LYS C 3 158 ? -3.501  9.651   61.086 1.00 0.40 ? 158 LYS A C      1 
ATOM 3203 O O      . LYS C 3 158 ? -2.284  9.556   60.881 1.00 0.41 ? 158 LYS A O      1 
ATOM 3204 C CB     . LYS C 3 158 ? -5.029  9.301   59.144 1.00 0.38 ? 158 LYS A CB     1 
ATOM 3205 C CG     . LYS C 3 158 ? -3.884  9.491   58.145 1.00 0.43 ? 158 LYS A CG     1 
ATOM 3206 C CD     . LYS C 3 158 ? -4.413  10.160  56.877 1.00 0.46 ? 158 LYS A CD     1 
ATOM 3207 C CE     . LYS C 3 158 ? -5.225  9.158   56.056 1.00 0.46 ? 158 LYS A CE     1 
ATOM 3208 N NZ     . LYS C 3 158 ? -5.561  9.770   54.747 1.00 0.52 ? 158 LYS A NZ     1 
ATOM 3209 H H      . LYS C 3 158 ? -6.510  8.613   61.018 1.00 0.36 ? 158 LYS A H      1 
ATOM 3210 H HA     . LYS C 3 158 ? -3.977  7.763   60.181 1.00 0.38 ? 158 LYS A HA     1 
ATOM 3211 H HB2    . LYS C 3 158 ? -5.776  8.648   58.729 1.00 0.36 ? 158 LYS A HB2    1 
ATOM 3212 H HB3    . LYS C 3 158 ? -5.472  10.260  59.368 1.00 0.40 ? 158 LYS A HB3    1 
ATOM 3213 H HG2    . LYS C 3 158 ? -3.119  10.115  58.585 1.00 0.47 ? 158 LYS A HG2    1 
ATOM 3214 H HG3    . LYS C 3 158 ? -3.462  8.529   57.895 1.00 0.43 ? 158 LYS A HG3    1 
ATOM 3215 H HD2    . LYS C 3 158 ? -5.041  10.996  57.148 1.00 0.46 ? 158 LYS A HD2    1 
ATOM 3216 H HD3    . LYS C 3 158 ? -3.581  10.514  56.286 1.00 0.52 ? 158 LYS A HD3    1 
ATOM 3217 H HE2    . LYS C 3 158 ? -4.645  8.261   55.898 1.00 0.49 ? 158 LYS A HE2    1 
ATOM 3218 H HE3    . LYS C 3 158 ? -6.138  8.911   56.571 1.00 0.41 ? 158 LYS A HE3    1 
ATOM 3219 H HZ1    . LYS C 3 158 ? -5.995  9.053   54.132 1.00 1.10 ? 158 LYS A HZ1    1 
ATOM 3220 H HZ2    . LYS C 3 158 ? -4.694  10.132  54.301 1.00 1.14 ? 158 LYS A HZ2    1 
ATOM 3221 H HZ3    . LYS C 3 158 ? -6.231  10.551  54.890 1.00 1.11 ? 158 LYS A HZ3    1 
ATOM 3222 N N      . GLU C 3 159 ? -4.040  10.566  61.882 1.00 0.40 ? 159 GLU A N      1 
ATOM 3223 C CA     . GLU C 3 159 ? -3.232  11.553  62.580 1.00 0.42 ? 159 GLU A CA     1 
ATOM 3224 C C      . GLU C 3 159 ? -2.367  10.892  63.656 1.00 0.43 ? 159 GLU A C      1 
ATOM 3225 O O      . GLU C 3 159 ? -1.331  11.448  64.048 1.00 0.45 ? 159 GLU A O      1 
ATOM 3226 C CB     . GLU C 3 159 ? -4.154  12.585  63.233 1.00 0.42 ? 159 GLU A CB     1 
ATOM 3227 C CG     . GLU C 3 159 ? -3.332  13.793  63.687 1.00 0.44 ? 159 GLU A CG     1 
ATOM 3228 C CD     . GLU C 3 159 ? -2.726  14.488  62.467 1.00 0.45 ? 159 GLU A CD     1 
ATOM 3229 O OE1    . GLU C 3 159 ? -3.098  14.131  61.360 1.00 0.45 ? 159 GLU A OE1    1 
ATOM 3230 O OE2    . GLU C 3 159 ? -1.900  15.364  62.658 1.00 0.47 ? 159 GLU A OE2    1 
ATOM 3231 H H      . GLU C 3 159 ? -5.013  10.576  62.003 1.00 0.40 ? 159 GLU A H      1 
ATOM 3232 H HA     . GLU C 3 159 ? -2.593  12.055  61.868 1.00 0.43 ? 159 GLU A HA     1 
ATOM 3233 H HB2    . GLU C 3 159 ? -4.899  12.904  62.519 1.00 0.42 ? 159 GLU A HB2    1 
ATOM 3234 H HB3    . GLU C 3 159 ? -4.641  12.142  64.088 1.00 0.42 ? 159 GLU A HB3    1 
ATOM 3235 H HG2    . GLU C 3 159 ? -3.971  14.485  64.215 1.00 0.45 ? 159 GLU A HG2    1 
ATOM 3236 H HG3    . GLU C 3 159 ? -2.539  13.463  64.341 1.00 0.45 ? 159 GLU A HG3    1 
ATOM 3237 N N      . LYS C 3 160 ? -2.793  9.725   64.160 1.00 0.42 ? 160 LYS A N      1 
ATOM 3238 C CA     . LYS C 3 160 ? -2.023  9.044   65.187 1.00 0.43 ? 160 LYS A CA     1 
ATOM 3239 C C      . LYS C 3 160 ? -0.929  8.152   64.573 1.00 0.43 ? 160 LYS A C      1 
ATOM 3240 O O      . LYS C 3 160 ? -0.101  7.612   65.309 1.00 0.44 ? 160 LYS A O      1 
ATOM 3241 C CB     . LYS C 3 160 ? -2.957  8.171   66.026 1.00 0.41 ? 160 LYS A CB     1 
ATOM 3242 C CG     . LYS C 3 160 ? -3.943  9.054   66.792 1.00 0.41 ? 160 LYS A CG     1 
ATOM 3243 C CD     . LYS C 3 160 ? -4.667  8.208   67.844 1.00 0.41 ? 160 LYS A CD     1 
ATOM 3244 C CE     . LYS C 3 160 ? -5.555  9.108   68.706 1.00 0.41 ? 160 LYS A CE     1 
ATOM 3245 N NZ     . LYS C 3 160 ? -5.894  8.400   69.973 1.00 0.41 ? 160 LYS A NZ     1 
ATOM 3246 H H      . LYS C 3 160 ? -3.631  9.330   63.838 1.00 0.41 ? 160 LYS A H      1 
ATOM 3247 H HA     . LYS C 3 160 ? -1.563  9.779   65.829 1.00 0.44 ? 160 LYS A HA     1 
ATOM 3248 H HB2    . LYS C 3 160 ? -3.503  7.502   65.376 1.00 0.40 ? 160 LYS A HB2    1 
ATOM 3249 H HB3    . LYS C 3 160 ? -2.374  7.593   66.729 1.00 0.42 ? 160 LYS A HB3    1 
ATOM 3250 H HG2    . LYS C 3 160 ? -3.406  9.855   67.281 1.00 0.43 ? 160 LYS A HG2    1 
ATOM 3251 H HG3    . LYS C 3 160 ? -4.666  9.468   66.106 1.00 0.41 ? 160 LYS A HG3    1 
ATOM 3252 H HD2    . LYS C 3 160 ? -5.278  7.466   67.348 1.00 0.39 ? 160 LYS A HD2    1 
ATOM 3253 H HD3    . LYS C 3 160 ? -3.941  7.715   68.472 1.00 0.41 ? 160 LYS A HD3    1 
ATOM 3254 H HE2    . LYS C 3 160 ? -5.027  10.022  68.934 1.00 0.42 ? 160 LYS A HE2    1 
ATOM 3255 H HE3    . LYS C 3 160 ? -6.463  9.340   68.170 1.00 0.40 ? 160 LYS A HE3    1 
ATOM 3256 H HZ1    . LYS C 3 160 ? -5.121  8.523   70.657 1.00 0.43 ? 160 LYS A HZ1    1 
ATOM 3257 H HZ2    . LYS C 3 160 ? -6.028  7.386   69.778 1.00 0.40 ? 160 LYS A HZ2    1 
ATOM 3258 H HZ3    . LYS C 3 160 ? -6.769  8.797   70.369 1.00 0.41 ? 160 LYS A HZ3    1 
ATOM 3259 N N      . ARG C 3 161 ? -0.913  8.030   63.244 1.00 0.42 ? 161 ARG A N      1 
ATOM 3260 C CA     . ARG C 3 161 ? 0.103   7.202   62.577 1.00 0.43 ? 161 ARG A CA     1 
ATOM 3261 C C      . ARG C 3 161 ? 1.493   7.853   62.655 1.00 0.45 ? 161 ARG A C      1 
ATOM 3262 O O      . ARG C 3 161 ? 1.604   9.076   62.751 1.00 0.46 ? 161 ARG A O      1 
ATOM 3263 C CB     . ARG C 3 161 ? -0.277  7.010   61.108 1.00 0.42 ? 161 ARG A CB     1 
ATOM 3264 C CG     . ARG C 3 161 ? -1.540  6.152   61.014 1.00 0.40 ? 161 ARG A CG     1 
ATOM 3265 C CD     . ARG C 3 161 ? -1.929  5.974   59.546 1.00 0.39 ? 161 ARG A CD     1 
ATOM 3266 N NE     . ARG C 3 161 ? -3.173  5.156   59.462 1.00 0.38 ? 161 ARG A NE     1 
ATOM 3267 C CZ     . ARG C 3 161 ? -3.843  5.099   58.344 1.00 0.37 ? 161 ARG A CZ     1 
ATOM 3268 N NH1    . ARG C 3 161 ? -3.431  5.769   57.302 1.00 0.38 ? 161 ARG A NH1    1 
ATOM 3269 N NH2    . ARG C 3 161 ? -4.926  4.375   58.268 1.00 0.36 ? 161 ARG A NH2    1 
ATOM 3270 H H      . ARG C 3 161 ? -1.583  8.500   62.707 1.00 0.42 ? 161 ARG A H      1 
ATOM 3271 H HA     . ARG C 3 161 ? 0.139   6.235   63.054 1.00 0.42 ? 161 ARG A HA     1 
ATOM 3272 H HB2    . ARG C 3 161 ? -0.462  7.974   60.655 1.00 0.42 ? 161 ARG A HB2    1 
ATOM 3273 H HB3    . ARG C 3 161 ? 0.530   6.517   60.588 1.00 0.42 ? 161 ARG A HB3    1 
ATOM 3274 H HG2    . ARG C 3 161 ? -1.350  5.184   61.458 1.00 0.40 ? 161 ARG A HG2    1 
ATOM 3275 H HG3    . ARG C 3 161 ? -2.346  6.638   61.542 1.00 0.39 ? 161 ARG A HG3    1 
ATOM 3276 H HD2    . ARG C 3 161 ? -2.100  6.938   59.095 1.00 0.40 ? 161 ARG A HD2    1 
ATOM 3277 H HD3    . ARG C 3 161 ? -1.130  5.470   59.022 1.00 0.40 ? 161 ARG A HD3    1 
ATOM 3278 H HE     . ARG C 3 161 ? -3.485  4.657   60.246 1.00 0.37 ? 161 ARG A HE     1 
ATOM 3279 H HH11   . ARG C 3 161 ? -2.602  6.326   57.361 1.00 0.39 ? 161 ARG A HH11   1 
ATOM 3280 H HH12   . ARG C 3 161 ? -3.945  5.727   56.446 1.00 0.38 ? 161 ARG A HH12   1 
ATOM 3281 H HH21   . ARG C 3 161 ? -5.243  3.864   59.067 1.00 0.36 ? 161 ARG A HH21   1 
ATOM 3282 H HH22   . ARG C 3 161 ? -5.440  4.333   57.411 1.00 0.36 ? 161 ARG A HH22   1 
ATOM 3283 N N      . ILE C 3 162 ? 2.536   7.033   62.593 1.00 0.45 ? 162 ILE A N      1 
ATOM 3284 C CA     . ILE C 3 162 ? 3.914   7.534   62.598 1.00 0.47 ? 162 ILE A CA     1 
ATOM 3285 C C      . ILE C 3 162 ? 4.092   8.324   61.316 1.00 0.48 ? 162 ILE A C      1 
ATOM 3286 O O      . ILE C 3 162 ? 4.516   9.482   61.329 1.00 0.49 ? 162 ILE A O      1 
ATOM 3287 C CB     . ILE C 3 162 ? 4.895   6.359   62.632 1.00 0.47 ? 162 ILE A CB     1 
ATOM 3288 C CG1    . ILE C 3 162 ? 4.870   5.714   64.020 1.00 0.47 ? 162 ILE A CG1    1 
ATOM 3289 C CG2    . ILE C 3 162 ? 6.306   6.863   62.327 1.00 0.49 ? 162 ILE A CG2    1 
ATOM 3290 C CD1    . ILE C 3 162 ? 5.619   4.381   63.977 1.00 0.47 ? 162 ILE A CD1    1 
ATOM 3291 H H      . ILE C 3 162 ? 2.381   6.070   62.503 1.00 0.44 ? 162 ILE A H      1 
ATOM 3292 H HA     . ILE C 3 162 ? 4.073   8.174   63.455 1.00 0.48 ? 162 ILE A HA     1 
ATOM 3293 H HB     . ILE C 3 162 ? 4.605   5.630   61.889 1.00 0.46 ? 162 ILE A HB     1 
ATOM 3294 H HG12   . ILE C 3 162 ? 5.348   6.374   64.730 1.00 0.48 ? 162 ILE A HG12   1 
ATOM 3295 H HG13   . ILE C 3 162 ? 3.848   5.542   64.319 1.00 0.46 ? 162 ILE A HG13   1 
ATOM 3296 H HG21   . ILE C 3 162 ? 6.466   7.808   62.823 1.00 0.50 ? 162 ILE A HG21   1 
ATOM 3297 H HG22   . ILE C 3 162 ? 6.422   6.991   61.261 1.00 0.49 ? 162 ILE A HG22   1 
ATOM 3298 H HG23   . ILE C 3 162 ? 7.029   6.142   62.683 1.00 0.50 ? 162 ILE A HG23   1 
ATOM 3299 H HD11   . ILE C 3 162 ? 5.521   3.884   64.932 1.00 0.47 ? 162 ILE A HD11   1 
ATOM 3300 H HD12   . ILE C 3 162 ? 6.662   4.560   63.769 1.00 0.48 ? 162 ILE A HD12   1 
ATOM 3301 H HD13   . ILE C 3 162 ? 5.198   3.757   63.203 1.00 0.46 ? 162 ILE A HD13   1 
ATOM 3302 N N      . ASN C 3 163 ? 3.788   7.692   60.195 1.00 0.47 ? 163 ASN A N      1 
ATOM 3303 C CA     . ASN C 3 163 ? 3.860   8.327   58.888 1.00 0.47 ? 163 ASN A CA     1 
ATOM 3304 C C      . ASN C 3 163 ? 2.487   8.383   58.210 1.00 0.46 ? 163 ASN A C      1 
ATOM 3305 C CB     . ASN C 3 163 ? 4.825   7.542   57.998 1.00 0.48 ? 163 ASN A CB     1 
ATOM 3306 C CG     . ASN C 3 163 ? 6.254   7.716   58.516 1.00 0.49 ? 163 ASN A CG     1 
ATOM 3307 O OD1    . ASN C 3 163 ? 6.579   8.726   59.106 1.00 0.50 ? 163 ASN A OD1    1 
ATOM 3308 N ND2    . ASN C 3 163 ? 7.126   6.765   58.317 1.00 0.50 ? 163 ASN A ND2    1 
ATOM 3309 H H      . ASN C 3 163 ? 3.469   6.768   60.247 1.00 0.46 ? 163 ASN A H      1 
ATOM 3310 H HA     . ASN C 3 163 ? 4.237   9.331   59.005 1.00 0.48 ? 163 ASN A HA     1 
ATOM 3311 H HB2    . ASN C 3 163 ? 4.559   6.494   58.016 1.00 0.47 ? 163 ASN A HB2    1 
ATOM 3312 H HB3    . ASN C 3 163 ? 4.763   7.911   56.986 1.00 0.48 ? 163 ASN A HB3    1 
ATOM 3313 H HD21   . ASN C 3 163 ? 6.863   5.950   57.840 1.00 0.49 ? 163 ASN A HD21   1 
ATOM 3314 H HD22   . ASN C 3 163 ? 8.043   6.867   58.644 1.00 0.51 ? 163 ASN A HD22   1 
ATOM 3315 N N      . ASP D 4 6   ? 20.119  -12.566 30.657 1.00 1.42 ? 206 ASP B N      1 
ATOM 3316 C CA     . ASP D 4 6   ? 18.931  -12.548 29.760 1.00 0.24 ? 206 ASP B CA     1 
ATOM 3317 C C      . ASP D 4 6   ? 17.660  -12.352 30.586 1.00 0.24 ? 206 ASP B C      1 
ATOM 3318 O O      . ASP D 4 6   ? 17.258  -13.213 31.339 1.00 0.25 ? 206 ASP B O      1 
ATOM 3319 C CB     . ASP D 4 6   ? 18.857  -13.892 28.979 1.00 1.45 ? 206 ASP B CB     1 
ATOM 3320 C CG     . ASP D 4 6   ? 19.292  -13.722 27.506 1.00 2.36 ? 206 ASP B CG     1 
ATOM 3321 O OD1    . ASP D 4 6   ? 19.440  -12.595 27.060 1.00 3.02 ? 206 ASP B OD1    1 
ATOM 3322 O OD2    . ASP D 4 6   ? 19.460  -14.733 26.845 1.00 3.04 ? 206 ASP B OD2    1 
ATOM 3323 H H      . ASP D 4 6   ? 21.019  -12.682 30.287 1.00 1.99 ? 206 ASP B H      1 
ATOM 3324 H HA     . ASP D 4 6   ? 19.029  -11.734 29.057 1.00 1.02 ? 206 ASP B HA     1 
ATOM 3325 H HB2    . ASP D 4 6   ? 19.512  -14.607 29.451 1.00 2.05 ? 206 ASP B HB2    1 
ATOM 3326 H HB3    . ASP D 4 6   ? 17.846  -14.277 29.000 1.00 2.07 ? 206 ASP B HB3    1 
ATOM 3327 N N      . ARG D 4 7   ? 17.023  -11.222 30.451 1.00 0.23 ? 207 ARG B N      1 
ATOM 3328 C CA     . ARG D 4 7   ? 15.777  -10.972 31.228 1.00 0.23 ? 207 ARG B CA     1 
ATOM 3329 C C      . ARG D 4 7   ? 14.576  -11.539 30.475 1.00 0.22 ? 207 ARG B C      1 
ATOM 3330 O O      . ARG D 4 7   ? 14.527  -11.527 29.261 1.00 0.21 ? 207 ARG B O      1 
ATOM 3331 C CB     . ARG D 4 7   ? 15.564  -9.466  31.401 1.00 0.22 ? 207 ARG B CB     1 
ATOM 3332 C CG     . ARG D 4 7   ? 14.491  -9.227  32.469 1.00 0.23 ? 207 ARG B CG     1 
ATOM 3333 C CD     . ARG D 4 7   ? 13.933  -7.811  32.328 1.00 0.24 ? 207 ARG B CD     1 
ATOM 3334 N NE     . ARG D 4 7   ? 12.864  -7.608  33.346 1.00 0.25 ? 207 ARG B NE     1 
ATOM 3335 C CZ     . ARG D 4 7   ? 12.375  -6.419  33.548 1.00 1.01 ? 207 ARG B CZ     1 
ATOM 3336 N NH1    . ARG D 4 7   ? 12.828  -5.406  32.862 1.00 2.00 ? 207 ARG B NH1    1 
ATOM 3337 N NH2    . ARG D 4 7   ? 11.431  -6.241  34.432 1.00 1.00 ? 207 ARG B NH2    1 
ATOM 3338 H H      . ARG D 4 7   ? 17.367  -10.543 29.833 1.00 0.22 ? 207 ARG B H      1 
ATOM 3339 H HA     . ARG D 4 7   ? 15.852  -11.447 32.193 1.00 0.24 ? 207 ARG B HA     1 
ATOM 3340 H HB2    . ARG D 4 7   ? 16.492  -9.005  31.710 1.00 0.23 ? 207 ARG B HB2    1 
ATOM 3341 H HB3    . ARG D 4 7   ? 15.243  -9.035  30.464 1.00 0.21 ? 207 ARG B HB3    1 
ATOM 3342 H HG2    . ARG D 4 7   ? 13.693  -9.945  32.357 1.00 0.23 ? 207 ARG B HG2    1 
ATOM 3343 H HG3    . ARG D 4 7   ? 14.937  -9.334  33.448 1.00 0.25 ? 207 ARG B HG3    1 
ATOM 3344 H HD2    . ARG D 4 7   ? 14.715  -7.088  32.480 1.00 0.25 ? 207 ARG B HD2    1 
ATOM 3345 H HD3    . ARG D 4 7   ? 13.523  -7.690  31.333 1.00 0.23 ? 207 ARG B HD3    1 
ATOM 3346 H HE     . ARG D 4 7   ? 12.526  -8.371  33.860 1.00 0.80 ? 207 ARG B HE     1 
ATOM 3347 H HH11   . ARG D 4 7   ? 13.550  -5.546  32.184 1.00 2.01 ? 207 ARG B HH11   1 
ATOM 3348 H HH12   . ARG D 4 7   ? 12.455  -4.492  33.014 1.00 2.74 ? 207 ARG B HH12   1 
ATOM 3349 H HH21   . ARG D 4 7   ? 11.083  -7.019  34.955 1.00 0.37 ? 207 ARG B HH21   1 
ATOM 3350 H HH22   . ARG D 4 7   ? 11.056  -5.327  34.585 1.00 1.74 ? 207 ARG B HH22   1 
ATOM 3351 N N      . VAL D 4 8   ? 13.604  -12.049 31.186 1.00 0.23 ? 208 VAL B N      1 
ATOM 3352 C CA     . VAL D 4 8   ? 12.414  -12.629 30.513 1.00 0.22 ? 208 VAL B CA     1 
ATOM 3353 C C      . VAL D 4 8   ? 11.364  -11.537 30.306 1.00 0.21 ? 208 VAL B C      1 
ATOM 3354 O O      . VAL D 4 8   ? 11.025  -10.793 31.204 1.00 0.22 ? 208 VAL B O      1 
ATOM 3355 C CB     . VAL D 4 8   ? 11.828  -13.742 31.383 1.00 0.24 ? 208 VAL B CB     1 
ATOM 3356 C CG1    . VAL D 4 8   ? 10.665  -14.408 30.645 1.00 0.24 ? 208 VAL B CG1    1 
ATOM 3357 C CG2    . VAL D 4 8   ? 12.909  -14.784 31.673 1.00 0.25 ? 208 VAL B CG2    1 
ATOM 3358 H H      . VAL D 4 8   ? 13.667  -12.057 32.164 1.00 0.24 ? 208 VAL B H      1 
ATOM 3359 H HA     . VAL D 4 8   ? 12.704  -13.035 29.554 1.00 0.22 ? 208 VAL B HA     1 
ATOM 3360 H HB     . VAL D 4 8   ? 11.469  -13.321 32.312 1.00 0.25 ? 208 VAL B HB     1 
ATOM 3361 H HG11   . VAL D 4 8   ? 9.890   -13.680 30.461 1.00 0.23 ? 208 VAL B HG11   1 
ATOM 3362 H HG12   . VAL D 4 8   ? 10.269  -15.211 31.249 1.00 0.25 ? 208 VAL B HG12   1 
ATOM 3363 H HG13   . VAL D 4 8   ? 11.017  -14.806 29.704 1.00 0.23 ? 208 VAL B HG13   1 
ATOM 3364 H HG21   . VAL D 4 8   ? 13.305  -15.162 30.743 1.00 0.25 ? 208 VAL B HG21   1 
ATOM 3365 H HG22   . VAL D 4 8   ? 12.483  -15.598 32.241 1.00 0.27 ? 208 VAL B HG22   1 
ATOM 3366 H HG23   . VAL D 4 8   ? 13.705  -14.327 32.243 1.00 0.26 ? 208 VAL B HG23   1 
ATOM 3367 N N      . LYS D 4 9   ? 10.876  -11.431 29.109 1.00 0.20 ? 209 LYS B N      1 
ATOM 3368 C CA     . LYS D 4 9   ? 9.869   -10.385 28.785 1.00 0.19 ? 209 LYS B CA     1 
ATOM 3369 C C      . LYS D 4 9   ? 8.461   -10.937 29.048 1.00 0.20 ? 209 LYS B C      1 
ATOM 3370 O O      . LYS D 4 9   ? 8.249   -12.132 29.070 1.00 0.21 ? 209 LYS B O      1 
ATOM 3371 C CB     . LYS D 4 9   ? 10.047  -9.999  27.323 1.00 0.18 ? 209 LYS B CB     1 
ATOM 3372 C CG     . LYS D 4 9   ? 11.476  -9.468  27.119 1.00 0.18 ? 209 LYS B CG     1 
ATOM 3373 C CD     . LYS D 4 9   ? 11.635  -9.034  25.671 1.00 0.19 ? 209 LYS B CD     1 
ATOM 3374 C CE     . LYS D 4 9   ? 13.051  -8.551  25.375 1.00 0.24 ? 209 LYS B CE     1 
ATOM 3375 N NZ     . LYS D 4 9   ? 13.121  -8.155  23.937 1.00 1.20 ? 209 LYS B NZ     1 
ATOM 3376 H H      . LYS D 4 9   ? 11.186  -12.037 28.404 1.00 0.20 ? 209 LYS B H      1 
ATOM 3377 H HA     . LYS D 4 9   ? 10.036  -9.524  29.417 1.00 0.20 ? 209 LYS B HA     1 
ATOM 3378 H HB2    . LYS D 4 9   ? 9.891   -10.867 26.700 1.00 0.18 ? 209 LYS B HB2    1 
ATOM 3379 H HB3    . LYS D 4 9   ? 9.337   -9.230  27.062 1.00 0.18 ? 209 LYS B HB3    1 
ATOM 3380 H HG2    . LYS D 4 9   ? 11.647  -8.626  27.776 1.00 0.19 ? 209 LYS B HG2    1 
ATOM 3381 H HG3    . LYS D 4 9   ? 12.187  -10.249 27.339 1.00 0.20 ? 209 LYS B HG3    1 
ATOM 3382 H HD2    . LYS D 4 9   ? 11.392  -9.856  25.018 1.00 0.20 ? 209 LYS B HD2    1 
ATOM 3383 H HD3    . LYS D 4 9   ? 10.973  -8.228  25.505 1.00 0.19 ? 209 LYS B HD3    1 
ATOM 3384 H HE2    . LYS D 4 9   ? 13.284  -7.698  25.997 1.00 1.01 ? 209 LYS B HE2    1 
ATOM 3385 H HE3    . LYS D 4 9   ? 13.753  -9.346  25.565 1.00 0.90 ? 209 LYS B HE3    1 
ATOM 3386 H HZ1    . LYS D 4 9   ? 13.390  -8.979  23.363 1.00 1.76 ? 209 LYS B HZ1    1 
ATOM 3387 H HZ2    . LYS D 4 9   ? 13.827  -7.400  23.816 1.00 1.80 ? 209 LYS B HZ2    1 
ATOM 3388 H HZ3    . LYS D 4 9   ? 12.189  -7.812  23.628 1.00 1.78 ? 209 LYS B HZ3    1 
ATOM 3389 N N      . ARG D 4 10  ? 7.506   -10.073 29.284 1.00 0.20 ? 210 ARG B N      1 
ATOM 3390 C CA     . ARG D 4 10  ? 6.118   -10.534 29.591 1.00 0.21 ? 210 ARG B CA     1 
ATOM 3391 C C      . ARG D 4 10  ? 5.457   -11.148 28.355 1.00 0.21 ? 210 ARG B C      1 
ATOM 3392 O O      . ARG D 4 10  ? 5.738   -10.759 27.238 1.00 0.20 ? 210 ARG B O      1 
ATOM 3393 C CB     . ARG D 4 10  ? 5.280   -9.347  30.066 1.00 0.22 ? 210 ARG B CB     1 
ATOM 3394 C CG     . ARG D 4 10  ? 5.980   -8.665  31.241 1.00 0.28 ? 210 ARG B CG     1 
ATOM 3395 C CD     . ARG D 4 10  ? 5.297   -7.330  31.531 1.00 0.34 ? 210 ARG B CD     1 
ATOM 3396 N NE     . ARG D 4 10  ? 3.835   -7.546  31.707 1.00 0.52 ? 210 ARG B NE     1 
ATOM 3397 C CZ     . ARG D 4 10  ? 3.100   -6.617  32.255 1.00 0.74 ? 210 ARG B CZ     1 
ATOM 3398 N NH1    . ARG D 4 10  ? 3.649   -5.504  32.656 1.00 1.43 ? 210 ARG B NH1    1 
ATOM 3399 N NH2    . ARG D 4 10  ? 1.817   -6.803  32.404 1.00 0.85 ? 210 ARG B NH2    1 
ATOM 3400 H H      . ARG D 4 10  ? 7.708   -9.116  29.289 1.00 0.20 ? 210 ARG B H      1 
ATOM 3401 H HA     . ARG D 4 10  ? 6.154   -11.272 30.377 1.00 0.22 ? 210 ARG B HA     1 
ATOM 3402 H HB2    . ARG D 4 10  ? 5.161   -8.642  29.259 1.00 0.23 ? 210 ARG B HB2    1 
ATOM 3403 H HB3    . ARG D 4 10  ? 4.310   -9.696  30.384 1.00 0.25 ? 210 ARG B HB3    1 
ATOM 3404 H HG2    . ARG D 4 10  ? 5.920   -9.299  32.114 1.00 0.34 ? 210 ARG B HG2    1 
ATOM 3405 H HG3    . ARG D 4 10  ? 7.016   -8.489  30.995 1.00 0.34 ? 210 ARG B HG3    1 
ATOM 3406 H HD2    . ARG D 4 10  ? 5.709   -6.909  32.429 1.00 0.42 ? 210 ARG B HD2    1 
ATOM 3407 H HD3    . ARG D 4 10  ? 5.464   -6.653  30.707 1.00 0.42 ? 210 ARG B HD3    1 
ATOM 3408 H HE     . ARG D 4 10  ? 3.423   -8.385  31.410 1.00 1.03 ? 210 ARG B HE     1 
ATOM 3409 H HH11   . ARG D 4 10  ? 4.633   -5.362  32.544 1.00 1.53 ? 210 ARG B HH11   1 
ATOM 3410 H HH12   . ARG D 4 10  ? 3.087   -4.792  33.077 1.00 1.95 ? 210 ARG B HH12   1 
ATOM 3411 H HH21   . ARG D 4 10  ? 1.397   -7.658  32.098 1.00 0.97 ? 210 ARG B HH21   1 
ATOM 3412 H HH22   . ARG D 4 10  ? 1.254   -6.092  32.824 1.00 1.21 ? 210 ARG B HH22   1 
ATOM 3413 N N      . PRO D 4 11  ? 4.543   -12.072 28.550 1.00 0.22 ? 211 PRO B N      1 
ATOM 3414 C CA     . PRO D 4 11  ? 3.802   -12.690 27.420 1.00 0.22 ? 211 PRO B CA     1 
ATOM 3415 C C      . PRO D 4 11  ? 3.073   -11.615 26.610 1.00 0.21 ? 211 PRO B C      1 
ATOM 3416 O O      . PRO D 4 11  ? 2.550   -10.660 27.153 1.00 0.22 ? 211 PRO B O      1 
ATOM 3417 C CB     . PRO D 4 11  ? 2.763   -13.593 28.079 1.00 0.24 ? 211 PRO B CB     1 
ATOM 3418 C CG     . PRO D 4 11  ? 3.286   -13.873 29.447 1.00 0.51 ? 211 PRO B CG     1 
ATOM 3419 C CD     . PRO D 4 11  ? 4.103   -12.645 29.848 1.00 0.23 ? 211 PRO B CD     1 
ATOM 3420 H HA     . PRO D 4 11  ? 4.473   -13.252 26.791 1.00 0.21 ? 211 PRO B HA     1 
ATOM 3421 H HB2    . PRO D 4 11  ? 1.823   -13.063 28.134 1.00 0.43 ? 211 PRO B HB2    1 
ATOM 3422 H HB3    . PRO D 4 11  ? 2.648   -14.513 27.523 1.00 0.46 ? 211 PRO B HB3    1 
ATOM 3423 H HG2    . PRO D 4 11  ? 2.466   -14.018 30.140 1.00 0.92 ? 211 PRO B HG2    1 
ATOM 3424 H HG3    . PRO D 4 11  ? 3.919   -14.747 29.435 1.00 0.93 ? 211 PRO B HG3    1 
ATOM 3425 H HD2    . PRO D 4 11  ? 3.488   -11.938 30.392 1.00 0.38 ? 211 PRO B HD2    1 
ATOM 3426 H HD3    . PRO D 4 11  ? 4.947   -12.953 30.437 1.00 0.36 ? 211 PRO B HD3    1 
ATOM 3427 N N      . MET D 4 12  ? 3.042   -11.755 25.318 1.00 0.21 ? 212 MET B N      1 
ATOM 3428 C CA     . MET D 4 12  ? 2.358   -10.734 24.476 1.00 0.21 ? 212 MET B CA     1 
ATOM 3429 C C      . MET D 4 12  ? 0.840   -10.867 24.614 1.00 0.22 ? 212 MET B C      1 
ATOM 3430 O O      . MET D 4 12  ? 0.297   -11.953 24.581 1.00 0.23 ? 212 MET B O      1 
ATOM 3431 C CB     . MET D 4 12  ? 2.758   -10.928 23.011 1.00 0.21 ? 212 MET B CB     1 
ATOM 3432 C CG     . MET D 4 12  ? 4.233   -10.571 22.844 1.00 0.20 ? 212 MET B CG     1 
ATOM 3433 S SD     . MET D 4 12  ? 4.705   -10.698 21.098 1.00 0.22 ? 212 MET B SD     1 
ATOM 3434 C CE     . MET D 4 12  ? 4.663   -12.502 20.950 1.00 0.29 ? 212 MET B CE     1 
ATOM 3435 H H      . MET D 4 12  ? 3.476   -12.525 24.896 1.00 0.21 ? 212 MET B H      1 
ATOM 3436 H HA     . MET D 4 12  ? 2.661   -9.747  24.796 1.00 0.21 ? 212 MET B HA     1 
ATOM 3437 H HB2    . MET D 4 12  ? 2.598   -11.957 22.725 1.00 0.21 ? 212 MET B HB2    1 
ATOM 3438 H HB3    . MET D 4 12  ? 2.163   -10.281 22.387 1.00 0.21 ? 212 MET B HB3    1 
ATOM 3439 H HG2    . MET D 4 12  ? 4.386   -9.560  23.183 1.00 0.20 ? 212 MET B HG2    1 
ATOM 3440 H HG3    . MET D 4 12  ? 4.837   -11.241 23.436 1.00 0.21 ? 212 MET B HG3    1 
ATOM 3441 H HE1    . MET D 4 12  ? 3.678   -12.813 20.632 1.00 1.07 ? 212 MET B HE1    1 
ATOM 3442 H HE2    . MET D 4 12  ? 4.890   -12.953 21.901 1.00 1.03 ? 212 MET B HE2    1 
ATOM 3443 H HE3    . MET D 4 12  ? 5.398   -12.818 20.222 1.00 1.09 ? 212 MET B HE3    1 
ATOM 3444 N N      . ASN D 4 13  ? 0.153   -9.771  24.809 1.00 0.23 ? 213 ASN B N      1 
ATOM 3445 C CA     . ASN D 4 13  ? -1.326  -9.833  24.994 1.00 0.24 ? 213 ASN B CA     1 
ATOM 3446 C C      . ASN D 4 13  ? -2.033  -9.969  23.643 1.00 0.25 ? 213 ASN B C      1 
ATOM 3447 O O      . ASN D 4 13  ? -1.441  -9.818  22.594 1.00 0.24 ? 213 ASN B O      1 
ATOM 3448 C CB     . ASN D 4 13  ? -1.811  -8.556  25.696 1.00 0.25 ? 213 ASN B CB     1 
ATOM 3449 C CG     . ASN D 4 13  ? -1.642  -7.344  24.777 1.00 0.25 ? 213 ASN B CG     1 
ATOM 3450 O OD1    . ASN D 4 13  ? -1.924  -7.411  23.598 1.00 0.25 ? 213 ASN B OD1    1 
ATOM 3451 N ND2    . ASN D 4 13  ? -1.196  -6.221  25.274 1.00 0.26 ? 213 ASN B ND2    1 
ATOM 3452 H H      . ASN D 4 13  ? 0.594   -8.919  24.863 1.00 0.23 ? 213 ASN B H      1 
ATOM 3453 H HA     . ASN D 4 13  ? -1.574  -10.681 25.612 1.00 0.25 ? 213 ASN B HA     1 
ATOM 3454 H HB2    . ASN D 4 13  ? -2.855  -8.666  25.954 1.00 0.26 ? 213 ASN B HB2    1 
ATOM 3455 H HB3    . ASN D 4 13  ? -1.235  -8.403  26.597 1.00 0.25 ? 213 ASN B HB3    1 
ATOM 3456 H HD21   . ASN D 4 13  ? -0.974  -6.160  26.226 1.00 0.27 ? 213 ASN B HD21   1 
ATOM 3457 H HD22   . ASN D 4 13  ? -1.080  -5.440  24.692 1.00 0.26 ? 213 ASN B HD22   1 
ATOM 3458 N N      . ALA D 4 14  ? -3.299  -10.289 23.676 1.00 0.26 ? 214 ALA B N      1 
ATOM 3459 C CA     . ALA D 4 14  ? -4.066  -10.490 22.415 1.00 0.27 ? 214 ALA B CA     1 
ATOM 3460 C C      . ALA D 4 14  ? -3.857  -9.317  21.449 1.00 0.27 ? 214 ALA B C      1 
ATOM 3461 O O      . ALA D 4 14  ? -3.797  -9.506  20.250 1.00 0.28 ? 214 ALA B O      1 
ATOM 3462 C CB     . ALA D 4 14  ? -5.555  -10.611 22.745 1.00 0.29 ? 214 ALA B CB     1 
ATOM 3463 H H      . ALA D 4 14  ? -3.741  -10.427 24.540 1.00 0.27 ? 214 ALA B H      1 
ATOM 3464 H HA     . ALA D 4 14  ? -3.736  -11.401 21.941 1.00 0.27 ? 214 ALA B HA     1 
ATOM 3465 H HB1    . ALA D 4 14  ? -5.956  -9.632  22.963 1.00 0.29 ? 214 ALA B HB1    1 
ATOM 3466 H HB2    . ALA D 4 14  ? -5.683  -11.251 23.606 1.00 0.29 ? 214 ALA B HB2    1 
ATOM 3467 H HB3    . ALA D 4 14  ? -6.078  -11.035 21.901 1.00 0.30 ? 214 ALA B HB3    1 
ATOM 3468 N N      . PHE D 4 15  ? -3.752  -8.112  21.938 1.00 0.27 ? 215 PHE B N      1 
ATOM 3469 C CA     . PHE D 4 15  ? -3.559  -6.969  21.005 1.00 0.28 ? 215 PHE B CA     1 
ATOM 3470 C C      . PHE D 4 15  ? -2.127  -6.960  20.485 1.00 0.26 ? 215 PHE B C      1 
ATOM 3471 O O      . PHE D 4 15  ? -1.896  -6.741  19.312 1.00 0.26 ? 215 PHE B O      1 
ATOM 3472 C CB     . PHE D 4 15  ? -3.826  -5.662  21.754 1.00 0.29 ? 215 PHE B CB     1 
ATOM 3473 C CG     . PHE D 4 15  ? -3.585  -4.489  20.837 1.00 0.29 ? 215 PHE B CG     1 
ATOM 3474 C CD1    . PHE D 4 15  ? -4.614  -4.027  19.998 1.00 0.31 ? 215 PHE B CD1    1 
ATOM 3475 C CD2    . PHE D 4 15  ? -2.326  -3.859  20.820 1.00 0.29 ? 215 PHE B CD2    1 
ATOM 3476 C CE1    . PHE D 4 15  ? -4.385  -2.933  19.144 1.00 0.32 ? 215 PHE B CE1    1 
ATOM 3477 C CE2    . PHE D 4 15  ? -2.099  -2.765  19.964 1.00 0.30 ? 215 PHE B CE2    1 
ATOM 3478 C CZ     . PHE D 4 15  ? -3.128  -2.302  19.126 1.00 0.31 ? 215 PHE B CZ     1 
ATOM 3479 H H      . PHE D 4 15  ? -3.807  -7.962  22.907 1.00 0.27 ? 215 PHE B H      1 
ATOM 3480 H HA     . PHE D 4 15  ? -4.245  -7.060  20.176 1.00 0.29 ? 215 PHE B HA     1 
ATOM 3481 H HB2    . PHE D 4 15  ? -4.851  -5.647  22.095 1.00 0.30 ? 215 PHE B HB2    1 
ATOM 3482 H HB3    . PHE D 4 15  ? -3.164  -5.594  22.605 1.00 0.28 ? 215 PHE B HB3    1 
ATOM 3483 H HD1    . PHE D 4 15  ? -5.579  -4.510  20.011 1.00 0.32 ? 215 PHE B HD1    1 
ATOM 3484 H HD2    . PHE D 4 15  ? -1.536  -4.214  21.463 1.00 0.28 ? 215 PHE B HD2    1 
ATOM 3485 H HE1    . PHE D 4 15  ? -5.175  -2.574  18.505 1.00 0.33 ? 215 PHE B HE1    1 
ATOM 3486 H HE2    . PHE D 4 15  ? -1.134  -2.282  19.951 1.00 0.30 ? 215 PHE B HE2    1 
ATOM 3487 H HZ     . PHE D 4 15  ? -2.954  -1.464  18.469 1.00 0.32 ? 215 PHE B HZ     1 
ATOM 3488 N N      . MET D 4 16  ? -1.148  -7.161  21.334 1.00 0.25 ? 216 MET B N      1 
ATOM 3489 C CA     . MET D 4 16  ? 0.222   -7.160  20.834 1.00 0.24 ? 216 MET B CA     1 
ATOM 3490 C C      . MET D 4 16  ? 0.435   -8.270  19.810 1.00 0.23 ? 216 MET B C      1 
ATOM 3491 O O      . MET D 4 16  ? 1.000   -8.059  18.755 1.00 0.23 ? 216 MET B O      1 
ATOM 3492 C CB     . MET D 4 16  ? 1.145   -7.382  22.030 1.00 0.22 ? 216 MET B CB     1 
ATOM 3493 C CG     . MET D 4 16  ? 0.982   -6.225  23.021 1.00 0.22 ? 216 MET B CG     1 
ATOM 3494 S SD     . MET D 4 16  ? 1.715   -4.715  22.349 1.00 0.22 ? 216 MET B SD     1 
ATOM 3495 C CE     . MET D 4 16  ? 3.450   -5.127  22.666 1.00 0.22 ? 216 MET B CE     1 
ATOM 3496 H H      . MET D 4 16  ? -1.334  -7.317  22.284 1.00 0.25 ? 216 MET B H      1 
ATOM 3497 H HA     . MET D 4 16  ? 0.427   -6.208  20.370 1.00 0.24 ? 216 MET B HA     1 
ATOM 3498 H HB2    . MET D 4 16  ? 0.890   -8.314  22.515 1.00 0.23 ? 216 MET B HB2    1 
ATOM 3499 H HB3    . MET D 4 16  ? 2.169   -7.421  21.690 1.00 0.21 ? 216 MET B HB3    1 
ATOM 3500 H HG2    . MET D 4 16  ? -0.066  -6.053  23.186 1.00 0.24 ? 216 MET B HG2    1 
ATOM 3501 H HG3    . MET D 4 16  ? 1.451   -6.478  23.958 1.00 0.22 ? 216 MET B HG3    1 
ATOM 3502 H HE1    . MET D 4 16  ? 3.523   -6.021  23.264 1.00 1.02 ? 216 MET B HE1    1 
ATOM 3503 H HE2    . MET D 4 16  ? 3.922   -4.316  23.195 1.00 1.03 ? 216 MET B HE2    1 
ATOM 3504 H HE3    . MET D 4 16  ? 3.945   -5.285  21.724 1.00 1.07 ? 216 MET B HE3    1 
ATOM 3505 N N      . VAL D 4 17  ? -0.068  -9.453  20.092 1.00 0.24 ? 217 VAL B N      1 
ATOM 3506 C CA     . VAL D 4 17  ? 0.057   -10.562 19.101 1.00 0.24 ? 217 VAL B CA     1 
ATOM 3507 C C      . VAL D 4 17  ? -0.688  -10.159 17.815 1.00 0.26 ? 217 VAL B C      1 
ATOM 3508 O O      . VAL D 4 17  ? -0.170  -10.253 16.713 1.00 0.26 ? 217 VAL B O      1 
ATOM 3509 C CB     . VAL D 4 17  ? -0.565  -11.835 19.677 1.00 0.25 ? 217 VAL B CB     1 
ATOM 3510 C CG1    . VAL D 4 17  ? -0.332  -13.000 18.713 1.00 0.26 ? 217 VAL B CG1    1 
ATOM 3511 C CG2    . VAL D 4 17  ? 0.087   -12.153 21.025 1.00 0.24 ? 217 VAL B CG2    1 
ATOM 3512 H H      . VAL D 4 17  ? -0.555  -9.593  20.931 1.00 0.24 ? 217 VAL B H      1 
ATOM 3513 H HA     . VAL D 4 17  ? 1.101   -10.733 18.876 1.00 0.24 ? 217 VAL B HA     1 
ATOM 3514 H HB     . VAL D 4 17  ? -1.627  -11.688 19.813 1.00 0.26 ? 217 VAL B HB     1 
ATOM 3515 H HG11   . VAL D 4 17  ? -0.914  -12.846 17.817 1.00 0.27 ? 217 VAL B HG11   1 
ATOM 3516 H HG12   . VAL D 4 17  ? -0.635  -13.923 19.185 1.00 0.26 ? 217 VAL B HG12   1 
ATOM 3517 H HG13   . VAL D 4 17  ? 0.716   -13.052 18.458 1.00 0.25 ? 217 VAL B HG13   1 
ATOM 3518 H HG21   . VAL D 4 17  ? 1.046   -12.622 20.859 1.00 0.23 ? 217 VAL B HG21   1 
ATOM 3519 H HG22   . VAL D 4 17  ? -0.550  -12.824 21.582 1.00 0.24 ? 217 VAL B HG22   1 
ATOM 3520 H HG23   . VAL D 4 17  ? 0.223   -11.239 21.583 1.00 0.23 ? 217 VAL B HG23   1 
ATOM 3521 N N      . TRP D 4 18  ? -1.903  -9.703  17.967 1.00 0.27 ? 218 TRP B N      1 
ATOM 3522 C CA     . TRP D 4 18  ? -2.727  -9.281  16.793 1.00 0.28 ? 218 TRP B CA     1 
ATOM 3523 C C      . TRP D 4 18  ? -2.096  -8.079  16.080 1.00 0.28 ? 218 TRP B C      1 
ATOM 3524 O O      . TRP D 4 18  ? -2.265  -7.896  14.891 1.00 0.30 ? 218 TRP B O      1 
ATOM 3525 C CB     . TRP D 4 18  ? -4.124  -8.899  17.286 1.00 0.29 ? 218 TRP B CB     1 
ATOM 3526 C CG     . TRP D 4 18  ? -4.873  -8.220  16.191 1.00 0.31 ? 218 TRP B CG     1 
ATOM 3527 C CD1    . TRP D 4 18  ? -5.595  -8.850  15.236 1.00 0.33 ? 218 TRP B CD1    1 
ATOM 3528 C CD2    . TRP D 4 18  ? -4.998  -6.795  15.927 1.00 0.32 ? 218 TRP B CD2    1 
ATOM 3529 N NE1    . TRP D 4 18  ? -6.151  -7.901  14.400 1.00 0.34 ? 218 TRP B NE1    1 
ATOM 3530 C CE2    . TRP D 4 18  ? -5.808  -6.617  14.782 1.00 0.34 ? 218 TRP B CE2    1 
ATOM 3531 C CE3    . TRP D 4 18  ? -4.482  -5.648  16.560 1.00 0.31 ? 218 TRP B CE3    1 
ATOM 3532 C CZ2    . TRP D 4 18  ? -6.103  -5.349  14.285 1.00 0.35 ? 218 TRP B CZ2    1 
ATOM 3533 C CZ3    . TRP D 4 18  ? -4.778  -4.369  16.064 1.00 0.33 ? 218 TRP B CZ3    1 
ATOM 3534 C CH2    . TRP D 4 18  ? -5.585  -4.221  14.927 1.00 0.34 ? 218 TRP B CH2    1 
ATOM 3535 H H      . TRP D 4 18  ? -2.283  -9.638  18.867 1.00 0.27 ? 218 TRP B H      1 
ATOM 3536 H HA     . TRP D 4 18  ? -2.808  -10.104 16.100 1.00 0.29 ? 218 TRP B HA     1 
ATOM 3537 H HB2    . TRP D 4 18  ? -4.656  -9.790  17.585 1.00 0.30 ? 218 TRP B HB2    1 
ATOM 3538 H HB3    . TRP D 4 18  ? -4.038  -8.232  18.129 1.00 0.29 ? 218 TRP B HB3    1 
ATOM 3539 H HD1    . TRP D 4 18  ? -5.719  -9.919  15.146 1.00 0.33 ? 218 TRP B HD1    1 
ATOM 3540 H HE1    . TRP D 4 18  ? -6.721  -8.094  13.625 1.00 0.35 ? 218 TRP B HE1    1 
ATOM 3541 H HE3    . TRP D 4 18  ? -3.856  -5.754  17.433 1.00 0.30 ? 218 TRP B HE3    1 
ATOM 3542 H HZ2    . TRP D 4 18  ? -6.726  -5.239  13.409 1.00 0.36 ? 218 TRP B HZ2    1 
ATOM 3543 H HZ3    . TRP D 4 18  ? -4.378  -3.496  16.556 1.00 0.33 ? 218 TRP B HZ3    1 
ATOM 3544 H HH2    . TRP D 4 18  ? -5.810  -3.234  14.549 1.00 0.36 ? 218 TRP B HH2    1 
ATOM 3545 N N      . SER D 4 19  ? -1.360  -7.262  16.785 1.00 0.27 ? 219 SER B N      1 
ATOM 3546 C CA     . SER D 4 19  ? -0.722  -6.092  16.114 1.00 0.28 ? 219 SER B CA     1 
ATOM 3547 C C      . SER D 4 19  ? 0.555   -6.546  15.405 1.00 0.27 ? 219 SER B C      1 
ATOM 3548 O O      . SER D 4 19  ? 0.890   -6.061  14.347 1.00 0.28 ? 219 SER B O      1 
ATOM 3549 C CB     . SER D 4 19  ? -0.374  -5.032  17.160 1.00 0.27 ? 219 SER B CB     1 
ATOM 3550 O OG     . SER D 4 19  ? -0.096  -5.670  18.399 1.00 0.26 ? 219 SER B OG     1 
ATOM 3551 H H      . SER D 4 19  ? -1.220  -7.422  17.741 1.00 0.26 ? 219 SER B H      1 
ATOM 3552 H HA     . SER D 4 19  ? -1.407  -5.673  15.390 1.00 0.29 ? 219 SER B HA     1 
ATOM 3553 H HB2    . SER D 4 19  ? 0.495   -4.481  16.841 1.00 0.27 ? 219 SER B HB2    1 
ATOM 3554 H HB3    . SER D 4 19  ? -1.207  -4.352  17.271 1.00 0.28 ? 219 SER B HB3    1 
ATOM 3555 H HG     . SER D 4 19  ? -0.760  -5.391  19.032 1.00 0.26 ? 219 SER B HG     1 
ATOM 3556 N N      . ARG D 4 20  ? 1.272   -7.476  15.970 1.00 0.25 ? 220 ARG B N      1 
ATOM 3557 C CA     . ARG D 4 20  ? 2.517   -7.943  15.303 1.00 0.25 ? 220 ARG B CA     1 
ATOM 3558 C C      . ARG D 4 20  ? 2.213   -8.284  13.844 1.00 0.27 ? 220 ARG B C      1 
ATOM 3559 O O      . ARG D 4 20  ? 2.901   -7.841  12.940 1.00 0.28 ? 220 ARG B O      1 
ATOM 3560 C CB     . ARG D 4 20  ? 3.018   -9.195  16.026 1.00 0.24 ? 220 ARG B CB     1 
ATOM 3561 C CG     . ARG D 4 20  ? 4.463   -9.483  15.606 1.00 0.85 ? 220 ARG B CG     1 
ATOM 3562 C CD     . ARG D 4 20  ? 4.957   -10.788 16.255 1.00 0.81 ? 220 ARG B CD     1 
ATOM 3563 N NE     . ARG D 4 20  ? 5.799   -11.521 15.270 1.00 1.39 ? 220 ARG B NE     1 
ATOM 3564 C CZ     . ARG D 4 20  ? 6.556   -12.504 15.661 1.00 1.84 ? 220 ARG B CZ     1 
ATOM 3565 N NH1    . ARG D 4 20  ? 6.581   -12.844 16.920 1.00 2.13 ? 220 ARG B NH1    1 
ATOM 3566 N NH2    . ARG D 4 20  ? 7.287   -13.148 14.793 1.00 2.64 ? 220 ARG B NH2    1 
ATOM 3567 H H      . ARG D 4 20  ? 0.992   -7.867  16.824 1.00 0.25 ? 220 ARG B H      1 
ATOM 3568 H HA     . ARG D 4 20  ? 3.274   -7.177  15.355 1.00 0.25 ? 220 ARG B HA     1 
ATOM 3569 H HB2    . ARG D 4 20  ? 2.974   -9.039  17.094 1.00 0.66 ? 220 ARG B HB2    1 
ATOM 3570 H HB3    . ARG D 4 20  ? 2.395   -10.037 15.759 1.00 0.67 ? 220 ARG B HB3    1 
ATOM 3571 H HG2    . ARG D 4 20  ? 4.515   -9.574  14.532 1.00 1.27 ? 220 ARG B HG2    1 
ATOM 3572 H HG3    . ARG D 4 20  ? 5.093   -8.663  15.926 1.00 1.26 ? 220 ARG B HG3    1 
ATOM 3573 H HD2    . ARG D 4 20  ? 5.549   -10.560 17.132 1.00 1.20 ? 220 ARG B HD2    1 
ATOM 3574 H HD3    . ARG D 4 20  ? 4.118   -11.407 16.541 1.00 1.08 ? 220 ARG B HD3    1 
ATOM 3575 H HE     . ARG D 4 20  ? 5.778   -11.265 14.323 1.00 2.00 ? 220 ARG B HE     1 
ATOM 3576 H HH11   . ARG D 4 20  ? 6.019   -12.349 17.583 1.00 2.12 ? 220 ARG B HH11   1 
ATOM 3577 H HH12   . ARG D 4 20  ? 7.162   -13.599 17.223 1.00 2.78 ? 220 ARG B HH12   1 
ATOM 3578 H HH21   . ARG D 4 20  ? 7.263   -12.886 13.828 1.00 3.07 ? 220 ARG B HH21   1 
ATOM 3579 H HH22   . ARG D 4 20  ? 7.868   -13.904 15.092 1.00 3.06 ? 220 ARG B HH22   1 
ATOM 3580 N N      . GLY D 4 21  ? 1.195   -9.065  13.592 1.00 0.28 ? 221 GLY B N      1 
ATOM 3581 C CA     . GLY D 4 21  ? 0.868   -9.424  12.179 1.00 0.30 ? 221 GLY B CA     1 
ATOM 3582 C C      . GLY D 4 21  ? 0.050   -8.309  11.515 1.00 0.31 ? 221 GLY B C      1 
ATOM 3583 O O      . GLY D 4 21  ? 0.222   -8.026  10.347 1.00 0.33 ? 221 GLY B O      1 
ATOM 3584 H H      . GLY D 4 21  ? 0.649   -9.413  14.326 1.00 0.28 ? 221 GLY B H      1 
ATOM 3585 H HA2    . GLY D 4 21  ? 1.786   -9.570  11.629 1.00 0.30 ? 221 GLY B HA2    1 
ATOM 3586 H HA3    . GLY D 4 21  ? 0.296   -10.339 12.167 1.00 0.31 ? 221 GLY B HA3    1 
ATOM 3587 N N      . GLN D 4 22  ? -0.831  -7.668  12.234 1.00 0.31 ? 222 GLN B N      1 
ATOM 3588 C CA     . GLN D 4 22  ? -1.633  -6.575  11.608 1.00 0.33 ? 222 GLN B CA     1 
ATOM 3589 C C      . GLN D 4 22  ? -0.719  -5.369  11.363 1.00 0.33 ? 222 GLN B C      1 
ATOM 3590 O O      . GLN D 4 22  ? -0.774  -4.730  10.330 1.00 0.34 ? 222 GLN B O      1 
ATOM 3591 C CB     . GLN D 4 22  ? -2.771  -6.173  12.548 1.00 0.33 ? 222 GLN B CB     1 
ATOM 3592 C CG     . GLN D 4 22  ? -3.796  -5.336  11.779 1.00 0.35 ? 222 GLN B CG     1 
ATOM 3593 C CD     . GLN D 4 22  ? -4.665  -6.255  10.920 1.00 0.36 ? 222 GLN B CD     1 
ATOM 3594 O OE1    . GLN D 4 22  ? -5.174  -7.249  11.397 1.00 0.36 ? 222 GLN B OE1    1 
ATOM 3595 N NE2    . GLN D 4 22  ? -4.858  -5.963  9.663  1.00 0.38 ? 222 GLN B NE2    1 
ATOM 3596 H H      . GLN D 4 22  ? -0.961  -7.900  13.178 1.00 0.30 ? 222 GLN B H      1 
ATOM 3597 H HA     . GLN D 4 22  ? -2.041  -6.918  10.668 1.00 0.34 ? 222 GLN B HA     1 
ATOM 3598 H HB2    . GLN D 4 22  ? -3.249  -7.060  12.936 1.00 0.33 ? 222 GLN B HB2    1 
ATOM 3599 H HB3    . GLN D 4 22  ? -2.376  -5.590  13.366 1.00 0.32 ? 222 GLN B HB3    1 
ATOM 3600 H HG2    . GLN D 4 22  ? -4.420  -4.800  12.480 1.00 0.35 ? 222 GLN B HG2    1 
ATOM 3601 H HG3    . GLN D 4 22  ? -3.281  -4.632  11.143 1.00 0.35 ? 222 GLN B HG3    1 
ATOM 3602 H HE21   . GLN D 4 22  ? -4.448  -5.160  9.278  1.00 0.38 ? 222 GLN B HE21   1 
ATOM 3603 H HE22   . GLN D 4 22  ? -5.413  -6.545  9.105  1.00 0.39 ? 222 GLN B HE22   1 
ATOM 3604 N N      . ARG D 4 23  ? 0.128   -5.065  12.309 1.00 0.31 ? 223 ARG B N      1 
ATOM 3605 C CA     . ARG D 4 23  ? 1.063   -3.911  12.151 1.00 0.31 ? 223 ARG B CA     1 
ATOM 3606 C C      . ARG D 4 23  ? 1.882   -4.077  10.869 1.00 0.32 ? 223 ARG B C      1 
ATOM 3607 O O      . ARG D 4 23  ? 2.046   -3.141  10.112 1.00 0.33 ? 223 ARG B O      1 
ATOM 3608 C CB     . ARG D 4 23  ? 1.990   -3.870  13.367 1.00 0.29 ? 223 ARG B CB     1 
ATOM 3609 C CG     . ARG D 4 23  ? 2.849   -2.604  13.329 1.00 0.29 ? 223 ARG B CG     1 
ATOM 3610 C CD     . ARG D 4 23  ? 4.028   -2.776  14.282 1.00 0.27 ? 223 ARG B CD     1 
ATOM 3611 N NE     . ARG D 4 23  ? 3.542   -2.717  15.694 1.00 0.26 ? 223 ARG B NE     1 
ATOM 3612 C CZ     . ARG D 4 23  ? 2.697   -1.797  16.066 1.00 0.27 ? 223 ARG B CZ     1 
ATOM 3613 N NH1    . ARG D 4 23  ? 2.290   -0.898  15.217 1.00 0.29 ? 223 ARG B NH1    1 
ATOM 3614 N NH2    . ARG D 4 23  ? 2.263   -1.774  17.297 1.00 0.27 ? 223 ARG B NH2    1 
ATOM 3615 H H      . ARG D 4 23  ? 0.155   -5.601  13.126 1.00 0.30 ? 223 ARG B H      1 
ATOM 3616 H HA     . ARG D 4 23  ? 0.497   -2.993  12.100 1.00 0.32 ? 223 ARG B HA     1 
ATOM 3617 H HB2    . ARG D 4 23  ? 1.394   -3.872  14.268 1.00 0.28 ? 223 ARG B HB2    1 
ATOM 3618 H HB3    . ARG D 4 23  ? 2.632   -4.738  13.358 1.00 0.28 ? 223 ARG B HB3    1 
ATOM 3619 H HG2    . ARG D 4 23  ? 3.214   -2.448  12.324 1.00 0.30 ? 223 ARG B HG2    1 
ATOM 3620 H HG3    . ARG D 4 23  ? 2.257   -1.755  13.635 1.00 0.29 ? 223 ARG B HG3    1 
ATOM 3621 H HD2    . ARG D 4 23  ? 4.485   -3.735  14.117 1.00 0.26 ? 223 ARG B HD2    1 
ATOM 3622 H HD3    . ARG D 4 23  ? 4.759   -1.996  14.096 1.00 0.27 ? 223 ARG B HD3    1 
ATOM 3623 H HE     . ARG D 4 23  ? 3.851   -3.384  16.343 1.00 0.25 ? 223 ARG B HE     1 
ATOM 3624 H HH11   . ARG D 4 23  ? 2.625   -0.912  14.276 1.00 0.29 ? 223 ARG B HH11   1 
ATOM 3625 H HH12   . ARG D 4 23  ? 1.642   -0.193  15.508 1.00 0.30 ? 223 ARG B HH12   1 
ATOM 3626 H HH21   . ARG D 4 23  ? 2.578   -2.461  17.952 1.00 0.25 ? 223 ARG B HH21   1 
ATOM 3627 H HH22   . ARG D 4 23  ? 1.618   -1.068  17.585 1.00 0.28 ? 223 ARG B HH22   1 
ATOM 3628 N N      . ARG D 4 24  ? 2.382   -5.253  10.593 1.00 0.31 ? 224 ARG B N      1 
ATOM 3629 C CA     . ARG D 4 24  ? 3.164   -5.443  9.337  1.00 0.32 ? 224 ARG B CA     1 
ATOM 3630 C C      . ARG D 4 24  ? 2.225   -5.321  8.133  1.00 0.35 ? 224 ARG B C      1 
ATOM 3631 O O      . ARG D 4 24  ? 2.597   -4.799  7.101  1.00 0.36 ? 224 ARG B O      1 
ATOM 3632 C CB     . ARG D 4 24  ? 3.807   -6.834  9.348  1.00 0.32 ? 224 ARG B CB     1 
ATOM 3633 C CG     . ARG D 4 24  ? 5.011   -6.866  8.402  1.00 0.33 ? 224 ARG B CG     1 
ATOM 3634 C CD     . ARG D 4 24  ? 6.128   -5.985  8.967  1.00 0.31 ? 224 ARG B CD     1 
ATOM 3635 N NE     . ARG D 4 24  ? 7.156   -5.737  7.915  1.00 0.32 ? 224 ARG B NE     1 
ATOM 3636 C CZ     . ARG D 4 24  ? 7.484   -6.684  7.080  1.00 0.34 ? 224 ARG B CZ     1 
ATOM 3637 N NH1    . ARG D 4 24  ? 6.934   -7.860  7.178  1.00 0.34 ? 224 ARG B NH1    1 
ATOM 3638 N NH2    . ARG D 4 24  ? 8.363   -6.454  6.146  1.00 0.35 ? 224 ARG B NH2    1 
ATOM 3639 H H      . ARG D 4 24  ? 2.232   -6.007  11.200 1.00 0.30 ? 224 ARG B H      1 
ATOM 3640 H HA     . ARG D 4 24  ? 3.934   -4.688  9.272  1.00 0.32 ? 224 ARG B HA     1 
ATOM 3641 H HB2    . ARG D 4 24  ? 4.134   -7.068  10.350 1.00 0.30 ? 224 ARG B HB2    1 
ATOM 3642 H HB3    . ARG D 4 24  ? 3.081   -7.566  9.027  1.00 0.33 ? 224 ARG B HB3    1 
ATOM 3643 H HG2    . ARG D 4 24  ? 5.366   -7.884  8.310  1.00 0.33 ? 224 ARG B HG2    1 
ATOM 3644 H HG3    . ARG D 4 24  ? 4.721   -6.499  7.428  1.00 0.34 ? 224 ARG B HG3    1 
ATOM 3645 H HD2    . ARG D 4 24  ? 5.713   -5.042  9.284  1.00 0.31 ? 224 ARG B HD2    1 
ATOM 3646 H HD3    . ARG D 4 24  ? 6.585   -6.478  9.815  1.00 0.30 ? 224 ARG B HD3    1 
ATOM 3647 H HE     . ARG D 4 24  ? 7.577   -4.856  7.841  1.00 0.33 ? 224 ARG B HE     1 
ATOM 3648 H HH11   . ARG D 4 24  ? 6.259   -8.038  7.894  1.00 0.33 ? 224 ARG B HH11   1 
ATOM 3649 H HH12   . ARG D 4 24  ? 7.186   -8.584  6.536  1.00 0.35 ? 224 ARG B HH12   1 
ATOM 3650 H HH21   . ARG D 4 24  ? 8.784   -5.550  6.067  1.00 0.35 ? 224 ARG B HH21   1 
ATOM 3651 H HH22   . ARG D 4 24  ? 8.611   -7.180  5.505  1.00 0.36 ? 224 ARG B HH22   1 
ATOM 3652 N N      . LYS D 4 25  ? 1.015   -5.797  8.249  1.00 0.35 ? 225 LYS B N      1 
ATOM 3653 C CA     . LYS D 4 25  ? 0.060   -5.707  7.105  1.00 0.37 ? 225 LYS B CA     1 
ATOM 3654 C C      . LYS D 4 25  ? -0.143  -4.230  6.747  1.00 0.38 ? 225 LYS B C      1 
ATOM 3655 O O      . LYS D 4 25  ? -0.098  -3.841  5.599  1.00 0.40 ? 225 LYS B O      1 
ATOM 3656 C CB     . LYS D 4 25  ? -1.276  -6.326  7.520  1.00 0.38 ? 225 LYS B CB     1 
ATOM 3657 C CG     . LYS D 4 25  ? -2.203  -6.422  6.306  1.00 0.40 ? 225 LYS B CG     1 
ATOM 3658 C CD     . LYS D 4 25  ? -3.605  -6.825  6.769  1.00 0.40 ? 225 LYS B CD     1 
ATOM 3659 C CE     . LYS D 4 25  ? -4.324  -7.572  5.645  1.00 0.42 ? 225 LYS B CE     1 
ATOM 3660 N NZ     . LYS D 4 25  ? -5.293  -6.654  4.981  1.00 0.44 ? 225 LYS B NZ     1 
ATOM 3661 H H      . LYS D 4 25  ? 0.734   -6.217  9.087  1.00 0.34 ? 225 LYS B H      1 
ATOM 3662 H HA     . LYS D 4 25  ? 0.460   -6.237  6.253  1.00 0.38 ? 225 LYS B HA     1 
ATOM 3663 H HB2    . LYS D 4 25  ? -1.106  -7.314  7.921  1.00 0.37 ? 225 LYS B HB2    1 
ATOM 3664 H HB3    . LYS D 4 25  ? -1.741  -5.707  8.274  1.00 0.37 ? 225 LYS B HB3    1 
ATOM 3665 H HG2    . LYS D 4 25  ? -2.247  -5.465  5.809  1.00 0.41 ? 225 LYS B HG2    1 
ATOM 3666 H HG3    . LYS D 4 25  ? -1.824  -7.169  5.623  1.00 0.41 ? 225 LYS B HG3    1 
ATOM 3667 H HD2    . LYS D 4 25  ? -3.526  -7.466  7.636  1.00 0.39 ? 225 LYS B HD2    1 
ATOM 3668 H HD3    . LYS D 4 25  ? -4.165  -5.939  7.027  1.00 0.41 ? 225 LYS B HD3    1 
ATOM 3669 H HE2    . LYS D 4 25  ? -3.600  -7.917  4.923  1.00 0.43 ? 225 LYS B HE2    1 
ATOM 3670 H HE3    . LYS D 4 25  ? -4.854  -8.417  6.057  1.00 0.42 ? 225 LYS B HE3    1 
ATOM 3671 H HZ1    . LYS D 4 25  ? -4.773  -5.912  4.469  1.00 0.45 ? 225 LYS B HZ1    1 
ATOM 3672 H HZ2    . LYS D 4 25  ? -5.903  -6.217  5.701  1.00 0.44 ? 225 LYS B HZ2    1 
ATOM 3673 H HZ3    . LYS D 4 25  ? -5.876  -7.191  4.309  1.00 0.46 ? 225 LYS B HZ3    1 
ATOM 3674 N N      . MET D 4 26  ? -0.366  -3.417  7.738  1.00 0.38 ? 226 MET B N      1 
ATOM 3675 C CA     . MET D 4 26  ? -0.578  -1.961  7.497  1.00 0.39 ? 226 MET B CA     1 
ATOM 3676 C C      . MET D 4 26  ? 0.708   -1.308  6.997  1.00 0.39 ? 226 MET B C      1 
ATOM 3677 O O      . MET D 4 26  ? 0.673   -0.368  6.226  1.00 0.40 ? 226 MET B O      1 
ATOM 3678 C CB     . MET D 4 26  ? -1.012  -1.293  8.803  1.00 0.38 ? 226 MET B CB     1 
ATOM 3679 C CG     . MET D 4 26  ? -1.575  0.097   8.503  1.00 0.40 ? 226 MET B CG     1 
ATOM 3680 S SD     . MET D 4 26  ? -3.138  -0.066  7.603  1.00 0.42 ? 226 MET B SD     1 
ATOM 3681 C CE     . MET D 4 26  ? -4.221  0.547   8.916  1.00 0.42 ? 226 MET B CE     1 
ATOM 3682 H H      . MET D 4 26  ? -0.396  -3.764  8.653  1.00 0.36 ? 226 MET B H      1 
ATOM 3683 H HA     . MET D 4 26  ? -1.355  -1.833  6.759  1.00 0.40 ? 226 MET B HA     1 
ATOM 3684 H HB2    . MET D 4 26  ? -1.773  -1.895  9.280  1.00 0.38 ? 226 MET B HB2    1 
ATOM 3685 H HB3    . MET D 4 26  ? -0.160  -1.199  9.460  1.00 0.36 ? 226 MET B HB3    1 
ATOM 3686 H HG2    . MET D 4 26  ? -1.747  0.625   9.428  1.00 0.39 ? 226 MET B HG2    1 
ATOM 3687 H HG3    . MET D 4 26  ? -0.869  0.649   7.899  1.00 0.40 ? 226 MET B HG3    1 
ATOM 3688 H HE1    . MET D 4 26  ? -3.903  1.538   9.211  1.00 0.42 ? 226 MET B HE1    1 
ATOM 3689 H HE2    . MET D 4 26  ? -4.168  -0.112  9.767  1.00 0.40 ? 226 MET B HE2    1 
ATOM 3690 H HE3    . MET D 4 26  ? -5.240  0.582   8.554  1.00 0.43 ? 226 MET B HE3    1 
ATOM 3691 N N      . ALA D 4 27  ? 1.845   -1.774  7.435  1.00 0.37 ? 227 ALA B N      1 
ATOM 3692 C CA     . ALA D 4 27  ? 3.117   -1.143  6.980  1.00 0.37 ? 227 ALA B CA     1 
ATOM 3693 C C      . ALA D 4 27  ? 3.360   -1.461  5.503  1.00 0.39 ? 227 ALA B C      1 
ATOM 3694 O O      . ALA D 4 27  ? 3.842   -0.632  4.759  1.00 0.40 ? 227 ALA B O      1 
ATOM 3695 C CB     . ALA D 4 27  ? 4.279   -1.684  7.814  1.00 0.35 ? 227 ALA B CB     1 
ATOM 3696 H H      . ALA D 4 27  ? 1.864   -2.523  8.067  1.00 0.36 ? 227 ALA B H      1 
ATOM 3697 H HA     . ALA D 4 27  ? 3.051   -0.072  7.110  1.00 0.38 ? 227 ALA B HA     1 
ATOM 3698 H HB1    . ALA D 4 27  ? 4.349   -2.753  7.686  1.00 0.35 ? 227 ALA B HB1    1 
ATOM 3699 H HB2    . ALA D 4 27  ? 4.112   -1.455  8.857  1.00 0.34 ? 227 ALA B HB2    1 
ATOM 3700 H HB3    . ALA D 4 27  ? 5.201   -1.223  7.489  1.00 0.35 ? 227 ALA B HB3    1 
ATOM 3701 N N      . GLN D 4 28  ? 3.038   -2.653  5.056  1.00 0.39 ? 228 GLN B N      1 
ATOM 3702 C CA     . GLN D 4 28  ? 3.228   -2.948  3.643  1.00 0.41 ? 228 GLN B CA     1 
ATOM 3703 C C      . GLN D 4 28  ? 2.256   -2.154  2.777  1.00 0.43 ? 228 GLN B C      1 
ATOM 3704 O O      . GLN D 4 28  ? 2.586   -1.669  1.713  1.00 0.45 ? 228 GLN B O      1 
ATOM 3705 C CB     . GLN D 4 28  ? 3.011   -4.443  3.404  1.00 0.41 ? 228 GLN B CB     1 
ATOM 3706 C CG     . GLN D 4 28  ? 4.084   -5.241  4.148  1.00 0.40 ? 228 GLN B CG     1 
ATOM 3707 C CD     . GLN D 4 28  ? 3.832   -6.738  3.956  1.00 0.40 ? 228 GLN B CD     1 
ATOM 3708 O OE1    . GLN D 4 28  ? 2.758   -7.138  3.555  1.00 0.41 ? 228 GLN B OE1    1 
ATOM 3709 N NE2    . GLN D 4 28  ? 4.786   -7.588  4.226  1.00 0.39 ? 228 GLN B NE2    1 
ATOM 3710 H H      . GLN D 4 28  ? 2.650   -3.322  5.656  1.00 0.38 ? 228 GLN B H      1 
ATOM 3711 H HA     . GLN D 4 28  ? 4.238   -2.694  3.363  1.00 0.41 ? 228 GLN B HA     1 
ATOM 3712 H HB2    . GLN D 4 28  ? 2.033   -4.727  3.766  1.00 0.41 ? 228 GLN B HB2    1 
ATOM 3713 H HB3    . GLN D 4 28  ? 3.079   -4.652  2.347  1.00 0.43 ? 228 GLN B HB3    1 
ATOM 3714 H HG2    . GLN D 4 28  ? 5.058   -4.986  3.756  1.00 0.40 ? 228 GLN B HG2    1 
ATOM 3715 H HG3    . GLN D 4 28  ? 4.045   -5.003  5.201  1.00 0.38 ? 228 GLN B HG3    1 
ATOM 3716 H HE21   . GLN D 4 28  ? 5.653   -7.264  4.548  1.00 0.38 ? 228 GLN B HE21   1 
ATOM 3717 H HE22   . GLN D 4 28  ? 4.634   -8.548  4.106  1.00 0.40 ? 228 GLN B HE22   1 
ATOM 3718 N N      . GLU D 4 29  ? 1.056   -1.985  3.282  1.00 0.43 ? 229 GLU B N      1 
ATOM 3719 C CA     . GLU D 4 29  ? 0.054   -1.174  2.540  1.00 0.45 ? 229 GLU B CA     1 
ATOM 3720 C C      . GLU D 4 29  ? 0.311   0.303   2.843  1.00 0.46 ? 229 GLU B C      1 
ATOM 3721 O O      . GLU D 4 29  ? 0.067   1.173   2.033  1.00 0.47 ? 229 GLU B O      1 
ATOM 3722 C CB     . GLU D 4 29  ? -1.355  -1.555  2.996  1.00 0.46 ? 229 GLU B CB     1 
ATOM 3723 C CG     . GLU D 4 29  ? -1.634  -3.014  2.628  1.00 0.46 ? 229 GLU B CG     1 
ATOM 3724 C CD     . GLU D 4 29  ? -3.119  -3.319  2.838  1.00 0.46 ? 229 GLU B CD     1 
ATOM 3725 O OE1    . GLU D 4 29  ? -3.825  -2.439  3.301  1.00 0.47 ? 229 GLU B OE1    1 
ATOM 3726 O OE2    . GLU D 4 29  ? -3.524  -4.428  2.532  1.00 0.47 ? 229 GLU B OE2    1 
ATOM 3727 H H      . GLU D 4 29  ? 0.833   -2.358  4.162  1.00 0.42 ? 229 GLU B H      1 
ATOM 3728 H HA     . GLU D 4 29  ? 0.157   -1.351  1.480  1.00 0.47 ? 229 GLU B HA     1 
ATOM 3729 H HB2    . GLU D 4 29  ? -1.434  -1.431  4.066  1.00 0.44 ? 229 GLU B HB2    1 
ATOM 3730 H HB3    . GLU D 4 29  ? -2.077  -0.919  2.504  1.00 0.47 ? 229 GLU B HB3    1 
ATOM 3731 H HG2    . GLU D 4 29  ? -1.375  -3.180  1.593  1.00 0.47 ? 229 GLU B HG2    1 
ATOM 3732 H HG3    . GLU D 4 29  ? -1.043  -3.663  3.257  1.00 0.44 ? 229 GLU B HG3    1 
ATOM 3733 N N      . ASN D 4 30  ? 0.832   0.579   4.012  1.00 0.44 ? 230 ASN B N      1 
ATOM 3734 C CA     . ASN D 4 30  ? 1.148   1.989   4.392  1.00 0.44 ? 230 ASN B CA     1 
ATOM 3735 C C      . ASN D 4 30  ? 2.590   2.043   4.908  1.00 0.42 ? 230 ASN B C      1 
ATOM 3736 O O      . ASN D 4 30  ? 2.830   2.296   6.073  1.00 0.41 ? 230 ASN B O      1 
ATOM 3737 C CB     . ASN D 4 30  ? 0.191   2.449   5.494  1.00 0.43 ? 230 ASN B CB     1 
ATOM 3738 C CG     . ASN D 4 30  ? -1.243  2.077   5.112  1.00 0.45 ? 230 ASN B CG     1 
ATOM 3739 O OD1    . ASN D 4 30  ? -1.490  1.601   4.023  1.00 0.46 ? 230 ASN B OD1    1 
ATOM 3740 N ND2    . ASN D 4 30  ? -2.206  2.278   5.971  1.00 0.45 ? 230 ASN B ND2    1 
ATOM 3741 H H      . ASN D 4 30  ? 1.035   -0.148  4.637  1.00 0.42 ? 230 ASN B H      1 
ATOM 3742 H HA     . ASN D 4 30  ? 1.047   2.630   3.529  1.00 0.46 ? 230 ASN B HA     1 
ATOM 3743 H HB2    . ASN D 4 30  ? 0.455   1.967   6.423  1.00 0.42 ? 230 ASN B HB2    1 
ATOM 3744 H HB3    . ASN D 4 30  ? 0.265   3.520   5.610  1.00 0.44 ? 230 ASN B HB3    1 
ATOM 3745 H HD21   . ASN D 4 30  ? -2.007  2.664   6.849  1.00 0.44 ? 230 ASN B HD21   1 
ATOM 3746 H HD22   . ASN D 4 30  ? -3.128  2.043   5.736  1.00 0.46 ? 230 ASN B HD22   1 
ATOM 3747 N N      . PRO D 4 31  ? 3.542   1.785   4.051  1.00 0.43 ? 231 PRO B N      1 
ATOM 3748 C CA     . PRO D 4 31  ? 4.988   1.780   4.427  1.00 0.41 ? 231 PRO B CA     1 
ATOM 3749 C C      . PRO D 4 31  ? 5.557   3.179   4.685  1.00 0.42 ? 231 PRO B C      1 
ATOM 3750 O O      . PRO D 4 31  ? 6.681   3.315   5.132  1.00 0.41 ? 231 PRO B O      1 
ATOM 3751 C CB     . PRO D 4 31  ? 5.673   1.141   3.219  1.00 0.42 ? 231 PRO B CB     1 
ATOM 3752 C CG     . PRO D 4 31  ? 4.763   1.396   2.064  1.00 0.45 ? 231 PRO B CG     1 
ATOM 3753 C CD     . PRO D 4 31  ? 3.343   1.471   2.629  1.00 0.45 ? 231 PRO B CD     1 
ATOM 3754 H HA     . PRO D 4 31  ? 5.143   1.155   5.291  1.00 0.40 ? 231 PRO B HA     1 
ATOM 3755 H HB2    . PRO D 4 31  ? 6.637   1.601   3.051  1.00 0.42 ? 231 PRO B HB2    1 
ATOM 3756 H HB3    . PRO D 4 31  ? 5.786   0.078   3.372  1.00 0.42 ? 231 PRO B HB3    1 
ATOM 3757 H HG2    . PRO D 4 31  ? 5.026   2.331   1.588  1.00 0.46 ? 231 PRO B HG2    1 
ATOM 3758 H HG3    . PRO D 4 31  ? 4.827   0.586   1.356  1.00 0.45 ? 231 PRO B HG3    1 
ATOM 3759 H HD2    . PRO D 4 31  ? 2.785   2.256   2.138  1.00 0.46 ? 231 PRO B HD2    1 
ATOM 3760 H HD3    . PRO D 4 31  ? 2.842   0.522   2.523  1.00 0.45 ? 231 PRO B HD3    1 
ATOM 3761 N N      . LYS D 4 32  ? 4.816   4.236   4.435  1.00 0.43 ? 232 LYS B N      1 
ATOM 3762 C CA     . LYS D 4 32  ? 5.315   5.577   4.703  1.00 0.44 ? 232 LYS B CA     1 
ATOM 3763 C C      . LYS D 4 32  ? 4.583   6.194   5.884  1.00 0.43 ? 232 LYS B C      1 
ATOM 3764 O O      . LYS D 4 32  ? 4.881   7.288   6.323  1.00 0.44 ? 232 LYS B O      1 
ATOM 3765 C CB     . LYS D 4 32  ? 5.114   6.452   3.466  1.00 0.46 ? 232 LYS B CB     1 
ATOM 3766 C CG     . LYS D 4 32  ? 5.939   5.895   2.304  1.00 0.47 ? 232 LYS B CG     1 
ATOM 3767 C CD     . LYS D 4 32  ? 5.824   6.834   1.101  1.00 0.49 ? 232 LYS B CD     1 
ATOM 3768 C CE     . LYS D 4 32  ? 6.551   6.221   -0.098 1.00 0.50 ? 232 LYS B CE     1 
ATOM 3769 N NZ     . LYS D 4 32  ? 6.570   7.200   -1.221 1.00 0.53 ? 232 LYS B NZ     1 
ATOM 3770 H H      . LYS D 4 32  ? 3.909   4.120   4.086  1.00 0.44 ? 232 LYS B H      1 
ATOM 3771 H HA     . LYS D 4 32  ? 6.370   5.524   4.927  1.00 0.43 ? 232 LYS B HA     1 
ATOM 3772 H HB2    . LYS D 4 32  ? 4.068   6.458   3.195  1.00 0.47 ? 232 LYS B HB2    1 
ATOM 3773 H HB3    . LYS D 4 32  ? 5.436   7.461   3.682  1.00 0.47 ? 232 LYS B HB3    1 
ATOM 3774 H HG2    . LYS D 4 32  ? 6.973   5.816   2.603  1.00 0.46 ? 232 LYS B HG2    1 
ATOM 3775 H HG3    . LYS D 4 32  ? 5.565   4.919   2.033  1.00 0.47 ? 232 LYS B HG3    1 
ATOM 3776 H HD2    . LYS D 4 32  ? 4.782   6.979   0.855  1.00 0.50 ? 232 LYS B HD2    1 
ATOM 3777 H HD3    . LYS D 4 32  ? 6.274   7.786   1.343  1.00 0.50 ? 232 LYS B HD3    1 
ATOM 3778 H HE2    . LYS D 4 32  ? 7.564   5.974   0.181  1.00 0.49 ? 232 LYS B HE2    1 
ATOM 3779 H HE3    . LYS D 4 32  ? 6.035   5.324   -0.410 1.00 0.50 ? 232 LYS B HE3    1 
ATOM 3780 H HZ1    . LYS D 4 32  ? 7.132   6.815   -2.006 1.00 0.53 ? 232 LYS B HZ1    1 
ATOM 3781 H HZ2    . LYS D 4 32  ? 6.992   8.093   -0.893 1.00 0.53 ? 232 LYS B HZ2    1 
ATOM 3782 H HZ3    . LYS D 4 32  ? 5.598   7.375   -1.546 1.00 0.54 ? 232 LYS B HZ3    1 
ATOM 3783 N N      . MET D 4 33  ? 3.638   5.468   6.427  1.00 0.43 ? 233 MET B N      1 
ATOM 3784 C CA     . MET D 4 33  ? 2.896   5.978   7.609  1.00 0.42 ? 233 MET B CA     1 
ATOM 3785 C C      . MET D 4 33  ? 3.755   5.712   8.851  1.00 0.40 ? 233 MET B C      1 
ATOM 3786 O O      . MET D 4 33  ? 4.358   4.666   8.985  1.00 0.38 ? 233 MET B O      1 
ATOM 3787 C CB     . MET D 4 33  ? 1.561   5.241   7.740  1.00 0.42 ? 233 MET B CB     1 
ATOM 3788 C CG     . MET D 4 33  ? 0.743   5.860   8.874  1.00 0.43 ? 233 MET B CG     1 
ATOM 3789 S SD     . MET D 4 33  ? -0.044  7.381   8.289  1.00 0.45 ? 233 MET B SD     1 
ATOM 3790 C CE     . MET D 4 33  ? -1.730  6.736   8.175  1.00 0.46 ? 233 MET B CE     1 
ATOM 3791 H H      . MET D 4 33  ? 3.435   4.578   6.068  1.00 0.42 ? 233 MET B H      1 
ATOM 3792 H HA     . MET D 4 33  ? 2.723   7.039   7.504  1.00 0.44 ? 233 MET B HA     1 
ATOM 3793 H HB2    . MET D 4 33  ? 1.013   5.324   6.812  1.00 0.44 ? 233 MET B HB2    1 
ATOM 3794 H HB3    . MET D 4 33  ? 1.743   4.200   7.958  1.00 0.41 ? 233 MET B HB3    1 
ATOM 3795 H HG2    . MET D 4 33  ? -0.017  5.162   9.193  1.00 0.42 ? 233 MET B HG2    1 
ATOM 3796 H HG3    . MET D 4 33  ? 1.394   6.088   9.705  1.00 0.41 ? 233 MET B HG3    1 
ATOM 3797 H HE1    . MET D 4 33  ? -1.706  5.742   7.748  1.00 0.46 ? 233 MET B HE1    1 
ATOM 3798 H HE2    . MET D 4 33  ? -2.323  7.381   7.547  1.00 0.48 ? 233 MET B HE2    1 
ATOM 3799 H HE3    . MET D 4 33  ? -2.167  6.697   9.163  1.00 0.46 ? 233 MET B HE3    1 
ATOM 3800 N N      . HIS D 4 34  ? 3.844   6.651   9.759  1.00 0.40 ? 234 HIS B N      1 
ATOM 3801 C CA     . HIS D 4 34  ? 4.658   6.446   10.953 1.00 0.38 ? 234 HIS B CA     1 
ATOM 3802 C C      . HIS D 4 34  ? 3.952   5.515   11.932 1.00 0.37 ? 234 HIS B C      1 
ATOM 3803 O O      . HIS D 4 34  ? 2.739   5.505   12.006 1.00 0.38 ? 234 HIS B O      1 
ATOM 3804 C CB     . HIS D 4 34  ? 4.903   7.798   11.630 1.00 0.39 ? 234 HIS B CB     1 
ATOM 3805 C CG     . HIS D 4 34  ? 5.142   8.849   10.581 1.00 0.42 ? 234 HIS B CG     1 
ATOM 3806 N ND1    . HIS D 4 34  ? 6.313   8.913   9.839  1.00 0.44 ? 234 HIS B ND1    1 
ATOM 3807 C CD2    . HIS D 4 34  ? 4.359   9.887   10.137 1.00 0.46 ? 234 HIS B CD2    1 
ATOM 3808 C CE1    . HIS D 4 34  ? 6.200   9.958   8.995  1.00 0.45 ? 234 HIS B CE1    1 
ATOM 3809 N NE2    . HIS D 4 34  ? 5.030   10.581  9.139  1.00 0.46 ? 234 HIS B NE2    1 
ATOM 3810 H H      . HIS D 4 34  ? 3.366   7.497   9.635  1.00 0.42 ? 234 HIS B H      1 
ATOM 3811 H HA     . HIS D 4 34  ? 5.604   6.010   10.667 1.00 0.37 ? 234 HIS B HA     1 
ATOM 3812 H HB2    . HIS D 4 34  ? 4.041   8.073   12.221 1.00 0.40 ? 234 HIS B HB2    1 
ATOM 3813 H HB3    . HIS D 4 34  ? 5.770   7.727   12.270 1.00 0.38 ? 234 HIS B HB3    1 
ATOM 3814 H HD1    . HIS D 4 34  ? 7.080   8.309   9.914  1.00 0.49 ? 234 HIS B HD1    1 
ATOM 3815 H HD2    . HIS D 4 34  ? 3.373   10.127  10.509 1.00 0.52 ? 234 HIS B HD2    1 
ATOM 3816 H HE1    . HIS D 4 34  ? 6.962   10.253  8.289  1.00 0.48 ? 234 HIS B HE1    1 
ATOM 3817 H HE2    . HIS D 4 34  ? 4.710   11.365  8.645  1.00 0.49 ? 234 HIS B HE2    1 
ATOM 3818 N N      . ASN D 4 35  ? 4.667   4.726   12.686 1.00 0.35 ? 235 ASN B N      1 
ATOM 3819 C CA     . ASN D 4 35  ? 3.980   3.813   13.645 1.00 0.33 ? 235 ASN B CA     1 
ATOM 3820 C C      . ASN D 4 35  ? 3.111   4.627   14.587 1.00 0.34 ? 235 ASN B C      1 
ATOM 3821 O O      . ASN D 4 35  ? 2.127   4.135   15.103 1.00 0.34 ? 235 ASN B O      1 
ATOM 3822 C CB     . ASN D 4 35  ? 5.025   3.043   14.453 1.00 0.31 ? 235 ASN B CB     1 
ATOM 3823 C CG     . ASN D 4 35  ? 5.545   1.863   13.627 1.00 0.30 ? 235 ASN B CG     1 
ATOM 3824 O OD1    . ASN D 4 35  ? 5.823   2.004   12.453 1.00 0.31 ? 235 ASN B OD1    1 
ATOM 3825 N ND2    . ASN D 4 35  ? 5.685   0.698   14.196 1.00 0.28 ? 235 ASN B ND2    1 
ATOM 3826 H H      . ASN D 4 35  ? 5.646   4.734   12.625 1.00 0.34 ? 235 ASN B H      1 
ATOM 3827 H HA     . ASN D 4 35  ? 3.364   3.115   13.098 1.00 0.34 ? 235 ASN B HA     1 
ATOM 3828 H HB2    . ASN D 4 35  ? 5.845   3.701   14.700 1.00 0.31 ? 235 ASN B HB2    1 
ATOM 3829 H HB3    . ASN D 4 35  ? 4.574   2.672   15.362 1.00 0.30 ? 235 ASN B HB3    1 
ATOM 3830 H HD21   . ASN D 4 35  ? 5.458   0.583   15.142 1.00 0.28 ? 235 ASN B HD21   1 
ATOM 3831 H HD22   . ASN D 4 35  ? 6.020   -0.063  13.676 1.00 0.28 ? 235 ASN B HD22   1 
ATOM 3832 N N      . SER D 4 36  ? 3.449   5.864   14.842 1.00 0.36 ? 236 SER B N      1 
ATOM 3833 C CA     . SER D 4 36  ? 2.616   6.662   15.770 1.00 0.37 ? 236 SER B CA     1 
ATOM 3834 C C      . SER D 4 36  ? 1.197   6.788   15.218 1.00 0.39 ? 236 SER B C      1 
ATOM 3835 O O      . SER D 4 36  ? 0.225   6.705   15.947 1.00 0.39 ? 236 SER B O      1 
ATOM 3836 C CB     . SER D 4 36  ? 3.226   8.055   15.931 1.00 0.38 ? 236 SER B CB     1 
ATOM 3837 O OG     . SER D 4 36  ? 4.632   7.933   16.104 1.00 0.37 ? 236 SER B OG     1 
ATOM 3838 H H      . SER D 4 36  ? 4.249   6.256   14.432 1.00 0.36 ? 236 SER B H      1 
ATOM 3839 H HA     . SER D 4 36  ? 2.582   6.173   16.733 1.00 0.36 ? 236 SER B HA     1 
ATOM 3840 H HB2    . SER D 4 36  ? 3.025   8.643   15.051 1.00 0.40 ? 236 SER B HB2    1 
ATOM 3841 H HB3    . SER D 4 36  ? 2.788   8.540   16.795 1.00 0.39 ? 236 SER B HB3    1 
ATOM 3842 H HG     . SER D 4 36  ? 4.789   7.319   16.824 1.00 0.36 ? 236 SER B HG     1 
ATOM 3843 N N      . GLU D 4 37  ? 1.053   6.975   13.932 1.00 0.40 ? 237 GLU B N      1 
ATOM 3844 C CA     . GLU D 4 37  ? -0.314  7.101   13.372 1.00 0.41 ? 237 GLU B CA     1 
ATOM 3845 C C      . GLU D 4 37  ? -0.895  5.708   13.146 1.00 0.40 ? 237 GLU B C      1 
ATOM 3846 O O      . GLU D 4 37  ? -2.054  5.469   13.423 1.00 0.41 ? 237 GLU B O      1 
ATOM 3847 C CB     . GLU D 4 37  ? -0.254  7.852   12.039 1.00 0.43 ? 237 GLU B CB     1 
ATOM 3848 C CG     . GLU D 4 37  ? 0.212   9.287   12.283 1.00 0.45 ? 237 GLU B CG     1 
ATOM 3849 C CD     . GLU D 4 37  ? 0.019   10.110  11.008 1.00 0.47 ? 237 GLU B CD     1 
ATOM 3850 O OE1    . GLU D 4 37  ? -0.376  9.532   10.009 1.00 0.47 ? 237 GLU B OE1    1 
ATOM 3851 O OE2    . GLU D 4 37  ? 0.268   11.304  11.052 1.00 0.48 ? 237 GLU B OE2    1 
ATOM 3852 H H      . GLU D 4 37  ? 1.837   7.031   13.346 1.00 0.39 ? 237 GLU B H      1 
ATOM 3853 H HA     . GLU D 4 37  ? -0.939  7.644   14.065 1.00 0.42 ? 237 GLU B HA     1 
ATOM 3854 H HB2    . GLU D 4 37  ? 0.439   7.353   11.377 1.00 0.42 ? 237 GLU B HB2    1 
ATOM 3855 H HB3    . GLU D 4 37  ? -1.236  7.865   11.589 1.00 0.44 ? 237 GLU B HB3    1 
ATOM 3856 H HG2    . GLU D 4 37  ? -0.366  9.723   13.085 1.00 0.45 ? 237 GLU B HG2    1 
ATOM 3857 H HG3    . GLU D 4 37  ? 1.258   9.286   12.552 1.00 0.43 ? 237 GLU B HG3    1 
ATOM 3858 N N      . ILE D 4 38  ? -0.117  4.769   12.661 1.00 0.39 ? 238 ILE B N      1 
ATOM 3859 C CA     . ILE D 4 38  ? -0.686  3.410   12.457 1.00 0.38 ? 238 ILE B CA     1 
ATOM 3860 C C      . ILE D 4 38  ? -1.162  2.887   13.805 1.00 0.37 ? 238 ILE B C      1 
ATOM 3861 O O      . ILE D 4 38  ? -2.245  2.350   13.925 1.00 0.37 ? 238 ILE B O      1 
ATOM 3862 C CB     . ILE D 4 38  ? 0.395   2.449   11.925 1.00 0.36 ? 238 ILE B CB     1 
ATOM 3863 C CG1    . ILE D 4 38  ? 0.816   2.905   10.522 1.00 0.38 ? 238 ILE B CG1    1 
ATOM 3864 C CG2    . ILE D 4 38  ? -0.192  1.024   11.886 1.00 0.36 ? 238 ILE B CG2    1 
ATOM 3865 C CD1    . ILE D 4 38  ? 2.090   2.182   10.030 1.00 0.36 ? 238 ILE B CD1    1 
ATOM 3866 H H      . ILE D 4 38  ? 0.819   4.958   12.448 1.00 0.38 ? 238 ILE B H      1 
ATOM 3867 H HA     . ILE D 4 38  ? -1.517  3.461   11.769 1.00 0.39 ? 238 ILE B HA     1 
ATOM 3868 H HB     . ILE D 4 38  ? 1.244   2.467   12.588 1.00 0.35 ? 238 ILE B HB     1 
ATOM 3869 H HG12   . ILE D 4 38  ? 0.009   2.728   9.828  1.00 0.39 ? 238 ILE B HG12   1 
ATOM 3870 H HG13   . ILE D 4 38  ? 1.021   3.956   10.573 1.00 0.39 ? 238 ILE B HG13   1 
ATOM 3871 H HG21   . ILE D 4 38  ? -1.243  1.070   11.643 1.00 1.09 ? 238 ILE B HG21   1 
ATOM 3872 H HG22   . ILE D 4 38  ? -0.071  0.572   12.854 1.00 1.06 ? 238 ILE B HG22   1 
ATOM 3873 H HG23   . ILE D 4 38  ? 0.313   0.426   11.151 1.00 1.07 ? 238 ILE B HG23   1 
ATOM 3874 H HD11   . ILE D 4 38  ? 2.194   1.229   10.511 1.00 1.07 ? 238 ILE B HD11   1 
ATOM 3875 H HD12   . ILE D 4 38  ? 2.960   2.784   10.258 1.00 1.08 ? 238 ILE B HD12   1 
ATOM 3876 H HD13   . ILE D 4 38  ? 2.031   2.039   8.959  1.00 1.08 ? 238 ILE B HD13   1 
ATOM 3877 N N      . SER D 4 39  ? -0.366  3.041   14.827 1.00 0.36 ? 239 SER B N      1 
ATOM 3878 C CA     . SER D 4 39  ? -0.781  2.552   16.161 1.00 0.35 ? 239 SER B CA     1 
ATOM 3879 C C      . SER D 4 39  ? -2.144  3.137   16.513 1.00 0.37 ? 239 SER B C      1 
ATOM 3880 O O      . SER D 4 39  ? -2.971  2.482   17.110 1.00 0.36 ? 239 SER B O      1 
ATOM 3881 C CB     . SER D 4 39  ? 0.247   2.986   17.206 1.00 0.34 ? 239 SER B CB     1 
ATOM 3882 O OG     . SER D 4 39  ? 1.536   2.541   16.809 1.00 0.32 ? 239 SER B OG     1 
ATOM 3883 H H      . SER D 4 39  ? 0.503   3.480   14.711 1.00 0.35 ? 239 SER B H      1 
ATOM 3884 H HA     . SER D 4 39  ? -0.845  1.475   16.146 1.00 0.33 ? 239 SER B HA     1 
ATOM 3885 H HB2    . SER D 4 39  ? 0.250   4.062   17.285 1.00 0.35 ? 239 SER B HB2    1 
ATOM 3886 H HB3    . SER D 4 39  ? -0.014  2.558   18.165 1.00 0.33 ? 239 SER B HB3    1 
ATOM 3887 H HG     . SER D 4 39  ? 2.085   3.316   16.665 1.00 0.33 ? 239 SER B HG     1 
ATOM 3888 N N      . LYS D 4 40  ? -2.403  4.352   16.104 1.00 0.38 ? 240 LYS B N      1 
ATOM 3889 C CA     . LYS D 4 40  ? -3.733  4.967   16.384 1.00 0.40 ? 240 LYS B CA     1 
ATOM 3890 C C      . LYS D 4 40  ? -4.836  4.330   15.530 1.00 0.41 ? 240 LYS B C      1 
ATOM 3891 O O      . LYS D 4 40  ? -5.915  4.067   16.023 1.00 0.42 ? 240 LYS B O      1 
ATOM 3892 C CB     . LYS D 4 40  ? -3.666  6.466   16.082 1.00 0.42 ? 240 LYS B CB     1 
ATOM 3893 C CG     . LYS D 4 40  ? -2.805  7.161   17.137 1.00 0.42 ? 240 LYS B CG     1 
ATOM 3894 C CD     . LYS D 4 40  ? -2.933  8.678   16.983 1.00 0.45 ? 240 LYS B CD     1 
ATOM 3895 C CE     . LYS D 4 40  ? -1.622  9.347   17.404 1.00 0.44 ? 240 LYS B CE     1 
ATOM 3896 N NZ     . LYS D 4 40  ? -1.747  10.824  17.250 1.00 0.46 ? 240 LYS B NZ     1 
ATOM 3897 H H      . LYS D 4 40  ? -1.730  4.849   15.593 1.00 0.39 ? 240 LYS B H      1 
ATOM 3898 H HA     . LYS D 4 40  ? -3.973  4.832   17.428 1.00 0.40 ? 240 LYS B HA     1 
ATOM 3899 H HB2    . LYS D 4 40  ? -3.232  6.616   15.104 1.00 0.43 ? 240 LYS B HB2    1 
ATOM 3900 H HB3    . LYS D 4 40  ? -4.662  6.882   16.101 1.00 0.44 ? 240 LYS B HB3    1 
ATOM 3901 H HG2    . LYS D 4 40  ? -3.139  6.870   18.123 1.00 0.42 ? 240 LYS B HG2    1 
ATOM 3902 H HG3    . LYS D 4 40  ? -1.772  6.875   17.006 1.00 0.41 ? 240 LYS B HG3    1 
ATOM 3903 H HD2    . LYS D 4 40  ? -3.147  8.919   15.952 1.00 0.45 ? 240 LYS B HD2    1 
ATOM 3904 H HD3    . LYS D 4 40  ? -3.735  9.038   17.611 1.00 0.46 ? 240 LYS B HD3    1 
ATOM 3905 H HE2    . LYS D 4 40  ? -1.411  9.108   18.436 1.00 0.43 ? 240 LYS B HE2    1 
ATOM 3906 H HE3    . LYS D 4 40  ? -0.818  8.987   16.780 1.00 0.43 ? 240 LYS B HE3    1 
ATOM 3907 H HZ1    . LYS D 4 40  ? -1.727  11.072  16.240 1.00 0.47 ? 240 LYS B HZ1    1 
ATOM 3908 H HZ2    . LYS D 4 40  ? -0.955  11.291  17.739 1.00 0.46 ? 240 LYS B HZ2    1 
ATOM 3909 H HZ3    . LYS D 4 40  ? -2.647  11.142  17.664 1.00 0.48 ? 240 LYS B HZ3    1 
ATOM 3910 N N      . ARG D 4 41  ? -4.620  4.085   14.256 1.00 0.41 ? 241 ARG B N      1 
ATOM 3911 C CA     . ARG D 4 41  ? -5.677  3.477   13.463 1.00 0.42 ? 241 ARG B CA     1 
ATOM 3912 C C      . ARG D 4 41  ? -5.913  2.029   13.865 1.00 0.41 ? 241 ARG B C      1 
ATOM 3913 O O      . ARG D 4 41  ? -7.034  1.563   13.928 1.00 0.41 ? 241 ARG B O      1 
ATOM 3914 C CB     . ARG D 4 41  ? -5.295  3.533   11.984 1.00 0.43 ? 241 ARG B CB     1 
ATOM 3915 C CG     . ARG D 4 41  ? -5.199  4.992   11.535 1.00 0.45 ? 241 ARG B CG     1 
ATOM 3916 C CD     . ARG D 4 41  ? -4.917  5.047   10.032 1.00 0.46 ? 241 ARG B CD     1 
ATOM 3917 N NE     . ARG D 4 41  ? -4.620  6.452   9.635  1.00 0.47 ? 241 ARG B NE     1 
ATOM 3918 C CZ     . ARG D 4 41  ? -4.063  6.699   8.480  1.00 0.48 ? 241 ARG B CZ     1 
ATOM 3919 N NH1    . ARG D 4 41  ? -3.769  5.716   7.674  1.00 0.47 ? 241 ARG B NH1    1 
ATOM 3920 N NH2    . ARG D 4 41  ? -3.799  7.930   8.133  1.00 0.49 ? 241 ARG B NH2    1 
ATOM 3921 H H      . ARG D 4 41  ? -3.756  4.307   13.847 1.00 0.41 ? 241 ARG B H      1 
ATOM 3922 H HA     . ARG D 4 41  ? -6.589  4.034   13.606 1.00 0.44 ? 241 ARG B HA     1 
ATOM 3923 H HB2    . ARG D 4 41  ? -4.340  3.047   11.840 1.00 0.42 ? 241 ARG B HB2    1 
ATOM 3924 H HB3    . ARG D 4 41  ? -6.047  3.028   11.397 1.00 0.44 ? 241 ARG B HB3    1 
ATOM 3925 H HG2    . ARG D 4 41  ? -6.132  5.494   11.746 1.00 0.46 ? 241 ARG B HG2    1 
ATOM 3926 H HG3    . ARG D 4 41  ? -4.397  5.481   12.068 1.00 0.44 ? 241 ARG B HG3    1 
ATOM 3927 H HD2    . ARG D 4 41  ? -4.068  4.420   9.803  1.00 0.44 ? 241 ARG B HD2    1 
ATOM 3928 H HD3    . ARG D 4 41  ? -5.782  4.696   9.490  1.00 0.47 ? 241 ARG B HD3    1 
ATOM 3929 H HE     . ARG D 4 41  ? -4.841  7.189   10.240 1.00 0.48 ? 241 ARG B HE     1 
ATOM 3930 H HH11   . ARG D 4 41  ? -3.971  4.773   7.939  1.00 0.46 ? 241 ARG B HH11   1 
ATOM 3931 H HH12   . ARG D 4 41  ? -3.342  5.905   6.790  1.00 0.48 ? 241 ARG B HH12   1 
ATOM 3932 H HH21   . ARG D 4 41  ? -4.024  8.681   8.750  1.00 0.50 ? 241 ARG B HH21   1 
ATOM 3933 H HH22   . ARG D 4 41  ? -3.371  8.119   7.250  1.00 0.50 ? 241 ARG B HH22   1 
ATOM 3934 N N      . LEU D 4 42  ? -4.859  1.315   14.171 1.00 0.39 ? 242 LEU B N      1 
ATOM 3935 C CA     . LEU D 4 42  ? -5.037  -0.095  14.606 1.00 0.37 ? 242 LEU B CA     1 
ATOM 3936 C C      . LEU D 4 42  ? -5.887  -0.113  15.869 1.00 0.37 ? 242 LEU B C      1 
ATOM 3937 O O      . LEU D 4 42  ? -6.774  -0.931  16.018 1.00 0.38 ? 242 LEU B O      1 
ATOM 3938 C CB     . LEU D 4 42  ? -3.670  -0.719  14.897 1.00 0.35 ? 242 LEU B CB     1 
ATOM 3939 C CG     . LEU D 4 42  ? -2.854  -0.789  13.606 1.00 0.35 ? 242 LEU B CG     1 
ATOM 3940 C CD1    . LEU D 4 42  ? -1.485  -1.403  13.900 1.00 0.33 ? 242 LEU B CD1    1 
ATOM 3941 C CD2    . LEU D 4 42  ? -3.593  -1.655  12.584 1.00 0.36 ? 242 LEU B CD2    1 
ATOM 3942 H H      . LEU D 4 42  ? -3.965  1.714   14.137 1.00 0.38 ? 242 LEU B H      1 
ATOM 3943 H HA     . LEU D 4 42  ? -5.532  -0.655  13.827 1.00 0.38 ? 242 LEU B HA     1 
ATOM 3944 H HB2    . LEU D 4 42  ? -3.146  -0.114  15.624 1.00 0.35 ? 242 LEU B HB2    1 
ATOM 3945 H HB3    . LEU D 4 42  ? -3.805  -1.716  15.290 1.00 0.34 ? 242 LEU B HB3    1 
ATOM 3946 H HG     . LEU D 4 42  ? -2.723  0.207   13.209 1.00 0.36 ? 242 LEU B HG     1 
ATOM 3947 H HD11   . LEU D 4 42  ? -0.941  -1.530  12.975 1.00 0.33 ? 242 LEU B HD11   1 
ATOM 3948 H HD12   . LEU D 4 42  ? -1.617  -2.366  14.373 1.00 0.32 ? 242 LEU B HD12   1 
ATOM 3949 H HD13   . LEU D 4 42  ? -0.931  -0.752  14.558 1.00 0.32 ? 242 LEU B HD13   1 
ATOM 3950 H HD21   . LEU D 4 42  ? -4.349  -1.063  12.089 1.00 0.38 ? 242 LEU B HD21   1 
ATOM 3951 H HD22   . LEU D 4 42  ? -4.058  -2.489  13.088 1.00 0.35 ? 242 LEU B HD22   1 
ATOM 3952 H HD23   . LEU D 4 42  ? -2.891  -2.025  11.851 1.00 0.36 ? 242 LEU B HD23   1 
ATOM 3953 N N      . GLY D 4 43  ? -5.640  0.786   16.783 1.00 0.38 ? 243 GLY B N      1 
ATOM 3954 C CA     . GLY D 4 43  ? -6.460  0.810   18.020 1.00 0.38 ? 243 GLY B CA     1 
ATOM 3955 C C      . GLY D 4 43  ? -7.906  1.112   17.647 1.00 0.40 ? 243 GLY B C      1 
ATOM 3956 O O      . GLY D 4 43  ? -8.830  0.535   18.187 1.00 0.41 ? 243 GLY B O      1 
ATOM 3957 H H      . GLY D 4 43  ? -4.928  1.446   16.647 1.00 0.38 ? 243 GLY B H      1 
ATOM 3958 H HA2    . GLY D 4 43  ? -6.402  -0.152  18.509 1.00 0.37 ? 243 GLY B HA2    1 
ATOM 3959 H HA3    . GLY D 4 43  ? -6.092  1.578   18.684 1.00 0.38 ? 243 GLY B HA3    1 
ATOM 3960 N N      . ALA D 4 44  ? -8.119  2.006   16.708 1.00 0.42 ? 244 ALA B N      1 
ATOM 3961 C CA     . ALA D 4 44  ? -9.475  2.299   16.273 1.00 0.44 ? 244 ALA B CA     1 
ATOM 3962 C C      . ALA D 4 44  ? -10.118 1.086   15.613 1.00 0.44 ? 244 ALA B C      1 
ATOM 3963 O O      . ALA D 4 44  ? -11.241 0.725   15.900 1.00 0.44 ? 244 ALA B O      1 
ATOM 3964 C CB     . ALA D 4 44  ? -9.448  3.461   15.278 1.00 0.45 ? 244 ALA B CB     1 
ATOM 3965 H H      . ALA D 4 44  ? -7.361  2.452   16.275 1.00 0.42 ? 244 ALA B H      1 
ATOM 3966 H HA     . ALA D 4 44  ? -10.065 2.589   17.128 1.00 0.44 ? 244 ALA B HA     1 
ATOM 3967 H HB1    . ALA D 4 44  ? -8.886  3.171   14.403 1.00 0.45 ? 244 ALA B HB1    1 
ATOM 3968 H HB2    . ALA D 4 44  ? -8.979  4.317   15.739 1.00 0.46 ? 244 ALA B HB2    1 
ATOM 3969 H HB3    . ALA D 4 44  ? -10.458 3.713   14.992 1.00 0.47 ? 244 ALA B HB3    1 
ATOM 3970 N N      . GLU D 4 45  ? -9.373  0.420   14.749 1.00 0.42 ? 245 GLU B N      1 
ATOM 3971 C CA     . GLU D 4 45  ? -9.889  -0.786  14.113 1.00 0.42 ? 245 GLU B CA     1 
ATOM 3972 C C      . GLU D 4 45  ? -10.039 -1.921  15.117 1.00 0.41 ? 245 GLU B C      1 
ATOM 3973 O O      . GLU D 4 45  ? -11.000 -2.664  15.100 1.00 0.42 ? 245 GLU B O      1 
ATOM 3974 C CB     . GLU D 4 45  ? -8.930  -1.218  13.001 1.00 0.42 ? 245 GLU B CB     1 
ATOM 3975 C CG     . GLU D 4 45  ? -9.512  -2.429  12.266 1.00 0.42 ? 245 GLU B CG     1 
ATOM 3976 C CD     . GLU D 4 45  ? -8.507  -2.925  11.227 1.00 0.41 ? 245 GLU B CD     1 
ATOM 3977 O OE1    . GLU D 4 45  ? -7.467  -2.301  11.091 1.00 0.41 ? 245 GLU B OE1    1 
ATOM 3978 O OE2    . GLU D 4 45  ? -8.794  -3.920  10.581 1.00 0.42 ? 245 GLU B OE2    1 
ATOM 3979 H H      . GLU D 4 45  ? -8.458  0.714   14.564 1.00 0.42 ? 245 GLU B H      1 
ATOM 3980 H HA     . GLU D 4 45  ? -10.852 -0.571  13.676 1.00 0.44 ? 245 GLU B HA     1 
ATOM 3981 H HB2    . GLU D 4 45  ? -8.797  -0.404  12.304 1.00 0.43 ? 245 GLU B HB2    1 
ATOM 3982 H HB3    . GLU D 4 45  ? -7.977  -1.485  13.432 1.00 0.40 ? 245 GLU B HB3    1 
ATOM 3983 H HG2    . GLU D 4 45  ? -9.716  -3.217  12.977 1.00 0.41 ? 245 GLU B HG2    1 
ATOM 3984 H HG3    . GLU D 4 45  ? -10.428 -2.143  11.772 1.00 0.44 ? 245 GLU B HG3    1 
ATOM 3985 N N      . TRP D 4 46  ? -9.081  -2.055  16.006 1.00 0.39 ? 246 TRP B N      1 
ATOM 3986 C CA     . TRP D 4 46  ? -9.140  -3.136  17.031 1.00 0.38 ? 246 TRP B CA     1 
ATOM 3987 C C      . TRP D 4 46  ? -10.393 -2.984  17.895 1.00 0.39 ? 246 TRP B C      1 
ATOM 3988 O O      . TRP D 4 46  ? -11.006 -3.956  18.285 1.00 0.39 ? 246 TRP B O      1 
ATOM 3989 C CB     . TRP D 4 46  ? -7.895  -3.055  17.916 1.00 0.36 ? 246 TRP B CB     1 
ATOM 3990 C CG     . TRP D 4 46  ? -8.010  -4.024  19.051 1.00 0.35 ? 246 TRP B CG     1 
ATOM 3991 C CD1    . TRP D 4 46  ? -8.329  -3.695  20.324 1.00 0.36 ? 246 TRP B CD1    1 
ATOM 3992 C CD2    . TRP D 4 46  ? -7.802  -5.466  19.040 1.00 0.35 ? 246 TRP B CD2    1 
ATOM 3993 N NE1    . TRP D 4 46  ? -8.333  -4.843  21.097 1.00 0.36 ? 246 TRP B NE1    1 
ATOM 3994 C CE2    . TRP D 4 46  ? -8.011  -5.961  20.354 1.00 0.35 ? 246 TRP B CE2    1 
ATOM 3995 C CE3    . TRP D 4 46  ? -7.454  -6.388  18.026 1.00 0.35 ? 246 TRP B CE3    1 
ATOM 3996 C CZ2    . TRP D 4 46  ? -7.880  -7.326  20.653 1.00 0.35 ? 246 TRP B CZ2    1 
ATOM 3997 C CZ3    . TRP D 4 46  ? -7.323  -7.761  18.324 1.00 0.35 ? 246 TRP B CZ3    1 
ATOM 3998 C CH2    . TRP D 4 46  ? -7.536  -8.227  19.635 1.00 0.35 ? 246 TRP B CH2    1 
ATOM 3999 H H      . TRP D 4 46  ? -8.321  -1.438  15.994 1.00 0.39 ? 246 TRP B H      1 
ATOM 4000 H HA     . TRP D 4 46  ? -9.161  -4.097  16.537 1.00 0.38 ? 246 TRP B HA     1 
ATOM 4001 H HB2    . TRP D 4 46  ? -7.026  -3.298  17.325 1.00 0.36 ? 246 TRP B HB2    1 
ATOM 4002 H HB3    . TRP D 4 46  ? -7.796  -2.053  18.307 1.00 0.37 ? 246 TRP B HB3    1 
ATOM 4003 H HD1    . TRP D 4 46  ? -8.551  -2.699  20.678 1.00 0.37 ? 246 TRP B HD1    1 
ATOM 4004 H HE1    . TRP D 4 46  ? -8.535  -4.879  22.055 1.00 0.37 ? 246 TRP B HE1    1 
ATOM 4005 H HE3    . TRP D 4 46  ? -7.290  -6.041  17.018 1.00 0.35 ? 246 TRP B HE3    1 
ATOM 4006 H HZ2    . TRP D 4 46  ? -8.047  -7.680  21.659 1.00 0.36 ? 246 TRP B HZ2    1 
ATOM 4007 H HZ3    . TRP D 4 46  ? -7.062  -8.458  17.545 1.00 0.35 ? 246 TRP B HZ3    1 
ATOM 4008 H HH2    . TRP D 4 46  ? -7.435  -9.279  19.856 1.00 0.36 ? 246 TRP B HH2    1 
ATOM 4009 N N      . LYS D 4 47  ? -10.780 -1.779  18.196 1.00 0.41 ? 247 LYS B N      1 
ATOM 4010 C CA     . LYS D 4 47  ? -11.995 -1.589  19.035 1.00 0.42 ? 247 LYS B CA     1 
ATOM 4011 C C      . LYS D 4 47  ? -13.254 -1.959  18.245 1.00 0.44 ? 247 LYS B C      1 
ATOM 4012 O O      . LYS D 4 47  ? -14.329 -2.068  18.803 1.00 0.45 ? 247 LYS B O      1 
ATOM 4013 C CB     . LYS D 4 47  ? -12.117 -0.138  19.492 1.00 0.44 ? 247 LYS B CB     1 
ATOM 4014 C CG     . LYS D 4 47  ? -11.015 0.167   20.497 1.00 0.43 ? 247 LYS B CG     1 
ATOM 4015 C CD     . LYS D 4 47  ? -11.160 1.605   20.989 1.00 0.45 ? 247 LYS B CD     1 
ATOM 4016 C CE     . LYS D 4 47  ? -9.991  1.931   21.910 1.00 0.46 ? 247 LYS B CE     1 
ATOM 4017 N NZ     . LYS D 4 47  ? -10.283 3.168   22.687 1.00 1.22 ? 247 LYS B NZ     1 
ATOM 4018 H H      . LYS D 4 47  ? -10.276 -1.004  17.873 1.00 0.41 ? 247 LYS B H      1 
ATOM 4019 H HA     . LYS D 4 47  ? -11.926 -2.218  19.909 1.00 0.41 ? 247 LYS B HA     1 
ATOM 4020 H HB2    . LYS D 4 47  ? -12.020 0.518   18.639 1.00 0.44 ? 247 LYS B HB2    1 
ATOM 4021 H HB3    . LYS D 4 47  ? -13.079 0.014   19.958 1.00 0.45 ? 247 LYS B HB3    1 
ATOM 4022 H HG2    . LYS D 4 47  ? -11.100 -0.508  21.336 1.00 0.42 ? 247 LYS B HG2    1 
ATOM 4023 H HG3    . LYS D 4 47  ? -10.054 0.040   20.035 1.00 0.42 ? 247 LYS B HG3    1 
ATOM 4024 H HD2    . LYS D 4 47  ? -11.158 2.279   20.143 1.00 0.46 ? 247 LYS B HD2    1 
ATOM 4025 H HD3    . LYS D 4 47  ? -12.086 1.709   21.533 1.00 0.46 ? 247 LYS B HD3    1 
ATOM 4026 H HE2    . LYS D 4 47  ? -9.819  1.110   22.591 1.00 0.99 ? 247 LYS B HE2    1 
ATOM 4027 H HE3    . LYS D 4 47  ? -9.119  2.084   21.303 1.00 0.98 ? 247 LYS B HE3    1 
ATOM 4028 H HZ1    . LYS D 4 47  ? -10.574 3.926   22.039 1.00 1.79 ? 247 LYS B HZ1    1 
ATOM 4029 H HZ2    . LYS D 4 47  ? -9.428  3.460   23.204 1.00 1.74 ? 247 LYS B HZ2    1 
ATOM 4030 H HZ3    . LYS D 4 47  ? -11.049 2.978   23.362 1.00 1.78 ? 247 LYS B HZ3    1 
ATOM 4031 N N      . LEU D 4 48  ? -13.165 -2.124  16.943 1.00 0.44 ? 248 LEU B N      1 
ATOM 4032 C CA     . LEU D 4 48  ? -14.360 -2.443  16.156 1.00 0.45 ? 248 LEU B CA     1 
ATOM 4033 C C      . LEU D 4 48  ? -14.513 -3.953  15.942 1.00 0.45 ? 248 LEU B C      1 
ATOM 4034 O O      . LEU D 4 48  ? -15.515 -4.408  15.430 1.00 0.46 ? 248 LEU B O      1 
ATOM 4035 C CB     . LEU D 4 48  ? -14.266 -1.751  14.795 1.00 0.46 ? 248 LEU B CB     1 
ATOM 4036 C CG     . LEU D 4 48  ? -14.062 -0.250  14.997 1.00 0.47 ? 248 LEU B CG     1 
ATOM 4037 C CD1    . LEU D 4 48  ? -14.096 0.458   13.642 1.00 0.49 ? 248 LEU B CD1    1 
ATOM 4038 C CD2    . LEU D 4 48  ? -15.182 0.301   15.885 1.00 0.49 ? 248 LEU B CD2    1 
ATOM 4039 H H      . LEU D 4 48  ? -12.301 -2.008  16.493 1.00 0.43 ? 248 LEU B H      1 
ATOM 4040 H HA     . LEU D 4 48  ? -15.231 -2.071  16.673 1.00 0.47 ? 248 LEU B HA     1 
ATOM 4041 H HB2    . LEU D 4 48  ? -13.431 -2.158  14.243 1.00 0.45 ? 248 LEU B HB2    1 
ATOM 4042 H HB3    . LEU D 4 48  ? -15.178 -1.917  14.243 1.00 0.48 ? 248 LEU B HB3    1 
ATOM 4043 H HG     . LEU D 4 48  ? -13.107 -0.077  15.472 1.00 0.46 ? 248 LEU B HG     1 
ATOM 4044 H HD11   . LEU D 4 48  ? -13.280 0.100   13.030 1.00 0.48 ? 248 LEU B HD11   1 
ATOM 4045 H HD12   . LEU D 4 48  ? -13.995 1.523   13.789 1.00 0.49 ? 248 LEU B HD12   1 
ATOM 4046 H HD13   . LEU D 4 48  ? -15.034 0.249   13.150 1.00 0.50 ? 248 LEU B HD13   1 
ATOM 4047 H HD21   . LEU D 4 48  ? -15.248 1.372   15.759 1.00 0.50 ? 248 LEU B HD21   1 
ATOM 4048 H HD22   . LEU D 4 48  ? -14.967 0.073   16.918 1.00 0.48 ? 248 LEU B HD22   1 
ATOM 4049 H HD23   . LEU D 4 48  ? -16.121 -0.152  15.603 1.00 0.50 ? 248 LEU B HD23   1 
ATOM 4050 N N      . LEU D 4 49  ? -13.540 -4.737  16.326 1.00 0.43 ? 249 LEU B N      1 
ATOM 4051 C CA     . LEU D 4 49  ? -13.672 -6.211  16.128 1.00 0.42 ? 249 LEU B CA     1 
ATOM 4052 C C      . LEU D 4 49  ? -14.685 -6.753  17.142 1.00 0.43 ? 249 LEU B C      1 
ATOM 4053 O O      . LEU D 4 49  ? -14.842 -6.214  18.221 1.00 0.43 ? 249 LEU B O      1 
ATOM 4054 C CB     . LEU D 4 49  ? -12.315 -6.882  16.348 1.00 0.40 ? 249 LEU B CB     1 
ATOM 4055 C CG     . LEU D 4 49  ? -11.277 -6.249  15.420 1.00 0.40 ? 249 LEU B CG     1 
ATOM 4056 C CD1    . LEU D 4 49  ? -9.890  -6.808  15.750 1.00 0.38 ? 249 LEU B CD1    1 
ATOM 4057 C CD2    . LEU D 4 49  ? -11.624 -6.582  13.967 1.00 0.41 ? 249 LEU B CD2    1 
ATOM 4058 H H      . LEU D 4 49  ? -12.734 -4.364  16.739 1.00 0.42 ? 249 LEU B H      1 
ATOM 4059 H HA     . LEU D 4 49  ? -14.020 -6.413  15.126 1.00 0.43 ? 249 LEU B HA     1 
ATOM 4060 H HB2    . LEU D 4 49  ? -12.010 -6.748  17.376 1.00 0.39 ? 249 LEU B HB2    1 
ATOM 4061 H HB3    . LEU D 4 49  ? -12.395 -7.937  16.131 1.00 0.40 ? 249 LEU B HB3    1 
ATOM 4062 H HG     . LEU D 4 49  ? -11.275 -5.178  15.558 1.00 0.40 ? 249 LEU B HG     1 
ATOM 4063 H HD11   . LEU D 4 49  ? -9.819  -7.825  15.398 1.00 0.37 ? 249 LEU B HD11   1 
ATOM 4064 H HD12   . LEU D 4 49  ? -9.739  -6.785  16.820 1.00 0.37 ? 249 LEU B HD12   1 
ATOM 4065 H HD13   . LEU D 4 49  ? -9.136  -6.205  15.266 1.00 0.37 ? 249 LEU B HD13   1 
ATOM 4066 H HD21   . LEU D 4 49  ? -12.459 -5.974  13.649 1.00 0.42 ? 249 LEU B HD21   1 
ATOM 4067 H HD22   . LEU D 4 49  ? -11.889 -7.625  13.889 1.00 0.41 ? 249 LEU B HD22   1 
ATOM 4068 H HD23   . LEU D 4 49  ? -10.771 -6.378  13.338 1.00 0.40 ? 249 LEU B HD23   1 
ATOM 4069 N N      . SER D 4 50  ? -15.390 -7.815  16.822 1.00 0.43 ? 250 SER B N      1 
ATOM 4070 C CA     . SER D 4 50  ? -16.343 -8.374  17.772 1.00 0.44 ? 250 SER B CA     1 
ATOM 4071 C C      . SER D 4 50  ? -15.655 -9.332  18.738 1.00 0.42 ? 250 SER B C      1 
ATOM 4072 O O      . SER D 4 50  ? -14.517 -9.699  18.531 1.00 0.41 ? 250 SER B O      1 
ATOM 4073 C CB     . SER D 4 50  ? -17.436 -9.123  17.010 1.00 0.45 ? 250 SER B CB     1 
ATOM 4074 O OG     . SER D 4 50  ? -16.893 -10.321 16.468 1.00 0.45 ? 250 SER B OG     1 
ATOM 4075 H H      . SER D 4 50  ? -15.262 -8.241  15.947 1.00 0.43 ? 250 SER B H      1 
ATOM 4076 H HA     . SER D 4 50  ? -16.796 -7.572  18.332 1.00 0.45 ? 250 SER B HA     1 
ATOM 4077 H HB2    . SER D 4 50  ? -18.243 -9.370  17.681 1.00 0.46 ? 250 SER B HB2    1 
ATOM 4078 H HB3    . SER D 4 50  ? -17.813 -8.495  16.212 1.00 0.46 ? 250 SER B HB3    1 
ATOM 4079 H HG     . SER D 4 50  ? -15.943 -10.299 16.599 1.00 0.43 ? 250 SER B HG     1 
ATOM 4080 N N      . GLU D 4 51  ? -16.296 -9.748  19.788 1.00 0.43 ? 251 GLU B N      1 
ATOM 4081 C CA     . GLU D 4 51  ? -15.632 -10.676 20.747 1.00 0.41 ? 251 GLU B CA     1 
ATOM 4082 C C      . GLU D 4 51  ? -15.387 -12.023 20.069 1.00 0.41 ? 251 GLU B C      1 
ATOM 4083 O O      . GLU D 4 51  ? -14.368 -12.652 20.273 1.00 0.40 ? 251 GLU B O      1 
ATOM 4084 C CB     . GLU D 4 51  ? -16.531 -10.878 21.968 1.00 0.42 ? 251 GLU B CB     1 
ATOM 4085 C CG     . GLU D 4 51  ? -15.792 -11.713 23.014 1.00 0.41 ? 251 GLU B CG     1 
ATOM 4086 C CD     . GLU D 4 51  ? -16.717 -11.980 24.202 1.00 0.42 ? 251 GLU B CD     1 
ATOM 4087 O OE1    . GLU D 4 51  ? -17.850 -11.527 24.158 1.00 0.44 ? 251 GLU B OE1    1 
ATOM 4088 O OE2    . GLU D 4 51  ? -16.279 -12.630 25.136 1.00 0.42 ? 251 GLU B OE2    1 
ATOM 4089 H H      . GLU D 4 51  ? -17.214 -9.445  19.955 1.00 0.44 ? 251 GLU B H      1 
ATOM 4090 H HA     . GLU D 4 51  ? -14.689 -10.255 21.060 1.00 0.40 ? 251 GLU B HA     1 
ATOM 4091 H HB2    . GLU D 4 51  ? -16.785 -9.915  22.389 1.00 0.43 ? 251 GLU B HB2    1 
ATOM 4092 H HB3    . GLU D 4 51  ? -17.433 -11.391 21.671 1.00 0.43 ? 251 GLU B HB3    1 
ATOM 4093 H HG2    . GLU D 4 51  ? -15.489 -12.654 22.575 1.00 0.41 ? 251 GLU B HG2    1 
ATOM 4094 H HG3    . GLU D 4 51  ? -14.919 -11.176 23.353 1.00 0.40 ? 251 GLU B HG3    1 
ATOM 4095 N N      . THR D 4 52  ? -16.315 -12.482 19.258 1.00 0.42 ? 252 THR B N      1 
ATOM 4096 C CA     . THR D 4 52  ? -16.097 -13.744 18.569 1.00 0.42 ? 252 THR B CA     1 
ATOM 4097 C C      . THR D 4 52  ? -14.879 -13.667 17.664 1.00 0.41 ? 252 THR B C      1 
ATOM 4098 O O      . THR D 4 52  ? -14.047 -14.551 17.626 1.00 0.40 ? 252 THR B O      1 
ATOM 4099 C CB     . THR D 4 52  ? -17.330 -14.083 17.732 1.00 0.44 ? 252 THR B CB     1 
ATOM 4100 O OG1    . THR D 4 52  ? -18.481 -14.079 18.566 1.00 0.45 ? 252 THR B OG1    1 
ATOM 4101 C CG2    . THR D 4 52  ? -17.159 -15.466 17.104 1.00 0.44 ? 252 THR B CG2    1 
ATOM 4102 H H      . THR D 4 52  ? -17.135 -11.965 19.102 1.00 0.43 ? 252 THR B H      1 
ATOM 4103 H HA     . THR D 4 52  ? -15.947 -14.524 19.299 1.00 0.42 ? 252 THR B HA     1 
ATOM 4104 H HB     . THR D 4 52  ? -17.448 -13.349 16.949 1.00 0.45 ? 252 THR B HB     1 
ATOM 4105 H HG1    . THR D 4 52  ? -19.247 -14.259 18.015 1.00 0.46 ? 252 THR B HG1    1 
ATOM 4106 H HG21   . THR D 4 52  ? -18.123 -15.842 16.791 1.00 0.46 ? 252 THR B HG21   1 
ATOM 4107 H HG22   . THR D 4 52  ? -16.728 -16.141 17.829 1.00 0.44 ? 252 THR B HG22   1 
ATOM 4108 H HG23   . THR D 4 52  ? -16.506 -15.395 16.248 1.00 0.44 ? 252 THR B HG23   1 
ATOM 4109 N N      . GLU D 4 53  ? -14.760 -12.568 16.961 1.00 0.41 ? 253 GLU B N      1 
ATOM 4110 C CA     . GLU D 4 53  ? -13.578 -12.379 16.081 1.00 0.41 ? 253 GLU B CA     1 
ATOM 4111 C C      . GLU D 4 53  ? -12.328 -12.169 16.941 1.00 0.39 ? 253 GLU B C      1 
ATOM 4112 O O      . GLU D 4 53  ? -11.257 -12.628 16.613 1.00 0.38 ? 253 GLU B O      1 
ATOM 4113 C CB     . GLU D 4 53  ? -13.794 -11.153 15.192 1.00 0.41 ? 253 GLU B CB     1 
ATOM 4114 C CG     . GLU D 4 53  ? -14.902 -11.445 14.178 1.00 0.43 ? 253 GLU B CG     1 
ATOM 4115 C CD     . GLU D 4 53  ? -14.937 -10.337 13.125 1.00 0.44 ? 253 GLU B CD     1 
ATOM 4116 O OE1    . GLU D 4 53  ? -14.161 -9.405  13.249 1.00 0.44 ? 253 GLU B OE1    1 
ATOM 4117 O OE2    . GLU D 4 53  ? -15.740 -10.440 12.212 1.00 0.46 ? 253 GLU B OE2    1 
ATOM 4118 H H      . GLU D 4 53  ? -15.434 -11.860 17.038 1.00 0.42 ? 253 GLU B H      1 
ATOM 4119 H HA     . GLU D 4 53  ? -13.446 -13.253 15.462 1.00 0.41 ? 253 GLU B HA     1 
ATOM 4120 H HB2    . GLU D 4 53  ? -14.078 -10.310 15.805 1.00 0.41 ? 253 GLU B HB2    1 
ATOM 4121 H HB3    . GLU D 4 53  ? -12.880 -10.923 14.665 1.00 0.41 ? 253 GLU B HB3    1 
ATOM 4122 H HG2    . GLU D 4 53  ? -14.710 -12.393 13.698 1.00 0.44 ? 253 GLU B HG2    1 
ATOM 4123 H HG3    . GLU D 4 53  ? -15.853 -11.485 14.688 1.00 0.44 ? 253 GLU B HG3    1 
ATOM 4124 N N      . LYS D 4 54  ? -12.455 -11.484 18.046 1.00 0.38 ? 254 LYS B N      1 
ATOM 4125 C CA     . LYS D 4 54  ? -11.272 -11.262 18.927 1.00 0.36 ? 254 LYS B CA     1 
ATOM 4126 C C      . LYS D 4 54  ? -10.961 -12.543 19.708 1.00 0.36 ? 254 LYS B C      1 
ATOM 4127 O O      . LYS D 4 54  ? -9.829  -12.806 20.061 1.00 0.34 ? 254 LYS B O      1 
ATOM 4128 C CB     . LYS D 4 54  ? -11.592 -10.143 19.910 1.00 0.37 ? 254 LYS B CB     1 
ATOM 4129 C CG     . LYS D 4 54  ? -11.691 -8.803  19.169 1.00 0.39 ? 254 LYS B CG     1 
ATOM 4130 C CD     . LYS D 4 54  ? -12.304 -7.723  20.104 1.00 0.46 ? 254 LYS B CD     1 
ATOM 4131 C CE     . LYS D 4 54  ? -11.338 -6.546  20.268 1.00 0.90 ? 254 LYS B CE     1 
ATOM 4132 N NZ     . LYS D 4 54  ? -11.853 -5.616  21.308 1.00 0.92 ? 254 LYS B NZ     1 
ATOM 4133 H H      . LYS D 4 54  ? -13.330 -11.122 18.300 1.00 0.39 ? 254 LYS B H      1 
ATOM 4134 H HA     . LYS D 4 54  ? -10.418 -10.994 18.322 1.00 0.36 ? 254 LYS B HA     1 
ATOM 4135 H HB2    . LYS D 4 54  ? -12.526 -10.358 20.397 1.00 0.38 ? 254 LYS B HB2    1 
ATOM 4136 H HB3    . LYS D 4 54  ? -10.809 -10.081 20.652 1.00 0.36 ? 254 LYS B HB3    1 
ATOM 4137 H HG2    . LYS D 4 54  ? -10.701 -8.504  18.850 1.00 0.37 ? 254 LYS B HG2    1 
ATOM 4138 H HG3    . LYS D 4 54  ? -12.318 -8.926  18.298 1.00 0.43 ? 254 LYS B HG3    1 
ATOM 4139 H HD2    . LYS D 4 54  ? -13.226 -7.361  19.671 1.00 1.00 ? 254 LYS B HD2    1 
ATOM 4140 H HD3    . LYS D 4 54  ? -12.516 -8.143  21.077 1.00 1.07 ? 254 LYS B HD3    1 
ATOM 4141 H HE2    . LYS D 4 54  ? -10.383 -6.923  20.570 1.00 1.56 ? 254 LYS B HE2    1 
ATOM 4142 H HE3    . LYS D 4 54  ? -11.236 -6.022  19.337 1.00 1.47 ? 254 LYS B HE3    1 
ATOM 4143 H HZ1    . LYS D 4 54  ? -12.806 -5.913  21.597 1.00 1.40 ? 254 LYS B HZ1    1 
ATOM 4144 H HZ2    . LYS D 4 54  ? -11.891 -4.651  20.920 1.00 1.37 ? 254 LYS B HZ2    1 
ATOM 4145 H HZ3    . LYS D 4 54  ? -11.221 -5.634  22.133 1.00 1.37 ? 254 LYS B HZ3    1 
ATOM 4146 N N      . ARG D 4 55  ? -11.946 -13.360 20.005 1.00 0.37 ? 255 ARG B N      1 
ATOM 4147 C CA     . ARG D 4 55  ? -11.717 -14.578 20.767 1.00 0.37 ? 255 ARG B CA     1 
ATOM 4148 C C      . ARG D 4 55  ? -10.508 -15.341 20.248 1.00 0.36 ? 255 ARG B C      1 
ATOM 4149 O O      . ARG D 4 55  ? -9.611  -15.629 21.016 1.00 0.34 ? 255 ARG B O      1 
ATOM 4150 C CB     . ARG D 4 55  ? -12.954 -15.471 20.671 1.00 0.38 ? 255 ARG B CB     1 
ATOM 4151 C CG     . ARG D 4 55  ? -13.212 -16.134 22.026 1.00 0.38 ? 255 ARG B CG     1 
ATOM 4152 C CD     . ARG D 4 55  ? -14.201 -15.285 22.828 1.00 0.39 ? 255 ARG B CD     1 
ATOM 4153 N NE     . ARG D 4 55  ? -13.970 -15.497 24.284 1.00 0.39 ? 255 ARG B NE     1 
ATOM 4154 C CZ     . ARG D 4 55  ? -14.480 -14.667 25.154 1.00 0.39 ? 255 ARG B CZ     1 
ATOM 4155 N NH1    . ARG D 4 55  ? -15.192 -13.653 24.746 1.00 0.40 ? 255 ARG B NH1    1 
ATOM 4156 N NH2    . ARG D 4 55  ? -14.276 -14.852 26.429 1.00 0.39 ? 255 ARG B NH2    1 
ATOM 4157 H H      . ARG D 4 55  ? -12.856 -13.136 19.721 1.00 0.38 ? 255 ARG B H      1 
ATOM 4158 H HA     . ARG D 4 55  ? -11.554 -14.322 21.802 1.00 0.36 ? 255 ARG B HA     1 
ATOM 4159 H HB2    . ARG D 4 55  ? -13.810 -14.873 20.392 1.00 0.39 ? 255 ARG B HB2    1 
ATOM 4160 H HB3    . ARG D 4 55  ? -12.789 -16.235 19.926 1.00 0.38 ? 255 ARG B HB3    1 
ATOM 4161 H HG2    . ARG D 4 55  ? -13.626 -17.119 21.870 1.00 0.39 ? 255 ARG B HG2    1 
ATOM 4162 H HG3    . ARG D 4 55  ? -12.285 -16.212 22.571 1.00 0.37 ? 255 ARG B HG3    1 
ATOM 4163 H HD2    . ARG D 4 55  ? -14.057 -14.242 22.588 1.00 0.39 ? 255 ARG B HD2    1 
ATOM 4164 H HD3    . ARG D 4 55  ? -15.210 -15.575 22.577 1.00 0.40 ? 255 ARG B HD3    1 
ATOM 4165 H HE     . ARG D 4 55  ? -13.434 -16.259 24.590 1.00 0.38 ? 255 ARG B HE     1 
ATOM 4166 H HH11   . ARG D 4 55  ? -15.348 -13.512 23.769 1.00 0.40 ? 255 ARG B HH11   1 
ATOM 4167 H HH12   . ARG D 4 55  ? -15.583 -13.016 25.412 1.00 0.41 ? 255 ARG B HH12   1 
ATOM 4168 H HH21   . ARG D 4 55  ? -13.730 -15.629 26.741 1.00 0.39 ? 255 ARG B HH21   1 
ATOM 4169 H HH22   . ARG D 4 55  ? -14.666 -14.215 27.095 1.00 0.40 ? 255 ARG B HH22   1 
ATOM 4170 N N      . PRO D 4 56  ? -10.428 -15.697 18.976 1.00 0.36 ? 256 PRO B N      1 
ATOM 4171 C CA     . PRO D 4 56  ? -9.261  -16.450 18.438 1.00 0.36 ? 256 PRO B CA     1 
ATOM 4172 C C      . PRO D 4 56  ? -7.924  -15.799 18.817 1.00 0.34 ? 256 PRO B C      1 
ATOM 4173 O O      . PRO D 4 56  ? -6.931  -16.476 18.997 1.00 0.33 ? 256 PRO B O      1 
ATOM 4174 C CB     . PRO D 4 56  ? -9.462  -16.429 16.914 1.00 0.37 ? 256 PRO B CB     1 
ATOM 4175 C CG     . PRO D 4 56  ? -10.618 -15.513 16.648 1.00 0.38 ? 256 PRO B CG     1 
ATOM 4176 C CD     . PRO D 4 56  ? -11.423 -15.417 17.942 1.00 0.38 ? 256 PRO B CD     1 
ATOM 4177 H HA     . PRO D 4 56  ? -9.286  -17.469 18.785 1.00 0.36 ? 256 PRO B HA     1 
ATOM 4178 H HB2    . PRO D 4 56  ? -8.571  -16.056 16.428 1.00 0.36 ? 256 PRO B HB2    1 
ATOM 4179 H HB3    . PRO D 4 56  ? -9.691  -17.422 16.557 1.00 0.38 ? 256 PRO B HB3    1 
ATOM 4180 H HG2    . PRO D 4 56  ? -10.255 -14.536 16.362 1.00 0.37 ? 256 PRO B HG2    1 
ATOM 4181 H HG3    . PRO D 4 56  ? -11.239 -15.921 15.865 1.00 0.39 ? 256 PRO B HG3    1 
ATOM 4182 H HD2    . PRO D 4 56  ? -11.833 -14.422 18.059 1.00 0.38 ? 256 PRO B HD2    1 
ATOM 4183 H HD3    . PRO D 4 56  ? -12.204 -16.160 17.962 1.00 0.39 ? 256 PRO B HD3    1 
ATOM 4184 N N      . PHE D 4 57  ? -7.882  -14.498 18.957 1.00 0.33 ? 257 PHE B N      1 
ATOM 4185 C CA     . PHE D 4 57  ? -6.607  -13.823 19.341 1.00 0.31 ? 257 PHE B CA     1 
ATOM 4186 C C      . PHE D 4 57  ? -6.442  -13.873 20.859 1.00 0.31 ? 257 PHE B C      1 
ATOM 4187 O O      . PHE D 4 57  ? -5.339  -13.935 21.367 1.00 0.29 ? 257 PHE B O      1 
ATOM 4188 C CB     . PHE D 4 57  ? -6.643  -12.366 18.876 1.00 0.31 ? 257 PHE B CB     1 
ATOM 4189 C CG     . PHE D 4 57  ? -6.625  -12.320 17.366 1.00 0.32 ? 257 PHE B CG     1 
ATOM 4190 C CD1    . PHE D 4 57  ? -5.414  -12.439 16.675 1.00 0.31 ? 257 PHE B CD1    1 
ATOM 4191 C CD2    . PHE D 4 57  ? -7.822  -12.157 16.656 1.00 0.34 ? 257 PHE B CD2    1 
ATOM 4192 C CE1    . PHE D 4 57  ? -5.398  -12.396 15.275 1.00 0.33 ? 257 PHE B CE1    1 
ATOM 4193 C CE2    . PHE D 4 57  ? -7.806  -12.114 15.256 1.00 0.35 ? 257 PHE B CE2    1 
ATOM 4194 C CZ     . PHE D 4 57  ? -6.594  -12.234 14.566 1.00 0.34 ? 257 PHE B CZ     1 
ATOM 4195 H H      . PHE D 4 57  ? -8.694  -13.967 18.819 1.00 0.34 ? 257 PHE B H      1 
ATOM 4196 H HA     . PHE D 4 57  ? -5.777  -14.330 18.873 1.00 0.31 ? 257 PHE B HA     1 
ATOM 4197 H HB2    . PHE D 4 57  ? -7.542  -11.894 19.241 1.00 0.32 ? 257 PHE B HB2    1 
ATOM 4198 H HB3    . PHE D 4 57  ? -5.780  -11.845 19.261 1.00 0.30 ? 257 PHE B HB3    1 
ATOM 4199 H HD1    . PHE D 4 57  ? -4.490  -12.564 17.222 1.00 0.30 ? 257 PHE B HD1    1 
ATOM 4200 H HD2    . PHE D 4 57  ? -8.757  -12.065 17.189 1.00 0.34 ? 257 PHE B HD2    1 
ATOM 4201 H HE1    . PHE D 4 57  ? -4.463  -12.487 14.743 1.00 0.32 ? 257 PHE B HE1    1 
ATOM 4202 H HE2    . PHE D 4 57  ? -8.729  -11.989 14.710 1.00 0.36 ? 257 PHE B HE2    1 
ATOM 4203 H HZ     . PHE D 4 57  ? -6.582  -12.201 13.487 1.00 0.35 ? 257 PHE B HZ     1 
ATOM 4204 N N      . ILE D 4 58  ? -7.519  -13.854 21.607 1.00 0.32 ? 258 ILE B N      1 
ATOM 4205 C CA     . ILE D 4 58  ? -7.391  -13.933 23.055 1.00 0.31 ? 258 ILE B CA     1 
ATOM 4206 C C      . ILE D 4 58  ? -6.937  -15.341 23.470 1.00 0.31 ? 258 ILE B C      1 
ATOM 4207 O O      . ILE D 4 58  ? -6.046  -15.506 24.277 1.00 0.30 ? 258 ILE B O      1 
ATOM 4208 C CB     . ILE D 4 58  ? -8.763  -13.613 23.681 1.00 0.33 ? 258 ILE B CB     1 
ATOM 4209 C CG1    . ILE D 4 58  ? -9.130  -12.142 23.396 1.00 0.33 ? 258 ILE B CG1    1 
ATOM 4210 C CG2    . ILE D 4 58  ? -8.696  -13.843 25.193 1.00 0.33 ? 258 ILE B CG2    1 
ATOM 4211 C CD1    . ILE D 4 58  ? -10.606 -11.864 23.760 1.00 0.35 ? 258 ILE B CD1    1 
ATOM 4212 H H      . ILE D 4 58  ? -8.406  -13.809 21.191 1.00 0.33 ? 258 ILE B H      1 
ATOM 4213 H HA     . ILE D 4 58  ? -6.663  -13.210 23.390 1.00 0.30 ? 258 ILE B HA     1 
ATOM 4214 H HB     . ILE D 4 58  ? -9.512  -14.265 23.255 1.00 0.34 ? 258 ILE B HB     1 
ATOM 4215 H HG12   . ILE D 4 58  ? -8.490  -11.491 23.975 1.00 0.32 ? 258 ILE B HG12   1 
ATOM 4216 H HG13   . ILE D 4 58  ? -8.979  -11.937 22.346 1.00 0.33 ? 258 ILE B HG13   1 
ATOM 4217 H HG21   . ILE D 4 58  ? -8.111  -14.713 25.391 1.00 1.07 ? 258 ILE B HG21   1 
ATOM 4218 H HG22   . ILE D 4 58  ? -9.684  -14.000 25.589 1.00 1.05 ? 258 ILE B HG22   1 
ATOM 4219 H HG23   . ILE D 4 58  ? -8.242  -12.992 25.679 1.00 1.07 ? 258 ILE B HG23   1 
ATOM 4220 H HD11   . ILE D 4 58  ? -10.708 -10.843 24.098 1.00 1.07 ? 258 ILE B HD11   1 
ATOM 4221 H HD12   . ILE D 4 58  ? -10.932 -12.527 24.540 1.00 1.12 ? 258 ILE B HD12   1 
ATOM 4222 H HD13   . ILE D 4 58  ? -11.227 -12.013 22.888 1.00 1.04 ? 258 ILE B HD13   1 
ATOM 4223 N N      . ASP D 4 59  ? -7.527  -16.364 22.878 1.00 0.32 ? 259 ASP B N      1 
ATOM 4224 C CA     . ASP D 4 59  ? -7.114  -17.694 23.189 1.00 0.33 ? 259 ASP B CA     1 
ATOM 4225 C C      . ASP D 4 59  ? -5.646  -17.908 22.884 1.00 0.32 ? 259 ASP B C      1 
ATOM 4226 O O      . ASP D 4 59  ? -4.927  -18.520 23.648 1.00 0.31 ? 259 ASP B O      1 
ATOM 4227 C CB     . ASP D 4 59  ? -7.947  -18.686 22.379 1.00 0.34 ? 259 ASP B CB     1 
ATOM 4228 C CG     . ASP D 4 59  ? -9.401  -18.635 22.849 1.00 0.35 ? 259 ASP B CG     1 
ATOM 4229 O OD1    . ASP D 4 59  ? -9.646  -18.047 23.889 1.00 0.35 ? 259 ASP B OD1    1 
ATOM 4230 O OD2    . ASP D 4 59  ? -10.246 -19.184 22.161 1.00 0.37 ? 259 ASP B OD2    1 
ATOM 4231 H H      . ASP D 4 59  ? -8.224  -16.209 22.204 1.00 0.33 ? 259 ASP B H      1 
ATOM 4232 H HA     . ASP D 4 59  ? -7.285  -17.878 24.237 1.00 0.33 ? 259 ASP B HA     1 
ATOM 4233 H HB2    . ASP D 4 59  ? -7.897  -18.429 21.331 1.00 0.34 ? 259 ASP B HB2    1 
ATOM 4234 H HB3    . ASP D 4 59  ? -7.560  -19.685 22.523 1.00 0.35 ? 259 ASP B HB3    1 
ATOM 4235 N N      . GLU D 4 60  ? -5.172  -17.388 21.770 1.00 0.31 ? 260 GLU B N      1 
ATOM 4236 C CA     . GLU D 4 60  ? -3.733  -17.549 21.439 1.00 0.30 ? 260 GLU B CA     1 
ATOM 4237 C C      . GLU D 4 60  ? -2.890  -16.832 22.493 1.00 0.29 ? 260 GLU B C      1 
ATOM 4238 O O      . GLU D 4 60  ? -1.911  -17.367 22.975 1.00 0.28 ? 260 GLU B O      1 
ATOM 4239 C CB     . GLU D 4 60  ? -3.454  -16.943 20.062 1.00 0.30 ? 260 GLU B CB     1 
ATOM 4240 C CG     . GLU D 4 60  ? -2.000  -17.214 19.669 1.00 0.29 ? 260 GLU B CG     1 
ATOM 4241 C CD     . GLU D 4 60  ? -1.895  -17.324 18.147 1.00 0.30 ? 260 GLU B CD     1 
ATOM 4242 O OE1    . GLU D 4 60  ? -2.850  -16.964 17.478 1.00 0.31 ? 260 GLU B OE1    1 
ATOM 4243 O OE2    . GLU D 4 60  ? -0.860  -17.767 17.674 1.00 0.30 ? 260 GLU B OE2    1 
ATOM 4244 H H      . GLU D 4 60  ? -5.762  -16.883 21.172 1.00 0.31 ? 260 GLU B H      1 
ATOM 4245 H HA     . GLU D 4 60  ? -3.481  -18.600 21.427 1.00 0.31 ? 260 GLU B HA     1 
ATOM 4246 H HB2    . GLU D 4 60  ? -4.114  -17.388 19.332 1.00 0.31 ? 260 GLU B HB2    1 
ATOM 4247 H HB3    . GLU D 4 60  ? -3.623  -15.877 20.096 1.00 0.29 ? 260 GLU B HB3    1 
ATOM 4248 H HG2    . GLU D 4 60  ? -1.377  -16.403 20.016 1.00 0.28 ? 260 GLU B HG2    1 
ATOM 4249 H HG3    . GLU D 4 60  ? -1.672  -18.138 20.118 1.00 0.30 ? 260 GLU B HG3    1 
ATOM 4250 N N      . ALA D 4 61  ? -3.263  -15.642 22.886 1.00 0.28 ? 261 ALA B N      1 
ATOM 4251 C CA     . ALA D 4 61  ? -2.475  -14.939 23.932 1.00 0.27 ? 261 ALA B CA     1 
ATOM 4252 C C      . ALA D 4 61  ? -2.529  -15.793 25.192 1.00 0.27 ? 261 ALA B C      1 
ATOM 4253 O O      . ALA D 4 61  ? -1.562  -15.931 25.913 1.00 0.27 ? 261 ALA B O      1 
ATOM 4254 C CB     . ALA D 4 61  ? -3.092  -13.567 24.211 1.00 0.27 ? 261 ALA B CB     1 
ATOM 4255 H H      . ALA D 4 61  ? -4.067  -15.227 22.509 1.00 0.28 ? 261 ALA B H      1 
ATOM 4256 H HA     . ALA D 4 61  ? -1.451  -14.825 23.608 1.00 0.26 ? 261 ALA B HA     1 
ATOM 4257 H HB1    . ALA D 4 61  ? -2.911  -12.912 23.370 1.00 0.26 ? 261 ALA B HB1    1 
ATOM 4258 H HB2    . ALA D 4 61  ? -2.646  -13.144 25.099 1.00 0.26 ? 261 ALA B HB2    1 
ATOM 4259 H HB3    . ALA D 4 61  ? -4.156  -13.674 24.360 1.00 0.28 ? 261 ALA B HB3    1 
ATOM 4260 N N      . LYS D 4 62  ? -3.669  -16.383 25.456 1.00 0.29 ? 262 LYS B N      1 
ATOM 4261 C CA     . LYS D 4 62  ? -3.798  -17.245 26.618 1.00 0.30 ? 262 LYS B CA     1 
ATOM 4262 C C      . LYS D 4 62  ? -2.882  -18.454 26.495 1.00 0.30 ? 262 LYS B C      1 
ATOM 4263 O O      . LYS D 4 62  ? -2.218  -18.847 27.434 1.00 0.30 ? 262 LYS B O      1 
ATOM 4264 C CB     . LYS D 4 62  ? -5.249  -17.719 26.767 1.00 0.31 ? 262 LYS B CB     1 
ATOM 4265 C CG     A LYS D 4 62  ? -6.142  -16.536 27.173 0.50 0.32 ? 262 LYS B CG     1 
ATOM 4266 C CG     B LYS D 4 62  ? -6.119  -16.567 27.284 0.50 0.32 ? 262 LYS B CG     1 
ATOM 4267 C CD     A LYS D 4 62  ? -6.019  -16.274 28.679 0.50 1.06 ? 262 LYS B CD     1 
ATOM 4268 C CD     B LYS D 4 62  ? -7.569  -17.036 27.407 0.50 1.06 ? 262 LYS B CD     1 
ATOM 4269 C CE     A LYS D 4 62  ? -7.012  -15.194 29.095 0.50 1.31 ? 262 LYS B CE     1 
ATOM 4270 C CE     B LYS D 4 62  ? -8.458  -15.866 27.852 0.50 1.31 ? 262 LYS B CE     1 
ATOM 4271 N NZ     A LYS D 4 62  ? -6.888  -14.965 30.560 0.50 2.09 ? 262 LYS B NZ     1 
ATOM 4272 N NZ     B LYS D 4 62  ? -8.291  -15.593 29.299 0.50 2.09 ? 262 LYS B NZ     1 
ATOM 4273 H H      . LYS D 4 62  ? -4.433  -16.261 24.851 1.00 0.29 ? 262 LYS B H      1 
ATOM 4274 H HA     . LYS D 4 62  ? -3.537  -16.688 27.504 1.00 0.29 ? 262 LYS B HA     1 
ATOM 4275 H HB2    A LYS D 4 62  ? -5.593  -18.122 25.829 0.50 0.32 ? 262 LYS B HB2    1 
ATOM 4276 H HB2    B LYS D 4 62  ? -5.618  -18.049 25.813 0.50 0.32 ? 262 LYS B HB2    1 
ATOM 4277 H HB3    A LYS D 4 62  ? -5.300  -18.486 27.524 0.50 0.32 ? 262 LYS B HB3    1 
ATOM 4278 H HB3    B LYS D 4 62  ? -5.291  -18.538 27.469 0.50 0.32 ? 262 LYS B HB3    1 
ATOM 4279 H HG2    A LYS D 4 62  ? -5.842  -15.653 26.628 0.50 0.88 ? 262 LYS B HG2    1 
ATOM 4280 H HG2    B LYS D 4 62  ? -5.758  -16.251 28.251 0.50 0.88 ? 262 LYS B HG2    1 
ATOM 4281 H HG3    A LYS D 4 62  ? -7.170  -16.769 26.936 0.50 0.87 ? 262 LYS B HG3    1 
ATOM 4282 H HG3    B LYS D 4 62  ? -6.068  -15.740 26.594 0.50 0.87 ? 262 LYS B HG3    1 
ATOM 4283 H HD2    A LYS D 4 62  ? -6.229  -17.183 29.222 0.50 1.57 ? 262 LYS B HD2    1 
ATOM 4284 H HD2    B LYS D 4 62  ? -7.908  -17.405 26.449 0.50 1.57 ? 262 LYS B HD2    1 
ATOM 4285 H HD3    A LYS D 4 62  ? -5.024  -15.940 28.916 0.50 1.66 ? 262 LYS B HD3    1 
ATOM 4286 H HD3    B LYS D 4 62  ? -7.631  -17.827 28.133 0.50 1.66 ? 262 LYS B HD3    1 
ATOM 4287 H HE2    A LYS D 4 62  ? -6.792  -14.277 28.565 0.50 1.65 ? 262 LYS B HE2    1 
ATOM 4288 H HE2    B LYS D 4 62  ? -8.176  -14.990 27.330 0.50 1.65 ? 262 LYS B HE2    1 
ATOM 4289 H HE3    A LYS D 4 62  ? -8.015  -15.514 28.861 0.50 1.60 ? 262 LYS B HE3    1 
ATOM 4290 H HE3    B LYS D 4 62  ? -9.492  -16.099 27.642 0.50 1.60 ? 262 LYS B HE3    1 
ATOM 4291 H HZ1    A LYS D 4 62  ? -6.943  -13.947 30.759 0.50 2.52 ? 262 LYS B HZ1    1 
ATOM 4292 H HZ1    B LYS D 4 62  ? -8.320  -14.564 29.459 0.50 2.52 ? 262 LYS B HZ1    1 
ATOM 4293 H HZ2    A LYS D 4 62  ? -5.973  -15.336 30.889 0.50 2.55 ? 262 LYS B HZ2    1 
ATOM 4294 H HZ2    B LYS D 4 62  ? -7.375  -15.967 29.620 0.50 2.55 ? 262 LYS B HZ2    1 
ATOM 4295 H HZ3    A LYS D 4 62  ? -7.660  -15.456 31.053 0.50 2.50 ? 262 LYS B HZ3    1 
ATOM 4296 H HZ3    B LYS D 4 62  ? -9.059  -16.044 29.829 0.50 2.50 ? 262 LYS B HZ3    1 
ATOM 4297 N N      . ARG D 4 63  ? -2.801  -19.023 25.302 1.00 0.30 ? 263 ARG B N      1 
ATOM 4298 C CA     . ARG D 4 63  ? -1.902  -20.147 25.084 1.00 0.31 ? 263 ARG B CA     1 
ATOM 4299 C C      . ARG D 4 63  ? -0.445  -19.724 25.189 1.00 0.30 ? 263 ARG B C      1 
ATOM 4300 O O      . ARG D 4 63  ? 0.374   -20.386 25.795 1.00 0.30 ? 263 ARG B O      1 
ATOM 4301 C CB     . ARG D 4 63  ? -2.156  -20.735 23.695 1.00 0.32 ? 263 ARG B CB     1 
ATOM 4302 C CG     . ARG D 4 63  ? -3.577  -21.298 23.631 1.00 0.33 ? 263 ARG B CG     1 
ATOM 4303 C CD     . ARG D 4 63  ? -3.798  -21.975 22.276 1.00 0.34 ? 263 ARG B CD     1 
ATOM 4304 N NE     . ARG D 4 63  ? -5.236  -22.339 22.132 1.00 0.36 ? 263 ARG B NE     1 
ATOM 4305 C CZ     . ARG D 4 63  ? -5.714  -22.649 20.959 1.00 0.37 ? 263 ARG B CZ     1 
ATOM 4306 N NH1    . ARG D 4 63  ? -4.935  -22.644 19.913 1.00 0.37 ? 263 ARG B NH1    1 
ATOM 4307 N NH2    . ARG D 4 63  ? -6.974  -22.966 20.832 1.00 0.38 ? 263 ARG B NH2    1 
ATOM 4308 H H      . ARG D 4 63  ? -3.318  -18.658 24.553 1.00 0.30 ? 263 ARG B H      1 
ATOM 4309 H HA     . ARG D 4 63  ? -2.103  -20.907 25.822 1.00 0.32 ? 263 ARG B HA     1 
ATOM 4310 H HB2    . ARG D 4 63  ? -2.040  -19.961 22.950 1.00 0.31 ? 263 ARG B HB2    1 
ATOM 4311 H HB3    . ARG D 4 63  ? -1.448  -21.528 23.505 1.00 0.32 ? 263 ARG B HB3    1 
ATOM 4312 H HG2    . ARG D 4 63  ? -3.713  -22.022 24.421 1.00 0.34 ? 263 ARG B HG2    1 
ATOM 4313 H HG3    . ARG D 4 63  ? -4.288  -20.495 23.751 1.00 0.33 ? 263 ARG B HG3    1 
ATOM 4314 H HD2    . ARG D 4 63  ? -3.517  -21.296 21.485 1.00 0.34 ? 263 ARG B HD2    1 
ATOM 4315 H HD3    . ARG D 4 63  ? -3.193  -22.868 22.216 1.00 0.35 ? 263 ARG B HD3    1 
ATOM 4316 H HE     . ARG D 4 63  ? -5.822  -22.343 22.918 1.00 0.36 ? 263 ARG B HE     1 
ATOM 4317 H HH11   . ARG D 4 63  ? -3.969  -22.402 20.010 1.00 0.36 ? 263 ARG B HH11   1 
ATOM 4318 H HH12   . ARG D 4 63  ? -5.302  -22.883 19.014 1.00 0.38 ? 263 ARG B HH12   1 
ATOM 4319 H HH21   . ARG D 4 63  ? -7.572  -22.972 21.635 1.00 0.38 ? 263 ARG B HH21   1 
ATOM 4320 H HH22   . ARG D 4 63  ? -7.342  -23.205 19.933 1.00 0.39 ? 263 ARG B HH22   1 
ATOM 4321 N N      . LEU D 4 64  ? -0.132  -18.577 24.633 1.00 0.28 ? 264 LEU B N      1 
ATOM 4322 C CA     . LEU D 4 64  ? 1.258   -18.057 24.740 1.00 0.27 ? 264 LEU B CA     1 
ATOM 4323 C C      . LEU D 4 64  ? 1.564   -17.808 26.214 1.00 0.27 ? 264 LEU B C      1 
ATOM 4324 O O      . LEU D 4 64  ? 2.671   -18.008 26.671 1.00 0.26 ? 264 LEU B O      1 
ATOM 4325 C CB     . LEU D 4 64  ? 1.379   -16.746 23.959 1.00 0.25 ? 264 LEU B CB     1 
ATOM 4326 C CG     . LEU D 4 64  ? 1.071   -16.999 22.483 1.00 0.26 ? 264 LEU B CG     1 
ATOM 4327 C CD1    . LEU D 4 64  ? 0.666   -15.685 21.812 1.00 0.25 ? 264 LEU B CD1    1 
ATOM 4328 C CD2    . LEU D 4 64  ? 2.317   -17.559 21.792 1.00 0.26 ? 264 LEU B CD2    1 
ATOM 4329 H H      . LEU D 4 64  ? -0.823  -18.045 24.185 1.00 0.28 ? 264 LEU B H      1 
ATOM 4330 H HA     . LEU D 4 64  ? 1.950   -18.785 24.342 1.00 0.27 ? 264 LEU B HA     1 
ATOM 4331 H HB2    . LEU D 4 64  ? 0.678   -16.026 24.356 1.00 0.25 ? 264 LEU B HB2    1 
ATOM 4332 H HB3    . LEU D 4 64  ? 2.384   -16.361 24.055 1.00 0.24 ? 264 LEU B HB3    1 
ATOM 4333 H HG     . LEU D 4 64  ? 0.260   -17.710 22.402 1.00 0.27 ? 264 LEU B HG     1 
ATOM 4334 H HD11   . LEU D 4 64  ? 0.925   -15.720 20.765 1.00 0.26 ? 264 LEU B HD11   1 
ATOM 4335 H HD12   . LEU D 4 64  ? 1.186   -14.865 22.285 1.00 0.24 ? 264 LEU B HD12   1 
ATOM 4336 H HD13   . LEU D 4 64  ? -0.399  -15.542 21.917 1.00 0.26 ? 264 LEU B HD13   1 
ATOM 4337 H HD21   . LEU D 4 64  ? 2.125   -17.664 20.735 1.00 0.27 ? 264 LEU B HD21   1 
ATOM 4338 H HD22   . LEU D 4 64  ? 2.560   -18.523 22.212 1.00 0.27 ? 264 LEU B HD22   1 
ATOM 4339 H HD23   . LEU D 4 64  ? 3.145   -16.883 21.942 1.00 0.25 ? 264 LEU B HD23   1 
ATOM 4340 N N      . ARG D 4 65  ? 0.592   -17.365 26.978 1.00 0.27 ? 265 ARG B N      1 
ATOM 4341 C CA     . ARG D 4 65  ? 0.826   -17.132 28.397 1.00 0.27 ? 265 ARG B CA     1 
ATOM 4342 C C      . ARG D 4 65  ? 1.040   -18.438 29.147 1.00 0.29 ? 265 ARG B C      1 
ATOM 4343 O O      . ARG D 4 65  ? 1.913   -18.548 29.987 1.00 0.29 ? 265 ARG B O      1 
ATOM 4344 C CB     . ARG D 4 65  ? -0.400  -16.420 28.996 1.00 0.28 ? 265 ARG B CB     1 
ATOM 4345 C CG     A ARG D 4 65  ? -0.388  -14.953 28.576 0.50 0.27 ? 265 ARG B CG     1 
ATOM 4346 C CG     B ARG D 4 65  ? -0.374  -14.945 28.607 0.50 0.27 ? 265 ARG B CG     1 
ATOM 4347 C CD     A ARG D 4 65  ? -1.688  -14.285 29.005 0.50 0.30 ? 265 ARG B CD     1 
ATOM 4348 C CD     B ARG D 4 65  ? -1.654  -14.253 29.072 0.50 0.30 ? 265 ARG B CD     1 
ATOM 4349 N NE     A ARG D 4 65  ? -1.771  -14.327 30.488 0.50 1.25 ? 265 ARG B NE     1 
ATOM 4350 N NE     B ARG D 4 65  ? -1.654  -12.843 28.582 0.50 1.25 ? 265 ARG B NE     1 
ATOM 4351 C CZ     A ARG D 4 65  ? -2.611  -13.561 31.120 0.50 1.71 ? 265 ARG B CZ     1 
ATOM 4352 C CZ     B ARG D 4 65  ? -2.748  -12.136 28.633 0.50 1.71 ? 265 ARG B CZ     1 
ATOM 4353 N NH1    A ARG D 4 65  ? -3.390  -12.753 30.454 0.50 1.85 ? 265 ARG B NH1    1 
ATOM 4354 N NH1    B ARG D 4 65  ? -2.751  -10.901 28.209 0.50 2.69 ? 265 ARG B NH1    1 
ATOM 4355 N NH2    A ARG D 4 65  ? -2.666  -13.601 32.421 0.50 2.69 ? 265 ARG B NH2    1 
ATOM 4356 N NH2    B ARG D 4 65  ? -3.839  -12.664 29.112 0.50 1.85 ? 265 ARG B NH2    1 
ATOM 4357 H H      . ARG D 4 65  ? -0.296  -17.202 26.597 1.00 0.27 ? 265 ARG B H      1 
ATOM 4358 H HA     . ARG D 4 65  ? 1.697   -16.505 28.516 1.00 0.26 ? 265 ARG B HA     1 
ATOM 4359 H HB2    A ARG D 4 65  ? -1.302  -16.892 28.638 0.50 0.29 ? 265 ARG B HB2    1 
ATOM 4360 H HB2    B ARG D 4 65  ? -1.302  -16.877 28.618 0.50 0.29 ? 265 ARG B HB2    1 
ATOM 4361 H HB3    A ARG D 4 65  ? -0.364  -16.480 30.075 0.50 0.28 ? 265 ARG B HB3    1 
ATOM 4362 H HB3    B ARG D 4 65  ? -0.378  -16.502 30.074 0.50 0.28 ? 265 ARG B HB3    1 
ATOM 4363 H HG2    A ARG D 4 65  ? 0.434   -14.464 29.061 0.50 0.26 ? 265 ARG B HG2    1 
ATOM 4364 H HG2    B ARG D 4 65  ? 0.465   -14.481 29.082 0.50 0.26 ? 265 ARG B HG2    1 
ATOM 4365 H HG3    A ARG D 4 65  ? -0.276  -14.879 27.507 0.50 0.27 ? 265 ARG B HG3    1 
ATOM 4366 H HG3    B ARG D 4 65  ? -0.283  -14.853 27.537 0.50 0.27 ? 265 ARG B HG3    1 
ATOM 4367 H HD2    A ARG D 4 65  ? -1.696  -13.257 28.666 0.50 0.98 ? 265 ARG B HD2    1 
ATOM 4368 H HD2    B ARG D 4 65  ? -2.511  -14.771 28.674 0.50 0.98 ? 265 ARG B HD2    1 
ATOM 4369 H HD3    A ARG D 4 65  ? -2.528  -14.815 28.582 0.50 0.93 ? 265 ARG B HD3    1 
ATOM 4370 H HD3    B ARG D 4 65  ? -1.696  -14.263 30.152 0.50 0.93 ? 265 ARG B HD3    1 
ATOM 4371 H HE     A ARG D 4 65  ? -1.187  -14.930 30.991 0.50 1.99 ? 265 ARG B HE     1 
ATOM 4372 H HE     B ARG D 4 65  ? -0.831  -12.449 28.223 0.50 1.99 ? 265 ARG B HE     1 
ATOM 4373 H HH11   A ARG D 4 65  ? -3.342  -12.722 29.456 0.50 1.77 ? 265 ARG B HH11   1 
ATOM 4374 H HH11   B ARG D 4 65  ? -1.914  -10.495 27.843 0.50 3.20 ? 265 ARG B HH11   1 
ATOM 4375 H HH12   A ARG D 4 65  ? -4.034  -12.166 30.942 0.50 2.51 ? 265 ARG B HH12   1 
ATOM 4376 H HH12   B ARG D 4 65  ? -3.592  -10.361 28.251 0.50 3.11 ? 265 ARG B HH12   1 
ATOM 4377 H HH21   A ARG D 4 65  ? -2.063  -14.219 32.927 0.50 3.20 ? 265 ARG B HH21   1 
ATOM 4378 H HH21   B ARG D 4 65  ? -3.835  -13.610 29.439 0.50 1.77 ? 265 ARG B HH21   1 
ATOM 4379 H HH22   A ARG D 4 65  ? -3.308  -13.015 32.914 0.50 3.11 ? 265 ARG B HH22   1 
ATOM 4380 H HH22   B ARG D 4 65  ? -4.680  -12.125 29.154 0.50 2.51 ? 265 ARG B HH22   1 
ATOM 4381 N N      . ALA D 4 66  ? 0.262   -19.446 28.831 1.00 0.30 ? 266 ALA B N      1 
ATOM 4382 C CA     . ALA D 4 66  ? 0.446   -20.760 29.512 1.00 0.31 ? 266 ALA B CA     1 
ATOM 4383 C C      . ALA D 4 66  ? 1.773   -21.371 29.056 1.00 0.31 ? 266 ALA B C      1 
ATOM 4384 O O      . ALA D 4 66  ? 2.546   -21.870 29.850 1.00 0.32 ? 266 ALA B O      1 
ATOM 4385 C CB     . ALA D 4 66  ? -0.705  -21.696 29.140 1.00 0.33 ? 266 ALA B CB     1 
ATOM 4386 H H      . ALA D 4 66  ? -0.423  -19.344 28.138 1.00 0.30 ? 266 ALA B H      1 
ATOM 4387 H HA     . ALA D 4 66  ? 0.463   -20.613 30.583 1.00 0.32 ? 266 ALA B HA     1 
ATOM 4388 H HB1    . ALA D 4 66  ? -0.779  -21.766 28.064 1.00 0.33 ? 266 ALA B HB1    1 
ATOM 4389 H HB2    . ALA D 4 66  ? -1.630  -21.307 29.539 1.00 0.33 ? 266 ALA B HB2    1 
ATOM 4390 H HB3    . ALA D 4 66  ? -0.520  -22.677 29.552 1.00 0.34 ? 266 ALA B HB3    1 
ATOM 4391 N N      . LEU D 4 67  ? 2.033   -21.342 27.769 1.00 0.31 ? 267 LEU B N      1 
ATOM 4392 C CA     . LEU D 4 67  ? 3.314   -21.875 27.293 1.00 0.31 ? 267 LEU B CA     1 
ATOM 4393 C C      . LEU D 4 67  ? 4.498   -21.061 27.826 1.00 0.30 ? 267 LEU B C      1 
ATOM 4394 O O      . LEU D 4 67  ? 5.531   -21.584 28.194 1.00 0.31 ? 267 LEU B O      1 
ATOM 4395 C CB     . LEU D 4 67  ? 3.332   -21.846 25.763 1.00 0.31 ? 267 LEU B CB     1 
ATOM 4396 C CG     . LEU D 4 67  ? 4.603   -22.525 25.252 1.00 0.32 ? 267 LEU B CG     1 
ATOM 4397 C CD1    . LEU D 4 67  ? 4.476   -24.040 25.422 1.00 0.34 ? 267 LEU B CD1    1 
ATOM 4398 C CD2    . LEU D 4 67  ? 4.797   -22.194 23.771 1.00 0.31 ? 267 LEU B CD2    1 
ATOM 4399 H H      . LEU D 4 67  ? 1.397   -20.943 27.141 1.00 0.30 ? 267 LEU B H      1 
ATOM 4400 H HA     . LEU D 4 67  ? 3.414   -22.897 27.620 1.00 0.33 ? 267 LEU B HA     1 
ATOM 4401 H HB2    . LEU D 4 67  ? 2.466   -22.369 25.384 1.00 0.32 ? 267 LEU B HB2    1 
ATOM 4402 H HB3    . LEU D 4 67  ? 3.311   -20.822 25.421 1.00 0.29 ? 267 LEU B HB3    1 
ATOM 4403 H HG     . LEU D 4 67  ? 5.452   -22.170 25.818 1.00 0.31 ? 267 LEU B HG     1 
ATOM 4404 H HD11   . LEU D 4 67  ? 3.439   -24.327 25.330 1.00 0.35 ? 267 LEU B HD11   1 
ATOM 4405 H HD12   . LEU D 4 67  ? 4.844   -24.325 26.396 1.00 0.34 ? 267 LEU B HD12   1 
ATOM 4406 H HD13   . LEU D 4 67  ? 5.056   -24.538 24.658 1.00 0.35 ? 267 LEU B HD13   1 
ATOM 4407 H HD21   . LEU D 4 67  ? 4.011   -22.656 23.192 1.00 0.32 ? 267 LEU B HD21   1 
ATOM 4408 H HD22   . LEU D 4 67  ? 5.755   -22.569 23.441 1.00 0.32 ? 267 LEU B HD22   1 
ATOM 4409 H HD23   . LEU D 4 67  ? 4.762   -21.123 23.634 1.00 0.30 ? 267 LEU B HD23   1 
ATOM 4410 N N      . HIS D 4 68  ? 4.295   -19.766 27.917 1.00 0.28 ? 268 HIS B N      1 
ATOM 4411 C CA     . HIS D 4 68  ? 5.364   -18.907 28.488 1.00 0.27 ? 268 HIS B CA     1 
ATOM 4412 C C      . HIS D 4 68  ? 5.577   -19.323 29.946 1.00 0.29 ? 268 HIS B C      1 
ATOM 4413 O O      . HIS D 4 68  ? 6.688   -19.372 30.437 1.00 0.29 ? 268 HIS B O      1 
ATOM 4414 C CB     . HIS D 4 68  ? 4.934   -17.442 28.428 1.00 0.26 ? 268 HIS B CB     1 
ATOM 4415 C CG     . HIS D 4 68  ? 6.044   -16.570 28.944 1.00 0.25 ? 268 HIS B CG     1 
ATOM 4416 N ND1    . HIS D 4 68  ? 7.211   -16.353 28.224 1.00 0.24 ? 268 HIS B ND1    1 
ATOM 4417 C CD2    . HIS D 4 68  ? 6.183   -15.852 30.108 1.00 0.25 ? 268 HIS B CD2    1 
ATOM 4418 C CE1    . HIS D 4 68  ? 7.993   -15.537 28.954 1.00 0.23 ? 268 HIS B CE1    1 
ATOM 4419 N NE2    . HIS D 4 68  ? 7.412   -15.203 30.107 1.00 0.24 ? 268 HIS B NE2    1 
ATOM 4420 H H      . HIS D 4 68  ? 3.434   -19.379 27.652 1.00 0.28 ? 268 HIS B H      1 
ATOM 4421 H HA     . HIS D 4 68  ? 6.280   -19.044 27.932 1.00 0.27 ? 268 HIS B HA     1 
ATOM 4422 H HB2    . HIS D 4 68  ? 4.711   -17.173 27.405 1.00 0.25 ? 268 HIS B HB2    1 
ATOM 4423 H HB3    . HIS D 4 68  ? 4.054   -17.299 29.037 1.00 0.26 ? 268 HIS B HB3    1 
ATOM 4424 H HD1    . HIS D 4 68  ? 7.425   -16.725 27.343 1.00 0.24 ? 268 HIS B HD1    1 
ATOM 4425 H HD2    . HIS D 4 68  ? 5.449   -15.800 30.899 1.00 0.26 ? 268 HIS B HD2    1 
ATOM 4426 H HE1    . HIS D 4 68  ? 8.968   -15.192 28.643 1.00 0.23 ? 268 HIS B HE1    1 
ATOM 4427 H HE2    . HIS D 4 68  ? 7.776   -14.624 30.810 1.00 0.24 ? 268 HIS B HE2    1 
ATOM 4428 N N      . MET D 4 69  ? 4.506   -19.621 30.652 1.00 0.30 ? 269 MET B N      1 
ATOM 4429 C CA     . MET D 4 69  ? 4.620   -20.039 32.043 1.00 0.31 ? 269 MET B CA     1 
ATOM 4430 C C      . MET D 4 69  ? 5.307   -21.395 32.156 1.00 0.33 ? 269 MET B C      1 
ATOM 4431 O O      . MET D 4 69  ? 5.943   -21.697 33.145 1.00 0.34 ? 269 MET B O      1 
ATOM 4432 C CB     . MET D 4 69  ? 3.233   -20.134 32.640 1.00 0.33 ? 269 MET B CB     1 
ATOM 4433 C CG     . MET D 4 69  ? 3.326   -20.563 34.100 1.00 0.37 ? 269 MET B CG     1 
ATOM 4434 S SD     . MET D 4 69  ? 1.693   -21.060 34.626 1.00 0.53 ? 269 MET B SD     1 
ATOM 4435 C CE     . MET D 4 69  ? 1.046   -19.427 34.968 1.00 1.09 ? 269 MET B CE     1 
ATOM 4436 H H      . MET D 4 69  ? 3.620   -19.570 30.234 1.00 0.29 ? 269 MET B H      1 
ATOM 4437 H HA     . MET D 4 69  ? 5.201   -19.307 32.583 1.00 0.31 ? 269 MET B HA     1 
ATOM 4438 H HB2    . MET D 4 69  ? 2.752   -19.168 32.578 1.00 0.31 ? 269 MET B HB2    1 
ATOM 4439 H HB3    . MET D 4 69  ? 2.654   -20.860 32.090 1.00 0.34 ? 269 MET B HB3    1 
ATOM 4440 H HG2    . MET D 4 69  ? 3.998   -21.390 34.221 1.00 0.42 ? 269 MET B HG2    1 
ATOM 4441 H HG3    . MET D 4 69  ? 3.667   -19.736 34.698 1.00 0.32 ? 269 MET B HG3    1 
ATOM 4442 H HE1    . MET D 4 69  ? 0.150   -19.530 35.554 1.00 1.67 ? 269 MET B HE1    1 
ATOM 4443 H HE2    . MET D 4 69  ? 0.833   -18.935 34.038 1.00 1.73 ? 269 MET B HE2    1 
ATOM 4444 H HE3    . MET D 4 69  ? 1.771   -18.852 35.518 1.00 1.71 ? 269 MET B HE3    1 
ATOM 4445 N N      . LYS D 4 70  ? 5.195   -22.218 31.137 1.00 0.33 ? 270 LYS B N      1 
ATOM 4446 C CA     . LYS D 4 70  ? 5.847   -23.513 31.201 1.00 0.35 ? 270 LYS B CA     1 
ATOM 4447 C C      . LYS D 4 70  ? 7.357   -23.366 31.077 1.00 0.35 ? 270 LYS B C      1 
ATOM 4448 O O      . LYS D 4 70  ? 8.120   -24.055 31.723 1.00 0.36 ? 270 LYS B O      1 
ATOM 4449 C CB     . LYS D 4 70  ? 5.268   -24.396 30.081 1.00 0.36 ? 270 LYS B CB     1 
ATOM 4450 C CG     . LYS D 4 70  ? 5.313   -25.873 30.505 1.00 1.11 ? 270 LYS B CG     1 
ATOM 4451 C CD     . LYS D 4 70  ? 4.576   -26.731 29.480 1.00 1.43 ? 270 LYS B CD     1 
ATOM 4452 C CE     . LYS D 4 70  ? 4.462   -28.156 30.020 1.00 2.15 ? 270 LYS B CE     1 
ATOM 4453 N NZ     . LYS D 4 70  ? 3.945   -29.054 28.953 1.00 2.64 ? 270 LYS B NZ     1 
ATOM 4454 H H      . LYS D 4 70  ? 4.687   -21.956 30.341 1.00 0.32 ? 270 LYS B H      1 
ATOM 4455 H HA     . LYS D 4 70  ? 5.613   -23.980 32.145 1.00 0.36 ? 270 LYS B HA     1 
ATOM 4456 H HB2    . LYS D 4 70  ? 4.243   -24.109 29.895 1.00 0.87 ? 270 LYS B HB2    1 
ATOM 4457 H HB3    . LYS D 4 70  ? 5.846   -24.265 29.178 1.00 0.86 ? 270 LYS B HB3    1 
ATOM 4458 H HG2    . LYS D 4 70  ? 6.342   -26.194 30.566 1.00 1.80 ? 270 LYS B HG2    1 
ATOM 4459 H HG3    . LYS D 4 70  ? 4.842   -25.992 31.469 1.00 1.72 ? 270 LYS B HG3    1 
ATOM 4460 H HD2    . LYS D 4 70  ? 3.586   -26.325 29.318 1.00 1.74 ? 270 LYS B HD2    1 
ATOM 4461 H HD3    . LYS D 4 70  ? 5.120   -26.741 28.550 1.00 1.90 ? 270 LYS B HD3    1 
ATOM 4462 H HE2    . LYS D 4 70  ? 5.427   -28.499 30.355 1.00 2.72 ? 270 LYS B HE2    1 
ATOM 4463 H HE3    . LYS D 4 70  ? 3.770   -28.162 30.854 1.00 2.53 ? 270 LYS B HE3    1 
ATOM 4464 H HZ1    . LYS D 4 70  ? 3.950   -28.550 28.045 1.00 3.01 ? 270 LYS B HZ1    1 
ATOM 4465 H HZ2    . LYS D 4 70  ? 2.974   -29.348 29.184 1.00 2.99 ? 270 LYS B HZ2    1 
ATOM 4466 H HZ3    . LYS D 4 70  ? 4.555   -29.892 28.885 1.00 2.97 ? 270 LYS B HZ3    1 
ATOM 4467 N N      . GLU D 4 71  ? 7.786   -22.414 30.282 1.00 0.33 ? 271 GLU B N      1 
ATOM 4468 C CA     . GLU D 4 71  ? 9.220   -22.175 30.166 1.00 0.33 ? 271 GLU B CA     1 
ATOM 4469 C C      . GLU D 4 71  ? 9.788   -21.598 31.458 1.00 0.33 ? 271 GLU B C      1 
ATOM 4470 O O      . GLU D 4 71  ? 10.833  -22.001 31.924 1.00 0.34 ? 271 GLU B O      1 
ATOM 4471 C CB     . GLU D 4 71  ? 9.479   -21.195 29.021 1.00 0.31 ? 271 GLU B CB     1 
ATOM 4472 C CG     . GLU D 4 71  ? 9.056   -21.833 27.696 1.00 0.31 ? 271 GLU B CG     1 
ATOM 4473 C CD     . GLU D 4 71  ? 9.370   -20.876 26.545 1.00 0.29 ? 271 GLU B CD     1 
ATOM 4474 O OE1    . GLU D 4 71  ? 9.725   -19.742 26.823 1.00 0.28 ? 271 GLU B OE1    1 
ATOM 4475 O OE2    . GLU D 4 71  ? 9.253   -21.294 25.404 1.00 0.30 ? 271 GLU B OE2    1 
ATOM 4476 H H      . GLU D 4 71  ? 7.151   -21.842 29.805 1.00 0.32 ? 271 GLU B H      1 
ATOM 4477 H HA     . GLU D 4 71  ? 9.717   -23.106 29.946 1.00 0.34 ? 271 GLU B HA     1 
ATOM 4478 H HB2    . GLU D 4 71  ? 8.908   -20.291 29.185 1.00 0.29 ? 271 GLU B HB2    1 
ATOM 4479 H HB3    . GLU D 4 71  ? 10.531  -20.956 28.983 1.00 0.31 ? 271 GLU B HB3    1 
ATOM 4480 H HG2    . GLU D 4 71  ? 9.595   -22.758 27.554 1.00 0.33 ? 271 GLU B HG2    1 
ATOM 4481 H HG3    . GLU D 4 71  ? 7.996   -22.033 27.715 1.00 0.31 ? 271 GLU B HG3    1 
ATOM 4482 N N      . HIS D 4 72  ? 9.067   -20.671 32.076 1.00 0.32 ? 272 HIS B N      1 
ATOM 4483 C CA     . HIS D 4 72  ? 9.511   -20.104 33.345 1.00 0.32 ? 272 HIS B CA     1 
ATOM 4484 C C      . HIS D 4 72  ? 8.395   -20.168 34.379 1.00 0.33 ? 272 HIS B C      1 
ATOM 4485 O O      . HIS D 4 72  ? 7.721   -19.191 34.636 1.00 0.32 ? 272 HIS B O      1 
ATOM 4486 C CB     . HIS D 4 72  ? 9.912   -18.644 33.138 1.00 0.30 ? 272 HIS B CB     1 
ATOM 4487 C CG     . HIS D 4 72  ? 11.034  -18.565 32.144 1.00 0.29 ? 272 HIS B CG     1 
ATOM 4488 N ND1    . HIS D 4 72  ? 12.315  -19.010 32.436 1.00 0.31 ? 272 HIS B ND1    1 
ATOM 4489 C CD2    . HIS D 4 72  ? 11.083  -18.093 30.856 1.00 0.28 ? 272 HIS B CD2    1 
ATOM 4490 C CE1    . HIS D 4 72  ? 13.075  -18.801 31.347 1.00 0.30 ? 272 HIS B CE1    1 
ATOM 4491 N NE2    . HIS D 4 72  ? 12.372  -18.243 30.359 1.00 0.28 ? 272 HIS B NE2    1 
ATOM 4492 H H      . HIS D 4 72  ? 8.210   -20.391 31.693 1.00 0.31 ? 272 HIS B H      1 
ATOM 4493 H HA     . HIS D 4 72  ? 10.364  -20.657 33.705 1.00 0.33 ? 272 HIS B HA     1 
ATOM 4494 H HB2    . HIS D 4 72  ? 9.064   -18.084 32.768 1.00 0.29 ? 272 HIS B HB2    1 
ATOM 4495 H HB3    . HIS D 4 72  ? 10.236  -18.223 34.079 1.00 0.31 ? 272 HIS B HB3    1 
ATOM 4496 H HD1    . HIS D 4 72  ? 12.613  -19.401 33.285 1.00 0.32 ? 272 HIS B HD1    1 
ATOM 4497 H HD2    . HIS D 4 72  ? 10.252  -17.660 30.318 1.00 0.27 ? 272 HIS B HD2    1 
ATOM 4498 H HE1    . HIS D 4 72  ? 14.124  -19.046 31.281 1.00 0.30 ? 272 HIS B HE1    1 
ATOM 4499 H HE2    . HIS D 4 72  ? 12.696  -17.990 29.471 1.00 0.27 ? 272 HIS B HE2    1 
ATOM 4500 N N      . PRO D 4 73  ? 8.173   -21.327 34.953 1.00 0.35 ? 273 PRO B N      1 
ATOM 4501 C CA     . PRO D 4 73  ? 7.091   -21.546 35.957 1.00 0.36 ? 273 PRO B CA     1 
ATOM 4502 C C      . PRO D 4 73  ? 7.264   -20.685 37.218 1.00 0.37 ? 273 PRO B C      1 
ATOM 4503 O O      . PRO D 4 73  ? 6.345   -20.523 37.998 1.00 0.37 ? 273 PRO B O      1 
ATOM 4504 C CB     . PRO D 4 73  ? 7.191   -23.035 36.310 1.00 0.38 ? 273 PRO B CB     1 
ATOM 4505 C CG     . PRO D 4 73  ? 8.030   -23.656 35.240 1.00 0.38 ? 273 PRO B CG     1 
ATOM 4506 C CD     . PRO D 4 73  ? 8.936   -22.554 34.700 1.00 0.36 ? 273 PRO B CD     1 
ATOM 4507 H HA     . PRO D 4 73  ? 6.129   -21.353 35.510 1.00 0.35 ? 273 PRO B HA     1 
ATOM 4508 H HB2    . PRO D 4 73  ? 7.661   -23.159 37.275 1.00 0.39 ? 273 PRO B HB2    1 
ATOM 4509 H HB3    . PRO D 4 73  ? 6.210   -23.485 36.313 1.00 0.39 ? 273 PRO B HB3    1 
ATOM 4510 H HG2    . PRO D 4 73  ? 8.623   -24.459 35.657 1.00 0.40 ? 273 PRO B HG2    1 
ATOM 4511 H HG3    . PRO D 4 73  ? 7.403   -24.031 34.447 1.00 0.38 ? 273 PRO B HG3    1 
ATOM 4512 H HD2    . PRO D 4 73  ? 9.876   -22.540 35.236 1.00 0.37 ? 273 PRO B HD2    1 
ATOM 4513 H HD3    . PRO D 4 73  ? 9.100   -22.680 33.641 1.00 0.36 ? 273 PRO B HD3    1 
ATOM 4514 N N      . ASP D 4 74  ? 8.438   -20.123 37.457 1.00 0.36 ? 274 ASP B N      1 
ATOM 4515 C CA     . ASP D 4 74  ? 8.650   -19.317 38.618 1.00 0.37 ? 274 ASP B CA     1 
ATOM 4516 C C      . ASP D 4 74  ? 8.731   -17.847 38.271 1.00 0.35 ? 274 ASP B C      1 
ATOM 4517 O O      . ASP D 4 74  ? 9.028   -17.014 39.104 1.00 0.36 ? 274 ASP B O      1 
ATOM 4518 C CB     . ASP D 4 74  ? 9.950   -19.746 39.298 1.00 0.38 ? 274 ASP B CB     1 
ATOM 4519 C CG     . ASP D 4 74  ? 9.807   -21.177 39.818 1.00 0.40 ? 274 ASP B CG     1 
ATOM 4520 O OD1    . ASP D 4 74  ? 8.686   -21.585 40.072 1.00 1.11 ? 274 ASP B OD1    1 
ATOM 4521 O OD2    . ASP D 4 74  ? 10.822  -21.841 39.954 1.00 1.12 ? 274 ASP B OD2    1 
ATOM 4522 H H      . ASP D 4 74  ? 9.175   -20.264 36.830 1.00 0.36 ? 274 ASP B H      1 
ATOM 4523 H HA     . ASP D 4 74  ? 7.835   -19.471 39.306 1.00 0.38 ? 274 ASP B HA     1 
ATOM 4524 H HB2    . ASP D 4 74  ? 10.761  -19.700 38.586 1.00 0.38 ? 274 ASP B HB2    1 
ATOM 4525 H HB3    . ASP D 4 74  ? 10.160  -19.084 40.125 1.00 0.39 ? 274 ASP B HB3    1 
ATOM 4526 N N      . TYR D 4 75  ? 8.472   -17.507 37.032 1.00 0.33 ? 275 TYR B N      1 
ATOM 4527 C CA     . TYR D 4 75  ? 8.534   -16.084 36.608 1.00 0.32 ? 275 TYR B CA     1 
ATOM 4528 C C      . TYR D 4 75  ? 7.476   -15.251 37.337 1.00 0.32 ? 275 TYR B C      1 
ATOM 4529 O O      . TYR D 4 75  ? 6.357   -15.679 37.542 1.00 0.33 ? 275 TYR B O      1 
ATOM 4530 C CB     . TYR D 4 75  ? 8.296   -15.987 35.102 1.00 0.30 ? 275 TYR B CB     1 
ATOM 4531 C CG     . TYR D 4 75  ? 8.300   -14.534 34.684 1.00 0.28 ? 275 TYR B CG     1 
ATOM 4532 C CD1    . TYR D 4 75  ? 9.511   -13.884 34.420 1.00 0.28 ? 275 TYR B CD1    1 
ATOM 4533 C CD2    . TYR D 4 75  ? 7.091   -13.836 34.568 1.00 0.28 ? 275 TYR B CD2    1 
ATOM 4534 C CE1    . TYR D 4 75  ? 9.514   -12.535 34.038 1.00 0.26 ? 275 TYR B CE1    1 
ATOM 4535 C CE2    . TYR D 4 75  ? 7.094   -12.489 34.185 1.00 0.27 ? 275 TYR B CE2    1 
ATOM 4536 C CZ     . TYR D 4 75  ? 8.306   -11.839 33.920 1.00 0.26 ? 275 TYR B CZ     1 
ATOM 4537 O OH     . TYR D 4 75  ? 8.310   -10.510 33.544 1.00 0.25 ? 275 TYR B OH     1 
ATOM 4538 H H      . TYR D 4 75  ? 8.238   -18.197 36.376 1.00 0.33 ? 275 TYR B H      1 
ATOM 4539 H HA     . TYR D 4 75  ? 9.513   -15.690 36.836 1.00 0.32 ? 275 TYR B HA     1 
ATOM 4540 H HB2    . TYR D 4 75  ? 9.081   -16.515 34.578 1.00 0.30 ? 275 TYR B HB2    1 
ATOM 4541 H HB3    . TYR D 4 75  ? 7.341   -16.430 34.858 1.00 0.30 ? 275 TYR B HB3    1 
ATOM 4542 H HD1    . TYR D 4 75  ? 10.444  -14.421 34.510 1.00 0.28 ? 275 TYR B HD1    1 
ATOM 4543 H HD2    . TYR D 4 75  ? 6.156   -14.336 34.771 1.00 0.29 ? 275 TYR B HD2    1 
ATOM 4544 H HE1    . TYR D 4 75  ? 10.449  -12.034 33.835 1.00 0.26 ? 275 TYR B HE1    1 
ATOM 4545 H HE2    . TYR D 4 75  ? 6.162   -11.950 34.095 1.00 0.27 ? 275 TYR B HE2    1 
ATOM 4546 H HH     . TYR D 4 75  ? 8.579   -10.463 32.625 1.00 0.24 ? 275 TYR B HH     1 
ATOM 4547 N N      . LYS D 4 76  ? 7.829   -14.055 37.703 1.00 0.32 ? 276 LYS B N      1 
ATOM 4548 C CA     . LYS D 4 76  ? 6.857   -13.157 38.391 1.00 0.33 ? 276 LYS B CA     1 
ATOM 4549 C C      . LYS D 4 76  ? 6.914   -11.770 37.762 1.00 0.32 ? 276 LYS B C      1 
ATOM 4550 O O      . LYS D 4 76  ? 7.975   -11.249 37.479 1.00 0.31 ? 276 LYS B O      1 
ATOM 4551 C CB     . LYS D 4 76  ? 7.202   -13.063 39.874 1.00 0.35 ? 276 LYS B CB     1 
ATOM 4552 C CG     A LYS D 4 76  ? 6.898   -14.395 40.560 0.33 0.37 ? 276 LYS B CG     1 
ATOM 4553 C CG     B LYS D 4 76  ? 7.019   -14.448 40.539 0.33 0.37 ? 276 LYS B CG     1 
ATOM 4554 C CG     C LYS D 4 76  ? 6.844   -14.370 40.583 0.33 0.37 ? 276 LYS B CG     1 
ATOM 4555 C CD     A LYS D 4 76  ? 7.190   -14.273 42.056 0.33 1.16 ? 276 LYS B CD     1 
ATOM 4556 C CD     B LYS D 4 76  ? 5.547   -14.904 40.479 0.33 1.16 ? 276 LYS B CD     1 
ATOM 4557 C CD     C LYS D 4 76  ? 7.255   -14.281 42.058 0.33 1.16 ? 276 LYS B CD     1 
ATOM 4558 C CE     A LYS D 4 76  ? 6.888   -15.605 42.746 0.33 1.42 ? 276 LYS B CE     1 
ATOM 4559 C CE     B LYS D 4 76  ? 5.417   -16.337 40.991 0.33 1.42 ? 276 LYS B CE     1 
ATOM 4560 C CE     C LYS D 4 76  ? 6.288   -13.367 42.822 0.33 1.42 ? 276 LYS B CE     1 
ATOM 4561 N NZ     A LYS D 4 76  ? 7.200   -15.495 44.200 0.33 2.23 ? 276 LYS B NZ     1 
ATOM 4562 N NZ     B LYS D 4 76  ? 4.020   -16.798 40.752 0.33 2.23 ? 276 LYS B NZ     1 
ATOM 4563 N NZ     C LYS D 4 76  ? 6.574   -13.447 44.282 0.33 2.23 ? 276 LYS B NZ     1 
ATOM 4564 H H      . LYS D 4 76  ? 8.733   -13.732 37.505 1.00 0.32 ? 276 LYS B H      1 
ATOM 4565 H HA     . LYS D 4 76  ? 5.859   -13.560 38.285 1.00 0.33 ? 276 LYS B HA     1 
ATOM 4566 H HB2    A LYS D 4 76  ? 8.252   -12.833 39.983 0.33 0.37 ? 276 LYS B HB2    1 
ATOM 4567 H HB2    B LYS D 4 76  ? 8.230   -12.745 39.982 0.33 0.37 ? 276 LYS B HB2    1 
ATOM 4568 H HB2    C LYS D 4 76  ? 8.260   -12.872 39.983 0.33 0.37 ? 276 LYS B HB2    1 
ATOM 4569 H HB3    A LYS D 4 76  ? 6.614   -12.282 40.331 0.33 0.36 ? 276 LYS B HB3    1 
ATOM 4570 H HB3    B LYS D 4 76  ? 6.551   -12.347 40.351 0.33 0.36 ? 276 LYS B HB3    1 
ATOM 4571 H HB3    C LYS D 4 76  ? 6.645   -12.252 40.306 0.33 0.36 ? 276 LYS B HB3    1 
ATOM 4572 H HG2    A LYS D 4 76  ? 5.858   -14.647 40.413 0.33 0.87 ? 276 LYS B HG2    1 
ATOM 4573 H HG2    B LYS D 4 76  ? 7.637   -15.171 40.030 0.33 0.87 ? 276 LYS B HG2    1 
ATOM 4574 H HG2    C LYS D 4 76  ? 5.780   -14.539 40.511 0.33 0.87 ? 276 LYS B HG2    1 
ATOM 4575 H HG3    A LYS D 4 76  ? 7.520   -15.169 40.135 0.33 0.98 ? 276 LYS B HG3    1 
ATOM 4576 H HG3    B LYS D 4 76  ? 7.325   -14.385 41.573 0.33 0.98 ? 276 LYS B HG3    1 
ATOM 4577 H HG3    C LYS D 4 76  ? 7.371   -15.188 40.114 0.33 0.98 ? 276 LYS B HG3    1 
ATOM 4578 H HD2    A LYS D 4 76  ? 8.231   -14.020 42.200 0.33 1.75 ? 276 LYS B HD2    1 
ATOM 4579 H HD2    B LYS D 4 76  ? 4.942   -14.250 41.084 0.33 1.75 ? 276 LYS B HD2    1 
ATOM 4580 H HD2    C LYS D 4 76  ? 7.234   -15.270 42.494 0.33 1.75 ? 276 LYS B HD2    1 
ATOM 4581 H HD3    A LYS D 4 76  ? 6.569   -13.500 42.483 0.33 1.97 ? 276 LYS B HD3    1 
ATOM 4582 H HD3    B LYS D 4 76  ? 5.189   -14.882 39.472 0.33 1.97 ? 276 LYS B HD3    1 
ATOM 4583 H HD3    C LYS D 4 76  ? 8.256   -13.881 42.128 0.33 1.97 ? 276 LYS B HD3    1 
ATOM 4584 H HE2    A LYS D 4 76  ? 5.844   -15.846 42.620 0.33 2.06 ? 276 LYS B HE2    1 
ATOM 4585 H HE2    B LYS D 4 76  ? 6.105   -16.979 40.457 0.33 2.06 ? 276 LYS B HE2    1 
ATOM 4586 H HE2    C LYS D 4 76  ? 6.414   -12.348 42.499 0.33 2.06 ? 276 LYS B HE2    1 
ATOM 4587 H HE3    A LYS D 4 76  ? 7.494   -16.383 42.306 0.33 1.50 ? 276 LYS B HE3    1 
ATOM 4588 H HE3    B LYS D 4 76  ? 5.634   -16.369 42.046 0.33 1.50 ? 276 LYS B HE3    1 
ATOM 4589 H HE3    C LYS D 4 76  ? 5.272   -13.682 42.636 0.33 1.50 ? 276 LYS B HE3    1 
ATOM 4590 H HZ1    A LYS D 4 76  ? 8.010   -14.857 44.334 0.33 2.64 ? 276 LYS B HZ1    1 
ATOM 4591 H HZ1    B LYS D 4 76  ? 3.368   -15.998 40.878 0.33 2.64 ? 276 LYS B HZ1    1 
ATOM 4592 H HZ1    C LYS D 4 76  ? 6.830   -14.422 44.533 0.33 2.64 ? 276 LYS B HZ1    1 
ATOM 4593 H HZ2    A LYS D 4 76  ? 7.434   -16.437 44.575 0.33 2.68 ? 276 LYS B HZ2    1 
ATOM 4594 H HZ2    B LYS D 4 76  ? 3.781   -17.552 41.428 0.33 2.68 ? 276 LYS B HZ2    1 
ATOM 4595 H HZ2    C LYS D 4 76  ? 5.729   -13.160 44.816 0.33 2.68 ? 276 LYS B HZ2    1 
ATOM 4596 H HZ3    A LYS D 4 76  ? 6.375   -15.115 44.704 0.33 2.65 ? 276 LYS B HZ3    1 
ATOM 4597 H HZ3    B LYS D 4 76  ? 3.934   -17.161 39.781 0.33 2.65 ? 276 LYS B HZ3    1 
ATOM 4598 H HZ3    C LYS D 4 76  ? 7.364   -12.812 44.515 0.33 2.65 ? 276 LYS B HZ3    1 
ATOM 4599 N N      . TYR D 4 77  ? 5.783   -11.143 37.583 1.00 0.32 ? 277 TYR B N      1 
ATOM 4600 C CA     . TYR D 4 77  ? 5.787   -9.770  37.025 1.00 0.31 ? 277 TYR B CA     1 
ATOM 4601 C C      . TYR D 4 77  ? 6.163   -8.820  38.158 1.00 0.33 ? 277 TYR B C      1 
ATOM 4602 O O      . TYR D 4 77  ? 5.477   -8.732  39.157 1.00 0.35 ? 277 TYR B O      1 
ATOM 4603 C CB     . TYR D 4 77  ? 4.392   -9.429  36.497 1.00 0.31 ? 277 TYR B CB     1 
ATOM 4604 C CG     . TYR D 4 77  ? 4.342   -7.976  36.097 1.00 0.31 ? 277 TYR B CG     1 
ATOM 4605 C CD1    . TYR D 4 77  ? 5.349   -7.439  35.288 1.00 0.29 ? 277 TYR B CD1    1 
ATOM 4606 C CD2    . TYR D 4 77  ? 3.288   -7.166  36.536 1.00 0.32 ? 277 TYR B CD2    1 
ATOM 4607 C CE1    . TYR D 4 77  ? 5.302   -6.090  34.915 1.00 0.29 ? 277 TYR B CE1    1 
ATOM 4608 C CE2    . TYR D 4 77  ? 3.242   -5.818  36.163 1.00 0.32 ? 277 TYR B CE2    1 
ATOM 4609 C CZ     . TYR D 4 77  ? 4.249   -5.280  35.353 1.00 0.31 ? 277 TYR B CZ     1 
ATOM 4610 O OH     . TYR D 4 77  ? 4.202   -3.951  34.984 1.00 0.31 ? 277 TYR B OH     1 
ATOM 4611 H H      . TYR D 4 77  ? 4.939   -11.565 37.849 1.00 0.33 ? 277 TYR B H      1 
ATOM 4612 H HA     . TYR D 4 77  ? 6.513   -9.698  36.228 1.00 0.30 ? 277 TYR B HA     1 
ATOM 4613 H HB2    . TYR D 4 77  ? 4.173   -10.046 35.638 1.00 0.30 ? 277 TYR B HB2    1 
ATOM 4614 H HB3    . TYR D 4 77  ? 3.658   -9.614  37.269 1.00 0.32 ? 277 TYR B HB3    1 
ATOM 4615 H HD1    . TYR D 4 77  ? 6.163   -8.065  34.951 1.00 0.28 ? 277 TYR B HD1    1 
ATOM 4616 H HD2    . TYR D 4 77  ? 2.511   -7.582  37.160 1.00 0.33 ? 277 TYR B HD2    1 
ATOM 4617 H HE1    . TYR D 4 77  ? 6.080   -5.675  34.291 1.00 0.28 ? 277 TYR B HE1    1 
ATOM 4618 H HE2    . TYR D 4 77  ? 2.428   -5.193  36.500 1.00 0.34 ? 277 TYR B HE2    1 
ATOM 4619 H HH     . TYR D 4 77  ? 3.720   -3.472  35.660 1.00 0.33 ? 277 TYR B HH     1 
ATOM 4620 N N      . ARG D 4 78  ? 7.263   -8.135  38.031 1.00 0.32 ? 278 ARG B N      1 
ATOM 4621 C CA     . ARG D 4 78  ? 7.710   -7.219  39.114 1.00 0.34 ? 278 ARG B CA     1 
ATOM 4622 C C      . ARG D 4 78  ? 8.044   -5.849  38.511 1.00 0.34 ? 278 ARG B C      1 
ATOM 4623 O O      . ARG D 4 78  ? 9.176   -5.586  38.160 1.00 0.33 ? 278 ARG B O      1 
ATOM 4624 C CB     . ARG D 4 78  ? 8.938   -7.817  39.805 1.00 0.35 ? 278 ARG B CB     1 
ATOM 4625 C CG     . ARG D 4 78  ? 8.614   -9.251  40.234 1.00 0.35 ? 278 ARG B CG     1 
ATOM 4626 C CD     . ARG D 4 78  ? 9.737   -9.810  41.114 1.00 0.37 ? 278 ARG B CD     1 
ATOM 4627 N NE     . ARG D 4 78  ? 11.059  -9.415  40.550 1.00 0.35 ? 278 ARG B NE     1 
ATOM 4628 C CZ     . ARG D 4 78  ? 12.142  -9.568  41.260 1.00 0.37 ? 278 ARG B CZ     1 
ATOM 4629 N NH1    . ARG D 4 78  ? 12.071  -10.060 42.466 1.00 0.39 ? 278 ARG B NH1    1 
ATOM 4630 N NH2    . ARG D 4 78  ? 13.301  -9.225  40.765 1.00 0.36 ? 278 ARG B NH2    1 
ATOM 4631 H H      . ARG D 4 78  ? 7.812   -8.243  37.227 1.00 0.31 ? 278 ARG B H      1 
ATOM 4632 H HA     . ARG D 4 78  ? 6.913   -7.105  39.836 1.00 0.36 ? 278 ARG B HA     1 
ATOM 4633 H HB2    . ARG D 4 78  ? 9.773   -7.820  39.118 1.00 0.33 ? 278 ARG B HB2    1 
ATOM 4634 H HB3    . ARG D 4 78  ? 9.186   -7.229  40.676 1.00 0.36 ? 278 ARG B HB3    1 
ATOM 4635 H HG2    . ARG D 4 78  ? 7.688   -9.257  40.789 1.00 0.36 ? 278 ARG B HG2    1 
ATOM 4636 H HG3    . ARG D 4 78  ? 8.508   -9.871  39.357 1.00 0.34 ? 278 ARG B HG3    1 
ATOM 4637 H HD2    . ARG D 4 78  ? 9.643   -9.416  42.113 1.00 0.38 ? 278 ARG B HD2    1 
ATOM 4638 H HD3    . ARG D 4 78  ? 9.662   -10.888 41.148 1.00 0.37 ? 278 ARG B HD3    1 
ATOM 4639 H HE     . ARG D 4 78  ? 11.113  -9.037  39.647 1.00 0.34 ? 278 ARG B HE     1 
ATOM 4640 H HH11   . ARG D 4 78  ? 11.184  -10.320 42.849 1.00 0.39 ? 278 ARG B HH11   1 
ATOM 4641 H HH12   . ARG D 4 78  ? 12.902  -10.180 43.009 1.00 0.40 ? 278 ARG B HH12   1 
ATOM 4642 H HH21   . ARG D 4 78  ? 13.356  -8.844  39.842 1.00 0.34 ? 278 ARG B HH21   1 
ATOM 4643 H HH22   . ARG D 4 78  ? 14.132  -9.345  41.308 1.00 0.37 ? 278 ARG B HH22   1 
ATOM 4644 N N      . PRO D 4 79  ? 7.059   -4.994  38.355 1.00 0.34 ? 279 PRO B N      1 
ATOM 4645 C CA     . PRO D 4 79  ? 7.270   -3.651  37.742 1.00 0.34 ? 279 PRO B CA     1 
ATOM 4646 C C      . PRO D 4 79  ? 8.121   -2.725  38.613 1.00 0.36 ? 279 PRO B C      1 
ATOM 4647 O O      . PRO D 4 79  ? 8.136   -2.829  39.824 1.00 0.37 ? 279 PRO B O      1 
ATOM 4648 C CB     . PRO D 4 79  ? 5.852   -3.084  37.574 1.00 0.35 ? 279 PRO B CB     1 
ATOM 4649 C CG     . PRO D 4 79  ? 5.018   -3.796  38.583 1.00 0.36 ? 279 PRO B CG     1 
ATOM 4650 C CD     . PRO D 4 79  ? 5.639   -5.187  38.744 1.00 0.35 ? 279 PRO B CD     1 
ATOM 4651 H HA     . PRO D 4 79  ? 7.713   -3.753  36.765 1.00 0.32 ? 279 PRO B HA     1 
ATOM 4652 H HB2    . PRO D 4 79  ? 5.842   -2.016  37.760 1.00 0.36 ? 279 PRO B HB2    1 
ATOM 4653 H HB3    . PRO D 4 79  ? 5.491   -3.283  36.589 1.00 0.33 ? 279 PRO B HB3    1 
ATOM 4654 H HG2    . PRO D 4 79  ? 5.034   -3.262  39.526 1.00 0.38 ? 279 PRO B HG2    1 
ATOM 4655 H HG3    . PRO D 4 79  ? 4.001   -3.892  38.229 1.00 0.36 ? 279 PRO B HG3    1 
ATOM 4656 H HD2    . PRO D 4 79  ? 5.554   -5.498  39.773 1.00 0.37 ? 279 PRO B HD2    1 
ATOM 4657 H HD3    . PRO D 4 79  ? 5.165   -5.900  38.087 1.00 0.34 ? 279 PRO B HD3    1 
ATOM 4658 N N      . ARG D 4 80  ? 8.823   -1.812  37.999 1.00 0.35 ? 280 ARG B N      1 
ATOM 4659 C CA     . ARG D 4 80  ? 9.660   -0.871  38.792 1.00 0.37 ? 280 ARG B CA     1 
ATOM 4660 C C      . ARG D 4 80  ? 8.829   0.350   39.166 1.00 0.39 ? 280 ARG B C      1 
ATOM 4661 O O      . ARG D 4 80  ? 8.260   1.018   38.325 1.00 0.38 ? 280 ARG B O      1 
ATOM 4662 C CB     . ARG D 4 80  ? 10.880  -0.417  37.986 1.00 0.36 ? 280 ARG B CB     1 
ATOM 4663 C CG     . ARG D 4 80  ? 11.868  0.258   38.946 1.00 0.37 ? 280 ARG B CG     1 
ATOM 4664 C CD     . ARG D 4 80  ? 12.887  1.096   38.171 1.00 0.37 ? 280 ARG B CD     1 
ATOM 4665 N NE     . ARG D 4 80  ? 14.240  0.505   38.384 1.00 0.36 ? 280 ARG B NE     1 
ATOM 4666 C CZ     . ARG D 4 80  ? 15.269  0.935   37.708 1.00 0.36 ? 280 ARG B CZ     1 
ATOM 4667 N NH1    . ARG D 4 80  ? 15.120  1.844   36.783 1.00 0.35 ? 280 ARG B NH1    1 
ATOM 4668 N NH2    . ARG D 4 80  ? 16.453  0.441   37.951 1.00 0.35 ? 280 ARG B NH2    1 
ATOM 4669 H H      . ARG D 4 80  ? 8.792   -1.740  37.022 1.00 0.34 ? 280 ARG B H      1 
ATOM 4670 H HA     . ARG D 4 80  ? 9.992   -1.365  39.694 1.00 0.38 ? 280 ARG B HA     1 
ATOM 4671 H HB2    . ARG D 4 80  ? 11.347  -1.272  37.518 1.00 0.34 ? 280 ARG B HB2    1 
ATOM 4672 H HB3    . ARG D 4 80  ? 10.574  0.292   37.230 1.00 0.35 ? 280 ARG B HB3    1 
ATOM 4673 H HG2    . ARG D 4 80  ? 11.324  0.898   39.623 1.00 0.39 ? 280 ARG B HG2    1 
ATOM 4674 H HG3    . ARG D 4 80  ? 12.389  -0.500  39.512 1.00 0.38 ? 280 ARG B HG3    1 
ATOM 4675 H HD2    . ARG D 4 80  ? 12.650  1.087   37.123 1.00 0.35 ? 280 ARG B HD2    1 
ATOM 4676 H HD3    . ARG D 4 80  ? 12.860  2.116   38.536 1.00 0.38 ? 280 ARG B HD3    1 
ATOM 4677 H HE     . ARG D 4 80  ? 14.360  -0.206  39.047 1.00 0.37 ? 280 ARG B HE     1 
ATOM 4678 H HH11   . ARG D 4 80  ? 14.212  2.211   36.587 1.00 0.35 ? 280 ARG B HH11   1 
ATOM 4679 H HH12   . ARG D 4 80  ? 15.914  2.171   36.271 1.00 0.35 ? 280 ARG B HH12   1 
ATOM 4680 H HH21   . ARG D 4 80  ? 16.563  -0.265  38.650 1.00 0.36 ? 280 ARG B HH21   1 
ATOM 4681 H HH22   . ARG D 4 80  ? 17.247  0.771   37.441 1.00 0.35 ? 280 ARG B HH22   1 
ATOM 4682 N N      . ARG D 4 81  ? 8.766   0.648   40.429 1.00 0.41 ? 281 ARG B N      1 
ATOM 4683 C CA     . ARG D 4 81  ? 7.989   1.825   40.886 1.00 0.43 ? 281 ARG B CA     1 
ATOM 4684 C C      . ARG D 4 81  ? 8.864   3.079   40.821 1.00 0.44 ? 281 ARG B C      1 
ATOM 4685 O O      . ARG D 4 81  ? 10.026  3.061   41.175 1.00 0.44 ? 281 ARG B O      1 
ATOM 4686 C CB     . ARG D 4 81  ? 7.516   1.639   42.312 1.00 0.46 ? 281 ARG B CB     1 
ATOM 4687 C CG     . ARG D 4 81  ? 6.208   2.466   42.504 1.00 1.25 ? 281 ARG B CG     1 
ATOM 4688 C CD     . ARG D 4 81  ? 5.039   1.525   42.842 1.00 1.70 ? 281 ARG B CD     1 
ATOM 4689 N NE     . ARG D 4 81  ? 4.323   2.019   44.031 1.00 2.43 ? 281 ARG B NE     1 
ATOM 4690 C CZ     . ARG D 4 81  ? 4.950   2.436   45.098 1.00 3.17 ? 281 ARG B CZ     1 
ATOM 4691 N NH1    . ARG D 4 81  ? 6.250   2.411   45.204 1.00 3.45 ? 281 ARG B NH1    1 
ATOM 4692 N NH2    . ARG D 4 81  ? 4.253   2.827   46.075 1.00 4.10 ? 281 ARG B NH2    1 
ATOM 4693 H H      . ARG D 4 81  ? 9.243   0.096   41.084 1.00 0.41 ? 281 ARG B H      1 
ATOM 4694 H HA     . ARG D 4 81  ? 7.125   1.955   40.250 1.00 0.43 ? 281 ARG B HA     1 
ATOM 4695 H HB2    . ARG D 4 81  ? 7.355   0.588   42.485 1.00 0.98 ? 281 ARG B HB2    1 
ATOM 4696 H HB3    . ARG D 4 81  ? 8.268   1.990   43.006 1.00 0.97 ? 281 ARG B HB3    1 
ATOM 4697 H HG2    . ARG D 4 81  ? 6.354   3.196   43.264 1.00 1.94 ? 281 ARG B HG2    1 
ATOM 4698 H HG3    . ARG D 4 81  ? 5.960   3.012   41.604 1.00 1.83 ? 281 ARG B HG3    1 
ATOM 4699 H HD2    . ARG D 4 81  ? 4.347   1.506   42.014 1.00 2.01 ? 281 ARG B HD2    1 
ATOM 4700 H HD3    . ARG D 4 81  ? 5.388   0.518   43.016 1.00 2.20 ? 281 ARG B HD3    1 
ATOM 4701 H HE     . ARG D 4 81  ? 3.344   2.022   44.024 1.00 2.83 ? 281 ARG B HE     1 
ATOM 4702 H HH11   . ARG D 4 81  ? 6.809   2.056   44.455 1.00 3.15 ? 281 ARG B HH11   1 
ATOM 4703 H HH12   . ARG D 4 81  ? 6.688   2.766   46.029 1.00 4.26 ? 281 ARG B HH12   1 
ATOM 4704 H HH21   . ARG D 4 81  ? 3.272   2.786   46.001 1.00 4.36 ? 281 ARG B HH21   1 
ATOM 4705 H HH22   . ARG D 4 81  ? 4.682   3.188   46.900 1.00 4.76 ? 281 ARG B HH22   1 
ATOM 4706 N N      . LYS D 4 82  ? 8.299   4.170   40.400 1.00 0.45 ? 282 LYS B N      1 
ATOM 4707 C CA     . LYS D 4 82  ? 9.052   5.454   40.328 1.00 0.46 ? 282 LYS B CA     1 
ATOM 4708 C C      . LYS D 4 82  ? 8.841   6.218   41.630 1.00 0.49 ? 282 LYS B C      1 
ATOM 4709 O O      . LYS D 4 82  ? 7.975   5.892   42.419 1.00 0.50 ? 282 LYS B O      1 
ATOM 4710 C CB     . LYS D 4 82  ? 8.553   6.271   39.133 1.00 0.46 ? 282 LYS B CB     1 
ATOM 4711 C CG     . LYS D 4 82  ? 9.528   7.420   38.866 1.00 0.85 ? 282 LYS B CG     1 
ATOM 4712 C CD     . LYS D 4 82  ? 9.141   8.134   37.572 1.00 1.28 ? 282 LYS B CD     1 
ATOM 4713 C CE     . LYS D 4 82  ? 10.158  9.239   37.285 1.00 1.72 ? 282 LYS B CE     1 
ATOM 4714 N NZ     . LYS D 4 82  ? 9.793   9.935   36.019 1.00 2.33 ? 282 LYS B NZ     1 
ATOM 4715 H H      . LYS D 4 82  ? 7.354   4.152   40.143 1.00 0.45 ? 282 LYS B H      1 
ATOM 4716 H HA     . LYS D 4 82  ? 10.104  5.250   40.192 1.00 0.45 ? 282 LYS B HA     1 
ATOM 4717 H HB2    . LYS D 4 82  ? 8.499   5.635   38.261 1.00 0.65 ? 282 LYS B HB2    1 
ATOM 4718 H HB3    . LYS D 4 82  ? 7.574   6.671   39.350 1.00 0.74 ? 282 LYS B HB3    1 
ATOM 4719 H HG2    . LYS D 4 82  ? 9.482   8.122   39.688 1.00 1.40 ? 282 LYS B HG2    1 
ATOM 4720 H HG3    . LYS D 4 82  ? 10.532  7.036   38.779 1.00 1.28 ? 282 LYS B HG3    1 
ATOM 4721 H HD2    . LYS D 4 82  ? 9.138   7.424   36.758 1.00 1.65 ? 282 LYS B HD2    1 
ATOM 4722 H HD3    . LYS D 4 82  ? 8.159   8.569   37.677 1.00 1.81 ? 282 LYS B HD3    1 
ATOM 4723 H HE2    . LYS D 4 82  ? 10.165  9.947   38.099 1.00 2.24 ? 282 LYS B HE2    1 
ATOM 4724 H HE3    . LYS D 4 82  ? 11.141  8.801   37.181 1.00 2.02 ? 282 LYS B HE3    1 
ATOM 4725 H HZ1    . LYS D 4 82  ? 9.854   10.962  36.160 1.00 2.78 ? 282 LYS B HZ1    1 
ATOM 4726 H HZ2    . LYS D 4 82  ? 8.822   9.676   35.751 1.00 2.74 ? 282 LYS B HZ2    1 
ATOM 4727 H HZ3    . LYS D 4 82  ? 10.450  9.651   35.265 1.00 2.67 ? 282 LYS B HZ3    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   301 301 DT  THY C . n 
A 1 2   DG  2   302 302 DG  GUA C . n 
A 1 3   DT  3   303 303 DT  THY C . n 
A 1 4   DC  4   304 304 DC  CYT C . n 
A 1 5   DT  5   305 305 DT  THY C . n 
A 1 6   DT  6   306 306 DT  THY C . n 
A 1 7   DT  7   307 307 DT  THY C . n 
A 1 8   DG  8   308 308 DG  GUA C . n 
A 1 9   DT  9   309 309 DT  THY C . n 
A 1 10  DC  10  310 310 DC  CYT C . n 
A 1 11  DA  11  311 311 DA  ADE C . n 
A 1 12  DT  12  312 312 DT  THY C . n 
A 1 13  DG  13  313 313 DG  GUA C . n 
A 1 14  DC  14  314 314 DC  CYT C . n 
A 1 15  DT  15  315 315 DT  THY C . n 
A 1 16  DA  16  316 316 DA  ADE C . n 
A 1 17  DA  17  317 317 DA  ADE C . n 
A 1 18  DT  18  318 318 DT  THY C . n 
A 1 19  DG  19  319 319 DG  GUA C . n 
B 2 1   DC  1   320 320 DC  CYT D . n 
B 2 2   DA  2   321 321 DA  ADE D . n 
B 2 3   DT  3   322 322 DT  THY D . n 
B 2 4   DT  4   323 323 DT  THY D . n 
B 2 5   DA  5   324 324 DA  ADE D . n 
B 2 6   DG  6   325 325 DG  GUA D . n 
B 2 7   DC  7   326 326 DC  CYT D . n 
B 2 8   DA  8   327 327 DA  ADE D . n 
B 2 9   DT  9   328 328 DT  THY D . n 
B 2 10  DG  10  329 329 DG  GUA D . n 
B 2 11  DA  11  330 330 DA  ADE D . n 
B 2 12  DC  12  331 331 DC  CYT D . n 
B 2 13  DA  13  332 332 DA  ADE D . n 
B 2 14  DA  14  333 333 DA  ADE D . n 
B 2 15  DA  15  334 334 DA  ADE D . n 
B 2 16  DG  16  335 335 DG  GUA D . n 
B 2 17  DA  17  336 336 DA  ADE D . n 
B 2 18  DC  18  337 337 DC  CYT D . n 
B 2 19  DA  19  338 338 DA  ADE D . n 
C 3 1   GLY 1   1   ?   ?   ?   A . n 
C 3 2   SER 2   2   ?   ?   ?   A . n 
C 3 3   HIS 3   3   ?   ?   ?   A . n 
C 3 4   MET 4   4   ?   ?   ?   A . n 
C 3 5   GLU 5   5   5   GLU GLU A . n 
C 3 6   GLU 6   6   6   GLU GLU A . n 
C 3 7   PRO 7   7   7   PRO PRO A . n 
C 3 8   SER 8   8   8   SER SER A . n 
C 3 9   ASP 9   9   9   ASP ASP A . n 
C 3 10  LEU 10  10  10  LEU LEU A . n 
C 3 11  GLU 11  11  11  GLU GLU A . n 
C 3 12  GLU 12  12  12  GLU GLU A . n 
C 3 13  LEU 13  13  13  LEU LEU A . n 
C 3 14  GLU 14  14  14  GLU GLU A . n 
C 3 15  GLN 15  15  15  GLN GLN A . n 
C 3 16  PHE 16  16  16  PHE PHE A . n 
C 3 17  ALA 17  17  17  ALA ALA A . n 
C 3 18  LYS 18  18  18  LYS LYS A . n 
C 3 19  THR 19  19  19  THR THR A . n 
C 3 20  PHE 20  20  20  PHE PHE A . n 
C 3 21  LYS 21  21  21  LYS LYS A . n 
C 3 22  GLN 22  22  22  GLN GLN A . n 
C 3 23  ARG 23  23  23  ARG ARG A . n 
C 3 24  ARG 24  24  24  ARG ARG A . n 
C 3 25  ILE 25  25  25  ILE ILE A . n 
C 3 26  LYS 26  26  26  LYS LYS A . n 
C 3 27  LEU 27  27  27  LEU LEU A . n 
C 3 28  GLY 28  28  28  GLY GLY A . n 
C 3 29  PHE 29  29  29  PHE PHE A . n 
C 3 30  THR 30  30  30  THR THR A . n 
C 3 31  GLN 31  31  31  GLN GLN A . n 
C 3 32  GLY 32  32  32  GLY GLY A . n 
C 3 33  ASP 33  33  33  ASP ASP A . n 
C 3 34  VAL 34  34  34  VAL VAL A . n 
C 3 35  GLY 35  35  35  GLY GLY A . n 
C 3 36  LEU 36  36  36  LEU LEU A . n 
C 3 37  ALA 37  37  37  ALA ALA A . n 
C 3 38  MET 38  38  38  MET MET A . n 
C 3 39  GLY 39  39  39  GLY GLY A . n 
C 3 40  LYS 40  40  40  LYS LYS A . n 
C 3 41  LEU 41  41  41  LEU LEU A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  GLY 43  43  43  GLY GLY A . n 
C 3 44  ASN 44  44  44  ASN ASN A . n 
C 3 45  ASP 45  45  45  ASP ASP A . n 
C 3 46  PHE 46  46  46  PHE PHE A . n 
C 3 47  SER 47  47  47  SER SER A . n 
C 3 48  GLN 48  48  48  GLN GLN A . n 
C 3 49  THR 49  49  49  THR THR A . n 
C 3 50  THR 50  50  50  THR THR A . n 
C 3 51  ILE 51  51  51  ILE ILE A . n 
C 3 52  SER 52  52  52  SER SER A . n 
C 3 53  ARG 53  53  53  ARG ARG A . n 
C 3 54  PHE 54  54  54  PHE PHE A . n 
C 3 55  GLU 55  55  55  GLU GLU A . n 
C 3 56  ALA 56  56  56  ALA ALA A . n 
C 3 57  LEU 57  57  57  LEU LEU A . n 
C 3 58  ASN 58  58  58  ASN ASN A . n 
C 3 59  LEU 59  59  59  LEU LEU A . n 
C 3 60  SER 60  60  60  SER SER A . n 
C 3 61  PHE 61  61  61  PHE PHE A . n 
C 3 62  LYS 62  62  62  LYS LYS A . n 
C 3 63  ASN 63  63  63  ASN ASN A . n 
C 3 64  MET 64  64  64  MET MET A . n 
C 3 65  ALA 65  65  65  ALA ALA A . n 
C 3 66  LYS 66  66  66  LYS LYS A . n 
C 3 67  LEU 67  67  67  LEU LEU A . n 
C 3 68  LYS 68  68  68  LYS LYS A . n 
C 3 69  PRO 69  69  69  PRO PRO A . n 
C 3 70  LEU 70  70  70  LEU LEU A . n 
C 3 71  LEU 71  71  71  LEU LEU A . n 
C 3 72  GLU 72  72  72  GLU GLU A . n 
C 3 73  LYS 73  73  73  LYS LYS A . n 
C 3 74  TRP 74  74  74  TRP TRP A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  ASN 76  76  76  ASN ASN A . n 
C 3 77  ASP 77  77  77  ASP ASP A . n 
C 3 78  ALA 78  78  78  ALA ALA A . n 
C 3 79  GLU 79  79  79  GLU GLU A . n 
C 3 80  ASN 80  80  ?   ?   ?   A . n 
C 3 81  LEU 81  81  ?   ?   ?   A . n 
C 3 82  SER 82  82  ?   ?   ?   A . n 
C 3 83  SER 83  83  ?   ?   ?   A . n 
C 3 84  ASP 84  84  ?   ?   ?   A . n 
C 3 85  SER 85  85  ?   ?   ?   A . n 
C 3 86  SER 86  86  ?   ?   ?   A . n 
C 3 87  LEU 87  87  ?   ?   ?   A . n 
C 3 88  SER 88  88  ?   ?   ?   A . n 
C 3 89  SER 89  89  ?   ?   ?   A . n 
C 3 90  PRO 90  90  ?   ?   ?   A . n 
C 3 91  SER 91  91  ?   ?   ?   A . n 
C 3 92  ALA 92  92  ?   ?   ?   A . n 
C 3 93  LEU 93  93  ?   ?   ?   A . n 
C 3 94  ASN 94  94  ?   ?   ?   A . n 
C 3 95  SER 95  95  ?   ?   ?   A . n 
C 3 96  PRO 96  96  ?   ?   ?   A . n 
C 3 97  GLY 97  97  ?   ?   ?   A . n 
C 3 98  ILE 98  98  ?   ?   ?   A . n 
C 3 99  GLU 99  99  ?   ?   ?   A . n 
C 3 100 GLY 100 100 ?   ?   ?   A . n 
C 3 101 LEU 101 101 ?   ?   ?   A . n 
C 3 102 SER 102 102 ?   ?   ?   A . n 
C 3 103 GLU 103 103 ?   ?   ?   A . n 
C 3 104 ARG 104 104 ?   ?   ?   A . n 
C 3 105 ARG 105 105 ?   ?   ?   A . n 
C 3 106 LYS 106 106 ?   ?   ?   A . n 
C 3 107 LYS 107 107 ?   ?   ?   A . n 
C 3 108 ARG 108 108 ?   ?   ?   A . n 
C 3 109 THR 109 109 ?   ?   ?   A . n 
C 3 110 SER 110 110 110 SER SER A . n 
C 3 111 ILE 111 111 111 ILE ILE A . n 
C 3 112 GLU 112 112 112 GLU GLU A . n 
C 3 113 THR 113 113 113 THR THR A . n 
C 3 114 ASN 114 114 114 ASN ASN A . n 
C 3 115 ILE 115 115 115 ILE ILE A . n 
C 3 116 ARG 116 116 116 ARG ARG A . n 
C 3 117 VAL 117 117 117 VAL VAL A . n 
C 3 118 ALA 118 118 118 ALA ALA A . n 
C 3 119 LEU 119 119 119 LEU LEU A . n 
C 3 120 GLU 120 120 120 GLU GLU A . n 
C 3 121 LYS 121 121 121 LYS LYS A . n 
C 3 122 SER 122 122 122 SER SER A . n 
C 3 123 PHE 123 123 123 PHE PHE A . n 
C 3 124 LEU 124 124 124 LEU LEU A . n 
C 3 125 GLU 125 125 125 GLU GLU A . n 
C 3 126 ASN 126 126 126 ASN ASN A . n 
C 3 127 GLN 127 127 127 GLN GLN A . n 
C 3 128 LYS 128 128 128 LYS LYS A . n 
C 3 129 PRO 129 129 129 PRO PRO A . n 
C 3 130 THR 130 130 130 THR THR A . n 
C 3 131 SER 131 131 131 SER SER A . n 
C 3 132 GLU 132 132 132 GLU GLU A . n 
C 3 133 GLU 133 133 133 GLU GLU A . n 
C 3 134 ILE 134 134 134 ILE ILE A . n 
C 3 135 THR 135 135 135 THR THR A . n 
C 3 136 MET 136 136 136 MET MET A . n 
C 3 137 ILE 137 137 137 ILE ILE A . n 
C 3 138 ALA 138 138 138 ALA ALA A . n 
C 3 139 ASP 139 139 139 ASP ASP A . n 
C 3 140 GLN 140 140 140 GLN GLN A . n 
C 3 141 LEU 141 141 141 LEU LEU A . n 
C 3 142 ASN 142 142 142 ASN ASN A . n 
C 3 143 MET 143 143 143 MET MET A . n 
C 3 144 GLU 144 144 144 GLU GLU A . n 
C 3 145 LYS 145 145 145 LYS LYS A . n 
C 3 146 GLU 146 146 146 GLU GLU A . n 
C 3 147 VAL 147 147 147 VAL VAL A . n 
C 3 148 ILE 148 148 148 ILE ILE A . n 
C 3 149 ARG 149 149 149 ARG ARG A . n 
C 3 150 VAL 150 150 150 VAL VAL A . n 
C 3 151 TRP 151 151 151 TRP TRP A . n 
C 3 152 PHE 152 152 152 PHE PHE A . n 
C 3 153 CYS 153 153 153 CYS CYS A . n 
C 3 154 ASN 154 154 154 ASN ASN A . n 
C 3 155 ARG 155 155 155 ARG ARG A . n 
C 3 156 ARG 156 156 156 ARG ARG A . n 
C 3 157 GLN 157 157 157 GLN GLN A . n 
C 3 158 LYS 158 158 158 LYS LYS A . n 
C 3 159 GLU 159 159 159 GLU GLU A . n 
C 3 160 LYS 160 160 160 LYS LYS A . n 
C 3 161 ARG 161 161 161 ARG ARG A . n 
C 3 162 ILE 162 162 162 ILE ILE A . n 
C 3 163 ASN 163 163 163 ASN ASN A . n 
C 3 164 PRO 164 164 ?   ?   ?   A . n 
C 3 165 PRO 165 165 ?   ?   ?   A . n 
C 3 166 SER 166 166 ?   ?   ?   A . n 
C 3 167 SER 167 167 ?   ?   ?   A . n 
D 4 1   GLY 1   201 ?   ?   ?   B . n 
D 4 2   SER 2   202 ?   ?   ?   B . n 
D 4 3   HIS 3   203 ?   ?   ?   B . n 
D 4 4   MET 4   204 ?   ?   ?   B . n 
D 4 5   PRO 5   205 ?   ?   ?   B . n 
D 4 6   ASP 6   206 206 ASP ASP B . n 
D 4 7   ARG 7   207 207 ARG ARG B . n 
D 4 8   VAL 8   208 208 VAL VAL B . n 
D 4 9   LYS 9   209 209 LYS LYS B . n 
D 4 10  ARG 10  210 210 ARG ARG B . n 
D 4 11  PRO 11  211 211 PRO PRO B . n 
D 4 12  MET 12  212 212 MET MET B . n 
D 4 13  ASN 13  213 213 ASN ASN B . n 
D 4 14  ALA 14  214 214 ALA ALA B . n 
D 4 15  PHE 15  215 215 PHE PHE B . n 
D 4 16  MET 16  216 216 MET MET B . n 
D 4 17  VAL 17  217 217 VAL VAL B . n 
D 4 18  TRP 18  218 218 TRP TRP B . n 
D 4 19  SER 19  219 219 SER SER B . n 
D 4 20  ARG 20  220 220 ARG ARG B . n 
D 4 21  GLY 21  221 221 GLY GLY B . n 
D 4 22  GLN 22  222 222 GLN GLN B . n 
D 4 23  ARG 23  223 223 ARG ARG B . n 
D 4 24  ARG 24  224 224 ARG ARG B . n 
D 4 25  LYS 25  225 225 LYS LYS B . n 
D 4 26  MET 26  226 226 MET MET B . n 
D 4 27  ALA 27  227 227 ALA ALA B . n 
D 4 28  GLN 28  228 228 GLN GLN B . n 
D 4 29  GLU 29  229 229 GLU GLU B . n 
D 4 30  ASN 30  230 230 ASN ASN B . n 
D 4 31  PRO 31  231 231 PRO PRO B . n 
D 4 32  LYS 32  232 232 LYS LYS B . n 
D 4 33  MET 33  233 233 MET MET B . n 
D 4 34  HIS 34  234 234 HIS HIS B . n 
D 4 35  ASN 35  235 235 ASN ASN B . n 
D 4 36  SER 36  236 236 SER SER B . n 
D 4 37  GLU 37  237 237 GLU GLU B . n 
D 4 38  ILE 38  238 238 ILE ILE B . n 
D 4 39  SER 39  239 239 SER SER B . n 
D 4 40  LYS 40  240 240 LYS LYS B . n 
D 4 41  ARG 41  241 241 ARG ARG B . n 
D 4 42  LEU 42  242 242 LEU LEU B . n 
D 4 43  GLY 43  243 243 GLY GLY B . n 
D 4 44  ALA 44  244 244 ALA ALA B . n 
D 4 45  GLU 45  245 245 GLU GLU B . n 
D 4 46  TRP 46  246 246 TRP TRP B . n 
D 4 47  LYS 47  247 247 LYS LYS B . n 
D 4 48  LEU 48  248 248 LEU LEU B . n 
D 4 49  LEU 49  249 249 LEU LEU B . n 
D 4 50  SER 50  250 250 SER SER B . n 
D 4 51  GLU 51  251 251 GLU GLU B . n 
D 4 52  THR 52  252 252 THR THR B . n 
D 4 53  GLU 53  253 253 GLU GLU B . n 
D 4 54  LYS 54  254 254 LYS LYS B . n 
D 4 55  ARG 55  255 255 ARG ARG B . n 
D 4 56  PRO 56  256 256 PRO PRO B . n 
D 4 57  PHE 57  257 257 PHE PHE B . n 
D 4 58  ILE 58  258 258 ILE ILE B . n 
D 4 59  ASP 59  259 259 ASP ASP B . n 
D 4 60  GLU 60  260 260 GLU GLU B . n 
D 4 61  ALA 61  261 261 ALA ALA B . n 
D 4 62  LYS 62  262 262 LYS LYS B . n 
D 4 63  ARG 63  263 263 ARG ARG B . n 
D 4 64  LEU 64  264 264 LEU LEU B . n 
D 4 65  ARG 65  265 265 ARG ARG B . n 
D 4 66  ALA 66  266 266 ALA ALA B . n 
D 4 67  LEU 67  267 267 LEU LEU B . n 
D 4 68  HIS 68  268 268 HIS HIS B . n 
D 4 69  MET 69  269 269 MET MET B . n 
D 4 70  LYS 70  270 270 LYS LYS B . n 
D 4 71  GLU 71  271 271 GLU GLU B . n 
D 4 72  HIS 72  272 272 HIS HIS B . n 
D 4 73  PRO 73  273 273 PRO PRO B . n 
D 4 74  ASP 74  274 274 ASP ASP B . n 
D 4 75  TYR 75  275 275 TYR TYR B . n 
D 4 76  LYS 76  276 276 LYS LYS B . n 
D 4 77  TYR 77  277 277 TYR TYR B . n 
D 4 78  ARG 78  278 278 ARG ARG B . n 
D 4 79  PRO 79  279 279 PRO PRO B . n 
D 4 80  ARG 80  280 280 ARG ARG B . n 
D 4 81  ARG 81  281 281 ARG ARG B . n 
D 4 82  LYS 82  282 282 LYS LYS B . n 
D 4 83  THR 83  283 ?   ?   ?   B . n 
D 4 84  LYS 84  284 ?   ?   ?   B . n 
D 4 85  THR 85  285 ?   ?   ?   B . n 
D 4 86  LEU 86  286 ?   ?   ?   B . n 
D 4 87  MET 87  287 ?   ?   ?   B . n 
D 4 88  LYS 88  288 ?   ?   ?   B . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-27 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OE2  B GLU 251 ? ? HH12 B ARG 255 ? ? 0.84 
2  1 HD12 A LEU 13  ? ? HD2  A LYS 68  ? ? 1.24 
3  1 HE21 A GLN 31  ? ? O    A GLN 48  ? ? 1.28 
4  1 HE2  B MET 233 ? ? HH22 B ARG 241 ? ? 1.32 
5  1 HH12 A ARG 24  ? ? HB2  A GLN 31  ? ? 1.33 
6  1 OD1  B ASN 213 ? ? H    B MET 216 ? ? 1.44 
7  1 O    B SER 219 ? ? H    B ARG 223 ? ? 1.50 
8  1 OE2  B GLU 251 ? ? NH1  B ARG 255 ? ? 1.54 
9  1 O    A GLY 28  ? ? HZ3  B LYS 262 ? B 1.56 
10 1 NE2  A GLN 31  ? ? O    A GLN 48  ? ? 1.62 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N1 C DA 311 ? ? C2 C DA 311 ? ? N3 C DA 311 ? ? 126.27 129.30 -3.03 0.50 N 
2 1 N1 D DA 321 ? ? C2 D DA 321 ? ? N3 D DA 321 ? ? 126.22 129.30 -3.08 0.50 N 
3 1 C6 D DT 322 ? ? C5 D DT 322 ? ? C7 D DT 322 ? ? 119.08 122.90 -3.82 0.60 N 
4 1 N1 D DA 324 ? ? C2 D DA 324 ? ? N3 D DA 324 ? ? 126.23 129.30 -3.07 0.50 N 
5 1 N1 D DA 330 ? ? C2 D DA 330 ? ? N3 D DA 330 ? ? 126.24 129.30 -3.06 0.50 N 
6 1 N1 D DA 332 ? ? C2 D DA 332 ? ? N3 D DA 332 ? ? 126.14 129.30 -3.16 0.50 N 
7 1 N1 D DA 333 ? ? C2 D DA 333 ? ? N3 D DA 333 ? ? 126.25 129.30 -3.05 0.50 N 
8 1 N1 D DA 334 ? ? C2 D DA 334 ? ? N3 D DA 334 ? ? 126.29 129.30 -3.01 0.50 N 
9 1 N1 D DA 336 ? ? C2 D DA 336 ? ? N3 D DA 336 ? ? 126.13 129.30 -3.17 0.50 N 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     155 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.085 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 5   ? CG  ? C GLU 5   CG  
2  1 Y 1 A GLU 5   ? CD  ? C GLU 5   CD  
3  1 Y 1 A GLU 5   ? OE1 ? C GLU 5   OE1 
4  1 Y 1 A GLU 5   ? OE2 ? C GLU 5   OE2 
5  1 Y 1 A GLU 79  ? O   ? C GLU 79  O   
6  1 Y 1 A LYS 121 ? CG  ? C LYS 121 CG  
7  1 Y 1 A LYS 121 ? CD  ? C LYS 121 CD  
8  1 Y 1 A LYS 121 ? CE  ? C LYS 121 CE  
9  1 Y 1 A LYS 121 ? NZ  ? C LYS 121 NZ  
10 1 Y 1 A LYS 128 ? CG  ? C LYS 128 CG  
11 1 Y 1 A LYS 128 ? CD  ? C LYS 128 CD  
12 1 Y 1 A LYS 128 ? CE  ? C LYS 128 CE  
13 1 Y 1 A LYS 128 ? NZ  ? C LYS 128 NZ  
14 1 Y 1 A GLU 132 ? CG  ? C GLU 132 CG  
15 1 Y 1 A GLU 132 ? CD  ? C GLU 132 CD  
16 1 Y 1 A GLU 132 ? OE1 ? C GLU 132 OE1 
17 1 Y 1 A GLU 132 ? OE2 ? C GLU 132 OE2 
18 1 Y 1 A LYS 145 ? CG  ? C LYS 145 CG  
19 1 Y 1 A LYS 145 ? CD  ? C LYS 145 CD  
20 1 Y 1 A LYS 145 ? CE  ? C LYS 145 CE  
21 1 Y 1 A LYS 145 ? NZ  ? C LYS 145 NZ  
22 1 Y 1 A ASN 163 ? O   ? C ASN 163 O   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1   ? C GLY 1   
2  1 Y 1 A SER 2   ? C SER 2   
3  1 Y 1 A HIS 3   ? C HIS 3   
4  1 Y 1 A MET 4   ? C MET 4   
5  1 Y 1 A ASN 80  ? C ASN 80  
6  1 Y 1 A LEU 81  ? C LEU 81  
7  1 Y 1 A SER 82  ? C SER 82  
8  1 Y 1 A SER 83  ? C SER 83  
9  1 Y 1 A ASP 84  ? C ASP 84  
10 1 Y 1 A SER 85  ? C SER 85  
11 1 Y 1 A SER 86  ? C SER 86  
12 1 Y 1 A LEU 87  ? C LEU 87  
13 1 Y 1 A SER 88  ? C SER 88  
14 1 Y 1 A SER 89  ? C SER 89  
15 1 Y 1 A PRO 90  ? C PRO 90  
16 1 Y 1 A SER 91  ? C SER 91  
17 1 Y 1 A ALA 92  ? C ALA 92  
18 1 Y 1 A LEU 93  ? C LEU 93  
19 1 Y 1 A ASN 94  ? C ASN 94  
20 1 Y 1 A SER 95  ? C SER 95  
21 1 Y 1 A PRO 96  ? C PRO 96  
22 1 Y 1 A GLY 97  ? C GLY 97  
23 1 Y 1 A ILE 98  ? C ILE 98  
24 1 Y 1 A GLU 99  ? C GLU 99  
25 1 Y 1 A GLY 100 ? C GLY 100 
26 1 Y 1 A LEU 101 ? C LEU 101 
27 1 Y 1 A SER 102 ? C SER 102 
28 1 Y 1 A GLU 103 ? C GLU 103 
29 1 Y 1 A ARG 104 ? C ARG 104 
30 1 Y 1 A ARG 105 ? C ARG 105 
31 1 Y 1 A LYS 106 ? C LYS 106 
32 1 Y 1 A LYS 107 ? C LYS 107 
33 1 Y 1 A ARG 108 ? C ARG 108 
34 1 Y 1 A THR 109 ? C THR 109 
35 1 Y 1 A PRO 164 ? C PRO 164 
36 1 Y 1 A PRO 165 ? C PRO 165 
37 1 Y 1 A SER 166 ? C SER 166 
38 1 Y 1 A SER 167 ? C SER 167 
39 1 Y 1 B GLY 201 ? D GLY 1   
40 1 Y 1 B SER 202 ? D SER 2   
41 1 Y 1 B HIS 203 ? D HIS 3   
42 1 Y 1 B MET 204 ? D MET 4   
43 1 Y 1 B PRO 205 ? D PRO 5   
44 1 Y 1 B THR 283 ? D THR 83  
45 1 Y 1 B LYS 284 ? D LYS 84  
46 1 Y 1 B THR 285 ? D THR 85  
47 1 Y 1 B LEU 286 ? D LEU 86  
48 1 Y 1 B MET 287 ? D MET 87  
49 1 Y 1 B LYS 288 ? D LYS 88  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1O4X 'double helix'        
1O4X 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 1  1_555 B DA 19 1_555 -0.074 -0.107 -0.363 6.618   -4.191  -1.158 1  C_DT301:DA338_D C 301 ? D 338 ? 20 1 
1 A DG 2  1_555 B DC 18 1_555 -0.208 -0.280 -0.517 -0.984  -17.393 3.959  2  C_DG302:DC337_D C 302 ? D 337 ? 19 1 
1 A DT 3  1_555 B DA 17 1_555 0.056  -0.244 -0.534 -5.307  -18.318 4.628  3  C_DT303:DA336_D C 303 ? D 336 ? 20 1 
1 A DC 4  1_555 B DG 16 1_555 0.103  -0.162 0.272  -14.263 19.976  -0.113 4  C_DC304:DG335_D C 304 ? D 335 ? 19 1 
1 A DT 5  1_555 B DA 15 1_555 0.084  -0.152 0.401  -9.596  19.614  3.505  5  C_DT305:DA334_D C 305 ? D 334 ? 20 1 
1 A DT 6  1_555 B DA 14 1_555 0.015  -0.128 0.194  2.374   11.419  -0.212 6  C_DT306:DA333_D C 306 ? D 333 ? 20 1 
1 A DT 7  1_555 B DA 13 1_555 -0.135 -0.138 -0.306 3.353   -0.921  1.358  7  C_DT307:DA332_D C 307 ? D 332 ? 20 1 
1 A DG 8  1_555 B DC 12 1_555 -0.067 -0.170 -0.153 2.663   4.508   -2.433 8  C_DG308:DC331_D C 308 ? D 331 ? 19 1 
1 A DT 9  1_555 B DA 11 1_555 -0.042 -0.118 -0.232 1.940   -3.608  -2.200 9  C_DT309:DA330_D C 309 ? D 330 ? 20 1 
1 A DC 10 1_555 B DG 10 1_555 0.125  -0.196 -0.276 1.917   -7.691  -0.622 10 C_DC310:DG329_D C 310 ? D 329 ? 19 1 
1 A DA 11 1_555 B DT 9  1_555 0.084  -0.107 -0.202 -0.872  -6.512  -0.111 11 C_DA311:DT328_D C 311 ? D 328 ? 20 1 
1 A DT 12 1_555 B DA 8  1_555 -0.014 -0.125 -0.235 1.622   -8.055  -1.535 12 C_DT312:DA327_D C 312 ? D 327 ? 20 1 
1 A DG 13 1_555 B DC 7  1_555 -0.084 -0.189 -0.049 -0.116  -5.890  -1.660 13 C_DG313:DC326_D C 313 ? D 326 ? 19 1 
1 A DC 14 1_555 B DG 6  1_555 0.093  -0.188 -0.323 2.587   -4.647  -0.371 14 C_DC314:DG325_D C 314 ? D 325 ? 19 1 
1 A DT 15 1_555 B DA 5  1_555 0.008  -0.137 -0.225 -0.592  -7.120  -0.833 15 C_DT315:DA324_D C 315 ? D 324 ? 20 1 
1 A DA 16 1_555 B DT 4  1_555 0.060  -0.122 -0.289 -3.708  -3.013  -0.337 16 C_DA316:DT323_D C 316 ? D 323 ? 20 1 
1 A DA 17 1_555 B DT 3  1_555 0.038  -0.123 -0.376 -0.852  2.928   1.782  17 C_DA317:DT322_D C 317 ? D 322 ? 20 1 
1 A DT 18 1_555 B DA 2  1_555 -0.064 -0.134 -0.353 5.519   -1.954  0.488  18 C_DT318:DA321_D C 318 ? D 321 ? 20 1 
1 A DG 19 1_555 B DC 1  1_555 -0.237 -0.212 -0.264 8.106   -3.427  2.218  19 C_DG319:DC320_D C 319 ? D 320 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 1  1_555 B DA 19 1_555 A DG 2  1_555 B DC 18 1_555 0.433  0.408  3.624 1.507  8.999  35.434 -0.749 -0.456 3.631 14.490 
-2.427 36.554 1  CC_DT301DG302:DC337DA338_DD C 301 ? D 338 ? C 302 ? D 337 ? 
1 A DG 2  1_555 B DC 18 1_555 A DT 3  1_555 B DA 17 1_555 0.068  -0.209 3.261 -0.385 6.218  37.031 -1.130 -0.155 3.184 9.706  
0.601  37.533 2  CC_DG302DT303:DA336DC337_DD C 302 ? D 337 ? C 303 ? D 336 ? 
1 A DT 3  1_555 B DA 17 1_555 A DC 4  1_555 B DG 16 1_555 0.685  0.481  3.700 -7.403 18.003 33.038 -1.887 -2.126 3.306 28.763 
11.828 38.208 3  CC_DT303DC304:DG335DA336_DD C 303 ? D 336 ? C 304 ? D 335 ? 
1 A DC 4  1_555 B DG 16 1_555 A DT 5  1_555 B DA 15 1_555 0.069  -0.738 3.857 -3.168 8.269  26.422 -3.803 -1.012 3.441 17.478 
6.695  27.842 4  CC_DC304DT305:DA334DG335_DD C 304 ? D 335 ? C 305 ? D 334 ? 
1 A DT 5  1_555 B DA 15 1_555 A DT 6  1_555 B DA 14 1_555 -0.182 0.097  3.543 4.709  11.835 25.455 -2.763 1.549  3.190 24.964 
-9.934 28.417 5  CC_DT305DT306:DA333DA334_DD C 305 ? D 334 ? C 306 ? D 333 ? 
1 A DT 6  1_555 B DA 14 1_555 A DT 7  1_555 B DA 13 1_555 -0.228 0.770  4.174 2.026  32.292 22.474 -4.376 0.686  3.038 56.000 
-3.514 39.223 6  CC_DT306DT307:DA332DA333_DD C 306 ? D 333 ? C 307 ? D 332 ? 
1 A DT 7  1_555 B DA 13 1_555 A DG 8  1_555 B DC 12 1_555 0.006  0.267  3.705 -0.683 4.678  35.534 -0.331 -0.121 3.708 7.623  
1.113  35.837 7  CC_DT307DG308:DC331DA332_DD C 307 ? D 332 ? C 308 ? D 331 ? 
1 A DG 8  1_555 B DC 12 1_555 A DT 9  1_555 B DA 11 1_555 -0.122 -0.444 3.588 0.976  8.528  31.571 -2.382 0.399  3.352 15.323 
-1.754 32.688 8  CC_DG308DT309:DA330DC331_DD C 308 ? D 331 ? C 309 ? D 330 ? 
1 A DT 9  1_555 B DA 11 1_555 A DC 10 1_555 B DG 10 1_555 -0.044 -0.075 3.465 0.902  5.124  35.123 -0.916 0.211  3.418 8.433  
-1.484 35.494 9  CC_DT309DC310:DG329DA330_DD C 309 ? D 330 ? C 310 ? D 329 ? 
1 A DC 10 1_555 B DG 10 1_555 A DA 11 1_555 B DT 9  1_555 0.086  0.205  3.665 -0.644 3.755  36.279 -0.257 -0.237 3.666 6.010  
1.031  36.471 10 CC_DC310DA311:DT328DG329_DD C 310 ? D 329 ? C 311 ? D 328 ? 
1 A DA 11 1_555 B DT 9  1_555 A DT 12 1_555 B DA 8  1_555 -0.199 -0.377 3.234 0.576  2.143  34.225 -0.971 0.427  3.202 3.636  
-0.978 34.295 11 CC_DA311DT312:DA327DT328_DD C 311 ? D 328 ? C 312 ? D 327 ? 
1 A DT 12 1_555 B DA 8  1_555 A DG 13 1_555 B DC 7  1_555 -0.294 0.559  3.657 -0.724 5.295  37.080 0.085  0.350  3.704 8.273  
1.131  37.450 12 CC_DT312DG313:DC326DA327_DD C 312 ? D 327 ? C 313 ? D 326 ? 
1 A DG 13 1_555 B DC 7  1_555 A DC 14 1_555 B DG 6  1_555 0.637  0.527  3.361 2.089  1.642  37.864 0.593  -0.703 3.409 2.527  
-3.214 37.954 13 CC_DG313DC314:DG325DC326_DD C 313 ? D 326 ? C 314 ? D 325 ? 
1 A DC 14 1_555 B DG 6  1_555 A DT 15 1_555 B DA 5  1_555 0.013  -0.300 3.627 0.186  2.975  33.253 -1.067 0.011  3.588 5.186  
-0.324 33.383 14 CC_DC314DT315:DA324DG325_DD C 314 ? D 325 ? C 315 ? D 324 ? 
1 A DT 15 1_555 B DA 5  1_555 A DA 16 1_555 B DT 4  1_555 0.126  -0.079 3.758 0.272  2.509  35.712 -0.543 -0.160 3.745 4.084  
-0.443 35.798 15 CC_DT315DA316:DT323DA324_DD C 315 ? D 324 ? C 316 ? D 323 ? 
1 A DA 16 1_555 B DT 4  1_555 A DA 17 1_555 B DT 3  1_555 0.507  -0.374 3.464 -0.946 0.240  34.285 -0.675 -1.016 3.447 0.407  
1.605  34.298 16 CC_DA316DA317:DT322DT323_DD C 316 ? D 323 ? C 317 ? D 322 ? 
1 A DA 17 1_555 B DT 3  1_555 A DT 18 1_555 B DA 2  1_555 -0.519 -0.603 3.270 0.264  0.910  31.794 -1.266 0.994  3.248 1.662  
-0.482 31.807 17 CC_DA317DT318:DA321DT322_DD C 317 ? D 322 ? C 318 ? D 321 ? 
1 A DT 18 1_555 B DA 2  1_555 A DG 19 1_555 B DC 1  1_555 -0.022 -0.139 3.369 0.238  7.434  32.975 -1.474 0.077  3.261 12.894 
-0.412 33.781 18 CC_DT318DG319:DC320DA321_DD C 318 ? D 321 ? C 319 ? D 320 ? 
#